3P8OA

Crystal structure of hcv ns3/ns4a protease complexed with des-bromine analogue of bi 201335
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV serine protease NS3
publication title Combined X-ray, NMR, and kinetic analyses reveal uncommon binding characteristics of the hepatitis C virus NS3-NS4A protease inhibitor BI 201335.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 38
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8oA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3p8oA01
3RLYH 1MD7A 1OSSA 1YPMH 1O2MA 1DVAH 2OCVB 5TCAA 1KSNA 3UIRA 4U01A 1XUIA 1NN6A 2EI6A 1AHTH 4D7FA 1GJ6A 1EZXC 4X8VH 3PMAB 3RU4D 3BEUA 1KXDA 3L33A 3MU0A 1P8VC 1GG6C 4E7NA 3W94A 1KXCA 3EA9A 4WF8A 3A81A 4TYDA 1SGEE 3U8OH 4Z6AH 2J38A 2QV1A 3PV4A 2XCNA 2R0KA 1ZGIA 1YM0A 3ESTA 1IQMA 2FI4E 5HYOA 1BMAA 3TH2H 1GVKB 3T28A 3ZV9A 3D49H 1HAGE 1BHXF 1Z6JH 1HJAB 5GPIB 1DE7H 2BD8A 2A2XH 1ANEA 1W0YH 2RA0A 1GI3A 4YOGA 6CHAC 4YM9A 4B6FA 1O2IA 4NIXA 2ZHQH 3AASA 2FYQA 4UFDH 4Y6DA 5EXNA 1WTGH 2OTVA 2QA9E 3Q3XA 1UVOA 3SV2H 1C2LA 4AORA 2BD9A 1O3GA 5A2MH 1FY1A 3SUGA 1MAXA 1BRCE 1A3EH 4OGYA 1QQ4A 2VWLA 4X8SH 1FXYA 4RN6A 1TABE 2A7JA 3M3SA 2WINI 4DY7B 2O9QA 3N7OA 4DVAU 1T8LA 2A45B 3VB4A 1V2RT 2BLOA 2HLCA 3QUMP 3TH3H 4BAMB 1GBEA 1HNEE 1WV7H 3TGIE 5DG6A 5JPMH 4YT6H 5E2PA 5IYTA 1O3OA 1DLKB 3GY4A 2WUBA 1O2VA 1B0FA 3SZNA 1BTZA 3NK8A 4Z0KA 2QXJA 1T31A 4Q7YA 1O5BB 1V2JT 1K1IA 2ZTYA 3OX7U 1ZSKA 1ZMNA 3S0NA 2PW8H 2GT8A 3IITA 2ANKH 2VU8E 3QWCH 1B7XB 1TMTH 3RXCA 1FIWA 1RRKA 4K8BA 6GCHG 4H6TA 5DP6A 2A7CA 3SNEA 1W3CA 2XYAA 1TGNA 2J94A 4GHQA 1V2VT 1O5EH 1Z1JA 3TNSA 1CA8B 1TGSZ 1K2I1 1HFDA 1BDAA 1ORFA 3RM2H 1AD8H 3MTYA 3U98H 4D76A 2C90B 1HAPH 1T4UH 1O3HA 4UE7H 2VVVA 1Z71A 2ZEBA 3RXAA 3RC6A 4FUHA 2FI3E 3RDZA 1O0DH 2M5TA 1G32B 2A1DB 3A83A 3RMNH 1NFUA 4ZKNU 5GJ4B 5GXPA 3NZIA 3UWJH 3KEEA 4JZEH 5BRRE 3HKIB 4YT7H 3U1JB 1K1NA 2JH0D 1CBWB 1LHEH 1K1OA 4JYTA 3M37A 1ANCA 2FDAA 1O2JA 1DWBH 2ODPA 4WMFA 1C5XB 2VB0A 2ZIQH 7LPRA 1FPCH 2FM2A 4D9RA 9LPRA 1FJSA 1S82A 2NWNA 3K65B 3VXEH 1QJ6B 1ESTA 2BVXH 1O35A 4DCDA 4ZHAA 2V0BA 3UREA 2DE8A 1WTHD 1D3PB 1HUTH 3GDUA 2UUKB 1TGBA 5C1YA 1SGRE 1GDNA 1OWKA 5ABWA 3LU9B 1VCQA 2B7DH 4NIYA 5DGJA 1HIAA 4CRDA 1F0SA 1GJCB 2BTCE 5A0CA 2CXVA 2TGAA 2QXGA 1Q3XA 2BVSH 5A8ZA 1A5IA 3PROA 2PGBB 4ESTE 4O03A 2QXIA 2QCYA 4Y8ZA 1CA0C 1BJUA 2QC2A 5A0BA 4KP0A 1MTSA 1P06A 4NA7A 4A6LA 2ZFSA 4DURA 1F92A 1GJ8B 1W10U 2ZHWH 4HTCH 4XDEA 3SNDA 3TJOA 3ZZCA 1THRH 4INKA 5GWZA 4HGCA 1P10A 2G81E 5L2ZH 2BD7A 3LC5A 1U6QA 2FOMB 1PQ7A 1MKXK 1IQEA 1NU7B 3LKWA 2Q6GA 2Q6DA 5FPTA 2A4RA 1S0RA 1UK4A 4ABAA 2GV6A 1TGCA 1F5LA 1MZAA 3BSQA 3MH4A 1ETTH 1UTOA 2ZDNA 5E0GA 4NSVA 2NU3E 1O2YA 1PQ5A 4I33A 1H8IH 3OU0A 4Y76A 1CGHA 1SB1H 1MAYA 1QY6A 1EZUC 3FZDA 1A5GH 1N6XA 1T8MA 1G30B 1A0JA 1THSH 3RXLA 4INLA 3A7XA 1DDJA 1JBUH 2UUYA 2H2ZA 2FTMA 2GTBA 3BTTE 3PMBB 2BY5X 1EASA 3P95A 2Z9GA 1TNIA 2TRMA 3ELAH 3SU5A 1BITA 1EUFA 1Z8RA 2FWWA 4TY7A 1AN1E 3SOSA 1TX7A 3BTME 2H9EH 3ATMA 3ATWA 1V2LT 2FEQH 2CF8H 4RSPA 1QTFA 1ZOMA 2J95A 1RJXB 2OC0A 4GHTA 3AW1A 1EAUA 1XMNB 1LHGH 1MTVA 2TGTA 4E7RG 5FPSA 4K69A 1O5AB 1NZQH 3TK5A 1IQKA 4X2VA 2ZP0H 4ZXYH 2PR3A 3PM3A 1LPZB 2QXHA 3E3TA 3TPIZ 4BNRA 6ESTA 4Q80A 3FFGA 4Y0ZE 1SGIB 2B8OH 2FOGA 2A32A 3AK5A 1YCPK 1IOEA 2AFQB 2F3CE 1VJAU 1E36B 3SYJA 5DO4H 2PTCE 1VCPA 3Q3YA 2THFB 1C2DA 4A92A 1N1LA 4I8LA 1DUEA 1YYY1 1V2ST 1MH0A 1ZZZA 4IN1A 4JCNA 3BEIB 3B9FH 3DFJA 2SNWA 3KCGH 1V2KT 1C4V2 2EEKA 2GD4B 1J14A 3ITIA 2A4OA 3A82A 2UWLA 3VB3A 1L1GA 3M5LA 2Z9KA 3ATIA 1SGQE 3U8TH 2O8LA 1KTSB 2PUXB 1CGIE 3H09A 2Z9LA 4GUXA 3TH4H 2NU4E 2BDCA 2IN2A 3RXQA 1F0UA 1C2FA 1Y3WA 3CP7A 2CMYA 2GX4A 1XUJA 4MDSA 2NU2E 5DJ7A 4GLYA 2VH6A 4CH2B 3RXDA 1C9TA 4NZQA 1UTPA 1OP0A 2ZFFH 4Y7AA 3QZRA 1HJ8A 1FNIA 1TYNA 3RXTA 3U8RH 1Z6EA 2OD3B 4FUFA 2P8OB 1SLUB 2BLQA 2FIRH 1GI4A 4NA9H 3SUDA 1C2KA 2FX4A 4B71A 1MU8B 3F9GA 4ISLA 1SR5C 1QFKH 2IOTA 2JH5D 4FUCA 1ELEE 2QN5T 3VB6A 2YNAA 3OY6U 3SJIA 2Z9IA 2QY0B 2SGAA 6CHAB 1JIRA 3AAUA 1KTTB 5K0HA 4A1XA 4RKOB 1GI1A 2BDYA 2P94A 3PMJA 1ZPCA 2FOBA 2ZQ1A 2SGFE 3JZ2B 3O8DA 2G5VA 1OP2A 3GY6A 1WQVH 1BJVA 1ZGVA 2RA3A 3HGPA 4X1SU 1Z1IA 1O3IA 1C1WH 2HPQH 3SV7A 1V2PT 4CBOA 1CBWC 1ARCA 1BQYA 4CREA 1P2KA 3MI4A 1C5YB 1SGNE 1H9HE 1XUKA 1O2UA 2B0FA 1ELGA 1MTUA 2A0QB 3B23B 4B6EA 3PLKA 1AUJA 3E8LA 1TMBH 1P04A 3RM0H 1NRRH 5DP9A 2PSYA 3PTNA 3T27A 1LPKB 1BA8B 2HNTC 3MNSA 4AN7A 4THNH 2P3FH 3F9EA 4DOQA 3RP2A 2AGGX 4MNVA 3SN8A 1S83A 4TPIZ 2BX3A 5C1UA 4WVPE 3SNAA 1HAVB 1C1UH 1ZMLA 2OBQA 3SUEA 5C2ZA 1CU1A 1SGYE 1D9IA 1UMAH 4WMEA 1TRNA 1DICA 1TRMA 1DSTA 1VITH 3A8CA 5E0JA 5EQRA 1P05A 1DSUA 1WYKA 2BY8X 1SGDE 1BTUA 1LVBA 2Y80A 5EODA 2R9PA 1B0EA 2W3KA 4O97A 1S6HA 1PPCE 2BB4A 1HAYB 3QGJA 4VGCB 4AFZA 1ANDA 3UNRA 4X2WA 3F1SB 1UCYK 1TOCB 1O2QA 1FQ3A 1BBRK 2O8UA 4JZDH 5FCKA 3V0XA 1A0HB 2YNBA 1D3TB 3F9FA 3FP7E 1DITH 2Z94A 3F9HA 2CJIA 1V2TT 4ASHA 2Z3CA 2ZU3A 1V2UT 4O3UA 2TBSA 1H9LB 1CQQA 2FMJA 3KGPA 3VB5A 1P01A 3ZVAA 4KGAA 4M9FA 2ZF0H 5K7RA 2HOBA 1QIXB 1FDPA 2UUJB 4H4FA 2C8XB 4OS1A 1TNKA 3UUZA 3T29A 1SC8U 1XUGA 2BHGA 1GI0A 1VGCC 3TU7H 1AGJA 3EAJA 1K9OE 4ABDA 4XBCA 1O2PA 4AYYB 4CH8B 3A7WA 3NCLA 3MU4A 1ELTA 1GBJA 2VBCA 3T26A 5T6FA 1FV9A 5EQSA 4WH8A 3SZEA 4E05H 1E37B 1NESE 2BYAX 2F83A 2SGEE 1EAWA 3SORA 3EE0B 1MU6B 3ZZDA 1TPPA 1P12E 1E34B 2ZPSA 4IMQA 1TBZH 1IQHA 3BEFB 4CR5A 1FN6A 1ZPBA 4IMZA 3V3MA 2BM2A 2V3HH 1YPEH 4B75A 1P9SA 1UHBA 1ELBA 3LH3A 1AIXH 1SSXA 4LZ4B 1FY3A 5A0AE 1QQUA 1FPHH 1ZR0A 1IQJA 1UK2A 3GY7A 5EQQA 4JK6A 4NIWA 1C5TA 1KDQA 3TK9A 2ZA5A 3RXRA 4TWWA 1ZLRA 4A5TS 4X6PA 1BRUP 1BTWA 1QCPA 2V6NA 3GDVA 1AFQB 2NU1E 2SGPE 3GCOA 1C1OA 1CE5A 1Z7KA 1O2ZA 3LC3A 1YPKH 2RCEA 1FN8A 1EXFA 2BD4A 5JBTA 3ZV8A 2JKHA 3EGKH 3UTUH 5ETXA 4NCYA 1O3DA 2D2DA 4CRAA 2F9NA 3PV5A 2GZ9A 3BG8A 5HM2A 3U1IB 1BMMH 2VNTA 2PKSC 1RXPA 4KTUA 1QURH 1SLWB 1Y5BT 1QJ1B 3MNBA 5C3NA 1YKTA 2AEIH 1QBVH 1BOQA 4B76A 1O3NA 4R8TB 2BVRH 5A8XA 1ZSJA 1AFEH 2WV4A 4OS4A 3SO3A 1BB0B 4NIVA 1Y3XA 1VR1H 6GCHF 1NM6A 5PTPA 4UFFH 3TGJE 3A7ZA 1OWHA 2P8OC 8GCHG 1P02A 2WHXA 3OTJE 4MNXA 1O2TA 1D6WA 1GI5A 1F5RA 5FX5A 1W7XH 2PKAA 3GCTG 4DJZB 3TNTA 1Y5UT 1SOZA 3UQOA 3A8DA 4YO9A 1V2QT 4CRFA 1AO5A 1WOFA 3ZVEA 2F91A 2AH4X 3RXEA 1TLDA 3OSYA 1KLTA 3TJNA 2QAAA 5FCRA 4BXSA 2BOKA 2OC8A 2CN0H 1O3AA 3SV6A 4Y8YA 1H1BA 3AAVA 3HPTB 2FI5E 3UNSA 1HIAB 1WXRA 1P9UA 4Y11E 3RC5A 3QTOH 1ETRH 1UO6A 3SU4A 1VJ9U 2F9VA 2PUQH 3A7VA 3KQBA 3P70B 2BD2A 2C93B 2FOFA 3KQCA 4UD9H 4BXWA 1E38B 3F6UH 4NFFA 4MPXA 1TNGA 4AOQA 2PSXA 2OC7A 1TQ7B 2RG3A 2F9UA 5L6NH 4ABEA 5B6OA 2AGIX 4CRBA 4GSOA 3K2UA 3KQDA 2Y5FA 1C2EA 1DWDH 1NROH 2PTNA 3QO6A 2YOLA 1EAXA 1OS8A 1MTNB 5EU8A 1G2MA 2VIVA 5JDUB 2BY6X 4UFEH 1HBTH 2OUAA 5A8YA 3SV8A 4U2WA 3K9XB 3SJ8A 1G3DA 1DM4B 1GJDB 1MKWH 3PLBA 4E06H 1OWDA 4DGJA 3SW2B 4X8UH 2H5DA 7KMEH 1Q31A 4ABFA 1KYNA 1MQ6A 3TK6A 3RXFA 2ODQA 1TWXB 5FAHA 3P8NA 1A7SA 5EXLA 2ZGHA 1D3DB 1GMDG 2ZDVH 3UY9A 1UTMA 2BXTH 1O3CA 2JETB 4VGCC 4NZLA 4I8HA 4Y10E 2VVCA 8KME2 1SGTA 2GDDA 1EATA 2Q1JA 3GY5A 3OTPA 1C2IA 1TONA 3MYWA 1G3BA 3PB1E 1NFWA 2FLRH 2GT7A 2R3UA 1QB1A 3UR9A 4X1QU 1K22H 1QBOA 2ZQ2A 1DOJA 3Q00A 4A1VA 1C1TA 2H5CA 4X6NA 3SQHE 4WXIA 1AZ8A 4FVBA 1YP9A 2ZFQH 1T7CA 1HRTH 2ZTZA 2Z3EA 1UTKA 1Y3YA 3A84A 1WSSH 4ZHLU 3KF2A 1L1JA 1HGTH 1A1RA 1EPTA 1DWEH 4A1TA 1GI6A 2ZHFH 3TVJB 1BCUH 3A80A 1X7AC 3LIWA 3ZVFA 2QGRA 4JMYA 3ZZAA 4OGXA 2FS8A 4U30A 3SHAH 4AYVB 1XUFA 4ZUHA 4AX9H 2XTTB 3PWCA 2V3OH 1A2CH 2BDHA 3BTDE 3ZYEA 4JYUH 1Y5AT 1XKBC 1WQSA 2PHBA 1C5RA 5EW2H 1EP5A 4MG3A 1EJNA 3MO6A 4YTAA 2C4FH 4AG1A 3V7TA 1XUHA 1GVLA 5GCHG 1G3CA 2ILNA 1EP6A 4WH6A 2ASUB 2AIPA 1C5ZB 1TIOA 5AVDA 3VB7A 3HK6B 2O8TA 1OX1A 2JH6D 3RXMA 1T32A 1Y3VA 2Y82A 3KNXA 3LGTA 2ZPRA 4MPUA 1LHFH 1FIZA 1PPBH 1HDTH 1KY9A 3NKKA 1TMUH 1Q2WA 2FTLE 2OXSA 3M35A 2ANYA 1D6RA 1AFQC 1GWAA 2BD3A 1O3EA 1H8DH 1LKAA 1O3LA 4I7YH 5T6GA 1PFXC 3QGNB 1W7GH 1JMOH 3MWIU 5C1XA 1ELFA 2VINA 4FU9A 2GKVE 4WJG2 4CHAB 3LGYA 4ZHMU 1TBRH 2BDAA 3LGIA 1LMWB 3MOCA 4AB8A 1GBBA 3RXBA 3BTWE 2OBOA 1O3MA 3BTEE 1FAXA 1VGCB 4YOJA 1ETSH 2BY9X 1Z8JB 1P3EA 4FXGH 3DT0H 1HAXB 1C1MA 3D62A 1UTJA 4AG2A 3TLOA 1BT7A 5CE1A 3E6PH 5F8ZA 1O3JA 1SPJA 2Y7XA 1LDTT 1VZQH 2I6QA 3UOUA 1EAIA 1GJ7B 1EJAA 1ESAA 1A0LA 1OP8A 2XC4A 1O2OA 4SGBE 4NGAH 3RXUA 1GBLA 1LQEA 1O37A 2GCTB 4K60A 1CT0E 1O2WA 3O8BA 1EPTC 4YLQH 4J2YB 3MNXA 3S9AA 4K1TA 1XM1A 2ANWA 4YLUA 5GDSH 3M3TA 1NRQH 1C5UA 1C1VH 2NU0E 2XXLA 1SL3A 1FMGA 2BZAA 1S0QA 1ZJDA 4F49A 4INHA 1DUAA 1L4ZA 3U69H 1F2SE 1AQ7A 4BANB 2J9NA 1PYTD 1C4U2 1MUEB 3SU0A 4MTBA 1OKXA 1NFYA 2F9OA 1C5NH 2W3IA 3ATKA 4R0IA 1AZZA 1FONA 5HMAA 4TWYA 2H6MA 4H6SB 1TX8A 1GHVH 2Z6BD 1TE0A 4MVNA 1MMJN 2XWBI 1O31A 1QNJA 4ZKOU 2FO9A 5CHAC 1SHHB 3RXOA 5F8XA 1A4WH 4XE4A 2ZPQA 1JIMA 1DLEA 1OOKB 4K2YA 4X0WU 1YLDA 3SGAE 1P3CA 1SGFG 2SGDE 3IG6B 2A5KA 2BY7X 2PKSB 2BLVA 2ANMH 3SUFA 2ZU2A 1CHGA 3UOPA 1HLTH 1KLJH 3NUMA 1MTNC 2BLWA 1TPAE 1GI2A 1W8BH 1LHCH 3SNBA 4J1YA 1LPGB 4ZXXH 3SGQE 2R2MB 4Y8XA 4GPGA 5H4IB 3M61U 4CBNA 1JWTA 3KN2A 1IQLA 2FLBH 2XBVA 3BV9B 1IQFA 2ZWLH 3ZVBA 2AYWA 1O5CB 1YPGH 1OWJA 3ZVDA 2VH0A 3ODDA 3SJ9A 3BIVH 1GHZA 4B73A 5J4SA 3SJOA 1HV7A 3M5MA 3QN7A 1EX3A 1PQ8A 2JETC 2C8WB 4K1SA 1AU8A 4DIHH 1O2NA 4X2YA 2ZDKA 1TALA 1TOMH 2ZGXH 1J17T 2ZO3H 2PV9B 7GCHG 4BOHA 1ELAA 2VGCC 1C5OH 5C20A 2TGDA 3ZZ5A 4I8JA 5DP3A 1DXWA 4YZUA 1EJMA 2O8WA 4X1NU 2VIQA 1C5PA 1TQ0B 3FVFB 1S6FA 1CT4E 3Q76A 1C9PA 1C4Y2 5C5NA 1WBGB 1QA0A 2DUCA 1BTYA 1ABIH 1UHBB 3HKJB 5T3HA 1GJBB 1O3PB 4BAOB 1SLXB 4KTCA 1HYLA 3H5CB 3GYMA 3R3GB 1CSOE 4Y79A 5G4BA 5ESBA 4UONA 5EG4A 2VIOA 2HALA 4Y7BA 1O2KA 4K1EA 1GBAA 2CHAC 4ZH8A 3RXKA 1AE8H 2GVFA 8LPRA 2D8WA 1YPHC 4NWKA 1UTLM 2ZHDA 1KDQB 1FAKH 3MU1A 1FUJA 1AE5A 3M3VA 3S69A 1YC0A 1A46H 3UQVA 3V12A 3AW0A 5AFYH 2PWXA 1Z8IB 2HNTF 4H42U 1S85A 4ZROA 1GCTB 4X2XA 1BTPA 2XNIA 5E0HA 2ZZUH 1HJ9A 1ZHRA 1L0ZA 3TITA 4ABGA 1XXDA 1FZZA 3LDXH 1VCWA 3O8RA 3RC4A 2WUCA 1AWFH 1A61H 1SFIA 2GDEH 2ZG0H 1GI8B 2BD5A 1TA6A 1GHAG 2V35A 1DANH 2BQ7B 3TJUA 5I46H 5FHTA 1NRNH 1MKXH 4GCHF 1ID5H 4X1RU 5EGMA 1MBMA 3GCNA 1GBMA 1V2NT 2Y5GA 1K1PA 4K5ZA 2QYIA 3RXHA 1MQ5A 1P2QA 1K21H 1MKWK 1BIOA 1RD3B 7ESTE 8ESTE 1DX5M 2PKAB 2A4QA 2ZCKP 3PV2A 5DP7A 1W11U 1YPJH 4Y71A 5DK1A 1O36A 3LJOA 1ACBE 1GPZA 1GGDB 3ZVGA 2AIQA 3TIUA 3Q3KA 4CHAC 1O2XA 1MCTA 1QJ7B 2Q6FA 5LPEA 1C2HA 1C1NA 1SQAA 4JZIA 4MLFB 3OY5U 5JBAS 1C2JA 4OS6A 4WY3A 2WZQA 2ZNKH 5EPYA 1IQGA 1RTKA 3ENSB 2IJD1 2W26A 1O30A 3HK3B 5A09A 1LKBA 4JZFH 2KAIA 4ISOA 2WPKS 3M5NA 5LPFA 1GJAB 1C2GA 3SU1A 2FXRA 1YCPM 2FX6A 2TGPZ 3TJVA 3CS7A 1ZTJA 4JZ1A 3D65E 1Z8GA 1HPGA 3QDZB 2IJOB 1L1NA 1LO6A 1SQTA 2BQWB 3C1KA 2F4LA 8GCHF 3V13A 3TGKE 4Y0YE 3C27B 1EZSC 5AHGH 2GCTC 2GZ8A 2QIQA 1O2LA 3GCTF 3EA7A 3S7HB 2H9HA 3A87A 3LT3A 3E0NB 1QBNA 1GDQA 1IQNA 4FU7A 1PPFE 3RXJA 2OP9A 1NC6A 1C5VA 5I25A 1NFXA 1ANBA 1LVYA 1FLEE 1GHWH 3UFAA 1LQDB 3SV9A 1F5KU 3ZZ4A 5EPNA 1GMHF 1IQIA 1FY4A 1TX6A 2GCHF 4GCHG 4OS2A 3URCA 4AFUA 5TJXA 1KXBA 3H7TA 5F03A 1ZTLA 3U9AH 5T1VA 3DD2H 1W13U 2OQUA 2XRCA 1AVWA 1CHOG 2RDLA 4B2AA 2C8YB 2SGQE 5ESTE 1QB6A 1QA7A 2FOEA 4XOJA 1W2KH 1H4WA 4WXVA 1GJ5H 1G3EA 3F68H 1C1QA 4YOIA 1ZMJA 5AFZH 3MH5A 3EQ0H 4OS7A 1HAZB 3VPKA 2ZDMA 1P11E 2P3TB 2P93A 1FY5A 1IHTH 2ZGBH 3VXFH 1TNJA 2G52A 1P2OA 1N8OC 1DFPA 1DT2A 1EB1H 3A8BA 3T25A 1T8OA 1G36A 3DFLA 1AB9C 1GHBF 1AVGH 1YGCH 3DUXH 4D8NA 1KXEA 1K28D 3RMLH 3PYHA 4AFQA 4AGJA 1P2NA 3RU4E 1DXPA 1GHYH 1HAHH 3LONA 2ZU4A 1TBQH 1DY9A 1TAWA 1ZPZA 2P3UB 4DW2U 2CF9H 1SBWA 1THPB 1BTHH 3QK1A 1P2MA 3VGCC 3P8GA 4HI3A 1ELVA 4CRCA 1SFQB 3SHCH 3T62A 1GJ9B 1GMDF 1EPTB 3RXIA 2BMGB 2UUFB 1YPLH 2WPLS 3T2NA 1AKSB 4NSYA 1O2RA 1EB2A 3JZ1B 1L2EA 1P57B 2BZ6H 3PWBA 4RI0A 4Q2KA 4BTTB 2W7UA 3E90B 3MO3A 2XWAA 1HCGA 4DG4A 1GMHG 4ABBA 1PQAA 2GCHG 1B5GH 3P8FA 1CO7E 1C1SA 1XKAC 4TY6A 1CVWH 1QB9A 1TPSA 1OPHB 3LJJA 1QHRB 5CMXH 3GY2A 1EZQA 3NPSA 4DIIH 3QLPH 1J15A 2D26C 1GL0E 2ZECA 4CRGA 2BOHB 1LCYA 2OQ5A 5CHAB 4KKDA 2C3SA 2BDGA 1A3BH 4IGDA 2FZZA 3LPRA 2A2QH 4ZMAH 1RIWC 2I6SA 4FUDA 4I32A 1E0FD 4I31A 5HM9A 1TFXA 4NWLA 3RXGA 3MNCA 2VWMA 2SFAA 3I78A 1GCTC 1O38A 2HWLB 4B74A 3BTGE 3MH6A 3ZYDA 3ZZ6A 3QX5H 1GHBG 4IC5A 9ESTA 3K6YA 4LZ1H 1VITG 3I29A 1GCDA 2A5IA 4Q7ZA 1YPHE 5JYIA 1G37A 3ZVCA 2R2WU 2VIDA 1EKBB 1NS3A 3BG4C 4IS5A 3RXPA 5IDKA 1BTXA 1UCYH 1MBQA 1BBRH 2WYGA 5GCHF 2EA3A 3NXPA 2HNTE 4JYVH 1ZHPA 4ABJA 4MPWA 3BTQE 1N6YA 3RXVA 2ZTXA 2B5TB 1ELCA 1SGFA 2VGCB 3ZZ8A 3P17H 2J4IA 2XBXA 3A85A 1TRYA 5JB8S 2OC1A 2VWOA 3E0PB 1WCZA 2C8ZB 3GCHC 1G9IE 2HGTH 3MFJA 5J4QA 3A7YA 1V2MT 1EOJA 3BF6H 3HATH 3SJKA 1Y3UA 1UVSH 4MPVA 1GGDC 1V3XA 1C5SA 1CGJE 2G5NA 5GNDA 3UR6A 4NFEA 4A7IB 2CHAB 5LH8A 4B1TA 4MQAA 3WY8A 1K1LA 1S81A 1UJ1A 3BTKE 2TPIZ 2FS9A 3PO1B 3PLPA 2XBWA 3BTFE 1NY22 2WV9A 4AZ2B 5JBCS 4RKJB 3AVZA 2SNVA 1S5SA 1AKSA 1UVUH 2H1UA 2IPHA 3DA9B 4I8GA 1NO9H 2A5AA 3D23A 3A86A 2O8MA 2OLGA 2W5EA 4BAHB 1JOUB 3KQEA 4O3TA 1YF4A 2P59A 3M36A 1NPMA 2FESH 1PPHE 4MNWA 1O32A 1OWEA 4ABIA 1O34A 1QR3E 1V2OT 3RU4T 1GI7B 2BDBA 2AMPA 4X8TH 1BZXE 3S9BA 1ZJKA 2G51A 1AMHA 5LGOA 1K1MA 1LVOA 2A7HA 2CGAA 2ZHEH 3K6ZA 1DS2E 1S84A 2G4UA 4B2BA 2XC5A 4WWYA 1C1PA 2ZGJA 4WMDA 3RMMH 3GOVB 3KIDU 2WPJS 3STJA 4ZAEA 4OS5A 1SG8B 4BTUB 2R0LA 3BIUH 4D7GA 3HGNA 2ZGCA 1YLCA 1J8AA 2QF3A 4MNYA 4GAWA 1GBCA 1ESBA 4K8YA 4IW4E 2EC9H 1SVPA 3SBKA 4AB9A 3KHVA 1JXPA 3KL6A 1O2SA 1LHDH 2ZFPH 5DKMA 1F7ZA 1H9IE 2GMTB 2Z3DA 5F8TA 3VFEA 3L6PA 2ZC9H 4ISHH 1PJPA 1RFNA 1O5DH 3UNQA 2VWNA 2J2UA 4FUIA 3SNCA 2Z9JA 3LGWA 4DT7B 3FAOA 3FZZA 1GBDA 3PTBA 1BMLA 5LPRA 3FP8E 3W95A 2OINA 4ABHA 1TNHA 4F4OC 1O3BA 2XW9A 1RTLA 3GISB 2XBYA 1TGTA 1J16A 2EI8A 2FP7B 2WV5A 3G01A 5FX6A 3T5FH 2EI7A 3URDA 4NG9H 1QRWA 1C5WB 3E16B 1TB6H 3VEQB 7GCHF 2ULLA 5F6MA 4BAQB 1SGCA 1ARBA 4U32A 3LOXA 3R0FA 1P2JA 1PPEE 5B6LA 3CENA 1O3KA 1CT2E 3SGBE 1ABJH 3SU6A 4FUJA 1KXAA 3UPEA 4HFPB 5JBBS 3PMHB 4BAKB 3E1XB 1W14U 3EYDA 2HRVA 1HJAC 4UEHH 3A8AA 3SI4H 1XX9A 1KLIH 3ATLA 1O3FA 1UTNA 3P92A 1NTPA 1RS0A 1BUIA 2BX4A 3OYPA 3MMGA 2STBE 5FBIA 1LTOA 4FU8A 2WPHS 4IN2A 2ZDAH 3UWIA 4O9VA 1GMCF 3SU2A 1NRPH 1AI8H 2ZKSA 3GY8A 2ZCLP 1J9CH 1SGPE 1Y8TA 1C5MD 1SOTA 3B8JA 1N8OB 1DPOA 1RGQA 1JRTA 1AB9B 1WAYB 2ALPA 5L30H 4X1PU 4ZKRU 2AGEX 5GIBA 1FI8A 1BMNH 1F0TA 1XVMA 2G8TA 1O2GH 1HAOH 1F0RA 1GBKA 4FUGA 3VGCB 1GHAF 1QRXA 1MTWA 2ZCHP 4M7GA 4ZKSU 2GP9B 1EOLA 2Z7FE 1GHXH 2KAIB 2D1JA 3ZZBA 3S7KB 2QF0A 1GG6B 2ZFTA 1ZRKA 1M9UA 3M5OA 3I77A 4GVUA 2UWOA 2G55A 1C5LH 2GZ7A 1BRBE 1GDUA 2XCFA 4FVDA 2P95A 2FOAA 2WPIS 2A4GA 5C5OA 2FOCA 1O2HA 3LGVA 2PLXA 1V6DA 1ELDE 3GYLB 1BHXB 1UVTH 4KELA 2LNCA 1P03A 3GICB 1T8NA 3IWMA 2AERH 1QL8A 2PFEA 2STAE 3RLWH 2AMDA 3M7QA 3SI3H 2CV3A 1GL1A 3MHWU 5AF9H 1NU9A 2ALVA 2HVXA 1TA2A 2P16A 3DHKH 4IC6A 3PO1C 1RIWB 1P0SH 4BTIB 3M7TA 1QGFA 1KIGH 3MU5A 1GMCG 1DWCH 1QL9A 3MH7A 3QTVH 1ZHMA 1GBFA 3RMOH 4NA8A 1HAIH 3NWUA 2G00A 3FANA 4D9QA 4FUBA 2Y6TA 1INCA 1V2WT 1GVZA 1L4DA 2TIOA 1NRSH 3S9CA 1ZYOA 4JK5A 4CR9A 2GGVB 5DP8A 5E8EH 1D4PB 5C67A 3GDSA 3BG4B 5EOKA 1QL7A 2F9PA 1XXFA 4LXBH 5FPYA 1MZDA 1PPZA 4ISIH 4UFGH 1A5HA 4SGAE 3SU3A 1SHYA 1BRAA 4OM9A 4K3JA 2BXUH 1JRSA 4I8KA 5E2OA 1HXEH 1AWHB 6LPRA 1OXGA 2F9BH 3MU8A 4XBBA 1KXFA 1K1JA 2Y5HA 1CHOF 1Y59T 2PGQB 2XC0A 1SI5H 3RXSA 3GCHB 4LOYH 1EQ9A 3P8OA 2H9TH 2ODYB 3CS0A 2AS9A 1AY6H 2K1QA 2VJ1A 2Y7ZA 5EW1H 1O33A 2Y81A 1GBTA 2ZU5A 3SQEE 1IAUA 3H7OA 4AGKA 5FBEA 3QZQA 3BTHE 1AVXA 4Q7XA 1HB0B 2GMTC 1PPGE 1OWIA 2WYJA 3A88A 2DE9A 1HXFH 1O5FH 3ZZ9A 5HGGA 2FODA 2BDIA 2J34A 1GBIA 3LH1A 1ZRBA 1AUTC 2ZU1A 1P09A 2GV7A 1D3QB 5DP4A 1W0ZU 2ZFRH 3L3TA 1WUNH 3MO9A 2G4TA 1GI9B 1IHSH 1TNLA 5DP5A 4B2CA 3A7TA 2R3YA 5TCCA 5L2YH 1OYTH 4QT8C 1DY8A 1C5QA 2A31A 2HPPH 1O5GH 4YESB 2FOHA 1UCYE 3M7UA 1C1RA 1BBRE 1MCVA 4ISNA 1ZSLA 2BQ6B 3STIA 1T4VH 1NT1A 1SLVB 3RUOA 5FXLA 1YCPH 4XFQA 4X6OA 3FP6E 1YBWA 2ZDLA 4XSKU 1C2MA 1RTFB 2VIWA 1GJ4H 4PROA 1TPOA 1GBHA 2FPZA 3EA8A 2VIPA 3GY3A 4X6MA 4IBLH 1E35B 4XBDA 3ZZ7A 4TPYA 3BN9A 1UK3A 2LPRA 3ZZ3A 3ODFA 5SGAE 1FY8E 1CA0B 2VVUA 4KTSA 1G2LA 2UWPA 1XVOA 3E91A 4HZHA 4UDWH 5T6DA 3LGUA 4FUEA 1O39A 1W12U 3A89A 3O8CA 1QRZA 2B9LA 1LVMA 4AFSA 1OYQA 5JB9S 1ZTKA 2J92A 5HXFA 3Q77A 5BPEA 2AMQA 1UTQA 1SQOA 2ESTE 1UVPA 2WPMS 3P6ZB 1HAVA 1P2IA 4LK4A 2W7SA 1WU1A 1MD8A 2FYRA 3EDXB 2ZI2H 5EXMA 1VITF 2OK5A 1SMFE 5DPAA 1PYTC
chains in the Genus database with same CATH superfamily
3RLYH 1MD7A 1OSSA 1YPMH 1O2MA 1DVAH 2OCVB 5TCAA 1KSNA 3UIRA 4U01A 1XUIA 1NN6A 2EI6A 1AHTH 4D7FA 1GJ6A 1EZXC 4X8VH 3PMAB 3RU4D 3BEUA 1KXDA 3L33A 3MU0A 1P8VC 1GG6C 4E7NA 3W94A 1KXCA 3EA9A 4WF8A 3A81A 4TYDA 1SGEE 3U8OH 4Z6AH 2J38A 2QV1A 3PV4A 2XCNA 2R0KA 1ZGIA 1YM0A 3ESTA 1IQMA 2FI4E 5HYOA 1BMAA 3TH2H 1GVKB 3T28A 3ZV9A 3D49H 1HAGE 1BHXF 1Z6JH 1H8HD 1HJAB 5GPIB 1DE7H 2BD8A 2A2XH 1ANEA 1W0YH 2RA0A 1GI3A 4YOGA 6CHAC 4YM9A 4B6FA 1O2IA 4NIXA 2ZHQH 3AASA 2FYQA 4UFDH 4Y6DA 5EXNA 1WTGH 2OTVA 2QA9E 3Q3XA 1UVOA 1E79D 3SV2H 1C2LA 4AORA 2BD9A 1O3GA 5A2MH 1FY1A 3SUGA 1MAXA 1BRCE 1A3EH 4OGYA 1QQ4A 2VWLA 4X8SH 1FXYA 4RN6A 4FETA 1TABE 2A7JA 3M3SA 2WINI 4DY7B 2O9QA 3N7OA 3FN8A 4DVAU 1T8LA 2A45B 3VB4A 2RDEA 1V2RT 2BLOA 2HLCA 3QUMP 3TH3H 4BAMB 1GBEA 1HNEE 1WV7H 3TGIE 5DG6A 5JPMH 4YT6H 5E2PA 5IYTA 1O3OA 1DLKB 3GY4A 2WUBA 1O2VA 1B0FA 3SZNA 1BTZA 3NK8A 4Z0KA 2QXJA 1T31A 4Q7YA 1O5BB 1V2JT 1K1IA 2ZTYA 4TT3D 3OX7U 1ZSKA 1ZMNA 3S0NA 2PW8H 2GT8A 3IITA 2ANKH 2VU8E 3QWCH 1B7XB 1TMTH 3RXCA 1FIWA 1RRKA 4K8BA 6GCHG 4H6TA 5DP6A 2A7CA 3SNEA 1W3CA 2XYAA 1TGNA 2J94A 4GHQA 1V2VT 1O5EH 1Z1JA 3TNSA 1CA8B 1TGSZ 1K2I1 1HFDA 1BDAA 1ORFA 3RM2H 1AD8H 3MTYA 3U98H 4D76A 2C90B 1HAPH 1T4UH 1O3HA 4UE7H 2VVVA 1Z71A 2ZEBA 3RXAA 3RC6A 4FUHA 2FI3E 3RDZA 1O0DH 2M5TA 1G32B 2A1DB 3A83A 3RMNH 1NFUA 4ZKNU 5GJ4B 2V7QD 3NZIA 5GXPA 3UWJH 3KEEA 4JZEH 5BRRE 3HKIB 4YT7H 3U1JB 1K1NA 2JH0D 1CBWB 1LHEH 1K1OA 4JYTA 3M37A 1ANCA 2FDAA 1O2JA 1DWBH 2ODPA 4WMFA 1C5XB 2VB0A 2ZIQH 7LPRA 1FPCH 2FM2A 4D9RA 9LPRA 1FJSA 1S82A 2NWNA 3K65B 3VXEH 1QJ6B 1ESTA 2BVXH 1O35A 4DCDA 4ZHAA 2V0BA 3UREA 2DE8A 1WTHD 1D3PB 1VKYA 3GDUA 1HUTH 2UUKB 1TGBA 1H8ED 5C1YA 1SGRE 1GDNA 1OWKA 5ABWA 3LU9B 1VCQA 2B7DH 4NIYA 5DGJA 1HIAA 4CRDA 1F0SA 1GJCB 2BTCE 1NBMD 5A0CA 2CXVA 2TGAA 2QXGA 1Q3XA 2BVSH 5A8ZA 1A5IA 3PROA 2PGBB 4FOUC 5CHBA 4ESTE 4O03A 2QXIA 2QCYA 4Y8ZA 2KCPA 1CA0C 1BJUA 2QC2A 5A0BA 4KP0A 1MTSA 5HKKD 1P06A 4NA7A 3OAAD 4A6LA 4ASUD 2ZFSA 4DURA 1F92A 1GJ8B 1W10U 2ZHWH 4HTCH 4XDEA 3SNDA 3TJOA 3ZZCA 1THRH 4INKA 5GWZA 4HGCA 1P10A 2G81E 5L2ZH 2BD7A 3LC5A 1U6QA 2FOMB 1PQ7A 1MKXK 1IQEA 5C94A 1NU7B 3LKWA 2Q6GA 2Q6DA 5FPTA 2A4RA 1S0RA 1UK4A 4ABAA 2GV6A 1TGCA 5HIZA 1F5LA 1MZAA 3BSQA 3F2GA 3MH4A 1ETTH 1UTOA 1W0JD 2ZDNA 5E0GA 4NSVA 2NU3E 1O2YA 1PQ5A 4I33A 1H8IH 3OU0A 4Y76A 1CGHA 1SB1H 1MAYA 1QY6A 1EZUC 3FZDA 1A5GH 1N6XA 1T8MA 1G30B 4XRNA 1A0JA 1THSH 3RXLA 4INLA 3A7XA 1DDJA 1JBUH 2UUYA 2H2ZA 2FTMA 2GTBA 3BTTE 3PMBB 2BY5X 1EASA 3P95A 2Z9GA 1TNIA 2TRMA 3ELAH 3SU5A 1BITA 1EUFA 1Z8RA 2FWWA 4TY7A 1AN1E 3SOSA 1TX7A 3BTME 2H9EH 3ATMA 3ATWA 1V2LT 2FEQH 2CF8H 4RSPA 1QTFA 1ZOMA 2J95A 1RJXB 2WPDD 2OC0A 4GHTA 3AW1A 1EAUA 1XMNB 1LHGH 1MTVA 2TGTA 4E7RG 5FPSA 4K69A 1O5AB 1NZQH 3TK5A 1IQKA 4X2VA 2L74A 2ZP0H 4ZXYH 2PR3A 3PM3A 1LPZB 2QXHA 3E3TA 3TPIZ 2J97A 4BNRA 6ESTA 4Q80A 3FFGA 4Y0ZE 1SGIB 2B8OH 2FOGA 2A32A 3AK5A 1YCPK 4P02A 1IOEA 2AFQB 2F3CE 1VJAU 1E36B 3SYJA 5DO4H 2PTCE 4Q4LA 1VCPA 3Q3YA 2THFB 3DSGA 1C2DA 4A92A 1N1LA 4I8LA 1DUEA 1YYY1 1V2ST 1MH0A 1ZZZA 4IN1A 2LP6A 4JCNA 3BEIB 3B9FH 3DFJA 2SNWA 3KCGH 1V2KT 1C4V2 2EEKA 2GD4B 1J14A 3ITIA 2A4OA 3A82A 2UWLA 3VB3A 1L1GA 3M5LA 2Z9KA 3ATIA 1SGQE 3U8TH 2O8LA 1KTSB 2PUXB 1CGIE 3H09A 2Z9LA 4GUXA 3TH4H 2BDCA 2NU4E 2IN2A 3RXQA 1F0UA 1C2FA 5F53A 1Y3WA 3CP7A 2CMYA 2GX4A 1XUJA 2EQNA 2NU2E 4MDSA 4GLYA 2VH6A 5DJ7A 4CH2B 3RXDA 1C9TA 4NZQA 1UTPA 1OP0A 2ZFFH 4Y7AA 3QZRA 1HJ8A 1FNIA 1TYNA 3RXTA 3U8RH 1Z6EA 2OD3B 4FUFA 1SLUB 2BLQA 2P8OB 2FIRH 1GI4A 4NA9H 3SUDA 1C2KA 2FX4A 4B71A 1MU8B 3F9GA 4ISLA 1SR5C 2QE7D 1QFKH 2IOTA 2JH5D 4FUCA 1ELEE 2QN5T 3VB6A 2YNAA 3OY6U 3SJIA 2Z9IA 2QY0B 2SGAA 6CHAB 2KX4A 1JIRA 3AAUA 1KTTB 5K0HA 4A1XA 4RKOB 1GI1A 2BDYA 2P94A 3PMJA 1ZPCA 2FOBA 2ZQ1A 2SGFE 3JZ2B 3O8DA 2G5VA 1OP2A 3GY6A 1WQVH 1BJVA 1ZGVA 2RA3A 3HGPA 4X1SU 1Z1IA 1O3IA 1C1WH 2HPQH 3SV7A 1V2PT 4CBOA 1CBWC 1ARCA 1BQYA 4CREA 1P2KA 3FO8D 3MI4A 1C5YB 1SGNE 1H9HE 1XUKA 1O2UA 2B0FA 1ELGA 1MTUA 2A0QB 3B23B 4B6EA 4ZCNA 3PLKA 1AUJA 3E8LA 1TMBH 5EJZA 1P04A 3RM0H 4AC9A 1NRRH 5DP9A 2PSYA 3PTNA 3T27A 1LPKB 1BA8B 2HNTC 3MNSA 4AN7A 4THNH 2P3FH 3F9EA 4DOQA 3RP2A 2AGGX 4MNVA 3SN8A 1S83A 4TPIZ 2BX3A 5C1UA 4WVPE 3SNAA 1HAVB 1C1UH 1ZMLA 2OBQA 3SUEA 5C2ZA 1CU1A 1SGYE 1D9IA 1UMAH 4WMEA 1TRNA 1DICA 1TRMA 1DSTA 1VITH 3A8CA 5E0JA 5EQRA 1P05A 1DSUA 1WYKA 2BY8X 1SGDE 1BTUA 1LVBA 2Y80A 5EODA 2R9PA 3DSPA 1B0EA 2W3KA 4O97A 1S6HA 1PPCE 2BB4A 1HAYB 3QGJA 4VGCB 4AFZA 1ANDA 3UNRA 4X2WA 3F1SB 1UCYK 1TOCB 1O2QA 1FQ3A 2W6JD 1BBRK 2O8UA 4JZDH 5FCKA 3V0XA 1A0HB 2YNBA 3N7DA 1D3TB 3F9FA 3FP7E 1DITH 2Z94A 3F9HA 2CJIA 1V2TT 4ASHA 2Z3CA 2ZU3A 1V2UT 4O3UA 2TBSA 1H9LB 1CQQA 2FMJA 3KGPA 3VB5A 1P01A 2CK3D 3ZVAA 4KGAA 4M9FA 2ZF0H 5K7RA 2HOBA 1QIXB 1FDPA 2UUJB 4H4FA 2C8XB 4OS1A 1TNKA 3UUZA 3T29A 5KECA 1SC8U 1XUGA 2BHGA 1GI0A 1VGCC 3TU7H 1AGJA 3EAJA 1K9OE 4ABDA 4XBCA 1O2PA 4AYYB 4CH8B 3A7WA 3NCLA 3MU4A 1ELTA 1GBJA 2VBCA 3T26A 5T6FA 1FV9A 5EQSA 4WH8A 3SZEA 4E05H 1E37B 1NESE 2BYAX 2F83A 2SGEE 3OE7D 1EAWA 3SORA 3EE0B 1MU6B 3ZZDA 1TPPA 1P12E 1E34B 2ZPSA 4IMQA 1TBZH 1IQHA 3BEFB 2KCAA 3N99A 1FN6A 4CR5A 1ZPBA 4IMZA 3V3MA 2BM2A 2V3HH 1YPEH 4B75A 1P9SA 1UHBA 1ELBA 3LH3A 1AIXH 1SSXA 4LZ4B 1FY3A 5A0AE 1QQUA 1FPHH 1ZR0A 1IQJA 1UK2A 3GY7A 5EQQA 4JK6A 4NIWA 1C5TA 1KDQA 3TK9A 2ZA5A 5FL7D 3RXRA 4TWWA 1ZLRA 4A5TS 4X6PA 1BRUP 1BTWA 1QCPA 2V6NA 3GDVA 1AFQB 2NU1E 2SGPE 3GCOA 1C1OA 1WDIA 1CE5A 1Z7KA 1O2ZA 3LC3A 3PRDA 1YPKH 2RCEA 1FN8A 1EXFA 2BD4A 5JBTA 3ZV8A 2JKHA 3EGKH 3UTUH 5ETXA 4NCYA 1O3DA 2D2DA 1W0KD 4CRAA 2F9NA 3PV5A 2GZ9A 3BG8A 1UW7A 5HM2A 3U1IB 1BMMH 2VNTA 1E1RD 2PKSC 1RXPA 4KTUA 1QURH 1SLWB 1Y5BT 1QJ1B 3MNBA 5C3NA 1YKTA 2AEIH 1QBVH 1BOQA 4B76A 1O3NA 4R8TB 2BVRH 5A8XA 1ZSJA 1AFEH 2WV4A 4OS4A 3SO3A 1BB0B 4NIVA 1Y3XA 5DN6D 1VR1H 6GCHF 1NM6A 2YMSC 5PTPA 4UFFH 3TGJE 3A7ZA 1OWHA 2P8OC 8GCHG 1P02A 2WHXA 3OTJE 4MNXA 1O2TA 1D6WA 1GI5A 1F5RA 5FX5A 1W7XH 2AHME 2PKAA 3GCTG 4DJZB 3TNTA 1Y5UT 1SOZA 3UQOA 3A8DA 4YO9A 1V2QT 4CRFA 1AO5A 1WOFA 3ZVEA 2F91A 2AH4X 3RXEA 1TLDA 3OSYA 1KLTA 3TJNA 2QAAA 5FCRA 4BXSA 2BOKA 2OC8A 2CN0H 1O3AA 3SV6A 4Y8YA 1H1BA 3AAVA 3HPTB 2FI5E 2IPQX 3UNSA 1HIAB 1WXRA 1P9UA 4Y11E 3RC5A 3QTOH 1ETRH 1UO6A 3SU4A 1VJ9U 2F9VA 2PUQH 3A7VA 3DSOA 3KQBA 3P70B 2BD2A 2C93B 2FOFA 3KQCA 4UD9H 4BXWA 1E38B 3F6UH 4NFFA 4MPXA 1TNGA 4AOQA 2PSXA 2OC7A 1TQ7B 2RG3A 2F9UA 5L6NH 4ABEA 5B6OA 5CDFE 2AGIX 4CRBA 4GSOA 3K2UA 3KQDA 2Y5FA 1C2EA 1DWDH 1NROH 2PTNA 3QO6A 2YOLA 1EAXA 1OS8A 1MTNB 5EU8A 1G2MA 2VIVA 5JDUB 2BY6X 4UFEH 1HBTH 2OUAA 5A8YA 3SV8A 4U2WA 3K9XB 3SJ8A 1G3DA 1DM4B 1GJDB 1MKWH 2WSSD 3PLBA 4E06H 1OWDA 4DGJA 3SW2B 4X8UH 2H5DA 7KMEH 1Q31A 4ABFA 1KYNA 1MQ6A 3TK6A 3RXFA 2ODQA 3FKSD 1TWXB 5FAHA 3P8NA 1A7SA 5EXLA 2ZGHA 1D3DB 1GMDG 2ZDVH 3UY9A 1UTMA 2BXTH 1O3CA 2JETB 4VGCC 4NZLA 4I8HA 4Y10E 2VVCA 8KME2 1SGTA 2GDDA 1EATA 4RT1A 2Q1JA 3GY5A 3OTPA 1C2IA 1TONA 3MYWA 3W1EA 1G3BA 3PB1E 1NFWA 2FLRH 2GT7A 2R3UA 1QB1A 3UR9A 4X1QU 1K22H 1QBOA 2ZQ2A 1DOJA 3Q00A 4A1VA 1C1TA 2H5CA 4X6NA 3SQHE 4WXIA 1AZ8A 4FVBA 1YP9A 2ZFQH 1T7CA 1HRTH 2ZTZA 2Z3EA 1UTKA 1Y3YA 3A84A 1WSSH 4ZHLU 3KF2A 1L1JA 4F55A 1HGTH 1A1RA 1EPTA 1DWEH 3U28C 4A1TA 1GI6A 2ZHFH 3TVJB 1BCUH 3A80A 1X7AC 3LIWA 3WWFA 3ZVFA 2QGRA 4JMYA 3ZZAA 4OGXA 2FS8A 4U30A 3SHAH 4AYVB 1XUFA 4ZUHA 4AX9H 2XTTB 3PWCA 2V3OH 1A2CH 2BDHA 3BTDE 3ZYEA 4JYUH 1Y5AT 1XKBC 1WQSA 2PHBA 1C5RA 5EW2H 1EP5A 4MG3A 1EJNA 3MO6A 4YTAA 2C4FH 4AG1A 2KZ4A 3V7TA 1XUHA 1GVLA 5GCHG 1G3CA 2ILNA 1EP6A 4WH6A 2ASUB 2AIPA 1C5ZB 1TIOA 5AVDA 3VB7A 3HK6B 1OX1A 2JH6D 2O8TA 3RXMA 1T32A 1Y3VA 2Y82A 3KNXA 3LGTA 2ZPRA 4MPUA 1LHFH 1FIZA 1PPBH 1HDTH 1KY9A 3NKKA 1TMUH 1Q2WA 2FTLE 2OXSA 3M35A 2ANYA 1D6RA 1AFQC 1GWAA 2BD3A 1O3EA 1H8DH 1LKAA 1O3LA 4I7YH 5T6GA 1PFXC 3QGNB 3VG8A 1W7GH 1JMOH 3MWIU 5C1XA 1ELFA 2VINA 4FU9A 2GKVE 4WJG2 4CHAB 3LGYA 4ZHMU 1TBRH 2BDAA 3LGIA 1LMWB 3MOCA 4AB8A 1GBBA 3RXBA 3BTWE 2GJGA 2OBOA 1O3MA 3BTEE 1FAXA 1VGCB 4YOJA 1ETSH 2BY9X 1Z8JB 1P3EA 4FXGH 3DT0H 1HAXB 1C1MA 3D62A 1UTJA 4AG2A 3TLOA 1BT7A 5CE1A 3E6PH 5F8ZA 1O3JA 1SPJA 2Y7XA 1LDTT 1VZQH 2I6QA 3UOUA 1EAIA 1GJ7B 1EJAA 1ESAA 1A0LA 1OP8A 2XC4A 1O2OA 3PRBA 4SGBE 4NGAH 3RXUA 1GBLA 1LQEA 1O37A 2GCTB 4K60A 1CT0E 1O2WA 3O8BA 1EPTC 4YLQH 4J2YB 3MNXA 3S9AA 4K1TA 3MQKC 1XM1A 2ANWA 4YLUA 5GDSH 3M3TA 1NRQH 1C5UA 1C1VH 2L6OA 2NU0E 2XXLA 1SL3A 1FMGA 2BZAA 1S0QA 1ZJDA 4F49A 4INHA 1DUAA 1L4ZA 3U69H 1F2SE 1AQ7A 4BANB 1QZ8A 2J9NA 1PYTD 1C4U2 1MUEB 3SU0A 4MTBA 1OKXA 1NFYA 2F9OA 1C5NH 2W3IA 3ATKA 4R0IA 1AZZA 1FONA 5HMAA 4TWYA 2H6MA 4H6SB 1TX8A 1GHVH 2Z6BD 1TE0A 4MVNA 1MMJN 2XWBI 1O31A 1QNJA 4ZKOU 2FO9A 5CHAC 1SHHB 3RXOA 5F8XA 3WW7A 1A4WH 4XE4A 2ZPQA 1JIMA 1DLEA 1OOKB 4K2YA 4X0WU 1YLDA 3SGAE 3KQ5A 1P3CA 1SGFG 2SGDE 3IG6B 2A5KA 2BY7X 2PKSB 2BLVA 2ANMH 3SUFA 2ZU2A 1CHGA 3UOPA 1HLTH 1KLJH 3NUMA 1MTNC 2BLWA 1TPAE 1GI2A 1W8BH 1LHCH 3SNBA 4J1YA 1LPGB 4ZXXH 3SGQE 2R2MB 4Y8XA 4GPGA 5H4IB 3M61U 4CBNA 1JWTA 3KN2A 1IQLA 2YMSB 2FLBH 2XBVA 3BV9B 1IQFA 2ZWLH 3ZVBA 2AYWA 1O5CB 1YPGH 1OWJA 3ZVDA 2VH0A 3ODDA 3SJ9A 3BIVH 1GHZA 4B73A 2KFWA 5J4SA 3SJOA 1HV7A 3M5MA 3QN7A 1EX3A 1PQ8A 1OHHD 2C8WB 2JETC 1AU8A 4K1SA 1O2NA 4DIHH 4X2YA 2ZDKA 1TALA 1TOMH 2ZGXH 1J17T 2ZO3H 2PV9B 7GCHG 4BOHA 1ELAA 2VGCC 1C5OH 5C20A 2TGDA 3ZZ5A 4I8JA 5DP3A 1DXWA 4YZUA 1EJMA 2O8WA 4X1NU 2VIQA 1C5PA 1TQ0B 3FVFB 1S6FA 1CT4E 3Q76A 1C9PA 1C4Y2 5C5NA 1WBGB 1QA0A 2DUCA 1BTYA 1ABIH 1UHBB 3HKJB 5T3HA 1GJBB 1O3PB 4BAOB 1SLXB 4KTCA 1HYLA 3H5CB 3GYMA 3R3GB 1CSOE 4Y79A 5G4BA 3F0PA 5ESBA 4UONA 5EG4A 2VIOA 4RT0A 2HALA 4Y7BA 1O2KA 4K1EA 1GBAA 2CHAC 4ZH8A 3RXKA 1AE8H 2GVFA 8LPRA 2W6ID 2D8WA 1YPHC 4NWKA 1UTLM 2EY4C 2ZHDA 1KDQB 1FAKH 3MU1A 4Q63A 1FUJA 1AE5A 3M3VA 3S69A 1YC0A 1A46H 3UQVA 2K8IA 3V12A 3AW0A 5AFYH 2PWXA 1Z8IB 2HNTF 4H42U 1S85A 4ZROA 1GCTB 4X2XA 1BTPA 2XNIA 5E0HA 2ZZUH 1HJ9A 2JDID 1ZHRA 1L0ZA 3TITA 4ABGA 1XXDA 1FZZA 3LDXH 1VCWA 3O8RA 3RC4A 2KM0A 2WUCA 1AWFH 1A61H 1SFIA 5C0UA 2GDEH 2ZG0H 1GI8B 2BD5A 1TA6A 2M2AA 1GHAG 2V35A 1DANH 2BQ7B 4P00A 3TJUA 5I46H 5FHTA 1NRNH 1MKXH 4GCHF 1ID5H 4X1RU 5EGMA 1MBMA 3GCNA 1GBMA 1V2NT 2Y5GA 1K1PA 4K5ZA 2QYIA 3RXHA 1MQ5A 1P2QA 1K21H 1MKWK 1BIOA 1RD3B 1FX0B 7ESTE 8ESTE 1DX5M 2PKAB 2A4QA 2ZCKP 3PV2A 5DP7A 1W11U 1YPJH 4Y71A 5DK1A 1O36A 3LJOA 1ACBE 1GPZA 1GGDB 3ZVGA 2AIQA 3TIUA 3Q3KA 4CHAC 1O2XA 1MCTA 1QJ7B 4XD7D 2Q6FA 2QF4A 1C2HA 5LPEA 1C1NA 1SQAA 4JZIA 4MLFB 3OY5U 5JBAS 1C2JA 4OS6A 2WZQA 4WY3A 2ZNKH 5EPYA 1BMFD 1IQGA 1RTKA 3ENSB 2IJD1 2W26A 1O30A 3HK3B 5A09A 1LKBA 4JZFH 2KAIA 4ISOA 2WPKS 3M5NA 1SKYE 1GJAB 5KEDA 5LPFA 1C2GA 3SU1A 2FXRA 1YCPM 2FX6A 2KR7A 2TGPZ 3TJVA 3CS7A 1ZTJA 4JZ1A 3D65E 1Z8GA 1HPGA 3QDZB 2IJOB 1L1NA 1LO6A 1SQTA 2BQWB 2F4LA 3C1KA 8GCHF 3V13A 3TGKE 4Y0YE 3C27B 1EZSC 5AHGH 2GCTC 2GZ8A 2QIQA 1O2LA 4Z1MD 3GCTF 3EA7A 5C17A 3S7HB 2H9HA 3A87A 3LT3A 3E0NB 1QBNA 1GDQA 1IQNA 4FU7A 1PPFE 3RXJA 2OP9A 4YXWD 1NC6A 1C5VA 5I25A 1NFXA 1ANBA 1LVYA 1FLEE 1GHWH 3UFAA 5KGOA 1KMHB 1LQDB 3SV9A 1F5KU 3ZZ4A 5EPNA 1GMHF 1IQIA 1FY4A 1TX6A 2GCHF 3CNRA 4GCHG 4OS2A 3URCA 4AFUA 5TJXA 1KXBA 3H7TA 5F03A 1ZTLA 5T1VA 3U9AH 3DD2H 1W13U 2OQUA 2XRCA 1AVWA 1CHOG 2RDLA 2LELA 4B2AA 2C8YB 2SGQE 5ESTE 1QB6A 1QA7A 2FOEA 4XOJA 1W2KH 1H4WA 2J5UA 4WXVA 1GJ5H 1G3EA 3F68H 1C1QA 4YOIA 1ZMJA 4ACAA 5AFZH 3MH5A 3EQ0H 4OS7A 1HAZB 3VPKA 2ZDMA 1P11E 2P3TB 2P93A 1FY5A 1IHTH 2ZGBH 3VXFH 1TNJA 2G52A 1P2OA 1N8OC 1DFPA 1DT2A 1EB1H 3A8BA 3T25A 1T8OA 1G36A 3DFLA 1AB9C 1GHBF 1AVGH 1YGCH 3DUXH 4D8NA 1KXEA 1K28D 3RMLH 3PYHA 4AFQA 4AGJA 1P2NA 3RU4E 1DXPA 1GHYH 1HAHH 3LONA 2ZU4A 3KYFA 1TBQH 1DY9A 1TAWA 1ZPZA 2P3UB 4DW2U 2CF9H 1SBWA 1THPB 1BTHH 3QK1A 1P2MA 3VGCC 3P8GA 4HI3A 1ELVA 4CRCA 2KCYA 1SFQB 2KCOA 3SHCH 3T62A 1GJ9B 1GMDF 1EPTB 3RXIA 2BMGB 2UUFB 1YPLH 2WPLS 3T2NA 1AKSB 4NSYA 1O2RA 1EB2A 2RFKC 3JZ1B 1L2EA 1P57B 2BZ6H 3PWBA 4RI0A 4Q2KA 4BTTB 2W7UA 3E90B 3MO3A 5EIYA 2XWAA 1HCGA 4DG4A 1GMHG 4ABBA 1PQAA 2GCHG 1B5GH 3P8FA 1CO7E 1C1SA 1XKAC 1YWUA 4TY6A 1CVWH 1QB9A 1TPSA 1OPHB 3LJJA 1QHRB 2XOKD 5CMXH 3GY2A 1EZQA 3NPSA 4DIIH 3QLPH 1J15A 2D26C 1GL0E 2ZECA 4CRGA 2BOHB 1LCYA 2OQ5A 5CHAB 4KKDA 2C3SA 2BDGA 3F2HA 1A3BH 4IGDA 2FZZA 3LPRA 2A2QH 4ZMAH 1RIWC 2I6SA 4FUDA 4I32A 1E0FD 4I31A 5HM9A 1TFXA 4NWLA 3RXGA 3MNCA 2VWMA 2SFAA 3I78A 1GCTC 1O38A 2HWLB 4B74A 3BTGE 3MH6A 3ZYDA 3ZZ6A 3QX5H 1GHBG 4IC5A 9ESTA 3K6YA 4LZ1H 1VITG 3I29A 1GCDA 2A5IA 4Q7ZA 1YLNA 1YPHE 5JYIA 4ACBA 3F2FA 1G37A 3ZVCA 1EFRD 2R2WU 2VIDA 5IK2D 1EKBB 1NS3A 3BG4C 4IS5A 3RXPA 5IDKA 2XNDD 1BTXA 1UCYH 1MBQA 1BBRH 2WYGA 5GCHF 2EA3A 3NXPA 2HNTE 4JYVH 1ZHPA 4ABJA 4MPWA 3BTQE 1N6YA 3RXVA 2ZTXA 2B5TB 1ELCA 1SGFA 2VGCB 3ZZ8A 3P17H 2J4IA 2XBXA 3A85A 1TRYA 5JB8S 2OC1A 2VWOA 3E0PB 1WCZA 2C8ZB 3GCHC 1G9IE 2HGTH 3MFJA 5J4QA 3A7YA 3ZIAD 1V2MT 1EOJA 3BF6H 3HATH 3SJKA 1Y3UA 1UVSH 4MPVA 1GGDC 1V3XA 1C5SA 1CGJE 2G5NA 5GNDA 3UR6A 4NFEA 4A7IB 2CHAB 5LH8A 4B1TA 4MQAA 3WY8A 1K1LA 1S81A 1UJ1A 3BTKE 2TPIZ 2FS9A 3PO1B 3PLPA 2XBWA 2WV9A 1NY22 3BTFE 4DT4A 4AZ2B 5JBCS 4TSFD 4RKJB 2JIZD 3AVZA 2SNVA 1S5SA 1AKSA 1UVUH 2H1UA 2IPHA 3DA9B 4I8GA 1NO9H 2A5AA 3D23A 1YY3A 3A86A 2O8MA 2OLGA 2W5EA 4BAHB 1JOUB 3KQEA 4O3TA 1YF4A 2P59A 3M36A 1NPMA 2FESH 1MABB 2JJ2D 1NBME 1PPHE 3OFND 1O32A 1OWEA 4MNWA 4ABIA 1O34A 1QR3E 1V2OT 3RU4T 1GI7B 2BDBA 2AMPA 4X8TH 1BZXE 3S9BA 1ZJKA 2G51A 1AMHA 5LGOA 1K1MA 1LVOA 2A7HA 2CGAA 2ZHEH 3K6ZA 1DS2E 1S84A 2G4UA 4B2BA 2XC5A 4WWYA 1C1PA 2ZGJA 4WMDA 3RMMH 3GOVB 3KIDU 2WPJS 3STJA 4ZAEA 4OS5A 1SG8B 4BTUB 2R0LA 3BIUH 4D7GA 3HGNA 2ZGCA 1YLCA 1J8AA 2QF3A 4MNYA 4GAWA 1GBCA 1ESBA 4K8YA 4IW4E 2EC9H 1SVPA 3SBKA 4AB9A 3KHVA 1JXPA 3KL6A 1O2SA 1LHDH 2ZFPH 4HG6A 5DKMA 1F7ZA 1H9IE 2GMTB 2Z3DA 5F8TA 3VFEA 3L6PA 2ZC9H 4ISHH 3WWBA 1PJPA 1RFNA 1O5DH 3UNQA 2VWNA 2J2UA 5DSFA 4FUIA 3SNCA 2Z9JA 3LGWA 4DT7B 3FAOA 3FZZA 1GBDA 3PTBA 1BMLA 5LPRA 3FP8E 3W95A 2OINA 4ABHA 1TNHA 4F4OC 1O3BA 2XW9A 1RTLA 2V3MA 3GISB 2XBYA 1TGTA 1J16A 3EE7A 2EI8A 2FP7B 2WV5A 3G01A 5FX6A 3T5FH 2EI7A 3URDA 4NG9H 1QRWA 1C5WB 3E16B 1TB6H 3VEQB 7GCHF 2ULLA 5F6MA 4BAQB 1SGCA 1ARBA 4U32A 3LOXA 3OEED 3R0FA 1P2JA 1PPEE 5B6LA 3CENA 1O3KA 1CT2E 1E1QD 2JJ1D 3SGBE 1ABJH 3SU6A 4FUJA 1KXAA 3UPEA 4HFPB 5JBBS 5EJ1A 3PMHB 4BAKB 3E1XB 1W14U 3EYDA 2HRVA 1HJAC 4UEHH 3A8AA 5C0TA 1S6LA 3SI4H 1XX9A 1KLIH 3ATLA 1O3FA 1UTNA 3P92A 1NTPA 1RS0A 1BUIA 2BX4A 3OYPA 2YMSD 3MMGA 2STBE 5FBIA 1LTOA 4FU8A 2WPHS 4IN2A 3KYGA 2ZDAH 3UWIA 4O9VA 1COWD 1GMCF 3SU2A 1NRPH 1AI8H 2ZKSA 3GY8A 4F48B 2ZCLP 1J9CH 1SGPE 3N7EA 1Y8TA 1C5MD 1SOTA 3B8JA 1N8OB 1DPOA 1RGQA 1JRTA 1AB9B 1WAYB 2ALPA 5L30H 4X1PU 4ZKRU 2AGEX 5GIBA 1FI8A 1BMNH 1F0TA 1XVMA 2G8TA 1O2GH 1HAOH 1F0RA 1GBKA 4FUGA 3VGCB 1GHAF 1QRXA 1MTWA 2ZCHP 4M7GA 4ZKSU 2GP9B 1EOLA 2K0QA 2Z7FE 1GHXH 2KAIB 2D1JA 3ZZBA 3S7KB 2QF0A 1GG6B 2ZFTA 1ZRKA 1M9UA 3M5OA 3I77A 4GVUA 2UWOA 2G55A 1C5LH 2GZ7A 1BRBE 3OEHD 1GDUA 2XCFA 4FVDA 2P95A 2FOAA 2WPIS 2A4GA 5C5OA 2FOCA 1O2HA 3LGVA 2PLXA 1V6DA 1ELDE 3GYLB 1BHXB 1UVTH 2QF5A 4KELA 2LNCA 1P03A 3GICB 1T8NA 3IWMA 2AERH 1QL8A 2PFEA 2STAE 3RLWH 2AMDA 3M7QA 3SI3H 2CV3A 2HVYB 1GL1A 3MHWU 5AF9H 1NU9A 2ALVA 2HVXA 1TA2A 2P16A 3DHKH 4IC6A 3PO1C 1RIWB 1P0SH 4BTIB 3UB0A 3M7TA 1QGFA 2HLDD 1KIGH 3MU5A 1GMCG 1DWCH 1QL9A 3MH7A 3QTVH 1ZHMA 1GBFA 3RMOH 2J98B 3UAIC 4NA8A 1HAIH 3NWUA 2G00A 3FANA 4D9QA 4FUBA 2Y6TA 1INCA 1V2WT 1GVZA 1L4DA 2TIOA 1NRSH 3S9CA 1ZYOA 4JK5A 4CR9A 2GGVB 5DP8A 5E8EH 1D4PB 5C67A 3GDSA 3BG4B 5EOKA 1QL7A 2F9PA 1XXFA 4LXBH 5FPYA 1MZDA 1PPZA 4ISIH 4UFGH 1A5HA 4SGAE 3SU3A 1SHYA 1BRAA 4OM9A 4K3JA 2BXUH 5EJLA 1JRSA 4I8KA 5E2OA 1HXEH 1AWHB 6LPRA 2F43B 1OXGA 2F9BH 3MU8A 4XBBA 3F0OA 1KXFA 1K1JA 2Y5HA 2PP6A 1CHOF 1Y59T 2PGQB 2XC0A 1SI5H 3F3BA 3RXSA 3GCHB 4LOYH 1EQ9A 3P8OA 2H9TH 2ODYB 3CS0A 2AS9A 1AY6H 2K1QA 2VJ1A 2Y7ZA 5EW1H 1O33A 2Y81A 1GBTA 2ZU5A 3GS9A 3SQEE 1IAUA 3H7OA 4AGKA 5FBEA 3QZQA 3BTHE 1AVXA 4Q7XA 1HB0B 2GMTC 1PPGE 1OWIA 2WYJA 3A88A 2DE9A 1HXFH 1O5FH 3ZZ9A 5HGGA 2FODA 2BDIA 3FOAA 2J34A 1GBIA 3LH1A 1ZRBA 1AUTC 2ZU1A 1P09A 2GV7A 1D3QB 5DP4A 1W0ZU 2ZFRH 3L3TA 1WUNH 3MO9A 2G4TA 1GI9B 1IHSH 1TNLA 5DP5A 4B2CA 3A7TA 2R3YA 5TCCA 5L2YH 1OYTH 4QT8C 1DY8A 4I86A 1C5QA 2A31A 2HPPH 1O5GH 4YESB 2FOHA 1UCYE 3M7UA 3NRLA 1C1RA 1BBRE 1MCVA 4ISNA 1ZSLA 2BQ6B 3STIA 1T4VH 1NT1A 1SLVB 3RUOA 5FXLA 1YCPH 4XFQA 4X6OA 3FP6E 1YBWA 2ZDLA 1SQRA 4XSKU 1C2MA 1RTFB 2VIWA 1GJ4H 4PROA 1TPOA 1GBHA 2FPZA 3EA8A 2VIPA 3GY3A 4X6MA 3DCLA 4IBLH 1E35B 4XBDA 3ZZ7A 4TPYA 3BN9A 1UK3A 2LPRA 3ZZ3A 3ODFA 5SGAE 1FY8E 2J98A 1CA0B 2VVUA 4KTSA 1G2LA 2UWPA 1XVOA 3E91A 4HZHA 4UDWH 5T6DA 3LGUA 4FUEA 1K0HA 1O39A 1W12U 3A89A 3O8CA 1QRZA 2B9LA 1LVMA 5HIYA 4AFSA 1OYQA 5JB9S 1ZTKA 2J92A 5HXFA 3Q77A 5BPEA 2AMQA 1UTQA 1SQOA 2ESTE 1UVPA 2WPMS 3P6ZB 1HAVA 1P2IA 4LK4A 2W7SA 1WU1A 1MD8A 2FYRA 3EDXB 2ZI2H 5EXMA 1VITF 2OK5A 1SMFE 5DPAA 1PYTC
chains in the Genus database with same CATH topology
3RLYH 1MD7A 1OSSA 1YPMH 1O2MA 1DVAH 2OCVB 5TCAA 1KSNA 3UIRA 4U01A 1XUIA 1NN6A 2EI6A 1AHTH 4D7FA 1GJ6A 1EZXC 4X8VH 3PMAB 3RU4D 3BEUA 1KXDA 3L33A 3MU0A 1P8VC 1GG6C 4E7NA 3W94A 1KXCA 3EA9A 4WF8A 3A81A 4TYDA 1SGEE 3U8OH 4Z6AH 2J38A 2QV1A 3PV4A 2XCNA 2R0KA 1ZGIA 1YM0A 3ESTA 1IQMA 2FI4E 5HYOA 1BMAA 3TH2H 1GVKB 3T28A 3ZV9A 3D49H 1HAGE 1BHXF 1Z6JH 1H8HD 1HJAB 5GPIB 1DE7H 2BD8A 2A2XH 1ANEA 1W0YH 2RA0A 1GI3A 4YOGA 6CHAC 4YM9A 4B6FA 1O2IA 4NIXA 2ZHQH 3AASA 2FYQA 4UFDH 4Y6DA 5EXNA 1WTGH 2OTVA 2QA9E 3Q3XA 1UVOA 1E79D 3SV2H 1C2LA 4AORA 2BD9A 1O3GA 5A2MH 1FY1A 3SUGA 1MAXA 1BRCE 1A3EH 4OGYA 1QQ4A 2VWLA 4X8SH 1FXYA 4RN6A 4FETA 1TABE 2A7JA 3M3SA 2WINI 4DY7B 2O9QA 3N7OA 3FN8A 4DVAU 1T8LA 2A45B 3VB4A 1V2RT 2BLOA 2HLCA 3QUMP 3TH3H 4BAMB 1GBEA 1HNEE 1WV7H 3TGIE 5DG6A 5JPMH 4YT6H 5E2PA 5IYTA 1O3OA 1DLKB 3GY4A 2WUBA 1O2VA 1B0FA 3SZNA 1BTZA 3NK8A 4Z0KA 2QXJA 1T31A 4Q7YA 1O5BB 1V2JT 1K1IA 2ZTYA 4TT3D 3OX7U 1ZSKA 1ZMNA 3S0NA 2PW8H 2GT8A 3IITA 2ANKH 2VU8E 3QWCH 1B7XB 1TMTH 3RXCA 1FIWA 1RRKA 4K8BA 6GCHG 4H6TA 5DP6A 2A7CA 3SNEA 1W3CA 2XYAA 1TGNA 2J94A 4GHQA 1V2VT 1O5EH 1Z1JA 3TNSA 1CA8B 1TGSZ 1K2I1 1HFDA 1BDAA 1ORFA 3RM2H 1AD8H 3MTYA 3U98H 4D76A 2C90B 1HAPH 1T4UH 1O3HA 4UE7H 2VVVA 1Z71A 2ZEBA 3RXAA 3RC6A 4FUHA 2FI3E 3RDZA 1O0DH 2M5TA 1G32B 2A1DB 3A83A 3RMNH 1NFUA 4ZKNU 5GJ4B 5GXPA 3NZIA 2V7QD 3UWJH 3KEEA 4JZEH 5BRRE 3HKIB 4YT7H 3U1JB 1K1NA 2JH0D 1CBWB 1LHEH 1K1OA 4JYTA 3M37A 1ANCA 2FDAA 1O2JA 1DWBH 2ODPA 4WMFA 1C5XB 2VB0A 2ZIQH 7LPRA 1FPCH 2FM2A 4D9RA 9LPRA 1FJSA 1S82A 2NWNA 3K65B 3VXEH 1QJ6B 1ESTA 2BVXH 1O35A 4DCDA 4ZHAA 2V0BA 3UREA 2DE8A 1WTHD 1D3PB 1HUTH 3GDUA 2UUKB 1TGBA 1H8ED 5C1YA 1SGRE 1GDNA 1OWKA 5ABWA 3LU9B 1VCQA 2B7DH 4NIYA 5DGJA 1HIAA 4CRDA 1F0SA 1GJCB 2BTCE 5A0CA 1NBMD 2CXVA 2TGAA 2QXGA 1Q3XA 2BVSH 5A8ZA 1A5IA 3PROA 2PGBB 4ESTE 5CHBA 4O03A 2QXIA 2QCYA 4Y8ZA 2KCPA 1CA0C 1BJUA 2QC2A 5A0BA 4KP0A 1MTSA 5HKKD 1P06A 4NA7A 3OAAD 4A6LA 4ASUD 2ZFSA 4DURA 1F92A 1GJ8B 1W10U 2ZHWH 4HTCH 4XDEA 3SNDA 3TJOA 3ZZCA 1THRH 4INKA 5GWZA 4HGCA 1P10A 2G81E 5L2ZH 2BD7A 3LC5A 1U6QA 2FOMB 1PQ7A 1MKXK 1IQEA 1NU7B 3LKWA 2Q6GA 2Q6DA 5FPTA 2A4RA 1S0RA 1UK4A 4ABAA 2GV6A 1TGCA 1F5LA 1MZAA 3BSQA 3F2GA 3MH4A 1ETTH 1UTOA 2ZDNA 1W0JD 5E0GA 4NSVA 2NU3E 1O2YA 1PQ5A 4I33A 1H8IH 3OU0A 4Y76A 1CGHA 1SB1H 1MAYA 1QY6A 1EZUC 3FZDA 1A5GH 1N6XA 1T8MA 1G30B 1A0JA 1THSH 3RXLA 4INLA 3A7XA 1DDJA 1JBUH 2UUYA 2H2ZA 2FTMA 2GTBA 3BTTE 3PMBB 2BY5X 1EASA 3P95A 2Z9GA 1TNIA 2TRMA 3ELAH 3SU5A 1BITA 1EUFA 1Z8RA 2FWWA 4TY7A 1AN1E 3SOSA 1TX7A 3BTME 2H9EH 3ATMA 3ATWA 1V2LT 2FEQH 2CF8H 4RSPA 1QTFA 1ZOMA 2J95A 1RJXB 2WPDD 2OC0A 4GHTA 3AW1A 1EAUA 1XMNB 1LHGH 1MTVA 2TGTA 4E7RG 5FPSA 4K69A 1O5AB 1NZQH 3TK5A 1IQKA 4X2VA 2ZP0H 4ZXYH 2PR3A 3PM3A 1LPZB 2QXHA 3E3TA 3TPIZ 4BNRA 6ESTA 4Q80A 3FFGA 4Y0ZE 1SGIB 2B8OH 2FOGA 2A32A 3AK5A 1YCPK 1IOEA 2AFQB 2F3CE 1VJAU 1E36B 3SYJA 5DO4H 2PTCE 4Q4LA 1VCPA 3Q3YA 2THFB 1C2DA 4A92A 1N1LA 4I8LA 1DUEA 1YYY1 1V2ST 1MH0A 1ZZZA 4IN1A 4JCNA 3BEIB 3B9FH 3DFJA 2SNWA 3KCGH 1V2KT 1C4V2 2EEKA 2GD4B 1J14A 3ITIA 2A4OA 3A82A 2UWLA 3VB3A 1L1GA 3M5LA 2Z9KA 3ATIA 1SGQE 3U8TH 2O8LA 1KTSB 2PUXB 1CGIE 3H09A 2Z9LA 4GUXA 3TH4H 2NU4E 2BDCA 2IN2A 3RXQA 1F0UA 1C2FA 5F53A 1Y3WA 3CP7A 2CMYA 2GX4A 1XUJA 4MDSA 2NU2E 5DJ7A 4GLYA 2VH6A 4CH2B 3RXDA 1C9TA 4NZQA 1UTPA 1OP0A 2ZFFH 4Y7AA 3QZRA 1HJ8A 1FNIA 1TYNA 3RXTA 3U8RH 1Z6EA 2OD3B 4FUFA 2P8OB 1SLUB 2BLQA 2FIRH 1GI4A 4NA9H 3SUDA 1C2KA 2FX4A 4B71A 1MU8B 3F9GA 4ISLA 1SR5C 2QE7D 1QFKH 2IOTA 2JH5D 4FUCA 1ELEE 2QN5T 3VB6A 2YNAA 3OY6U 3SJIA 2Z9IA 2QY0B 2SGAA 6CHAB 1JIRA 3AAUA 1KTTB 5K0HA 4A1XA 4RKOB 1GI1A 2BDYA 2P94A 3PMJA 1ZPCA 2FOBA 2ZQ1A 2SGFE 3JZ2B 3O8DA 2G5VA 1OP2A 3GY6A 1WQVH 1BJVA 1ZGVA 2RA3A 3HGPA 4X1SU 1Z1IA 1O3IA 1C1WH 2HPQH 3SV7A 1V2PT 4CBOA 1CBWC 1ARCA 1BQYA 4CREA 1P2KA 3FO8D 3MI4A 1C5YB 1SGNE 1H9HE 1XUKA 1O2UA 2B0FA 1ELGA 1MTUA 2A0QB 3B23B 4B6EA 4ZCNA 3PLKA 1AUJA 3E8LA 1TMBH 1P04A 3RM0H 1NRRH 5DP9A 2PSYA 3PTNA 3T27A 1LPKB 1BA8B 2HNTC 3MNSA 4AN7A 4THNH 2P3FH 3F9EA 4DOQA 3RP2A 2AGGX 4MNVA 3SN8A 1S83A 4TPIZ 2BX3A 5C1UA 4WVPE 3SNAA 1HAVB 1C1UH 1ZMLA 2OBQA 3SUEA 5C2ZA 1CU1A 1SGYE 1D9IA 1UMAH 4WMEA 1TRNA 1DICA 1TRMA 1DSTA 1VITH 3A8CA 5E0JA 5EQRA 1P05A 1DSUA 1WYKA 2BY8X 1SGDE 1BTUA 1LVBA 2Y80A 5EODA 2R9PA 3DSPA 1B0EA 2W3KA 4O97A 1S6HA 1PPCE 2BB4A 1HAYB 3QGJA 4VGCB 4AFZA 1ANDA 3UNRA 4X2WA 3F1SB 1UCYK 1TOCB 1O2QA 1FQ3A 2W6JD 1BBRK 2O8UA 4JZDH 5FCKA 3V0XA 1A0HB 2YNBA 3N7DA 1D3TB 3F9FA 3FP7E 1DITH 2Z94A 3F9HA 2CJIA 1V2TT 4ASHA 2Z3CA 2ZU3A 1V2UT 4O3UA 2TBSA 1H9LB 1CQQA 2FMJA 3KGPA 3VB5A 1P01A 2CK3D 3ZVAA 4KGAA 4M9FA 2ZF0H 5K7RA 2HOBA 1QIXB 1FDPA 2UUJB 4H4FA 2C8XB 4OS1A 1TNKA 3UUZA 3T29A 1SC8U 1XUGA 2BHGA 1GI0A 1VGCC 3TU7H 1AGJA 3EAJA 1K9OE 4ABDA 4XBCA 1O2PA 4AYYB 4CH8B 3A7WA 3NCLA 3MU4A 1ELTA 1GBJA 2VBCA 3T26A 5T6FA 1FV9A 5EQSA 4WH8A 3SZEA 4E05H 1E37B 1NESE 2BYAX 2F83A 2SGEE 3OE7D 1EAWA 3SORA 3EE0B 1MU6B 3ZZDA 1TPPA 1P12E 1E34B 2ZPSA 4IMQA 1TBZH 1IQHA 3BEFB 2KCAA 4CR5A 1FN6A 3N99A 1ZPBA 4IMZA 3V3MA 2BM2A 2V3HH 1YPEH 4B75A 1P9SA 1UHBA 1ELBA 3LH3A 1AIXH 1SSXA 4LZ4B 1FY3A 5A0AE 1QQUA 1FPHH 1ZR0A 1IQJA 1UK2A 3GY7A 5EQQA 4JK6A 4NIWA 1C5TA 1KDQA 3TK9A 2ZA5A 5FL7D 3RXRA 4TWWA 1ZLRA 4A5TS 4X6PA 1BRUP 1BTWA 1QCPA 2V6NA 3GDVA 1AFQB 2NU1E 2SGPE 3GCOA 1C1OA 1CE5A 1Z7KA 1O2ZA 3LC3A 3PRDA 1YPKH 2RCEA 1FN8A 1EXFA 2BD4A 5JBTA 3ZV8A 2JKHA 3EGKH 3UTUH 5ETXA 4NCYA 1O3DA 2D2DA 1W0KD 4CRAA 2F9NA 3PV5A 2GZ9A 3BG8A 5HM2A 3U1IB 1BMMH 2VNTA 1E1RD 2PKSC 1RXPA 4KTUA 1QURH 1SLWB 1Y5BT 1QJ1B 3MNBA 5C3NA 1YKTA 2AEIH 1QBVH 1BOQA 4B76A 1O3NA 4R8TB 2BVRH 5A8XA 1ZSJA 1AFEH 2WV4A 4OS4A 3SO3A 1BB0B 4NIVA 1Y3XA 5DN6D 1VR1H 6GCHF 1NM6A 2YMSC 5PTPA 4UFFH 3TGJE 3A7ZA 1OWHA 2P8OC 8GCHG 1P02A 2WHXA 3OTJE 4MNXA 1O2TA 1D6WA 1GI5A 1F5RA 5FX5A 1W7XH 2PKAA 3GCTG 4DJZB 2AHME 3TNTA 1Y5UT 1SOZA 3UQOA 3A8DA 4YO9A 1V2QT 4CRFA 1AO5A 1WOFA 3ZVEA 2F91A 2AH4X 3RXEA 1TLDA 3OSYA 1KLTA 3TJNA 2QAAA 5FCRA 4BXSA 2BOKA 2OC8A 2CN0H 1O3AA 3SV6A 4Y8YA 1H1BA 3AAVA 3HPTB 2FI5E 3UNSA 1HIAB 1WXRA 1P9UA 4Y11E 3RC5A 3QTOH 1ETRH 1UO6A 3SU4A 1VJ9U 2F9VA 2PUQH 3A7VA 3DSOA 3KQBA 3P70B 2BD2A 2C93B 2FOFA 3KQCA 4UD9H 4BXWA 1E38B 3F6UH 4NFFA 4MPXA 1TNGA 4AOQA 2PSXA 2OC7A 1TQ7B 2RG3A 2F9UA 5L6NH 4ABEA 5B6OA 5CDFE 2AGIX 4CRBA 4GSOA 3K2UA 3KQDA 2Y5FA 1C2EA 1DWDH 1NROH 2PTNA 3QO6A 2YOLA 1EAXA 1OS8A 1MTNB 5EU8A 1G2MA 2VIVA 5JDUB 2BY6X 4UFEH 1HBTH 2OUAA 5A8YA 3SV8A 4U2WA 3K9XB 3SJ8A 1G3DA 1DM4B 1GJDB 1MKWH 3PLBA 4E06H 2WSSD 1OWDA 4DGJA 3SW2B 4X8UH 2H5DA 7KMEH 1Q31A 4ABFA 1KYNA 1MQ6A 3TK6A 3RXFA 2ODQA 3FKSD 1TWXB 5FAHA 3P8NA 1A7SA 5EXLA 2ZGHA 1D3DB 1GMDG 2ZDVH 3UY9A 1UTMA 2BXTH 1O3CA 2JETB 4VGCC 4NZLA 4I8HA 4Y10E 2VVCA 8KME2 1SGTA 2GDDA 1EATA 2Q1JA 3GY5A 3OTPA 1C2IA 1TONA 3MYWA 3W1EA 1G3BA 3PB1E 1NFWA 2FLRH 2GT7A 2R3UA 1QB1A 3UR9A 4X1QU 1K22H 1QBOA 2ZQ2A 1DOJA 3Q00A 4A1VA 1C1TA 2H5CA 4X6NA 3SQHE 4WXIA 1AZ8A 4FVBA 1YP9A 2ZFQH 1T7CA 1HRTH 2ZTZA 2Z3EA 1UTKA 1Y3YA 3A84A 1WSSH 4ZHLU 3KF2A 1L1JA 4F55A 1HGTH 1A1RA 1EPTA 1DWEH 4A1TA 1GI6A 2ZHFH 3TVJB 1BCUH 3A80A 1X7AC 3LIWA 3WWFA 3ZVFA 2QGRA 4JMYA 3ZZAA 4OGXA 2FS8A 4U30A 3SHAH 4AYVB 1XUFA 4ZUHA 4AX9H 2XTTB 3PWCA 2V3OH 1A2CH 2BDHA 3BTDE 3ZYEA 4JYUH 1Y5AT 1XKBC 1WQSA 2PHBA 1C5RA 5EW2H 1EP5A 4MG3A 1EJNA 3MO6A 4YTAA 2C4FH 4AG1A 2KZ4A 3V7TA 1XUHA 1GVLA 5GCHG 1G3CA 2ILNA 1EP6A 4WH6A 2ASUB 2AIPA 1C5ZB 1TIOA 5AVDA 3VB7A 3HK6B 2O8TA 1OX1A 2JH6D 3RXMA 1T32A 1Y3VA 2Y82A 3KNXA 3LGTA 2ZPRA 4MPUA 1LHFH 1FIZA 1PPBH 1HDTH 1KY9A 3NKKA 1TMUH 1Q2WA 2FTLE 2OXSA 3M35A 2ANYA 1D6RA 1AFQC 1GWAA 2BD3A 1O3EA 1H8DH 1LKAA 1O3LA 4I7YH 5T6GA 1PFXC 3QGNB 3VG8A 1W7GH 1JMOH 3MWIU 5C1XA 1ELFA 2VINA 4FU9A 2GKVE 4WJG2 4CHAB 3LGYA 4ZHMU 1TBRH 2BDAA 3LGIA 1LMWB 3MOCA 4AB8A 1GBBA 3RXBA 3BTWE 2OBOA 1O3MA 3BTEE 1FAXA