3MU8A

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region b of the crystal. fifth step of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu8A01
1T7CA 2TGDA 3BV9B 2AEIH 4CBNA 1OYQA 1LHCH 1EJAA 4YLQH 2JKHA 1HJ9A 1TX8A 4WXIA 3LH1A 5J4SA 2SGAA 1YYY1 2AGEX 2ZFTA 4AFUA 1XXDA 1RTKA 3A7WA 4BAHB 1FUJA 1TFXA 4NFEA 3MNCA 1DANH 4X0WU 2O8MA 4AG1A 3NUMA 1GHAG 2BY6X 1O2UA 1WQVH 3SU2A 1C5OH 1A61H 2V35A 1ANDA 2D2DA 4JYVH 1LVBA 3T62A 1P9UA 4B73A 3L33A 4GCHF 1HNEE 1GBDA 2BD8A 4U2WA 1C1UH 1HLTH 1TGCA 2BZAA 1ZLRA 3KQDA 3TK9A 1EJMA 1CA0C 7LPRA 4I8GA 1ELBA 4ZUHA 1L4DA 1OP0A 1QRWA 2A7JA 1O2SA 1TOMH 1TPAE 1XKBC 4UFEH 4VGCC 4XBBA 4JK5A 3P70B 2FX6A 3SGBE 3TJNA 4X2XA 1YGCH 3M36A 3SNCA 3W95A 5DP7A 5JB9S 1C5YB 3SV9A 3U8RH 1M9UA 1SQAA 1C5RA 1EZQA 1BBRK 1GBFA 1UCYE 4ZH8A 3TK6A 2C93B 3BTQE 4HGCA 3OX7U 2WUBA 3RP2A 2A4GA 1O3LA 1AVXA 4RN6A 2J94A 2ZG0H 1C5VA 1DICA 1L4ZA 3M61U 1RTLA 3RU4E 1D3PB 2ZU2A 1YPJH 4GVUA 1SGCA 2NU4E 5JYIA 3R0FA 1S84A 2HPPH 3L6PA 1FY3A 1RIWC 1ZR0A 1K2I1 2FOBA 4Y0ZE 4CRGA 1O5EH 4AYYB 1UTOA 1DUEA 1O2RA 1SFQB 1ZTJA 1KXCA 2TPIZ 3CS7A 1G2MA 3QK1A 3ZVFA 2SGEE 3V3MA 4GSOA 1CGHA 1TGNA 2ZFSA 1AKSB 4X6MA 5GXPA 3GICB 1T4VH 2C8YB 1GJ4H 3KIDU 5T6DA 4AFQA 5C3NA 1C1TA 1PJPA 1KXEA 2BLQA 2P94A 1TNJA 4KTCA 1ETTH 1UTKA 3EE0B 5EQRA 4DIHH 5AFYH 1NROH 4NGAH 3G01A 2Q6GA 1IOEA 3GY7A 3H7TA 2WPKS 3SUEA 2GMTC 4A1VA 3RXHA 4JZEH 2OXSA 4I8HA 4Y8XA 1SBWA 4A1TA 4NWLA 3K9XB 4X6OA 4SGAE 1XX9A 1V2UT 2ZCLP 3BF6H 4OS4A 1O38A 3F9GA 1ZSKA 4H42U 3SNBA 1MD7A 3E6PH 2CMYA 3BIVH 1EX3A 2D8WA 1BTHH 3HGPA 2M5TA 1QBNA 4WMEA 1TX7A 4K3JA 5K7RA 2SGQE 3TNSA 4F49A 1KDQA 2XC4A 1AFQC 1B0FA 2AMPA 1UTQA 1RFNA 2W3IA 3JZ1B 2KAIB 4DVAU 1GI7B 1Y5BT 2NU3E 5TCCA 3HK3B 3SU3A 3D62A 3CS0A 3F6UH 2ZA5A 3QGJA 1RXPA 3URCA 2ZCKP 2FI3E 2FODA 1GI1A 3P17H 1CT2E 4YT7H 5DKMA 3LGYA 2BY5X 1AVWA 1DWCH 1O5CB 2R2WU 1WQSA 9LPRA 1V6DA 1ZSLA 4ISOA 3AASA 1ZPCA 3ZV9A 4ABHA 3UQOA 3P8NA 2UWPA 1V2TT 1FNIA 2SGDE 1C1WH 1HAVA 1QHRB 1BCUH 3FP7E 3ZVCA 3BTWE 2FI5E 1V2KT 1LO6A 1QCPA 1NN6A 2PKAA 4ZAEA 1O3DA 1V2PT 2ZDKA 4JZDH 1XKAC 2ZDNA 4FXGH 1J9CH 2OP9A 8ESTE 3VGCC 3ZZ9A 2AIQA 1Z7KA 4GHQA 4D7FA 2XBXA 1LVMA 4MPVA 2JH0D 1MCTA 1O3FA 1P0SH 4CHAC 4I7YH 3A7YA 1FV9A 1D3DB 2ASUB 3SHAH 4ABFA 4I8KA 4X8VH 3SUFA 2C8WB 3A82A 1WU1A 2P16A 1IQLA 3A84A 3F9HA 1O2MA 2WYGA 3QZRA 3ATLA 3ZVGA 4JYTA 2FTMA 2B9LA 3A7ZA 5EXLA 1TGSZ 1XVOA 2GV7A 4NA7A 4Y7BA 1EJNA 4RKOB 5BRRE 1ZGVA 1MMJN 2BQ7B 1O2TA 5JPMH 1O2XA 1LQDB 2ZPRA 4YO9A 1VJ9U 4AZ2B 3E3TA 1OWIA 2VWLA 3BEUA 4UFGH 1TABE 5C1YA 1A5GH 5LPFA 1GG6B 2FZZA 1O2GH 3MWIU 3A7TA 2ZWLH 5F8ZA 2ZDMA 1DSUA 1E0FD 4BNRA 1WTGH 5FCRA 2VJ1A 2FXRA 3KQCA 4MNXA 2ALVA 1W14U 3ATKA 3MHWU 1Z8GA 2Q6FA 1P02A 3Q3XA 1MTUA 3KF2A 4IC6A 1UTPA 2QCYA 3DA9B 2XBWA 1GI2A 1NZQH 4U30A 4FUJA 1C5PA 2W26A 1O35A 3MH5A 2FTLE 1AE8H 1FI8A 1P2NA 2PKSB 2R9PA 1A4WH 3ZYEA 1HFDA 3QGNB 1O3GA 1A5IA 4RKJB 3PV4A 2BOKA 3HATH 2ZNKH 1ARCA 1NT1A 2IJOB 2CHAC 3RXMA 2QF3A 1AY6H 4MPWA 1LHDH 3RXAA 2O8WA 3OSYA 4K1SA 1BTWA 1UVOA 5E8EH 2A0QB 2Z9KA 2XC0A 2BLOA 2PR3A 2PUQH 1J15A 1P3EA 2VWMA 1XXFA 1C5LH 3MH4A 2XWBI 2A4QA 4WMFA 3RXDA 3A81A 3P8GA 3GY6A 1GPZA 3BTFE 5JDUB 2W3KA 1BTYA 3GCHB 1C2EA 5E0JA 1KXBA 1V2MT 3TIUA 3BIUH 4MPXA 1QBVH 1O5GH 3DHKH 1BOQA 5DP6A 1H9HE 2ZGXH 3M37A 1H9LB 2ZHFH 1F2SE 2XTTB 1EP6A 1O2YA 3GDVA 1A0LA 4B2CA 1E34B 3FANA 3BG4C 3HKJB 2TIOA 4ABJA 2G5NA 1D4PB 1MZDA 4GUXA 2Y5FA 3GDSA 2ZDAH 1TBQH 3RU4D 1NFYA 3LJJA 3SUDA 4RSPA 4GCHG 1ZJDA 1P12E 1S85A 5GDSH 3EQ0H 1GBHA 2P3UB 4X6NA 5EPYA 5C1UA 1SGTA 1EB1H 2CN0H 4I33A 3U69H 2XBYA 1NU9A 1P2QA 1Y59T 1CO7E 3M5MA 3S9BA 1O2IA 3M3SA 1NESE 1V2OT 2KAIA 1V2LT 4AB8A 1TGTA 1SG8B 1TNLA 3TJUA 4TWYA 1P8VC 5EGMA 1UO6A 3TPIZ 2Y5GA 2HGTH 2AYWA 3LGVA 4YOIA 4NG9H 2A32A 4MTBA 5JBBS 1QNJA 3Q3KA 4ZXXH 2WPIS 3QWCH 2C90B 1J16A 1TA2A 1BRAA 4DGJA 3M7QA 1OWDA 2XYAA 4ABEA 3RXSA 5FXLA 3A8BA 2Y7XA 4FVBA 4NSVA 1A1RA 2O8TA 2JH6D 1MTSA 1QFKH 5LPEA 2FP7B 1CA8B 1CGJE 3ATIA 4UEHH 1AB9C 2VIPA 1NRNH 3IWMA 2ZU5A 1ORFA 4OS7A 4J2YB 1L1NA 3TU7H 5DG6A 2BYAX 1N6YA 3TLOA 2GGVB 3SI3H 5EPNA 4AGJA 3MU5A 5IDKA 1W11U 2XXLA 5F6MA 1ZHRA 3V13A 4TY7A 2TRMA 2ZECA 1IAUA 3A83A 3RC5A 3RM0H 1GJ7B 4DURA 2FOEA 3LGIA 5C5OA 2PFEA 1Y3WA 4KELA 5F03A 4MG3A 2B7DH 2EI6A 2GDEH 4FUGA 2IOTA 1KLIH 3QTOH 2YNAA 3RMMH 2Y7ZA 3MNBA 4XBCA 1QGFA 3AW1A 1V2RT 1T4UH 3T5FH 4IGDA 1HAHH 1C2JA 1ZJKA 2O8UA 1F92A 3E90B 1FIWA 4B76A 3TITA 3D65E 2CJIA 4IMZA 4CH2B 1ESTA 1MD8A 2FX4A 4MDSA 5FX5A 1GBKA 1DY9A 3ZYDA 1UCYH 4OGYA 1TOCB 1AHTH 1EOLA 3T28A 1O5BB 2HALA 2VB0A 1P09A 1TBRH 3DFLA 3E0NB 1P2MA 3PMJA 1CGIE 1CE5A 1QY6A 4FUIA 2BDGA 3TK5A 1GJ9B 3GISB 3T27A 1Q31A 2UUJB 1XM1A 1UVSH 4X1RU 4AG2A 1TAWA 1BMLA 5A8XA 1ZPBA 1HJ8A 1EAUA 2ZPQA 3UWJH 2RA3A 5L30H 4INLA 3MTYA 1EP5A 4IW4E 3SBKA 1BTZA 1QL9A 1F7ZA 1ZOMA 3MH7A 2IN2A 2C8ZB 1P11E 1C2MA 3P92A 1DLKB 5FHTA 3RXBA 1N1LA 5E0GA 1PQ7A 2A45B 3U8OH 4M7GA 5PTPA 4YT6H 1HAXB 1O3EA 1OP8A 1SGNE 2NU0E 2Z9JA 3OU0A 1P2JA 5FAHA 2NU2E 1ELAA 3CP7A 1PPFE 4GHTA 1LKBA 1TNKA 4ISIH 5JBCS 1QJ7B 1GBTA 3MNXA 1JWTA 2AGIX 1W2KH 3P8OA 1Q3XA 2P8OB 3GCNA 1BBRE 1ETSH 2P3FH 2A5KA 1LPGB 3GY5A 1O3MA 2QAAA 1QB9A 1UVPA 5IYTA 3M7UA 3FVFB 1S5SA 2A4OA 1EPTC 1YCPM 1W0ZU 3SU4A 5A09A 1OWHA 1DXPA 1VGCB 5GWZA 3KNXA 3RXVA 3KCGH 3SN8A 2FOHA 1MU8B 4K5ZA 3RC6A 1V2VT 5CHAC 1H8IH 1ARBA 1IQFA 3HK6B 3VB6A 2PKAB 1HPGA 1RRKA 2OC8A 2XCNA 4UFDH 5A0BA 4O3UA 1XUKA 2YOLA 2UWLA 1ZYOA 1S6HA 3LGUA 1MU6B 1AZ8A 3TGJE 2TGPZ 6GCHF 2ZU1A 5DO4H 1O0DH 4FU9A 5E2OA 1SLVB 3EA9A 2BDCA 4GPGA 4IC5A 3IG6B 1GDUA 1GWAA 1PYTD 2GT7A 1C5NH 3GYLB 1BJUA 1BT7A 1BA8B 3LPRA 4F4OC 5I46H 1RS0A 1TLDA 2BVSH 3LJOA 4DT7B 1JIMA 1NU7B 1O2VA 1KIGH 1F0TA 4GAWA 1MCVA 1GI5A 3KN2A 2GCHF 5HMAA 5K0HA 1NO9H 1BMNH 1O3JA 3ATWA 2FOGA 2Q6DA 4FUDA 4DG4A 1K1OA 5FPYA 4Y6DA 1S82A 4LXBH 1K1LA 1IQEA 1RD3B 1PPGE 3LC3A 1FPCH 4AGKA 4BAMB 3BTDE 2GP9B 1AU8A 2VH0A 2UWOA 2ZTXA 1SQTA 3P8FA 5T3HA 2B5TB 1DS2E 4CR9A 2WPLS 1AUJA 1TX6A 3PMHB 3S0NA 2QYIA 2Z3CA 1ZTLA 4Y8YA 2ODPA 1AE5A 2XCFA 2JETB 3PLBA 1GHXH 3BTTE 1SLXB 1O3OA 1C5UA 1INCA 1YCPK 2BDBA 3OYPA 1H1BA 1NC6A 1GJCB 1VITH 1C5QA 2VVVA 1P01A 1TRMA 4NIWA 1DOJA 3RXUA 1QRZA 2QGRA 2VGCC 4HI3A 1HRTH 1FQ3A 2J34A 1ELTA 3TJVA 1UTMA 3UUZA 3VXFH 3EAJA 1ANBA 3SV8A 5FBEA 1IHSH 4AN7A 1Y3VA 4YM9A 2VIWA 1SLWB 2BTCE 4B2AA 4BOHA 3UQVA 1O2JA 1DVAH 2PTNA 4H6SB 1BITA 2BLWA 3O8DA 4U01A 1HXFH 1MH0A 2ZFPH 4UFFH 1C5TA 2NWNA 2QA9E 2BY9X 1G2LA 5DP5A 3RU4T 5A8ZA 2AFQB 3ESTA 2A4RA 1HAOH 1O3CA 4DY7B 3SQEE 1Z6EA 2B8OH 1LCYA 1MBQA 1O2OA 1SLUB 4XBDA 2FS8A 2ZFFH 4A1XA 3M3TA 2DE8A 3MOCA 4K1EA 1LQEA 1MUEB 2QY0B 1O39A 4K69A 1BJVA 3PO1B 3UOPA 3N7OA 1TNHA 5EQSA 1LKAA 3B9FH 4MNYA 4O03A 1JMOH 4CRCA 1DDJA 1GMDF 3AW0A 1LDTT 1SGIB 1NY22 2VWNA 1K1MA 3MNSA 2FLRH 1YPHE 2RA0A 2EC9H 1GBJA 1HAYB 2ZDLA 1D6RA 4PROA 4Z0KA 3BSQA 4D8NA 5BPEA 4X2VA 1XUIA 1K1PA 2ZHQH 1T8MA 1GBBA 3CENA 1C1MA 1LHFH 4BXSA 4DCDA 3RDZA 4ISNA 5DP4A 1ELGA 1MTVA 2BD2A 2OQ5A 1EQ9A 3BTGE 1C2DA 3PWCA 4AORA 1MTNC 4WXVA 1GMCG 1HAZB 5G4BA 3EDXB 4A5TS 5CMXH 3V12A 1YPLH 1GHZA 1GGDB 3PTNA 2W7SA 1CQQA 1BHXB 1VITF 1SI5H 2VINA 4XDEA 4WJG2 1K9OE 1AFEH 1MQ6A 3LT3A 1ESAA 1GL1A 5EU8A 1BRCE 2GKVE 4BTUB 1F5KU 4OS2A 3BTEE 1THSH 2AS9A 2R0LA 3DT0H 1C5WB 1V2WT 1MKXK 1RJXB 1ZMLA 1UHBA 5ETXA 3UNQA 3BN9A 1YLDA 1P2KA 1TWXB 2STBE 2GCTB 2H2ZA 5FPTA 3GY3A 1K21H 1TPOA 4O3TA 3FZZA 3SUGA 3LC5A 2SGPE 1PYTC 4CRDA 2BD4A 2ZU4A 2LNCA 1GI9B 2CV3A 3UNSA 1BZXE 5I25A 1TA6A 5B6OA 1HAIH 1L0ZA 3SJOA 3LDXH 1F0RA 2C4FH 2PUXB 1C5XB 1DPOA 2HNTC 1P2OA 4FU8A 1N8OB 3T26A 1AQ7A 4FUCA 1Y3YA 3RXKA 1T8OA 1TRYA 4WMDA 3UIRA 4DJZB 2G00A 4Q7ZA 4D7GA 1SGPE 3SQHE 1DXWA 3UY9A 1OP2A 1CBWB 5C67A 5GCHF 1XUHA 3SGQE 7GCHF 1EZSC 3KGPA 1F0SA 2XC5A 3MO6A 1RTFB 5ESTE 3GYMA 1LVYA 1EKBB 4HZHA 2QXIA 1C1NA 2XNIA 3A8AA 1KYNA 1O3HA 1P3CA 2THFB 2A7CA 1C9TA 2HNTF 4NIXA 4YZUA 2F91A 4OS1A 2FOMB 5DGJA 1EAXA 4ISLA 4Y0YE 2ZC9H 3Q77A 3E1XB 3U1IB 1ZRBA 3QLPH 1BMMH 2ZGBH 1GCTB 3A8CA 3A88A 1KSNA 4NSYA 2H5CA 4O97A 5JBTA 1O2HA 3U98H 1V2NT 3LGTA 3SNAA 3VFEA 5LH8A 2TGAA 5DPAA 1TQ7B 3RXJA 3NPSA 1HUTH 4ABGA 4ZMAH 1A3BH 5JB8S 4TY6A 3RXPA 3DFJA 5GJ4B 1BMAA 2Z7FE 1GCDA 1O3AA 1C9PA 4CRAA 2FEQH 2WPMS 2AIPA 3RC4A 3SJKA 1UTLM 1JRSA 1W3CA 2Z3DA 4KGAA 4ZKRU 1ELFA 1AIXH 2P59A 4J1YA 3NK8A 2J95A 3I77A 4ZKNU 2CXVA 5FCKA 3DUXH 2Y5HA 2XBVA 5C20A 1AI8H 3UREA 1MAXA 4SGBE 1GHAF 2W5EA 4KKDA 1GDQA 1QL7A 3KQBA 8GCHF 1ZMJA 4UD9H 2D1JA 3RXCA 1U6QA 1ZRKA 3LH3A 3ZV8A 3ZVBA 1Z6JH 4K1TA 1P57B 3OY6U 1YP9A 3SJ9A 3TGIE 3RXQA 1TGBA 2OBOA 1GHWH 1J8AA 3M7TA 5DK1A 3U8TH 3SOSA 2BD5A 5JBAS 1SGDE 1O2ZA 6GCHG 1Z71A 1C1PA 4GLYA 3OTJE 1ACBE 2TGTA 1DY8A 5L2YH 9ESTA 1S0QA 1HAGE 1WTHD 2J2UA 2VIVA 1FLEE 4XFQA 1H4WA 1PQAA 1F0UA 1DE7H 1HIAA 1SMFE 3SO3A 5CE1A 1ANEA 1JXPA 1O2KA 2P93A 1GHYH 2G5VA 1O2QA 2BOHB 1BQYA 1C1RA 3QN7A 2GCHG 2RG3A 4MLFB 5HM2A 1P10A 3P95A 1X7AC 2SNVA 1QRXA 2ANYA 2FYQA 2F9OA 2BDYA 4UE7H 1UK2A 1L1JA 1V3XA 2F9BH 1Q2WA 1UK3A 3MO9A 3F68H 3FAOA 1FY5A 1F5RA 2H9EH 4OS6A 2QXGA 1ZTKA 1FXYA 1DX5M 3ELAH 1GI0A 2BX4A 3GY8A 3SJ8A 3SGAE 1J14A 1O3PB 1GBEA 2ANWA 3GOVB 3SV2H 3Q76A 4KTSA 1QBOA 2O9QA 3SV6A 4ABBA 4X1SU 1YPEH 1HJAB 2Y81A 5T6GA 1SR5C 2G4TA 3TNTA 1GDNA 3OY5U 3AAUA 1G3EA 4CR5A 4JYUH 4E06H 1QQUA 2A5IA 3E91A 3LU9B 1QL8A 2D26C 3VEQB 2QXHA 1G3DA 3AAVA 1WSSH 4I32A 4NZQA 4BTIB 1Z8IB 6CHAB 5FX6A 1O5FH 1XUGA 2BM2A 1C4V2 1LPKB 4ZXYH 1DWEH 2BY8X 3BEFB 4X8TH 5GIBA 1XUFA 2H5DA 1OOKB 2PTCE 1GBIA 2H1UA 1S0RA 3NZIA 3SNDA 4WH8A 1GG6C 1YF4A 1T32A 1S6FA 3AVZA 2QV1A 1E38B 1ZPZA 2FOAA 3Q3YA 3SZNA 1EASA 1PQ8A 2BQWB 1FY8E 1BTPA 1FZZA 1SOZA 1GMDG 1TPPA 2ZHEH 4KP0A 3DD2H 1W13U 2YNBA 2VIDA 2BMGB 1H9IE 1D3QB 2PKSC 4ZKSU 3EA7A 3UTUH 3ZZ4A 2IPHA 1OWEA 2A31A 2ZGHA 4H4FA 1Y5AT 1ID5H 1CA0B 3ZZ6A 1SL3A 1UJ1A 1DSTA 5LGOA 3MFJA 1C5ZB 3PB1E 1A7SA 2Y80A 3T2NA 2FOCA 1SGFG 4FU7A 2LPRA 3TH4H 2R3YA 4VGCB 1TNIA 1ZZZA 1H8DH 4NCYA 2BLVA 4BANB 4TYDA 1G3CA 1FONA 3M5LA 2BD9A 2FMJA 4JZ1A 1FAXA 1K1NA 4BAKB 1C1VH 4MPUA 1SGQE 1VITG 2BDHA 1PPCE 2O8LA 3D49H 3ZZAA 1O3KA 2ZFQH 1ELEE 1O3BA 2PGQB 3QUMP 4O9VA 3GCHC 4ASHA 1GI3A 3UR6A 1XUJA 1TNGA 3PTBA 3S69A 2VGCB 2CGAA 1FAKH 1NFXA 2OC0A 1WYKA 3KQEA 1RIWB 3SU6A 1XMNB 1ELVA 1SQOA 3H7OA 4I8JA 5EG4A 1PPZA 1LVOA 4BAQB 1P06A 2PW8H 4B71A 4HFPB 2BQ6B 3MU8A 1CVWH 3SORA 2AMQA 1NFWA 3IITA 3RXFA 1Y5UT 1UHBB 2WINI 1BRUP 1EZXC 1S81A 3EGKH 1W10U 3RLYH 1SGEE 1W12U 4BXWA 3RM2H 4B75A 1SGRE 4MNWA 2GMTB 4Y11E 2GTBA 3LGWA 1NRQH 5GCHG 3SU1A 3URDA 1VCQA 2J92A 1NPMA 1QR3E 3ZZCA 2VVUA 2BVXH 4LOYH 1DM4B 3I78A 3Q00A 2VVCA 3F1SB 2Z9GA 1NS3A 1GHBF 1GI6A 4A7IB 2GT8A 1LMWB 2OCVB 3STIA 1QB6A 8KME2 1FN6A 2QN5T 4IMQA 4AFSA 2FM2A 5ABWA 2F9NA 2ZHWH 5AHGH 1GI4A 3NKKA 2ANMH 5AF9H 1AWHB 2GDDA 1G3BA 1QJ6B 4Y7AA 3VB3A 3ODFA 1MTNB 4AOQA 2G81E 4WH6A 1AGJA 1ESBA 4XE4A 3ZZ3A 2HOBA 4NA8A 2BZ6H 4LK4A 2AH4X 3ZZ8A 1AFQB 4AX9H 3BEIB 1THPB 2ZHDA 1YC0A 2HPQH 4DOQA 1EUFA 1QURH 1EAWA 3PM3A 1AWFH 1WCZA 1K1IA 1EXFA 3S7HB 3PMAB 4E7NA 1AUTC 3LONA 4INKA 1MBMA 4WVPE 1BIOA 4Q2KA 3A7VA 1BTXA 2VWOA 4JCNA 4Z6AH 5A2MH 2EI8A 1GBCA 1MZAA 4JZIA 3TGKE 1EPTA 2BDAA 4ZROA 2ZGJA 4ABDA 2FLBH 1C1QA 2SNWA 1DT2A 3ATMA 2CF8H 3SU5A 1ZSJA 1WAYB 2JH5D 4ISHH 2OBQA 2ODYB 4X2YA 8GCHG 1O32A 1A2CH 1HCGA 3RXOA 4B2BA 1FJSA 2A7HA 5EW2H 1C2LA 2EEKA 1AZZA 2FO9A 1CHGA 3VGCB 4TWWA 3M5OA 2ZZUH 4X1NU 5T6FA 1IQMA 3GCTF 4MQAA 1O3IA 4NIVA 4CHAB 3R3GB 3TJOA 1GJ8B 1PQ5A 3A7XA 1MTWA 2WPHS 2BXUH 4B1TA 1W0YH 3B8JA 3UOUA 2PGBB 1AO5A 3RXLA 4D9QA 1O2PA 1ELDE 1OKXA 1EAIA 3HKIB 1SB1H 1P03A 2OLGA 4X8SH 1DUAA 4FUEA 3ZZBA 2R2MB 1ZGIA 1NRPH 1TONA 3RXGA 2R0KA 1GJBB 3PLKA 1GJAB 1QTFA 4E7RG 2VNTA 3B23B 3SW2B 5HYOA 1HYLA 1DWDH 1KLJH 1Y3UA 3FP6E 3GY2A 3SI4H 3ENSB 3SNEA 2FWWA 1TMBH 2V3HH 1CHOF 1ANCA 2SGFE 2OD3B 5AFZH 1FN8A 1YLCA 1TMUH 1Z8JB 1MKWH 1TB6H 2BDIA 2Q1JA 1GVLA 1HIAB 1KTSB 2J38A 3QDZB 2ODQA 2ZQ2A 4H6TA 4D9RA 2FYRA 4NZLA 4OS5A 6LPRA 1VCWA 3GCOA 4X6PA 1D9IA 2ZTZA 1TPSA 2QC2A 1IQHA 1SHHB 3KHVA 1E37B 1SOTA 3PROA 1MAYA 2CF9H 3JZ2B 4R0IA 3RMNH 2P8OC 2SFAA 4NFFA 2Y6TA 1ZMNA 2F9PA 4A6LA 2GVFA 1IQJA 1GMHF 1LHEH 1EOJA 4K8YA 1WBGB 3ZZ7A 1GJDB 4IS5A 3E0PB 1VGCC 1THRH 1CT4E 3MU0A 3MI4A 3ODDA 2W7UA 2CHAB 1FY1A 5DJ7A 5FPSA 2H6MA 2Z3EA 3TH3H 2ALPA 3NXPA 1G9IE 1HXEH 3FFGA 2G52A 4K2YA 2Z9IA 4BAOB 5C2ZA 3GDUA 3A85A 3UPEA 1K28D 1JBUH 2UUKB 4Q80A 1GJ5H 1C2GA 5A8YA 4CREA 3H5CB 1G36A 1WUNH 5EW1H 5E2PA 1A3EH 2FI4E 2P95A 3LIWA 1UTNA 4CRFA 2QF0A 2K1QA 1P05A 1SGFA 4OGXA 5EOKA 3O8CA 1HGTH 1G30B 1ZHPA 1OYTH 2EA3A 3BTME 1GVZA 2ZU3A 1EB2A 5H4IB 1UCYK 3BG4B 1GJ6A 1PFXC 1MQ5A 1YPKH 3MMGA 2PHBA 1LHGH 5SGAE 3UWIA 2BY7X 2Z6BD 1QQ4A 1OS8A 3WY8A 1TQ0B 1YBWA 3QO6A 1D3TB 1VJAU 2A1DB 3SV7A 1O5AB 2A5AA 1ABJH 1KXAA 8LPRA 2UUFB 3FP8E 2H9TH 1SHYA 1N6XA 1SVPA 1KXFA 2FESH 1O3NA 4D76A 2C3SA 3RXRA 3SU0A 1W7XH 4X1QU 2JETC 1DFPA 2AGGX 2B0FA 2ZO3H 1SPJA 4ZHMU 1BUIA 1C2IA 4I8LA 1GVKB 1P2IA 2A2QH 2ZCHP 2PSXA 4DIIH 1W7GH 3NCLA 4THNH 1QJ1B 4YTAA 1GBMA 5TJXA 4WY3A 5EODA 3K65B 4INHA 5F8XA 1YKTA 4IN1A 4B74A 1O31A 2OC1A 3F9FA 5DP9A 1QIXB 5A0AE 2A2XH 3RXTA 2ANKH 1AB9B 3A89A 1O2WA 1SSXA 1HDTH 4CRBA 4I31A 5L6NH 5HXFA 5J4QA 3VB7A 3UR9A 4CH8B 2J4IA 2TBSA 1NRRH 1HB0B 4MNVA 5EXNA 2GZ8A 1OWJA 4FUBA 3U9AH 2DUCA 1C4U2 3D23A 1NTPA 2ULLA 1C5SA 3LOXA 4FVDA 3A8DA 4CBOA 1Y3XA 2VU8E 3BTKE 3PO1C 2UUYA 2WUCA 1YPMH 2ZKSA 5ESBA 3S9AA 3SHCH 1A0JA 2ZPSA 5TCAA 3K2UA 3T29A 2BHGA 4XOJA 1NM6A 3VB4A 2WV4A 1GBLA 2G4UA 2FDAA 1TALA 2WYJA 4NA9H 4AFZA 4FUHA 4YOGA 1TE0A 2J9NA 1Z1JA 2WPJS 3MU4A 1HAPH 1YPGH 1O2NA 1HV7A 1GHBG 4TPYA 1GHVH 2Z94A 2R3UA 4X2WA 4AYVB 2GD4B 5EQQA 4A92A 2OUAA 1S83A 1E35B 1EATA 1G32B 2BVRH 2WV5A 3RMLH 3V0XA 2Z9LA 1BTUA 1CSOE 1AVGH 2VIOA 2G51A 4U32A 1UVUH 1D6WA 2BD7A 3ZVAA 1GGDC 1SGYE 3M35A 4YOJA 1GI8B 3VB5A 2ZTYA 3O8BA 5FBIA 3TVJB 1K1JA 1BDAA 2G55A 1RGQA 1P9SA 2HNTE 4AB9A 2QXJA 3MU1A 3KL6A 4YLUA 1AKSA 1WOFA 2GCTC 2ZEBA 3ZZDA 4UDWH 3PWBA 1O36A 4Y76A 4ABIA 3MO3A 1LPZB 1SC8U 5HGGA 3BTHE 3STJA 3NWUA 4IBLH 3RMOH 1ELCA 2XW9A 1TBZH 3VXEH 1BHXF 2I6SA 1YCPH 1BBRH 5DP8A 1VR1H 2V6NA 1N8OC 4DW2U 3PLPA 1P04A 3O8RA 1E36B 7KMEH 3C1KA 1VZQH 2ESTE 2PSYA 1O5DH 3K6ZA 3RXEA 3MYWA 2ZIQH 4BTTB 1O34A 1C4Y2 2RCEA 1OSSA 1CBWC 1FY4A 3RLWH 1IQIA 1Y8TA 1UTJA 3M3VA 1YM0A 4TPIZ 1L1GA 4Y79A 3U1JB 1A5HA 1PPEE 2C8XB 1C5MD 4WWYA 1LTOA 3SJIA 1V2ST 1TMTH 1AD8H 1EPTB 2BB4A 3GCTG 2BX3A 5HM9A 1JOUB 3RXIA 1O30A 4ZHLU 2BD3A 4K8BA 5CHAB 1SFIA 3GY4A 3QTVH 3ZZ5A 3T25A 1JRTA 1AN1E 1OPHB 4X8UH 1MKWK 2STAE 2RDLA 1L2EA 1GCTC 1CT0E 1GMCF 4K60A 2HRVA 2ILNA 2P3TB 2XRCA 3EA8A 1FDPA 3BG8A 1KY9A 1KLTA 2OTVA 3I29A 3PMBB 1WV7H 1O37A 4Q7YA 2F9VA 2PV9B 3K6YA 3V7TA 3ZVDA 5A0CA 6ESTA 1V2JT 2GZ7A 1CHOG 2VH6A 2OINA 2ZP0H 3HGNA 3QZQA 5L2ZH 1DLEA 1A0HB 3VPKA 1OWKA 1GBAA 3P6ZB 1DWBH 1KXDA 2FIRH 1Z8RA 3F9EA 1QA7A 3QX5H 1B0EA 2XWAA 1JIRA 4NWKA 7ESTE 3A80A 1O33A 2FOFA 1UK4A 1B7XB 1C2HA 2ZI2H 1GMHG 1TRNA 1BB0B 2BXTH 1EZUC 4X1PU 1T8NA 3LKWA 4JK6A 1FMGA 3UFAA 5AVDA 1MKXH 1CU1A 3PYHA 4ESTE 4LZ4B 3A86A 2I6QA 2F83A 3ITIA 4NIYA 1A46H 4LZ1H 2ZF0H 3HPTB 4Y8ZA 1ETRH 1T31A 1ABIH 4Y71A 2V0BA 3KEEA 3A87A 5C1XA 2DE9A 2QIQA 4KTUA 1AMHA 2GX4A 3UNRA 1ZHMA 1UVTH 4R8TB 4ABAA 1PPHE 3E16B 1QB1A 1NFUA 2VIQA 4HTCH 2F3CE 3FZDA 2Y82A 5E0HA 5GPIB 5DP3A 1DITH 3W94A 1C1OA 2HWLB 4Y10E 1KDQB 4QT8C 4JZFH 2ZQ1A 1C2KA 2PLXA 3ZVEA 2FS9A 2GZ9A 5LPRA 1NRSH 4Q7XA 4WF8A 1GL0E 2AERH 1BRBE 4ZHAA 1B5GH 3EYDA 4UONA 2G8TA 2GV6A 1K22H 2OC7A 2HLCA 3M5NA 1IQNA 1FPHH 1TIOA 7GCHG 4MVNA 3S9CA 1FIZA 1IHTH 1OXGA 3S7KB 2F9UA 4YESB 5EXMA 2HVXA 2ZGCA 1F5LA 4XSKU 1C1SA 4ZKOU 2FPZA 1HJAC 2EI7A 1HBTH 1KTTB 2OQUA 1TYNA 1T8LA 1J17T 1UMAH 3C27B 2NU1E 5F8TA 4JMYA 1QA0A 5C5NA 1HAVB 1W8BH 1XVMA 1G37A 4IN2A 1YPHC 3RUOA 2ZFRH 3MH6A 2H9HA 4FUFA 1IQGA 1Z1IA 6CHAC 1V2QT 2V3OH 3L3TA 1O2LA 2ZDVH 1OX1A 1C2FA 2PWXA 3TH2H 1IQKA 1VCPA 2AMDA 1PPBH 4E05H 3E8LA
chains in the Genus database with same CATH superfamily
1T7CA 2TGDA 3BV9B 2AEIH 4CBNA 1OYQA 1LHCH 1EJAA 4YLQH 2JKHA 2YMSD 1HJ9A 1TX8A 4WXIA 3LH1A 5J4SA 2SGAA 1YYY1 2AGEX 2ZFTA 2YMSB 4AFUA 1XXDA 2W6ID 1RTKA 2WZQA 3A7WA 4BAHB 2JJ1D 4YXWD 1FUJA 1TFXA 4NFEA 3MNCA 1DANH 4X0WU 2O8MA 4AG1A 4P02A 3NUMA 1GHAG 2BY6X 1O2UA 1WQVH 3SU2A 1C5OH 1A61H 2V35A 1ANDA 2D2DA 4JYVH 1LVBA 3T62A 1P9UA 4B73A 3L33A 4GCHF 1HNEE 1GBDA 2BD8A 4U2WA 3OTPA 4DT4A 1C1UH 1HLTH 1E1RD 1TGCA 2BZAA 1ZLRA 3KQDA 3TK9A 1EJMA 1CA0C 7LPRA 4I8GA 1ELBA 4ZUHA 1L4DA 1OP0A 1QRWA 2A7JA 1O2SA 1TOMH 1TPAE 1XKBC 4UFEH 4VGCC 4XBBA 4JK5A 3P70B 2FX6A 3SGBE 3TJNA 4X2XA 1YGCH 3M36A 3SNCA 3W95A 5DP7A 5JB9S 1C5YB 4Q63A 3SV9A 3U8RH 1M9UA 1SQAA 1C5RA 1EZQA 1BBRK 1GBFA 1UCYE 4ZH8A 3TK6A 2C93B 3BTQE 4HGCA 3OX7U 2WUBA 3RP2A 2A4GA 1O3LA 1AVXA 4RN6A 2J94A 2ZG0H 1C5VA 1DICA 1L4ZA 3M61U 1RTLA 3RU4E 1D3PB 2ZU2A 1YPJH 4GVUA 1SGCA 2NU4E 5JYIA 3R0FA 1S84A 2HPPH 3L6PA 1FY3A 1RIWC 1ZR0A 1K2I1 2FOBA 4Y0ZE 4CRGA 1O5EH 4AYYB 1UTOA 1DUEA 1O2RA 1SFQB 1ZTJA 1KXCA 2TPIZ 3CS7A 1G2MA 3QK1A 3ZVFA 2SGEE 5HKKD 3V3MA 4GSOA 1CGHA 1TGNA 2ZFSA 1AKSB 4X6MA 5GXPA 2W6JD 3GICB 3DSPA 2KM0A 1T4VH 2C8YB 1GJ4H 3KIDU 5T6DA 4AFQA 5C3NA 1C1TA 1PJPA 1KXEA 2BLQA 2P94A 1TNJA 4KTCA 1ETTH 1UTKA 3EE0B 2EQNA 5EQRA 4DIHH 5AFYH 1NROH 4NGAH 3G01A 2Q6GA 1IOEA 3GY7A 3H7TA 2WPKS 3SUEA 2GMTC 4A1VA 3RXHA 4JZEH 2OXSA 4I8HA 4Y8XA 1SBWA 4A1TA 4NWLA 3K9XB 4X6OA 4SGAE 2HVYB 1XX9A 1V2UT 2ZCLP 3BF6H 1E1QD 4OS4A 1O38A 3F9GA 1ZSKA 4H42U 3SNBA 1MD7A 3E6PH 2CMYA 3DSGA 3BIVH 1EX3A 2D8WA 1BTHH 3HGPA 2M5TA 1QBNA 3W1EA 4WMEA 1TX7A 4K3JA 5K7RA 2SGQE 3TNSA 4F49A 1KDQA 2XC4A 1AFQC 1B0FA 2AMPA 1UTQA 1RFNA 2W3IA 3JZ1B 2KAIB 4DVAU 1GI7B 1Y5BT 2NU3E 5TCCA 3HK3B 3SU3A 3KYFA 3D62A 3CS0A 3F6UH 2ZA5A 3QGJA 1RXPA 3URCA 3PRBA 2ZCKP 2FI3E 3FKSD 2FODA 1GI1A 3P17H 1CT2E 4YT7H 5DKMA 3LGYA 2BY5X 1AVWA 1DWCH 1O5CB 2R2WU 1WQSA 1NBME 9LPRA 1V6DA 1ZSLA 4ISOA 3AASA 1ZPCA 3ZV9A 3SYJA 4ABHA 3UQOA 3P8NA 2UWPA 1V2TT 1FNIA 2SGDE 1C1WH 1HAVA 1QHRB 1BCUH 3FP7E 3ZVCA 3BTWE 2FI5E 1V2KT 1LO6A 1QCPA 1NN6A 2PKAA 4ZAEA 1O3DA 1V2PT 2KCOA 2ZDKA 4JZDH 1XKAC 2ZDNA 4FXGH 1J9CH 2OP9A 8ESTE 3VGCC 3ZZ9A 2AIQA 1Z7KA 4GHQA 4D7FA 2XBXA 1LVMA 4MPVA 2JH0D 1MCTA 1O3FA 1P0SH 4CHAC 4I7YH 3A7YA 1FV9A 1D3DB 2ASUB 3SHAH 4ABFA 4I8KA 4X8VH 3SUFA 2C8WB 3A82A 1WU1A 2P16A 1IQLA 3A84A 3F9HA 1O2MA 2WYGA 3QZRA 3ATLA 4XD7D 3ZVGA 4F48B 4JYTA 2FTMA 2B9LA 3A7ZA 5EXLA 1TGSZ 1XVOA 2GV7A 4NA7A 4Y7BA 1EJNA 4RKOB 5BRRE 1ZGVA 1MMJN 2BQ7B 1O2TA 5JPMH 1O2XA 1LQDB 2ZPRA 4YO9A 1VJ9U 4AZ2B 3E3TA 1OWIA 2VWLA 3BEUA 4UFGH 1TABE 5C1YA 5B6LA 1A5GH 5LPFA 1GG6B 5FL7D 2FZZA 1O2GH 3MWIU 3A7TA 2ZWLH 5F8ZA 2ZDMA 1DSUA 1E0FD 4BNRA 1WTGH 5FCRA 2VJ1A 2FXRA 3KQCA 4MNXA 2ALVA 1W14U 3ATKA 3MHWU 1Z8GA 2Q6FA 1P02A 3Q3XA 1MTUA 3KF2A 4IC6A 1UTPA 2QCYA 3DA9B 2XBWA 1GI2A 1NZQH 4U30A 4FUJA 1C5PA 2W26A 1O35A 3MH5A 2FTLE 1AE8H 1FI8A 1P2NA 2PKSB 2R9PA 1A4WH 3ZYEA 1HFDA 3QGNB 4OM9A 1O3GA 1A5IA 4RKJB 3PV4A 2BOKA 3HATH 2ZNKH 1ARCA 1NT1A 2IJOB 2CHAC 3RXMA 2QF3A 1AY6H 4MPWA 1LHDH 3RXAA 2O8WA 3OSYA 4K1SA 1BTWA 1UVOA 5E8EH 2A0QB 2Z9KA 2XC0A 2BLOA 2PR3A 2PUQH 1J15A 1P3EA 2VWMA 1XXFA 1C5LH 3MH4A 2XWBI 2A4QA 4WMFA 3RXDA 3A81A 3P8GA 3GY6A 1GPZA 3BTFE 5JDUB 2W3KA 1BTYA 3GCHB 1C2EA 5E0JA 1KXBA 1V2MT 3TIUA 3BIUH 4MPXA 1QBVH 1O5GH 3DHKH 1BOQA 5DP6A 1H9HE 2ZGXH 3M37A 1H9LB 2ZHFH 1F2SE 2XTTB 1EP6A 1O2YA 3GDVA 1A0LA 4B2CA 1E34B 3FANA 3BG4C 3HKJB 5CHBA 2TIOA 4ABJA 2G5NA 1D4PB 1MZDA 4GUXA 2Y5FA 3GDSA 2ZDAH 1TBQH 3RU4D 1NFYA 3OFND 3LJJA 3SUDA 4RSPA 4GCHG 1ZJDA 1P12E 1S85A 5GDSH 3EQ0H 2F4LA 1GBHA 2P3UB 2QF4A 4X6NA 5EPYA 5C1UA 1SGTA 1EB1H 2CN0H 4I33A 3U69H 2XBYA 1NU9A 1P2QA 1Y59T 5EJ1A 1CO7E 3M5MA 3S9BA 1O2IA 3M3SA 1NESE 1V2OT 2KAIA 1V2LT 4AB8A 1TGTA 1SG8B 1TNLA 3TJUA 4TWYA 1P8VC 5EGMA 1UO6A 3TPIZ 2Y5GA 2HGTH 2AYWA 3LGVA 4YOIA 4NG9H 2A32A 4MTBA 5JBBS 1QNJA 3Q3KA 4ZXXH 2WPIS 3QWCH 2C90B 1J16A 1TA2A 1BRAA 4DGJA 3M7QA 1OWDA 2XYAA 4ABEA 3RXSA 5FXLA 3A8BA 2Y7XA 4FVBA 4NSVA 1A1RA 2O8TA 2JH6D 1MTSA 1QFKH 5LPEA 2FP7B 1CA8B 1CGJE 3ATIA 4UEHH 1AB9C 2VIPA 1NRNH 3IWMA 2ZU5A 1ORFA 4OS7A 4J2YB 1L1NA 3TU7H 5DG6A 2BYAX 1N6YA 3TLOA 2GGVB 3SI3H 5EPNA 4AGJA 3MU5A 1W0JD 5IDKA 1W11U 2XXLA 5F6MA 1ZHRA 3V13A 4TY7A 2TRMA 2ZECA 1IAUA 3A83A 3RC5A 3RM0H 1GJ7B 4DURA 2FOEA 3LGIA 2RFKC 5C5OA 2PFEA 1Y3WA 4KELA 5F03A 4MG3A 2B7DH 2EI6A 4RT1A 2GDEH 4FUGA 1W0KD 2IOTA 1KLIH 3QTOH 2YNAA 3RMMH 2Y7ZA 3MNBA 4XBCA 1QGFA 3AW1A 1V2RT 1T4UH 3T5FH 4IGDA 5C17A 1HAHH 1C2JA 1ZJKA 2O8UA 1F92A 3E90B 1FIWA 4B76A 3TITA 3D65E 2CJIA 4IMZA 4CH2B 1NBMD 1ESTA 1MD8A 2FX4A 4MDSA 5FX5A 1GBKA 1DY9A 3ZYDA 1UCYH 4OGYA 1TOCB 1AHTH 1EOLA 3T28A 1O5BB 2HALA 2VB0A 1P09A 1TBRH 3DFLA 3E0NB 1P2MA 3PMJA 1CGIE 1CE5A 1QY6A 4FUIA 2BDGA 3TK5A 1GJ9B 3GISB 3T27A 1Q31A 2UUJB 1XM1A 1UVSH 4X1RU 4AG2A 1TAWA 1BMLA 5A8XA 1ZPBA 5C0UA 3UAIC 1HJ8A 1EAUA 2ZPQA 3UWJH 2RA3A 5L30H 4INLA 3MTYA 1EP5A 4IW4E 3SBKA 1BTZA 1QL9A 1F7ZA 1ZOMA 1OHHD 2IN2A 2C8ZB 3MH7A 1P11E 1C2MA 3P92A 1DLKB 5FHTA 3RXBA 1N1LA 5E0GA 1PQ7A 2A45B 3U8OH 2XNDD 4M7GA 5PTPA 4YT6H 1HAXB 3OE7D 1O3EA 1OP8A 1SGNE 2NU0E 2Z9JA 3OU0A 1P2JA 5FAHA 2NU2E 1K0HA 1ELAA 3CP7A 1PPFE 4GHTA 1LKBA 1TNKA 4ISIH 5JBCS 1QJ7B 1GBTA 3MNXA 1JWTA 2QF5A 2AGIX 1W2KH 3P8OA 1Q3XA 2P8OB 3GCNA 1BBRE 1ETSH 2P3FH 2A5KA 1LPGB 3GY5A 1O3MA 4FETA 2QAAA 1QB9A 1UVPA 5IYTA 3M7UA 3FVFB 1S5SA 2A4OA 1EPTC 1YCPM 1W0ZU 3SU4A 5A09A 1OWHA 1DXPA 1VGCB 5GWZA 3KNXA 3RXVA 3KCGH 3SN8A 3FO8D 2FOHA 1MU8B 4K5ZA 3RC6A 1V2VT 5CHAC 1H8IH 1ARBA 1IQFA 3HK6B 3VB6A 2PKAB 1HPGA 1RRKA 2OC8A 2XCNA 4UFDH 5A0BA 4O3UA 1S6LA 1XUKA 2YOLA 2UWLA 1ZYOA 1S6HA 3LGUA 1MU6B 1AZ8A 2M2AA 3TGJE 2TGPZ 6GCHF 2ZU1A 5DO4H 1O0DH 4FU9A 5E2OA 1SLVB 3EA9A 2BDCA 4GPGA 4IC5A 3IG6B 1GDUA 1GWAA 3OAAD 1PYTD 2GT7A 2PP6A 1C5NH 3GYLB 1BJUA 1BT7A 1BA8B 3LPRA 4F4OC 4F55A 5I46H 1RS0A 1TLDA 2BVSH 3LJOA 3ZIAD 1JIMA 1NU7B 4DT7B 1O2VA 1KIGH 1F0TA 3FOAA 4GAWA 1MCVA 2K8IA 1GI5A 3KN2A 2GCHF 5HMAA 5K0HA 3VG8A 1NO9H 1BMNH 1O3JA 3ATWA 2FOGA 2Q6DA 4FUDA 4DG4A 1K1OA 5FPYA 3F2HA 4Y6DA 1S82A 4LXBH 1K1LA 1IQEA 1RD3B 1PPGE 3LC3A 1FPCH 4AGKA 4BAMB 3BTDE 2GP9B 1AU8A 2VH0A 2UWOA 2ZTXA 1SQTA 3P8FA 5T3HA 2B5TB 1DS2E 4CR9A 2WPLS 2V7QD 1AUJA 1TX6A 4AC9A 3PMHB 3S0NA 2QYIA 4Z1MD 2Z3CA 1ZTLA 4Y8YA 2ODPA 1AE5A 2XCFA 2JETB 3PLBA 1GHXH 3BTTE 1SLXB 1KMHB 1O3OA 4FOUC 1C5UA 1INCA 1YCPK 2BDBA 3OYPA 1H1BA 1NC6A 1GJCB 1VITH 1C5QA 2VVVA 1P01A 1TRMA 4NIWA 5HIYA 1DOJA 3RXUA 1QRZA 2QGRA 2VGCC 4HI3A 1HRTH 1FQ3A 2J34A 1ELTA 3TJVA 1UTMA 3UUZA 3VXFH 3EAJA 1ANBA 3SV8A 5FBEA 1IHSH 4AN7A 1Y3VA 4YM9A 2VIWA 1SLWB 2BTCE 4B2AA 4BOHA 3UQVA 1O2JA 1DVAH 2PTNA 4H6SB 1BITA 2BLWA 3O8DA 4U01A 1HXFH 1MH0A 2ZFPH 4UFFH 1C5TA 2NWNA 2QA9E 2BY9X 1G2LA 5DP5A 3RU4T 5A8ZA 2AHME 2AFQB 3ESTA 3F2GA 2A4RA 1HAOH 1O3CA 4DY7B 3SQEE 1Z6EA 2B8OH 1LCYA 1MBQA 1O2OA 1SLUB 4XBDA 2FS8A 2ZFFH 4A1XA 3M3TA 2DE8A 3MOCA 4K1EA 1LQEA 1MUEB 2QY0B 1O39A 4K69A 1BJVA 3PO1B 3UOPA 3N7OA 1TNHA 5EQSA 1LKAA 3B9FH 4MNYA 4O03A 1JMOH 4CRCA 1DDJA 4I86A 1QZ8A 1GMDF 3AW0A 1LDTT 1SGIB 1NY22 2VWNA 1K1MA 3MNSA 2FLRH 1YPHE 2RA0A 2EC9H 1GBJA 1HAYB 2ZDLA 1D6RA 4PROA 4Z0KA 3BSQA 4D8NA 5BPEA 1FX0B 4X2VA 1XUIA 1K1PA 2ZHQH 1T8MA 1GBBA 3CENA 1C1MA 1LHFH 4BXSA 4DCDA 3RDZA 4ISNA 5DP4A 1ELGA 1MTVA 2BD2A 2OQ5A 1EQ9A 3BTGE 1C2DA 3PWCA 4AORA 1MTNC 4WXVA 1GMCG 3DSOA 1HAZB 5G4BA 3EDXB 3SZEA 4A5TS 5CMXH 3V12A 1YPLH 1GHZA 1GGDB 3PTNA 2W7SA 1CQQA 1BHXB 1VITF 1UW7A 1SI5H 2VINA 4XDEA 4WJG2 1K9OE 1AFEH 1YY3A 1MQ6A 3LT3A 1ESAA 1GL1A 5EU8A 3PV2A 1BRCE 2GKVE 4BTUB 1F5KU 4OS2A 3BTEE 1THSH 2AS9A 2R0LA 3DT0H 1C5WB 1V2WT 1MKXK 1RJXB 1ZMLA 1UHBA 5ETXA 3UNQA 3BN9A 1YLDA 1P2KA 1TWXB 2STBE 3H09A 2GCTB 2H2ZA 5FPTA 3GY3A 1K21H 1TPOA 4O3TA 3FZZA 3SUGA 3LC5A 2SGPE 1PYTC 4CRDA 2BD4A 2ZU4A 2F43B 1GI9B 2LNCA 2YMSC 2CV3A 3UNSA 1BZXE 5I25A 1TA6A 5B6OA 1HAIH 1L0ZA 3SJOA 3LDXH 1F0RA 2C4FH 2PUXB 1C5XB 1DPOA 2HNTC 1P2OA 4FU8A 1N8OB 3T26A 3F0OA 1AQ7A 4FUCA 1Y3YA 3RXKA 1T8OA 1TRYA 4WMDA 3UIRA 4DJZB 2G00A 4Q7ZA 4D7GA 3FN8A 1SGPE 3SQHE 1DXWA 3UY9A 1OP2A 1CBWB 4B6EA 5C67A 5GCHF 1XUHA 3SGQE 1YLNA 7GCHF 1EZSC 3KGPA 1F0SA 2XC5A 3MO6A 1RTFB 5ESTE 3GYMA 1LVYA 1EKBB 4HZHA 2QXIA 1C1NA 2XNIA 3A8AA 1KYNA 1O3HA 1P3CA 2THFB 2A7CA 1C9TA 2HNTF 4NIXA 4YZUA 2F91A 4OS1A 2FOMB 5DGJA 1EAXA 4ISLA 4Y0YE 2ZC9H 3Q77A 3E1XB 3U1IB 1ZRBA 3QLPH 1BMMH 2ZGBH 1GCTB 3A8CA 3A88A 1KSNA 4NSYA 2H5CA 4O97A 5JBTA 1O2HA 3U98H 1V2NT 3LGTA 3SNAA 3VFEA 5LH8A 2TGAA 5DPAA 1TQ7B 3RXJA 3NPSA 1HUTH 4ABGA 4ZMAH 1A3BH 3PV5A 5JB8S 4TY6A 3RXPA 3DFJA 5GJ4B 1BMAA 2Z7FE 1GCDA 1O3AA 1C9PA 4CRAA 2FEQH 2WPMS 2AIPA 3RC4A 3SJKA 1UTLM 1JRSA 1W3CA 2Z3DA 4KGAA 4ZKRU 1ELFA 1AIXH 2P59A 4J1YA 3NK8A 2J95A 3I77A 4ZKNU 2CXVA 5FCKA 3DUXH 2Y5HA 2XBVA 5C20A 1AI8H 3UREA 1MAXA 4SGBE 1GHAF 2W5EA 4KKDA 1GDQA 1QL7A 3OEED 3KQBA 8GCHF 1ZMJA 4UD9H 2D1JA 4B6FA 3RXCA 1U6QA 1ZRKA 3LH3A 3ZV8A 2KFWA 3ZVBA 1Z6JH 4K1TA 1P57B 3OY6U 1YP9A 3SJ9A 3TGIE 3RXQA 1TGBA 2OBOA 1GHWH 1J8AA 3M7TA 5DK1A 3U8TH 3SOSA 2BD5A 5JBAS 1SGDE 1O2ZA 6GCHG 1SQRA 1Z71A 1C1PA 4GLYA 4M9FA 3OTJE 1ACBE 2TGTA 1DY8A 5L2YH 9ESTA 1S0QA 1HAGE 1WTHD 2J2UA 2VIVA 1FLEE 4XFQA 1H4WA 1PQAA 1F0UA 1DE7H 1HIAA 1SMFE 3SO3A 5CE1A 1ANEA 1JXPA 1O2KA 2P93A 1GHYH 2G5VA 1O2QA 2BOHB 1BQYA 1C1RA 3QN7A 2GCHG 2RG3A 3DCLA 4MLFB 5HM2A 1P10A 3P95A 1X7AC 2SNVA 1QRXA 2ANYA 2FYQA 2F9OA 2BDYA 4UE7H 1UK2A 2V3MA 1L1JA 1V3XA 2F9BH 1Q2WA 1UK3A 3MO9A 3F68H 3FAOA 1FY5A 1F5RA 2H9EH 4OS6A 1VKYA 2QXGA 1ZTKA 1FXYA 3AK5A 1DX5M 3ELAH 1GI0A 2BX4A 3GY8A 3SJ8A 2JJ2D 3SGAE 1J14A 1O3PB 1GBEA 2ANWA 3GOVB 3SV2H 3Q76A 4KTSA 1QBOA 2O9QA 3SV6A 4ABBA 4X1SU 4RT0A 1YPEH 1HJAB 5KECA 2Y81A 5T6GA 1SR5C 3KYGA 2G4TA 3TNTA 1GDNA 3OY5U 3AAUA 1G3EA 4CR5A 4JYUH 4E06H 1QQUA 2A5IA 3E91A 4P00A 3LU9B 1QL8A 2D26C 3VEQB 2QXHA 1G3DA 3AAVA 1WSSH 4I32A 4NZQA 4BTIB 1Z8IB 6CHAB 5FX6A 4ACAA 1O5FH 1XUGA 2BM2A 1C4V2 1LPKB 4ZXYH 1DWEH 2BY8X 3BEFB 4X8TH 5GIBA 1XUFA 2H5DA 1OOKB 2PTCE 1GBIA 2H1UA 1S0RA 3NZIA 3SNDA 4TSFD 4WH8A 1GG6C 1YF4A 1T32A 1S6FA 3AVZA 2QV1A 1E38B 1ZPZA 2FOAA 3Q3YA 3SZNA 1EASA 1PQ8A 2BQWB 1FY8E 1BTPA 1FZZA 1SOZA 1GMDG 1TPPA 2RDEA 2ZHEH 4KP0A 3DD2H 1W13U 2YNBA 2VIDA 2WHXA 2BMGB 1H9IE 1D3QB 2PKSC 4ZKSU 3EA7A 3UTUH 3ZZ4A 2IPHA 1OWEA 2A31A 3U28C 2ZGHA 4H4FA 1Y5AT 1ID5H 1CA0B 3ZZ6A 1SL3A 1UJ1A 1DSTA 5LGOA 3MFJA 1C5ZB 3PB1E 1A7SA 2Y80A 3T2NA 2FOCA 1SGFG 4FU7A 2LPRA 3TH4H 2R3YA 4VGCB 1TNIA 1ZZZA 1H8DH 4NCYA 2BLVA 4BANB 4TYDA 1G3CA 1FONA 3M5LA 2BD9A 2FMJA 4JZ1A 1FAXA 1K1NA 4BAKB 1C1VH 4MPUA 1SGQE 1VITG 2BDHA 1PPCE 2O8LA 3D49H 3ZZAA 1O3KA 2ZFQH 1ELEE 1O3BA 2PGQB 3QUMP 4O9VA 3GCHC 3WWFA 4ASHA 1GI3A 3UR6A 1XUJA 1TNGA 3PTBA 2KX4A 3S69A 2EY4C 2VGCB 2CGAA 1FAKH 1NFXA 2OC0A 1WYKA 3KQEA 1RIWB 3SU6A 1XMNB 1ELVA 1SQOA 3H7OA 4I8JA 5EG4A 1PPZA 1LVOA 4BAQB 1P06A 2PW8H 4B71A 4HFPB 2BQ6B 3MU8A 1CVWH 3SORA 2AMQA 1NFWA 3IITA 3RXFA 1Y5UT 1UHBB 2WINI 1BRUP 1EZXC 1S81A 3EGKH 1W10U 3MQKC 3RLYH 1SGEE 3GS9A 1W12U 4BXWA 3RM2H 4B75A 1SGRE 4MNWA 5EIYA 2GMTB 4Y11E 2GTBA 3LGWA 1NRQH 5GCHG 3SU1A 3URDA 1VCQA 2J92A 1NPMA 1QR3E 3ZZCA 2VVUA 2BVXH 4LOYH 1DM4B 3I78A 3Q00A 2VVCA 3F1SB 2Z9GA 1NS3A 1GHBF 1GI6A 4A7IB 2GT8A 1LMWB 2OCVB 3STIA 1QB6A 2J5UA 8KME2 1FN6A 2QN5T 4IMQA 4AFSA 2FM2A 5ABWA 2F9NA 3F2FA 2ZHWH 5AHGH 1GI4A 3NKKA 2ANMH 5AF9H 1AWHB 2GDDA 1G3BA 1QJ6B 4Y7AA 3VB3A 3ODFA 1MTNB 4AOQA 2G81E 4WH6A 1AGJA 1ESBA 3F0PA 4XE4A 3ZZ3A 2HOBA 4NA8A 2BZ6H 4LK4A 3WWBA 2AH4X 3ZZ8A 1AFQB 4AX9H 3BEIB 1THPB 2ZHDA 1YC0A 2IJD1 3KQ5A 2HPQH 4DOQA 1EUFA 1QURH 4TT3D 1EAWA 1BMFD 3PM3A 1AWFH 1WCZA 1K1IA 1EXFA 3S7HB 3PMAB 4E7NA 1AUTC 3LONA 4INKA 1MBMA 4WVPE 1BIOA 1MABB 4Q2KA 3A7VA 1BTXA 2VWOA 3N7EA 2KZ4A 4JCNA 4Z6AH 2JDID 5A2MH 2EI8A 1GBCA 1MZAA 4JZIA 3TGKE 1EPTA 2BDAA 4ZROA 2ZGJA 4ABDA 2FLBH 1C1QA 2SNWA 1DT2A 3ATMA 2CF8H 3SU5A 2CK3D 4ZCNA 2KCAA 5KEDA 1ZSJA 1WAYB 2JH5D 4ISHH 2OBQA 2ODYB 4X2YA 3EE7A 1O32A 8GCHG 1A2CH 1HCGA 3RXOA 4B2BA 1FJSA 2A7HA 5EW2H 1C2LA 2EEKA 1AZZA 2FO9A 1CHGA 3VGCB 4TWWA 3M5OA 2ZZUH 4X1NU 5T6FA 1IQMA 3GCTF 4MQAA 1O3IA 4NIVA 4CHAB 3R3GB 3TJOA 1GJ8B 1PQ5A 3A7XA 1MTWA 2WPHS 2BXUH 4B1TA 1W0YH 5C0TA 3B8JA 3UOUA 2PGBB 1AO5A 3RXLA 4D9QA 1O2PA 1ELDE 1OKXA 1EAIA 3HKIB 1SB1H 1P03A 2OLGA 4X8SH 1DUAA 4FUEA 3ZZBA 2R2MB 1ZGIA 1NRPH 1TONA 3RXGA 2R0KA 1GJBB 3PLKA 1GJAB 1QTFA 4E7RG 2VNTA 3B23B 3SW2B 5HYOA 1HYLA 1DWDH 1KLJH 5DSFA 1Y3UA 3FP6E 3GY2A 3SI4H 3ENSB 3SNEA 2FWWA 1TMBH 2V3HH 1CHOF 1ANCA 2SGFE 2OD3B 5AFZH 2KCYA 1FN8A 1YLCA 1TMUH 1Z8JB 1MKWH 1TB6H 2BDIA 2Q1JA 1GVLA 1HIAB 1KTSB 2J38A 2GJGA 3QDZB 2ODQA 2ZQ2A 4H6TA 4D9RA 2FYRA 4NZLA 4OS5A 6LPRA 1VCWA 3GCOA 4X6PA 1D9IA 2ZTZA 1H8ED 1TPSA 2QC2A 1IQHA 1SHHB 3KHVA 1E37B 1SOTA 3PROA 1MAYA 2CF9H 3JZ2B 4R0IA 3RMNH 2P8OC 2SFAA 4NFFA 2Y6TA 1ZMNA 2J97A 1COWD 2F9PA 4A6LA 2GVFA 1IQJA 4XRNA 1GMHF 5F53A 1LHEH 1EOJA 4K8YA 1WBGB 3ZZ7A 1GJDB 4IS5A 3E0PB 1E79D 1VGCC 1THRH 1CT4E 3MU0A 3MI4A 3ODDA 2W7UA 2CHAB 1FY1A 5DJ7A 5FPSA 2H6MA 2Z3EA 3TH3H 2WPDD 2ALPA 1WXRA 3NXPA 1G9IE 1HXEH 3FFGA 2G52A 4K2YA 2Z9IA 4BAOB 5C2ZA 3GDUA 3A85A 3UPEA 1K28D 1JBUH 2UUKB 4Q80A 1GJ5H 1C2GA 5A8YA 2OK5A 4CREA 3H5CB 1G36A 1WUNH 5EW1H 5E2PA 1A3EH 2FI4E 2P95A 3LIWA 1UTNA 3N99A 4CRFA 2QF0A 2K1QA 1P05A 1SGFA 2IPQX 4OGXA 5EOKA 3O8CA 1HGTH 2J98A 1G30B 1ZHPA 1OYTH 2EA3A 1H8HD 3BTME 1GVZA 2ZU3A 1EB2A 5H4IB 1UCYK 3BG4B 1GJ6A 1PFXC 1MQ5A 1YPKH 3MMGA 2PHBA 1LHGH 5SGAE 3UWIA 2BY7X 2Z6BD 1QQ4A 1OS8A 3WY8A 1TQ0B 1YBWA 3QO6A 1D3TB 1VJAU 2A1DB 3SV7A 1O5AB 2A5AA 1ABJH 1KXAA 8LPRA 2UUFB 5GNDA 2WSSD 3FP8E 2H9TH 1SHYA 1N6XA 1SVPA 1KXFA 2FESH 1O3NA 4D76A 2C3SA 3RXRA 3SU0A 1W7XH 4X1QU 2JETC 1DFPA 2AGGX 2B0FA 2ZO3H 1SPJA 4ZHMU 1BUIA 1C2IA 4I8LA 1GVKB 1P2IA 2A2QH 2ZCHP 2PSXA 2WV9A 4DIIH 1W7GH 3NCLA 2HLDD 2L74A 4THNH 1QJ1B 4YTAA 1GBMA 5TJXA 4WY3A 5EODA 3K65B 4INHA 5F8XA 1YKTA 4IN1A 4B74A 1O31A 2OC1A 3F9FA 5DP9A 1QIXB 5A0AE 2A2XH 3RXTA 2ANKH 1AB9B 3A89A 1O2WA 1SSXA 1HDTH 4CRBA 4I31A 5L6NH 5HXFA 5J4QA 3VB7A 3UR9A 4CH8B 2J4IA 2TBSA 1NRRH 3PRDA 1HB0B 4MNVA 5EXNA 2GZ8A 1OWJA 4FUBA 3U9AH 2DUCA 1C4U2 3D23A 1NTPA 2ULLA 1C5SA 3LOXA 4FVDA 3A8DA 4CBOA 1Y3XA 2VU8E 3BTKE 3PO1C 2UUYA 2WUCA 1YPMH 2ZKSA 5ESBA 3S9AA 3SHCH 1A0JA 2ZPSA 5TCAA 3K2UA 3T29A 2BHGA 4XOJA 1NM6A 3VB4A 2WV4A 1GBLA 2G4UA 2FDAA 1TALA 3CNRA 2WYJA 4NA9H 4AFZA 4FUHA 4YOGA 1TE0A 2J9NA 1Z1JA 2WPJS 3MU4A 1HAPH 1YPGH 1O2NA 1HV7A 1GHBG 4TPYA 1GHVH 2Z94A 2R3UA 4X2WA 4AYVB 2GD4B 5EQQA 4A92A 2OUAA 1S83A 1E35B 4HG6A 1EATA 1G32B 2BVRH 2WV5A 3RMLH 3V0XA 2Z9LA 1BTUA 1CSOE 1AVGH 2VIOA 2G51A 4U32A 1UVUH 1D6WA 2BD7A 3ZVAA 1GGDC 1SGYE 3M35A 4YOJA 1GI8B 3VB5A 2ZTYA 3O8BA 3N7DA 5FBIA 2LELA 3TVJB 1K1JA 1BDAA 2G55A 1RGQA 1P9SA 2HNTE 4AB9A 2QXJA 3MU1A 1YWUA 3KL6A 4YLUA 3UB0A 1AKSA 1WOFA 2GCTC 2ZEBA 3ZZDA 4UDWH 3PWBA 1O36A 4Y76A 4ABIA 3MO3A 1LPZB 1SC8U 5HGGA 3BTHE 3STJA 3NWUA 4IBLH 3RMOH 1ELCA 2XW9A 1TBZH 3VXEH 1BHXF 2I6SA 1YCPH 1BBRH 2LP6A 5DP8A 1VR1H 2V6NA 1N8OC 4RI0A 4DW2U 3PLPA 5EJZA 1P04A 3O8RA 1E36B 7KMEH 3C1KA 1VZQH 2ESTE 2PSYA 1O5DH 3K6ZA 3RXEA 3MYWA 2ZIQH 4BTTB 1O34A 1C4Y2 2RCEA 1OSSA 1CBWC 1FY4A 3RLWH 1IQIA 1Y8TA 1UTJA 3M3VA 1YM0A 4TPIZ 2JIZD 1L1GA 1WDIA 4Y79A 1A5HA 3U1JB 1PPEE 2C8XB 1C5MD 4WWYA 1LTOA 3SJIA 1V2ST 1TMTH 1AD8H 1EPTB 4ASUD 2BB4A 3GCTG 2BX3A 5HM9A 1JOUB 3RXIA 1O30A 4ZHLU 2BD3A 4K8BA 5CHAB 1SFIA 3GY4A 3QTVH 3ZZ5A 3T25A 1JRTA 1AN1E 1OPHB 4X8UH 1MKWK 2STAE 2RDLA 1L2EA 1GCTC 1CT0E 1GMCF 4K60A 2HRVA 2ILNA 2P3TB 2XRCA 3EA8A 1FDPA 3BG8A 5EJLA 1KY9A 1KLTA 2OTVA 3I29A 3PMBB 1WV7H 1O37A 4Q7YA 2F9VA 2PV9B 3K6YA 3V7TA 3ZVDA 5A0CA 6ESTA 1V2JT 2GZ7A 1CHOG 2VH6A 2OINA 2ZP0H 3HGNA 3QZQA 5L2ZH 1DLEA 1A0HB 3VPKA 1OWKA 5T1VA 1GBAA 3P6ZB 1DWBH 1KXDA 2FIRH 1Z8RA 3F9EA 2XOKD 1QA7A 3QX5H 1B0EA 2XWAA 1JIRA 4NWKA 2K0QA 2VBCA 3A80A 1O33A 7ESTE 2FOFA 1UK4A 4ACBA 1B7XB 1C2HA 2ZI2H 1GMHG 1TRNA 4Q4LA 1BB0B 2BXTH 1EZUC 4X1PU 2QE7D 1T8NA 3LKWA 4JK6A 1FMGA 3UFAA 5AVDA 1MKXH 1CU1A 3PYHA 4ESTE 4LZ4B 3A86A 2I6QA 2F83A 3ITIA 4NIYA 1A46H 4LZ1H 2ZF0H 3WW7A 3HPTB 4Y8ZA 1ETRH 1T31A 1ABIH 4Y71A 2V0BA 3KEEA 3A87A 2KCPA 5C1XA 2DE9A 2QIQA 4KTUA 2L6OA 1AMHA 2GX4A 3UNRA 1ZHMA 1UVTH 4R8TB 4ABAA 1PPHE 3E16B 1QB1A 1NFUA 2VIQA 4HTCH 2F3CE 3FZDA 2Y82A 5E0HA 5GPIB 5DP3A 1EFRD 1DITH 3W94A 1C1OA 2HWLB 2KR7A 4Y10E 1KDQB 4QT8C 4JZFH 2ZQ1A 1C2KA 3F3BA 2PLXA 3ZVEA 2J98B 2FS9A 2GZ9A 5LPRA 1NRSH 4Q7XA 4WF8A 1GL0E 2AERH 1BRBE 4ZHAA 1B5GH 3EYDA 4UONA 2G8TA 2GV6A 1K22H 2OC7A 2HLCA 3M5NA 1IQNA 1FPHH 1TIOA 5KGOA 5CDFE 7GCHG 4MVNA 3S9CA 1FIZA 1IHTH 1OXGA 3S7KB 2F9UA 4YESB 5EXMA 2HVXA 2ZGCA 1F5LA 3OEHD 4XSKU 1C1SA 4ZKOU 2FPZA 5IK2D 1HJAC 2EI7A 1HBTH 1KTTB 2OQUA 1TYNA 1T8LA 1J17T 1UMAH 3C27B 2NU1E 5F8TA 4JMYA 1SKYE 1QA0A 5C5NA 5C94A 1HAVB 1W8BH 1XVMA 1G37A 4IN2A 1YPHC 5DN6D 3NRLA 3RUOA 2ZFRH 3MH6A 2H9HA 4FUFA 1IQGA 1Z1IA 6CHAC 1V2QT 2V3OH 3L3TA 1O2LA 2ZDVH 1OX1A 1C2FA 2PWXA 5HIZA 3TH2H 1IQKA 1VCPA 2AMDA 1PPBH 4E05H 3E8LA
chains in the Genus database with same CATH topology
1T7CA 2TGDA 3BV9B 2AEIH 4CBNA 1OYQA 1LHCH 1EJAA 4YLQH 2JKHA 1HJ9A 1TX8A 4WXIA 3LH1A 5J4SA 2SGAA 1YYY1 2AGEX 2ZFTA 4AFUA 1XXDA 1RTKA 3A7WA 4BAHB 1FUJA 1TFXA 4NFEA 3MNCA 1DANH 4X0WU 2O8MA 4AG1A 3NUMA 1GHAG 2BY6X 1O2UA 1WQVH 3SU2A 1C5OH 1A61H 2V35A 1ANDA 2D2DA 4JYVH 1LVBA 3T62A 1P9UA 4B73A 3L33A 4GCHF 1HNEE 1GBDA 2BD8A 4U2WA 1C1UH 1HLTH 1TGCA 2BZAA 1ZLRA 3KQDA 3TK9A 1EJMA 1CA0C 7LPRA 4I8GA 1ELBA 4ZUHA 1L4DA 1OP0A 1QRWA 2A7JA 1O2SA 1TOMH 1TPAE 1XKBC 4UFEH 4VGCC 4XBBA 4JK5A 3P70B 2FX6A 3SGBE 3TJNA 4X2XA 1YGCH 3M36A 3SNCA 3W95A 5DP7A 5JB9S 1C5YB 3SV9A 3U8RH 1M9UA 1SQAA 1C5RA 1EZQA 1BBRK 1GBFA 1UCYE 4ZH8A 3TK6A 2C93B 3BTQE 4HGCA 3OX7U 2WUBA 3RP2A 2A4GA 1O3LA 1AVXA 4RN6A 2J94A 2ZG0H 1C5VA 1DICA 1L4ZA 3M61U 1RTLA 3RU4E 1D3PB 2ZU2A 1YPJH 4GVUA 1SGCA 2NU4E 5JYIA 3R0FA 1S84A 2HPPH 3L6PA 1FY3A 1RIWC 1ZR0A 1K2I1 2FOBA 4Y0ZE 4CRGA 1O5EH 4AYYB 1UTOA 1DUEA 1O2RA 1SFQB 1ZTJA 1KXCA 2TPIZ 3CS7A 1G2MA 3QK1A 3ZVFA 2SGEE 3V3MA 4GSOA 1CGHA 1TGNA 2ZFSA 1AKSB 4X6MA 5GXPA 3GICB 1T4VH 2C8YB 1GJ4H 3KIDU 5T6DA 4AFQA 5C3NA 1C1TA 1PJPA 1KXEA 2BLQA 2P94A 1TNJA 4KTCA 1ETTH 1UTKA 3EE0B 5EQRA 4DIHH 5AFYH 1NROH 4NGAH 3G01A 2Q6GA 1IOEA 3GY7A 3H7TA 2WPKS 3SUEA 2GMTC 4A1VA 3RXHA 4JZEH 2OXSA 4I8HA 4Y8XA 1SBWA 4A1TA 4NWLA 3K9XB 4X6OA 4SGAE 1XX9A 1V2UT 2ZCLP 3BF6H 4OS4A 1O38A 3F9GA 1ZSKA 4H42U 3SNBA 1MD7A 3E6PH 2CMYA 3BIVH 1EX3A 2D8WA 1BTHH 3HGPA 2M5TA 1QBNA 4WMEA 1TX7A 4K3JA 5K7RA 2SGQE 3TNSA 4F49A 1KDQA 2XC4A 1AFQC 1B0FA 2AMPA 1UTQA 1RFNA 2W3IA 3JZ1B 2KAIB 4DVAU 1GI7B 1Y5BT 2NU3E 5TCCA 3HK3B 3SU3A 3D62A 3CS0A 3F6UH 2ZA5A 3QGJA 1RXPA 3URCA 2ZCKP 2FI3E 2FODA 1GI1A 3P17H 1CT2E 4YT7H 5DKMA 3LGYA 2BY5X 1AVWA 1DWCH 1O5CB 2R2WU 1WQSA 9LPRA 1V6DA 1ZSLA 4ISOA 3AASA 1ZPCA 3ZV9A 4ABHA 3UQOA 3P8NA 2UWPA 1V2TT 1FNIA 2SGDE 1C1WH 1HAVA 1QHRB 1BCUH 3FP7E 3ZVCA 3BTWE 2FI5E 1V2KT 1LO6A 1QCPA 1NN6A 2PKAA 4ZAEA 1O3DA 1V2PT 2ZDKA 4JZDH 1XKAC 2ZDNA 4FXGH 1J9CH 2OP9A 8ESTE 3VGCC 3ZZ9A 2AIQA 1Z7KA 4GHQA 4D7FA 2XBXA 1LVMA 4MPVA 2JH0D 1MCTA 1O3FA 1P0SH 4CHAC 4I7YH 3A7YA 1FV9A 1D3DB 2ASUB 3SHAH 4ABFA 4I8KA 4X8VH 3SUFA 2C8WB 3A82A 1WU1A 2P16A 1IQLA 3A84A 3F9HA 1O2MA 2WYGA 3QZRA 3ATLA 3ZVGA 4JYTA 2FTMA 2B9LA 3A7ZA 5EXLA 1TGSZ 1XVOA 2GV7A 4NA7A 4Y7BA 1EJNA 4RKOB 5BRRE 1ZGVA 1MMJN 2BQ7B 1O2TA 5JPMH 1O2XA 1LQDB 2ZPRA 4YO9A 1VJ9U 4AZ2B 3E3TA 1OWIA 2VWLA 3BEUA 4UFGH 1TABE 5C1YA 1A5GH 5LPFA 1GG6B 2FZZA 1O2GH 3MWIU 3A7TA 2ZWLH 5F8ZA 2ZDMA 1DSUA 1E0FD 4BNRA 1WTGH 5FCRA 2VJ1A 2FXRA 3KQCA 4MNXA 2ALVA 1W14U 3ATKA 3MHWU 1Z8GA 2Q6FA 1P02A 3Q3XA 1MTUA 3KF2A 4IC6A 1UTPA 2QCYA 3DA9B 2XBWA 1GI2A 1NZQH 4U30A 4FUJA 1C5PA 2W26A 1O35A 3MH5A 2FTLE 1AE8H 1FI8A 1P2NA 2PKSB 2R9PA 1A4WH 3ZYEA 1HFDA 3QGNB 1O3GA 1A5IA 4RKJB 3PV4A 2BOKA 3HATH 2ZNKH 1ARCA 1NT1A 2IJOB 2CHAC 3RXMA 2QF3A 1AY6H 4MPWA 1LHDH 3RXAA 2O8WA 3OSYA 4K1SA 1BTWA 1UVOA 5E8EH 2A0QB 2Z9KA 2XC0A 2BLOA 2PR3A 2PUQH 1J15A 1P3EA 2VWMA 1XXFA 1C5LH 3MH4A 2XWBI 2A4QA 4WMFA 3RXDA 3A81A 3P8GA 3GY6A 1GPZA 3BTFE 5JDUB 2W3KA 1BTYA 3GCHB 1C2EA 5E0JA 1KXBA 1V2MT 3TIUA 3BIUH 4MPXA 1QBVH 1O5GH 3DHKH 1BOQA 5DP6A 1H9HE 2ZGXH 3M37A 1H9LB 2ZHFH 1F2SE 2XTTB 1EP6A 1O2YA 3GDVA 1A0LA 4B2CA 1E34B 3FANA 3BG4C 3HKJB 2TIOA 4ABJA 2G5NA 1D4PB 1MZDA 4GUXA 2Y5FA 3GDSA 2ZDAH 1TBQH 3RU4D 1NFYA 3LJJA 3SUDA 4RSPA 4GCHG 1ZJDA 1P12E 1S85A 5GDSH 3EQ0H 1GBHA 2P3UB 4X6NA 5EPYA 5C1UA 1SGTA 1EB1H 2CN0H 4I33A 3U69H 2XBYA 1NU9A 1P2QA 1Y59T 1CO7E 3M5MA 3S9BA 1O2IA 3M3SA 1NESE 1V2OT 2KAIA 1V2LT 4AB8A 1TGTA 1SG8B 1TNLA 3TJUA 4TWYA 1P8VC 5EGMA 1UO6A 3TPIZ 2Y5GA 2HGTH 2AYWA 3LGVA 4YOIA 4NG9H 2A32A 4MTBA 5JBBS 1QNJA 3Q3KA 4ZXXH 2WPIS 3QWCH 2C90B 1J16A 1TA2A 1BRAA 4DGJA 3M7QA 1OWDA 2XYAA 4ABEA 3RXSA 5FXLA 3A8BA 2Y7XA 4FVBA 4NSVA 1A1RA 2O8TA 2JH6D 1MTSA 1QFKH 5LPEA 2FP7B 1CA8B 1CGJE 3ATIA 4UEHH 1AB9C 2VIPA 1NRNH 3IWMA 2ZU5A 1ORFA 4OS7A 4J2YB 1L1NA 3TU7H 5DG6A 2BYAX 1N6YA 3TLOA 2GGVB 3SI3H 5EPNA 4AGJA 3MU5A 5IDKA 1W11U 2XXLA 5F6MA 1ZHRA 3V13A 4TY7A 2TRMA 2ZECA 1IAUA 3A83A 3RC5A 3RM0H 1GJ7B 4DURA 2FOEA 3LGIA 5C5OA 2PFEA 1Y3WA 4KELA 5F03A 4MG3A 2B7DH 2EI6A 2GDEH 4FUGA 2IOTA 1KLIH 3QTOH 2YNAA 3RMMH 2Y7ZA 3MNBA 4XBCA 1QGFA 3AW1A 1V2RT 1T4UH 3T5FH 4IGDA 1HAHH 1C2JA 1ZJKA 2O8UA 1F92A 3E90B 1FIWA 4B76A 3TITA 3D65E 2CJIA 4IMZA 4CH2B 1ESTA 1MD8A 2FX4A 4MDSA 5FX5A 1GBKA 1DY9A 3ZYDA 1UCYH 4OGYA 1TOCB 1AHTH 1EOLA 3T28A 1O5BB 2HALA 2VB0A 1P09A 1TBRH 3DFLA 3E0NB 1P2MA 3PMJA 1CGIE 1CE5A 1QY6A 4FUIA 2BDGA 3TK5A 1GJ9B 3GISB 3T27A 1Q31A 2UUJB 1XM1A 1UVSH 4X1RU 4AG2A 1TAWA 1BMLA 5A8XA 1ZPBA 1HJ8A 1EAUA 2ZPQA 3UWJH 2RA3A 5L30H 4INLA 3MTYA 1EP5A 4IW4E 3SBKA 1BTZA 1QL9A 1F7ZA 1ZOMA 3MH7A 2IN2A 2C8ZB 1P11E 1C2MA 3P92A 1DLKB 5FHTA 3RXBA 1N1LA 5E0GA 1PQ7A 2A45B 3U8OH 4M7GA 5PTPA 4YT6H 1HAXB 1O3EA 1OP8A 1SGNE 2NU0E 2Z9JA 3OU0A 1P2JA 5FAHA 2NU2E 1ELAA 3CP7A 1PPFE 4GHTA 1LKBA 1TNKA 4ISIH 5JBCS 1QJ7B 1GBTA 3MNXA 1JWTA 2AGIX 1W2KH 3P8OA 1Q3XA 2P8OB 3GCNA 1BBRE 1ETSH 2P3FH 2A5KA 1LPGB 3GY5A 1O3MA 2QAAA 1QB9A 1UVPA 5IYTA 3M7UA 3FVFB 1S5SA 2A4OA 1EPTC 1YCPM 1W0ZU 3SU4A 5A09A 1OWHA 1DXPA 1VGCB 5GWZA 3KNXA 3RXVA 3KCGH 3SN8A 2FOHA 1MU8B 4K5ZA 3RC6A 1V2VT 5CHAC 1H8IH 1ARBA 1IQFA 3HK6B 3VB6A 2PKAB 1HPGA 1RRKA 2OC8A 2XCNA 4UFDH 5A0BA 4O3UA 1XUKA 2YOLA 2UWLA 1ZYOA 1S6HA 3LGUA 1MU6B 1AZ8A 3TGJE 2TGPZ 6GCHF 2ZU1A 5DO4H 1O0DH 4FU9A 5E2OA 1SLVB 3EA9A 2BDCA 4GPGA 4IC5A 3IG6B 1GDUA 1GWAA 1PYTD 2GT7A 1C5NH 3GYLB 1BJUA 1BT7A 1BA8B 3LPRA 4F4OC 5I46H 1RS0A 1TLDA 2BVSH 3LJOA 4DT7B 1JIMA 1NU7B 1O2VA 1KIGH 1F0TA 4GAWA 1MCVA 1GI5A 3KN2A 2GCHF 5HMAA 5K0HA 1NO9H 1BMNH 1O3JA 3ATWA 2FOGA 2Q6DA 4FUDA 4DG4A 1K1OA 5FPYA 4Y6DA 1S82A 4LXBH 1K1LA 1IQEA 1RD3B 1PPGE 3LC3A 1FPCH 4AGKA 4BAMB 3BTDE 2GP9B 1AU8A 2VH0A 2UWOA 2ZTXA 1SQTA 3P8FA 5T3HA 2B5TB 1DS2E 4CR9A 2WPLS 1AUJA 1TX6A 3PMHB 3S0NA 2QYIA 2Z3CA 1ZTLA 4Y8YA 2ODPA 1AE5A 2XCFA 2JETB 3PLBA 1GHXH 3BTTE 1SLXB 1O3OA 1C5UA 1INCA 1YCPK 2BDBA 3OYPA 1H1BA 1NC6A 1GJCB 1VITH 1C5QA 2VVVA 1P01A 1TRMA 4NIWA 1DOJA 3RXUA 1QRZA 2QGRA 2VGCC 4HI3A 1HRTH 1FQ3A 2J34A 1ELTA 3TJVA 1UTMA 3UUZA 3VXFH 3EAJA 1ANBA 3SV8A 5FBEA 1IHSH 4AN7A 1Y3VA 4YM9A 2VIWA 1SLWB 2BTCE 4B2AA 4BOHA 3UQVA 1O2JA 1DVAH 2PTNA 4H6SB 1BITA 2BLWA 3O8DA 4U01A 1HXFH 1MH0A 2ZFPH 4UFFH 1C5TA 2NWNA 2QA9E 2BY9X 1G2LA 5DP5A 3RU4T 5A8ZA 2AFQB 3ESTA 2A4RA 1HAOH 1O3CA 4DY7B 3SQEE 1Z6EA 2B8OH 1LCYA 1MBQA 1O2OA 1SLUB 4XBDA 2FS8A 2ZFFH 4A1XA 3M3TA 2DE8A 3MOCA 4K1EA 1LQEA 1MUEB 2QY0B 1O39A 4K69A 1BJVA 3PO1B 3UOPA 3N7OA 1TNHA 5EQSA 1LKAA 3B9FH 4MNYA 4O03A 1JMOH 4CRCA 1DDJA 1GMDF 3AW0A 1LDTT 1SGIB 1NY22 2VWNA 1K1MA 3MNSA 2FLRH 1YPHE 2RA0A 2EC9H 1GBJA 1HAYB 2ZDLA 1D6RA 4PROA 4Z0KA 3BSQA 4D8NA 5BPEA 4X2VA 1XUIA 1K1PA 2ZHQH 1T8MA 1GBBA 3CENA 1C1MA 1LHFH 4BXSA 4DCDA 3RDZA 4ISNA 5DP4A 1ELGA 1MTVA 2BD2A 2OQ5A 1EQ9A 3BTGE 1C2DA 3PWCA 4AORA 1MTNC 4WXVA 1GMCG 1HAZB 5G4BA 3EDXB 4A5TS 5CMXH 3V12A 1YPLH 1GHZA 1GGDB 3PTNA 2W7SA 1CQQA 1BHXB 1VITF 1SI5H 2VINA 4XDEA 4WJG2 1K9OE 1AFEH 1MQ6A 3LT3A 1ESAA 1GL1A 5EU8A 1BRCE 2GKVE 4BTUB 1F5KU 4OS2A 3BTEE 1THSH 2AS9A 2R0LA 3DT0H 1C5WB 1V2WT 1MKXK 1RJXB 1ZMLA 1UHBA 5ETXA 3UNQA 3BN9A 1YLDA 1P2KA 1TWXB 2STBE 2GCTB 2H2ZA 5FPTA 3GY3A 1K21H 1TPOA 4O3TA 3FZZA 3SUGA 3LC5A 2SGPE 1PYTC 4CRDA 2BD4A 2ZU4A 2LNCA 1GI9B 2CV3A 3UNSA 1BZXE 5I25A 1TA6A 5B6OA 1HAIH 1L0ZA 3SJOA 3LDXH 1F0RA 2C4FH 2PUXB 1C5XB 1DPOA 2HNTC 1P2OA 4FU8A 1N8OB 3T26A 1AQ7A 4FUCA 1Y3YA 3RXKA 1T8OA 1TRYA 4WMDA 3UIRA 4DJZB 2G00A 4Q7ZA 4D7GA 1SGPE 3SQHE 1DXWA 3UY9A 1OP2A 1CBWB 5C67A 5GCHF 1XUHA 3SGQE 7GCHF 1EZSC 3KGPA 1F0SA 2XC5A 3MO6A 1RTFB 5ESTE 3GYMA 1LVYA 1EKBB 4HZHA 2QXIA 1C1NA 2XNIA 3A8AA 1KYNA 1O3HA 1P3CA 2THFB 2A7CA 1C9TA 2HNTF 4NIXA 4YZUA 2F91A 4OS1A 2FOMB 5DGJA 1EAXA 4ISLA 4Y0YE 2ZC9H 3Q77A 3E1XB 3U1IB 1ZRBA 3QLPH 1BMMH 2ZGBH 1GCTB 3A8CA 3A88A 1KSNA 4NSYA 2H5CA 4O97A 5JBTA 1O2HA 3U98H 1V2NT 3LGTA 3SNAA 3VFEA 5LH8A 2TGAA 5DPAA 1TQ7B 3RXJA 3NPSA 1HUTH 4ABGA 4ZMAH 1A3BH 5JB8S 4TY6A 3RXPA 3DFJA 5GJ4B 1BMAA 2Z7FE 1GCDA 1O3AA 1C9PA 4CRAA <