3MU8A

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region b of the crystal. fifth step of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu8A01
1BHXF 2FOCA 1Z1IA 3LT3A 3QTOH 2Z9GA 2QC2A 1C1MA 3SJ8A 2GV7A 4ZROA 2FXRA 4ISHH 2W3IA 1PYTD 1TQ0B 2ZTZA 1ELAA 2AYWA 2BZAA 1GJCB 1HYLA 1AB9B 1GVLA 1B7XB 2HNTF 4AG1A 1AFEH 2QIQA 1SGIB 1GG6B 2G51A 3P8NA 1GHWH 1LQDB 2FTMA 1QBVH 2F83A 3GCHC 5TJXA 5CHAB 2FWWA 2P93A 2WPMS 1MKWH 2XNIA 1YLDA 1G37A 1GJBB 3NWUA 2VU8E 1P2NA 1VITG 3GYMA 1EUFA 2G52A 4LXBH 1C4U2 5F8ZA 4YO9A 8LPRA 2GT8A 2ZGXH 1CA0B 1C5SA 2BVSH 4AFZA 1BZXE 5DP4A 2P16A 1GBLA 2OLGA 2R2MB 1V2ST 4ISNA 2R0LA 9ESTA 2F9PA 2VNTA 1VITH 2OCVB 1UVOA 3RMNH 1SGFA 4K1TA 1F0SA 2XC0A 1QL8A 3A7TA 1J15A 1H1BA 3MOCA 3V0XA 1HJAB 4GCHF 3QGJA 1UCYK 2BD2A 2ZDKA 1BRUP 2AMPA 3C27B 3RXEA 2QXJA 3F6UH 3RXIA 4A5TS 3BTQE 4UEHH 1SGTA 3STIA 3ZZ9A 4GUXA 1GHYH 4NA7A 1AE8H 4LK4A 2DE8A 2ZDAH 4MNWA 4MNYA 1QB1A 3AW1A 2WINI 1Y59T 3CS7A 3T62A 5TCAA 4K1EA 2P94A 5BRRE 1O38A 1TRMA 1AWHB 5DP5A 2HPPH 4NIWA 4AYVB 4WVPE 1F2SE 2P59A 2UWPA 3K9XB 3L33A 2F9BH 3RXKA 1MKXK 3Q3YA 5LGOA 5FPYA 1VCWA 3TGJE 1IQJA 1UTKA 1V2RT 2ZG0H 5HXFA 3HK3B 4ISOA 4H42U 1V6DA 3MYWA 1QBNA 3NK8A 1LKAA 3V7TA 3PMJA 3UFAA 4O3TA 3E16B 4WJG2 3M5NA 1FNIA 2OQ5A 5T3HA 2ZPSA 1F5RA 3ELAH 1EZSC 1WBGB 3RM2H 2GCTB 1KXBA 1NFWA 3VB3A 3T25A 2O8LA 1A0HB 2XC4A 2TBSA 2VWOA 1DLEA 1HGTH 4Y10E 1F92A 4WMDA 2JETC 3VEQB 4TPYA 1WUNH 5JBTA 5K7RA 5GCHF 1DXWA 2RG3A 3ESTA 1F5KU 3LU9B 2ESTE 3HGNA 3ZZ5A 1TYNA 4JZIA 3KN2A 3SHAH 5HM2A 5IDKA 2TGAA 2Y7XA 2FYRA 4H4FA 1VJAU 1GJ8B 2G8TA 1LHCH 3LDXH 1AMHA 2FEQH 1CHGA 3A80A 2THFB 1NT1A 4ISIH 3SBKA 3BTGE 1TIOA 1ZGIA 2JH0D 2SGPE 4IW4E 5I25A 5HYOA 4ABJA 3K6ZA 3M35A 1JIRA 1YP9A 4I8JA 2BXTH 3TJOA 3MU1A 1YGCH 1OWJA 1J17T 1O2MA 3M7UA 1ZSKA 2B5TB 1HXEH 3SUEA 1XMNB 1Y5UT 1JOUB 1O5EH 3DFLA 4B73A 3S69A 4HFPB 3L6PA 1H8IH 1O3BA 3A7XA 2GZ9A 3SU2A 1AN1E 1ACBE 1GCDA 1TLDA 5E2OA 4AN7A 3UTUH 2QYIA 4CREA 1FJSA 1UK4A 2ZU3A 5L30H 3S9AA 1G2MA 3F9HA 2VJ1A 4B71A 2ZCLP 1A5IA 1L1NA 2PKSC 2UUKB 3SNCA 5GXPA 2C8YB 4D76A 4TPIZ 4DY7B 3RXJA 3BTME 1P2IA 1WOFA 1O3DA 1Y3VA 2BQ7B 1GMCF 3SUGA 1G36A 4OS5A 1EAIA 7GCHG 2Q6DA 3RXQA 1O3HA 5J4SA 3B8JA 4B2AA 1C1RA 2Y80A 1P09A 1TRNA 1YM0A 1A2CH 1GL1A 4X1NU 1K22H 2KAIA 1BB0B 1QTFA 3G01A 5ABWA 1AI8H 4INLA 2FDAA 1YLCA 3QGNB 1A0JA 1INCA 5ETXA 4CH8B 3URCA 2ZTXA 3VB6A 4TY6A 1EASA 2QF3A 1N6YA 3BEFB 1V2MT 1AIXH 2UWOA 3MU4A 1SC8U 1O3AA 1UVTH 3BN9A 3UNSA 1SGQE 3FVFB 8GCHG 4MPXA 1E35B 4JZ1A 4K8YA 4X1QU 1Z8RA 1J9CH 1ZSJA 1GI1A 2BD9A 3TIUA 5JBCS 2BQ6B 4E7NA 4Y7AA 2GDDA 1JXPA 2IPHA 1EPTC 1SGCA 1O3NA 1W12U 1Z8JB 2ZGJA 1DUEA 1G9IE 4XBCA 1TPSA 1F0UA 3E3TA 3SJIA 1A0LA 1WV7H 1DITH 4CR5A 1MMJN 5LPRA 1HAGE 3HATH 2A4RA 4FUIA 1NN6A 4A1VA 1UTOA 2Q1JA 1ABIH 2V35A 3GCTF 3SZNA 4TYDA 4AG2A 1HAIH 3GY3A 1QFKH 1UHBA 5GJ4B 1MD7A 3RXSA 2NU4E 3NXPA 3SQHE 1IQHA 1OYQA 5A09A 1K1NA 1LMWB 4I8KA 3RU4D 4ZMAH 1BMLA 1V2QT 2CXVA 2Y5GA 4AGJA 2Y5HA 4IN2A 1GDNA 1RIWC 5CMXH 3RU4E 5A8XA 2JH5D 3U1IB 5DO4H 2IJOB 2WUCA 3PLPA 3RXLA 2ZU2A 3UIRA 4Y8ZA 1C5PA 1SGYE 1OWHA 2R3UA 1ANBA 1GBAA 4B74A 1TX6A 3FZZA 3MH7A 2CJIA 4JMYA 2VVVA 4GCHG 1DFPA 1ZJKA 3O8CA 1BOQA 5DPAA 4AORA 1GDUA 1O2YA 1BBRE 2A5KA 3HPTB 2ZPQA 1AZZA 1MKWK 1UTPA 4IC5A 1TQ7B 2ODYB 3TK5A 1HAXB 3SU5A 2J38A 1SSXA 4BTIB 1BTPA 3SJKA 2ZP0H 3M61U 1C5VA 2BY5X 3SNBA 1C1WH 1PQ8A 3V3MA 4Y0YE 1WTHD 2FESH 1XUKA 2J34A 1NRNH 3TK6A 4HI3A 2R2WU 5DP7A 3OSYA 2Z6BD 3A8DA 3PLKA 3A8AA 1E38B 1V2UT 4IMQA 1HJ9A 2RA3A 1NPMA 1HPGA 1ELFA 4BAKB 3QLPH 5EW1H 2G81E 2FI5E 2LNCA 1ELBA 1C5XB 4K69A 3PYHA 1ZHRA 2ZHDA 1ESAA 3NUMA 1YPEH 2FP7B 3CP7A 2AS9A 2BLWA 2BQWB 1GJAB 3LJJA 4X2YA 2CF9H 3M7QA 3BG4C 1E37B 2Z7FE 1ZLRA 2PGQB 1ELVA 2FOBA 1ORFA 1DE7H 1MZAA 1FI8A 5L6NH 3ITIA 1LVYA 4YOGA 1ZPCA 5EPNA 3M3SA 2HNTE 2TGPZ 3PTBA 5GCHG 1O39A 2PKAA 4ZUHA 3A7WA 1GCTB 1NRSH 1P05A 1FQ3A 5HM9A 3BEIB 4Z0KA 2PV9B 5A0BA 3PTNA 4X6PA 1SLVB 1WYKA 1ZYOA 6CHAC 2P8OC 2Q6FA 1GI3A 1RS0A 2EI8A 4GSOA 1LKBA 1ZMJA 1JBUH 3TPIZ 3R3GB 4NA9H 4WF8A 2GDEH 2BDGA 2Z9JA 3GDSA 4A92A 2PWXA 4CBNA 3A7ZA 3PLBA 4X8TH 4NSVA 1W10U 1TNHA 2BMGB 4IS5A 3RXPA 3RLYH 1XUGA 1L0ZA 4KTCA 2PW8H 2ZDMA 2ULLA 3NKKA 4JYTA 3VB5A 1OWEA 2VB0A 2OC7A 3M5MA 1CT2E 1F0RA 2UUJB 3S7KB 2CHAB 3KIDU 2QY0B 1MTNC 4Y6DA 3OU0A 5C5NA 2DE9A 3AAVA 4K5ZA 4H6SB 1V2PT 3MHWU 2ZFFH 1HRTH 4A7IB 4B75A 3K65B 3ZZ4A 3SU4A 4E7RG 2HALA 4UONA 3UPEA 1XX9A 2XBVA 3GDVA 3E90B 5GDSH 3RMMH 6GCHF 2V3OH 4UFEH 3S9CA 1IQEA 3ZZDA 2H9HA 2FYQA 1O3CA 1C5LH 1O2SA 1XXDA 5JB9S 1G32B 2ZEBA 2ZGCA 3F68H 3RXBA 4ZKNU 4AFQA 5SGAE 1PPZA 2ILNA 4UFDH 1EAUA 1THRH 3SU0A 7ESTE 1HIAA 4BTUB 1L4DA 4X1SU 1FLEE 3LGTA 4YZUA 1TE0A 2J4IA 5DGJA 3VGCC 1VZQH 1M9UA 1VCQA 1AZ8A 1NESE 1Z8IB 3P6ZB 4D8NA 2DUCA 1MTUA 2CN0H 2AMDA 3ZZBA 3ENSB 3ZZ6A 4ABGA 3T27A 1O2GH 4JK5A 2ZIQH 1BT7A 1P2QA 4NCYA 1PPGE 1WTGH 1AKSB 2XTTB 2IOTA 2HNTC 4X8SH 3A7VA 2ZGHA 2STBE 1SHYA 1ZSLA 2XBYA 4AX9H 1Z71A 4GLYA 5F03A 2PUQH 3BTTE 3PMHB 3DA9B 4CRAA 5JDUB 2VIOA 1CVWH 1AUJA 1CA8B 1A1RA 3FANA 3A8BA 3DFJA 4YOJA 9LPRA 1ZPZA 1P2MA 3VXFH 4OGYA 2JH6D 1Z1JA 1RJXB 1C1OA 3GCTG 4YOIA 1S6HA 1LDTT 1BBRK 2FOHA 2CMYA 3PM3A 3LGIA 4CRDA 2PSYA 1P12E 5EXLA 3IG6B 4U30A 2G5VA 2Z9KA 2V6NA 1ZR0A 2F9OA 3A89A 5A0CA 4AGKA 4PROA 2I6QA 4DIHH 2Z9IA 5H4IB 1A3BH 3JZ1B 3S7HB 4AB8A 1K21H 2F3CE 3C1KA 1VGCB 1N8OB 2C8WB 3M3TA 3VXEH 2VWMA 1IOEA 1YBWA 3BTKE 1ZZZA 3TITA 4WMEA 2F9UA 4Y79A 2TGTA 3B23B 1IQLA 4X2WA 2XWAA 3BF6H 3SOSA 4GVUA 2PSXA 4FXGH 1T8LA 1G2LA 3SO3A 1GJ9B 1TNKA 1A4WH 4I7YH 1XUFA 1OP0A 4FU8A 4YT7H 2R3YA 1DUAA 4MPUA 1QQUA 4KTUA 3QK1A 1JIMA 4INHA 1EJNA 2GMTB 4JZDH 4KTSA 1SB1H 2F9VA 1ELEE 4ASHA 3RXFA 3LKWA 2ZQ2A 1O5FH 3GY8A 1FN6A 1BTWA 2FOFA 1TNJA 1Y5AT 2FOGA 1LVOA 5F8XA 4CHAB 1GBIA 1NM6A 4NIVA 1SBWA 4QT8C 3SJOA 4BOHA 1QCPA 1O32A 1DX5M 2AERH 1W11U 3EE0B 3O8RA 2ZFRH 3SUFA 4X2XA 4Q2KA 4R8TB 2PUXB 1MZDA 4I8GA 2OD3B 3UNQA 5DK1A 2Y81A 1G3EA 5G4BA 4U01A 1C4Y2 5HGGA 1XVMA 3MNBA 1NRPH 5ESTE 1XKBC 1HFDA 1BMMH 3UNRA 5C2ZA 1YCPM 3T2NA 3P70B 1YYY1 3O8BA 3LC3A 1HAZB 1MQ5A 4D9QA 4ISLA 1W0YH 2D2DA 3U1JB 1OYTH 3TNTA 1C5TA 1EOJA 1V2LT 5JBBS 3F9EA 4A6LA 2BD4A 3Q76A 2P3UB 1KY9A 5C3NA 3URDA 1YPHE 1TBZH 1TFXA 2B7DH 4THNH 1S85A 3OYPA 5EG4A 1O3FA 1UVPA 1GGDB 1TB6H 2H2ZA 3V13A 5E8EH 1MAYA 1P3CA 1PQ7A 3SUDA 1RTFB 1L2EA 2O9QA 3A86A 2J94A 2GZ8A 3P17H 3UREA 1NU7B 3SV6A 2AFQB 2PFEA 5A8YA 3M3VA 2VH6A 1GHAF 3FZDA 2C3SA 1W8BH 1C1QA 3GCHB 1BMAA 2OC0A 4MVNA 3D23A 1C2HA 3SHCH 1PYTC 1GBFA 2HOBA 1NFYA 2NU3E 3T28A 1GI2A 4MNXA 1V3XA 2FPZA 4ZHMU 1LVMA 3ATIA 4FUGA 3M7TA 1PPHE 4LOYH 2FM2A 1QR3E 1A7SA 1QQ4A 1CGIE 2WUBA 1FPHH 2R9PA 4OS6A 1BTHH 1P2KA 5E2PA 1C5MD 1GJ4H 2BXUH 3MU0A 4GAWA 1C1SA 3OY6U 1Y3XA 4NZLA 2J2UA 1GI6A 2VGCC 3ZVDA 2CGAA 3MH6A 5AVDA 6GCHG 1FZZA 1PPCE 1E0FD 4ABDA 4HTCH 2ZDLA 3T29A 1Z7KA 1LHGH 4AOQA 3GY7A 2Y7ZA 1KTSB 1GL0E 5B6OA 2BZ6H 1O2NA 2HWLB 5JBAS 1V2NT 2RCEA 5AFYH 5A0AE 1XVOA 2BX4A 3D49H 3GYLB 2VIQA 1O3EA 3I29A 4KP0A 1BUIA 4BAMB 1KDQA 1QA7A 1SPJA 1A3EH 4FUHA 1V2TT 1O2KA 5FXLA 2FZZA 1TRYA 3ODDA 1TGTA 1J16A 4E05H 1TPAE 1IAUA 3GY4A 1YKTA 2SNWA 3KEEA 4XE4A 1GBMA 2OP9A 4AZ2B 2FX4A 2ZFQH 5BPEA 1H9HE 1BRAA 1PQ5A 1SQAA 1YPHC 3I77A 1N1LA 1SVPA 3AW0A 3QUMP 1GI9B 3GY6A 4AYYB 4FVBA 4BAOB 5HMAA 5F6MA 1ZHPA 4H6TA 1FIZA 1O2HA 1OP2A 3PMBB 1HAYB 5EPYA 1CE5A 3KGPA 3UWIA 1LO6A 3P8GA 4O3UA 5JB8S 1C1NA 1AHTH 1BBRH 2A4GA 2JETB 2CF8H 3HKJB 2XXLA 3SGAE 1O30A 3RC4A 1W13U 5F8TA 1H9LB 2BD3A 2ZPRA 1S6FA 2A7JA 2PHBA 1BQYA 3RDZA 3PWCA 1O2OA 2SGEE 3RXTA 1TGSZ 2ANYA 2C8ZB 1EP6A 3UQOA 2G4TA 1GHVH 1NRQH 4FUBA 1NY22 3PO1C 3M5OA 1OWKA 2VINA 3FAOA 1NFUA 2QAAA 1AY6H 1OS8A 2BDAA 4X6MA 4DOQA 3TGIE 3TVJB 3SU6A 1K2I1 3SW2B 1O2QA 1T4UH 3Q3KA 1QL7A 4FUEA 4FU9A 2F9NA 1AFQC 3U8OH 5EXMA 2XCNA 2V3HH 3PROA 1SGNE 1O5AB 4FUJA 4ZKSU 3U69H 1ANEA 2FODA 4NA8A 1BRCE 3SORA 3ZYDA 3F1SB 2BDCA 4WH6A 2GTBA 4CRCA 4D7FA 4VGCB 1CGJE 1EPTA 4ESTE 1ETRH 2KAIB 1C2FA 4AB9A 2P95A 2PKSB 1ETTH 1GMHF 3ZV8A 1DWDH 2BY9X 2W7SA 1ZGVA 6ESTA 5EGMA 4A1XA 1O2WA 3A81A 2ZECA 1O2XA 1GMDF 4K1SA 2JKHA 4OS1A 5T6FA 1EX3A 5DP8A 2Y6TA 1MU6B 4A1TA 4I31A 3ZZ7A 7KMEH 4Q7YA 2WV4A 4R0IA 1AWFH 3BG8A 1MBQA 2AH4X 1TNGA 1FMGA 1TAWA 2SGQE 3M37A 3ATKA 3ZVAA 1YCPH 3ZVBA 1KTTB 2BX3A 1MCTA 2XC5A 4UFGH 1O3IA 2BDYA 3LOXA 2HGTH 3EA9A 1A46H 2O8UA 4MDSA 1GBBA 1P06A 1YPLH 2SGFE 2QXIA 1AE5A 3ZZAA 1VITF 2ZFPH 4KELA 1UHBB 1ABJH 1ESBA 4B76A 2ZGBH 2M5TA 4IGDA 4U32A 3U98H 1OWIA 3S9BA 3RXRA 2Q6GA 3I78A 4FUDA 3MH5A 2B0FA 4YM9A 4NFFA 1EPTB 1CT0E 3LJOA 1SLWB 3UQVA 2BLQA 4I8LA 2ANMH 1FIWA 2WPKS 4HZHA 1K1JA 2HLCA 4ABFA 1EJAA 3LGVA 2PLXA 3B9FH 1MQ6A 5EOKA 4IC6A 1GJ5H 4DURA 1CO7E 1GHAG 4D7GA 3QZRA 4BAHB 1V2JT 4B1TA 5FPTA 3LGWA 4E06H 1SR5C 3P95A 1UMAH 1OP8A 1BDAA 1EQ9A 3DD2H 1ZMLA 1L4ZA 3R0FA 2ZU5A 3ZVEA 4GHQA 4X1RU 2FI4E 2BVRH 1ARBA 1P2JA 1P10A 3KF2A 1AD8H 1XKAC 1CBWC 3EDXB 2FX6A 3E0NB 1O2UA 1U6QA 1RIWB 1TPOA 2FOEA 1BTXA 1H8DH 2WYGA 3K2UA 3ATWA 2ODQA 3OX7U 1O3JA 1TA6A 3FP6E 1GJDB 3SV2H 4Z6AH 4CRBA 3UR9A 4I33A 5AF9H 2WPIS 4RKOB 2IN2A 1FXYA 5DKMA 1DANH 2OBQA 2GV6A 1MD8A 3MO6A 2G55A 1SHHB 2W26A 1P3EA 3QZQA 3MWIU 3LC5A 1P03A 1G3CA 1RFNA 3KNXA 3RU4T 1P11E 2ZU4A 3ZV9A 2ALPA 3A88A 1Y3UA 2XBXA 1UCYE 1W14U 1UVUH 3N7OA 1F0TA 1EATA 1ELDE 2H9EH 1HAOH 2BB4A 2ZFSA 1B0EA 1HJ8A 1EAWA 4SGBE 1DICA 1H4WA 1V2KT 3NPSA 2ZCHP 3KQDA 1AQ7A 1UTNA 3SGQE 1C1VH 3NCLA 4K60A 4I32A 3TJVA 3RXVA 2NWNA 1O36A 1BCUH 6LPRA 1S0QA 1ESTA 1HXFH 1D6WA 1ZTLA 1GMCG 1OKXA 1GBCA 2FMJA 2PKAB 4SGAE 4HGCA 1QJ1B 1TGCA 2SGAA 3PV4A 1LQEA 1QRZA 1TX7A 4YT6H 3F9GA 3GDUA 1BITA 2EI7A 5EQRA 4MPVA 1NFXA 3GCNA 3RXMA 1O34A 1N8OC 3UOPA 1HV7A 1DY9A 4CR9A 1O5BB 2BDIA 1BA8B 3BG4B 1C5ZB 1HNEE 1C1PA 5JYIA 2Y82A 4DJZB 4DT7B 1FY3A 2UUYA 2TRMA 1AB9C 1O3LA 1CQQA 2D8WA 2FOAA 2RA0A 4BANB 3CS0A 2VIPA 1GG6C 3QN7A 3BEUA 4MG3A 1UTJA 5CHAC 2A31A 3LPRA 2ZA5A 5FBEA 4YLQH 5C5OA 1L1GA 1TNIA 3SNAA 3OTJE 1T7CA 4ZXXH 6CHAB 2P8OB 3IITA 5EU8A 1CA0C 1GI5A 3SN8A 1LPKB 4CBOA 1D3TB 4NZQA 4Y76A 3RXGA 5A2MH 3TK9A 1XM1A 3H7OA 2OC1A 3V12A 1ETSH 2BOHB 2ZC9H 3VPKA 2GP9B 1EZQA 1AO5A 2ZHEH 3MI4A 3MO3A 5C67A 4MNVA 2ANKH 1UK2A 4UFFH 4KKDA 1WQVH 1EZXC 3ZVGA 1LPGB 2ZI2H 1Z6EA 1HJAC 1UTLM 2H5CA 3ZVFA 4ZHLU 2VWNA 2A2QH 4ZHAA 2P3TB 1MTNB 3LGUA 3ATLA 2BOKA 3QTVH 1SMFE 1GHBF 2PR3A 1HIAB 2QF0A 3ZYEA 1DWBH 1P01A 5AFZH 4DGJA 3SI4H 3SU1A 1Q31A 5EW2H 1KSNA 2OBOA 1GMHG 3RP2A 1G3BA 1MU8B 2A5IA 3KL6A 1VR1H 2PGBB 1L1JA 1RD3B 1GMDG 2BYAX 3RC5A 4KGAA 1LVBA 7LPRA 4RN6A 1BIOA 1OSSA 1RTKA 2A4OA 1AVWA 1C5UA 1YPKH 1ZRKA 3BIUH 1E34B 5T6GA 3STJA 5C1UA 1TBRH 1O3PB 1ZPBA 2ZHWH 3FP8E 5C1YA 4JK6A 1O0DH 1HAHH 2ZHQH 4Y8YA 4FU7A 3VGCB 1BJUA 1Z6JH 1AVXA 1KXEA 1DM4B 1F7ZA 1LTOA 1EOLA 4YTAA 5TCCA 4DVAU 1DWCH 1K9OE 2ZU1A 1MH0A 2VIWA 4XFQA 1BHXB 2GCTC 2PTCE 1A5GH 1O2IA 3BTHE 2D1JA 3T26A 4JYUH 1JWTA 1ANCA 1TABE 1GVZA 1K1IA 2OC8A 2STAE 2RDLA 2XYAA 3O8DA 1W7GH 5FHTA 1OOKB 4INKA 1LHDH 3KCGH 1O35A 1GDQA 3D62A 2GVFA 1ZRBA 1TGNA 1YC0A 1GI8B 2QXHA 3RUOA 2VVUA 1D4PB 1SQTA 4WH8A 1C5YB 1O2TA 1C2MA 2BM2A 3JZ2B 3F9FA 1C5OH 5FX5A 3KHVA 2H9TH 4OGXA 2BDHA 4OS2A 3SV7A 1QRXA 2BY8X 2FLBH 1SFQB 1LCYA 1Y5BT 2A2XH 1X7AC 2GCHF 5E0JA 1GPZA 3ZZ3A 1OX1A 4RKJB 4MTBA 1YCPK 2WV5A 4DW2U 1DOJA 2J95A 4UE7H 1QURH 1TOMH 2XW9A 3U8RH 2SNVA 4K8BA 1Y8TA 3ATMA 2GKVE 2GD4B 1SGRE 1THSH 3SGBE 1PPBH 4JZFH 2BLVA 4BXWA 1FV9A 1JMOH 1WAYB 3DT0H 1XUIA 1MAXA 1P57B 5FPSA 3SNEA 2WYJA 3AVZA 4CRGA 2BD7A 1V2OT 1O37A 2QN5T 2YNBA 4NFEA 3RMLH 2G5NA 1C5QA 3LGYA 2OXSA 5ESBA 3VB7A 3MTYA 2EI6A 1CHOF 3RXHA 1TX8A 1S83A 1VCPA 3LONA 1EB2A 1J14A 1Y3YA 2XCFA 1K1PA 3SJ9A 2QXGA 3LH3A 5J4QA 3H5CB 1MTSA 2NU2E 3EQ0H 4Y0ZE 3U8TH 2VIVA 1P04A 4NSYA 2BTCE 1W3CA 2ZDVH 3W94A 1DSTA 1ZTKA 2J9NA 1RRKA 4J1YA 1DY8A 1YPJH 4O9VA 1G3DA 1W7XH 1WQSA 1UO6A 1GBTA 1PFXC 5IYTA 3D65E 1TGBA 1SG8B 1P02A 4B2CA 4Q80A 4ZH8A 3QO6A 1Y3WA 2EEKA 3E1XB 2FTLE 3GCOA 5PTPA 4XOJA 1EB1H 2CV3A 1OPHB 2W3KA 2BDBA 1AGJA 4ZXYH 4X1PU 1ZOMA 1CGHA 4FVDA 1ANDA 3EAJA 1C2KA 3Q77A 4MQAA 1Q3XA 2VIDA 1FPCH 3GY5A 2Z3CA 3TH4H 4Y8XA 1GVKB 3BTDE 2AIPA 1DS2E 1KYNA 1P9UA 4AFSA 1PQAA 1C2IA 1IQNA 1S5SA 3BTEE 1UVSH 3KQBA 1E36B 4JYVH 1NRRH 1S81A 1XXFA 4F4OC 1W2KH 3MU5A 4UDWH 2Z94A 2H5DA 3EA8A 1TBQH 2I6SA 1HB0B 5I46H 1P2OA 5EQSA 1TOCB 1C5WB 2A45B 5DP9A 4XDEA 2EA3A 1ELCA 1EKBB 1DT2A 1K1MA 5AHGH 2G4UA 4VGCC 1GI0A 2R0KA 1S0RA 1QGFA 3PWBA 1A5HA 1TMBH 5FCRA 1BMNH 1GBEA 1ZJDA 1D3DB 1UTQA 2C8XB 2O8WA 1HCGA 1TMTH 1O2VA 3MNSA 1O2PA 1IHTH 2Z9LA 3UR6A 2FI3E 5EQQA 1QJ6B 3A83A 1O5GH 2W5EA 1SOTA 3QX5H 1MTWA 1NTPA 1O3OA 2K1QA 3M5LA 2ZWLH 4TWYA 4Y71A 4K3JA 4BNRA 1GJ7B 3HGPA 1XUJA 2HVXA 2BHGA 1PPFE 1HAVA 3TH2H 4TWWA 1KLIH 1GHBG 1GBHA 1JRSA 2FIRH 3ZZCA 1FAXA 4WXIA 1RXPA 4DCDA 2F91A 4LZ1H 1T8MA 3MU8A 1V2VT 1KDQB 4I8HA 1QY6A 1QB6A 2ANWA 1KXAA 3DHKH 1QNJA 1KLTA 1TWXB 2VGCB 1ZMNA 5CE1A 1GJ6A 2HRVA 3BSQA 3SV9A 1WSSH 4FUFA 1QHRB 1DVAH 2FLRH 4TY7A 4K2YA 4ABAA 2GX4A 2UWLA 1HAPH 1NO9H 3MFJA 3P92A 4OS4A 3ZZ8A 8ESTE 3P8OA 4ABEA 3A7YA 3EGKH 1QA0A 1O31A 2A1DB 1PPEE 1BTUA 1O33A 2A4QA 3U9AH 1SFIA 2LPRA 1C1UH 1P9SA 4XBBA 2Z3DA 1GBDA 2A7HA 3WY8A 1C2JA 2HPQH 4XBDA 3RXAA 2GGVB 3L3TA 2OTVA 3RXCA 2BY7X 1C1TA 2NU0E 1GCTC 4X2VA 1GHXH 1W0ZU 1HAVB 1DDJA 4WXVA 4FUCA 2H1UA 2OUAA 1EZUC 1HUTH 1TPPA 4WWYA 1AU8A 1MTVA 2TIOA 1TALA 1CT4E 1ELGA 2XWBI 3K6YA 2W7UA 1BRBE 4X8VH 3RMOH 5FBIA 4U2WA 1KLJH 3ODFA 1SGPE 3BTWE 5A8ZA 1QB9A 3MNCA 2GCHG 5GIBA 3LH1A 3CENA 1UCYH 2G00A 1BTZA 1SI5H 1EJMA 1TMUH 1O2ZA 3GOVB 3AASA 3GICB 2A7CA 2AMQA 1A61H 1HBTH 4ZKOU 3OY5U 2QV1A 3HK6B 2ALVA 2YOLA 4X8UH 3A85A 1D3PB 1T8NA 3A8CA 4DIIH 5FCKA 3MNXA 3RC6A 1Z8GA 3SV8A 1YPMH 2CHAC 5GPIB 5E0HA 1LHFH 3SI3H 1D6RA 1O2RA 1SL3A 4BTTB 2ODPA 1RGQA 1ARCA 3PO1B 8KME2 5T6DA 2BD8A 3KQCA 2VVCA 5LPFA 3UWJH 1RTLA 4IN1A 4NWLA 1SGFG 3E6PH 1MKXH 2EC9H 1GWAA 4O97A 3TGKE 4M7GA 2D26C 3UY9A 1OXGA 1CHOG 3ZVCA 1DWEH 1NROH 1LHEH 3GISB 1FAKH 1TONA 2OQUA 1AFQB 2QGRA 1FY8E 3SNDA 4Y11E 1ID5H 1P8VC 4BXSA 1J8AA 5DJ7A 1B5GH 4NG9H 4MLFB 1O2LA 1QL9A 3BIVH 1C5RA 5EODA 4ABHA 3LIWA 3E8LA 3A82A 4IMZA 1CSOE 1MBMA 1KXCA 1QIXB 4Q7ZA 5DP3A 2TGDA 2YNAA 1HLTH 2VWLA 1SQOA 1DXPA 2FO9A 2XRCA 1THPB 2O8MA 4NIYA 2GZ7A 1UTMA 4MPWA 4GPGA 2P3FH 3VFEA 5LPEA 1JRTA 2OINA 2V0BA 2WPHS 3EYDA 1SLXB 4B2BA 1IQIA 1FONA 5FAHA 3RXOA 1K1LA 1C2EA 4OS7A 4YESB 2ZHFH 2J92A 3Q3XA 3S0NA 2ZFTA 1TNLA 2A5AA 4ABBA 1SGDE 3TLOA 1P0SH 3PMAB 1FY4A 1T4VH 4ZAEA 4XSKU 1O5DH 3TNSA 1GBJA 2UUFB 1OWDA 3T5FH 2B8OH 3RXDA 1O2JA 1IQGA 2WPJS 1Q2WA 1FDPA 1C4V2 3NZIA 1ZTJA 2BLOA 1GHZA 4JZEH 1S82A 1B0FA 1C5NH 3BTFE 3AAUA 4CH2B 2O8TA 3KQEA 1O5CB 1PJPA 3VB4A 3SQEE 1T8OA 1TA2A 1D3QB 1AKSA 3TJUA 1FN8A 3RM0H 3EA7A 2ZZUH 4F49A 1QJ7B 1NS3A 5GWZA 3MO9A 2ZDNA 1V2WT 4DG4A 1KXDA 1IQKA 2AGGX 3BV9B 3IWMA 1VGCC 1ZHMA 1H9IE 3E91A 2ZKSA 3Q00A 1S84A 5LH8A 1NZQH 4IBLH 4J2YB 5DG6A 3SU3A 1KIGH 4Y7BA 4CRFA 1WCZA 1G30B 1EAXA 2VH0A 2QCYA 5E0GA 3A87A 1MUEB 1T32A 1WU1A 2PTNA 4WY3A 2ZQ1A 4ABIA 3M36A 4Q7XA 1QRWA 5C20A 4JCNA 1O3KA 1T31A 2TPIZ 1K1OA 2A0QB 1N6XA 5EXNA 2AGIX 1IQFA 1DSUA 1CBWB 3TU7H 1EXFA 2Z3EA 1YF4A 1HDTH 2GMTC 1NU9A 1K28D 4ZKRU 1UK3A 5JPMH 1GBKA 2ZTYA 4GHTA 1BJVA 4RSPA 4NIXA 3UUZA 4CHAC 2AIQA 1C2LA 1SGEE 1C2GA 3QWCH 4X6NA 4UD9H 4X0WU 3MH4A 1F5LA 2XBWA 2GT7A 3QDZB 2BY6X 2ZNKH 3A84A 2AGEX 4WMFA 2NU1E 3MMGA 1IHSH 2AEIH 1C9PA 3W95A 7GCHF 1GI7B 1UJ1A 1FY5A 3RLWH 3HKIB 5L2ZH 1DPOA 3TH3H 1C9TA 1O3MA 1AVGH 2SFAA 1EP5A 1DLKB 2WPLS 4LZ4B 2H6MA 3H7TA 1YPGH 2Y5FA 4X6OA 2ZO3H 5C1XA 3FFGA 1CU1A 1BTYA 1ELTA 2FS8A 5DP6A 5L2YH 4YLUA 4AFUA 1NC6A 1MCVA 2BVXH 3FP7E 3UOUA 1QBOA 2BD5A 4D9RA 1SLUB 3PB1E 4BAQB 1C2DA 2C93B 1KXFA 2A32A 2SGDE 1VJ9U 2B9LA 2ZF0H 5FX6A 1FY1A 4NGAH 3E0PB 2C90B 4NWKA 2QA9E 1XUHA 1GI4A 3RXUA 2C4FH 2FS9A 8GCHF 5K0HA 1LPZB 3DUXH 1FUJA 1O3GA 1AUTC 2ZCKP 1D9IA 3GY2A 3P8FA 1GGDC 1SOZA 3TJNA 2FOMB 2ASUB 4O03A 1IQMA
chains in the Genus database with same CATH superfamily
2L6OA 1BHXF 2FOCA 1Z1IA 3LT3A 3QTOH 2Z9GA 2QC2A 1C1MA 3SJ8A 5C17A 5KECA 2GV7A 2YMSD 4ZROA 2FXRA 4ISHH 2W3IA 1YLNA 1PYTD 1TQ0B 2ZTZA 1ELAA 2AYWA 2BZAA 1GJCB 1HYLA 1AB9B 1GVLA 1B7XB 2HNTF 4AG1A 1AFEH 2QIQA 1SGIB 1GG6B 2G51A 3P8NA 1GHWH 1LQDB 2FTMA 1QBVH 2F83A 3GCHC 5TJXA 5CHAB 2FWWA 2P93A 2WPMS 1MKWH 2XNIA 1YLDA 1G37A 1GJBB 3NWUA 2VU8E 1P2NA 1VITG 2W6JD 3GYMA 1EUFA 2G52A 4LXBH 2WHXA 3PV5A 1C4U2 5F8ZA 4YO9A 8LPRA 2GT8A 1MABB 2ZGXH 1CA0B 1C5SA 2BVSH 4AFZA 1BZXE 5DP4A 2P16A 1GBLA 2OLGA 2R2MB 1V2ST 4ISNA 2R0LA 9ESTA 2F9PA 2VNTA 1VITH 2OCVB 1UVOA 3RMNH 1SGFA 4K1TA 2KCYA 1F0SA 2XC0A 1QL8A 3A7TA 1J15A 1H1BA 3MOCA 3V0XA 1HJAB 4GCHF 3QGJA 1UCYK 2BD2A 2ZDKA 1BRUP 2AMPA 3C27B 3RXEA 2QXJA 3F6UH 3RXIA 4A5TS 3BTQE 4UEHH 1SGTA 3STIA 3ZZ9A 4GUXA 1GHYH 4NA7A 2KM0A 1AE8H 4LK4A 2DE8A 2ZDAH 4MNWA 4MNYA 1QB1A 3AW1A 2WINI 1Y59T 3CS7A 3OTPA 3T62A 5TCAA 4K1EA 2P94A 4I86A 5BRRE 1O38A 1TRMA 1AWHB 5DP5A 2HPPH 4NIWA 4AYVB 4WVPE 1F2SE 2P59A 2JIZD 2UWPA 3K9XB 3L33A 2F9BH 5F53A 1MKXK 3Q3YA 3RXKA 5LGOA 5FPYA 1VCWA 3TGJE 1IQJA 1UTKA 1V2RT 2ZG0H 5HXFA 3HK3B 4ISOA 4H42U 4ACBA 4F55A 1V6DA 4B6EA 3MYWA 1QBNA 3NK8A 1LKAA 3V7TA 3PMJA 3UFAA 4O3TA 3E16B 4WJG2 3M5NA 1FNIA 2OQ5A 5T3HA 2ZPSA 1F5RA 3ELAH 1EZSC 1WBGB 3RM2H 2GCTB 1KXBA 1NFWA 3VB3A 3T25A 1COWD 2O8LA 1A0HB 2XC4A 2TBSA 2VWOA 1DLEA 1HGTH 4Y10E 1F92A 4WMDA 2JETC 3VEQB 4TPYA 1WUNH 3OE7D 5JBTA 4Q4LA 5K7RA 5GCHF 1DXWA 2RG3A 3ESTA 1F5KU 3LU9B 2ESTE 2V3MA 3HGNA 3ZZ5A 1TYNA 4JZIA 3KN2A 3SHAH 5HM2A 5IDKA 2TGAA 2Y7XA 2FYRA 4H4FA 1VJAU 1GJ8B 2G8TA 1LHCH 3LDXH 1AMHA 3F2GA 2FEQH 1CHGA 3A80A 2THFB 1NT1A 4ISIH 3SBKA 3BTGE 1TIOA 1ZGIA 2JH0D 2SGPE 3N7EA 3FOAA 4IW4E 5I25A 5HYOA 4ABJA 3K6ZA 2HLDD 3M35A 5EJZA 1JIRA 1YP9A 4I8JA 2BXTH 3TJOA 3MU1A 1YGCH 1OWJA 1J17T 1O2MA 3M7UA 1ZSKA 2B5TB 1HXEH 3SUEA 1XMNB 1Y5UT 1JOUB 1O5EH 3DFLA 4B73A 3S69A 4HFPB 3L6PA 1H8IH 1O3BA 3A7XA 2GZ9A 3SU2A 1AN1E 1ACBE 1GCDA 1TLDA 5E2OA 4AN7A 3UTUH 2QYIA 4CREA 1FJSA 1UK4A 2ZU3A 5L30H 3S9AA 1G2MA 3F9HA 2VJ1A 4B71A 2ZCLP 1A5IA 1L1NA 2PKSC 2UUKB 3SNCA 5GXPA 2C8YB 4D76A 4TPIZ 4DY7B 3RXJA 3BTME 1P2IA 1WOFA 1O3DA 1Y3VA 2BQ7B 1GMCF 2K0QA 1G36A 3SUGA 4OS5A 1EAIA 7GCHG 2Q6DA 3RXQA 4XD7D 1O3HA 5J4SA 3B8JA 4B2AA 1C1RA 2Y80A 1P09A 1TRNA 1YM0A 1A2CH 1GL1A 4X1NU 1K22H 2KAIA 1BB0B 1QTFA 3G01A 5ABWA 1AI8H 4INLA 2FDAA 1YLCA 3QGNB 1A0JA 1INCA 5ETXA 3UB0A 4CH8B 3URCA 2ZTXA 3VB6A 4TY6A 4ZCNA 1EASA 2QF3A 1N6YA 3BEFB 1V2MT 1AIXH 2UWOA 3MU4A 3DSPA 1SC8U 1O3AA 1UVTH 3BN9A 3UNSA 1SGQE 3FVFB 8GCHG 4MPXA 2KCOA 1E35B 4JZ1A 4K8YA 4X1QU 3OFND 1Z8RA 2M2AA 1W0KD 1J9CH 1ZSJA 1GI1A 2BD9A 3TIUA 5JBCS 2BQ6B 4E7NA 4Y7AA 2GDDA 1JXPA 2IPHA 1EPTC 1SGCA 1O3NA 1W12U 1Z8JB 2ZGJA 1DUEA 1G9IE 4XBCA 1TPSA 1F0UA 3E3TA 3SJIA 4ACAA 1A0LA 1WV7H 1DITH 4CR5A 1MMJN 5LPRA 1HAGE 3WWBA 3HATH 2A4RA 4FUIA 1NN6A 4A1VA 1UTOA 2Q1JA 1ABIH 2V35A 3GCTF 3SZNA 4TYDA 4AG2A 1HAIH 3GY3A 1QFKH 1UHBA 5GJ4B 1MD7A 1YY3A 3RXSA 2NU4E 3NXPA 3SQHE 1IQHA 2OK5A 1OYQA 5A09A 1K1NA 1LMWB 4I8KA 3RU4D 4ZMAH 1BMLA 1V2QT 2CXVA 2Y5GA 4AGJA 2Y5HA 4IN2A 1GDNA 1RIWC 5CMXH 3RU4E 1S6LA 5A8XA 2JH5D 3U1IB 5DO4H 2IJOB 2WUCA 3PLPA 3RXLA 2ZU2A 3UIRA 4Y8ZA 4AC9A 1C5PA 1SGYE 1OWHA 2R3UA 1ANBA 1GBAA 4B74A 1TX6A 3FZZA 3MH7A 2CJIA 4JMYA 2VVVA 4GCHG 3OEHD 1DFPA 1ZJKA 3O8CA 1BOQA 5DPAA 4AORA 1GDUA 1O2YA 1BBRE 2A5KA 3HPTB 2ZPQA 1AZZA 1MKWK 1UTPA 4IC5A 1TQ7B 2ODYB 3TK5A 1HAXB 3SU5A 2J38A 1SSXA 4BTIB 1BTPA 3SJKA 2ZP0H 3M61U 1C5VA 2BY5X 3SNBA 1C1WH 1PQ8A 3V3MA 4Y0YE 1WTHD 2FESH 1XUKA 2J34A 1NRNH 3TK6A 4HI3A 2R2WU 5DP7A 4F48B 3OSYA 2Z6BD 3A8DA 3PLKA 3PV2A 3A8AA 1E38B 1V2UT 4IMQA 1HJ9A 2RA3A 1NPMA 1HPGA 1ELFA 4BAKB 3QLPH 5EW1H 2G81E 2FI5E 2LNCA 1ELBA 1C5XB 4K69A 3DCLA 3PYHA 1ZHRA 2KCAA 2ZHDA 1ESAA 3NUMA 1YPEH 2FP7B 3CP7A 2AS9A 1H8ED 2BLWA 2BQWB 1GJAB 3LJJA 4X2YA 2CF9H 3M7QA 3BG4C 1E37B 2Z7FE 1ZLRA 2J98A 2PGQB 1ELVA 2FOBA 1ORFA 1DE7H 1MZAA 1FI8A 5L6NH 3ITIA 1LVYA 4YOGA 1ZPCA 5EPNA 3M3SA 2HNTE 2TGPZ 3PTBA 5GCHG 1O39A 2PKAA 4ZUHA 3A7WA 1GCTB 1NRSH 1P05A 1FQ3A 5HM9A 2RDEA 3BEIB 4Z0KA 2PV9B 5A0BA 3PTNA 4X6PA 1SLVB 1WYKA 1ZYOA 6CHAC 2P8OC 2Q6FA 1GI3A 1RS0A 2EI8A 4GSOA 1LKBA 1ZMJA 1JBUH 3TPIZ 3R3GB 4NA9H 4WF8A 2GDEH 2BDGA 3WWFA 2Z9JA 3GDSA 4A92A 2PWXA 4CBNA 3A7ZA 3PLBA 4X8TH 4NSVA 1W10U 1TNHA 2BMGB 4IS5A 3RXPA 3RLYH 1XUGA 1L0ZA 4KTCA 2PW8H 2ZDMA 2ULLA 3NKKA 4JYTA 3VB5A 1OWEA 2VB0A 2OC7A 3F0PA 3M5MA 1CT2E 1F0RA 2UUJB 3S7KB 2CHAB 3KIDU 2QY0B 1MTNC 4Y6DA 3OU0A 5C5NA 2DE9A 3AAVA 4K5ZA 4H6SB 1V2PT 3MHWU 2ZFFH 1HRTH 4A7IB 4B75A 3K65B 3ZZ4A 3SU4A 4E7RG 2HALA 2J98B 4UONA 3UPEA 1XX9A 2XBVA 3GDVA 3E90B 5GDSH 3RMMH 6GCHF 2V3OH 4UFEH 3S9CA 1IQEA 3ZZDA 2H9HA 2FYQA 1O3CA 1C5LH 1O2SA 1XXDA 5JB9S 1G32B 2ZEBA 2ZGCA 3F68H 3RXBA 4ZKNU 4AFQA 5SGAE 1PPZA 2ILNA 4UFDH 1EAUA 1THRH 3SU0A 7ESTE 1HIAA 4BTUB 1L4DA 4X1SU 1FLEE 3LGTA 4YZUA 1TE0A 2J4IA 5DGJA 3VGCC 1VZQH 1M9UA 3KYFA 2J5UA 1VCQA 2IPQX 1AZ8A 1NESE 1Z8IB 3P6ZB 4D8NA 2DUCA 1MTUA 2CN0H 2AMDA 3ZZBA 3ENSB 3ZZ6A 2JJ1D 4ABGA 3T27A 4B6FA 1O2GH 1K0HA 4FOUC 4JK5A 2ZIQH 1BT7A 1P2QA 4NCYA 1PPGE 1WTGH 1AKSB 2XTTB 2IOTA 2HNTC 4TSFD 4X8SH 3A7VA 2ZGHA 2STBE 1SHYA 1ZSLA 2XBYA 4AX9H 1Z71A 4GLYA 5F03A 2PUQH 3BTTE 3PMHB 3DA9B 4CRAA 5JDUB 2VIOA 1CVWH 1AUJA 2XOKD 1CA8B 1A1RA 3FANA 3A8BA 3F2FA 4RI0A 3DFJA 4YOJA 9LPRA 1ZPZA 1P2MA 3VXFH 4OGYA 2WZQA 2JH6D 1Z1JA 1RJXB 1C1OA 3GCTG 4YOIA 1S6HA 1LDTT 1BBRK 2FOHA 2CMYA 3PM3A 3LGIA 4CRDA 2PSYA 1P12E 5EXLA 3IG6B 4U30A 2G5VA 2Z9KA 2V6NA 1ZR0A 2F9OA 3A89A 5A0CA 4AGKA 4PROA 2I6QA 4DIHH 2Z9IA 5H4IB 1A3BH 3JZ1B 3S7HB 4AB8A 1K21H 2F3CE 3C1KA 1VGCB 1N8OB 2C8WB 3M3TA 3VXEH 2VWMA 1IOEA 1YBWA 3BTKE 1ZZZA 3TITA 4WMEA 2F9UA 4Y79A 2TGTA 3B23B 1IQLA 4X2WA 2XWAA 3PRDA 3BF6H 3SOSA 4GVUA 2PSXA 4FXGH 1T8LA 1G2LA 3SO3A 1GJ9B 1TNKA 1A4WH 4I7YH 1XUFA 3AK5A 1OP0A 4FU8A 4YT7H 2R3YA 1DUAA 4MPUA 1QQUA 4KTUA 3QK1A 1JIMA 4INHA 1EJNA 2GMTB 4JZDH 4KTSA 1SB1H 3WW7A 2F9VA 1ELEE 4XRNA 4ASHA 3RXFA 3LKWA 2ZQ2A 1O5FH 3GY8A 1FN6A 1BTWA 2FOFA 1TNJA 1Y5AT 2FOGA 1LVOA 5F8XA 4CHAB 2F43B 1GBIA 1NM6A 1SBWA 4NIVA 4QT8C 3SJOA 4BOHA 1QCPA 1O32A 1DX5M 2AERH 1W11U 3EE0B 3O8RA 2ZFRH 3SUFA 4X2XA 1NBMD 4Q2KA 4R8TB 2PUXB 1MZDA 4I8GA 2OD3B 3UNQA 5DK1A 2Y81A 1G3EA 5G4BA 4U01A 1C4Y2 1NBME 5HGGA 1XVMA 3MNBA 1NRPH 5ESTE 1XKBC 1HFDA 1BMMH 3UNRA 5C2ZA 1YCPM 3T2NA 3P70B 1YYY1 3O8BA 3H09A 3LC3A 1HAZB 1MQ5A 4D9QA 4ISLA 1W0YH 2D2DA 3U1JB 1OYTH 3TNTA 1C5TA 1EOJA 1V2LT 5JBBS 3F9EA 4A6LA 2BD4A 3Q76A 2P3UB 5HIZA 1KY9A 5C3NA 3URDA 1YPHE 1TBZH 1TFXA 2B7DH 4THNH 1S85A 3OYPA 5EG4A 1W0JD 1O3FA 1UVPA 1GGDB 1TB6H 2H2ZA 3V13A 5E8EH 1MAYA 1P3CA 1PQ7A 3SUDA 1RTFB 1L2EA 2O9QA 3A86A 2J94A 2GZ8A 3P17H 3UREA 1NU7B 3SV6A 2AFQB 2PFEA 5A8YA 3M3VA 2VH6A 1GHAF 2PP6A 3FZDA 2C3SA 1W8BH 5EJLA 1C1QA 3GCHB 1BMAA 2OC0A 4MVNA 3D23A 1C2HA 2YMSC 3SHCH 1PYTC 1GBFA 2HOBA 1NFYA 2NU3E 3T28A 1GI2A 4MNXA 1V3XA 2FPZA 2KR7A 1LVMA 4ZHMU 3ATIA 4FUGA 3M7TA 1PPHE 4LOYH 2FM2A 1QR3E 1A7SA 1QQ4A 1CGIE 2WUBA 1FPHH 3FO8D 2R9PA 4OS6A 1BTHH 1P2KA 5E2PA 1C5MD 1GJ4H 2BXUH 3MU0A 4GAWA 1C1SA 3OY6U 1Y3XA 4NZLA 2J2UA 1GI6A 2VGCC 3ZVDA 2CGAA 3MH6A 5AVDA 1UW7A 6GCHG 1FZZA 1PPCE 1E0FD 4ABDA 4HTCH 2ZDLA 3T29A 1Z7KA 1LHGH 4AOQA 3GY7A 2Y7ZA 1KTSB 1GL0E 5B6OA 2BZ6H 1O2NA 2HWLB 5JBAS 1V2NT 2RCEA 5AFYH 5A0AE 1XVOA 2BX4A 3D49H 3GYLB 2VIQA 1O3EA 3I29A 4KP0A 1BUIA 4BAMB 2KFWA 1KDQA 1QA7A 1A3EH 1SPJA 4FUHA 1V2TT 1O2KA 5FXLA 2FZZA 1TRYA 3ODDA 1TGTA 1J16A 4E05H 1TPAE 1IAUA 3GY4A 1YKTA 2SNWA 3KEEA 4XE4A 1GBMA 1H8HD 2OP9A 4AZ2B 2FX4A 2ZFQH 5BPEA 1H9HE 1BRAA 1E79D 1PQ5A 1SQAA 1YPHC 3I77A 1N1LA 1SVPA 3AW0A 3QUMP 1GI9B 2XNDD 3GY6A 4AYYB 4FVBA 4BAOB 5HMAA 5F6MA 1ZHPA 4H6TA 1FIZA 1O2HA 1OP2A 3PMBB 1HAYB 5EPYA 1CE5A 4ASUD 3PRBA 3KGPA 3UWIA 1LO6A 3P8GA 4O3UA 5JB8S 1C1NA 1AHTH 1BBRH 2A4GA 2JETB 2CF8H 3HKJB 2XXLA 3SGAE 1O30A 3RC4A 1W13U 5F8TA 1H9LB 2BD3A 2ZPRA 1S6FA 2A7JA 2PHBA 5B6LA 1BQYA 5FL7D 3RDZA 3PWCA 1O2OA 2SGEE 2F4LA 3RXTA 3ZIAD 1TGSZ 2ANYA 2C8ZB 1EP6A 3UQOA 2G4TA 1GHVH 1NRQH 4FUBA 3DSGA 1NY22 3PO1C 3M5OA 1OWKA 2VINA 3FAOA 1NFUA 2QAAA 1AY6H 1OS8A 2BDAA 4P00A 4X6MA 4DOQA 3TGIE 3TVJB 3SU6A 1K2I1 3SW2B 1O2QA 1T4UH 3Q3KA 4HG6A 1QL7A 4FUEA 4FU9A 2F9NA 1AFQC 3U8OH 5EXMA 2XCNA 2V3HH 3PROA 1SGNE 1O5AB 4FUJA 4ZKSU 3U69H 1ANEA 2FODA 4NA8A 1BRCE 3SORA 3ZYDA 3F1SB 2BDCA 4WH6A 2GTBA 4YXWD 4CRCA 4D7FA 4VGCB 1CGJE 1EPTA 4ESTE 1ETRH 2KAIB 1C2FA 4AB9A 2P95A 2PKSB 1ETTH 1GMHF 3ZV8A 1DWDH 2BY9X 2W7SA 1ZGVA 6ESTA 5EGMA 4A1XA 1O2WA 3A81A 2ZECA 1O2XA 1GMDF 2V7QD 4K1SA 2JKHA 4OS1A 5T6FA 1EX3A 5DP8A 2Y6TA 1MU6B 4A1TA 4I31A 5CDFE 1VKYA 3ZZ7A 7KMEH 2KZ4A 4Q7YA 2WV4A 4R0IA 1AWFH 3BG8A 1MBQA 1SQRA 2AH4X 1TNGA 1FMGA 1TAWA 2SGQE 3M37A 3ATKA 5T1VA 3ZVAA 1YCPH 3ZVBA 1KTTB 2BX3A 1MCTA 2XC5A 4UFGH 2HVYB 1O3IA 2BDYA 3LOXA 2HGTH 3EA9A 1A46H 2O8UA 4MDSA 1GBBA 1P06A 1YPLH 2SGFE 2QXIA 1AE5A 3ZZAA 1VITF 2ZFPH 4KELA 1UHBB 1ABJH 1ESBA 4B76A 2ZGBH 2M5TA 4IGDA 4U32A 3FN8A 1OWIA 3U98H 3S9BA 3RXRA 4DT4A 2Q6GA 3I78A 4FUDA 3MH5A 2B0FA 4YM9A 4NFFA 1EPTB 1CT0E 3LJOA 1SLWB 3UQVA 2BLQA 4I8LA 2ANMH 1FIWA 2WPKS 5DSFA 4HZHA 1K1JA 2HLCA 4ABFA 1EJAA 3LGVA 2PLXA 3B9FH 1MQ6A 5EOKA 4IC6A 1GJ5H 4DURA 1CO7E 1GHAG 4D7GA 3QZRA 4BAHB 1V2JT 4B1TA 5FPTA 3LGWA 4E06H 4RT0A 1SR5C 3P95A 1UMAH 1OP8A 1BDAA 1EQ9A 3DD2H 1ZMLA 1L4ZA 3R0FA 2ZU5A 3ZVEA 4GHQA 4X1RU 2FI4E 2BVRH 1ARBA 1P2JA 1P10A 3KF2A 1AD8H 1XKAC 1CBWC 3EDXB 2FX6A 3E0NB 1O2UA 1U6QA 1RIWB 1TPOA 2FOEA 1BTXA 3VG8A 1H8DH 2WYGA 3K2UA 3ATWA 2ODQA 3OX7U 1O3JA 1TA6A 3FP6E 1GJDB 3SV2H 4Z6AH 4CRBA 3UR9A 4I33A 5AF9H 5DN6D 2WPIS 4RKOB 2IN2A 1FXYA 5DKMA 1DANH 2OBQA 2GV6A 1MD8A 3MO6A 2G55A 1SHHB 2W26A 1P3EA 3QZQA 3MWIU 3LC5A 1P03A 1G3CA 1RFNA 3KNXA 3RU4T 3SYJA 1P11E 2ZU4A 3ZV9A 2ALPA 3A88A 1Y3UA 2XBXA 1UCYE 1W14U 1UVUH 3N7OA 1F0TA 1EATA 1ELDE 2H9EH 1HAOH 2BB4A 2ZFSA 1B0EA 1HJ8A 1EAWA 4SGBE 1DICA 1H4WA 1V2KT 3NPSA 2ZCHP 3KQDA 1AQ7A 1UTNA 3SGQE 1C1VH 3NCLA 4K60A 4I32A 3TJVA 3RXVA 2NWNA 1O36A 1BCUH 4FETA 6LPRA 1S0QA 1ESTA 1HXFH 1D6WA 1ZTLA 1GMCG 1OKXA 1GBCA 2FMJA 2PKAB 4SGAE 4HGCA 1QJ1B 1TGCA 2SGAA 3PV4A 1LQEA 1QRZA 1TX7A 4YT6H 1KMHB 3F9GA 3GDUA 1BITA 2EI7A 5EQRA 4MPVA 1NFXA 3GCNA 3RXMA 1O34A 1N8OC 3UOPA 1HV7A 1DY9A 4CR9A 1O5BB 2BDIA 1BA8B 3BG4B 1C5ZB 1HNEE 1C1PA 5JYIA 2Y82A 4DJZB 4DT7B 1FY3A 2UUYA 2TRMA 1AB9C 1O3LA 1CQQA 2LELA 2D8WA 2FOAA 2RA0A 4BANB 3CS0A 2VIPA 1GG6C 3QN7A 3BEUA 4MG3A 1UTJA 5CHAC 2W6ID 2A31A 3LPRA 2WV9A 2ZA5A 5FBEA 4YLQH 5IK2D 5C5OA 1L1GA 1TNIA 3SNAA 3OTJE 1T7CA 4ZXXH 6CHAB 2P8OB 3IITA 5EU8A 1CA0C 1GI5A 3SN8A 1LPKB 4CBOA 1D3TB 4NZQA 4Y76A 3RXGA 5A2MH 3TK9A 2JDID 1XM1A 3H7OA 2OC1A 3V12A 1ETSH 2BOHB 2ZC9H 3VPKA 2GP9B 1EZQA 1AO5A 2ZHEH 3MI4A 2KCPA 3MO3A 5C67A 4MNVA 2ANKH 1UK2A 4UFFH 4KKDA 1WQVH 1EZXC 3ZVGA 1LPGB 2ZI2H 1Z6EA 1HJAC 1UTLM 2H5CA 3ZVFA 4ZHLU 2VWNA 2A2QH 4ZHAA 2P3TB 1MTNB 3LGUA 3ATLA 2BOKA 3QTVH 1SMFE 1GHBF 2PR3A 1HIAB 2QF0A 3ZYEA 1DWBH 1P01A 5AFZH 4DGJA 3SI4H 3SU1A 1Q31A 5EW2H 1KSNA 2OBOA 1GMHG 3RP2A 1G3BA 1MU8B 2A5IA 3KL6A 1VR1H 2PGBB 1L1JA 3EE7A 1RD3B 1GMDG 2BYAX 3RC5A 4KGAA 1LVBA 7LPRA 4RN6A 1BIOA 1OSSA 1RTKA 2A4OA 1AVWA 1C5UA 1YPKH 1ZRKA 3BIUH 1E34B 5T6GA 3STJA 5C1UA 1TBRH 1O3PB 1ZPBA 2ZHWH 3FP8E 5C1YA 4JK6A 1O0DH 1HAHH 2ZHQH 4Y8YA 4FU7A 3VGCB 1BJUA 1Z6JH 1AVXA 1KXEA 1DM4B 1F7ZA 1LTOA 1EOLA 4YTAA 5TCCA 4DVAU 1DWCH 1K9OE 2ZU1A 4RT1A 1MH0A 2VIWA 4XFQA 1BHXB 2GCTC 2PTCE 1A5GH 1O2IA 3BTHE 2D1JA 3T26A 4JYUH 1JWTA 1ANCA 1TABE 1GVZA 1K1IA 2OC8A 2STAE 2RDLA 2XYAA 3O8DA 1W7GH 5FHTA 3U28C 5C0TA 1OOKB 4INKA 1LHDH 3KCGH 1O35A 1GDQA 1E1QD 3D62A 2GVFA 4TT3D 1ZRBA 1TGNA 1YC0A 1GI8B 2QXHA 3RUOA 2VVUA 1D4PB 5HIYA 1SQTA 4WH8A 1C5YB 1O2TA 1C2MA 2BM2A 3JZ2B 3F9FA 2RFKC 1C5OH 5FX5A 3KHVA 2H9TH 4OGXA 2BDHA 4OS2A 3SV7A 1QRXA 2BY8X 2FLBH 1SFQB 1LCYA 3W1EA 1Y5BT 2A2XH 1X7AC 2GCHF 5E0JA 1GPZA 3ZZ3A 1OX1A 4RKJB 4MTBA 1YCPK 2WV5A 4DW2U 1DOJA 2J95A 4UE7H 1QURH 1TOMH 2XW9A 3U8RH 2SNVA 4K8BA 1Y8TA 3ATMA 5KEDA 2GKVE 2GD4B 1SGRE 1THSH 3SGBE 1PPBH 4JZFH 2BLVA 4BXWA 1FV9A 1JMOH 2K8IA 1WAYB 2AHME 1XUIA 3DT0H 1MAXA 1P57B 5FPSA 3SNEA 2WYJA 3AVZA 4CRGA 2BD7A 1V2OT 1O37A 2QN5T 2YNBA 4NFEA 3RMLH 2G5NA 1C5QA 4M9FA 3LGYA 2OXSA 5ESBA 5EIYA 3VB7A 5EJ1A 3MTYA 2EI6A 4P02A 1CHOF 1E1RD 3RXHA 1TX8A 1S83A 1VCPA 3LONA 1EB2A 1J14A 1Y3YA 2XCFA 3FKSD 1K1PA 3N99A 3SJ9A 2QXGA 3LH3A 5J4QA 3H5CB 1MTSA 2NU2E 3EQ0H 4Y0ZE 3U8TH 4Q63A 2VIVA 1P04A 4NSYA 2BTCE 1W3CA 2ZDVH 3W94A 1DSTA 1ZTKA 2J9NA 3OEED 1RRKA 4J1YA 4Z1MD 1DY8A 1YPJH 4O9VA 1G3DA 1W7XH 3KYGA 1WQSA 1UO6A 3N7DA 1GBTA 1PFXC 5IYTA 3D65E 1TGBA 1SG8B 1P02A 4B2CA 4Q80A 4ZH8A 3QO6A 1Y3WA 2EEKA 3E1XB 2FTLE 3GCOA 5PTPA 4XOJA 1EB1H 2CV3A 1OPHB 2W3KA 2BDBA 2QE7D 1AGJA 4ZXYH 4X1PU 1ZOMA 1CGHA 4FVDA 1ANDA 3EAJA 1C2KA 3Q77A 4MQAA 1Q3XA 2VIDA 1FPCH 3GY5A 2Z3CA 3TH4H 4Y8XA 1GVKB 3BTDE 2AIPA 1DS2E 1KYNA 1P9UA 4AFSA 1PQAA 1C2IA 1IQNA 1S5SA 3BTEE 1UVSH 3KQBA 1E36B 4JYVH 1NRRH 2CK3D 1S81A 1XXFA 4F4OC 1W2KH 3MU5A 4UDWH 2Z94A 2H5DA 3EA8A 1TBQH 2I6SA 1HB0B 5I46H 1P2OA 5EQSA 1TOCB 1C5WB 2A45B 5DP9A 4XDEA 2EA3A 1ELCA 1EKBB 1DT2A 1K1MA 5AHGH 2G4UA 4VGCC 1GI0A 2R0KA 1S0RA 1QGFA 3PWBA 1A5HA 1TMBH 5FCRA 1BMNH 1GBEA 1ZJDA 1D3DB 1UTQA 2C8XB 2O8WA 1QZ8A 1HCGA 1TMTH 1O2VA 3MNSA 1O2PA 1IHTH 3F3BA 2Z9LA 3UR6A 2FI3E 5EQQA 1QJ6B 3A83A 1O5GH 2W5EA 2YMSB 3KQ5A 1SOTA 3QX5H 1MTWA 1NTPA 1O3OA 2K1QA 3M5LA 2ZWLH 4TWYA 4Y71A 4K3JA 4BNRA 1GJ7B 3HGPA 1XUJA 2HVXA 2BHGA 1PPFE 1HAVA 3TH2H 4TWWA 1KLIH 1GHBG 1GBHA 1JRSA 2FIRH 3ZZCA 3NRLA 1FAXA 4WXIA 1RXPA 5GNDA 4DCDA 2F91A 4LZ1H 1T8MA 3MU8A 1V2VT 1KDQB 4I8HA 1QY6A 1QB6A 2ANWA 2GJGA 1KXAA 3DHKH 1QNJA 1KLTA 1TWXB 2VGCB 1ZMNA 5CE1A 1GJ6A 2HRVA 3BSQA 3SV9A 1WSSH 3MQKC 4FUFA 1QHRB 1DVAH 2FLRH 3UAIC 4TY7A 4K2YA 4ABAA 2GX4A 2UWLA 1HAPH 1NO9H 3MFJA 3P92A 4OS4A 3OAAD 3ZZ8A 8ESTE 3P8OA 4ABEA 3A7YA 3EGKH 1QA0A 1O31A 2A1DB 1PPEE 1BTUA 1O33A 2A4QA 3U9AH 1SFIA 2LPRA 1C1UH 1P9SA 4XBBA 2Z3DA 1GBDA 2A7HA 3WY8A 1C2JA 2HPQH 2L74A 4XBDA 3RXAA 2GGVB 3L3TA 2OTVA 3RXCA 2BY7X 1C1TA 2NU0E 1GCTC 3F0OA 4X2VA 1GHXH 1W0ZU 1HAVB 1DDJA 4WXVA 4FUCA 2H1UA 2OUAA 1EZUC 1HUTH 1TPPA 4WWYA 1AU8A 1MTVA 2TIOA 2IJD1 1TALA 1CT4E 1ELGA 2XWBI 3K6YA 2W7UA 1BRBE 4X8VH 3RMOH 5FBIA 4U2WA 1KLJH 3ODFA 1SGPE 2J97A 3BTWE 3CNRA 5A8ZA 1QB9A 3MNCA 2KX4A 2GCHG 5GIBA 3LH1A 3CENA 1UCYH 2G00A 1BTZA 1SI5H 1EJMA 1TMUH 1O2ZA 3GOVB 3AASA 2WSSD 3GICB 2A7CA 2AMQA 1A61H 1HBTH 4ZKOU 3OY5U 2QV1A 3HK6B 2ALVA 2YOLA 4X8UH 3A85A 1D3PB 1T8NA 3A8CA 4DIIH 5FCKA 3MNXA 3RC6A 1Z8GA 3SV8A 1YPMH 2CHAC 5GPIB 5E0HA 1LHFH 3SI3H 1D6RA 1O2RA 1SL3A 4BTTB 2ODPA 1RGQA 1ARCA 3PO1B 8KME2 5T6DA 2BD8A 3KQCA 2VVCA 5LPFA 3UWJH 1RTLA 4IN1A 4NWLA 1SGFG 3E6PH 1MKXH 2EC9H 1GWAA 4O97A 3TGKE 4M7GA 2D26C 3UY9A 1OXGA 1CHOG 3ZVCA 1DWEH 1NROH 1LHEH 3GISB 1FAKH 1TONA 1AFQB 2OQUA 2QGRA 1FY8E 3SNDA 4Y11E 1ID5H 1P8VC 4BXSA 1J8AA 2QF5A 5DJ7A 1B5GH 4NG9H 4MLFB 1O2LA 1QL9A 3BIVH 1C5RA 4OM9A 5EODA 4ABHA 3LIWA 2LP6A 3E8LA 3A82A 4IMZA 1CSOE 1MBMA 1KXCA 5C94A 1QIXB 4Q7ZA 5DP3A 2TGDA 2YNAA 1HLTH 2VWLA 1SQOA 1DXPA 2FO9A 2XRCA 5CHBA 1THPB 2O8MA 4NIYA 2GZ7A 1UTMA 4MPWA 4GPGA 2P3FH 3VFEA 5LPEA 1JRTA 2OINA 2V0BA 2WPHS 3EYDA 2EQNA 1SLXB 4B2BA 1IQIA 1FONA 5FAHA 3RXOA 1K1LA 1C2EA 4OS7A 4YESB 2ZHFH 2J92A 3Q3XA 3S0NA 2ZFTA 1TNLA 2A5AA 4ABBA 1SGDE 3TLOA 1P0SH 3PMAB 1FY4A 1T4VH 4ZAEA 4XSKU 1SKYE 1O5DH 2JJ2D 3TNSA 1GBJA 2UUFB 1OWDA 3T5FH 2B8OH 3RXDA 1O2JA 5C0UA 1IQGA 2WPJS 1Q2WA 1FDPA 1C4V2 3NZIA 1ZTJA 2BLOA 1GHZA 1FX0B 4JZEH 1S82A 1B0FA 1C5NH 3BTFE 3AAUA 4CH2B 3SZEA 2VBCA 2O8TA 3KQEA 1O5CB 1PJPA 3VB4A 3SQEE 1T8OA 1TA2A 1D3QB 1AKSA 1OHHD 3TJUA 1FN8A 3RM0H 3EA7A 2ZZUH 1EFRD 1QJ7B 4F49A 1NS3A 5GWZA 3MO9A 2ZDNA 1V2WT 4DG4A 1KXDA 1IQKA 2AGGX 3BV9B 3IWMA 1VGCC 1WDIA 1ZHMA 1H9IE 3E91A 2ZKSA 3Q00A 1S84A 1YWUA 5LH8A 1NZQH 4IBLH 4J2YB 5DG6A 3SU3A 1KIGH 4Y7BA 4CRFA 1WCZA 1G30B 1EAXA 2VH0A 2QCYA 5E0GA 3A87A 1MUEB 1T32A 1WU1A 2PTNA 3DSOA 4WY3A 2ZQ1A 3F2HA 4ABIA 3M36A 4Q7XA 1QRWA 1BMFD 5C20A 4JCNA 1O3KA 1T31A 2TPIZ 1K1OA 2A0QB 1N6XA 5EXNA 2AGIX 1WXRA 1IQFA 1DSUA 1CBWB 3TU7H 1EXFA 2EY4C 2Z3EA 1YF4A 1HDTH 2GMTC 1NU9A 1K28D 4ZKRU 1UK3A 5JPMH 1GBKA 2ZTYA 4GHTA 1BJVA 4RSPA 4NIXA 3UUZA 4CHAC 2AIQA 1C2LA 1SGEE 1C2GA 3QWCH 4X6NA 4UD9H 4X0WU 3MH4A 1F5LA 2XBWA 2GT7A 3QDZB 2BY6X 2ZNKH 3A84A 2WPDD 5HKKD 2AGEX 4WMFA 2NU1E 3MMGA 1IHSH 2AEIH 1C9PA 3W95A 7GCHF 1GI7B 1UJ1A 1FY5A 3RLWH 3HKIB 5L2ZH 1DPOA 3TH3H 1C9TA 1O3MA 1AVGH 2SFAA 1EP5A 1DLKB 2WPLS 4LZ4B 2H6MA 3H7TA 1YPGH 2Y5FA 4X6OA 2ZO3H 5C1XA 3GS9A 3FFGA 1CU1A 1BTYA 1ELTA 2FS8A 5DP6A 5L2YH 4YLUA 4AFUA 1NC6A 2QF4A 1MCVA 2BVXH 3FP7E 3UOUA 1QBOA 2BD5A 4D9RA 1SLUB 3PB1E 4BAQB 1C2DA 2C93B 1KXFA 2A32A 2SGDE 1VJ9U 2B9LA 2ZF0H 5FX6A 1FY1A 5KGOA 4NGAH 3E0PB 2C90B 4NWKA 2QA9E 1XUHA 1GI4A 3RXUA 2C4FH 2FS9A 8GCHF 5K0HA 1LPZB 3DUXH 1FUJA 1O3GA 1AUTC 2ZCKP 1D9IA 3GY2A 3P8FA 1GGDC 1SOZA 3TJNA 2FOMB 2ASUB 4O03A 1IQMA
chains in the Genus database with same CATH topology
1BHXF 2FOCA 1Z1IA 3LT3A 3QTOH 2Z9GA 2QC2A 1C1MA 3SJ8A 2GV7A 4ZROA 2FXRA 4ISHH 2W3IA 1PYTD 1TQ0B 2ZTZA 1ELAA 2AYWA 2BZAA 1GJCB 1HYLA 1AB9B 1GVLA 1B7XB 2HNTF 4AG1A 1AFEH 2QIQA 1SGIB 1GG6B 2G51A 3P8NA 1GHWH 1LQDB 2FTMA 1QBVH 2F83A 3GCHC 5TJXA 5CHAB 2FWWA 2P93A 2WPMS 1MKWH 2XNIA 1YLDA 1G37A 1GJBB 3NWUA 2VU8E 1P2NA 1VITG 3GYMA 1EUFA 2G52A 4LXBH 1C4U2 5F8ZA 4YO9A 8LPRA 2GT8A 2ZGXH 1CA0B 1C5SA 2BVSH 4AFZA 1BZXE 5DP4A 2P16A 1GBLA 2OLGA 2R2MB 1V2ST 4ISNA 2R0LA 9ESTA 2F9PA 2VNTA 1VITH 2OCVB 1UVOA 3RMNH 1SGFA 4K1TA 1F0SA 2XC0A 1QL8A 3A7TA 1J15A 1H1BA 3MOCA 3V0XA 1HJAB 4GCHF 3QGJA 1UCYK 2BD2A 2ZDKA 1BRUP 2AMPA 3C27B 3RXEA 2QXJA 3F6UH 3RXIA 4A5TS 3BTQE 4UEHH 1SGTA 3STIA 3ZZ9A 4GUXA 1GHYH 4NA7A 1AE8H 4LK4A 2DE8A 2ZDAH 4MNWA 4MNYA 1QB1A 3AW1A 2WINI 1Y59T 3CS7A 3T62A 5TCAA 4K1EA 2P94A 5BRRE 1O38A 1TRMA 1AWHB 5DP5A 2HPPH 4NIWA 4AYVB 4WVPE 1F2SE 2P59A 2UWPA 3K9XB 3L33A 2F9BH 3RXKA 1MKXK 3Q3YA 5LGOA 5FPYA 1VCWA 3TGJE 1IQJA 1UTKA 1V2RT 2ZG0H 5HXFA 3HK3B 4ISOA 4H42U 1V6DA 3MYWA 1QBNA 3NK8A 1LKAA 3V7TA 3PMJA 3UFAA 4O3TA 3E16B 4WJG2 3M5NA 1FNIA 2OQ5A 5T3HA 2ZPSA 1F5RA 3ELAH 1EZSC 1WBGB 3RM2H 2GCTB 1KXBA 1NFWA 3VB3A 3T25A 2O8LA 1A0HB 2XC4A 2TBSA 2VWOA 1DLEA 1HGTH 4Y10E 1F92A 4WMDA 2JETC 3VEQB 4TPYA 1WUNH 5JBTA 5K7RA 5GCHF 1DXWA 2RG3A 3ESTA 1F5KU 3LU9B 2ESTE 3HGNA 3ZZ5A 1TYNA 4JZIA 3KN2A 3SHAH 5HM2A 5IDKA 2TGAA 2Y7XA 2FYRA 4H4FA 1VJAU 1GJ8B 2G8TA 1LHCH 3LDXH 1AMHA 2FEQH 1CHGA 3A80A 2THFB 1NT1A 4ISIH 3SBKA 3BTGE 1TIOA 1ZGIA 2JH0D 2SGPE 4IW4E 5I25A 5HYOA 4ABJA 3K6ZA 3M35A 1JIRA 1YP9A 4I8JA 2BXTH 3TJOA 3MU1A 1YGCH 1OWJA 1J17T 1O2MA 3M7UA 1ZSKA 2B5TB 1HXEH 3SUEA 1XMNB 1Y5UT 1JOUB 1O5EH 3DFLA 4B73A 3S69A 4HFPB 3L6PA 1H8IH 1O3BA 3A7XA 2GZ9A 3SU2A 1AN1E 1ACBE 1GCDA 1TLDA 5E2OA 4AN7A 3UTUH 2QYIA 4CREA 1FJSA 1UK4A 2ZU3A 5L30H 3S9AA 1G2MA 3F9HA 2VJ1A 4B71A 2ZCLP 1A5IA 1L1NA 2PKSC 2UUKB 3SNCA 5GXPA 2C8YB 4D76A 4TPIZ 4DY7B 3RXJA 3BTME 1P2IA 1WOFA 1O3DA 1Y3VA 2BQ7B 1GMCF 3SUGA 1G36A 4OS5A 1EAIA 7GCHG 2Q6DA 3RXQA 1O3HA 5J4SA 3B8JA 4B2AA 1C1RA 2Y80A 1P09A 1TRNA 1YM0A 1A2CH 1GL1A 4X1NU 1K22H 2KAIA 1BB0B 1QTFA 3G01A 5ABWA 1AI8H 4INLA 2FDAA 1YLCA 3QGNB 1A0JA 1INCA 5ETXA 4CH8B 3URCA 2ZTXA 3VB6A 4TY6A 1EASA 2QF3A 1N6YA 3BEFB 1V2MT 1AIXH 2UWOA 3MU4A 1SC8U 1O3AA 1UVTH 3BN9A 3UNSA 1SGQE 3FVFB 8GCHG 4MPXA 1E35B 4JZ1A 4K8YA 4X1QU 1Z8RA 1J9CH 1ZSJA 1GI1A 2BD9A 3TIUA 5JBCS 2BQ6B 4E7NA 4Y7AA 2GDDA 1JXPA 2IPHA 1EPTC 1SGCA 1O3NA 1W12U 1Z8JB 2ZGJA 1DUEA 1G9IE 4XBCA 1TPSA 1F0UA 3E3TA 3SJIA 1A0LA 1WV7H 1DITH 4CR5A 1MMJN 5LPRA 1HAGE 3HATH 2A4RA 4FUIA 1NN6A 4A1VA 1UTOA 2Q1JA 1ABIH 2V35A 3GCTF 3SZNA 4TYDA 4AG2A 1HAIH 3GY3A 1QFKH 1UHBA 5GJ4B 1MD7A 3RXSA 2NU4E 3NXPA 3SQHE 1IQHA 1OYQA 5A09A 1K1NA 1LMWB 4I8KA 3RU4D 4ZMAH 1BMLA 1V2QT 2CXVA 2Y5GA 4AGJA 2Y5HA 4IN2A 1GDNA 1RIWC 5CMXH 3RU4E 5A8XA 2JH5D 3U1IB 5DO4H 2IJOB 2WUCA 3PLPA 3RXLA 2ZU2A 3UIRA 4Y8ZA 1C5PA 1SGYE 1OWHA 2R3UA 1ANBA 1GBAA 4B74A 1TX6A 3FZZA 3MH7A 2CJIA 4JMYA 2VVVA 4GCHG 1DFPA 1ZJKA 3O8CA 1BOQA 5DPAA 4AORA 1GDUA 1O2YA 1BBRE 2A5KA 3HPTB 2ZPQA 1AZZA 1MKWK 1UTPA 4IC5A 1TQ7B 2ODYB 3TK5A 1HAXB 3SU5A 2J38A 1SSXA 4BTIB 1BTPA 3SJKA 2ZP0H 3M61U 1C5VA 2BY5X 3SNBA 1C1WH 1PQ8A 3V3MA 4Y0YE 1WTHD 2FESH 1XUKA 2J34A 1NRNH 3TK6A 4HI3A 2R2WU 5DP7A 3OSYA 2Z6BD 3A8DA 3PLKA 3A8AA 1E38B 1V2UT 4IMQA 1HJ9A 2RA3A 1NPMA 1HPGA 1ELFA 4BAKB 3QLPH 5EW1H 2G81E 2FI5E 2LNCA 1ELBA 1C5XB 4K69A 3PYHA 1ZHRA 2ZHDA 1ESAA 3NUMA 1YPEH 2FP7B 3CP7A 2AS9A 2BLWA 2BQWB 1GJAB 3LJJA 4X2YA 2CF9H 3M7QA 3BG4C 1E37B 2Z7FE 1ZLRA 2PGQB 1ELVA 2FOBA 1ORFA 1DE7H 1MZAA 1FI8A 5L6NH 3ITIA 1LVYA 4YOGA 1ZPCA 5EPNA 3M3SA 2HNTE 2TGPZ 3PTBA 5GCHG 1O39A 2PKAA 4ZUHA 3A7WA 1GCTB 1NRSH 1P05A 1FQ3A 5HM9A 3BEIB 4Z0KA 2PV9B 5A0BA 3PTNA 4X6PA 1SLVB 1WYKA 1ZYOA 6CHAC 2P8OC 2Q6FA 1GI3A 1RS0A 2EI8A 4GSOA 1LKBA 1ZMJA 1JBUH 3TPIZ 3R3GB 4NA9H 4WF8A 2GDEH 2BDGA 2Z9JA 3GDSA 4A92A 2PWXA 4CBNA 3A7ZA 3PLBA 4X8TH 4NSVA 1W10U 1TNHA 2BMGB 4IS5A 3RXPA 3RLYH 1XUGA 1L0ZA 4KTCA 2PW8H 2ZDMA 2ULLA 3NKKA 4JYTA 3VB5A 1OWEA 2VB0A 2OC7A 3M5MA 1CT2E 1F0RA 2UUJB 3S7KB 2CHAB 3KIDU 2QY0B 1MTNC 4Y6DA 3OU0A 5C5NA 2DE9A 3AAVA 4K5ZA 4H6SB 1V2PT 3MHWU 2ZFFH 1HRTH 4A7IB 4B75A 3K65B 3ZZ4A 3SU4A 4E7RG 2HALA 4UONA 3UPEA 1XX9A 2XBVA 3GDVA 3E90B 5GDSH 3RMMH 6GCHF 2V3OH 4UFEH 3S9CA 1IQEA 3ZZDA 2H9HA 2FYQA 1O3CA 1C5LH 1O2SA 1XXDA 5JB9S 1G32B 2ZEBA 2ZGCA 3F68H 3RXBA 4ZKNU 4AFQA 5SGAE 1PPZA 2ILNA 4UFDH 1EAUA 1THRH 3SU0A 7ESTE 1HIAA 4BTUB 1L4DA 4X1SU 1FLEE 3LGTA 4YZUA 1TE0A 2J4IA 5DGJA 3VGCC 1VZQH 1M9UA 1VCQA 1AZ8A 1NESE 1Z8IB 3P6ZB 4D8NA 2DUCA 1MTUA 2CN0H 2AMDA 3ZZBA 3ENSB 3ZZ6A 4ABGA 3T27A 1O2GH 4JK5A 2ZIQH 1BT7A 1P2QA 4NCYA 1PPGE 1WTGH 1AKSB 2XTTB 2IOTA 2HNTC 4X8SH 3A7VA 2ZGHA 2STBE 1SHYA 1ZSLA 2XBYA 4AX9H 1Z71A 4GLYA 5F03A 2PUQH 3BTTE 3PMHB 3DA9B 4CRAA 5JDUB 2VIOA 1CVWH 1AUJA 1CA8B 1A1RA 3FANA 3A8BA 3DFJA 4YOJA 9LPRA 1ZPZA 1P2MA 3VXFH 4OGYA 2JH6D 1Z1JA 1RJXB 1C1OA 3GCTG 4YOIA 1S6HA 1LDTT 1BBRK 2FOHA 2CMYA 3PM3A 3LGIA 4CRDA 2PSYA 1P12E 5EXLA 3IG6B 4U30A 2G5VA 2Z9KA 2V6NA 1ZR0A 2F9OA 3A89A 5A0CA 4AGKA 4PROA 2I6QA 4DIHH 2Z9IA 5H4IB 1A3BH 3JZ1B 3S7HB 4AB8A 1K21H 2F3CE 3C1KA 1VGCB 1N8OB 2C8WB 3M3TA 3VXEH 2VWMA 1IOEA 1YBWA 3BTKE 1ZZZA 3TITA 4WMEA 2F9UA 4Y79A 2TGTA 3B23B 1IQLA 4X2WA 2XWAA 3BF6H 3SOSA 4GVUA 2PSXA 4FXGH 1T8LA 1G2LA 3SO3A 1GJ9B 1TNKA 1A4WH 4I7YH 1XUFA 1OP0A 4FU8A 4YT7H 2R3YA 1DUAA 4MPUA 1QQUA 4KTUA 3QK1A 1JIMA 4INHA 1EJNA 2GMTB 4JZDH 4KTSA 1SB1H 2F9VA 1ELEE 4ASHA 3RXFA 3LKWA 2ZQ2A 1O5FH 3GY8A 1FN6A 1BTWA 2FOFA 1TNJA 1Y5AT 2FOGA 1LVOA 5F8XA 4CHAB 1GBIA 1NM6A 4NIVA 1SBWA 4QT8C 3SJOA 4BOHA 1QCPA 1O32A 1DX5M 2AERH 1W11U 3EE0B 3O8RA 2ZFRH 3SUFA 4X2XA 4Q2KA 4R8TB 2PUXB 1MZDA 4I8GA 2OD3B 3UNQA 5DK1A 2Y81A 1G3EA 5G4BA 4U01A 1C4Y2 5HGGA 1XVMA 3MNBA 1NRPH 5ESTE 1XKBC 1HFDA 1BMMH 3UNRA 5C2ZA 1YCPM 3T2NA 3P70B 1YYY1 3O8BA 3LC3A 1HAZB 1MQ5A 4D9QA 4ISLA 1W0YH 2D2DA 3U1JB 1OYTH 3TNTA 1C5TA 1EOJA 1V2LT 5JBBS 3F9EA 4A6LA 2BD4A 3Q76A 2P3UB 1KY9A 5C3NA 3URDA 1YPHE 1TBZH 1TFXA 2B7DH 4THNH 1S85A 3OYPA 5EG4A 1O3FA 1UVPA 1GGDB 1TB6H 2H2ZA 3V13A 5E8EH 1MAYA 1P3CA 1PQ7A 3SUDA 1RTFB 1L2EA 2O9QA 3A86A 2J94A 2GZ8A 3P17H 3UREA 1NU7B 3SV6A 2AFQB 2PFEA 5A8YA 3M3VA 2VH6A 1GHAF 3FZDA 2C3SA 1W8BH 1C1QA 3GCHB 1BMAA 2OC0A 4MVNA 3D23A 1C2HA 3SHCH 1PYTC 1GBFA 2HOBA 1NFYA 2NU3E 3T28A 1GI2A 4MNXA 1V3XA 2FPZA 4ZHMU 1LVMA 3ATIA 4FUGA 3M7TA 1PPHE 4LOYH 2FM2A 1QR3E 1A7SA 1QQ4A 1CGIE 2WUBA 1FPHH 2R9PA 4OS6A 1BTHH 1P2KA 5E2PA 1C5MD 1GJ4H 2BXUH 3MU0A 4GAWA 1C1SA 3OY6U 1Y3XA 4NZLA 2J2UA 1GI6A 2VGCC 3ZVDA 2CGAA 3MH6A 5AVDA 6GCHG 1FZZA 1PPCE 1E0FD 4ABDA 4HTCH 2ZDLA 3T29A 1Z7KA 1LHGH 4AOQA 3GY7A 2Y7ZA 1KTSB 1GL0E 5B6OA 2BZ6H 1O2NA 2HWLB 5JBAS 1V2NT 2RCEA 5AFYH 5A0AE 1XVOA 2BX4A 3D49H 3GYLB 2VIQA 1O3EA 3I29A 4KP0A 1BUIA 4BAMB 1KDQA 1QA7A 1SPJA 1A3EH 4FUHA 1V2TT 1O2KA 5FXLA 2FZZA 1TRYA 3ODDA 1TGTA 1J16A 4E05H 1TPAE 1IAUA 3GY4A 1YKTA 2SNWA 3KEEA 4XE4A 1GBMA 2OP9A 4AZ2B 2FX4A 2ZFQH 5BPEA 1H9HE 1BRAA 1PQ5A 1SQAA 1YPHC 3I77A 1N1LA 1SVPA 3AW0A 3QUMP 1GI9B 3GY6A 4AYYB 4FVBA 4BAOB 5HMAA 5F6MA 1ZHPA 4H6TA 1FIZA 1O2HA 1OP2A 3PMBB 1HAYB 5EPYA 1CE5A 3KGPA 3UWIA 1LO6A 3P8GA 4O3UA 5JB8S 1C1NA 1AHTH 1BBRH 2A4GA 2JETB 2CF8H 3HKJB 2XXLA 3SGAE 1O30A 3RC4A 1W13U 5F8TA 1H9LB 2BD3A 2ZPRA 1S6FA 2A7JA 2PHBA 1BQYA 3RDZA 3PWCA 1O2OA 2SGEE 3RXTA 1TGSZ 2ANYA 2C8ZB 1EP6A 3UQOA 2G4TA 1GHVH 1NRQH 4FUBA 1NY22 3PO1C 3M5OA 1OWKA 2VINA 3FAOA 1NFUA 2QAAA 1AY6H 1OS8A 2BDAA 4X6MA 4DOQA 3TGIE 3TVJB 3SU6A 1K2I1 3SW2B 1O2QA 1T4UH 3Q3KA 1QL7A 4FUEA 4FU9A 2F9NA 1AFQC 3U8OH 5EXMA 2XCNA 2V3HH 3PROA 1SGNE 1O5AB 4FUJA 4ZKSU 3U69H 1ANEA 2FODA 4NA8A 1BRCE 3SORA 3ZYDA 3F1SB 2BDCA 4WH6A 2GTBA 4CRCA 4D7FA 4VGCB 1CGJE 1EPTA 4ESTE 1ETRH 2KAIB 1C2FA 4AB9A 2P95A 2PKSB 1ETTH 1GMHF 3ZV8A 1DWDH 2BY9X 2W7SA 1ZGVA 6ESTA 5EGMA 4A1XA 1O2WA 3A81A 2ZECA 1O2XA 1GMDF 4K1SA 2JKHA 4OS1A 5T6FA 1EX3A 5DP8A 2Y6TA 1MU6B 4A1TA 4I31A 3ZZ7A 7KMEH 4Q7YA 2WV4A 4R0IA 1AWFH 3BG8A 1MBQA 2AH4X