1G3CA

Bovine beta-trypsin bound to para-amidino schiff base iron(iii) chelate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title X-ray crystallographic analyses of complexes between bovine beta-trypsin and Schiff base copper(II) or iron(III) chelates.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3cA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3cA02
1TALA 1GJDB 1O0DH 2P59A 3QZRA 3QO6A 1K1OA 1DM4B 3M7QA 4SGBE 1RD3B 2Y82A 4K5ZA 1J17T 1ZRBA 4K1TA 4JZIA 3UR9A 1GMHG 1SGFA 3SQHE 5DK1A 2ZFRH 5C67A 1GBLA 1UTKA 2R0KA 1AB9C 1N1LA 1F2SE 3EDXB 3RMNH 3SUFA 1C1QA 1GCDA 4JYVH 1TGTA 2QAAA 1B0EA 3OY6U 3RC4A 2NU3E 4X2YA 4AB9A 4DY7B 3LPRA 2RDLA 1G2MA 1CO7E 1KXFA 2A4RA 2GDEH 3SJ8A 2J2UA 4I33A 2CGAA 3NZIA 2ZIQH 1A3BH 3IG6B 1HJAC 5EQRA 2ZGXH 3RU4D 3PYHA 1SGIB 5EODA 2BX4A 3A84A 2QCYA 2QXGA 3M36A 4NIXA 2B9LA 1TNHA 1ELBA 1O37A 2ZFFH 4ABJA 1CE5A 4ZMAH 3F1SB 3KQBA 2ZZUH 3RMOH 1NRPH 1VCPA 1TNJA 1BBRE 4KP0A 1QHRB 4A5TS 4B75A 5EW1H 2Y80A 1K22H 4B2CA 2FTLE 4UFFH 2EC9H 5FX5A 1JMOH 1W0YH 2BDAA 1XUFA 1VGCB 1LQEA 3LU9B 4DCDA 4A1XA 1PPEE 1SC8U 1GPZA 3HATH 4MDSA 2XBVA 1H9HE 3B23B 1G3DA 1K9OE 4MNVA 1TFXA 1GHAG 5FXLA 1BB0B 1ZPBA 5EPNA 1Z8RA 1C1WH 1SR5C 1D4PB 3SV2H 3ATIA 4MPUA 4X1PU 4LZ4B 2R2WU 1YP9A 1B5GH 1C1OA 2VH0A 1HXEH 3LGYA 1Q2WA 5DP9A 5JBCS 1TONA 3TK9A 5JPMH 1CHGA 3SI3H 2BDHA 4MPWA 3U1IB 1YPHC 2VINA 1P09A 4Y11E 2QXJA 4Q7XA 4BANB 2VIDA 3A7VA 2ZTYA 1DUAA 1WBGB 1HIAA 1TX8A 5GIBA 4KELA 1BIOA 4CHAC 1V2QT 2B8OH 3SV7A 4VGCB 1C4V2 2GCHF 1Y3YA 2V6NA 2XC5A 1TYNA 2VIOA 1GI0A 1KTTB 2B7DH 5E0GA 1AHTH 2F9BH 1BTHH 1C5LH 1MTUA 3SBKA 8GCHG 1XUIA 4AFSA 3SU4A 2BDYA 2CV3A 1YKTA 5DKMA 1WV7H 1NN6A 1YF4A 2BMGB 3E0NB 5L2ZH 1P11E 4JYTA 3LH3A 1VITF 1H1BA 1Z8IB 1GG6B 3LT3A 4ABAA 2NU2E 2J92A 1GCTC 5EPYA 5I25A 2F83A 3SU5A 2ZPSA 1MMJN 1EP6A 1O5CB 2BDCA 2FPZA 7ESTE 2PKSB 2FODA 4KTUA 3P8OA 2PKAB 1N8OC 1AGJA 1NESE 1HFDA 2CMYA 3K65B 1V2LT 1TPSA 5AFZH 1ZTJA 5EOKA 1EB2A 3OX7U 1XKAC 2D2DA 5DO4H 3FFGA 4OGXA 2VB0A 3CS7A 3UUZA 5LH8A 2BM2A 2V3OH 2IPHA 1G37A 2OXSA 4ZKNU 1C5MD 1HJ8A 2Z9LA 1GI8B 3UNRA 1BTPA 7GCHG 1LHFH 3RUOA 1O3IA 1YGCH 2W26A 2ZGJA 3I29A 4XOJA 1EZUC 2VWLA 1DLEA 1P9UA 4X8UH 1EOLA 2BHGA 3GY4A 4JMYA 1S0QA 1HNEE 1IQLA 2C3SA 3L33A 4E05H 3M5OA 1O5BB 1ELGA 1ESBA 1A5IA 1C1NA 1MZDA 1S84A 5GCHG 1WTHD 2Y6TA 1TRYA 2FTMA 5ESBA 5C20A 2CXVA 1QL9A 1V2MT 1UTMA 4DT7B 1GL0E 3SU1A 2CF9H 4E06H 2PGQB 1ZSKA 4DGJA 3URDA 1A4WH 3W95A 3MNCA 1LHGH 1C2JA 2GZ9A 4CREA 1YM0A 3JZ1B 1HGTH 1SGQE 1OS8A 1RGQA 4QT8C 5JBBS 4U2WA 4D76A 3RXCA 3ZVFA 4DJZB 9LPRA 5F03A 2FS9A 2ZGBH 4ZKRU 1EKBB 1LMWB 4ZHMU 4AFQA 1UCYE 2WYJA 4FU8A 2V3HH 3P6ZB 2PWXA 4WH8A 3A88A 2ZDNA 2NWNA 2ILNA 5FBIA 1SGDE 2FOFA 1QB9A 3UQOA 1GHBG 1C1SA 3BTQE 4UE7H 1ANEA 2H6MA 1GHVH 3HPTB 1AFQC 1S83A 1DSUA 3ZVGA 1C5OH 1O3HA 4B71A 4YT7H 1O2PA 3TH3H 3R3GB 3HKIB 4GAWA 2Y5FA 1MZAA 1JWTA 2ZDLA 1IOEA 3T29A 1CQQA 6GCHG 3UFAA 3QGJA 1MBMA 1CGJE 1DVAH 3LDXH 1HDTH 2EEKA 5LPRA 4AN7A 1OWJA 1MKWK 3T26A 1TIOA 2AGGX 2P95A 1MTSA 2PUXB 1QL7A 2STBE 3EYDA 1AWFH 1SMFE 4YM9A 1P01A 2QIQA 1P02A 1G3CA 1TGSZ 2PTNA 2YNBA 7KMEH 1V2OT 3M61U 1XUJA 5BPEA 3U69H 3PV4A 3Q3YA 1V2PT 3BTDE 2BXTH 1GBKA 2Z6BD 4GCHF 2ANMH 4ABGA 3UNQA 1FN8A 1H8DH 2RA3A 2OINA 2Q1JA 1QBNA 3JZ2B 4E7NA 2ODQA 2TGPZ 2VIWA 2G4UA 4X2VA 2FOHA 2HPPH 2R3UA 1ZRKA 5AVDA 1C4Y2 2FEQH 2JH0D 3A7WA 2GZ7A 1GBBA 2VIPA 1ANBA 1AFEH 1P12E 2DE9A 1V2TT 2FOGA 8KME2 1S81A 4AFUA 4AOQA 1HIAB 2SGAA 3SN8A 2UUKB 5A0BA 1MAYA 2WPIS 1OP2A 1TOCB 1EQ9A 2ZI2H 3GDSA 1YBWA 3HGPA 1CU1A 4Y7BA 1BTUA 1FY3A 4RKOB 3T25A 3GY3A 1KXBA 3KCGH 1NO9H 2XC4A 1AIXH 1CHOG 1T7CA 1GBCA 1OSSA 1XVMA 2BD3A 2XBYA 3A85A 1MQ6A 3MH4A 1GJCB 3S9BA 1YC0A 3I77A 1KXCA 4K2YA 1EAXA 3M7TA 3ZVAA 3R0FA 4CRGA 1T4UH 1VGCC 2AMDA 2ZHDA 1MKXK 1MTNB 1O3EA 2BVRH 3RLWH 2G81E 1EZSC 1GI6A 2QC2A 1OWKA 2VGCB 2SNVA 2ZG0H 3E3TA 1E36B 1GJAB 1SGCA 1BTZA 1P3CA 1Z8JB 3ZV8A 1V6DA 5L6NH 2HNTF 1ZMNA 1WCZA 1HJ9A 2HALA 3SHAH 3UREA 2B5TB 2LPRA 2BY9X 4OS7A 3SU0A 4J2YB 1J15A 2WPHS 4DOQA 4ISLA 3RM2H 4INHA 4BAOB 1GBTA 2UWOA 2GV6A 4ABIA 2PHBA 2GGVB 1J8AA 1Z71A 3SJ9A 4VGCC 1CA8B 3ZZCA 4IN1A 4TYDA 1GBFA 1SGRE 1RXPA 2JH5D 3GY6A 3A8CA 1EJMA 4I8KA 3MH7A 1A0JA 2BOHB 3U8RH 1NU9A 3TVJB 1L0ZA 1GG6C 2A45B 4AORA 2FWWA 4IW4E 1MTWA 1PPFE 2GX4A 1V2RT 1P06A 1EASA 1F5KU 4TWWA 1GMHF 1O3MA 3GY2A 4AZ2B 1BOQA 2PKSC 1AZZA 2ZTXA 1SQTA 2A4QA 4BNRA 3TH4H 5GPIB 2PFEA 2Y5HA 2VIQA 3KIDU 3ELAH 2BLOA 4IS5A 2QA9E 2AGEX 1VITH 4A6LA 3SORA 2G52A 3BN9A 3MFJA 1V2JT 2PSYA 1FUJA 1S5SA 2ZECA 4MTBA 1KLIH 2ZHWH 3TJVA 1RRKA 1O2IA 1C5NH 5DP5A 3ZYDA 1QJ7B 2OQUA 1MD7A 5T6DA 5E0JA 3ZZBA 1MU6B 3GOVB 1NRSH 1HPGA 1TMBH 5TCAA 4NFFA 3ENSB 2FO9A 4K1EA 3F9FA 3BTFE 2ZTZA 4WF8A 1BMAA 1KXEA 2PKAA 1EZQA 1OPHB 3VFEA 1ZJKA 1EAUA 1GJ4H 1MCVA 1ELFA 3GYLB 2VVUA 1C1TA 1TNGA 1O5AB 1AZ8A 2Z9IA 3RXGA 3E16B 1ZMJA 1TE0A 1ZLRA 3TK5A 1YPLH 1W10U 1RTKA 1ARBA 4R0IA 1KY9A 2QYIA 4NSYA 1GHAF 3LH1A 1NU7B 5T3HA 2F9NA 1DE7H 2TBSA 1UTOA 1A0HB 1O5GH 1HBTH 2J95A 1A7SA 1C5VA 3C1KA 1BDAA 2UUFB 1IQNA 4HFPB 1NTPA 1PQ7A 3K9XB 4Y8XA 3LC3A 1AFQB 1GMCG 1P3EA 3D23A 4FVBA 2ODYB 3VXFH 1BUIA 3EAJA 4I8LA 4X6NA 2BX3A 1TNLA 3MTYA 3RXAA 2EI6A 3LGTA 1TGBA 1XX9A 2H9EH 3W94A 2BZ6H 3DA9B 3RC5A 8GCHF 2D26C 4X1NU 1GHWH 2OC8A 3PLKA 3L3TA 2F91A 6CHAB 1H9LB 2CN0H 1P04A 2GT7A 2SNWA 1GBDA 5EU8A 1TOMH 5C1UA 1CT2E 4TPYA 4CRCA 1D3PB 1E35B 1AMHA 1LQDB 4CH2B 1EZXC 4XBDA 2BY5X 2WV4A 2P8OB 3MMGA 4Y0YE 1SVPA 2GV7A 1S82A 2QF0A 4BTTB 4K8YA 1U6QA 5K7RA 4DIHH 5EXLA 1BTWA 4LXBH 1V2WT 1QGFA 1O5FH 4J1YA 4AGJA 2ZP0H 2GDDA 1Z1JA 5EQQA 4FU7A 1C5WB 4GHQA 1FIZA 4WWYA 2FLRH 4D9RA 4IMZA 2Y7XA 1YPKH 1JBUH 1IQHA 4Y71A 3ITIA 1D9IA 1HUTH 2XRCA 5C5NA 2FI4E 2ZDMA 1O3KA 7GCHF 5K0HA 2FI5E 5DJ7A 3BTGE 3RXBA 3RXUA 5IDKA 2GKVE 1O34A 1O2QA 1WYKA 1BBRH 1IAUA 1GVKB 3RXVA 1H8IH 1GJ6A 5JDUB 2W7UA 2GVFA 2PTCE 3UWJH 1XMNB 2WUCA 1PPGE 3QN7A 5HXFA 3M7UA 1TX6A 1IQFA 2W3IA 4FUIA 4MPXA 4ZROA 1HAIH 2ZFSA 4YZUA 3CP7A 1L4DA 4CRDA 5GCHF 1EXFA 3URCA 3M35A 1C2GA 4D7GA 1L2EA 1ZMLA 1XKBC 2IJOB 2ZA5A 4WXIA 1D6WA 1Y3VA 2PSXA 2Y5GA 2FOEA 2JETB 1YPJH 3MH6A 4B2BA 1JIRA 1ZYOA 1WAYB 3RXJA 4IBLH 3TJOA 4AG2A 2A2XH 4UFDH 4YLQH 1HB0B 5FX6A 5JBAS 1O2TA 1OKXA 2ZCKP 5E8EH 1A2CH 2V0BA 1SGYE 2GP9B 5CE1A 2ZHFH 3TNSA 4WXVA 1MTNC 4THNH 4Y8ZA 2SGQE 2WPJS 4O03A 1AQ7A 3LKWA 2WUBA 3RXIA 1X7AC 3FP8E 2VGCC 1ZZZA 2ZHQH 2VJ1A 4YOIA 1EOJA 2ZGHA 1Z6EA 1T31A 2KAIA 1GI3A 1ETTH 3SO3A 1N6XA 3RMMH 1DX5M 1QRZA 1V2ST 2TGDA 1GHBF 4F4OC 2F9VA 4MNXA 3TNTA 3A82A 1FY4A 3B8JA 3E8LA 4D8NA 4E7RG 3VEQB 1SSXA 2A7HA 3V0XA 5A8YA 5CHAB 5DP4A 1AN1E 4X8SH 1O3LA 2F9OA 5DP3A 1HAPH 4CH8B 4I8JA 6GCHF 2DE8A 3P8FA 1JXPA 3NK8A 4YT6H 4ZXYH 1RTLA 3QDZB 2NU1E 1C1UH 1G3BA 1P10A 1L1JA 1TBZH 1KDQA 4MVNA 3U98H 1NY22 4WY3A 3H7OA 4ZXXH 2BXUH 3AW1A 2BVXH 2J38A 1P8VC 1MBQA 1O2ZA 4UONA 2ZC9H 4U01A 1AD8H 1O36A 1LTOA 1SGEE 2A5IA 1PPZA 5GDSH 2CJIA 3CENA 1G32B 5FCKA 1LVMA 2XW9A 1O2XA 2ZKSA 1AVWA 3NUMA 5E2PA 1TQ7B 1IHSH 4O97A 4BXSA 1O3CA 4HI3A 1PFXC 3PROA 1Y5AT 3HKJB 1BRUP 3RXRA 1M9UA 3S7KB 2ZQ2A 1QURH 4Y79A 1W3CA 3H5CB 3SNCA 6LPRA 1FPCH 4AG1A 2FP7B 5F6MA 4JZEH 3GCTG 4WMDA 3U8OH 2FDAA 3E91A 3RMLH 1SGFG 4JK6A 1RJXB 1INCA 4UDWH 4I7YH 3A7YA 3A87A 4LZ1H 5B6OA 5E0HA 1W0ZU 5LPFA 1W7XH 2PUQH 1BRAA 2VVVA 3BTWE 4H4FA 1A0LA 1P9SA 1Y3UA 3MOCA 1F7ZA 3HK6B 4MNWA 2Z9JA 4FUGA 1QQ4A 5A8ZA 1AY6H 1CHOF 5FBEA 1LPKB 1L1GA 2QXIA 2OC0A 4RKJB 4F49A 1QNJA 4NG9H 2BDGA 1W14U 4NIWA 2ZCHP 5E2OA 4U32A 4MNYA 3S7HB 3OTJE 1LKAA 5F8ZA 1DY8A 1FY8E 1P05A 1HAHH 4UFGH 4IGDA 3LGIA 1IQIA 2D8WA 4B73A 1HXFH 4RN6A 2ZDKA 3MU1A 1LVOA 3VB7A 4Y8YA 5JB8S 1K1MA 5IYTA 2FX4A 3M3VA 2BZAA 1UCYH 2J9NA 3P70B 3UNSA 1KXAA 1LVYA 1YPGH 3BTKE 3QUMP 1O2RA 1KSNA 3SU6A 1BJUA 3FZZA 2AEIH 5FHTA 5DGJA 1VJ9U 1FLEE 1UVSH 3GCHC 5C2ZA 8ESTE 2OUAA 1NS3A 1BMNH 3C27B 3K6YA 3UIRA 1LCYA 4YO9A 4YOJA 1OWIA 1MAXA 3Q00A 1FN6A 4R8TB 4GUXA 3PMHB 3SV8A 1O3FA 1TABE 2BDBA 2SGFE 2ODPA 3M5MA 3KQDA 1LKBA 1DPOA 1SGTA 1GBIA 4YESB 2Z94A 1FNIA 1YPEH 3S69A 3BG8A 2P16A 3DFJA 4NA7A 3AAVA 5FCRA 4BAMB 4XBBA 5AHGH 2A0QB 5H4IB 1A5HA 4DVAU 1CSOE 3PO1B 4IMQA 2RA0A 3RU4T 1HAOH 6CHAC 1NFWA 3Q3XA 2GTBA 1J14A 4XE4A 1F0SA 5C3NA 1O3DA 2G8TA 4JZFH 3GCNA 1C1RA 1C2MA 2C8WB 1K1LA 2UUJB 3SJIA 2THFB 1O31A 1UVPA 2P8OC 3PLBA 1CT0E 3EGKH 1A5GH 1GJ5H 2ZU4A 3SW2B 3VPKA 2H9TH 3NPSA 2ZFPH 1KYNA 1DICA 3PMAB 1NPMA 2P3TB 3M3TA 4FUDA 2ALVA 4ABBA 1FV9A 2ZFQH 2HNTC 1OYQA 1SQAA 3ZVCA 4TPIZ 1PYTC 1WQSA 1OWDA 4Q7ZA 3PMBB 1V2KT 1E34B 3MO9A 4FUBA 4X6PA 1SGNE 5LGOA 1K1JA 1P2JA 3VB6A 1BJVA 2XNIA 1BHXF 1AUJA 1AVGH 3A7TA 1A1RA 1P0SH 2AYWA 1Q3XA 2KAIB 3TITA 1ZHMA 3BSQA 1OOKB 2O8TA 4Q80A 1H9IE 5C1YA 1O35A 1DOJA 2A2QH 2GCTB 2WPKS 1TX7A 1ZTKA 4DG4A 5A0AE 3OYPA 3EA7A 1P2NA 1NRRH 3RXOA 1ZGVA 4B1TA 2WPLS 2ZDVH 1ELEE 1V2UT 5ESTE 2XTTB 3BEIB 3ZV9A 1BA8B 5HMAA 4XDEA 3Q76A 4LK4A 4CBNA 4MG3A 3FANA 1EJNA 3L6PA 1SHHB 2GZ8A 2FOCA 2WYGA 1KDQB 1JIMA 2R2MB 1MQ5A 4FUHA 2JETC 3GDVA 2FESH 2P94A 5FPTA 3ZYEA 4UFEH 1HAXB 1FQ3A 1EPTB 3ATMA 3A89A 5A2MH 3SHCH 2HRVA 3LJOA 4K3JA 4X1SU 1RIWB 1O2MA 2OQ5A 1Y5BT 3Q77A 2ANWA 1GMCF 1XVOA 3EA8A 3V12A 1ZHPA 1K1NA 3GY7A 4OS4A 3KEEA 1ZJDA 2OTVA 3SUDA 1QBOA 2XWBI 8LPRA 2OBOA 3MH5A 1A3EH 3SNBA 4MPVA 1TAWA 2CHAB 2UUYA 1G30B 1SQOA 1O2GH 2HLCA 1ZSLA 1C5PA 2A4GA 3A8BA 3STJA 3T5FH 1TQ0B 1UVTH 2OC1A 4TY6A 4D7FA 3TIUA 1SBWA 5CHAC 1MUEB 1B7XB 1N6YA 3BG4B 1LDTT 2A31A 5J4QA 2AIPA 3FP7E 1CBWB 2TPIZ 5EXNA 3F6UH 2AMQA 1UK3A 2BVSH 4I31A 2ZO3H 3GDUA 3ZZ9A 2R9PA 5L30H 4ABDA 4BXWA 1P2IA 2A4OA 3SUEA 4Y76A 4NA8A 1C5YB 2J4IA 3O8RA 3SQEE 1OX1A 3NXPA 1SLUB 1BT7A 4KKDA 2G5NA 2OBQA 4NCYA 5AFYH 3TJNA 1VJAU 2FOBA 1NROH 1AI8H 3SJKA 3VB4A 1THRH 2OC7A 4NWKA 5TJXA 2OD3B 2F9UA 2VU8E 9ESTA 4AYVB 4IC6A 2AFQB 1QL8A 1KXDA 1O3OA 2ZFTA 4NIYA 1W12U 1JRSA 1TGCA 1GVLA 3MU5A 2FS8A 4JK5A 1UTNA 1D3QB 1O38A 1O30A 1QJ6B 4INLA 1O3JA 1PPBH 4MQAA 1YCPM 2ASUB 2FLBH 1RFNA 3SZNA 3TGJE 3KL6A 2TGAA 3E1XB 3VGCB 1BTYA 2ZHEH 3WY8A 1UK4A 5HGGA 1CVWH 3ZVDA 4WMFA 3D49H 1DANH 3A86A 1G2LA 1SFQB 2BY8X 1QJ1B 2VWNA 4U30A 2SFAA 2WV5A 1Z1IA 2FIRH 4A1VA 2VIVA 2HVXA 3QZQA 1F5RA 3F9HA 1Z7KA 1DUEA 2C90B 2DUCA 4AX9H 2BQ7B 4CRBA 3M5LA 3MU4A 2LNCA 1QRXA 2F9PA 4CRFA 5DP7A 1SPJA 1HV7A 1ABJH 1GI1A 2BQ6B 1DT2A 1C1MA 5JYIA 3GCHB 2BQWB 3PWCA 1AUTC 1P2QA 4GSOA 1C1PA 2FX6A 3QTOH 2VWMA 1W7GH 3ZZAA 2BLQA 3FP6E 3N7OA 3A80A 2TGTA 1B0FA 5HM2A 2ULLA 5T6GA 3RXQA 3AASA 3MNBA 1NZQH 5F8XA 4NZLA 2IOTA 2JH6D 1AO5A 1IHTH 3BF6H 2FZZA 3BTTE 1GMDG 2BOKA 1Y5UT 5A0CA 5A8XA 4GHTA 4DW2U 1XM1A 1MD8A 1NFUA 3RXHA 1QR3E 2ZQ1A 2QN5T 3SOSA 1FPHH 1TNKA 1TLDA 2V35A 1C5RA 2FM2A 1T8NA 3O8DA 1LO6A 1EUFA 3A7XA 1L1NA 2ZCLP 3BTHE 2GMTC 1CGIE 3QWCH 4X6MA 1SLXB 5EW2H 1C9PA 5DP6A 1O5EH 3BIVH 2XBXA 1O2NA 2GD4B 4JYUH 3NKKA 1VZQH 4M7GA 4Y10E 1Y3WA 4BTIB 2O8MA 1O32A 2Z7FE 3KF2A 2AH4X 2B0FA 3KQEA 1TRMA 1Y8TA 3VB5A 1UVUH 1HAZB 4ESTE 2I6QA 1GHYH 3ZZ5A 1Z6JH 1Q31A 3PO1C 4H42U 5DPAA 3UY9A 1OXGA 1YCPH 1H4WA 2ALPA 2G4TA 3SUGA 1LHDH 1T8OA 2EI7A 1QRWA 3GYMA 3M37A 2RCEA 2IN2A 2A5AA 1ZPCA 2AIQA 4H6TA 1OWEA 3BV9B 2EI8A 3SGAE 1P03A 3KHVA 4NSVA 1ANCA 2BDIA 1ELCA 3O8CA 1UTQA 3LONA 4FXGH 4NIVA 4GLYA 1KIGH 3ESTA 2PGBB 2TRMA 4NGAH 2YNAA 4ISNA 3RXEA 1C5TA 1E0FD 1GGDB 3KQCA 2VVCA 4BTUB 3CS0A 4X2WA 1YLDA 3BIUH 1OP0A 2RG3A 3GCTF 3SU2A 3RLYH 1UTLM 1WTGH 3SV9A 1O3PB 1WQVH 4CR5A 3FVFB 3GICB 1E38B 2STAE 3LOXA 1F0TA 1BQYA 1ELDE 3DD2H 3HGNA 5ETXA 5EXMA 1O33A 1LHEH 3DFLA 1TMUH 1C5QA 4CR9A 1C2DA 1K28D 2BY7X 3ZZ7A 1AE8H 3QX5H 2C93B 1ARCA 2W5EA 1IQJA 2GCTC 3P17H 1QB6A 2ZPQA 3SNDA 1IQGA 1ESAA 2FMJA 1ORFA 2PLXA 3S0NA 3MI4A 2F3CE 5SGAE 1UHBA 1MKWH 3IWMA 1XUHA 3ZVEA 4I8HA 1C5SA 1ETRH 2ZDAH 3BTME 3MU0A 5ABWA 3UR6A 4B2AA 1D3DB 4YLUA 1T4VH 3A8DA 1EX3A 2ZF0H 5GWZA 3U1JB 2P3FH 3F9EA 1XUKA 2XBWA 1DITH 4TWYA 3SGBE 5HYOA 1C2IA 5FPSA 3ZZ6A 5L2YH 1ACBE 1C2EA 1DSTA 4X6OA 3ZVBA 5AF9H 1P57B 2O8WA 1O2JA 1THPB 3A8AA 1T32A 1EPTC 2XCFA 3NCLA 2BYAX 1F0RA 1RIWC 1TPAE 2ZU1A 3STIA 1ZGIA 4I8GA 1GWAA 2OCVB 1GL1A 3KGPA 1QB1A 1THSH 2AGIX 4OGYA 3SJOA 3S9CA 5HM9A 3D65E 1O3NA 4NA9H 4JZ1A 4FU9A 1O39A 2ZU2A 3SV6A 2Y81A 3OU0A 1GI7B 1UJ1A 5I46H 1DFPA 1FXYA 3P8GA 2CHAC 4K1SA 1FY1A 2PW8H 3SNAA 1CA0B 1TNIA 2BB4A 3DHKH 3ZZ3A 1EAIA 4YOGA 1SLVB 1FMGA 4IN2A 1C2HA 2HOBA 2PR3A 3KNXA 1GJBB 3BG4C 1FJSA 4FVDA 3TPIZ 2R0LA 1LPZB 1SHYA 3ZZ4A 1EPTA 3UWIA 1GHZA 2BD8A 1GJ9B 3TK6A 2BD4A 1CBWC 4TY7A 4ISOA 1MKXH 3TGKE 3V13A 3ATKA 3MNXA 1K1IA 2HNTE 3TGIE 5JBTA 1K21H 4ISHH 4UEHH 1O3AA 1DY9A 5EG4A 3QLPH 3RXMA 1O2OA 2A7JA 2H5DA 1TPPA 1MTVA 1Y3XA 1ZR0A 3AVZA 2TIOA 3RXFA 4OS2A 1HCGA 1O2VA 1DWDH 1OYTH 1TGNA 4X1QU 2AS9A 3TU7H 1GBHA 3RXPA 2QGRA 2XWAA 1J16A 2ESTE 3RXTA 4Y7AA 3U8TH 1S6FA 1SLWB 1TBQH 3HK3B 1J9CH 1PQAA 1BRBE 3EQ0H 4Q7YA 3PWBA 1GJ7B 1BRCE 1F5LA 1O2UA 2A32A 4D9QA 1QQUA 1S85A 4X8VH 3PTBA 1Z8GA 1SL3A 1C1VH 4A7IB 1C5ZB 4JCNA 3VGCC 4ZKSU 1KLTA 1ELAA 2AERH 3UTUH 3G01A 1UMAH 1T8MA 1C2FA 1LVBA 2C8XB 2VWOA 1GI5A 1ELTA 4ZKOU 4O3TA 4X2XA 1DXWA 3GCOA 4DIIH 4ABFA 3AAUA 4A92A 1SGPE 5CMXH 4BOHA 1YCPK 4NFEA 1ZOMA 1HAYB 2W3KA 3QK1A 1GDNA 5PTPA 1G3EA 4X1RU 4O3UA 3MO6A 1GDQA 1VCQA 1UTJA 1F0UA 2Z3DA 3QGNB 3P8NA 1BZXE 2HGTH 2FOMB 2XC0A 4AB8A 1DWEH 1O2YA 2H2ZA 2QXHA 4FUCA 1V3XA 2C8ZB 2ZPRA 4X0WU 1NC6A 1K1PA 3P95A 3RU4E 2GMTB 1O2HA 2XYAA 3BEUA 1BBRK 3KN2A 4B74A 4WH6A 4XBCA 3RXSA 2HPQH 5EGMA 2G55A 2ANYA 1FDPA 1O2LA 2GCHG 3Q3KA 4NZQA 1IQKA 2WPMS 1IQEA 2BD5A 3V7TA 4AGKA 3U9AH 4A1TA 5A09A 1GBJA 3F68H 4XSKU 4PROA 1VITG 2I6SA 3GISB 2ZGCA 4KTCA 4OS1A 3PLPA 5GJ4B 4ZHAA 2BD9A 2UWPA 1TA2A 1AKSA 1BMMH 1JRTA 2EA3A 1OWHA 2XCNA 2SGDE 1GBAA 3MO3A 3RXLA 3A7ZA 1AB9B 3ATLA 3ODDA 3SI4H 4FUEA 2BD2A 3OSYA 1UHBB 1EATA 3LGVA 1C2LA 3QTVH 2NU0E 5FAHA 4JZDH 1G36A 2PV9B 1TBRH 3GY5A 1FIWA 3NWUA 1GI4A 3P92A 1HJAB 2QY0B 1QTFA 1S6HA 1SB1H 4DURA 1OP8A 3D62A 2FYRA 2ZU5A 3RM0H 2VH6A 4GPGA 1GVZA 1PQ5A 3UQVA 2SGEE 2BTCE 2ANKH 1GGDC 3RP2A 5DP8A 4ABHA 1PQ8A 1HAVA 1ZTLA 4AYYB 1P2OA 2XXLA 1T8LA 1QCPA 2QF3A 1VCWA 3SGQE 4KGAA 4X8TH 1O2KA 1RTFB 1MU8B 1WU1A 5DG6A 2FI3E 1D3TB 3ZZDA 1LHCH 5G4BA 4GVUA 3RXDA 3MU8A 1CT4E 3E0PB 1SOTA 1FONA 1DLKB 2AMPA 6ESTA 1TWXB 5F8TA 2Q6GA 4WVPE 1AE5A 1GDUA 3LGUA 3M3SA 1BITA 3DUXH 1S0RA 1JOUB 3FZDA 2J94A 1YPMH 1W13U 2G5VA 5C5OA 4BAQB 4K60A 4YTAA 2JKHA 5EQSA 3A83A 1GHXH 1ZSJA 4HTCH 3O8BA 3UPEA 2OP9A 5C1XA 1EJAA 1YLCA 2ZWLH 7LPRA 3BEFB 1ABIH 1PPCE 3SNEA 5T6FA 1FAXA 1V2NT 1UK2A 1YYY1 1EP5A 4B76A 1C5XB 2HWLB 4Y0ZE 4K69A 1QA7A 1SOZA 3PTNA 2Z9GA 4CHAB 4OS5A 1GMDF 3PMJA 1NRNH 3MWIU 1G9IE 1XXFA 1W8BH 4SGAE 1RS0A 3E6PH 3RDZA 4INKA 1SI5H 2ZEBA 4HGCA 3LC5A 2NU4E 2P93A 4ZHLU 5BRRE 1BCUH 1UTPA 3V3MA 2P3UB 4AFZA 3TLOA 4WJG2 4HZHA 1QIXB 1UVOA 3BTEE 1CGHA 4CBOA 1W11U 3S9AA 2C4FH 1TPOA 1NFYA 1DS2E 1TA6A 1GCTB 3LIWA 4OS6A 3M5NA 2W7SA 1NT1A 3IITA 4K8BA 1NFXA 1EAWA 2GT8A 1AVXA 5GXPA 1SFIA 5JB9S 5LPEA 1C2KA 4Z0KA 4WMEA 1SG8B 1WSSH 3B9FH 3RXKA 3T62A 3MHWU 1KLJH 1CA0C 1MH0A 1GBMA 2O8UA 2BY6X 1N8OB 4KTSA 4ZAEA 4ISIH 1DXPA 2A5KA 2ZU3A 5FPYA 1ELVA 2M5TA 1NRQH 1W2KH 1FZZA 1EB1H 1L4ZA 3K2UA 4FUJA 2BLWA 1UCYK 4LOYH 1ESTA 4GCHG 2FYQA 2WINI 1PJPA 2YOLA 3PB1E 4H6SB 2Z3CA 3AW0A 2FOAA 2K1QA 2Y7ZA 2Q6DA 1DDJA 3UOUA 4ZH8A 1GJ8B 1UO6A 4UD9H 2BD7A 4RSPA 4XFQA 1D6RA 1GI9B 2SGPE 1BTXA 3A81A 2H5CA 2VNTA 1F92A 4ASHA 1DWCH 2O9QA 2BLVA 1P2KA 2H9HA 1HAGE 3GY8A 2QV1A 3LJJA 1QA0A 1VR1H 1TMTH 1TB6H 1O5DH 1ZPZA 2Q6FA 2C8YB 1O3BA 3T2NA 1MCTA 3H7TA 4ZUHA 1Y59T 1FY5A 1O2WA 4BAHB 1GBEA 2G51A 1ETSH 1DWBH 1HLTH 3UOPA 1HRTH 1ZHRA 5J4SA 2D1JA 1PPHE 1QBVH 2FXRA 3TJUA 1QFKH 4Q2KA 2OLGA 3E90B 3MYWA 2Z3EA 1XUGA 1AU8A 2A7CA 3EE0B 2G00A 3ODFA 4I32A 2Z9KA 1LPGB 1FI8A 3T27A 1AKSB 5TCCA 3F9GA 2CF8H 1KTSB 1QY6A 3PM3A 1FAKH 1BHXB 2J34A 1WOFA 1IQMA 1PYTD 1TRNA 4IC5A 3MNSA 3VB3A 3FAOA 1O2SA 2O8LA 1YPHE 1E37B 4Y6DA 3VXEH 1C5UA 1A46H 3DT0H 3EA9A 3K6ZA 2H1UA 1ID5H 2UWLA 4ABEA 1A61H 2R3YA 4MLFB 1BMLA 1HYLA 3I78A 1ANDA 3T28A 1XXDA 1C4U2 4FUFA 3ATWA 3OY5U 4BAKB 1K2I1 3LGWA 1C9TA 3TH2H 1P2MA 1HAVB 4Z6AH 3RC6A 3SU3A 4O9VA 1O3GA 1AWHB 3ZZ8A 4NWLA 1GI2A 1NM6A 1V2VT 2ZNKH 4CRAA 2A1DB 1WUNH
chains in the Genus database with same CATH superfamily
1TALA 4B6EA 1GJDB 1O0DH 2P59A 3QZRA 4RT0A 3QO6A 1K1OA 1DM4B 3M7QA 4SGBE 1RD3B 2Y82A 4K5ZA 1J17T 1ZRBA 4K1TA 4JZIA 3UR9A 1GMHG 1SGFA 5IK2D 3SQHE 5DK1A 2ZFRH 5C67A 1GBLA 1UTKA 2R0KA 1AB9C 1N1LA 1F2SE 3EDXB 3RMNH 3SUFA 1C1QA 1GCDA 4JYVH 1TGTA 2QAAA 1B0EA 3OY6U 3RC4A 2NU3E 4X2YA 4AB9A 4DY7B 3LPRA 5KGOA 2RDLA 1G2MA 1CO7E 1KXFA 2A4RA 2GDEH 3SJ8A 1WDIA 2J2UA 4I33A 2CGAA 3NZIA 2ZIQH 1A3BH 3IG6B 1HJAC 5EQRA 2ZGXH 4FETA 3RU4D 3PYHA 1SGIB 5EODA 1OHHD 2BX4A 3A84A 2QCYA 2QXGA 3M36A 4NIXA 2B9LA 1TNHA 1ELBA 1O37A 2ZFFH 4XRNA 4ABJA 1CE5A 4ZMAH 3F1SB 3KQBA 2ZZUH 3RMOH 1NRPH 1VCPA 1TNJA 1BBRE 4KP0A 1QHRB 5EJLA 4A5TS 4B75A 5EW1H 2Y80A 1K22H 2K0QA 4B2CA 2FTLE 4UFFH 2EC9H 5FX5A 1JMOH 1W0YH 2BDAA 4OM9A 1XUFA 1VGCB 1LQEA 3LU9B 4DCDA 4A1XA 1PPEE 5CDFE 1SC8U 1GPZA 3HATH 4MDSA 2XBVA 1H9HE 3B23B 1G3DA 1K9OE 4MNVA 1TFXA 1GHAG 5FXLA 1BB0B 1ZPBA 5EPNA 1Z8RA 2V3MA 1C1WH 1SR5C 1W0KD 1D4PB 3SV2H 3ATIA 4MPUA 4X1PU 4LZ4B 2R2WU 1YP9A 1B5GH 1C1OA 2VH0A 1WXRA 5C0UA 1HXEH 4TSFD 3LGYA 1Q2WA 5DP9A 5JBCS 1TONA 3TK9A 5JPMH 1CHGA 3SI3H 2BDHA 4MPWA 3U1IB 1YPHC 2VINA 1P09A 4Y11E 5GNDA 2W6ID 2QXJA 4Q7XA 4BANB 2VIDA 3A7VA 2ZTYA 1DUAA 1WBGB 1HIAA 1E79D 1TX8A 5GIBA 4KELA 1BIOA 4CHAC 1V2QT 2B8OH 3SV7A 4VGCB 1C4V2 2GCHF 1Y3YA 2V6NA 2XC5A 1TYNA 2VIOA 1GI0A 1KTTB 2B7DH 5E0GA 1AHTH 2F9BH 1BTHH 1C5LH 1MTUA 3SBKA 8GCHG 1XUIA 4AFSA 3SU4A 2BDYA 2CV3A 1YKTA 5DKMA 1WV7H 1NN6A 1YF4A 2BMGB 3E0NB 5L2ZH 1P11E 4JYTA 3LH3A 1VITF 1H1BA 1Z8IB 1GG6B 3LT3A 4RI0A 4ABAA 2NU2E 2J92A 1GCTC 5EPYA 5I25A 2YMSB 2F83A 3SU5A 2ZPSA 1MMJN 1EP6A 1O5CB 2BDCA 2FPZA 7ESTE 2PKSB 2KCOA 2FODA 4KTUA 3P8OA 2PKAB 1N8OC 1AGJA 1NESE 4I86A 1HFDA 2CMYA 3K65B 1V2LT 1TPSA 5AFZH 1ZTJA 5EOKA 1EB2A 3OX7U 1XKAC 2D2DA 5DO4H 3FFGA 4OGXA 2VB0A 3CS7A 3UUZA 5LH8A 2BM2A 2V3OH 2IPHA 1G37A 2OXSA 4ZKNU 1C5MD 1HJ8A 2Z9LA 1GI8B 3UNRA 1BTPA 7GCHG 1LHFH 3RUOA 1O3IA 1YGCH 2W26A 2ZGJA 3I29A 4XOJA 1EZUC 2VWLA 1DLEA 1P9UA 4X8UH 1EOLA 2BHGA 2L6OA 3GY4A 4JMYA 1S0QA 3FKSD 1HNEE 1IQLA 2C3SA 3L33A 4E05H 3M5OA 1O5BB 1ELGA 1ESBA 1A5IA 1C1NA 1MZDA 1S84A 5GCHG 1WTHD 2Y6TA 1TRYA 2FTMA 5ESBA 5C20A 2CXVA 1QL9A 1V2MT 1UTMA 4DT7B 1GL0E 3SU1A 2CF9H 4E06H 2PGQB 1ZSKA 4DGJA 3URDA 1A4WH 3W95A 3MNCA 1LHGH 1C2JA 2GZ9A 4P00A 4CREA 1YM0A 3JZ1B 1HGTH 1SGQE 1OS8A 1RGQA 4QT8C 3WWFA 5JBBS 4U2WA 4D76A 3H09A 3RXCA 3ZVFA 4DJZB 9LPRA 5F03A 2FS9A 1SQRA 5C0TA 2ZGBH 4ZKRU 1EKBB 1LMWB 4ZHMU 4AFQA 1UCYE 2WYJA 4FU8A 2V3HH 3P6ZB 2PWXA 4WH8A 3A88A 2ZDNA 2NWNA 2ILNA 5FBIA 1SGDE 2FOFA 1QB9A 3UQOA 1GHBG 5DN6D 1C1SA 3BTQE 4UE7H 1ANEA 2H6MA 1GHVH 3HPTB 1AFQC 1S83A 1DSUA 3ZVGA 1C5OH 3F2GA 2PP6A 1O3HA 4B71A 4YT7H 1O2PA 3TH3H 3R3GB 3HKIB 5B6LA 4GAWA 2Y5FA 1MZAA 1JWTA 2ZDLA 1IOEA 3T29A 1CQQA 6GCHG 3UFAA 3QGJA 1MBMA 1CGJE 1DVAH 3LDXH 1HDTH 2EEKA 5LPRA 4AN7A 1OWJA 5F53A 1MKWK 3T26A 1TIOA 2AGGX 2P95A 1YY3A 1MTSA 2PUXB 1QL7A 2STBE 3EYDA 1AWFH 1SMFE 4YM9A 1P01A 2QIQA 1P02A 1G3CA 5HIZA 1TGSZ 2PTNA 2YNBA 7KMEH 1V2OT 3M61U 1XUJA 5BPEA 3U69H 3PV4A 3Q3YA 1V2PT 3BTDE 2BXTH 1GBKA 2Z6BD 4HG6A 4GCHF 2ANMH 4ABGA 3UNQA 1FN8A 3OE7D 1H8DH 2RA3A 2OINA 2Q1JA 1QBNA 3DCLA 3JZ2B 4E7NA 2ODQA 2TGPZ 2VIWA 2G4UA 4X2VA 2FOHA 2HPPH 2R3UA 1ZRKA 5AVDA 1C4Y2 2FEQH 2JH0D 2JIZD 3A7WA 2GZ7A 1GBBA 2VIPA 1ANBA 1AFEH 2W6JD 1P12E 2DE9A 1V2TT 2FOGA 8KME2 1S81A 4AFUA 3MQKC 4AOQA 2XNDD 1YLNA 1HIAB 3NRLA 2SGAA 3SN8A 2UUKB 5A0BA 1MAYA 2WPIS 1OP2A 1TOCB 1EQ9A 2ZI2H 3GDSA 1YBWA 3HGPA 1CU1A 4Y7BA 1BTUA 1FY3A 4RKOB 3T25A 3GY3A 1KXBA 3KCGH 1NO9H 2XC4A 1AIXH 1CHOG 1T7CA 1GBCA 1OSSA 1XVMA 2BD3A 2XBYA 3A85A 1MQ6A 3MH4A 1GJCB 3S9BA 1YC0A 4TT3D 3I77A 1KXCA 4K2YA 1EAXA 3M7TA 3ZVAA 3R0FA 4CRGA 1T4UH 1VGCC 3WWBA 2AMDA 2ZHDA 1MKXK 1MTNB 1O3EA 2BVRH 3RLWH 3ZIAD 2G81E 1EZSC 1GI6A 2QC2A 1OWKA 2VGCB 2SNVA 2ZG0H 3E3TA 1E36B 1GJAB 1SGCA 2XOKD 1BTZA 1P3CA 1Z8JB 3ZV8A 1V6DA 5L6NH 2HNTF 1ZMNA 1WCZA 2KZ4A 4XD7D 1HJ9A 2HALA 3SHAH 3UREA 2B5TB 2IPQX 2LPRA 2BY9X 4OS7A 3SU0A 4J2YB 1J15A 2WPHS 4DOQA 4ISLA 3RM2H 4INHA 4BAOB 1GBTA 2UWOA 2GV6A 4ABIA 2PHBA 2GGVB 1J8AA 1Z71A 3SJ9A 4VGCC 1CA8B 3ZZCA 4IN1A 4TYDA 1GBFA 1SGRE 4F55A 1RXPA 2JH5D 3GY6A 3A8CA 1EJMA 4I8KA 3MH7A 2KFWA 1A0JA 2BOHB 3U8RH 1NU9A 3TVJB 1L0ZA 1GG6C 2A45B 4AORA 2FWWA 4IW4E 1MTWA 1PPFE 2GX4A 1V2RT 2YMSC 1P06A 1EASA 1F5KU 2F4LA 4TWWA 5HKKD 1GMHF 1O3MA 3GY2A 4AZ2B 1BOQA 2PKSC 1AZZA 2ZTXA 1SQTA 2A4QA 4BNRA 3TH4H 2KCPA 5GPIB 2PFEA 2Y5HA 3KQ5A 2HLDD 2VIQA 3KIDU 3ELAH 2BLOA 4IS5A 2QA9E 2AGEX 1VITH 4A6LA 3SORA 2G52A 3PRDA 3BN9A 3MFJA 1V2JT 2PSYA 1FUJA 1S5SA 2ZECA 4MTBA 1KLIH 2ZHWH 2OK5A 3TJVA 1RRKA 1O2IA 1C5NH 5DP5A 3ZYDA 1QJ7B 2OQUA 1MD7A 5T6DA 5E0JA 3ZZBA 1MU6B 3GOVB 1NRSH 1HPGA 1TMBH 5TCAA 4NFFA 3ENSB 2FO9A 4K1EA 3F9FA 3BTFE 2ZTZA 4WF8A 1BMAA 1KXEA 2PKAA 4Q63A 1EZQA 1OPHB 3VFEA 1ZJKA 5EIYA 1EAUA 1GJ4H 1MCVA 1ELFA 3GYLB 2VVUA 4FOUC 1C1TA 1TNGA 1O5AB 1AZ8A 2Z9IA 3RXGA 3E16B 1ZMJA 1TE0A 1ZLRA 3TK5A 1YPLH 1W10U 1H8ED 1RTKA 1ARBA 4R0IA 1KY9A 2QYIA 4NSYA 2KCAA 1GHAF 3LH1A 2J97A 1NU7B 5T3HA 2F9NA 1DE7H 2TBSA 1UTOA 1A0HB 1O5GH 1HBTH 2J95A 1A7SA 1C5VA 3C1KA 2KM0A 1BDAA 2UUFB 1IQNA 4HFPB 1NTPA 1PQ7A 3K9XB 4Y8XA 3LC3A 1AFQB 1GMCG 1P3EA 3D23A 4FVBA 2ODYB 3VXFH 1BUIA 3EAJA 3F0PA 4I8LA 4X6NA 2BX3A 1TNLA 3W1EA 3MTYA 3RXAA 2EI6A 3LGTA 1TGBA 1XX9A 2H9EH 3W94A 2BZ6H 2CK3D 3DA9B 3RC5A 1COWD 8GCHF 2D26C 4X1NU 1GHWH 2OC8A 3FN8A 3PLKA 3L3TA 2F91A 6CHAB 2WV9A 1H9LB 2CN0H 1P04A 2GT7A 2SNWA 1GBDA 5EU8A 1TOMH 5C1UA 1CT2E 4TPYA 4CRCA 1D3PB 1E35B 1AMHA 1LQDB 4CH2B 1EZXC 4XBDA 2BY5X 2WV4A 2P8OB 3MMGA 4Y0YE 1SVPA 2GV7A 1S82A 2QF0A 4BTTB 4K8YA 1U6QA 5K7RA 4DIHH 5EXLA 1BTWA 1NBME 4LXBH 1V2WT 1QGFA 1O5FH 4J1YA 4F48B 4AGJA 2ZP0H 2GDDA 1Z1JA 3OEED 5EQQA 4FU7A 1C5WB 4GHQA 1FIZA 4WWYA 2FLRH 4D9RA 4IMZA 2JJ2D 2Y7XA 1YPKH 1JBUH 1IQHA 4Y71A 3ITIA 3FOAA 1D9IA 1HUTH 2XRCA 2RFKC 5C5NA 2FI4E 2ZDMA 1O3KA 7GCHF 5K0HA 2FI5E 5DJ7A 3BTGE 3RXBA 3RXUA 5IDKA 2GKVE 1O34A 1O2QA 1WYKA 1BBRH 1IAUA 1GVKB 3RXVA 1H8IH 1GJ6A 5JDUB 2W7UA 2GVFA 2PTCE 3UWJH 1XMNB 3OTPA 2WUCA 1PPGE 3QN7A 5HXFA 3M7UA 1TX6A 1IQFA 2W3IA 4FUIA 4MPXA 4ZROA 1UW7A 1HAIH 2ZFSA 4YZUA 3CP7A 1L4DA 4CRDA 5GCHF 1EXFA 3URCA 3M35A 1C2GA 4D7GA 1L2EA 1ZMLA 1XKBC 2IJOB 2ZA5A 4WXIA 1D6WA 1Y3VA 2PSXA 2Y5GA 2FOEA 2JETB 1YPJH 3MH6A 4B2BA 1JIRA 1ZYOA 1WAYB 3RXJA 4IBLH 3TJOA 4AG2A 2A2XH 4UFDH 4YLQH 1HB0B 5FX6A 5JBAS 1O2TA 1OKXA 2ZCKP 5E8EH 1A2CH 2V0BA 1SGYE 2GP9B 5CE1A 2ZHFH 3TNSA 4WXVA 1MTNC 4THNH 2LP6A 4Y8ZA 2SGQE 2WPJS 4O03A 1AQ7A 3LKWA 2WUBA 3RXIA 1X7AC 3FP8E 3WW7A 2LELA 2VGCC 1ZZZA 2ZHQH 2VJ1A 4YOIA 1EOJA 2ZGHA 1Z6EA 1T31A 2KAIA 1GI3A 1ETTH 3SO3A 1N6XA 3RMMH 1DX5M 1QRZA 1V2ST 2TGDA 1GHBF 4F4OC 2F9VA 4MNXA 3TNTA 3A82A 1FY4A 5CHBA 3B8JA 3E8LA 4D8NA 4E7RG 3VEQB 1SSXA 2WZQA 2A7HA 3V0XA 5A8YA 3KYGA 5CHAB 5DP4A 1AN1E 4X8SH 1O3LA 2F9OA 5DP3A 1HAPH 4CH8B 4I8JA 6GCHF 2DE8A 3P8FA 1JXPA 3NK8A 4YT6H 4ZXYH 1RTLA 1E1RD 1C1UH 1G3BA 1P10A 2NU1E 1L1JA 3QDZB 1TBZH 1KDQA 4MVNA 1KMHB 3U98H 1NY22 4WY3A 3H7OA 4ZXXH 2BXUH 3AW1A 2BVXH 2J38A 1P8VC 1MBQA 1O2ZA 4UONA 2ZC9H 4U01A 1AD8H 1O36A 1LTOA 1SGEE 2A5IA 1PPZA 5GDSH 2CJIA 3SZEA 3CENA 1G32B 5FCKA 1LVMA 2XW9A 1O2XA 2ZKSA 1AVWA 3NUMA 5E2PA 4B6FA 1TQ7B 1IHSH 4O97A 4BXSA 1O3CA 4HI3A 1PFXC 3PROA 1Y5AT 3HKJB 1BRUP 2KCYA 3RXRA 1M9UA 3S7KB 2ZQ2A 1QURH 4Y79A 1W3CA 3H5CB 3SNCA 6LPRA 1FPCH 4AG1A 2FP7B 5F6MA 4JZEH 3GCTG 4WMDA 3U8OH 2FDAA 3E91A 3RMLH 1SGFG 4JK6A 1RJXB 1INCA 4UDWH 4I7YH 3A7YA 3A87A 4LZ1H 5B6OA 5E0HA 1VKYA 1W0ZU 5LPFA 1W7XH 3N7EA 2PUQH 1BRAA 3UAIC 2VVVA 3BTWE 4H4FA 1A0LA 1P9SA 1Y3UA 3MOCA 1F7ZA 3HK6B 4MNWA 2Z9JA 4FUGA 1QQ4A 5A8ZA 2JDID 1AY6H 1CHOF 5FBEA 1LPKB 1L1GA 2QXIA 2OC0A 4RKJB 4F49A 1QNJA 4NG9H 2BDGA 1W14U 4NIWA 2ZCHP 5E2OA 4U32A 4MNYA 3S7HB 3OTJE 1LKAA 5F8ZA 1DY8A 1FY8E 1P05A 1HAHH 4UFGH 4IGDA 3LGIA 1IQIA 4ASUD 5KECA 2D8WA 4B73A 1HXFH 4RN6A 2ZDKA 3MU1A 1LVOA 3VB7A 4Y8YA 5JB8S 1K1MA 5IYTA 2FX4A 3M3VA 2BZAA 3F2HA 1UCYH 2J9NA 3P70B 3UNSA 1KXAA 1LVYA 2QE7D 1YPGH 3BTKE 3QUMP 1O2RA 1KSNA 3SU6A 1BJUA 3FZZA 2AEIH 5FHTA 3PRBA 5DGJA 1VJ9U 1FLEE 1UVSH 3GCHC 5C2ZA 8ESTE 2OUAA 1NS3A 1BMNH 3C27B 3K6YA 3UIRA 1LCYA 4YO9A 4YOJA 1OWIA 1MAXA 3Q00A 1FN6A 4R8TB 4GUXA 3PMHB 3KYFA 3SV8A 1O3FA 1TABE 2BDBA 2SGFE 2ODPA 3M5MA 3AK5A 3KQDA 1LKBA 1DPOA 1K0HA 1SGTA 1GBIA 4YESB 2Z94A 1FNIA 1YPEH 3S69A 3BG8A 2P16A 3DFJA 4NA7A 3AAVA 5FCRA 4BAMB 4XBBA 5AHGH 2A0QB 5H4IB 1A5HA 4DVAU 1CSOE 3PO1B 4IMQA 2RA0A 3RU4T 1HAOH 6CHAC 4Z1MD 2HVYB 2AHME 1NFWA 3Q3XA 2GTBA 1J14A 4XE4A 1F0SA 3GS9A 1O3DA 5C3NA 2G8TA 4JZFH 3GCNA 1C1RA 1C2MA 2C8WB 1K1LA 2UUJB 3SJIA 2THFB 1O31A 1UVPA 2P8OC 3PLBA 1CT0E 3EGKH 1A5GH 1GJ5H 2ZU4A 3SW2B 3N7DA 3VPKA 2H9TH 3NPSA 2ZFPH 1KYNA 1DICA 3PMAB 1NPMA 2P3TB 3M3TA 4FUDA 2ALVA 4ABBA 1FV9A 1S6LA 2ZFQH 2EY4C 2HNTC 1OYQA 1SQAA 3ZVCA 2RDEA 4TPIZ 1PYTC 1WQSA 1H8HD 1OWDA 4Q7ZA 3PMBB 1V2KT 1E34B 3MO9A 4FUBA 4X6PA 1SGNE 5LGOA 1K1JA 1P2JA 3OFND 3VB6A 1BJVA 2XNIA 1BHXF 1AUJA 1AVGH 3A7TA 1A1RA 1P0SH 2AYWA 1Q3XA 2KAIB 3TITA 1ZHMA 3BSQA 1OOKB 4AC9A 2O8TA 4Q80A 1H9IE 5C1YA 1YWUA 1O35A 1DOJA 2A2QH 2GCTB 3F2FA 2WPKS 1TX7A 4YXWD 1ZTKA 4DG4A 5A0AE 1E1QD 3OYPA 3EA7A 5KEDA 1P2NA 1NRRH 3RXOA 1ZGVA 4B1TA 2WPLS 2ZDVH 1ELEE 1V2UT 5ESTE 2XTTB 3BEIB 3ZV9A 1BA8B 5HMAA 4XDEA 3Q76A 4LK4A 4CBNA 4MG3A 3FANA 1EJNA 3L6PA 1SHHB 2GZ8A 2FOCA 2WYGA 1KDQB 1JIMA 2R2MB 1MQ5A 2WSSD 1NBMD 4FUHA 2JETC 3GDVA 2FESH 2P94A 5FPTA 3ZYEA 4UFEH 1HAXB 1FQ3A 1EPTB 3ATMA 3A89A 5A2MH 3SHCH 2HRVA 3LJOA 4K3JA 4X1SU 1RIWB 1O2MA 2OQ5A 1Y5BT 3Q77A 2ANWA 1GMCF 1XVOA 3EA8A 3V12A 1ZHPA 1K1NA 3GY7A 4OS4A 3KEEA 1ZJDA 2OTVA 3SUDA 1QBOA 2XWBI 8LPRA 2OBOA 3MH5A 1A3EH 3SNBA 4MPVA 1TAWA 2CHAB 2UUYA 2GJGA 1G30B 1SQOA 1O2GH 2HLCA 1ZSLA 1C5PA 2A4GA 3A8BA 3STJA 3T5FH 3VG8A 1TQ0B 1UVTH 2OC1A 4TY6A 4D7FA 3TIUA 1SBWA 5CHAC 1FX0B 1MUEB 1B7XB 1N6YA 3BG4B 1LDTT 2A31A 5J4QA 2AIPA 3FP7E 1CBWB 2TPIZ 5EXNA 3F6UH 2AMQA 1UK3A 2BVSH 4I31A 2ZO3H 3GDUA 3ZZ9A 2R9PA 5L30H 4ABDA 4BXWA 1P2IA 2A4OA 3SUEA 4Y76A 4NA8A 1C5YB 2J4IA 3O8RA 3SQEE 1OX1A 3NXPA 1SLUB 1BT7A 4KKDA 2G5NA 2OBQA 4NCYA 5AFYH 3TJNA 1VJAU 2FOBA 3U28C 1NROH 1AI8H 3SJKA 3VB4A 1THRH 2OC7A 4NWKA 5TJXA 2OD3B 2F9UA 2VU8E 9ESTA 4AYVB 4IC6A 2AFQB 1QL8A 1KXDA 1O3OA 2ZFTA 4NIYA 1W12U 1JRSA 2L74A 1TGCA 1GVLA 3MU5A 2FS8A 4JK5A 1UTNA 1D3QB 1O38A 1O30A 1QJ6B 4INLA 1O3JA 1PPBH 4MQAA 1YCPM 2ASUB 2FLBH 1RFNA 3SZNA 3TGJE 3KL6A 2TGAA 3E1XB 3VGCB 1BTYA 2ZHEH 3WY8A 1UK4A 5HGGA 1CVWH 3ZVDA 4WMFA 3D49H 1DANH 3A86A 1G2LA 1SFQB 2BY8X 1QJ1B 2VWNA 2VBCA 4U30A 2SFAA 2WV5A 1Z1IA 2FIRH 4A1VA 2VIVA 2HVXA 3UB0A 3QZQA 1F5RA 3F9HA 1Z7KA 1DUEA 2C90B 2DUCA 4AX9H 2BQ7B 4CRBA 3M5LA 3MU4A 2LNCA 1QRXA 2F9PA 4CRFA 5DP7A 1SPJA 1HV7A 1ABJH 1GI1A 2BQ6B 1DT2A 1C1MA 5JYIA 3GCHB 2BQWB 3PWCA 1SKYE 1AUTC 1P2QA 4GSOA 1C1PA 2FX6A 3QTOH 2VWMA 1W7GH 3ZZAA 2BLQA 3FP6E 3N7OA 3A80A 2TGTA 1B0FA 5HM2A 2ULLA 5T6GA 3RXQA 3AASA 3MNBA 1NZQH 5F8XA 4NZLA 2IOTA 2JH6D 1AO5A 1IHTH 3BF6H 2FZZA 3BTTE 1GMDG 2BOKA 1Y5UT 5A0CA 5A8XA 4GHTA 4DW2U 1XM1A 1MD8A 1NFUA 3RXHA 1QR3E 2ZQ1A 2QN5T 3SOSA 1FPHH 1TNKA 1TLDA 2V35A 1C5RA 2FM2A 1T8NA 3O8DA 1LO6A 1EUFA 3A7XA 3DSGA 1L1NA 2ZCLP 3BTHE 2GMTC 1CGIE 3QWCH 4X6MA 1SLXB 5EW2H 1C9PA 5DP6A 1O5EH 3BIVH 2XBXA 1O2NA 2GD4B 4JYUH 3NKKA 1VZQH 4M7GA 4Y10E 1Y3WA 4BTIB 2O8MA 1O32A 2Z7FE 3KF2A 2AH4X 2B0FA 3KQEA 1TRMA 1Y8TA 3VB5A 1UVUH 1BMFD 1HAZB 4ESTE 2I6QA 1GHYH 3ZZ5A 1Z6JH 1Q31A 3PO1C 4H42U 5DPAA 3UY9A 1OXGA 1YCPH 1H4WA 2ALPA 2G4TA 3SUGA 1LHDH 4ACAA 1T8OA 2EI7A 1QRWA 3GYMA 3M37A 2RCEA 2IN2A 2A5AA 1ZPCA 2AIQA 4H6TA 1OWEA 3BV9B 2EI8A 3SGAE 1P03A 3KHVA 4NSVA 1ANCA 2BDIA 1ELCA 2K8IA 3O8CA 1UTQA 3LONA 3PV2A 4FXGH 4NIVA 4GLYA 1KIGH 3ESTA 2PGBB 2TRMA 4NGAH 2YNAA 4ISNA 3RXEA 1C5TA 1E0FD 1GGDB 3KQCA 2VVCA 4BTUB 3CS0A 4X2WA 1YLDA 3BIUH 1OP0A 2RG3A 3GCTF 3SU2A 3RLYH 1UTLM 1WTGH 3SV9A 1O3PB 1WQVH 4CR5A 3FVFB 3GICB 1E38B 2STAE 3LOXA 1F0TA 1BQYA 1ELDE 3DD2H 3HGNA 5ETXA 5EXMA 1O33A 1LHEH 3DFLA 1TMUH 1C5QA 4CR9A 1C2DA 1K28D 2BY7X 3SYJA 3ZZ7A 1AE8H 3QX5H 2C93B 1ARCA 2W5EA 2V7QD 1IQJA 2GCTC 3P17H 1QB6A 2ZPQA 3SNDA 1IQGA 1ESAA 2FMJA 1ORFA 4DT4A 2PLXA 3S0NA 3FO8D 3MI4A 2F3CE 5SGAE 1UHBA 1MKWH 3IWMA 2YMSD 1XUHA 3ZVEA 4I8HA 1C5SA 1ETRH 2ZDAH 3BTME 3MU0A 5ABWA 3UR6A 4B2AA 1D3DB 3F0OA 4YLUA 1T4VH 3A8DA 1EX3A 2ZF0H 5GWZA 3U1JB 2P3FH 3F9EA 1XUKA 2XBWA 1DITH 4TWYA 3SGBE 5HYOA 1C2IA 5FPSA 3ZZ6A 5L2YH 2J98B 1ACBE 1C2EA 1DSTA 4X6OA 3ZVBA 5AF9H 1P57B 2O8WA 1O2JA 1THPB 3A8AA 1T32A 1EPTC 2XCFA 3NCLA 2BYAX 1F0RA 1RIWC 1TPAE 2ZU1A 3STIA 1ZGIA 4I8GA 1GWAA 2OCVB 1GL1A 3KGPA 1QB1A 1THSH 2AGIX 4OGYA 3SJOA 3S9CA 5HM9A 3D65E 1O3NA 4NA9H 4JZ1A 4FU9A 1O39A 5FL7D 2WHXA 2ZU2A 3SV6A 2Y81A 3OU0A 1GI7B 1UJ1A 5I46H 1DFPA 1FXYA 3P8GA 2CHAC 4K1SA 1FY1A 2PW8H 3SNAA 1CA0B 1TNIA 2BB4A 3DHKH 3ZZ3A 1EAIA 4YOGA 1SLVB 1FMGA 4IN2A 1C2HA 2HOBA 2PR3A 3KNXA 1GJBB 3BG4C 1FJSA 4FVDA 3TPIZ 2R0LA 1LPZB 1SHYA 3ZZ4A 1EPTA 3UWIA 1GHZA 2BD8A 3PV5A 1GJ9B 3TK6A 2BD4A 1CBWC 4TY7A 4ISOA 1MKXH 3TGKE 3V13A 3ATKA 3MNXA 1K1IA 2HNTE 3TGIE 5JBTA 1K21H 4ISHH 4UEHH 1O3AA 1DY9A 5EG4A 3QLPH 3RXMA 1O2OA 2A7JA 1MABB 2H5DA 1TPPA 1MTVA 1Y3XA 1ZR0A 3AVZA 2TIOA 3RXFA 4OS2A 1HCGA 1O2VA 1DWDH 1OYTH 1TGNA 4X1QU 2AS9A 3TU7H 1GBHA 3RXPA 2QGRA 2XWAA 1J16A 2ESTE 3RXTA 5HIYA 4Y7AA 2KR7A 1S6FA 1SLWB 3U8TH 1TBQH 3HK3B 1J9CH 1PQAA 1BRBE 2KX4A 3EQ0H 4Q7YA 5EJZA 3PWBA 1GJ7B 1BRCE 1F5LA 1O2UA 2A32A 4D9QA 1QQUA 1S85A 4X8VH 3PTBA 1Z8GA 1SL3A 1C1VH 4A7IB 1C5ZB 4JCNA 3VGCC 4ZKSU 1KLTA 1ELAA 2AERH 3UTUH 3G01A 1UMAH 1T8MA 1C2FA 1LVBA 2C8XB 2VWOA 1GI5A 1ELTA 4ZKOU 4O3TA 4X2XA 1DXWA 3GCOA 4DIIH 4ABFA 3AAUA 4A92A 5EJ1A 1SGPE 5CMXH 4BOHA 1YCPK 1EFRD 4NFEA 2WPDD 1ZOMA 1HAYB 2W3KA 3QK1A 1GDNA 5PTPA 1G3EA 4X1RU 3EE7A 4O3UA 3MO6A 1GDQA 1VCQA 1UTJA 1F0UA 2Z3DA 3QGNB 3P8NA 1BZXE 2HGTH 2FOMB 3CNRA 2XC0A 1QZ8A 4AB8A 1DWEH 1O2YA 2H2ZA 2QXHA 4FUCA 1V3XA 2C8ZB 2ZPRA 4X0WU 1NC6A 1K1PA 3P95A 3RU4E 2GMTB 4ZCNA 1O2HA 2XYAA 3BEUA 1BBRK 3KN2A 4B74A 4WH6A 4XBCA 3RXSA 2HPQH 5EGMA 2G55A 2ANYA 1FDPA 1O2LA 2GCHG 3Q3KA 4NZQA 1IQKA 2WPMS 1IQEA 2BD5A 3V7TA 4AGKA 3U9AH 4A1TA 5A09A 1GBJA 3F68H 2M2AA 4P02A 4XSKU 4PROA 1VITG 2I6SA 3GISB 2ZGCA 4KTCA 4OS1A 3PLPA 5GJ4B 4ZHAA 2BD9A 3F3BA 2UWPA 1TA2A 5C94A 1AKSA 1BMMH 1JRTA 2EA3A 1OWHA 2XCNA 2SGDE 1GBAA 3MO3A 3RXLA 3A7ZA 1AB9B 3ATLA 3ODDA 3SI4H 4FUEA 2BD2A 3OSYA 1UHBB 1EATA 3LGVA 1C2LA 3QTVH 2NU0E 5FAHA 4JZDH 1G36A 2PV9B 1TBRH 3GY5A 1FIWA 3NWUA 1GI4A 3P92A 1HJAB 2QY0B 1QTFA 1S6HA 1SB1H 4DURA 1OP8A 3D62A 2FYRA 2ZU5A 3RM0H 2VH6A 2IJD1 4GPGA 1GVZA 1PQ5A 3UQVA 2SGEE 2BTCE 5C17A 2ANKH 4Q4LA 1GGDC 3RP2A 5DP8A 4ABHA 1PQ8A 1HAVA 1ZTLA 4AYYB 1P2OA 2XXLA 1T8LA 1QCPA 2QF3A 1VCWA 3SGQE 4KGAA 4X8TH 1O2KA 1RTFB 1MU8B 1WU1A 5DG6A 2F43B 2FI3E 1D3TB 3ZZDA 1LHCH 5G4BA 4GVUA 3RXDA 2QF4A 3MU8A 1CT4E 3E0PB 1SOTA 1FONA 1DLKB 2AMPA 6ESTA 1TWXB 5F8TA 2Q6GA 4WVPE 1AE5A 1GDUA 3LGUA 3M3SA 3DSPA 1BITA 3DUXH 1S0RA 1JOUB 3FZDA 2J94A 1YPMH 1W13U 2G5VA 5C5OA 4BAQB 4K60A 4YTAA 2JKHA 5EQSA 3A83A 1GHXH 1ZSJA 4HTCH 3O8BA 3UPEA 2OP9A 5C1XA 1EJAA 1YLCA 2ZWLH 7LPRA 3BEFB 1ABIH 1PPCE 3SNEA 1W0JD 5T6FA 1FAXA 1V2NT 1UK2A 1YYY1 1EP5A 4B76A 1C5XB 2HWLB 4Y0ZE 4K69A 1QA7A 1SOZA 3PTNA 2Z9GA 4CHAB 4OS5A 1GMDF 3PMJA 1NRNH 3MWIU 1G9IE 1XXFA 1W8BH 4SGAE 1RS0A 3E6PH 3RDZA 4INKA 1SI5H 2ZEBA 4HGCA 3LC5A 2NU4E 2P93A 4ZHLU 5BRRE 1BCUH 1UTPA 3V3MA 2P3UB 4AFZA 3TLOA 4WJG2 4HZHA 1QIXB 1UVOA 3BTEE 1CGHA 4CBOA 1W11U 3S9AA 2C4FH 1TPOA 1NFYA 1DS2E 1TA6A 1GCTB 3LIWA 4OS6A 3M5NA 2W7SA 1NT1A 3IITA 2JJ1D 1NFXA 4K8BA 1EAWA 2GT8A 1AVXA 5GXPA 1SFIA 5JB9S 5LPEA 1C2KA 4Z0KA 4WMEA 1SG8B 1WSSH 3B9FH 3RXKA 3N99A 3T62A 3MHWU 1KLJH 1CA0C 1MH0A 1GBMA 2O8UA 2BY6X 1N8OB 2J98A 4KTSA 4ZAEA 4ISIH 3DSOA 1DXPA 2A5KA 2ZU3A 5FPYA 1ELVA 2M5TA 1NRQH 1W2KH 1FZZA 1EB1H 1L4ZA 3K2UA 4M9FA 4FUJA 2BLWA 1UCYK 4LOYH 1ESTA 3OEHD 4GCHG 5DSFA 2FYQA 2WINI 1PJPA 2YOLA 3PB1E 4H6SB 2Z3CA 3AW0A 2EQNA 2FOAA 2K1QA 2Y7ZA 2Q6DA 1DDJA 3UOUA 4ZH8A 1GJ8B 1UO6A 4UD9H 2BD7A 4RSPA 4XFQA 1D6RA 1GI9B 2SGPE 1BTXA 3A81A 2H5CA 2VNTA 1F92A 4ASHA 1DWCH 2O9QA 2BLVA 1P2KA 2H9HA 1HAGE 3GY8A 2QV1A 3LJJA 1QA0A 1VR1H 1TMTH 1TB6H 1O5DH 1ZPZA 2Q6FA 2C8YB 1O3BA 3T2NA 2QF5A 1MCTA 3H7TA 4ZUHA 1Y59T 1FY5A 1O2WA 4RT1A 4BAHB 1GBEA 2G51A 1ETSH 1DWBH 1HLTH 3UOPA 1HRTH 1ZHRA 5J4SA 2D1JA 1PPHE 1QBVH 2FXRA 3TJUA 1QFKH 4Q2KA 2OLGA 3E90B 3MYWA 2Z3EA 1XUGA 1AU8A 2A7CA 3EE0B 2G00A 3ODFA 4I32A 2Z9KA 1LPGB 1FI8A 3T27A 1AKSB 5TCCA 3F9GA 2CF8H 1KTSB 1QY6A 3PM3A 1FAKH 1BHXB 2J34A 1WOFA 1IQMA 3OAAD 1PYTD 1TRNA 4IC5A 3MNSA 3VB3A 3FAOA 1O2SA 2O8LA 1YPHE 1E37B 4Y6DA 3VXEH 1C5UA 1A46H 3DT0H 3EA9A 3K6ZA 2H1UA 1ID5H 2UWLA 4ABEA 1A61H 2R3YA 4MLFB 1BMLA 1HYLA 3I78A 1ANDA 3T28A 1XXDA 1C4U2 4FUFA 3ATWA 3OY5U 4BAKB 1K2I1 3LGWA 1C9TA 3TH2H 2J5UA 1P2MA 1HAVB 4Z6AH 5T1VA 3RC6A 3SU3A 4O9VA 1O3GA 1AWHB 3ZZ8A 4ACBA 4NWLA 1GI2A 1NM6A 1V2VT 2ZNKH 4CRAA 2A1DB 1WUNH
chains in the Genus database with same CATH topology
1TALA 1GJDB 1O0DH 2P59A 3QZRA 3QO6A 1K1OA 1DM4B 3M7QA 4SGBE 1RD3B 2Y82A 4K5ZA 1J17T 1ZRBA 4K1TA 4JZIA 3UR9A 1GMHG 1SGFA 3SQHE 5DK1A 2ZFRH 5C67A 1GBLA 1UTKA 2R0KA 1AB9C 1N1LA 1F2SE 3EDXB 3RMNH 3SUFA 1C1QA 1GCDA 4JYVH 1TGTA 2QAAA 1B0EA 3OY6U 3RC4A 2NU3E 4X2YA 4AB9A 4DY7B 3LPRA 2RDLA 1G2MA 1CO7E 1KXFA 2A4RA 2GDEH 3SJ8A 2J2UA 4I33A 2CGAA 3NZIA 2ZIQH 1A3BH 3IG6B 1HJAC 5EQRA 2ZGXH 3RU4D 3PYHA 1SGIB 5EODA 2BX4A 3A84A 2QCYA 2QXGA 3M36A 4NIXA 2B9LA 1TNHA 1ELBA 1O37A 2ZFFH 4ABJA 1CE5A 4ZMAH 3F1SB 3KQBA 2ZZUH 3RMOH 1NRPH 1VCPA 1TNJA 1BBRE 4KP0A 1QHRB 4A5TS 4B75A 5EW1H 2Y80A 1K22H 4B2CA 2FTLE 4UFFH 2EC9H 5FX5A 1JMOH 1W0YH 2BDAA 1XUFA 1VGCB 1LQEA 3LU9B 4DCDA 4A1XA 1PPEE 1SC8U 1GPZA 3HATH 4MDSA 2XBVA 1H9HE 3B23B 1G3DA 1K9OE 4MNVA 1TFXA 1GHAG 5FXLA 1BB0B 1ZPBA 5EPNA 1Z8RA 1C1WH 1SR5C 1D4PB 3SV2H 3ATIA 4MPUA 4X1PU 4LZ4B 2R2WU 1YP9A 1B5GH 1C1OA 2VH0A 1HXEH 3LGYA 1Q2WA 5DP9A 5JBCS 1TONA 3TK9A 5JPMH 1CHGA 3SI3H 2BDHA 4MPWA 3U1IB 1YPHC 2VINA 1P09A 4Y11E 2QXJA 4Q7XA 4BANB 2VIDA 3A7VA 2ZTYA 1DUAA 1WBGB 1HIAA 1TX8A 5GIBA 4KELA 1BIOA 4CHAC 1V2QT 2B8OH 3SV7A 4VGCB 1C4V2 2GCHF 1Y3YA 2V6NA 2XC5A 1TYNA 2VIOA 1GI0A 1KTTB 2B7DH 5E0GA 1AHTH 2F9BH 1BTHH 1C5LH 1MTUA 3SBKA 8GCHG 1XUIA 4AFSA 3SU4A 2BDYA 2CV3A 1YKTA 5DKMA 1WV7H 1NN6A 1YF4A 2BMGB 3E0NB 5L2ZH 1P11E 4JYTA 3LH3A 1VITF 1H1BA 1Z8IB 1GG6B 3LT3A 4ABAA 2NU2E 2J92A 1GCTC 5EPYA 5I25A 2F83A 3SU5A 2ZPSA 1MMJN 1EP6A 1O5CB 2BDCA 2FPZA 7ESTE 2PKSB 2FODA 4KTUA 3P8OA 2PKAB 1N8OC 1AGJA 1NESE 1HFDA 2CMYA 3K65B 1V2LT 1TPSA 5AFZH 1ZTJA 5EOKA 1EB2A 3OX7U 1XKAC 2D2DA 5DO4H 3FFGA 4OGXA 2VB0A 3CS7A 3UUZA 5LH8A 2BM2A 2V3OH 2IPHA 1G37A 2OXSA 4ZKNU 1C5MD 1HJ8A 2Z9LA 1GI8B 3UNRA 1BTPA 7GCHG 1LHFH 3RUOA 1O3IA 1YGCH 2W26A 2ZGJA 3I29A 4XOJA 1EZUC 2VWLA 1DLEA 1P9UA 4X8UH 1EOLA 2BHGA 3GY4A 4JMYA 1S0QA 1HNEE 1IQLA 2C3SA 3L33A 4E05H 3M5OA 1O5BB 1ELGA 1ESBA 1A5IA 1C1NA 1MZDA 1S84A 5GCHG 1WTHD 2Y6TA 1TRYA 2FTMA 5ESBA 5C20A 2CXVA 1QL9A 1V2MT 1UTMA 4DT7B 1GL0E 3SU1A 2CF9H 4E06H 2PGQB 1ZSKA 4DGJA 3URDA 1A4WH 3W95A 3MNCA 1LHGH 1C2JA 2GZ9A 4CREA 1YM0A 3JZ1B 1HGTH 1SGQE 1OS8A 1RGQA 4QT8C 5JBBS 4U2WA 4D76A 3RXCA 3ZVFA 4DJZB 9LPRA 5F03A 2FS9A 2ZGBH 4ZKRU 1EKBB 1LMWB 4ZHMU 4AFQA 1UCYE 2WYJA 4FU8A 2V3HH 3P6ZB 2PWXA 4WH8A 3A88A 2ZDNA 2NWNA 2ILNA 5FBIA 1SGDE 2FOFA 1QB9A 3UQOA 1GHBG 1C1SA 3BTQE 4UE7H 1ANEA 2H6MA 1GHVH 3HPTB 1AFQC 1S83A 1DSUA 3ZVGA 1C5OH 1O3HA 4B71A 4YT7H 1O2PA 3TH3H 3R3GB 3HKIB 4GAWA 2Y5FA 1MZAA 1JWTA 2ZDLA 1IOEA 3T29A 1CQQA 6GCHG 3UFAA 3QGJA 1MBMA 1CGJE 1DVAH 3LDXH 1HDTH 2EEKA 5LPRA 4AN7A 1OWJA 1MKWK 3T26A 1TIOA 2AGGX 2P95A 1MTSA 2PUXB 1QL7A 2STBE 3EYDA 1AWFH 1SMFE 4YM9A 1P01A 2QIQA 1P02A 1G3CA 1TGSZ 2PTNA 2YNBA 7KMEH 1V2OT 3M61U 1XUJA 5BPEA 3U69H 3PV4A 3Q3YA 1V2PT 3BTDE 2BXTH 1GBKA 2Z6BD 4GCHF 2ANMH 4ABGA 3UNQA 1FN8A 1H8DH 2RA3A 2OINA 2Q1JA 1QBNA 3JZ2B 4E7NA 2ODQA 2TGPZ 2VIWA 2G4UA 4X2VA 2FOHA 2HPPH 2R3UA 1ZRKA 5AVDA 1C4Y2 2FEQH 2JH0D 3A7WA 2GZ7A 1GBBA 2VIPA 1ANBA 1AFEH 1P12E 2DE9A 1V2TT 2FOGA 8KME2 1S81A 4AFUA 4AOQA 1HIAB 2SGAA 3SN8A 2UUKB 5A0BA 1MAYA 2WPIS 1OP2A 1TOCB 1EQ9A 2ZI2H 3GDSA 1YBWA 3HGPA 1CU1A 4Y7BA 1BTUA 1FY3A 4RKOB 3T25A 3GY3A 1KXBA 3KCGH 1NO9H 2XC4A 1AIXH 1CHOG 1T7CA 1GBCA 1OSSA 1XVMA 2BD3A 2XBYA 3A85A 1MQ6A 3MH4A 1GJCB 3S9BA 1YC0A 3I77A 1KXCA 4K2YA 1EAXA 3M7TA 3ZVAA 3R0FA 4CRGA 1T4UH 1VGCC 2AMDA 2ZHDA 1MKXK 1MTNB 1O3EA 2BVRH 3RLWH 2G81E 1EZSC 1GI6A 2QC2A 1OWKA 2VGCB 2SNVA 2ZG0H 3E3TA 1E36B 1GJAB 1SGCA 1BTZA 1P3CA 1Z8JB 3ZV8A 1V6DA 5L6NH 2HNTF 1ZMNA 1WCZA 1HJ9A 2HALA 3SHAH 3UREA 2B5TB 2LPRA 2BY9X 4OS7A 3SU0A 4J2YB 1J15A 2WPHS 4DOQA 4ISLA 3RM2H 4INHA 4BAOB 1GBTA 2UWOA 2GV6A 4ABIA 2PHBA 2GGVB 1J8AA 1Z71A 3SJ9A 4VGCC 1CA8B 3ZZCA 4IN1A 4TYDA 1GBFA 1SGRE 1RXPA 2JH5D 3GY6A 3A8CA 1EJMA 4I8KA 3MH7A 1A0JA 2BOHB 3U8RH 1NU9A 3TVJB 1L0ZA 1GG6C 2A45B 4AORA 2FWWA 4IW4E 1MTWA 1PPFE 2GX4A 1V2RT 1P06A 1EASA 1F5KU 4TWWA 1GMHF 1O3MA 3GY2A 4AZ2B 1BOQA 2PKSC 1AZZA 2ZTXA 1SQTA 2A4QA 4BNRA 3TH4H 5GPIB 2PFEA 2Y5HA 2VIQA 3KIDU 3ELAH 2BLOA 4IS5A 2QA9E 2AGEX 1VITH 4A6LA 3SORA 2G52A 3BN9A 3MFJA 1V2JT 2PSYA 1FUJA 1S5SA 2ZECA 4MTBA 1KLIH 2ZHWH 3TJVA 1RRKA 1O2IA 1C5NH 5DP5A 3ZYDA 1QJ7B 2OQUA 1MD7A 5T6DA 5E0JA 3ZZBA 1MU6B 3GOVB 1NRSH 1HPGA 1TMBH 5TCAA 4NFFA 3ENSB 2FO9A 4K1EA 3F9FA 3BTFE 2ZTZA 4WF8A 1BMAA 1KXEA 2PKAA 1EZQA 1OPHB 3VFEA 1ZJKA 1EAUA 1GJ4H 1MCVA 1ELFA 3GYLB 2VVUA 1C1TA 1TNGA 1O5AB 1AZ8A 2Z9IA 3RXGA 3E16B 1ZMJA 1TE0A 1ZLRA 3TK5A 1YPLH 1W10U 1RTKA 1ARBA 4R0IA 1KY9A 2QYIA 4NSYA 1GHAF 3LH1A 1NU7B 5T3HA 2F9NA 1DE7H 2TBSA 1UTOA 1A0HB 1O5GH 1HBTH 2J95A 1A7SA 1C5VA 3C1KA 1BDAA 2UUFB 1IQNA 4HFPB 1NTPA 1PQ7A 3K9XB 4Y8XA 3LC3A 1AFQB 1GMCG 1P3EA 3D23A 4FVBA 2ODYB 3VXFH 1BUIA 3EAJA 4I8LA 4X6NA 2BX3A 1TNLA 3MTYA 3RXAA 2EI6A 3LGTA 1TGBA 1XX9A 2H9EH 3W94A 2BZ6H 3DA9B 3RC5A 8GCHF 2D26C 4X1NU 1GHWH 2OC8A 3PLKA 3L3TA 2F91A 6CHAB 1H9LB 2CN0H 1P04A 2GT7A 2SNWA 1GBDA 5EU8A 1TOMH 5C1UA 1CT2E 4TPYA 4CRCA 1D3PB 1E35B 1AMHA 1LQDB 4CH2B 1EZXC 4XBDA 2BY5X 2WV4A 2P8OB 3MMGA 4Y0YE 1SVPA 2GV7A 1S82A 2QF0A 4BTTB 4K8YA 1U6QA 5K7RA 4DIHH 5EXLA 1BTWA 4LXBH 1V2WT 1QGFA 1O5FH 4J1YA 4AGJA 2ZP0H 2GDDA 1Z1JA 5EQQA 4FU7A 1C5WB 4GHQA 1FIZA 4WWYA 2FLRH 4D9RA 4IMZA 2Y7XA 1YPKH 1JBUH 1IQHA 4Y71A 3ITIA 1D9IA 1HUTH 2XRCA 5C5NA 2FI4E 2ZDMA 1O3KA 7GCHF 5K0HA 2FI5E 5DJ7A 3BTGE 3RXBA 3RXUA 5IDKA 2GKVE 1O34A 1O2QA 1WYKA 1BBRH 1IAUA 1GVKB 3RXVA 1H8IH 1GJ6A 5JDUB 2W7UA 2GVFA 2PTCE 3UWJH 1XMNB 2WUCA 1PPGE 3QN7A 5HXFA 3M7UA 1TX6A 1IQFA 2W3IA 4FUIA 4MPXA 4ZROA 1HAIH 2ZFSA 4YZUA 3CP7A 1L4DA 4CRDA 5GCHF 1EXFA 3URCA 3M35A 1C2GA 4D7GA 1L2EA 1ZMLA 1XKBC 2IJOB 2ZA5A 4WXIA 1D6WA 1Y3VA 2PSXA 2Y5GA 2FOEA 2JETB 1YPJH 3MH6A 4B2BA 1JIRA 1ZYOA 1WAYB 3RXJA 4IBLH 3TJOA 4AG2A 2A2XH 4UFDH 4YLQH 1HB0B 5FX6A 5JBAS 1O2TA 1OKXA 2ZCKP 5E8EH 1A2CH 2V0BA 1SGYE 2GP9B 5CE1A 2ZHFH 3TNSA 4WXVA 1MTNC 4THNH 4Y8ZA 2SGQE 2WPJS 4O03A 1AQ7A 3LKWA 2WUBA 3RXIA 1X7AC 3FP8E 2VGCC 1ZZZA 2ZHQH 2VJ1A 4YOIA 1EOJA 2ZGHA 1Z6EA 1T31A 2KAIA 1GI3A 1ETTH 3SO3A 1N6XA 3RMMH 1DX5M 1QRZA 1V2ST 2TGDA 1GHBF 4F4OC 2F9VA 4MNXA 3TNTA 3A82A 1FY4A 3B8JA 3E8LA 4D8NA 4E7RG 3VEQB 1SSXA 2A7HA 3V0XA 5A8YA 5CHAB 5DP4A 1AN1E 4X8SH 1O3LA 2F9OA 5DP3A 1HAPH 4CH8B 4I8JA 6GCHF 2DE8A 3P8FA 1JXPA 3NK8A 4YT6H 4ZXYH 1RTLA 3QDZB 2NU1E 1C1UH 1G3BA 1P10A 1L1JA 1TBZH 1KDQA 4MVNA 3U98H 1NY22 4WY3A 3H7OA 4ZXXH 2BXUH 3AW1A 2BVXH 2J38A 1P8VC 1MBQA 1O2ZA 4UONA 2ZC9H 4U01A 1AD8H 1O36A 1LTOA 1SGEE 2A5IA 1PPZA 5GDSH 2CJIA 3CENA 1G32B 5FCKA 1LVMA 2XW9A 1O2XA 2ZKSA 1AVWA 3NUMA 5E2PA 1TQ7B 1IHSH 4O97A 4BXSA 1O3CA 4HI3A 1PFXC 3PROA 1Y5AT 3HKJB 1BRUP 3RXRA 1M9UA 3S7KB 2ZQ2A 1QURH 4Y79A 1W3CA 3H5CB 3SNCA 6LPRA 1FPCH 4AG1A 2FP7B 5F6MA 4JZEH 3GCTG 4WMDA 3U8OH 2FDAA 3E91A 3RMLH 1SGFG 4JK6A 1RJXB 1INCA 4UDWH 4I7YH 3A7YA 3A87A 4LZ1H 5B6OA 5E0HA 1W0ZU 5LPFA 1W7XH 2PUQH 1BRAA 2VVVA 3BTWE 4H4FA 1A0LA 1P9SA 1Y3UA 3MOCA 1F7ZA 3HK6B 4MNWA 2Z9JA 4FUGA 1QQ4A 5A8ZA 1AY6H 1CHOF 5FBEA 1LPKB 1L1GA 2QXIA 2OC0A 4RKJB 4F49A 1QNJA 4NG9H 2BDGA 1W14U 4NIWA 2ZCHP 5E2OA 4U32A 4MNYA 3S7HB 3OTJE 1LKAA 5F8ZA 1DY8A 1FY8E 1P05A 1HAHH 4UFGH 4IGDA 3LGIA 1IQIA 2D8WA 4B73A 1HXFH 4RN6A 2ZDKA 3MU1A 1LVOA 3VB7A 4Y8YA 5JB8S 1K1MA 5IYTA 2FX4A 3M3VA 2BZAA 1UCYH 2J9NA 3P70B 3UNSA 1KXAA 1LVYA 1YPGH 3BTKE 3QUMP 1O2RA 1KSNA 3SU6A 1BJUA 3FZZA 2AEIH 5FHTA 5DGJA 1VJ9U 1FLEE 1UVSH 3GCHC 5C2ZA 8ESTE 2OUAA 1NS3A 1BMNH 3C27B 3K6YA 3UIRA 1LCYA 4YO9A 4YOJA 1OWIA 1MAXA 3Q00A 1FN6A 4R8TB 4GUXA 3PMHB 3SV8A 1O3FA 1TABE 2BDBA 2SGFE 2ODPA 3M5MA 3KQDA 1LKBA 1DPOA 1SGTA 1GBIA 4YESB 2Z94A 1FNIA 1YPEH 3S69A 3BG8A 2P16A 3DFJA 4NA7A 3AAVA 5FCRA 4BAMB 4XBBA 5AHGH 2A0QB 5H4IB 1A5HA 4DVAU 1CSOE 3PO1B 4IMQA 2RA0A 3RU4T 1HAOH 6CHAC 1NFWA 3Q3XA 2GTBA 1J14A 4XE4A 1F0SA 5C3NA 1O3DA 2G8TA 4JZFH 3GCNA 1C1RA 1C2MA 2C8WB 1K1LA 2UUJB 3SJIA 2THFB 1O31A 1UVPA 2P8OC 3PLBA 1CT0E 3EGKH 1A5GH 1GJ5H 2ZU4A 3SW2B 3VPKA 2H9TH 3NPSA 2ZFPH 1KYNA 1DICA 3PMAB 1NPMA 2P3TB 3M3TA 4FUDA 2ALVA 4ABBA 1FV9A 2ZFQH