3P8OA

Crystal structure of hcv ns3/ns4a protease complexed with des-bromine analogue of bi 201335
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HCV serine protease NS3
publication title Combined X-ray, NMR, and kinetic analyses reveal uncommon binding characteristics of the hepatitis C virus NS3-NS4A protease inhibitor BI 201335.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 38
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8oA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3p8oA01
4AB8A 2V3HH 2GD4B 3E1XB 3UWJH 1P03A 4Y71A 2SGAA 5DO4H 1NU9A 1K1PA 2BX3A 2BQ7B 1MUEB 2ZPSA 2W26A 4NZLA 1GI5A 2HVXA 5C2ZA 2P16A 1O2WA 4X2XA 3KQBA 1Z8IB 2GDEH 1DM4B 3M5OA 1S0QA 2M5TA 1HIAB 2UWPA 2Z3EA 1YC0A 1GI4A 4A1TA 3A7WA 4B6FA 2WINI 1UTQA 1TNJA 5H4IB 1HCGA 2RCEA 1EJMA 4JYUH 1AO5A 1IQJA 3E91A 2ZFQH 3QO6A 4ZKNU 4NCYA 6CHAC 4MNWA 4AFZA 5I46H 4Y7AA 4BAOB 4O9VA 1W0ZU 1XXDA 1H4WA 1ZLRA 1KY9A 1TRYA 1IQHA 1B5GH 1S84A 3ATWA 1O5DH 5DPAA 1X7AC 1C5WB 1TPSA 4MQAA 1GI6A 3EE0B 1QHRB 3SJIA 2C93B 3VB6A 1K1MA 1FDPA 1DXPA 3GDVA 1THPB 4B2CA 2PLXA 2YNBA 3KQDA 3TVJB 1N6XA 1JOUB 2GCHF 3L3TA 5C5NA 1C1UH 1OOKB 1VITF 4GVUA 1P04A 4GAWA 1K22H 1GHZA 5FAHA 1KTSB 1ELBA 5GWZA 2A31A 1DFPA 4WJG2 2BDBA 1GGDC 1UMAH 3SNEA 5DP4A 1AWHB 1ZPZA 2FI5E 3KHVA 1K1OA 1W3CA 3RXEA 4ABIA 1YGCH 1C5LH 3SV2H 1J14A 3NPSA 1G2MA 1G3EA 3E16B 1ZGIA 1RIWB 1LHCH 1H1BA 4CRBA 2FODA 3MO3A 2FX6A 5F8ZA 1L4ZA 1QL9A 1O3NA 2G52A 3TK9A 2FOHA 1NRQH 1O2XA 2FI3E 2VGCB 2AH4X 3SU4A 1D3PB 2ZHDA 3LDXH 1E38B 2ZA5A 4A7IB 1RJXB 2VINA 4BAKB 3NZIA 1P0SH 3O8CA 1KDQA 2A4QA 4NFFA 4CHAB 1O3FA 4CH8B 1V2UT 4A1XA 3A8BA 3QDZB 4CBOA 2UWOA 4FUIA 4I8LA 5EU8A 1UTNA 1B0FA 1L1NA 3BSQA 1HBTH 3A85A 2BLVA 3RXUA 2ANMH 1P09A 1JWTA 1SHHB 5JBBS 1OWHA 1TBZH 5EGMA 1NTPA 3U8RH 1ELAA 2J92A 1BB0B 3D23A 1ABJH 3O8BA 4OGXA 1F0RA 1W11U 2AGIX 5DP8A 2CV3A 3SJ8A 2TGPZ 5C1YA 2A4RA 3ESTA 1S6FA 3STIA 3RDZA 1BHXF 1DVAH 1TX8A 1DDJA 1A3BH 1TX7A 2PW8H 2VIVA 1GHBF 1WU1A 2BD3A 1BOQA 3C1KA 2GCHG 2FXRA 1A0JA 1VITG 2AGGX 4B75A 1MU6B 1P2QA 2OK5A 3LPRA 1O39A 1LHGH 2ZDAH 5JBCS 1MTWA 1A7SA 2BX4A 4NA9H 3SBKA 1VGCB 2FX4A 3HKIB 5E0GA 2ZQ2A 2HRVA 2BD2A 1AU8A 5CHAB 2W3KA 3ZZ6A 2I6SA 4XFQA 3PMAB 4F49A 2ZFFH 2A7JA 3RXJA 1UTOA 1LMWB 4LZ1H 4B6EA 5FBIA 1ZHRA 1L4DA 3A80A 1B7XB 3A87A 2BVRH 5DK1A 2FOAA 3EYDA 1GJCB 4TPYA 3SHCH 4NSVA 3E8LA 2ANYA 2AYWA 2BTCE 3ZV9A 7KMEH 1C9TA 4BTUB 1O2MA 1W7GH 1O3LA 3S9CA 1YYY1 1MD8A 2AMDA 3GCNA 3OY6U 3PWBA 2BMGB 2D1JA 2XBXA 1HJAB 2VIOA 2J9NA 2BLOA 1IHTH 2VNTA 1CHOF 4YTAA 2UUFB 3URCA 1O2GH 1BJVA 1GHXH 3TJVA 5T1VA 1AFEH 1EAIA 4KTSA 1JRTA 1MBQA 5J4QA 1HAHH 3PMHB 1V2KT 3TJNA 1O32A 1L1GA 5A8ZA 5AHGH 1DE7H 3UNQA 4JZFH 3BEIB 2F3CE 1C1MA 1SL3A 3FAOA 1OWDA 1GHBG 3VPKA 1TA2A 1FN8A 3OTJE 1K1LA 3A8CA 5EW1H 2BVXH 1XUHA 1O2TA 1V2WT 1GMCF 4AYYB 1ZSJA 1KLJH 3TJOA 2OQ5A 1QL8A 4MTBA 2EI6A 2GX4A 1OWEA 2XW9A 1MD7A 2BOKA 3SUGA 3LH3A 1YPEH 3P8GA 3KEEA 3QN7A 3ATIA 5TCAA 1H8DH 1ZMLA 1ZTKA 3SI3H 1DS2E 3UNSA 4ZKRU 3ZZCA 1C5SA 1UCYK 1TX6A 3BTKE 1AE8H 3F9EA 2Q6GA 1AE5A 3UTUH 1GWAA 1O31A 2FI4E 4RKJB 3HPTB 4JMYA 2C8WB 5CE1A 1C2JA 1ZZZA 1CU1A 3PO1C 2XCNA 1MH0A 4SGAE 4WXIA 4JZEH 2AMQA 3RM0H 1W7XH 4NIWA 2OC8A 1K9OE 5DP3A 3ZZ5A 5C5OA 2C3SA 3RXDA 1TQ7B 1FAXA 1ETTH 3Q00A 1P2NA 4OS7A 1LQEA 2O9QA 3QZRA 4XBCA 1O3DA 2BD8A 4ZKOU 1GG6B 1NT1A 1BITA 2ANKH 3MYWA 1E37B 1A0HB 1C2GA 4FUEA 2WV9A 3I78A 4Q7YA 3DT0H 1GI9B 1PQ5A 4FU9A 1CHOG 2EI7A 2G4UA 3FVFB 3PROA 4Y76A 4HI3A 4BAQB 2W5EA 1P01A 4ISNA 1GDQA 2FWWA 3S7HB 4YLUA 4FVBA 1ORFA 5EW2H 1PPEE 2XXLA 1GGDB 1ZPCA 3SOSA 2ZNKH 1P06A 4UE7H 3F9HA 4D8NA 5EQQA 2VIDA 3TH2H 1UO6A 3TLOA 2C8YB 4GUXA 1V2OT 4UD9H 3DD2H 3H7OA 1V2TT 1TPPA 1YKTA 3MU1A 3B23B 3LC3A 1GMCG 4WMDA 3BF6H 3GY3A 1EPTC 5DP9A 1GBKA 1HB0B 1MKWH 2CHAC 2Q6DA 4B74A 4E7NA 5G4BA 1QBOA 1SSXA 3M36A 3GY5A 4NZQA 1UHBA 1WUNH 1PPZA 4K1TA 4MLFB 4SGBE 2OBQA 3QLPH 2VH6A 3RU4E 1F0SA 1NESE 1BQYA 5K7RA 1P2MA 4THNH 4ZUHA 1DUAA 8KME2 2ZDMA 1DSUA 1P10A 4D9RA 1FY8E 1AZ8A 2SNVA 2W3IA 1UK3A 3HGPA 1FV9A 4HFPB 1BRCE 5BRRE 3QGJA 4FUDA 4AB9A 3CS0A 4FU7A 3UOUA 1KIGH 3VGCB 1D3QB 1FIWA 3MO9A 1KLIH 4INKA 3UR6A 1EKBB 3ATKA 4I8GA 1F0UA 3SU0A 4X1RU 4D7FA 3BTFE 3UUZA 1GBMA 5FX6A 1VZQH 1GHVH 4BTTB 4Y7BA 3PM3A 4CBNA 1S5SA 2OBOA 4A6LA 1FJSA 2ZTXA 1G32B 1HAVB 2VVVA 1EPTA 2GV6A 4ABDA 2FO9A 4HTCH 2BLWA 4X6PA 2ZP0H 3RXOA 1TIOA 1AFQC 3S69A 3BTTE 2V35A 5AVDA 2H6MA 1Z8JB 3SNDA 3S0NA 3SJKA 5GNDA 2PWXA 1OWJA 1IQGA 4K3JA 4AZ2B 4OS1A 4UFFH 4ISIH 1SPJA 1KTTB 1HLTH 1SI5H 5ESTE 3UPEA 5EXLA 1GVZA 2CJIA 5L2YH 2VWNA 1HNEE 2PUQH 2VVUA 4TYDA 5EPNA 2WPIS 3MFJA 3IWMA 2G8TA 1SVPA 3SHAH 1TNKA 4U01A 4MPWA 5JB9S 1BBRH 3E3TA 3A8AA 1SGQE 2DUCA 1BA8B 5ESBA 2FOCA 6ESTA 3GDSA 4TY7A 1TMBH 1IQKA 1ZRKA 3EDXB 4IGDA 3T2NA 4HGCA 1O3EA 2PUXB 4KTCA 1GBTA 2BOHB 1EZUC 2WZQA 2IOTA 2CMYA 2G81E 4R8TB 5A0BA 1C5NH 1UTMA 2QC2A 2F91A 3EQ0H 3VB3A 2R0LA 3F68H 1O2YA 1O0DH 2GVFA 1OWKA 3MU0A 2KAIA 5FHTA 3S9BA 4I7YH 1AHTH 2VIPA 1H9IE 3A7ZA 1EASA 1SLVB 5EOKA 3M5MA 4O3TA 1TBQH 2ZFRH 3R0FA 1O3BA 3A83A 5C1UA 1F5RA 5K0HA 1WQSA 2FIRH 1L2EA 2LNCA 1YCPH 2HGTH 1MAYA 2GDDA 5EQSA 1LPZB 1YM0A 3OSYA 1S6HA 2GZ8A 4YLQH 2XYAA 1C5PA 3SZNA 1J17T 2TIOA 3MH4A 1CT4E 3P8OA 3VEQB 4R0IA 1BIOA 1C1OA 5LH8A 2FOBA 1BMAA 1QB9A 4AFQA 2C4FH 4BNRA 1RS0A 1MTNC 1V2PT 1WTHD 2ZU3A 4I8KA 1HAZB 2FESH 5SGAE 3URDA 3Q3YA 2ZGHA 1HXFH 1DPOA 7LPRA 1AUJA 2J38A 4X1NU 4RI0A 2PGQB 4FU8A 2NU4E 2Z9IA 3VXFH 1ANEA 5HYOA 3ZV8A 1QJ6B 1S83A 1EJAA 1AKSA 1TNGA 1GI3A 4X1PU 1T8MA 2EC9H 1C1PA 3M3TA 1AMHA 3P17H 1W14U 1YPKH 5TCCA 2PKSC 1UTJA 1GMDF 4Y10E 1CA0C 3RXHA 2CF9H 2IJD1 1V6DA 2QA9E 9LPRA 2QXJA 1V2LT 2TPIZ 3ZZ7A 3BTME 1VCPA 1TALA 1YPGH 3OYPA 1DUEA 1LVBA 1GCTC 3A7VA 3C27B 1DX5M 4DJZB 1HJ8A 3SN8A 4YZUA 1GI8B 2HPPH 4K2YA 2G55A 3M3VA 2UUKB 1EOJA 1QA0A 4BXWA 1LPGB 4NWLA 3DHKH 1O36A 1GBEA 5GCHF 1HUTH 4Q2KA 2Y82A 1O33A 2D2DA 1C5OH 4MPXA 1UK2A 4IBLH 3EA8A 3GY6A 3A89A 1GBBA 1FLEE 3ENSB 2FOFA 2PKAA 4ABFA 3E0NB 3AVZA 3M5LA 5DP5A 1VITH 4ZHLU 4UONA 1FAKH 2O8TA 1KXEA 1P8VC 3HKJB 2F9BH 1CBWB 1QY6A 3AK5A 1LTOA 2Z7FE 2BY8X 3RMLH 2R0KA 2QYIA 1T7CA 1TPAE 3GY4A 4X1SU 1T4VH 5AFZH 1NFXA 1W0YH 1RTLA 4VGCB 3FP7E 3SI4H 1BCUH 1OKXA 3SU5A 3TK5A 2ZI2H 4U32A 1NM6A 1RTFB 4GLYA 5PTPA 1UTLM 2ZU1A 3ZZAA 2BB4A 1L1JA 1AB9C 3GICB 1ANCA 3RC4A 2H5DA 1GL0E 4XBDA 3EA7A 2CF8H 4X6MA 4AN7A 1MKWK 1TA6A 5FCKA 3UREA 3ZYDA 1GMDG 1LKAA 1AQ7A 2NU3E 3KQEA 4AGJA 2W7UA 4ZKSU 1ELEE 1JXPA 3A7TA 8GCHF 1HAOH 3AAUA 3JZ1B 4Y8YA 1V2RT 3GOVB 5A09A 1C1TA 4B76A 1HJ9A 4GCHF 3T27A 4CRAA 3QZQA 2XBYA 2ZDVH 1NO9H 1CHGA 1F0TA 1C5ZB 5EXMA 4AGKA 1SR5C 2ZGBH 4JZIA 1FI8A 2H1UA 2SGPE 1SLXB 5FBEA 2O8WA 1C2EA 1WSSH 5GCHG 4TWYA 1K2I1 3PLBA 1MTVA 1SOTA 5DG6A 1BHXB 1SHYA 2H9TH 4TWWA 2ALPA 3QUMP 1FY5A 3KCGH 2JKHA 2WYJA 4OS5A 5AF9H 4Y6DA 1C4Y2 2DE9A 1EZSC 4Q7ZA 1H8IH 1NY22 5AFYH 2EI8A 3PLPA 2ZGJA 1GVLA 5I25A 5GJ4B 4O3UA 2EEKA 4PROA 2ZF0H 1W8BH 4NIYA 1SBWA 2PFEA 2QF3A 2BXUH 3ZZ8A 2A0QB 1LHDH 3RC5A 1C2LA 3U98H 3M37A 2ZFPH 1BJUA 2Z9GA 3Q77A 2VWMA 4FUBA 1O2VA 1BTXA 3NWUA 3U8TH 1RGQA 2LPRA 2TRMA 4NSYA 1G36A 1J16A 1P3EA 2GCTB 3BEUA 2J34A 1HAYB 1O2SA 1SLUB 3RXAA 3TNTA 3QWCH 1NRRH 5B6LA 1P9UA 4DG4A 1BBRK 1FY1A 1SQTA 1FONA 2GMTB 3PLKA 1S82A 1S81A 4DVAU 3MMGA 1TAWA 4X2WA 5T6GA 2H2ZA 1MMJN 3BIUH 1KLTA 1K1JA 1E34B 1O3JA 4IMZA 1GCDA 3H09A 2OP9A 1P2IA 2O8LA 1ZYOA 2BD5A 3BIVH 3M7QA 3P70B 1AGJA 1N8OB 4UFDH 4NG9H 2BD7A 4GCHG 1GBDA 3GISB 2JETB 1EZQA 1GJDB 1GI0A 1ABIH 1CQQA 1SB1H 2ZTYA 3KL6A 2BZ6H 3PWCA 4X8TH 4RKOB 1C1NA 1C5RA 1E36B 4QT8C 1O5BB 1AI8H 1ESAA 1QB6A 4CREA 1W12U 4DY7B 1A0LA 1RTKA 1GHAF 1Y3VA 1BDAA 1QRXA 2P8OB 4YOGA 2DE8A 1YCPK 4IN1A 1QR3E 1WAYB 3FZZA 1SFQB 1TMTH 3KQCA 5FCRA 3OTPA 1AVGH 2TGDA 4Y8ZA 1EOLA 1N1LA 4RN6A 4FUHA 1ELTA 4AX9H 1UVPA 1DSTA 1FY4A 1ARCA 3W95A 1P3CA 5HXFA 1FUJA 3RXKA 1JBUH 3W94A 2CN0H 3LONA 1Y5UT 3LJOA 3MTYA 3GYLB 2GT8A 4X2YA 3RXPA 1ZHPA 2OXSA 1EX3A 3BTHE 1YCPM 3A7YA 4NA7A 1FQ3A 1G30B 2UWLA 4NIVA 3TNSA 2G5NA 1DY8A 2A4GA 2BZAA 1ETSH 3LC5A 1GMHF 1SGNE 3U9AH 3SV7A 1TNHA 1Z71A 3RXRA 3U69H 1GCTB 3BTWE 1TWXB 4ISHH 1TRMA 5FX5A 2SGEE 3T29A 1V2NT 3CS7A 1ELGA 3MU5A 2ZZUH 3LJJA 1XUIA 1O2NA 5C1XA 1OWIA 1SC8U 1A5GH 1XKBC 2BQWB 2WPHS 3T28A 5CMXH 2A5KA 3QX5H 4Y79A 3DUXH 1CA8B 1BMNH 3FFGA 3I77A 1F7ZA 4JYTA 4KTUA 3V3MA 1GHYH 2ODPA 1EATA 2BM2A 1DY9A 1Y3WA 2ZO3H 1GPZA 1PPHE 1RD3B 6CHAB 2UUJB 3FP6E 4MPUA 3DA9B 1AD8H 3ELAH 3HK3B 2XC0A 1BBRE 4X6NA 2WPKS 2R2WU 2J95A 2PSXA 2Z3DA 1LPKB 1AZZA 2ZKSA 1C1WH 1ZPBA 1QRWA 4X8VH 1FZZA 4KKDA 5E0HA 4IN2A 2A5AA 5GPIB 1GHAG 1VJ9U 2ZU4A 5HGGA 3STJA 2SNWA 5IYTA 4ABEA 3TH4H 1C5YB 1SGCA 5T6DA 1XUJA 2AIPA 1XXFA 1KDQB 3GY2A 4X2VA 2QY0B 3MH5A 1K21H 4H4FA 1MCVA 2C90B 3KF2A 2J4IA 2ESTE 3P95A 4IC6A 1W10U 1RRKA 4FVDA 2OQUA 4INHA 4ABHA 3OX7U 2Y7ZA 1QGFA 3UNRA 1AB9B 4MNXA 3K65B 1PQ8A 5EPYA 1DICA 1D6WA 2P3FH 4ESTE 4NGAH 3LGWA 1Z8GA 2B9LA 1WQVH 1Q3XA 3RM2H 1GMHG 1TNIA 3HGNA 3ITIA 1V2ST 1C1VH 4X8UH 1Q2WA 1B0EA 4CR5A 3SUFA 4DIHH 2XWBI 3L6PA 1ACBE 4Y11E 4B71A 2OC7A 1W2KH 2ZPRA 4GSOA 3BG4C 2P93A 4H42U 1TRNA 1ZRBA 1VCQA 4WY3A 3UY9A 1P2OA 3F9FA 1MQ6A 1YPLH 1CO7E 5EQRA 1DITH 1WBGB 3KGPA 1GJ9B 2TGTA 4ZXYH 1EJNA 4AFSA 2FPZA 3QTVH 3QK1A 1PQ7A 3SQHE 2XTTB 3RXIA 2TBSA 1NC6A 3NCLA 4DOQA 1HAPH 1N6YA 1SGEE 5GXPA 4TY6A 2Y80A 1C1SA 8LPRA 4B2BA 2FTMA 5F6MA 1LQDB 1UTPA 3SU2A 3LKWA 2JH5D 3SUEA 4B73A 1UCYE 3SYJA 2P95A 1QJ1B 4A92A 1E35B 1EP5A 1KXAA 3Q3XA 2CGAA 1QURH 5A8YA 1AN1E 1MBMA 1GJ8B 1C4V2 2Z9KA 5DJ7A 1DWEH 2FP7B 2B7DH 3Q3KA 3SU6A 1O30A 1C4U2 1TABE 1A46H 2IN2A 2UUYA 1O3PB 5J4SA 2BDGA 3LIWA 1O5GH 1WV7H 1PPFE 1RXPA 1HPGA 2WUBA 3GY7A 2G4TA 1OPHB 2VGCC 2XBVA 2P3TB 3RXSA 1CT2E 2VH0A 2GP9B 1O2LA 1QBVH 1TB6H 1QL7A 1O3MA 4FUCA 1QB1A 1P9SA 5DP6A 2SGDE 1UJ1A 2R9PA 3M7TA 2WPMS 3P8FA 2ZWLH 1CGJE 1DLEA 1MTUA 3RLWH 1GJBB 3RMMH 4E05H 1Y59T 1KXCA 1UVOA 1UVTH 1MZAA 4K8BA 4H6TA 2Q6FA 1FY3A 4IC5A 1C1RA 1O35A 2ZCLP 5E0JA 3AW0A 5LGOA 4WH8A 3M3SA 2Z94A 1Y5AT 3T25A 5FPTA 2PTNA 1XKAC 4Z0KA 2AMPA 2Z9JA 1PPCE 1LO6A 4K69A 4ABJA 1O38A 1MQ5A 2QXIA 4A5TS 1BMLA 2VVCA 4TPIZ 1J9CH 3ZVAA 1AUTC 3KIDU 1RFNA 5TJXA 3FANA 2F9NA 1EXFA 1XVOA 3D65E 3LGIA 2XC4A 1VJAU 1EB2A 4WVPE 1CVWH 2A45B 3U1IB 2GKVE 1GJ7B 1LHEH 4RSPA 2WUCA 3TITA 1PPBH 3MU8A 3UOPA 3N7OA 4OM9A 3BN9A 1TGCA 3K9XB 2SGFE 4UFGH 2HALA 2J2UA 3FZDA 3GCHC 2THFB 4M9FA 1D9IA 1VGCC 2AEIH 1GBFA 4MDSA 1SOZA 1HAXB 2Y6TA 3GY8A 1D3TB 4FUFA 1QNJA 1TPOA 3QGNB 2SFAA 4OGYA 1MU8B 2W7SA 1A5HA 2OLGA 1IQNA 1HGTH 1CE5A 2A2XH 4ZXXH 3SJ9A 1NRNH 1H9HE 1O5FH 2VU8E 1SGFA 3F1SB 2STAE 5A0CA 2PTCE 3LGTA 1BTZA 1THRH 1A2CH 2QAAA 5HMAA 1ELFA 2WPJS 4O03A 1NFWA 2A2QH 3ZVFA 3EA9A 3VB5A 1G3CA 3RLYH 4DGJA 2AFQB 3E0PB 1UVSH 3SZEA 1TNLA 2FMJA 4ASHA 4YT6H 2FDAA 1G9IE 2YOLA 4MG3A 2PR3A 3TGIE 1KXDA 3F6UH 4LK4A 4K60A 1NROH 1AWFH 1HJAC 2FLRH 3PO1B 1BRAA 1TMUH 4BXSA 1MTSA 1PPGE 3MNSA 4WF8A 4Y8XA 1ESBA 3T26A 2XRCA 1GJ4H 2QXGA 3RMOH 1PYTC 3RXBA 1SMFE 2ZCKP 2OINA 2FEQH 4UEHH 4ISLA 1UHBB 1OYQA 4Y0YE 3D62A 3NXPA 1MAXA 1Y5BT 2G51A 1DXWA 4MVNA 2A4OA 4CRCA 2ZHEH 1SQAA 1ZTLA 2FOMB 3PB1E 2CXVA 2NWNA 1DWCH 3HK6B 3SV6A 3RXGA 1BUIA 3ZVBA 2ZDLA 1CT0E 5L6NH 1CSOE 1IHSH 1IQFA 1YF4A 4KGAA 3PYHA 3VB7A 7ESTE 4O97A 1WOFA 2V6NA 3TJUA 2BLQA 1O5CB 1V2MT 1C5VA 3K2UA 3RP2A 1PJPA 1DWBH 1C2IA 1NU7B 3GYMA 1D3DB 5F8TA 1VCWA 2XCFA 3ZZBA 1J8AA 4DCDA 1JRSA 2FM2A 3A8DA 1TONA 1TGSZ 3LOXA 3UR9A 1BTPA 1EPTB 2FLBH 2CHAB 3DFJA 1IOEA 2GZ7A 1NPMA 2I6QA 3PV2A 2P3UB 3S7KB 5DGJA 4YO9A 2PGBB 1GG6C 3BG4B 3TPIZ 3TGJE 2JH6D 1O3GA 1PQAA 3IG6B 1GHWH 2OUAA 3SU1A 1ZMJA 2SGQE 2WHXA 1BRBE 4WMFA 3SNAA 1TGTA 1YPMH 3MNBA 1H9LB 1UTKA 4MNYA 3V13A 2ZEBA 2BY7X 1HV7A 1FPCH 1ZJDA 1PYTD 1GI2A 1XX9A 1S0RA 2Y5HA 2OD3B 3MU4A 3BTGE 3TIUA 3EAJA 3WY8A 1O2KA 3MHWU 1GVKB 3SGQE 1QJ7B 1ZR0A 1GBIA 1O2HA 1GBLA 1JIMA 1SGPE 1LHFH 2BDCA 1A1RA 3RXMA 1MKXK 2F9PA 1DT2A 1O34A 1AFQB 4D9QA 2AS9A 3NUMA 2V0BA 4IMQA 3T62A 3A88A 2Z9LA 3PV5A 3ZVGA 1C9PA 2H5CA 4ZHAA 1GJAB 3SUDA 1O2ZA 2BVSH 2FYQA 3MI4A 1O2RA 1P12E 3GDUA 3OU0A 1A5IA 1VR1H 2ZHWH 1BRUP 1S85A 4X0WU 7GCHF 1NZQH 4MNVA 2KAIB 3ZZ9A 4M7GA 2D8WA 1O3OA 1O5EH 4J2YB 2R2MB 3RU4T 4JYVH 1ZSKA 5EG4A 3RXFA 1C5TA 1SGRE 1MZDA 1TOMH 2WV5A 1SQOA 3TU7H 2FOEA 1AIXH 1MCTA 1NRPH 2G5VA 2ZFTA 3OY5U 3SV8A 2NU0E 3VGCC 4XSKU 1FXYA 1HYLA 3V12A 4CR9A 4YM9A 3RXCA 3SU3A 3ZZ4A 1GBAA 2TGAA 3SW2B 3H7TA 1EAXA 5ABWA 2C8XB 2ZGXH 3UIRA 3HATH 1HXEH 5JYIA 6LPRA 1EP6A 1C2DA 2FYRA 1OP0A 1O3AA 4K8YA 3NK8A 1Z1IA 1GI7B 2NU2E 3MH7A 3ATMA 5F03A 1Q31A 2HNTC 1Z6JH 2Q1JA 1V3XA 2ZG0H 2VWLA 4X6OA 1IQMA 2FS9A 3SNCA 4CH2B 1LCYA 2WYGA 4AFUA 2OTVA 2BY9X 2ZC9H 1XUFA 1C5UA 3PV4A 4YT7H 8GCHG 3SGAE 1OP8A 2XNIA 1YBWA 1BMMH 1BTWA 3MNCA 1AKSB 5FPYA 1K28D 4JK5A 3SQEE 1XMNB 3GCHB 1SGIB 3IITA 1OYTH 1AVWA 3P8NA 3TGKE 1CGHA 1AY6H 1A3EH 4OS4A 3RXVA 1DLKB 1GBCA 3SORA 1ID5H 1ESTA 1QQUA 3P92A 5GDSH 5A0AE 1O2OA 4AG1A 1EB1H 3BTQE 1G2LA 1XUKA 1IQIA 3FP8E 1O2IA 3ATLA 1EAUA 2ANWA 1UVUH 5FXLA 1P57B 3AAVA 3U8OH 3M35A 5F8XA 3UFAA 1F5LA 1ZOMA 1HAVA 4U30A 3R3GB 1ELVA 1O2PA 1MTNB 2A7CA 2IJOB 1M9UA 1TGNA 1O3HA 1WXRA 7GCHG 2ZFSA 4UDWH 3LU9B 1D4PB 3DFLA 1ANBA 2HWLB 4ABGA 1HDTH 4WH6A 4AYVB 3PMJA 3K6YA 2BD4A 1QTFA 1TFXA 5A2MH 3B8JA 2BY6X 1DANH 4YOJA 2PKAB 3A84A 1E0FD 1BT7A 2A7HA 4XBBA 1D6RA 1HRTH 2Y7XA 2B0FA 3BTEE 2PKSB 3ZZ3A 1CA0B 2R3YA 1Z7KA 4FUGA 2ZIQH 1TLDA 1YPHC 1O2QA 2D26C 1GJ6A 1T31A 1QRZA 1U6QA 2WPLS 2XWAA 4J1YA 1O3CA 1A61H 3MH6A 1GBHA 4HZHA 2HNTE 1P2JA 3M5NA 2BQ6B 1O5AB 2P94A 2RA0A 2ULLA 1C2HA 1TGBA 2GT7A 2ILNA 2G00A 3E90B 3VFEA 1XM1A 1ELDE 2AGEX 1DOJA 4OS6A 4XE4A 2F4LA 4CRGA 1HAGE 1IAUA 3UQVA 3E6PH 1T8LA 4INLA 5L2ZH 1SGFG 4GHQA 1NFUA 2BYAX 1V2JT 4X8SH 1TBRH 4CRDA 3MNXA 1QFKH 5IDKA 1SG8B 1GJ5H 5E8EH 4GPGA 2QXHA 1G37A 1P2KA 5HM2A 2ZHQH 1ETRH 1A4WH 5T3HA 2K1QA 2PSYA 1XUGA 2A32A 1EAWA 2XBWA 1BZXE 4ZROA 2PV9B 4IS5A 3PTNA 4H6SB 1G3BA 2BDIA 2WV4A 1HFDA 1QA7A 3SO3A 4YOIA 4XOJA 3P6ZB 4U2WA 1BTUA 2RDLA 2Y81A 4CRFA 1WYKA 2RA3A 2BY5X 2STBE 2VIWA 1T8OA 5JPMH 1ANDA 1LDTT 2PHBA 1SLWB 2ZTZA 1V2VT 3A82A 1T4UH 2VIQA 2ZU5A 1NRSH 2ZGCA 4DT7B 1YPHE 3ZVCA 3ODFA 2ASUB 2F9VA 1NN6A 1KSNA 5JBTA 1K1NA 4LXBH 4LZ4B 4FUJA 1THSH 4DW2U 1SGYE 3MO6A 3VXEH 1JMOH 1WCZA 1CBWC 2AERH 1ARBA 4I8JA 3RU4D 3M61U 1TQ0B 1BTYA 1P05A 4WMEA 1C1QA 5GIBA 2C8ZB 1WTGH 1INCA 2J94A 2P59A 2AIQA 3Q76A 4Z6AH 3CP7A 4VGCC 2Y5GA 4OS2A 4K1EA 5HM9A 1LVYA 1J15A 5ETXA 1EUFA 1F5KU 1HAIH 3TK6A 1MKXH 4E7RG 2OC1A 3UWIA 3PTBA 1HIAA 2A1DB 1O2JA 2GZ9A 2ZPQA 1W13U 4BANB 2ODQA 1SGTA 3KNXA 2ZCHP 3JZ2B 1OP2A 2EA3A 1FMGA 2BDYA 3I29A 9ESTA 4IW4E 4BOHA 2JH0D 4ZHMU 1O37A 1RIWC 1PFXC 4WXVA 6GCHF 2IPHA 4GHTA 4JZDH 3SV9A 1BTHH 4I33A 1K1IA 1IQEA 4UFEH 3H5CB 1C2FA 5EXNA 3RMNH 2QIQA 3LGVA 5B6OA 1ZJKA 4KELA 5C3NA 1F92A 1C2KA 2F9UA 5BPEA 3SNBA 1TOCB 1F2SE 4YESB 3A86A 2B5TB 1O2UA 1LVOA 3EGKH 2ALVA 5E2PA 3MOCA 4CHAC 2HLCA 2QV1A 4JK6A 2ZHFH 2BXTH 3RUOA 1C5QA 1OXGA 2ZECA 2A5IA 1O3KA 3RXTA 3GCTF 3RXLA 1Z1JA 4NWKA 4LOYH 1Y3XA 3ZYEA 4ABBA 2QCYA 8ESTE 2ODYB 2GV7A 3B9FH 3A81A 3U1JB 4BTIB 4DURA 1JIRA 4XDEA 3AW1A 2QF0A 1UK4A 3A7XA 3LT3A 2HNTF 4D7GA 3MWIU 3BV9B 1Y3YA 1LVMA 4JCNA 4E06H 3ZVEA 3ZZDA 2FS8A 3CENA 4NFEA 2O8MA 3NKKA 2HPQH 3VB4A 1GDNA 2QGRA 4KP0A 1P11E 3V0XA 4B1TA 5JB8S 1ZGVA 5DP7A 3F9GA 1SGDE 1Y3UA 4AORA 1GDUA 2GGVB 4ZAEA 1YLDA 2GCTC 2Z6BD 3ZVDA 1G3DA 4NA8A 5DKMA 5A8XA 2XC5A 3O8RA 3D49H 1QBNA 1Z6EA 4FXGH 4ZMAH 1L0ZA 2OCVB 2GMTC 2FOGA 5JDUB 1ZTJA 4DIIH 1YLCA 2Z3CA 3K6ZA 1FIZA 4D76A 5CHAC 4Q7XA 4JZ1A 5FPSA 1TYNA 3ODDA 2ZDKA 4I31A 2O8UA 4ISOA 3RXQA 1KYNA 1DWDH 3LGUA 5LPRA 3LH1A 2H9EH 1V2QT 3BTDE 1YP9A 4Q80A 6GCHG 1C2MA 1LKBA 1OS8A 2VJ1A 4ABAA 4F4OC 2BHGA 3O8DA 3PMBB 1N8OC 3M7UA 4WWYA 1KXBA 3RC6A 1XVMA 1EZXC 2JETC 1O3IA 3BG8A 4A1VA 2F9OA 4I8HA 1GI1A 2QN5T 2VBCA 2Y5FA 3KN2A 1ELCA 1KXFA 3AASA 2ZU2A 4MPVA 4I32A 5T6FA 1ZMNA 4AG2A 2BD9A 1EQ9A 1IQLA 1T32A 1C5XB 4ZH8A 5L30H 2H9HA 3BEFB 2GTBA 2P8OC 3SGBE 2F83A 1QCPA 2VB0A 1FN6A 1C5MD 3GCTG 1GBJA 1T8NA 2B8OH 2ZDNA 4K5ZA 3V7TA 1P02A 2V3OH 1FPHH 1Z8RA 2FTLE 4AOQA 1TE0A 1ZSLA 3L33A 4Y0ZE 1AVXA 5E2OA 3T5FH 1CGIE 3TH3H 4BAHB 5EODA 2R3UA 3LGYA 1FNIA 4BAMB 3S9AA 1NFYA 2HOBA 2OC0A 2YNAA 3GCOA 5LPFA 4X1QU 2RG3A 3G01A 4K1SA 1YPJH 3UQOA 1UCYH 5C20A 1OX1A 2BDHA 2VWOA 2FZZA 1SFIA 2BDAA 1NS3A 3QTOH 5JBAS 4B2AA 1OSSA 2ZQ1A 1ZHMA 2NU1E 3SJOA 1QIXB 1QQ4A 1GL1A 1Y8TA 4NIXA 5C67A 5LPEA
chains in the Genus database with same CATH superfamily
4AB8A 2V3HH 2GD4B 3E1XB 3UWJH 1P03A 2KCAA 4Y71A 2SGAA 5DO4H 1NU9A 1K1PA 2BX3A 2BQ7B 1MUEB 2ZPSA 2W26A 4NZLA 1GI5A 2HVXA 5C2ZA 2P16A 1O2WA 4X2XA 3KQBA 1Z8IB 2GDEH 1DM4B 3M5OA 1S0QA 2M5TA 1HIAB 2UWPA 2Z3EA 1YC0A 1GI4A 4A1TA 3A7WA 4B6FA 2WINI 1UTQA 1TNJA 5H4IB 1HCGA 2RCEA 1EJMA 4JYUH 1AO5A 1IQJA 3E91A 2ZFQH 3QO6A 4ZKNU 4NCYA 6CHAC 4MNWA 4AFZA 5I46H 4Y7AA 4BAOB 4O9VA 1W0ZU 1XXDA 1H4WA 1ZLRA 1KY9A 1TRYA 1IQHA 1B5GH 1S84A 3ATWA 1O5DH 4RT1A 5DPAA 1X7AC 1C5WB 1TPSA 4MQAA 1GI6A 3EE0B 1QHRB 3SJIA 2JJ1D 2C93B 3VB6A 1K1MA 1FDPA 1DXPA 3GDVA 1THPB 4B2CA 2PLXA 2YNBA 3KQDA 3TVJB 1N6XA 1JOUB 2GCHF 3L3TA 5C5NA 1C1UH 1OOKB 1VITF 2K0QA 4GVUA 1P04A 4GAWA 1K22H 1GHZA 5FAHA 1KTSB 1ELBA 5GWZA 2A31A 1DFPA 4WJG2 2BDBA 1GGDC 2YMSB 1UMAH 3SNEA 5DP4A 1AWHB 1ZPZA 2FI5E 3KHVA 1K1OA 1W3CA 3RXEA 4ABIA 1YGCH 1C5LH 3SV2H 1J14A 3NPSA 1G2MA 1G3EA 3E16B 1ZGIA 4TT3D 1RIWB 1LHCH 1H1BA 4CRBA 2FODA 3MO3A 2FX6A 5F8ZA 1L4ZA 1QL9A 1O3NA 2G52A 3TK9A 2FOHA 1NRQH 1O2XA 2FI3E 2VGCB 2AH4X 3SU4A 1D3PB 2ZHDA 3LDXH 1E38B 2ZA5A 4A7IB 1RJXB 2VINA 4BAKB 3NZIA 1P0SH 3F2HA 3O8CA 1KDQA 2A4QA 4NFFA 4CHAB 1O3FA 4CH8B 1V2UT 4A1XA 3A8BA 5DSFA 3QDZB 4CBOA 2UWOA 4FUIA 4I8LA 5EU8A 1UTNA 1B0FA 1L1NA 3BSQA 1HBTH 3A85A 2BLVA 3RXUA 2ANMH 3WWFA 1P09A 1JWTA 1SHHB 5JBBS 1OWHA 1TBZH 5EGMA 1NTPA 3U8RH 1ELAA 2J92A 1BB0B 3D23A 1ABJH 3O8BA 4OGXA 1F0RA 1W11U 2AGIX 5DP8A 2CV3A 3SJ8A 2TGPZ 5C1YA 2A4RA 3ESTA 3F3BA 1S6FA 3STIA 3RDZA 1BHXF 1DVAH 1TX8A 1DDJA 1A3BH 1TX7A 2PW8H 4ACBA 2VIVA 1GHBF 1WU1A 2BD3A 1BOQA 3C1KA 2GCHG 2FXRA 1A0JA 1VITG 2AGGX 4B75A 1MU6B 1P2QA 2RFKC 2OK5A 3LPRA 1O39A 1LHGH 2ZDAH 5JBCS 1MTWA 1A7SA 3N7EA 2BX4A 4NA9H 3SBKA 1VGCB 2FX4A 3HKIB 5E0GA 2ZQ2A 2HRVA 2BD2A 1AU8A 5CHAB 2W3KA 3ZZ6A 2I6SA 4XFQA 3PMAB 4F49A 2ZFFH 2A7JA 3RXJA 1UTOA 1LMWB 4LZ1H 4B6EA 5FBIA 1ZHRA 1L4DA 3A80A 1B7XB 4Z1MD 3A87A 1K0HA 2BVRH 5DK1A 2FOAA 3EYDA 1GJCB 4TPYA 1E1RD 3SHCH 4NSVA 3E8LA 2ANYA 2AYWA 2BTCE 3ZV9A 7KMEH 1C9TA 4BTUB 1O2MA 1W7GH 1O3LA 3S9CA 1YYY1 1MD8A 2AMDA 3GCNA 3OY6U 3PWBA 2BMGB 2D1JA 2XBXA 1HJAB 2VIOA 2J9NA 2BLOA 1IHTH 2VNTA 2XNDD 1CHOF 4YTAA 2UUFB 3URCA 1O2GH 1BJVA 1GHXH 3TJVA 5T1VA 1AFEH 1EAIA 2LELA 4KTSA 1JRTA 1MBQA 5J4QA 1HAHH 3PMHB 1V2KT 3TJNA 1O32A 1L1GA 5A8ZA 5AHGH 1DE7H 3UNQA 4JZFH 3BEIB 2F3CE 1C1MA 1SL3A 3FAOA 1OWDA 1GHBG 3VPKA 1TA2A 1FN8A 3OTJE 1K1LA 3A8CA 5EW1H 2BVXH 1XUHA 1O2TA 1V2WT 1GMCF 4AYYB 1ZSJA 1KLJH 3TJOA 2OQ5A 1QL8A 2JIZD 4MTBA 4TSFD 2EI6A 2GX4A 1OWEA 2XW9A 1MD7A 2BOKA 3SUGA 3LH3A 1YPEH 3P8GA 3KEEA 3QN7A 3ATIA 5TCAA 1H8DH 1ZMLA 1ZTKA 3SI3H 1DS2E 2WPDD 3UNSA 4ZKRU 3ZZCA 1C5SA 1UCYK 1TX6A 3BTKE 1AE8H 3F9EA 2Q6GA 1AE5A 3UTUH 1GWAA 1O31A 3N99A 2FI4E 4RKJB 3HPTB 4JMYA 2C8WB 5CE1A 1C2JA 1ZZZA 1CU1A 3PO1C 2XCNA 1MH0A 4SGAE 4WXIA 4JZEH 3WW7A 2AMQA 3RM0H 1W7XH 4NIWA 2OC8A 1K9OE 5DP3A 3ZZ5A 5C5OA 2C3SA 3RXDA 1TQ7B 1FAXA 1ETTH 3Q00A 1P2NA 4OS7A 1LQEA 2F43B 2O9QA 3QZRA 4XBCA 1O3DA 2BD8A 4ZKOU 1GG6B 1NT1A 1BITA 2ANKH 3MYWA 1E37B 1A0HB 1C2GA 2WV9A 4FUEA 3I78A 2EY4C 4Q7YA 3DT0H 1GI9B 3ZIAD 1PQ5A 4FU9A 1CHOG 2EI7A 2G4UA 3FVFB 3PROA 4Y76A 4HI3A 4BAQB 2W5EA 1P01A 4ISNA 1GDQA 2FWWA 3S7HB 4YLUA 5CHBA 4FVBA 1ORFA 5EW2H 1PPEE 2XXLA 1GGDB 1ZPCA 3SOSA 2ZNKH 1P06A 4UE7H 3F9HA 4D8NA 5EQQA 2VIDA 3TH2H 1UO6A 3TLOA 2C8YB 4GUXA 1V2OT 4UD9H 3DD2H 3H7OA 1V2TT 1TPPA 1YKTA 3MU1A 3B23B 3LC3A 1GMCG 4WMDA 3BF6H 3GY3A 1EPTC 5DP9A 1GBKA 1HB0B 1MKWH 2CHAC 2Q6DA 4B74A 4E7NA 2HLDD 5G4BA 1QBOA 1SSXA 3M36A 3GY5A 4NZQA 1UHBA 1WUNH 4F55A 1PPZA 4K1TA 4MLFB 4SGBE 2OBQA 3QLPH 2VH6A 3RU4E 1F0SA 1NESE 4DT4A 1BQYA 5K7RA 4P00A 1P2MA 4THNH 4ZUHA 1DUAA 8KME2 2ZDMA 1DSUA 1P10A 4D9RA 1FY8E 1AZ8A 2SNVA 2W3IA 1UK3A 3HGPA 1FV9A 4HFPB 1BRCE 5BRRE 3QGJA 4FUDA 4AB9A 3CS0A 4FU7A 3UOUA 1KIGH 3F2FA 3VGCB 1D3QB 1FIWA 3MO9A 1KLIH 4INKA 3UR6A 1EKBB 3ATKA 4I8GA 1F0UA 3SU0A 4X1RU 4D7FA 3BTFE 3UUZA 1GBMA 5FX6A 1VZQH 1GHVH 4BTTB 4Y7BA 3PM3A 4CBNA 1S5SA 2OBOA 4A6LA 1FJSA 2AHME 2L6OA 2ZTXA 3KYGA 1G32B 1HAVB 2VVVA 1EPTA 2GV6A 4ABDA 2FO9A 4HTCH 2BLWA 4X6PA 2ZP0H 3RXOA 1TIOA 1AFQC 3S69A 3BTTE 2V35A 5KECA 5AVDA 2H6MA 1Z8JB 3SNDA 3S0NA 3SJKA 5GNDA 2PWXA 1OWJA 1IQGA 4K3JA 4AZ2B 3PRDA 4OS1A 4UFFH 1SQRA 4ISIH 1SPJA 1KTTB 1HLTH 1SI5H 2QE7D 5ESTE 3UPEA 5EXLA 1GVZA 2CJIA 5L2YH 2VWNA 1HNEE 2PUQH 2VVUA 4TYDA 5EPNA 2WPIS 3MFJA 3IWMA 2G8TA 1SVPA 3SHAH 1TNKA 2V7QD 4U01A 4MPWA 5JB9S 1BBRH 3E3TA 3A8AA 1SGQE 2DUCA 1BA8B 2JDID 5ESBA 2FOCA 6ESTA 3GDSA 4TY7A 1TMBH 1IQKA 1ZRKA 3EDXB 4IGDA 3T2NA 4HGCA 1O3EA 2PUXB 5EIYA 4KTCA 1GBTA 2BOHB 1EZUC 2WZQA 2IOTA 2CMYA 2G81E 4R8TB 5A0BA 1C5NH 1UTMA 2QC2A 5KEDA 2F91A 3EQ0H 3VB3A 2R0LA 3F68H 1O2YA 1O0DH 2GVFA 1OWKA 3MU0A 2KAIA 3F0OA 5FHTA 3S9BA 4I7YH 1AHTH 2VIPA 1H9IE 3A7ZA 1EASA 1SLVB 5EOKA 3M5MA 4O3TA 1TBQH 2ZFRH 3R0FA 1O3BA 3A83A 5C1UA 1F5RA 5K0HA 1WQSA 2FIRH 1L2EA 2LNCA 1YCPH 2HGTH 1MAYA 1SKYE 2GDDA 1W0KD 5EQSA 1LPZB 1YM0A 3OSYA 1S6HA 1COWD 2GZ8A 4YLQH 2XYAA 1C5PA 3SZNA 1J17T 2TIOA 3MH4A 1CT4E 3P8OA 3VEQB 4R0IA 1BIOA 1C1OA 5LH8A 2FOBA 1BMAA 1QB9A 4AFQA 2C4FH 4BNRA 1RS0A 1MTNC 1V2PT 1WTHD 2ZU3A 4I8KA 1HAZB 2FESH 5SGAE 3URDA 3Q3YA 2ZGHA 1HXFH 1DPOA 7LPRA 1AUJA 2J38A 4X1NU 4RI0A 2PGQB 4FU8A 2NU4E 2Z9IA 3VXFH 1ANEA 5HYOA 3ZV8A 1QJ6B 1S83A 1EJAA 1AKSA 1TNGA 1GI3A 4X1PU 1T8MA 2EC9H 1C1PA 3M3TA 1AMHA 3P17H 1W14U 1YPKH 5TCCA 2PKSC 1UTJA 1GMDF 4Y10E 1CA0C 3RXHA 2CF9H 2IJD1 1V6DA 2QA9E 9LPRA 2QXJA 1V2LT 2TPIZ 3ZZ7A 3BTME 1VCPA 1TALA 1YPGH 3OYPA 1DUEA 1NBMD 1LVBA 1GCTC 3A7VA 3C27B 1DX5M 4DJZB 1HJ8A 3SN8A 3W1EA 4YZUA 1GI8B 2HPPH 4K2YA 2G55A 3M3VA 2UUKB 1EOJA 1QA0A 4BXWA 1LPGB 4NWLA 3DHKH 1O36A 1GBEA 5GCHF 1HUTH 4Q2KA 2Y82A 1O33A 2D2DA 1C5OH 4MPXA 1UK2A 3DSOA 4IBLH 3EA8A 3GY6A 3A89A 1GBBA 1FLEE 3ENSB 2FOFA 2PKAA 4ABFA 2KX4A 3E0NB 3AVZA 3M5LA 5DP5A 1VITH 4ZHLU 4UONA 1FAKH 2O8TA 1KXEA 1P8VC 3HKJB 4ZCNA 2F9BH 1CBWB 1QY6A 3AK5A 1LTOA 2Z7FE 2BY8X 3RMLH 2R0KA 2QYIA 3WWBA 1T7CA 1TPAE 3GY4A 4X1SU 1T4VH 5AFZH 1NFXA 1W0YH 1RTLA 4VGCB 3FP7E 3SI4H 2GJGA 1BCUH 1OKXA 3SU5A 3TK5A 2ZI2H 4U32A 1NM6A 1RTFB 4FOUC 4GLYA 5PTPA 1UTLM 2ZU1A 3ZZAA 2BB4A 1L1JA 2QF5A 1AB9C 3GICB 1ANCA 3RC4A 2H5DA 1GL0E 4XBDA 3EA7A 2CF8H 4X6MA 4AN7A 1MKWK 1TA6A 5FCKA 3UREA 3ZYDA 1GMDG 1LKAA 1AQ7A 2NU3E 3KQEA 4AGJA 1E79D 2W7UA 4ZKSU 1ELEE 1JXPA 3A7TA 8GCHF 1HAOH 3AAUA 3JZ1B 4Y8YA 1V2RT 3GOVB 5A09A 1C1TA 4B76A 1HJ9A 4GCHF 3T27A 4CRAA 3QZQA 2LP6A 2XBYA 2ZDVH 1NO9H 1CHGA 1F0TA 1C5ZB 5EXMA 4AGKA 1SR5C 2ZGBH 4JZIA 4YXWD 1FI8A 2H1UA 2SGPE 1SLXB 5FBEA 2O8WA 1C2EA 1WSSH 5GCHG 4TWYA 1K2I1 3PLBA 1MTVA 1SOTA 4HG6A 5DG6A 1BHXB 1SHYA 2H9TH 4TWWA 2ALPA 3QUMP 1FY5A 3KCGH 2JKHA 2WYJA 1EFRD 4Q4LA 4OS5A 4XD7D 5AF9H 4Y6DA 1C4Y2 2DE9A 1EZSC 4Q7ZA 1H8IH 1NY22 5AFYH 1QZ8A 2EI8A 3PLPA 3U28C 2ZGJA 1GVLA 5I25A 5GJ4B 4O3UA 2KCOA 2EEKA 4PROA 3UB0A 2ZF0H 1W8BH 4NIYA 1SBWA 2PFEA 2QF3A 2BXUH 3ZZ8A 2A0QB 1LHDH 3RC5A 2XOKD 1C2LA 3U98H 3M37A 2ZFPH 1BJUA 2Z9GA 3Q77A 2VWMA 4FUBA 1O2VA 1BTXA 3NWUA 3U8TH 1MABB 1RGQA 2LPRA 2TRMA 4NSYA 1G36A 1J16A 1P3EA 2GCTB 3BEUA 2J34A 1HAYB 1O2SA 1SLUB 3RXAA 3TNTA 3QWCH 1NRRH 5B6LA 1P9UA 4DG4A 1BBRK 1FY1A 1SQTA 1FONA 2GMTB 2KZ4A 3PLKA 3OAAD 1S82A 3NRLA 1S81A 4DVAU 3MMGA 1TAWA 4X2WA 5T6GA 2H2ZA 1MMJN 3BIUH 1KLTA 1K1JA 1E34B 1O3JA 4IMZA 1GCDA 3H09A 2OP9A 1P2IA 2O8LA 1ZYOA 2BD5A 3BIVH 3M7QA 3P70B 1AGJA 1N8OB 4UFDH 4NG9H 2BD7A 4GCHG 1GBDA 3GISB 2JETB 1EZQA 1GJDB 1GI0A 1ABIH 1CQQA 1SB1H 2ZTYA 3KL6A 2BZ6H 3PWCA 4X8TH 1FX0B 4RKOB 1C1NA 1C5RA 1E36B 4QT8C 1O5BB 1AI8H 1ESAA 1QB6A 4CREA 1W12U 2QF4A 1A0LA 1RTKA 4DY7B 1GHAF 1Y3VA 1BDAA 1QRXA 2P8OB 4YOGA 2DE8A 1YCPK 4IN1A 1QR3E 1WAYB 3FZZA 1SFQB 1TMTH 3KQCA 5FCRA 3OTPA 1AVGH 2TGDA 4Y8ZA 1EOLA 1N1LA 4RN6A 4FUHA 1ELTA 4AX9H 5C94A 1UVPA 1DSTA 1FY4A 1ARCA 3W95A 1P3CA 3FO8D 5HXFA 1FUJA 3RXKA 1JBUH 3W94A 2CN0H 3LONA 1Y5UT 3LJOA 3MTYA 3GYLB 2GT8A 4X2YA 3RXPA 1ZHPA 2OXSA 1EX3A 3BTHE 1E1QD 1YCPM 3A7YA 4NA7A 1FQ3A 1G30B 2UWLA 1W0JD 4NIVA 3TNSA 2G5NA 1DY8A 2A4GA 2BZAA 1ETSH 3LC5A 1GMHF 1SGNE 3U9AH 3SV7A 1TNHA 1Z71A 3RXRA 3U69H 1GCTB 3BTWE 1TWXB 4ISHH 1TRMA 5FX5A 2SGEE 3T29A 3N7DA 1V2NT 3CS7A 1ELGA 3MU5A 2ZZUH 3LJJA 1XUIA 1O2NA 5C1XA 1OWIA 1SC8U 1A5GH 1XKBC 2BQWB 2WPHS 3T28A 5CMXH 2A5KA 3QX5H 4Y79A 3DUXH 1CA8B 1BMNH 3FFGA 1YWUA 3I77A 1F7ZA 4JYTA 4KTUA 3V3MA 1GHYH 2ODPA 1EATA 3GS9A 2BM2A 1DY9A 1Y3WA 2J97A 2ZO3H 1GPZA 1PPHE 1RD3B 6CHAB 2UUJB 3FP6E 4MPUA 3DA9B 1AD8H 3ELAH 3HK3B 2XC0A 1BBRE 4X6NA 2WPKS 2R2WU 5F53A 3KYFA 2J95A 2PSXA 2Z3DA 1LPKB 3DSGA 1AZZA 2ZKSA 1C1WH 1ZPBA 1QRWA 4X8VH 1FZZA 4KKDA 5E0HA 4IN2A 2A5AA 5GPIB 2WSSD 1GHAG 1VJ9U 2ZU4A 5HGGA 3STJA 2SNWA 5IYTA 4ABEA 3TH4H 1C5YB 1SGCA 5T6DA 1XUJA 2AIPA 1XXFA 1KDQB 3GY2A 4X2VA 2QY0B 3MH5A 1K21H 4H4FA 1MCVA 1YLNA 2C90B 3KF2A 2J4IA 2ESTE 3P95A 4IC6A 1W10U 1RRKA 4FVDA 2OQUA 4INHA 4ABHA 3OX7U 2Y7ZA 1QGFA 3UNRA 1AB9B 4MNXA 3K65B 1PQ8A 5EPYA 1DICA 1D6WA 2P3FH 4ESTE 4NGAH 3LGWA 1Z8GA 2B9LA 1WQVH 1Q3XA 3RM2H 1GMHG 1TNIA 3HGNA 3ITIA 1V2ST 1C1VH 4X8UH 1Q2WA 1B0EA 4CR5A 3SUFA 4DIHH 2XWBI 3L6PA 3PRBA 1ACBE 4Y11E 4B71A 2OC7A 1W2KH 2ZPRA 4GSOA 3BG4C 2P93A 4H42U 1TRNA 1ZRBA 1VCQA 4WY3A 3UY9A 1P2OA 3F9FA 1MQ6A 1YPLH 1CO7E 5EQRA 1DITH 1WBGB 3KGPA 1GJ9B 2TGTA 4ZXYH 1EJNA 4AFSA 2FPZA 3QTVH 3QK1A 1PQ7A 3SQHE 1H8HD 2XTTB 3RXIA 5C0TA 2TBSA 1NC6A 3NCLA 4DOQA 1HAPH 2IPQX 1N6YA 1SGEE 3OFND 5GXPA 4TY6A 2Y80A 1C1SA 8LPRA 4B2BA 2FTMA 5F6MA 1LQDB 1UTPA 5C17A 3SU2A 3LKWA 2JH5D 3SUEA 4B73A 2YMSC 1UCYE 3MQKC 3SYJA 2P95A 1QJ1B 4A92A 1E35B 1EP5A 1KXAA 3Q3XA 2CGAA 1QURH 5A8YA 1AN1E 1MBMA 1GJ8B 2W6JD 1C4V2 2Z9KA 5DJ7A 2J5UA 1DWEH 2FP7B 2B7DH 3Q3KA 3SU6A 1O30A 1C4U2 1TABE 1A46H 2IN2A 2UUYA 1O3PB 5J4SA 2BDGA 3LIWA 1S6LA 1O5GH 1WV7H 1PPFE 1RXPA 1HPGA 2WUBA 3GY7A 2G4TA 1OPHB 2VGCC 2XBVA 2P3TB 3RXSA 1CT2E 2VH0A 2GP9B 1O2LA 1QBVH 1TB6H 1QL7A 1O3MA 4FUCA 5C0UA 1QB1A 1P9SA 5DP6A 2SGDE 1UJ1A 2R9PA 3M7TA 2WPMS 3P8FA 2ZWLH 1CGJE 1DLEA 1MTUA 3RLWH 1GJBB 3RMMH 2KCYA 1Y59T 4E05H 1KXCA 1UVOA 1UVTH 1MZAA 4K8BA 4H6TA 2Q6FA 1FY3A 4IC5A 1C1RA 1O35A 2ZCLP 5E0JA 3AW0A 5LGOA 4WH8A 3M3SA 4RT0A 2Z94A 1Y5AT 3T25A 5FPTA 2PTNA 1XKAC 4Z0KA 2AMPA 2Z9JA 1PPCE 1LO6A 4K69A 4ABJA 1O38A 1MQ5A 2QXIA 4A5TS 1BMLA 2VVCA 4TPIZ 1J9CH 3ZVAA 1AUTC 3KIDU 1RFNA 5TJXA 3FANA 2F9NA 1EXFA 1XVOA 3D65E 3LGIA 5DN6D 2XC4A 1VJAU 1EB2A 4WVPE 1CVWH 2A45B 3U1IB 2GKVE 1GJ7B 1LHEH 4RSPA 2WUCA 4OM9A 1PPBH 2JJ2D 3MU8A 3N7OA 3TITA 3UOPA 3BN9A 1TGCA 3K9XB 2SGFE 4UFGH 2HALA 1OHHD 1WDIA 2J2UA 3FZDA 3GCHC 2THFB 4M9FA 1D9IA 1VGCC 2AEIH 2HVYB 1GBFA 4MDSA 1SOZA 1HAXB 2Y6TA 3GY8A 1D3TB 4FUFA 1QNJA 1TPOA 3QGNB 2SFAA 4OGYA 1MU8B 5EJ1A 2W7SA 1A5HA 2OLGA 1IQNA 1HGTH 1CE5A 2A2XH 4ZXXH 3SJ9A 1NRNH 1H9HE 1O5FH 2VU8E 1SGFA 3F1SB 2STAE 5A0CA 2PTCE 3LGTA 1BTZA 1THRH 1A2CH 2J98A 2QAAA 5HMAA 1ELFA 2WPJS 4O03A 2KFWA 1NFWA 2A2QH 3ZVFA 3EA9A 3VB5A 1G3CA 3RLYH 4DGJA 2AFQB 3E0PB 1UVSH 3SZEA 1TNLA 2FMJA 4ASHA 4YT6H 2FDAA 1G9IE 2YOLA 4MG3A 2PR3A 3TGIE 1KXDA 3F6UH 4LK4A 4K60A 1NROH 1AWFH 1HJAC 2FLRH 3PO1B 1BRAA 1TMUH 4BXSA 1MTSA 1PPGE 3MNSA 4WF8A 4Y8XA 1ESBA 3T26A 2XRCA 1GJ4H 2QXGA 3RMOH 1PYTC 3RXBA 1SMFE 2ZCKP 2OINA 2FEQH 4UEHH 4ISLA 1UHBB 1OYQA 4Y0YE 3D62A 3NXPA 1MAXA 1Y5BT 2G51A 1DXWA 4MVNA 2A4OA 4CRCA 2ZHEH 1SQAA 1ZTLA 2FOMB 3PB1E 2CXVA 2NWNA 1DWCH 3HK6B 3SV6A 2K8IA 3RXGA 1BUIA 3ZVBA 2ZDLA 1CT0E 5L6NH 1CSOE 1IHSH 1IQFA 1YF4A 4KGAA 3PYHA 3VB7A 7ESTE 4O97A 1WOFA 2V6NA 3TJUA 2BLQA 1O5CB 1V2MT 1C5VA 3K2UA 3RP2A 1PJPA 1DWBH 1C2IA 1NU7B 3GYMA 1D3DB 5F8TA 1VCWA 2XCFA 3ZZBA 1J8AA 4DCDA 1JRSA 2FM2A 3A8DA 1TONA 1TGSZ 3LOXA 3UR9A 1BTPA 1EPTB 2FLBH 2CHAB 3DFJA 1IOEA 2GZ7A 1NPMA 2I6QA 3PV2A 2P3UB 3S7KB 5DGJA 4YO9A 2PGBB 1GG6C 3BG4B 3TPIZ 3TGJE 2JH6D 1O3GA 1PQAA 3IG6B 1GHWH 2OUAA 3SU1A 1ZMJA 2SGQE 2WHXA 1BRBE 4WMFA 3SNAA 1TGTA 1YPMH 3MNBA 1H9LB 1UTKA 4MNYA 3V13A 2ZEBA 2BY7X 1HV7A 2KM0A 1FPCH 1ZJDA 1PYTD 1GI2A 1XX9A 1S0RA 2Y5HA 2OD3B 3MU4A 3BTGE 3TIUA 3EAJA 3WY8A 1O2KA 2M2AA 3MHWU 1GVKB 3SGQE 1QJ7B 1ZR0A 1GBIA 1O2HA 1GBLA 1JIMA 1SGPE 1LHFH 2BDCA 1A1RA 3RXMA 1MKXK 2F9PA 1DT2A 1O34A 1AFQB 4D9QA 2AS9A 3NUMA 2V0BA 4IMQA 3T62A 3A88A 2Z9LA 3PV5A 3ZVGA 1C9PA 2H5CA 4ZHAA 1GJAB 3SUDA 1O2ZA 2BVSH 2FYQA 3MI4A 1O2RA 1P12E 3GDUA 3OU0A 1A5IA 1VR1H 2ZHWH 1BRUP 5CDFE 1S85A 4X0WU 7GCHF 1NZQH 4MNVA 2KAIB 3ZZ9A 5HKKD 4M7GA 2D8WA 1O3OA 1O5EH 4J2YB 2R2MB 3RU4T 4JYVH 1ZSKA 5EG4A 3RXFA 1C5TA 1SGRE 1MZDA 1TOMH 2WV5A 1SQOA 3TU7H 2FOEA 1AIXH 1MCTA 1NRPH 2G5VA 2ZFTA 2EQNA 3OY5U 3SV8A 3F2GA 2NU0E 3VGCC 4XSKU 3FOAA 1FXYA 3OEHD 1HYLA 3V12A 4CR9A 4YM9A 3RXCA 3SU3A 3ZZ4A 1GBAA 2TGAA 3SW2B 3H7TA 1EAXA 5ABWA 2C8XB 2ZGXH 3UIRA 3HATH 1HXEH 3EE7A 5JYIA 6LPRA 1EP6A 1C2DA 2FYRA 1OP0A 1O3AA 4K8YA 2KCPA 1Z1IA 3NK8A 1GI7B 2NU2E 2J98B 3MH7A 3ATMA 5F03A 1Q31A 2HNTC 4AC9A 1Z6JH 2Q1JA 1V3XA 2ZG0H 2VWLA 4X6OA 1IQMA 2FS9A 3SNCA 4CH2B 1LCYA 2WYGA 4AFUA 2OTVA 2BY9X 2ZC9H 1XUFA 1C5UA 3PV4A 4YT7H 8GCHG 3SGAE 1OP8A 2XNIA 1YBWA 1BMMH 1BTWA 3MNCA 1AKSB 5FPYA 1K28D 4JK5A 3SQEE 1XMNB 3GCHB 1SGIB 3IITA 1OYTH 1AVWA 3P8NA 3TGKE 2PP6A 1CGHA 1AY6H 1A3EH 4OS4A 3RXVA 1DLKB 1GBCA 3SORA 1ID5H 1ESTA 1QQUA 3P92A 5GDSH 5A0AE 1O2OA 4AG1A 1EB1H 3BTQE 1G2LA 1XUKA 1IQIA 3FP8E 1O2IA 3ATLA 1EAUA 2ANWA 5EJLA 1UVUH 5FXLA 1P57B 3AAVA 3U8OH 5HIYA 3M35A 5F8XA 3UFAA 1F5LA 1ZOMA 1HAVA 4U30A 4P02A 3R3GB 1ELVA 1O2PA 1MTNB 2A7CA 2IJOB 1M9UA 1TGNA 1O3HA 1WXRA 7GCHG 2ZFSA 4UDWH 3LU9B 1D4PB 3DFLA 1ANBA 2HWLB 4ABGA 1HDTH 4WH6A 4AYVB 3PMJA 3K6YA 2BD4A 1QTFA 1TFXA 5A2MH 3B8JA 2BY6X 1DANH 3CNRA 4YOJA 2PKAB 3A84A 1E0FD 1BT7A 2A7HA 4XBBA 1D6RA 1HRTH 2Y7XA 2B0FA 3OE7D 3BTEE 2PKSB 3ZZ3A 1CA0B 2R3YA 1Z7KA 4FUGA 2ZIQH 1TLDA 1YPHC 1O2QA 2D26C 1GJ6A 1T31A 1QRZA 1U6QA 2WPLS 2XWAA 4J1YA 1O3CA 1A61H 3MH6A 1GBHA 4HZHA 2HNTE 1P2JA 3M5NA 2BQ6B 1O5AB 2P94A 2RA0A 2ULLA 1BMFD 1C2HA 1TGBA 2GT7A 2ILNA 3DCLA 4FETA 2G00A 3E90B 3VFEA 1XM1A 1ELDE 4XRNA 2AGEX 1DOJA 4OS6A 4XE4A 2F4LA 4CRGA 1HAGE 3F0PA 1IAUA 3UQVA 3E6PH 1T8LA 4INLA 3FKSD 3KQ5A 5L2ZH 1SGFG 4GHQA 1NFUA 2BYAX 1V2JT 4X8SH 1TBRH 4CRDA 3MNXA 1QFKH 5IDKA 1SG8B 1GJ5H 2RDEA 5E8EH 4GPGA 2QXHA 1G37A 1P2KA 5HM2A 2ZHQH 1ETRH 1A4WH 5T3HA 2K1QA 2PSYA 1XUGA 2A32A 1EAWA 5HIZA 2XBWA 1BZXE 4ZROA 2PV9B 4IS5A 3PTNA 4Q63A 4H6SB 1G3BA 2BDIA 2WV4A 1HFDA 1QA7A 3SO3A 4YOIA 3UAIC 4XOJA 3P6ZB 4U2WA 1BTUA 2RDLA 2Y81A 4CRFA 1WYKA 2RA3A 2BY5X 2STBE 2VIWA 1T8OA 5JPMH 1ANDA 1LDTT 2PHBA 1SLWB 2ZTZA 1V2VT 3A82A 1T4UH 2VIQA 2ZU5A 1NRSH 2ZGCA 4DT7B 1YPHE 3ZVCA 3ODFA 2ASUB 4I86A 2CK3D 2F9VA 1NN6A 1KSNA 5JBTA 1K1NA 4LXBH 4LZ4B 4FUJA 1THSH 4DW2U 1SGYE 3MO6A 3VXEH 1JMOH 1WCZA 1CBWC 2AERH 1ARBA 4I8JA 3RU4D 3M61U 1TQ0B 1BTYA 1P05A 4WMEA 1C1QA 5GIBA 2C8ZB 1WTGH 1INCA 2J94A 2P59A 2AIQA 3Q76A 4Z6AH 3CP7A 4VGCC 2Y5GA 4OS2A 4K1EA 5HM9A 1LVYA 1J15A 5ETXA 1EUFA 1UW7A 1F5KU 1HAIH 3TK6A 1MKXH 4E7RG 2OC1A 3UWIA 3PTBA 3OEED 1HIAA 2A1DB 1O2JA 2GZ9A 2ZPQA 1W13U 4BANB 2ODQA 1SGTA 3KNXA 2ZCHP 3JZ2B 1OP2A 2EA3A 1FMGA 2BDYA 3I29A 9ESTA 4IW4E 4BOHA 2JH0D 4ASUD 4ZHMU 1O37A 5EJZA 1RIWC 1PFXC 4WXVA 6GCHF 2IPHA 4GHTA 4JZDH 3SV9A 1BTHH 4I33A 1K1IA 1IQEA 4UFEH 3H5CB 1C2FA 5EXNA 3RMNH 2QIQA 3LGVA 5B6OA 1ZJKA 4KELA 5C3NA 1F92A 1C2KA 2F9UA 1KMHB 5BPEA 3SNBA 1TOCB 1F2SE 4YESB 3A86A 2B5TB 1O2UA 1LVOA 3EGKH 2ALVA 5E2PA 3MOCA 4CHAC 2HLCA 2QV1A 4JK6A 2ZHFH 2BXTH 3RUOA 1C5QA 1OXGA 2ZECA 2A5IA 1O3KA 3RXTA 3GCTF 3RXLA 1Z1JA 4NWKA 4LOYH 1Y3XA 3ZYEA 4ABBA 2QCYA 8ESTE 2ODYB 2GV7A 3B9FH 3A81A 3U1JB 4BTIB 4DURA 1JIRA 4XDEA 3AW1A 2QF0A 1UK4A 3A7XA 2L74A 3LT3A 2HNTF 4D7GA 3MWIU 3BV9B 1Y3YA 1LVMA 4JCNA 4E06H 3ZVEA 3ZZDA 2FS8A 3CENA 4NFEA 5IK2D 2O8MA 3NKKA 2HPQH 3VB4A 1GDNA 2QGRA 4KP0A 1P11E 3V0XA 4B1TA 5JB8S 1ZGVA 5DP7A 3F9GA 1SGDE 1Y3UA 5KGOA 4AORA 1GDUA 2GGVB 4ZAEA 1YLDA 2GCTC 2Z6BD 3ZVDA 1G3DA 4NA8A 5DKMA 5A8XA 2XC5A 3O8RA 2YMSD 3D49H 1QBNA 1Z6EA 4FXGH 4ZMAH 1L0ZA 2OCVB 2GMTC 2FOGA 5JDUB 1ZTJA 4DIIH 1YLCA 2Z3CA 3K6ZA 1FIZA 4D76A 5CHAC 4Q7XA 4JZ1A 5FPSA 1TYNA 3ODDA 2ZDKA 4I31A 2O8UA 4ISOA 3RXQA 1KYNA 1DWDH 3LGUA 5LPRA 1YY3A 3LH1A 2H9EH 1V2QT 3BTDE 1YP9A 4Q80A 6GCHG 1C2MA 1LKBA 1OS8A 2VJ1A 4ABAA 4F4OC 2BHGA 3O8DA 3PMBB 1N8OC 3M7UA 4WWYA 1KXBA 3RC6A 1XVMA 1EZXC 2JETC 1O3IA 3BG8A 4A1VA 2F9OA 4I8HA 1GI1A 2QN5T 2VBCA 2Y5FA 3KN2A 1ELCA 1KXFA 2W6ID 2ZU2A 3AASA 4MPVA 1VKYA 2V3MA 4I32A 5T6FA 1ZMNA 4AG2A 2BD9A 3VG8A 1EQ9A 1IQLA 1T32A 3DSPA 1C5XB 4ZH8A 5L30H 2H9HA 3BEFB 2GTBA 2P8OC 3FN8A 3SGBE 2F83A 1QCPA 2VB0A 1FN6A 1C5MD 3GCTG 1GBJA 1T8NA 2B8OH 2ZDNA 4K5ZA 3V7TA 1P02A 2V3OH 1FPHH 1Z8RA 2FTLE 4AOQA 1TE0A 1ZSLA 3L33A 4Y0ZE 1AVXA 5E2OA 3T5FH 1CGIE 3TH3H 4BAHB 5EODA 5FL7D 2R3UA 3LGYA 1FNIA 4BAMB 4ACAA 1H8ED 3S9AA 1NFYA 2HOBA 2OC0A 2YNAA 3GCOA 5LPFA 4X1QU 2RG3A 3G01A 4K1SA 1YPJH 2KR7A 3UQOA 1UCYH 5C20A 1OX1A 2BDHA 2VWOA 2FZZA 1SFIA 2BDAA 1NS3A 3QTOH 5JBAS 4B2AA 1OSSA 2ZQ1A 1ZHMA 2NU1E 3SJOA 1QIXB 4F48B 1QQ4A 1NBME 1GL1A 1Y8TA 4NIXA 5C67A 5LPEA
chains in the Genus database with same CATH topology
4AB8A 2V3HH 2GD4B 3E1XB 3UWJH 1P03A 4Y71A 2KCAA 2SGAA 5DO4H 1NU9A 1K1PA 2BX3A 2BQ7B 1MUEB 2ZPSA 2W26A 4NZLA 1GI5A 2HVXA 5C2ZA 2P16A 1O2WA 4X2XA 3KQBA 1Z8IB 2GDEH 1DM4B 3M5OA 1S0QA 2M5TA 1HIAB 2UWPA 2Z3EA 1YC0A 1GI4A 4A1TA 3A7WA 4B6FA 2WINI 1UTQA 1TNJA 5H4IB 1HCGA 2RCEA 1EJMA 4JYUH 1AO5A 1IQJA 3E91A 2ZFQH 3QO6A 4ZKNU 4NCYA 6CHAC 4MNWA 4AFZA 5I46H 4Y7AA 4BAOB 4O9VA 1W0ZU 1XXDA 1H4WA 1ZLRA 1KY9A 1TRYA 1IQHA 1B5GH 1S84A 3ATWA 1O5DH 5DPAA 1X7AC 1C5WB 1TPSA 4MQAA 1GI6A 3EE0B 1QHRB 3SJIA 2JJ1D 2C93B 3VB6A 1K1MA 1FDPA 1DXPA 3GDVA 1THPB 4B2CA 2PLXA 2YNBA 3KQDA 3TVJB 1N6XA 1JOUB 2GCHF 3L3TA 5C5NA 1C1UH 1OOKB 1VITF 2K0QA 4GVUA 1P04A 4GAWA 1K22H 1GHZA 5FAHA 1KTSB 1ELBA 5GWZA 2A31A 1DFPA 4WJG2 2BDBA 1GGDC 2YMSB 1UMAH 3SNEA 5DP4A 1AWHB 1ZPZA 2FI5E 3KHVA 1K1OA 1W3CA 3RXEA 4ABIA 1YGCH 1C5LH 3SV2H 1J14A 3NPSA 1G2MA 1G3EA 3E16B 1ZGIA 4TT3D 1RIWB 1LHCH 1H1BA 4CRBA 2FODA 3MO3A 2FX6A 5F8ZA 1L4ZA 1QL9A 1O3NA 2G52A 3TK9A 2FOHA 1NRQH 1O2XA 2FI3E 2VGCB 2AH4X 3SU4A 1D3PB 2ZHDA 3LDXH 1E38B 2ZA5A 4A7IB 1RJXB 2VINA 4BAKB 3NZIA 1P0SH 3F2HA 3O8CA 1KDQA 2A4QA 4NFFA 4CHAB 1O3FA 4CH8B 1V2UT 4A1XA 3A8BA 5DSFA 3QDZB 4CBOA 2UWOA 4FUIA 4I8LA 5EU8A 1UTNA 1B0FA 1L1NA 3BSQA 1HBTH 3A85A 2BLVA 3RXUA 2ANMH 3WWFA 1P09A 1JWTA 1SHHB 5JBBS 1OWHA 1TBZH 5EGMA 1NTPA 3U8RH 1ELAA 2J92A 1BB0B 3D23A 1ABJH 3O8BA 4OGXA 1F0RA 1W11U 2AGIX 5DP8A 2CV3A 3SJ8A 2TGPZ 5C1YA 2A4RA 3ESTA 3F3BA 1S6FA 3STIA 3RDZA 1BHXF 1DVAH 1TX8A 1DDJA 1A3BH 1TX7A 2PW8H 2VIVA 1GHBF 1WU1A 2BD3A 1BOQA 3C1KA 2GCHG 2FXRA 1A0JA 1VITG 2AGGX 4B75A 1MU6B 1P2QA 2OK5A 3LPRA 1O39A 1LHGH 2ZDAH 5JBCS 1MTWA 1A7SA 3N7EA 2BX4A 4NA9H 3SBKA 1VGCB 2FX4A 3HKIB 5E0GA 2ZQ2A 2HRVA 2BD2A 1AU8A 5CHAB 2W3KA 3ZZ6A 2I6SA 4XFQA 3PMAB 4F49A 2ZFFH 2A7JA 3RXJA 1UTOA 1LMWB 4LZ1H 4B6EA 5FBIA 1ZHRA 1L4DA 3A80A 1B7XB 4Z1MD 3A87A 2BVRH 5DK1A 2FOAA 3EYDA 1GJCB 4TPYA 1E1RD 3SHCH 4NSVA 3E8LA 2ANYA 2AYWA 2BTCE 3ZV9A 7KMEH 1C9TA 4BTUB 1O2MA 1W7GH 1O3LA 3S9CA 1YYY1 1MD8A 2AMDA 3GCNA 3OY6U 3PWBA 2BMGB 2D1JA 2XBXA 1HJAB 2VIOA 2J9NA 2BLOA 1IHTH 2VNTA 2XNDD 1CHOF 4YTAA 2UUFB 3URCA 1O2GH 1BJVA 1GHXH 3TJVA 5T1VA 1AFEH 1EAIA 4KTSA 2LELA 1JRTA 1MBQA 5J4QA 1HAHH 3PMHB 1V2KT 3TJNA 1O32A 1L1GA 5A8ZA 5AHGH 1DE7H 3UNQA 4JZFH 3BEIB 2F3CE 1C1MA 1SL3A 3FAOA 1OWDA 1GHBG 3VPKA 1TA2A 1FN8A 3OTJE 1K1LA 3A8CA 5EW1H 2BVXH 1XUHA 1O2TA 1V2WT 1GMCF 4AYYB 1ZSJA 1KLJH 3TJOA 2OQ5A 1QL8A 2JIZD 4MTBA 4TSFD 2EI6A 2GX4A 1OWEA 2XW9A 1MD7A 2BOKA 3SUGA 3LH3A 1YPEH 3P8GA 3KEEA 3QN7A 3ATIA 5TCAA 1H8DH 1ZMLA 1ZTKA 3SI3H 1DS2E 3UNSA 2WPDD 4ZKRU 3ZZCA 1C5SA 1UCYK 1TX6A 3BTKE 1AE8H 3F9EA 2Q6GA 1AE5A 3UTUH 1GWAA 1O31A 3N99A 2FI4E 4RKJB 3HPTB 4JMYA 2C8WB 5CE1A 1C2JA 1ZZZA 1CU1A 3PO1C 2XCNA 1MH0A 4SGAE 4WXIA 4JZEH 3WW7A 2AMQA 3RM0H 1W7XH 4NIWA 2OC8A 1K9OE 5DP3A 3ZZ5A 5C5OA 2C3SA 3RXDA 1TQ7B 1FAXA 1ETTH 3Q00A 1P2NA 4OS7A 1LQEA 2F43B 2O9QA 3QZRA 4XBCA 1O3DA 2BD8A 4ZKOU 1GG6B 1NT1A 1BITA 2ANKH 3MYWA 1E37B 1A0HB 1C2GA 4FUEA 2WV9A 3I78A 4Q7YA 3DT0H 1GI9B 3ZIAD 1PQ5A 4FU9A 1CHOG 2EI7A 2G4UA 3FVFB 3PROA 4Y76A 4HI3A 4BAQB 2W5EA 1P01A 4ISNA 1GDQA 2FWWA 3S7HB 4YLUA 5CHBA 4FVBA 1ORFA 5EW2H 1PPEE 2XXLA 1GGDB 1ZPCA 3SOSA 2ZNKH 1P06A 4UE7H 3F9HA 4D8NA 5EQQA 2VIDA 3TH2H 1UO6A 3TLOA 2C8YB 4GUXA 1V2OT 4UD9H 3DD2H 3H7OA 1V2TT 1TPPA 1YKTA 3MU1A 3B23B 3LC3A 1GMCG 4WMDA 3BF6H 3GY3A 1EPTC 5DP9A 1GBKA 1HB0B 1MKWH 2CHAC 2Q6DA 4B74A 4E7NA 2HLDD 5G4BA 1QBOA 1SSXA 3M36A 3GY5A 4NZQA 1UHBA 1WUNH 4F55A 1PPZA 4K1TA 4MLFB 4SGBE 2OBQA 3QLPH 2VH6A 3RU4E 1F0SA 1NESE 4DT4A 1BQYA 5K7RA 1P2MA 4THNH 4ZUHA 1DUAA 8KME2 2ZDMA 1DSUA 1P10A 4D9RA 1FY8E 1AZ8A 2SNVA 2W3IA 1UK3A 3HGPA 1FV9A 4HFPB 1BRCE 5BRRE 3QGJA 4FUDA 4AB9A 3CS0A 4FU7A 3UOUA 1KIGH 3F2FA 3VGCB 1D3QB 1FIWA 3MO9A 1KLIH 4INKA 3UR6A 1EKBB 3ATKA 4I8GA 1F0UA 3SU0A 4X1RU 4D7FA 3BTFE 3UUZA 1GBMA 5FX6A 1VZQH 1GHVH 4BTTB 4Y7BA 3PM3A 4CBNA 1S5SA 2OBOA 4A6LA 1FJSA 2AHME 2ZTXA 2L6OA 1G32B 1HAVB 2VVVA 1EPTA 2GV6A 4ABDA 2FO9A 4HTCH 2BLWA 4X6PA 2ZP0H 3RXOA 1TIOA 1AFQC 3S69A 3BTTE 2V35A 5AVDA 2H6MA 1Z8JB 3SNDA 3S0NA 3SJKA 5GNDA 2PWXA 1OWJA 1IQGA 4K3JA 4AZ2B 3PRDA 4OS1A 4UFFH 4ISIH 1SPJA 1KTTB 1HLTH 1SI5H 5ESTE 3UPEA 2QE7D 5EXLA 1GVZA 2CJIA 5L2YH 2VWNA 1HNEE 2PUQH 2VVUA 4TYDA 5EPNA 2WPIS 3MFJA 3IWMA 2G8TA 1SVPA 3SHAH 1TNKA 4U01A 2V7QD 4MPWA 5JB9S 1BBRH 3E3TA 3A8AA 1SGQE 2DUCA 1BA8B 2JDID 5ESBA 2FOCA 6ESTA 3GDSA 4TY7A 1TMBH 1IQKA 1ZRKA 3EDXB 4IGDA 3T2NA 4HGCA 1O3EA 2PUXB 4KTCA 1GBTA 2BOHB 1EZUC 2WZQA 2IOTA 2CMYA 2G81E 4R8TB 5A0BA 1C5NH 1UTMA 2QC2A 2F91A 3EQ0H 3VB3A 2R0LA 3F68H 1O2YA 1O0DH 2GVFA 1OWKA 3MU0A 2KAIA 3F0OA 5FHTA 3S9BA 4I7YH 1AHTH 2VIPA 1H9IE 3A7ZA 1EASA 1SLVB 5EOKA 3M5MA 4O3TA 1TBQH 2ZFRH 3R0FA 1O3BA 3A83A 5C1UA 1F5RA 5K0HA 1WQSA 2FIRH 1L2EA 2LNCA 1YCPH 2HGTH 1MAYA 1SKYE 2GDDA 1W0KD 5EQSA 1LPZB 1YM0A 3OSYA 1S6HA 1COWD 2GZ8A 4YLQH 2XYAA 1C5PA 3SZNA 1J17T 2TIOA 3MH4A 1CT4E 3P8OA 3VEQB 4R0IA 1BIOA 1C1OA 5LH8A 2FOBA 1BMAA 1QB9A 4AFQA 2C4FH 4BNRA 1RS0A 1MTNC 1V2PT 1WTHD 2ZU3A 4I8KA 1HAZB 2FESH 5SGAE 3URDA 3Q3YA 2ZGHA 1HXFH 1DPOA 7LPRA 1AUJA 2J38A 4X1NU 4RI0A 2PGQB 4FU8A 2NU4E 2Z9IA 3VXFH 1ANEA 5HYOA 3ZV8A 1QJ6B 1S83A 1EJAA 1AKSA 1TNGA 1GI3A 4X1PU 1T8MA 2EC9H 1C1PA 3M3TA 1AMHA 3P17H 1W14U 1YPKH 5TCCA 2PKSC 1UTJA 1GMDF 4Y10E 1CA0C 3RXHA 2CF9H 2IJD1 1V6DA 2QA9E 9LPRA 2QXJA 1V2LT 2TPIZ 3ZZ7A 3BTME 1VCPA 1TALA 1YPGH 3OYPA 1DUEA 1NBMD 1LVBA 1GCTC 3A7VA 3C27B 1DX5M 4DJZB 1HJ8A 3SN8A 3W1EA 4YZUA 1GI8B 2HPPH 4K2YA 2G55A 3M3VA 2UUKB 1EOJA 1QA0A 4BXWA 1LPGB 4NWLA 3DHKH 1O36A 1GBEA 5GCHF 1HUTH 4Q2KA 2Y82A 1O33A 2D2DA 1C5OH 4MPXA 1UK2A 3DSOA 4IBLH 3EA8A 3GY6A 3A89A 1GBBA 1FLEE 3ENSB 2FOFA 2PKAA 4ABFA 3E0NB 3AVZA 3M5LA 5DP5A 1VITH 4ZHLU 4UONA 1FAKH 2O8TA 1KXEA 1P8VC 3HKJB 4ZCNA 2F9BH 1CBWB 1QY6A 3AK5A 1LTOA 2Z7FE 2BY8X 3RMLH 2R0KA 2QYIA 3WWBA 1T7CA 1TPAE 3GY4A 4X1SU 1T4VH 5AFZH 1NFXA 1W0YH 1RTLA 4VGCB 3FP7E 3SI4H 1BCUH 1OKXA 3SU5A 3TK5A 2ZI2H 4U32A 1NM6A 1RTFB 4GLYA 5PTPA 1UTLM 2ZU1A 3ZZAA 2BB4A 1L1JA 2QF5A 1AB9C 3GICB 1ANCA 3RC4A 2H5DA 1GL0E 4XBDA 3EA7A 2CF8H 4X6MA 4AN7A 1MKWK 1TA6A 5FCKA 3UREA 3ZYDA 1GMDG 1LKAA 1AQ7A 2NU3E 3KQEA 4AGJA 2W7UA 1E79D 4ZKSU 1ELEE 1JXPA 3A7TA 8GCHF 1HAOH 3AAUA 3JZ1B 4Y8YA 1V2RT 3GOVB 5A09A 1C1TA 4B76A 1HJ9A 4GCHF 3T27A 4CRAA 3QZQA 2XBYA 2ZDVH 1NO9H 1CHGA 1F0TA 1C5ZB 5EXMA 4AGKA 1SR5C 2ZGBH 4JZIA 4YXWD 1FI8A 2H1UA 2SGPE 1SLXB 5FBEA 2O8WA 1C2EA 1WSSH 5GCHG 4TWYA 1K2I1 3PLBA 1MTVA 1SOTA 5DG6A 1BHXB 1SHYA 2H9TH 4TWWA 2ALPA 3QUMP 1FY5A 3KCGH 2JKHA 2WYJA 1EFRD 4Q4LA 4OS5A 4XD7D 5AF9H 4Y6DA 1C4Y2 2DE9A 1EZSC 4Q7ZA 1H8IH 1NY22 5AFYH 2EI8A 3PLPA 2ZGJA 1GVLA 5I25A 5GJ4B 4O3UA 2KCOA 2EEKA 4PROA 3UB0A 2ZF0H 1W8BH 4NIYA 1SBWA 2PFEA 2QF3A 2BXUH 3ZZ8A 2A0QB 1LHDH 3RC5A 2XOKD 1C2LA 3U98H 3M37A 2ZFPH 1BJUA 2Z9GA 3Q77A 2VWMA 4FUBA 1O2VA 1BTXA 3NWUA 3U8TH 1MABB 1RGQA 2LPRA 2TRMA 4NSYA 1G36A 1J16A 1P3EA 2GCTB 3BEUA 2J34A 1HAYB 1O2SA 1SLUB 3RXAA 3TNTA 3QWCH 1NRRH 5B6LA 1P9UA 4DG4A 1BBRK 1FY1A 1SQTA 1FONA 2GMTB 2KZ4A 3PLKA 3OAAD 1S82A 3NRLA 1S81A 4DVAU 3MMGA 1TAWA 4X2WA 5T6GA 2H2ZA 1MMJN 3BIUH 1KLTA 1K1JA 1E34B 1O3JA 4IMZA 1GCDA 3H09A 2OP9A 1P2IA 2O8LA 1ZYOA 2BD5A 3BIVH 3M7QA 3P70B 1AGJA 1N8OB 4UFDH 4NG9H 2BD7A 4GCHG 1GBDA 3GISB 2JETB 1EZQA 1GJDB 1GI0A 1ABIH 1CQQA 1SB1H 2ZTYA 3KL6A 2BZ6H 3PWCA 4X8TH 4RKOB 1FX0B 1C1NA 1C5RA 1E36B 4QT8C 1O5BB 1AI8H 1ESAA 1QB6A 4CREA 1W12U 4DY7B 1A0LA 1RTKA 2QF4A 1GHAF 1Y3VA 1BDAA 1QRXA 2P8OB 4YOGA 2DE8A 1YCPK 4IN1A 1QR3E 1WAYB 3FZZA 1SFQB 1TMTH 3KQCA 5FCRA 3OTPA 1AVGH 2TGDA 4Y8ZA 1EOLA 1N1LA 4RN6A 4FUHA 1ELTA 4AX9H 1UVPA 1DSTA 1FY4A 1ARCA 3W95A 1P3CA 3FO8D 5HXFA 1FUJA 3RXKA 1JBUH 3W94A 2CN0H 3LONA 1Y5UT 3LJOA 3MTYA 3GYLB 2GT8A 4X2YA 3RXPA 1ZHPA 2OXSA 1EX3A 3BTHE 1E1QD 1YCPM 3A7YA 4NA7A 1FQ3A 1G30B 2UWLA 4NIVA 3TNSA 1W0JD 2G5NA