3T26A

Orthorhombic trypsin (bovine) in the presence of sarcosine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title The use of trimethylamine N-oxide as a primary precipitating agent and related methylamine osmolytes as cryoprotective agents for macromolecular crystallography.
pubmed doi rcsb
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t26A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t26A02
1H4WA 2FOHA 3CS7A 3PMAB 4IC6A 2ZDMA 2QC2A 2ZDLA 4JYUH 5ESTE 1ELGA 1QCPA 1BITA 1P57B 2ZO3H 2QGRA 1O0DH 2QN5T 1XUJA 4IN2A 1GJ4H 1RTKA 2PSXA 1LHDH 1FDPA 2W5EA 3E8LA 1ELVA 5T3HA 1C5MD 2GCHF 3SN8A 1DANH 3GDUA 5FBEA 2P8OC 1A5IA 1NFXA 1Y5UT 2VIOA 3U8RH 4FU7A 5DP7A 1SGIB 4ZHMU 1D3QB 2RG3A 5DP3A 4AZ2B 1PPEE 1F0SA 4HZHA 1XUKA 4U2WA 5C1YA 5L2YH 1S6HA 1MQ6A 1MTSA 4CHAB 2O8TA 3EGKH 1A4WH 1VCQA 2QY0B 3LOXA 1L4DA 1P06A 2BX4A 1ETRH 4X1SU 2A5KA 3E0PB 1E36B 4NG9H 3GCTF 5H4IB 3BEFB 4E05H 3A85A 1O39A 4Y7AA 1Y3UA 1QNJA 4O97A 3SJKA 3RC4A 3DHKH 1KXAA 4UFGH 4OGXA 1W2KH 4X8TH 3BF6H 5TCCA 4ABAA 3E16B 3FP6E 1SG8B 5JB9S 1XXDA 1SHHB 1PYTC 4HFPB 4HI3A 1P03A 2XTTB 1K1MA 2HPPH 3ATWA 1ID5H 2BVRH 2B5TB 3D49H 1EB1H 2BDYA 1FAKH 3MH6A 3A88A 3S9BA 1KXEA 1HAXB 1XX9A 7GCHG 1DICA 5AF9H 7KMEH 1SLWB 6ESTA 3A8AA 1Z1JA 3UR9A 2ALPA 1UTQA 4Y8YA 5K0HA 3TK5A 1O3GA 3U1IB 2QIQA 4H42U 4BXWA 5E0GA 1XUFA 2C93B 2FS9A 2XRCA 1AGJA 2VNTA 1NPMA 8GCHG 3LPRA 3QGJA 3FAOA 1B7XB 3GY7A 2FOAA 5DP9A 2Z3EA 4MVNA 5EODA 3M35A 1LVYA 1JIRA 2WPLS 3IG6B 3A7WA 1TBRH 2H9EH 5GCHF 1SHYA 1HRTH 5AHGH 3VB7A 1TFXA 1OP8A 4MNXA 3LIWA 1HNEE 2GV7A 4K69A 1ANCA 1VGCB 4XBBA 2XC5A 4XSKU 1C2LA 2XNIA 2Z9KA 4CH2B 4ZKOU 4XDEA 1GBCA 1O3EA 2OP9A 2R2MB 5DP5A 1DWCH 1AB9C 1NZQH 1O3LA 1ZJKA 1PPFE 5EW1H 4Y71A 4X6MA 1BCUH 4IBLH 4I31A 1HB0B 4NIXA 1GMHF 3UNQA 2BXUH 2SNWA 1SC8U 1GGDC 3MH7A 1IQEA 1DLKB 1C5SA 4TPIZ 1C1QA 2ZFSA 1F0UA 1MTUA 4CR9A 2JETC 4KGAA 2ZU2A 1GDNA 4DCDA 1BIOA 2ZU3A 4ISLA 1V6DA 4K1TA 4U30A 1O5DH 3UTUH 2VWMA 1EP6A 1TE0A 2PUXB 2XW9A 1MTNC 1GBDA 1UK4A 2OLGA 5GPIB 1BOQA 1V2VT 4R8TB 5G4BA 1O2PA 2SGDE 2OUAA 1BRAA 1SQTA 5J4SA 1BUIA 2C4FH 2XCFA 2DE8A 3B23B 4X2VA 1AKSB 3JZ1B 4OGYA 1GBEA 1ANDA 1O2YA 1CE5A 1P10A 1PPZA 1HAHH 3C27B 3SGBE 1BHXF 1EAXA 1TNLA 2BQ6B 1O5AB 1QGFA 1ZHPA 2SGQE 4FU9A 5JDUB 3H5CB 4SGAE 1DXPA 2OTVA 4K60A 4OS4A 3AW0A 1S81A 4J2YB 2GT8A 1IQMA 1P2JA 2P8OB 3S9AA 1QY6A 1U6QA 4MDSA 1AN1E 4TWYA 3M36A 2A4QA 1ABIH 1AD8H 1OWHA 2XXLA 4MG3A 2ZFQH 4AB9A 3T25A 2TGTA 1K21H 3KL6A 2HNTC 3BTTE 4X6OA 1XUGA 1HAGE 1THPB 4K8BA 1O5FH 5EQSA 1Q3XA 1O3IA 5F8TA 2BZAA 2FP7B 3HPTB 2BVSH 4FUJA 2ZHWH 3SOSA 1WBGB 1Z8GA 3RMLH 1GHAG 4IMQA 3TJOA 1NU9A 6CHAC 1ELFA 4CRCA 3SUFA 2ANMH 1JXPA 1NM6A 2GCTB 5T6FA 1UTOA 1IOEA 2PKSC 4ZKNU 2A4GA 1A3EH 5FX5A 1TAWA 1YCPH 1GI5A 1K28D 3BTME 3M7UA 1MU6B 1JRTA 5JBCS 2GZ8A 1ZOMA 4LZ4B 1BTPA 4BXSA 5ABWA 4WWYA 1BMAA 3EE0B 5FPSA 2FPZA 3A7XA 1P09A 2ZI2H 4VGCC 1BZXE 3KN2A 2TGAA 1Y3XA 3HK3B 2J38A 4TY7A 3SU4A 1MZDA 3PB1E 4X0WU 3RU4D 1LTOA 4A1VA 3TITA 1W13U 1HAPH 3GY6A 1FI8A 1YGCH 1BBRH 1TOMH 3ESTA 2F3CE 1C5XB 3P70B 4B75A 1WYKA 2GDDA 4YT7H 2ZHQH 4OS2A 2C90B 1G2MA 3RXSA 4CRGA 2ZPSA 4OS1A 2H6MA 1MBQA 1JBUH 1D3PB 3H7TA 1IQJA 1NESE 1F0TA 1GHZA 2Z9GA 1EJAA 3VFEA 1AY6H 1FQ3A 1HV7A 2ZQ1A 1SGCA 1TOCB 1J17T 4WH8A 5E0JA 5DKMA 4AOQA 4Y6DA 2W3KA 4BAQB 1EX3A 1C5PA 1ZPCA 1ETTH 1O2SA 1SLUB 1FAXA 2H9TH 1P3CA 2OC0A 3BTDE 1Z8JB 1DX5M 1JOUB 2NU4E 4FVDA 1TWXB 4D76A 1E35B 3RXIA 1SFQB 3MMGA 5JB8S 4OS6A 5DO4H 2Q6GA 5C67A 3U8OH 2GD4B 2VINA 3EAJA 3F9FA 2FESH 2GP9B 4BAKB 1HAOH 1D3TB 2SGAA 1O2OA 1P2OA 4DVAU 1QA7A 3GISB 2XC4A 1AUTC 1EPTA 1OOKB 6GCHF 2UWOA 3V0XA 3URCA 1QB1A 4NFFA 3ZZCA 1BMMH 5GIBA 4F49A 1V2NT 2BTCE 1Z7KA 5T6DA 1NN6A 1AU8A 3QN7A 2JETB 3LU9B 1V2KT 1Q31A 4FUFA 3K2UA 1WAYB 1EPTC 4X1QU 1C1NA 4BNRA 3SV2H 5JPMH 3PV4A 1EATA 1CHOF 1GHYH 3NK8A 2WV5A 1TGSZ 4DJZB 3ATKA 2OC8A 7LPRA 1MTNB 2BD9A 1T32A 1KLIH 4FUCA 1GDQA 3NKKA 1W10U 3MU1A 3RU4T 1CGHA 1Z1IA 1EUFA 4YO9A 3LT3A 1NTPA 3HATH 3RMOH 1SGNE 1TRNA 3QX5H 4A92A 2EC9H 1C9TA 1V2MT 1GBBA 1TQ0B 4ABHA 1GWAA 4CR5A 3GICB 2GV6A 4WXIA 2Q6DA 1FUJA 1TA2A 3MNSA 4XBCA 1BB0B 4JCNA 4KTUA 1Y8TA 3ZZ3A 4D7FA 2VU8E 1UTLM 1NROH 1ELAA 4NZLA 2OBOA 4NZQA 2Y7XA 1ZLRA 2XYAA 4MNWA 5BPEA 1C5NH 2STAE 1CGJE 2A7CA 3SNDA 1VZQH 3MFJA 2R3UA 3TNTA 3Q76A 1VITG 1MD8A 4GAWA 3OTJE 1EAIA 2A7HA 1DDJA 1Y59T 3KF2A 1FLEE 1C5RA 3LJJA 1E38B 1C1WH 1O38A 4XBDA 2JH0D 1ELCA 4JZFH 3VXEH 4TPYA 1V2JT 3SUDA 2A31A 2G4TA 3M7QA 1HAVB 3SQEE 1AMHA 1PQ8A 1THSH 1O35A 3DFLA 3BSQA 1SL3A 2P3UB 2PSYA 4MPWA 1MCVA 2OQUA 3RU4E 1X7AC 4JMYA 5DJ7A 1XVOA 4H4FA 4Y0ZE 2I6QA 6CHAB 2VIPA 4K8YA 1YPHC 4DW2U 2D1JA 2PKSB 3SNCA 4CRFA 3EDXB 4ABGA 1GBKA 1MKWH 4UDWH 1ARBA 2RDLA 3PLBA 2ZCKP 1UHBA 4F4OC 3E3TA 1OWJA 1RGQA 1TRYA 3LKWA 1P2NA 3ZZBA 4YOJA 1O33A 2D2DA 3FFGA 4WVPE 3RXQA 3SHCH 5FAHA 4DY7B 4VGCB 1UTPA 3CS0A 1A61H 1O3AA 4CREA 5A0BA 2HPQH 1S0RA 1GL1A 2P93A 1C2GA 2FOEA 2VWOA 1RD3B 1TMTH 2BDCA 3MO9A 3E90B 1SMFE 1ZSKA 1YF4A 1YC0A 4YOGA 3QTVH 1PYTD 4I8LA 1AIXH 4DIIH 2SGEE 1UCYK 3SGQE 1O34A 4FUDA 1IAUA 2PR3A 2ZP0H 5JBBS 1JWTA 1OSSA 4Y79A 4UFEH 3RXEA 2J95A 4I32A 5F8ZA 3DT0H 3LGYA 1BTWA 2ZGXH 4I7YH 4IGDA 4Y8XA 1MQ5A 1F92A 1DE7H 2KAIB 3ZVDA 3TLOA 1OPHB 4JYTA 3E1XB 5EPYA 3ZZAA 4GHQA 4BAHB 3ZZ5A 2F9VA 1C5TA 1A0JA 1TNIA 1JRSA 1LPKB 4O9VA 4MQAA 3M3VA 4IW4E 2ASUB 1GJ9B 1FN8A 3RXFA 2FWWA 2ZFFH 3M3SA 1HUTH 1TPOA 5C5NA 4YM9A 1YPLH 3SBKA 3VB3A 4BOHA 1DITH 4GUXA 3TVJB 2G5VA 1GHBF 3GDVA 3U9AH 5EQRA 1JIMA 3UOUA 1Y3YA 1YM0A 2RA0A 1OYQA 5DP8A 3URDA 4BAMB 1B5GH 1XUHA 1A2CH 3G01A 3UNRA 1GDUA 1LHCH 1AKSA 2F9PA 2FS8A 1MTWA 1P9SA 2ZCHP 2VVUA 3VPKA 3PLPA 3B9FH 1OXGA 2ZHEH 2ZKSA 4JZDH 3M5OA 1O36A 1EZXC 1OWDA 2AGEX 4H6TA 3PMHB 2P95A 2G55A 4ZKRU 2Z3DA 1C2FA 1E34B 2CV3A 2WINI 1SLXB 4QT8C 4JK5A 1GI4A 1RFNA 1S5SA 2EEKA 1EP5A 2QAAA 2EI8A 3T62A 7GCHF 3BTWE 2ZF0H 2WYGA 1G9IE 3T27A 1GBLA 1HGTH 4TY6A 3A82A 3EYDA 5LPFA 3MO6A 3BEUA 1DOJA 1H8DH 1O2GH 1PQAA 5K7RA 4B2CA 9ESTA 4I8JA 1PQ5A 2YNAA 1GVZA 4WMFA 2C8ZB 1D6WA 1WUNH 3A81A 9LPRA 2Y7ZA 1FZZA 1G2LA 4ZKSU 3KIDU 2BX3A 2GT7A 1C4V2 3D62A 1AUJA 3BTGE 1CHGA 4RSPA 3VGCB 2ZTYA 4NSYA 2AEIH 5E2OA 2ZZUH 1OP0A 1C1RA 1WOFA 1MH0A 4HGCA 1BTXA 3ZZ8A 1XMNB 1NT1A 1XUIA 5LGOA 1WQVH 2Z9JA 1T8OA 4BANB 2JH5D 1W14U 4Z0KA 1CA0C 3PMBB 5I46H 3IITA 2CN0H 1QBVH 1WV7H 4GCHF 4AB8A 1WTHD 2ZU1A 4JZ1A 2GCTC 2BY8X 1EXFA 1GI1A 1C5VA 1CA8B 1TABE 5E2PA 2WPKS 4WMEA 1N8OC 1RXPA 5F8XA 2AGGX 1CU1A 2Y80A 2QYIA 3NXPA 2FI5E 1ZMJA 1L4ZA 1OS8A 4U32A 5EG4A 1ELTA 2AERH 1TYNA 1N6YA 1ZTKA 3EA9A 4IN1A 3LH3A 2B0FA 1QURH 3E6PH 2QA9E 4Q80A 3UPEA 1QIXB 1O37A 1UHBB 4CRAA 4CBOA 1BHXB 4MNVA 1SGQE 5EW2H 2FEQH 1MKXH 2PGQB 2PUQH 2FOBA 1MBMA 1TMBH 4Y8ZA 3HK6B 1P02A 3ZZ4A 2C8WB 4UEHH 1G3DA 3P8FA 1Z6EA 3P8OA 1N1LA 1ZMLA 1BTYA 1UVTH 4FXGH 3NZIA 4Q7YA 2FOFA 4FUIA 1BRBE 3UR6A 4X8SH 1GG6B 1QJ6B 4X2XA 1LO6A 2IOTA 5E8EH 2Z7FE 1GJCB 3RXUA 4THNH 1GMDG 1FN6A 4X2YA 3U98H 4AG1A 1C2HA 1O3HA 1RJXB 1P05A 1K1IA 3AW1A 1BTZA 2PW8H 1HXFH 4K3JA 3ATMA 2BY7X 4NA8A 3RUOA 1Y3WA 1K1LA 5B6OA 1UVOA 1GJBB 4ABBA 2F91A 3F9EA 2YNBA 3GOVB 1RTLA 1BMLA 1ZGIA 3W95A 2GZ7A 2THFB 3K6ZA 4NCYA 2UWLA 2Z9LA 3BTHE 3RM2H 2H1UA 2OBQA 3SV9A 1TBZH 2ZCLP 1CT4E 1VR1H 1YP9A 1UK2A 2K1QA 3LGWA 5EU8A 2Q6FA 2Y5FA 3Q77A 4I8KA 1AO5A 4AG2A 2G8TA 3RXAA 4LXBH 1MCTA 3AAVA 1PJPA 2Y81A 3R0FA 2Y5GA 3M37A 3P92A 2VWNA 4Y10E 1DXWA 1Q2WA 3S69A 2VH0A 4DIHH 1ZJDA 2GVFA 2ZGHA 2WUCA 1LCYA 1DLEA 1SLVB 1HAIH 1P8VC 3M5NA 4MLFB 4A7IB 3VB4A 4DT7B 3SU0A 1HAYB 5HM9A 4RKJB 4YOIA 2AIPA 5JYIA 4NFEA 5DP6A 3AAUA 1IQIA 2BYAX 2ZG0H 1HAZB 1QFKH 4JZEH 1GBIA 1LHGH 2CMYA 2QXJA 1J9CH 3V13A 1W12U 1NFWA 1V2TT 2A4OA 2JKHA 3BG4B 5T6GA 1D9IA 1HAVA 1NRRH 1AFQB 3BTFE 2YOLA 1PFXC 1CT0E 4BTIB 1TNJA 2Q1JA 3QZRA 3S7KB 3CP7A 4NSVA 1A0LA 2FZZA 1KYNA 2R3YA 2ZEBA 2HNTE 2FI4E 2BZ6H 3ZYEA 4AORA 3O8BA 2ODPA 3TGJE 3EQ0H 1UVUH 3A8CA 1SGPE 2VIVA 4X1NU 3LONA 1CA0B 1TONA 3PROA 1J14A 2BLVA 1PPGE 2FM2A 2WPMS 3UY9A 1T7CA 3SZNA 2BD7A 1Z6JH 1QQUA 3FANA 4KTCA 2QV1A 1N8OB 1ESTA 1W8BH 2EI6A 2AMQA 1ACBE 3LC5A 5A09A 1ZRBA 1DUEA 1YLCA 3FZDA 3RXKA 3SU3A 1L1GA 2UUJB 1YKTA 1QL8A 1OX1A 1H9LB 3SJIA 3WY8A 1SQOA 1XXFA 1LVBA 1FV9A 2CF8H 4ZROA 1QJ1B 2B9LA 2BY5X 1F5LA 2KAIA 1KTSB 1LPZB 1AVXA 3MOCA 3OY5U 3BTKE 4AFUA 1AZZA 3RXGA 3KCGH 1PQ7A 3RXTA 5GWZA 1G3CA 4YZUA 1O2MA 3PLKA 4ISIH 1SGTA 3GY8A 2PLXA 3N7OA 4LK4A 3SNBA 5BRRE 4RKOB 3I77A 8LPRA 3I29A 1MU8B 2VH6A 4ZXXH 1S82A 2CXVA 2A2QH 2PKAB 1KSNA 1Y3VA 2BDHA 1C1UH 2R0KA 5DG6A 2WPJS 1BTUA 1QTFA 4MNYA 5EPNA 3VB6A 4ISNA 4K1EA 5HGGA 2PTCE 1LDTT 4FUBA 1S85A 1LVOA 3HKJB 2BLQA 2BD3A 2ZHFH 4WMDA 2J92A 1GI2A 1MMJN 2ZU5A 2ZTZA 2CJIA 1NC6A 5EXMA 2A7JA 1INCA 1IHTH 1C1VH 1C5UA 1K2I1 2BHGA 1GMCF 1O2TA 2PHBA 4MPUA 2FOMB 1FY1A 1F2SE 1ZR0A 7ESTE 3KQCA 1VITF 1O2IA 3PTBA 1UTNA 3RXOA 1SGFA 1HJAC 2XCNA 4AGJA 1EZQA 3I78A 1O5EH 3KGPA 1EOJA 4KTSA 3FVFB 4UE7H 1NU7B 3A83A 3A7TA 2Y6TA 3SNAA 2WPHS 1P9UA 1TQ7B 1O2ZA 2V3HH 1KY9A 4KELA 3ZVBA 3MU0A 3PO1C 2AH4X 1TGTA 1GBHA 3TIUA 3RMMH 1VITH 3O8DA 4CBNA 4D9RA 3UNSA 4NA9H 1QQ4A 5JBAS 2VIQA 4ZH8A 5LPRA 1A0HB 3ZZ7A 2NWNA 1T8MA 3Q3YA 1ETSH 2A45B 3KQDA 5A8ZA 3JZ2B 3KEEA 2CHAB 4WF8A 5C20A 1CSOE 1P3EA 3ODFA 3F9HA 1ZSJA 3QUMP 1GI0A 2EA3A 1TB6H 4ABJA 3O8RA 1G30B 2PFEA 3RXRA 1O32A 4B74A 3HGPA 2BDGA 2FTMA 4X6PA 2BY9X 1XVMA 1ZPZA 3M5MA 4FU8A 2H9HA 2BMGB 2AMPA 1MUEB 2A4RA 1TPSA 3VGCC 1SOTA 5F6MA 3RC6A 1LPGB 1SQAA 1GBAA 4ZXYH 6GCHG 1WCZA 5EOKA 4BTTB 4O3TA 1TPAE 2FIRH 4ABFA 2Z3CA 3EA8A 1S0QA 2Z6BD 1C1TA 3UUZA 5A2MH 1O3BA 1LKBA 1T8LA 2A0QB 1HXEH 1A1RA 1LKAA 1A3BH 3SJ8A 5HYOA 1UCYE 3GYMA 3FP8E 1C5LH 4ZHLU 3M3TA 1C1OA 4GVUA 5EQQA 1UO6A 3ELAH 1CHOG 5TCAA 1SB1H 3AASA 3BEIB 1HCGA 3A8DA 1TNHA 2FOCA 3SJ9A 1YPHE 3NPSA 2ZIQH 3T5FH 4BAOB 5ESBA 3V12A 3S7HB 3QTOH 1NS3A 1GI8B 5DPAA 2F83A 3QDZB 3RXVA 1ZPBA 1A7SA 1O5BB 3UOPA 2BD5A 2XWAA 2FLRH 3TNSA 5A0AE 1FPHH 3ZVAA 2W7SA 2NU0E 1GI7B 4K5ZA 5FPYA 4D9QA 1A5HA 4YLUA 1QRXA 5AFZH 2W3IA 3BTQE 2G52A 1FY4A 2ZFTA 2AMDA 1O3CA 1IQGA 5L30H 3PM3A 2R9PA 1GG6C 3RXCA 2QF3A 1C5YB 1LHFH 1OP2A 1V2OT 1Z8RA 3F1SB 5HM2A 1FNIA 3LGUA 5DP4A 5LH8A 2F9UA 1ZRKA 3MH4A 2QXGA 3GY3A 3ATLA 1K1PA 2F9NA 1W7XH 1O2LA 2H5CA 4YESB 1O31A 1WTGH 2BD4A 2BD8A 3S0NA 1SGEE 2HOBA 1ZHRA 1ZHMA 4X2WA 3SU1A 2AGIX 1CQQA 4NIVA 1HYLA 1TLDA 1CBWC 1DSTA 1BJUA 4AFQA 2FTLE 1AE8H 3VXFH 2ALVA 2BDIA 3NWUA 3U1JB 4D7GA 1PPCE 1NRPH 1HJAB 3M5LA 3ZVFA 3C1KA 1EB2A 5GJ4B 3NCLA 1VCWA 2FYQA 1GI9B 2HWLB 2BD2A 1BJVA 2GMTB 1IQNA 2RCEA 3P95A 1TRMA 1KIGH 1C2DA 1HLTH 1ZZZA 2BQ7B 1TNKA 3DA9B 2ZNKH 2Y5HA 3PO1B 1EQ9A 1KDQB 3UIRA 2VVCA 4CH8B 4DG4A 4YTAA 1G32B 2TIOA 3BN9A 3L3TA 4Y76A 1YCPK 1ZGVA 4Q7ZA 1O2XA 4JZIA 1OWKA 2OC7A 1GHVH 3MYWA 1TA6A 1ZYOA 3LC3A 3V3MA 1TNGA 2TGDA 2TBSA 1KLTA 5AFYH 2G51A 1ELBA 2VIWA 3SO3A 3MNBA 1GJ8B 2BOKA 5C2ZA 3ATIA 2XBWA 4AYVB 1GI6A 1DSUA 2ZDAH 1YLDA 1GHXH 2G81E 2ZECA 1BBRK 1FIWA 1V2RT 3RXDA 3BG4C 1O3MA 2P3TB 3RXJA 1AFQC 4UD9H 1TX8A 1TALA 1IQFA 3UWIA 2QXHA 3TK6A 2A32A 2WV4A 2AS9A 8GCHF 4PROA 1G36A 1B0FA 1W7GH 2GKVE 2FI3E 3BV9B 1UVPA 2VJ1A 1QR3E 1DS2E 4B2BA 1KXDA 1P01A 1F5RA 1QL7A 3SJOA 5IDKA 1GHBG 3L6PA 1DM4B 1BRUP 1L2EA 4DOQA 5I25A 1XKBC 2TRMA 1AVWA 2BB4A 2J2UA 4I8GA 3GDSA 1S6FA 4FVBA 2BQWB 5IYTA 1MTVA 1GMDF 1M9UA 1TX6A 2HLCA 2LNCA 3FP7E 3ZZ9A 1P0SH 1UVSH 1QA0A 1BRCE 2Z9IA 4GHTA 1QB6A 3ZZDA 2ZDKA 3MH5A 8ESTE 1HJ8A 5J4QA 1GI3A 3DD2H 2VVVA 1O30A 2BVXH 3CENA 4NIYA 3BG8A 3SU2A 1EAUA 1H9HE 4JYVH 1F7ZA 1VJAU 4TYDA 1SGYE 3M61U 3RP2A 2SGPE 1E37B 1TBQH 2V0BA 1T4VH 1GBFA 4ISHH 2UUYA 4LOYH 1Y5AT 3RXHA 4OS7A 1XM1A 3RXLA 3ZVCA 2C8XB 2B8OH 3A89A 4UFDH 1DT2A 4B76A 1SFIA 2O8WA 3RXPA 4J1YA 1CGIE 3SV7A 1C4Y2 2SFAA 1TGCA 5C5OA 2OCVB 1J16A 1SOZA 2PKAA 2DE9A 3IWMA 2GCHG 4WY3A 2GDEH 1GPZA 1EKBB 1RTFB 1SR5C 3Q3XA 1RIWC 1QBOA 1FJSA 2ZHDA 1J8AA 1UJ1A 1IQHA 1EZUC 2FODA 1YPGH 2XBVA 2BDBA 4XOJA 4X8VH 1T8NA 5FCRA 5L6NH 1T31A 1AHTH 3GCHB 3RXMA 4GPGA 3GCTG 2CF9H 1TMUH 4WXVA 2DUCA 1BTHH 1H1BA 5EXNA 3LDXH 2O8MA 3EA7A 3PTNA 1O3JA 3TGKE 4GCHG 1O2QA 1C1SA 2JH6D 1O2KA 3VEQB 5CMXH 1S83A 1CBWB 3PYHA 1Y5BT 1ELEE 1L1NA 2IPHA 3ZZ6A 1JMOH 4A5TS 1P2IA 3LGTA 5A0CA 2GGVB 1G3BA 2SGFE 1B0EA 1C5QA 1KLJH 1SGFG 2ANKH 4Y0YE 1MAYA 2J9NA 4OS5A 3SW2B 3SUEA 2VIDA 1W0ZU 2ZDNA 2TGPZ 3MTYA 1GHAF 2G00A 5EXLA 4D8NA 4XE4A 2ZTXA 1WU1A 1GCTC 2GX4A 2XBYA 1MKWK 4KKDA 4U01A 1OYTH 1ANEA 1HIAB 1DWDH 3TH2H 1N6XA 2CHAC 3RXBA 1PPHE 3BIVH 2ULLA 1YPEH 1GJDB 5GCHG 1F5KU 4GSOA 3QO6A 1O3NA 2WPIS 1UCYH 2F9BH 3GY4A 4Y7BA 4MTBA 2EI7A 1OWEA 1FXYA 1GVLA 1ZMNA 2AYWA 5GXPA 2VB0A 1ORFA 3AVZA 8KME2 3Q3KA 5DGJA 1J15A 1FPCH 1KXBA 1V2LT 3A8BA 1DPOA 1GMHG 2ZGJA 4Y11E 1GBJA 1OKXA 2O9QA 3QZQA 1AI8H 2A2XH 3OSYA 4B73A 2Y82A 4K2YA 4Q2KA 1C9PA 5FBIA 3ENSB 3D23A 4ZHAA 1O2VA 3OYPA 4A6LA 4DURA 1XKAC 4O3UA 1P2MA 3MU4A 6LPRA 3O8CA 2FOGA 3T28A 1DY8A 1RRKA 3S9CA 2BM2A 1W3CA 1DY9A 1GJAB 2TPIZ 1NRSH 1FMGA 2C3SA 3TPIZ 2UUFB 4ABIA 2A1DB 1HJ9A 1ZTLA 5C1XA 2ZGBH 1K1OA 2ZPRA 4INLA 2PTNA 1V2WT 3F6UH 4CRBA 4ESTE 1O3FA 1SSXA 1SPJA 4ASHA 2C8YB 1DFPA 2IJOB 3UQOA 1BMNH 2FO9A 2OC1A 2O8LA 3TGIE 4AYYB 3QWCH 2NU3E 2VGCC 4SGBE 1ARCA 4IC5A 1BDAA 3Q00A 1CVWH 5E0HA 4GLYA 1A46H 3TJVA 1GJ5H 3A84A 3OX7U 1O2NA 1HPGA 2VWLA 4I8HA 1DWEH 5FCKA 1Z71A 3P8GA 1A5GH 3VB5A 2P94A 1IHSH 3NUMA 3SUGA 3T29A 4FUGA 2GZ9A 2A5AA 1AWFH 3PMJA 4AFSA 1CT2E 5GDSH 1DVAH 3LH1A 1NRQH 2CGAA 3UFAA 1UTMA 3GY5A 1GJ6A 1TPPA 1RIWB 3R3GB 5DK1A 5A8YA 2OD3B 1HFDA 4H6SB 5HMAA 1MAXA 2H2ZA 3UREA 3RDZA 2FX6A 2FDAA 1NFYA 2A5IA 2OXSA 2ZA5A 3E91A 2ZFPH 3RLWH 3SU6A 3STJA 1DWBH 1C2IA 3MO3A 1HDTH 2H5DA 4FUEA 5PTPA 3M7TA 5CHAC 1W11U 3MI4A 1TIOA 2HGTH 3L33A 1EJNA 1SBWA 5AVDA 1FY3A 1C2MA 3LGVA 1CO7E 3GCNA 2BXTH 2ODQA 4X6NA 3RM0H 1MD7A 1L0ZA 1GJ7B 5JBTA 3E0NB 1YBWA 3BIUH 1O2JA 3MWIU 1OWIA 4X1RU 3U69H 3U8TH 1C2KA 3V7TA 3ZV8A 2V35A 3SGAE 4M7GA 1AB9B 3ODDA 1KDQA 2O8UA 2XC0A 1YYY1 4ISOA 3P17H 3GY2A 1G37A 2GMTC 2QF0A 2FMJA 5C3NA 1G3EA 1FY8E 2QXIA 1GGDB 1LMWB 1H8IH 2ZWLH 3SNEA 4UFFH 3HKIB 1VJ9U 1C1PA 4UONA 2F9OA 1EOLA 1ZSLA 3BTEE 1O2HA 1QRWA 1EJMA 2FLBH 4INHA 3KQEA 3MNCA 2D8WA 5HXFA 2HRVA 3TU7H 1EASA 4X1PU 1YPJH 2P3FH 3KHVA 4NWLA 3SI4H 1GCTB 1P2QA 1O5GH 5CE1A 3TJNA 1SVPA 2PWXA 1AE5A 2PGBB 1NO9H 1IQKA 3OY6U 4BTUB 1LVMA 1C5ZB 2SNVA 1TX7A 4B2AA 2ZPQA 1BQYA 3A7YA 2BY6X 4AGKA 4WJG2 4TWWA 3LGIA 1V2UT 1LHEH 1QJ7B 2AIQA 2ANWA 4NIWA 1THRH 4O03A 1UTJA 2RA3A 1EZSC 1MZAA 3KNXA 3RMNH 5TJXA 4A1XA 1MKXK 4WH6A 2AFQB 4IS5A 4AFZA 1AQ7A 2OINA 1P12E 1O2WA 1V2PT 3TH4H 4MPXA 1QB9A 2PV9B 3PWBA 4XFQA 1V2ST 1O3OA 1QRZA 4LZ1H 2G5NA 2FYRA 1AFEH 3LJOA 1GMCG 1V3XA 3RLYH 1O2RA 1AZ8A 4HTCH 5FXLA 4CHAC 2V3OH 1L1JA 3SU5A 1QBNA 4AN7A 3MNXA 3A86A 1K22H 2BDAA 4INKA 5EGMA 3UQVA 3SHAH 3TJUA 3ITIA 2ZU4A 1HBTH 2W7UA 1P2KA 4Z6AH 1GVKB 1ABJH 2BLOA 1AWHB 3PWCA 3STIA 4X8UH 2M5TA 1W0YH 5FHTA 1BT7A 2Z94A 1GBMA 4E7NA 5SGAE 1FONA 4DGJA 4NGAH 3A80A 3ZV9A 1K9OE 4I33A 4YT6H 2J94A 1BA8B 3K9XB 4NA7A 3QLPH 1K1JA 2HALA 1NFUA 3QK1A 1SGRE 3MU5A 2IN2A 2VGCB 4R0IA 1WSSH 4B71A 1GCDA 2B7DH 1C1MA 1LQDB 3DUXH 3F68H 3SORA 5C1UA 1SI5H 1D4PB 1QL9A 1KXCA 2ZGCA 3SQHE 2QCYA 2ESTE 4CRDA 1O3KA 4E7RG 2ANYA 1EAWA 3OU0A 4IMZA 4KP0A 1K1NA 1ELDE 1TGBA 2D26C 1YPMH 4B1TA 4E06H 4ABDA 1VCPA 1UTKA 3GCHC 1C2EA 1GHWH 1UK3A 1O2UA 2NU2E 1S84A 2BLWA 2ZQ2A 3ZVGA 2BOHB 1T4UH 1O3DA 2HVXA 2WUBA 4K1SA 2LPRA 1P11E 2R2WU 1NY22 2ZDVH 4ZUHA 2W26A 5CHAB 3RC5A 2ZC9H 1TGNA 2XWBI 1Z8IB 2UWPA 1C2JA 3QGNB 4NWKA 1O3PB 3T2NA 5FX6A 3TK9A 2ODYB 1O5CB 1VGCC 1C4U2 2ZFRH 1WQSA 1GBTA 3F9GA 3W94A 1ZTJA 1FIZA 1RS0A 2NU1E 1P04A 4FUHA 5ETXA 1NRNH 1YCPM 3K6YA 1C5WB 2G4UA 5FPTA 1D6RA 3UWJH 4MPVA 1C5OH 1D3DB 1AVGH 1V2QT 2HNTF 3D65E 1DUAA 2P59A 4AX9H 4ZMAH 1F0RA 4YLQH 1SGDE 3MU8A 1BBRE 5LPEA 2J4IA 2STBE 1FY5A 2UUKB 3A7VA 1YPKH 3B8JA 4ZAEA 1KTTB 1KXFA 3GCOA 3H7OA 3ZYDA 1HIAA 1LQEA 2ILNA 4A1TA 1E0FD 1H9IE 2J34A 4Q7XA 3ZVEA 3GYLB 3SI3H 2FXRA 4JK6A 4ABEA 2WYJA 1EPTB 3P8NA 1PPBH 2GTBA 1ESAA 3SV8A 3FZZA 5L2ZH 3A7ZA 2XBXA 3KQBA 1GL0E 2P16A 2V6NA 3SV6A 3K65B 3HGNA 4RN6A 3DFJA 3P6ZB 3T26A 1IQLA 5F03A 2R0LA 3MHWU 1QHRB 1ESBA 2OQ5A 3TH3H 1ANBA 5A8XA 1UMAH 3A87A 2I6SA 2FX4A
chains in the Genus database with same CATH superfamily
1H4WA 3NRLA 2FOHA 3CS7A 3PMAB 4IC6A 2ZDMA 2QC2A 2ZDLA 4JYUH 4TT3D 5ESTE 1ELGA 1QCPA 1BITA 1P57B 2ZO3H 2QGRA 1O0DH 2QN5T 1XUJA 4IN2A 1GJ4H 1RTKA 2PSXA 1LHDH 1FDPA 2W5EA 3E8LA 1ELVA 5T3HA 1C5MD 2GCHF 3SN8A 1DANH 3GDUA 5FBEA 2P8OC 1A5IA 1NFXA 1Y5UT 2VIOA 3U8RH 4FU7A 5DP7A 1SGIB 4ZHMU 1D3QB 2RG3A 5DP3A 4AZ2B 1PPEE 1F0SA 4HZHA 1XUKA 4U2WA 5C1YA 5L2YH 1S6HA 1MQ6A 1MTSA 4CHAB 2O8TA 3EGKH 1A4WH 1VCQA 2QY0B 3LOXA 1L4DA 1P06A 2BX4A 1ETRH 4X1SU 2A5KA 3E0PB 1E36B 4NG9H 3GCTF 5H4IB 3BEFB 4E05H 3A85A 1O39A 4Y7AA 1Y3UA 3H09A 2LP6A 1QNJA 4O97A 3SJKA 3RC4A 3DHKH 1KXAA 4UFGH 4OGXA 1W2KH 4X8TH 3BF6H 5TCCA 4ABAA 3E16B 5HKKD 3FP6E 1SG8B 5JB9S 1XXDA 1SHHB 1PYTC 4HFPB 4HI3A 1P03A 2XTTB 1K1MA 2HPPH 3ATWA 1ID5H 2BVRH 2B5TB 3D49H 1EB1H 2BDYA 1FAKH 3MH6A 3A88A 3S9BA 1KXEA 1HAXB 1XX9A 7GCHG 1DICA 5AF9H 7KMEH 1SLWB 6ESTA 3A8AA 1Z1JA 3UR9A 2ALPA 1UTQA 4Y8YA 5K0HA 3TK5A 1O3GA 3U1IB 2QIQA 4H42U 4BXWA 5E0GA 1XUFA 2C93B 1UW7A 2FS9A 2XRCA 1AGJA 2VNTA 1NPMA 8GCHG 3LPRA 3QGJA 3FAOA 1B7XB 3GY7A 2FOAA 2JJ2D 3F2GA 5DP9A 2Z3EA 4MVNA 5EODA 3M35A 1LVYA 1JIRA 2WPLS 3IG6B 3A7WA 1TBRH 2H9EH 5GCHF 1SHYA 1HRTH 5AHGH 3VB7A 1TFXA 1OP8A 4MNXA 3LIWA 1HNEE 2GV7A 4K69A 1ANCA 1VGCB 4XBBA 2XC5A 4XSKU 1C2LA 2XNIA 3DCLA 2Z9KA 4CH2B 4ZKOU 4XDEA 1GBCA 1O3EA 2OP9A 2R2MB 5DP5A 1DWCH 1AB9C 1NZQH 1O3LA 1ZJKA 1PPFE 5EW1H 4Y71A 4X6MA 1BCUH 4IBLH 4I31A 1HB0B 4NIXA 1GMHF 3UNQA 2BXUH 2SNWA 1SC8U 1GGDC 3MH7A 1IQEA 1DLKB 1C5SA 4TPIZ 5C0UA 1C1QA 2ZFSA 1F0UA 3AK5A 1MTUA 4CR9A 2JETC 4KGAA 2ZU2A 1GDNA 4P00A 4DCDA 1BIOA 2ZU3A 4ISLA 1WXRA 1V6DA 4K1TA 4U30A 1O5DH 3UTUH 2VWMA 1EP6A 1TE0A 2PUXB 2XW9A 1MTNC 1GBDA 1UK4A 2OLGA 5GPIB 1BOQA 1V2VT 4R8TB 5G4BA 3FKSD 1O2PA 2SGDE 2OUAA 1BRAA 1SQTA 1H8ED 5J4SA 1BUIA 2C4FH 2XCFA 2DE8A 3B23B 4X2VA 1AKSB 3JZ1B 4OGYA 1GBEA 1ANDA 1O2YA 1CE5A 1P10A 1PPZA 1HAHH 3C27B 3SGBE 3FO8D 1BHXF 1EAXA 1TNLA 2BQ6B 1O5AB 1QGFA 1ZHPA 2SGQE 2KCOA 4FU9A 5JDUB 3H5CB 4SGAE 1DXPA 2OTVA 4K60A 4OS4A 3AW0A 1S81A 4J2YB 2GT8A 1IQMA 1P2JA 2P8OB 3S9AA 1QY6A 1E1RD 1U6QA 4MDSA 1AN1E 4TWYA 3M36A 2A4QA 1ABIH 1AD8H 1OWHA 2XXLA 4MG3A 2ZFQH 4AB9A 3T25A 2TGTA 1K21H 3KL6A 2HNTC 3BTTE 4X6OA 1XUGA 2J97A 1HAGE 1THPB 4K8BA 1O5FH 5EQSA 1Q3XA 1O3IA 5F8TA 2BZAA 2FP7B 3HPTB 2BVSH 4FUJA 2ZHWH 3SOSA 1WBGB 1Z8GA 3RMLH 1GHAG 4IMQA 3TJOA 1NU9A 6CHAC 1ELFA 4CRCA 5C0TA 3SUFA 2ANMH 1JXPA 1NM6A 2PP6A 2GCTB 5T6FA 1UTOA 1IOEA 2PKSC 4ZKNU 2A4GA 1A3EH 5FX5A 1TAWA 1YCPH 1GI5A 1K28D 3BTME 3M7UA 1MU6B 1JRTA 5JBCS 2GZ8A 1ZOMA 2QF5A 4LZ4B 1BTPA 4BXSA 5ABWA 4WWYA 1BMAA 5B6LA 3EE0B 5FPSA 2FPZA 3A7XA 1P09A 2ZI2H 4VGCC 1BZXE 3KN2A 2TGAA 1Y3XA 3HK3B 2J38A 4TY7A 3SU4A 1MZDA 3PB1E 4X0WU 3RU4D 1LTOA 4A1VA 3TITA 1W13U 1HAPH 3GY6A 1FI8A 1YGCH 1BBRH 1TOMH 3ESTA 1W0JD 2F3CE 1C5XB 3P70B 4B75A 1WYKA 2GDDA 4YT7H 2ZHQH 4OS2A 3N7EA 3WWBA 2C90B 1G2MA 3RXSA 4CRGA 2ZPSA 4OS1A 2H6MA 1MBQA 1JBUH 4P02A 1D3PB 3H7TA 1IQJA 1NESE 1F0TA 1GHZA 2Z9GA 1EJAA 3VFEA 1AY6H 1FQ3A 1HV7A 2ZQ1A 1SGCA 1TOCB 1J17T 4WH8A 5E0JA 5DKMA 4AOQA 4Y6DA 2W3KA 4BAQB 1EX3A 1C5PA 1ZPCA 1ETTH 1O2SA 1SLUB 1FAXA 2H9TH 1P3CA 1OHHD 2OC0A 3BTDE 5IK2D 1Z8JB 1DX5M 1JOUB 2NU4E 4FVDA 1TWXB 4D76A 1E35B 3RXIA 1SFQB 3MMGA 5JB8S 4OS6A 5DO4H 2Q6GA 5C67A 3U8OH 2GD4B 2VINA 3EAJA 3F9FA 2FESH 2GP9B 4BAKB 1HAOH 1D3TB 2SGAA 1O2OA 1P2OA 4DVAU 1QA7A 3U28C 2F4LA 2XC4A 3GISB 1AUTC 1EPTA 1OOKB 6GCHF 2UWOA 3V0XA 3URCA 1QB1A 4NFFA 3ZZCA 1BMMH 5GIBA 4F49A 1V2NT 2BTCE 1Z7KA 5T6DA 1NN6A 1AU8A 3QN7A 2JETB 3LU9B 1V2KT 1Q31A 4Q4LA 4FUFA 3K2UA 1WAYB 1EPTC 4X1QU 1C1NA 4BNRA 3SV2H 5JPMH 3PV4A 1EATA 1CHOF 1GHYH 4F55A 3NK8A 2WV5A 1TGSZ 4DJZB 3ATKA 2OC8A 3OEHD 7LPRA 1MTNB 2BD9A 1T32A 1KLIH 4FUCA 1GDQA 3NKKA 1W10U 3MU1A 3RU4T 1CGHA 1Z1IA 1EUFA 4YO9A 3LT3A 1NTPA 3HATH 4Z1MD 3RMOH 1SGNE 1TRNA 3QX5H 4A92A 2EC9H 1C9TA 1V2MT 1GBBA 1TQ0B 4ABHA 1GWAA 3OTPA 4CR5A 3GICB 2GV6A 4WXIA 2Q6DA 1FUJA 1TA2A 3MNSA 4XBCA 1BB0B 4JCNA 4KTUA 1Y8TA 3ZZ3A 4D7FA 3SZEA 2VU8E 1UTLM 1NROH 1ELAA 4NZLA 2OBOA 4NZQA 2Y7XA 1ZLRA 2XYAA 4MNWA 5BPEA 1C5NH 2STAE 1CGJE 2A7CA 3SNDA 1VZQH 3MFJA 2R3UA 3TNTA 3Q76A 1VITG 1MD8A 4GAWA 3OTJE 1EAIA 2A7HA 1DDJA 1Y59T 3KF2A 1FLEE 1C5RA 3LJJA 1E38B 1C1WH 1O38A 4XBDA 2JH0D 1ELCA 4JZFH 4Q63A 3VXEH 4TPYA 1V2JT 3SUDA 3W1EA 2A31A 2G4TA 3M7QA 1HAVB 3SQEE 1AMHA 1PQ8A 1SQRA 1THSH 1O35A 3DFLA 3BSQA 1SL3A 2P3UB 2PSYA 4MPWA 1MCVA 2OQUA 3RU4E 1X7AC 4JMYA 5DJ7A 1XVOA 4H4FA 4Y0ZE 2I6QA 6CHAB 2VIPA 4K8YA 1YPHC 4DW2U 2D1JA 2PKSB 3SNCA 4CRFA 3EDXB 4ABGA 1GBKA 1MKWH 4UDWH 1ARBA 2RDLA 3PLBA 2ZCKP 1UHBA 4F4OC 3PV2A 3E3TA 1OWJA 1RGQA 1TRYA 3LKWA 1P2NA 3ZZBA 4YOJA 1O33A 2D2DA 3FFGA 4WVPE 3RXQA 3SHCH 5FAHA 4DY7B 4VGCB 1UTPA 3CS0A 1A61H 1O3AA 4CREA 5A0BA 2HPQH 1S0RA 1GL1A 5C94A 2P93A 1C2GA 2FOEA 2VWOA 1RD3B 1TMTH 2BDCA 3MO9A 2KR7A 3E90B 1SMFE 1ZSKA 1YF4A 1YC0A 4YOGA 3QTVH 1PYTD 4I8LA 1AIXH 4DIIH 2SGEE 1UCYK 3SGQE 1O34A 4FUDA 1IAUA 2PR3A 2ZP0H 5JBBS 1JWTA 1OSSA 4Y79A 4UFEH 3RXEA 2J95A 4I32A 5F8ZA 3DT0H 3LGYA 1BTWA 2ZGXH 4I7YH 4IGDA 4Y8XA 1NBME 1MQ5A 1F92A 1DE7H 4B6EA 2KAIB 3ZVDA 3TLOA 1OPHB 4JYTA 3E1XB 5EPYA 3ZZAA 4GHQA 4BAHB 3ZZ5A 2F9VA 1C5TA 1A0JA 1TNIA 1JRSA 2RDEA 1LPKB 4O9VA 4MQAA 2J5UA 3M3VA 4IW4E 2ASUB 1GJ9B 1FN8A 3RXFA 2FWWA 2ZFFH 3M3SA 1HUTH 1TPOA 5C5NA 4YM9A 1YPLH 3SBKA 3VB3A 4BOHA 1DITH 4GUXA 3TVJB 2G5VA 3PRDA 1GHBF 4FETA 3GDVA 3U9AH 5EQRA 1JIMA 3UOUA 1Y3YA 1YM0A 2RA0A 1OYQA 5DP8A 3URDA 4BAMB 3KYGA 1B5GH 1XUHA 1A2CH 3G01A 3UNRA 1GDUA 1LHCH 1AKSA 2F9PA 2FS8A 1MTWA 1P9SA 2ZCHP 2VVUA 3VPKA 3PLPA 3B9FH 1OXGA 2ZHEH 2ZKSA 4JZDH 3M5OA 2L74A 5EJZA 1O36A 1EZXC 1OWDA 2AGEX 4H6TA 3PMHB 2P95A 2G55A 1WDIA 4ZKRU 2Z3DA 1C2FA 1E34B 2CV3A 3F0OA 2WINI 1SLXB 4QT8C 4JK5A 3KQ5A 4XD7D 2KCYA 1GI4A 1RFNA 1S5SA 2EEKA 1EP5A 2QAAA 2EI8A 3T62A 7GCHF 3BTWE 2ZF0H 2WYGA 1G9IE 3T27A 1GBLA 1HGTH 4TY6A 3A82A 3EYDA 5LPFA 3MO6A 3BEUA 1DOJA 1H8DH 1O2GH 1PQAA 5K7RA 1FX0B 4B2CA 9ESTA 4I8JA 1PQ5A 2YNAA 1GVZA 4WMFA 2C8ZB 1D6WA 1WUNH 3A81A 4ZCNA 9LPRA 2Y7ZA 1FZZA 1G2LA 4ZKSU 3KIDU 2BX3A 2GT7A 1C4V2 3D62A 1AUJA 3BTGE 1CHGA 4RSPA 3VGCB 2ZTYA 5CDFE 4NSYA 2AEIH 5E2OA 2ZZUH 1OP0A 1C1RA 1WOFA 1MH0A 4HGCA 1BTXA 3ZZ8A 1XMNB 2EY4C 1NT1A 1XUIA 5LGOA 1WQVH 2Z9JA 1T8OA 4BANB 2JH5D 1W14U 4Z0KA 1CA0C 3PMBB 5I46H 3IITA 2CN0H 1QBVH 1WV7H 4GCHF 5HIYA 1WTHD 4AB8A 2ZU1A 4JZ1A 2GCTC 2BY8X 1EXFA 1GI1A 1C5VA 4FOUC 1CA8B 1TABE 5E2PA 2WPKS 4WMEA 1N8OC 1RXPA 5F8XA 2AGGX 1CU1A 2Y80A 2QYIA 3NXPA 2FI5E 1ZMJA 1L4ZA 1OS8A 4U32A 5EG4A 1ELTA 2AERH 1TYNA 1N6YA 1ZTKA 3EA9A 4IN1A 3LH3A 2B0FA 1QURH 3E6PH 2QA9E 4Q80A 3UPEA 1QIXB 1O37A 1UHBB 4CRAA 4CBOA 1BHXB 4MNVA 1SGQE 5EW2H 2FEQH 1MKXH 2PGQB 2PUQH 2FOBA 1MBMA 1TMBH 4Y8ZA 3HK6B 1P02A 3ZZ4A 2C8WB 4UEHH 1G3DA 3P8FA 1Z6EA 3P8OA 1N1LA 1YY3A 1ZMLA 1BTYA 1UVTH 4FXGH 3NZIA 4Q7YA 1S6LA 2FOFA 4FUIA 1BRBE 3UR6A 4X8SH 1GG6B 1QJ6B 4X2XA 1LO6A 2IOTA 5E8EH 2Z7FE 1GJCB 3RXUA 4THNH 1GMDG 1FN6A 4X2YA 3UAIC 3U98H 4AG1A 1C2HA 1O3HA 1RJXB 1P05A 1K1IA 3AW1A 1BTZA 2PW8H 1HXFH 4K3JA 3ATMA 2BY7X 4NA8A 3RUOA 1Y3WA 1K1LA 5B6OA 2VBCA 1UVOA 1GJBB 4ABBA 2F91A 3F9EA 2YNBA 3GOVB 1RTLA 1BMLA 3FOAA 1ZGIA 2GJGA 3W95A 2GZ7A 2THFB 3K6ZA 4NCYA 2UWLA 2Z9LA 3BTHE 3RM2H 2H1UA 2WPDD 2OBQA 3SV9A 1TBZH 2ZCLP 2WV9A 1CT4E 1VR1H 1YP9A 1UK2A 2K1QA 3LGWA 4B6FA 5EU8A 2Q6FA 2Y5FA 3Q77A 4I8KA 1AO5A 4AG2A 2G8TA 3RXAA 4LXBH 1MCTA 3AAVA 1VKYA 1PJPA 5GNDA 2Y81A 3R0FA 2Y5GA 3M37A 3P92A 2VWNA 4Y10E 1DXWA 1Q2WA 3S69A 2VH0A 4DIHH 1ZJDA 2GVFA 2ZGHA 2WUCA 1LCYA 4ACAA 1DLEA 1SLVB 1HAIH 1P8VC 3M5NA 4MLFB 4A7IB 3VB4A 4DT7B 3SU0A 1HAYB 5HM9A 4RKJB 4YOIA 2AIPA 5JYIA 4NFEA 5DP6A 3AAUA 1IQIA 2BYAX 4YXWD 2ZG0H 1HAZB 1QFKH 4JZEH 1GBIA 1LHGH 2CMYA 2QXJA 4RT1A 1J9CH 3V13A 1W12U 1NFWA 1V2TT 2A4OA 2JKHA 3BG4B 5T6GA 1D9IA 1HAVA 1NRRH 1AFQB 3BTFE 2YOLA 1PFXC 1CT0E 2F43B 4BTIB 1TNJA 2Q1JA 3QZRA 3S7KB 3CP7A 4NSVA 1A0LA 2FZZA 1KYNA 2R3YA 4XRNA 2ZEBA 2HNTE 2FI4E 2BZ6H 3ZYEA 4AORA 3O8BA 2ODPA 3OE7D 3TGJE 3EQ0H 1UVUH 3A8CA 1SGPE 2IJD1 2VIVA 4X1NU 3LONA 1CA0B 1TONA 3PROA 1J14A 2BLVA 1PPGE 2FM2A 2WPMS 3UY9A 1T7CA 3SZNA 2BD7A 1Z6JH 1QQUA 3FANA 4KTCA 2QV1A 1N8OB 1ESTA 1W8BH 2EI6A 2AMQA 1ACBE 3LC5A 5A09A 1ZRBA 1DUEA 4ASUD 1YLCA 3FZDA 3RXKA 3SU3A 3DSGA 1L1GA 2UUJB 1YKTA 1QL8A 1OX1A 1H9LB 3SJIA 3WY8A 1SQOA 1XXFA 1LVBA 1FV9A 2CF8H 4ZROA 1QJ1B 2B9LA 2BY5X 1F5LA 2KAIA 1KTSB 1LPZB 1AVXA 3MOCA 3OY5U 3DSOA 3BTKE 4AFUA 1AZZA 3RXGA 3KCGH 1PQ7A 3RXTA 2K0QA 5GWZA 1G3CA 4YZUA 1O2MA 3PLKA 4ISIH 1SGTA 3GY8A 2PLXA 3N7OA 4LK4A 3SNBA 5BRRE 4RKOB 3I77A 8LPRA 3I29A 1MU8B 2VH6A 4ZXXH 1S82A 3OFND 2CXVA 2A2QH 2PKAB 1KSNA 1Y3VA 2BDHA 3UB0A 1C1UH 2R0KA 5DG6A 2WPJS 1BTUA 1QTFA 4MNYA 5EPNA 3VB6A 4ISNA 4K1EA 5HGGA 2PTCE 1LDTT 1YLNA 4FUBA 1S85A 1LVOA 2J98B 3HKJB 2BLQA 2BD3A 2ZHFH 4WMDA 2J92A 1GI2A 1MMJN 2ZU5A 2ZTZA 2CJIA 1NC6A 5EXMA 2A7JA 1INCA 1IHTH 5T1VA 1C1VH 2HLDD 1C5UA 1K2I1 2BHGA 1GMCF 1O2TA 2PHBA 4MPUA 2FOMB 1FY1A 1F2SE 1ZR0A 7ESTE 3KQCA 1VITF 1O2IA 3PTBA 1UTNA 3RXOA 1SGFA 1HJAC 2XCNA 4AGJA 1EZQA 3I78A 2QE7D 1O5EH 3KGPA 1EOJA 4KTSA 3FVFB 4UE7H 1NU7B 3A83A 2W6JD 3A7TA 2Y6TA 3SNAA 2WPHS 1P9UA 1TQ7B 3N7DA 1O2ZA 2V3HH 1KY9A 4KELA 3ZVBA 3MU0A 1W0KD 2AH4X 3PO1C 1TGTA 1GBHA 3TIUA 3RMMH 1VITH 3O8DA 4CBNA 4D9RA 3VG8A 3UNSA 4NA9H 1QQ4A 5JBAS 2VIQA 4ZH8A 5LPRA 1A0HB 3ZZ7A 2NWNA 3DSPA 1T8MA 3Q3YA 1ETSH 2A45B 3KQDA 5A8ZA 3JZ2B 3KEEA 2CHAB 4WF8A 5C20A 1CSOE 1P3EA 3ODFA 4DT4A 3F9HA 1ZSJA 3QUMP 1GI0A 2EA3A 1TB6H 4ABJA 3O8RA 1G30B 2PFEA 3RXRA 2YMSC 1O32A 4B74A 3HGPA 2BDGA 2FTMA 4X6PA 2BY9X 1XVMA 1ZPZA 3M5MA 4FU8A 2H9HA 2BMGB 2WSSD 2AMPA 1MUEB 2A4RA 1TPSA 3VGCC 1SOTA 5F6MA 3RC6A 1LPGB 1SQAA 1GBAA 4ZXYH 6GCHG 1WCZA 5EOKA 4BTTB 4O3TA 1TPAE 2FIRH 4ABFA 2Z3CA 3EA8A 1S0QA 2Z6BD 1C1TA 3UUZA 5A2MH 1O3BA 1LKBA 1T8LA 2A0QB 2XNDD 1HXEH 4TSFD 1A1RA 1LKAA 1A3BH 3SJ8A 5HYOA 1UCYE 3GYMA 3FP8E 1C5LH 4ZHLU 3KYFA 1C1OA 3M3TA 4GVUA 5EQQA 1UO6A 3ELAH 1CHOG 5TCAA 1SB1H 3AASA 3BEIB 2LELA 1HCGA 3A8DA 1TNHA 2FOCA 3SJ9A 1YPHE 3NPSA 2ZIQH 3T5FH 4BAOB 5ESBA 3V12A 3S7HB 3OAAD 3QTOH 1NS3A 2KCAA 1GI8B 5DPAA 2F83A 3QDZB 3RXVA 1ZPBA 1A7SA 1O5BB 3UOPA 2BD5A 2XWAA 2FLRH 1KMHB 3TNSA 3EE7A 5A0AE 1FPHH 2M2AA 3ZVAA 2W7SA 2NU0E 1GI7B 4K5ZA 5FPYA 4D9QA 1A5HA 4YLUA 3WWFA 1QRXA 5AFZH 2W3IA 3BTQE 2G52A 1FY4A 2ZFTA 2AMDA 1O3CA 1IQGA 5L30H 3PM3A 2R9PA 1GG6C 3RXCA 2QF3A 1C5YB 1LHFH 1OP2A 1V2OT 1Z8RA 3F1SB 3F2HA 1FNIA 5HM2A 3LGUA 5DP4A 5LH8A 2F9UA 1ZRKA 3MH4A 2QXGA 3GY3A 3ATLA 1K1PA 2F9NA 1W7XH 1O2LA 2H5CA 4YESB 3FN8A 1O31A 1WTGH 2BD4A 3SYJA 2BD8A 3S0NA 1SGEE 2HOBA 1ZHRA 1ZHMA 4X2WA 3SU1A 2AGIX 1CQQA 1E79D 4NIVA 4F48B 1HYLA 1TLDA 1CBWC 1DSTA 1BJUA 4AFQA 2FTLE 1AE8H 3VXFH 4M9FA 2ALVA 2BDIA 3NWUA 3U1JB 4D7GA 1PPCE 1NRPH 2KZ4A 1HJAB 3M5LA 3ZVFA 3C1KA 4HG6A 1EB2A 5GJ4B 3NCLA 1VCWA 2FYQA 1GI9B 2HWLB 2BD2A 1BJVA 2GMTB 1IQNA 2RCEA 3P95A 1TRMA 1KIGH 1C2DA 1HLTH 1ZZZA 2BQ7B 2KCPA 1TNKA 3DA9B 2ZNKH 2Y5HA 3PO1B 1EQ9A 1KDQB 3WW7A 3UIRA 2VVCA 4CH8B 4DG4A 4YTAA 1G32B 2TIOA 3BN9A 3L3TA 4Y76A 1YCPK 1ZGVA 4Q7ZA 1O2XA 4JZIA 1OWKA 2OC7A 1GHVH 3MYWA 1TA6A 2AHME 1ZYOA 3LC3A 3V3MA 1TNGA 2TGDA 2TBSA 1KLTA 5AFYH 2G51A 1ELBA 2VIWA 3SO3A 3MNBA 1GJ8B 2IPQX 2BOKA 5C2ZA 3ATIA 2XBWA 4AYVB 1GI6A 1DSUA 2ZDAH 1YLDA 1GHXH 2G81E 2ZECA 1BBRK 1FIWA 2YMSB 1V2RT 3RXDA 3BG4C 1O3MA 2P3TB 3CNRA 1AFQC 3RXJA 4UD9H 1TX8A 1TALA 1IQFA 3UWIA 2QXHA 3TK6A 2A32A 2WV4A 2AS9A 8GCHF 4PROA 1G36A 1B0FA 1W7GH 2GKVE 2FI3E 3BV9B 1UVPA 2VJ1A 1QR3E 1DS2E 4B2BA 1KXDA 1P01A 1F5RA 1QL7A 1YWUA 3SJOA 5IDKA 1GHBG 3L6PA 4RI0A 1DM4B 1BRUP 1L2EA 2JJ1D 4DOQA 5I25A 1XKBC 2TRMA 1AVWA 2BB4A 2J2UA 4I8GA 3GDSA 1S6FA 4FVBA 2BQWB 5IYTA 1MTVA 1GMDF 1M9UA 1TX6A 2HLCA 2LNCA 3FP7E 3ZZ9A 1P0SH 1UVSH 1QA0A 1BRCE 2Z9IA 4GHTA 1QB6A 3ZZDA 2ZDKA 3MH5A 8ESTE 1HJ8A 5J4QA 1GI3A 3DD2H 2VVVA 1O30A 2BVXH 3CENA 4NIYA 3BG8A 3SU2A 1EAUA 1H9HE 4JYVH 1F7ZA 1VJAU 4TYDA 1SGYE 3M61U 3RP2A 2SGPE 1E37B 1TBQH 2V0BA 1T4VH 1GBFA 4ISHH 2UUYA 3F3BA 4LOYH 1Y5AT 3RXHA 4OS7A 1XM1A 3RXLA 3ZVCA 2C8XB 2B8OH 3A89A 4UFDH 1DT2A 4B76A 1SFIA 2O8WA 3RXPA 4J1YA 1H8HD 1CGIE 2WHXA 2W6ID 3SV7A 1C4Y2 2SFAA 5EJLA 1TGCA 5C5OA 1J16A 1SOZA 2OCVB 2PKAA 2DE9A 3IWMA 2GCHG 4WY3A 2GDEH 1GPZA 1EKBB 1RTFB 1SR5C 3Q3XA 1RIWC 1QBOA 1FJSA 2ZHDA 1J8AA 1UJ1A 2J98A 1IQHA 1EZUC 2FODA 1YPGH 2XBVA 2BDBA 4XOJA 4X8VH 1T8NA 5FCRA 5L6NH 1T31A 1AHTH 3GCHB 3RXMA 4GPGA 3GCTG 2CF9H 1TMUH 4WXVA 2DUCA 1BTHH 1H1BA 5EXNA 1BMFD 3LDXH 2O8MA 3EA7A 3PTNA 1O3JA 3TGKE 4GCHG 1O2QA 1C1SA 2JH6D 1O2KA 3VEQB 5CMXH 1S83A 1CBWB 3PYHA 1Y5BT 1ELEE 1L1NA 2IPHA 3ZZ6A 1JMOH 4A5TS 1P2IA 3LGTA 5A0CA 2GGVB 1G3BA 2SGFE 1B0EA 1C5QA 1KLJH 1SGFG 2ANKH 4Y0YE 4I86A 1MAYA 2J9NA 4OS5A 3SW2B 3SUEA 2VIDA 1W0ZU 2ZDNA 2TGPZ 3MTYA 1GHAF 2G00A 5EXLA 4D8NA 4XE4A 2ZTXA 1WU1A 1GCTC 2GX4A 2XBYA 1MKWK 2KX4A 4KKDA 4U01A 1OYTH 1ANEA 1HIAB 1DWDH 3TH2H 1N6XA 2CHAC 3RXBA 1PPHE 3BIVH 2ULLA 1YPEH 1GJDB 5GCHG 1F5KU 4GSOA 3QO6A 1O3NA 2WPIS 1UCYH 2F9BH 3GY4A 4Y7BA 4MTBA 2EI7A 1OWEA 1FXYA 1GVLA 1ZMNA 2AYWA 5GXPA 2VB0A 2OK5A 4OM9A 1ORFA 3AVZA 8KME2 3Q3KA 5DGJA 1J15A 1FPCH 1KXBA 1V2LT 3A8BA 1DPOA 1GMHG 2ZGJA 4Y11E 1GBJA 1OKXA 2O9QA 3QZQA 1AI8H 2A2XH 3OSYA 4B73A 2Y82A 4K2YA 4Q2KA 2JIZD 1C9PA 4ACBA 5FBIA 3ENSB 3D23A 4ZHAA 1O2VA 3OYPA 4A6LA 4DURA 1XKAC 4O3UA 1P2MA 1QZ8A 3MU4A 6LPRA 3O8CA 2FOGA 2YMSD 3T28A 1DY8A 1RRKA 3S9CA 2BM2A 1W3CA 1DY9A 1GJAB 2TPIZ 1NRSH 1FMGA 2C3SA 3TPIZ 2UUFB 4ABIA 2A1DB 1HJ9A 1ZTLA 5C1XA 2ZGBH 1K1OA 2ZPRA 4INLA 2PTNA 1V2WT 3F6UH 4CRBA 4ESTE 1O3FA 1SSXA 1SPJA 4ASHA 3N99A 2C8YB 1DFPA 2IJOB 3UQOA 1BMNH 2FO9A 2OC1A 5EJ1A 2O8LA 3TGIE 4AYYB 3QWCH 2NU3E 2VGCC 4SGBE 1ARCA 4IC5A 1BDAA 3Q00A 1CVWH 5E0HA 4GLYA 1A46H 3TJVA 1GJ5H 3A84A 3OX7U 1O2NA 1HPGA 2VWLA 4I8HA 1DWEH 5C17A 5FCKA 1Z71A 3P8GA 1A5GH 3VB5A 2P94A 1IHSH 3NUMA 3SUGA 3T29A 4FUGA 2GZ9A 2KFWA 2A5AA 1AWFH 3PMJA 4AFSA 1CT2E 5GDSH 1DVAH 3LH1A 1NRQH 2CGAA 3UFAA 1UTMA 3GY5A 1GJ6A 3PV5A 1TPPA 1RIWB 2XOKD 3R3GB 5DK1A 5A8YA 2OD3B 4RT0A 1HFDA 4H6SB 5HMAA 1MAXA 2H2ZA 3UREA 3RDZA 2FX6A 2FDAA 1NFYA 2A5IA 2OXSA 2ZA5A 3E91A 2ZFPH 3RLWH 3SU6A 3STJA 1DWBH 1C2IA 3MO3A 1HDTH 2H5DA 4FUEA 5PTPA 3M7TA 5CHAC 1W11U 5KECA 3MI4A 1TIOA 2HGTH 3L33A 1EJNA 1SBWA 5AVDA 1FY3A 1C2MA 3LGVA 1CO7E 3GCNA 2BXTH 2ODQA 4X6NA 3RM0H 1MD7A 1L0ZA 1GJ7B 5JBTA 3PRBA 3E0NB 1YBWA 3BIUH 1O2JA 3MWIU 1OWIA 2V7QD 4X1RU 3U69H 3U8TH 1C2KA 3V7TA 3ZV8A 2V35A 3SGAE 4M7GA 1AB9B 3ODDA 1KDQA 2O8UA 2XC0A 1YYY1 4ISOA 3P17H 3GY2A 1G37A 2GMTC 2QF0A 2FMJA 5C3NA 1G3EA 1FY8E 1SKYE 1NBMD 2QXIA 1GGDB 1LMWB 2CK3D 3MQKC 1H8IH 2ZWLH 3ZIAD 3SNEA 4UFFH 3HKIB 1VJ9U 1C1PA 4UONA 2F9OA 1EOLA 1ZSLA 3BTEE 1O2HA 3GS9A 5FL7D 1QRWA 1EJMA 2FLBH 4INHA 5F53A 3KQEA 3MNCA 2D8WA 5HXFA 2HRVA 3TU7H 1EASA 4X1PU 1YPJH 2P3FH 3KHVA 4NWLA 3SI4H 1GCTB 3F0PA 1P2QA 1O5GH 5CE1A 3TJNA 1SVPA 3OEED 2PWXA 1AE5A 2PGBB 1NO9H 1IQKA 3OY6U 4BTUB 1LVMA 1C5ZB 2SNVA 1TX7A 4B2AA 2ZPQA 1BQYA 3A7YA 2BY6X 4AGKA 4WJG2 4TWWA 5DN6D 3LGIA 1V2UT 1LHEH 1QJ7B 2AIQA 2ANWA 4NIWA 1THRH 4O03A 1UTJA 2JDID 1EZSC 1MZAA 2RA3A 3KNXA 3RMNH 5TJXA 5DSFA 4A1XA 1MKXK 4WH6A 2V3MA 2AFQB 4IS5A 4AFZA 1AQ7A 2OINA 1P12E 1O2WA 1V2PT 3TH4H 4MPXA 2QF4A 1QB9A 2PV9B 3PWBA 4XFQA 1V2ST 1O3OA 1K0HA 1QRZA 4LZ1H 2G5NA 2FYRA 1AFEH 3LJOA 1GMCG 2K8IA 1V3XA 3RLYH 1O2RA 1AZ8A 4HTCH 5FXLA 1EFRD 4CHAC 2V3OH 1L1JA 3SU5A 1QBNA 4AN7A 3MNXA 5HIZA 3A86A 5CHBA 1K22H 2BDAA 4INKA 5EGMA 3UQVA 3SHAH 3TJUA 3ITIA 2ZU4A 1HBTH 2W7UA 1P2KA 4Z6AH 1GVKB 1ABJH 2BLOA 1AWHB 3PWCA 2L6OA 3STIA 4X8UH 2M5TA 1W0YH 5FHTA 1BT7A 2Z94A 1GBMA 4E7NA 5SGAE 1FONA 4DGJA 4NGAH 3A80A 3ZV9A 1K9OE 4I33A 4YT6H 2J94A 1BA8B 3K9XB 4NA7A 3QLPH 1K1JA 2HALA 1NFUA 3QK1A 3F2FA 5KGOA 1SGRE 3MU5A 2IN2A 2VGCB 4R0IA 1WSSH 4B71A 5EIYA 1GCDA 2B7DH 1C1MA 1LQDB 3DUXH 3F68H 3SORA 5C1UA 1SI5H 1D4PB 1QL9A 1KXCA 2ZGCA 3SQHE 2QCYA 2ESTE 4CRDA 1O3KA 4E7RG 2WZQA 2ANYA 1EAWA 3OU0A 4IMZA 4KP0A 1K1NA 1ELDE 1TGBA 2D26C 1YPMH 4B1TA 4E06H 4ABDA 1VCPA 1UTKA 3GCHC 1C2EA 1GHWH 1UK3A 1O2UA 2KM0A 1S84A 2BLWA 2NU2E 2ZQ2A 3ZVGA 2BOHB 1T4UH 1O3DA 2HVXA 2WUBA 4K1SA 2LPRA 1P11E 2R2WU 5KEDA 1NY22 2ZDVH 4ZUHA 2EQNA 2W26A 5CHAB 3RC5A 2ZC9H 1COWD 1TGNA 2XWBI 1Z8IB 2UWPA 1C2JA 3QGNB 4NWKA 1O3PB 3T2NA 5FX6A 3TK9A 2ODYB 1O5CB 1VGCC 1C4U2 2ZFRH 1WQSA 1GBTA 3F9GA 3W94A 1ZTJA 1FIZA 4AC9A 1RS0A 2NU1E 1P04A 4FUHA 5ETXA 1NRNH 1YCPM 3K6YA 1C5WB 2G4UA 5FPTA 1D6RA 3UWJH 4MPVA 1C5OH 1D3DB 1AVGH 1V2QT 2HNTF 3D65E 1DUAA 2P59A 4AX9H 4ZMAH 1F0RA 4YLQH 1SGDE 3MU8A 1BBRE 5LPEA 2J4IA 2STBE 1FY5A 2UUKB 3A7VA 1YPKH 3B8JA 4ZAEA 1KTTB 1KXFA 3GCOA 3H7OA 3ZYDA 1HIAA 1LQEA 2ILNA 4A1TA 1E0FD 1H9IE 2J34A 4Q7XA 3ZVEA 3GYLB 2HVYB 3SI3H 2FXRA 4JK6A 4ABEA 2WYJA 1EPTB 3P8NA 1PPBH 2GTBA 1ESAA 3SV8A 3FZZA 5L2ZH 3A7ZA 2XBXA 3KQBA 1GL0E 2P16A 2V6NA 3SV6A 3K65B 3HGNA 4RN6A 2RFKC 3DFJA 1E1QD 3P6ZB 3T26A 1IQLA 5F03A 2R0LA 3MHWU 1QHRB 1MABB 1ESBA 2OQ5A 3TH3H 1ANBA 5A8XA 1UMAH 3A87A 2I6SA 2FX4A
chains in the Genus database with same CATH topology
1H4WA 2FOHA 3CS7A 3PMAB 4IC6A 2ZDMA 2QC2A 2ZDLA 4JYUH 5ESTE 1ELGA 1QCPA 1BITA 1P57B 2ZO3H 2QGRA 1O0DH 2QN5T 1XUJA 4IN2A 1GJ4H 1RTKA 2PSXA 1LHDH 1FDPA 2W5EA 3E8LA 1ELVA 5T3HA 1C5MD 2GCHF 3SN8A 1DANH 3GDUA 5FBEA 2P8OC 1A5IA 1NFXA 1Y5UT 2VIOA 3U8RH 4FU7A 5DP7A 1SGIB 4ZHMU 1D3QB 2RG3A 5DP3A 4AZ2B 1PPEE 1F0SA 4HZHA 1XUKA 4U2WA 5C1YA 5L2YH 1S6HA 1MQ6A 1MTSA 4CHAB 2O8TA 3EGKH 1A4WH 1VCQA 2QY0B 3LOXA 1L4DA 1P06A 2BX4A 1ETRH 4X1SU 2A5KA 3E0PB 1E36B 4NG9H 3GCTF 5H4IB 3BEFB 4E05H 3A85A 1O39A 4Y7AA 1Y3UA 1QNJA 4O97A 3SJKA 3RC4A 3DHKH 1KXAA 4UFGH 4OGXA 1W2KH 4X8TH 3BF6H 5TCCA 4ABAA 3E16B 3FP6E 1SG8B 5JB9S 1XXDA 1SHHB 1PYTC 4HFPB 4HI3A 1P03A 2XTTB 1K1MA 2HPPH 3ATWA 1ID5H 2BVRH 2B5TB 3D49H 1EB1H 2BDYA 1FAKH 3MH6A 3A88A 3S9BA 1KXEA 1HAXB 1XX9A 7GCHG 1DICA 5AF9H 7KMEH 1SLWB 6ESTA 3A8AA 1Z1JA 3UR9A 2ALPA 1UTQA 4Y8YA 5K0HA 3TK5A 1O3GA 3U1IB 2QIQA 4H42U 4BXWA 5E0GA 1XUFA 2C93B 2FS9A 2XRCA 1AGJA 2VNTA 1NPMA 8GCHG 3LPRA 3QGJA 3FAOA 1B7XB 3GY7A 2FOAA 5DP9A 2Z3EA 4MVNA 5EODA 3M35A 1LVYA 1JIRA 2WPLS 3IG6B 3A7WA 1TBRH 2H9EH 5GCHF 1SHYA 1HRTH 5AHGH 3VB7A 1TFXA 1OP8A 4MNXA 3LIWA 1HNEE 2GV7A 4K69A 1ANCA 1VGCB 4XBBA 2XC5A 4XSKU 1C2LA 2XNIA 2Z9KA 4CH2B 4ZKOU 4XDEA 1GBCA 1O3EA 2OP9A 2R2MB 5DP5A 1DWCH 1AB9C 1NZQH 1O3LA 1ZJKA 1PPFE 5EW1H 4Y71A 4X6MA 1BCUH 4IBLH 4I31A 1HB0B 4NIXA 1GMHF 3UNQA 2BXUH 2SNWA 1SC8U 1GGDC 3MH7A 1IQEA 1DLKB 1C5SA 4TPIZ 1C1QA 2ZFSA 1F0UA 1MTUA 4CR9A 2JETC 4KGAA 2ZU2A 1GDNA 4DCDA 1BIOA 2ZU3A 4ISLA 1V6DA 4K1TA 4U30A 1O5DH 3UTUH 2VWMA 1EP6A 1TE0A 2PUXB 2XW9A 1MTNC 1GBDA 1UK4A 2OLGA 5GPIB 1BOQA 1V2VT 4R8TB 5G4BA 1O2PA 2SGDE 2OUAA 1BRAA 1SQTA 5J4SA 1BUIA 2C4FH 2XCFA 2DE8A 3B23B 4X2VA 1AKSB 3JZ1B 4OGYA 1GBEA 1ANDA 1O2YA 1CE5A 1P10A 1PPZA 1HAHH 3C27B 3SGBE 1BHXF 1EAXA 1TNLA 2BQ6B 1O5AB 1QGFA 1ZHPA 2SGQE 4FU9A 5JDUB 3H5CB 4SGAE 1DXPA 2OTVA 4K60A 4OS4A 3AW0A 1S81A 4J2YB 2GT8A 1IQMA 1P2JA 2P8OB 3S9AA 1QY6A 1U6QA 4MDSA 1AN1E 4TWYA 3M36A 2A4QA 1ABIH 1AD8H 1OWHA 2XXLA 4MG3A 2ZFQH 4AB9A 3T25A 2TGTA 1K21H 3KL6A 2HNTC 3BTTE 4X6OA 1XUGA 1HAGE 1THPB 4K8BA 1O5FH 5EQSA 1Q3XA 1O3IA 5F8TA 2BZAA 2FP7B 3HPTB 2BVSH 4FUJA 2ZHWH 3SOSA 1WBGB 1Z8GA 3RMLH 1GHAG 4IMQA 3TJOA 1NU9A 6CHAC 1ELFA 4CRCA 3SUFA 2ANMH 1JXPA 1NM6A 2GCTB 5T6FA 1UTOA 1IOEA 2PKSC 4ZKNU 2A4GA 1A3EH 5FX5A 1TAWA 1YCPH 1GI5A 1K28D 3BTME 3M7UA 1MU6B 1JRTA 5JBCS 2GZ8A 1ZOMA 4LZ4B 1BTPA 4BXSA 5ABWA 4WWYA 1BMAA 3EE0B 5FPSA 2FPZA 3A7XA 1P09A 2ZI2H 4VGCC 1BZXE 3KN2A 2TGAA 1Y3XA 3HK3B 2J38A 4TY7A 3SU4A 1MZDA 3PB1E 4X0WU 3RU4D 1LTOA 4A1VA 3TITA 1W13U 1HAPH 3GY6A 1FI8A 1YGCH 1BBRH 1TOMH 3ESTA 2F3CE 1C5XB 3P70B 4B75A 1WYKA 2GDDA 4YT7H 2ZHQH 4OS2A 2C90B 1G2MA 3RXSA 4CRGA 2ZPSA 4OS1A 2H6MA 1MBQA 1JBUH 1D3PB 3H7TA 1IQJA 1NESE 1F0TA 1GHZA 2Z9GA 1EJAA 3VFEA 1AY6H 1FQ3A 1HV7A 2ZQ1A 1SGCA 1TOCB 1J17T 4WH8A 5E0JA 5DKMA 4AOQA 4Y6DA 2W3KA 4BAQB 1EX3A 1C5PA 1ZPCA 1ETTH 1O2SA 1SLUB 1FAXA 2H9TH 1P3CA 2OC0A 3BTDE 1Z8JB 1DX5M 1JOUB 2NU4E 4FVDA 1TWXB 4D76A 1E35B 3RXIA 1SFQB 3MMGA 5JB8S 4OS6A 5DO4H 2Q6GA 5C67A 3U8OH 2GD4B 2VINA 3EAJA 3F9FA 2FESH 2GP9B 4BAKB 1HAOH 1D3TB 2SGAA 1O2OA 1P2OA 4DVAU 1QA7A 3GISB 2XC4A 1AUTC 1EPTA 1OOKB 6GCHF 2UWOA 3V0XA 3URCA 1QB1A 4NFFA 3ZZCA 1BMMH 5GIBA 4F49A 1V2NT 2BTCE 1Z7KA 5T6DA 1NN6A 1AU8A 3QN7A 2JETB 3LU9B 1V2KT 1Q31A 4FUFA 3K2UA 1WAYB 1EPTC 4X1QU 1C1NA 4BNRA 3SV2H 5JPMH 3PV4A 1EATA 1CHOF 1GHYH 3NK8A 2WV5A 1TGSZ 4DJZB 3ATKA 2OC8A 7LPRA 1MTNB 2BD9A 1T32A 1KLIH 4FUCA 1GDQA 3NKKA 1W10U 3MU1A 3RU4T 1CGHA 1Z1IA 1EUFA 4YO9A 3LT3A 1NTPA 3HATH 3RMOH 1SGNE 1TRNA 3QX5H 4A92A 2EC9H 1C9TA 1V2MT 1GBBA 1TQ0B 4ABHA 1GWAA 4CR5A 3GICB 2GV6A 4WXIA 2Q6DA 1FUJA 1TA2A 3MNSA 4XBCA 1BB0B 4JCNA 4KTUA 1Y8TA 3ZZ3A 4D7FA 2VU8E 1UTLM 1NROH 1ELAA 4NZLA 2OBOA 4NZQA 2Y7XA 1ZLRA 2XYAA 4MNWA 5BPEA 1C5NH 2STAE 1CGJE 2A7CA 3SNDA 1VZQH 3MFJA 2R3UA 3TNTA 3Q76A 1VITG 1MD8A 4GAWA 3OTJE 1EAIA 2A7HA 1DDJA 1Y59T 3KF2A 1FLEE 1C5RA 3LJJA 1E38B 1C1WH 1O38A 4XBDA 2JH0D 1ELCA 4JZFH 3VXEH 4TPYA 1V2JT 3SUDA 2A31A 2G4TA 3M7QA 1HAVB 3SQEE 1AMHA 1PQ8A 1THSH 1O35A 3DFLA 3BSQA 1SL3A 2P3UB 2PSYA 4MPWA 1MCVA 2OQUA 3RU4E 1X7AC 4JMYA 5DJ7A 1XVOA 4H4FA 4Y0ZE 2I6QA 6CHAB 2VIPA 4K8YA 1YPHC 4DW2U 2D1JA 2PKSB 3SNCA 4CRFA 3EDXB 4ABGA 1GBKA 1MKWH 4UDWH 1ARBA 2RDLA 3PLBA 2ZCKP 1UHBA 4F4OC 3E3TA 1OWJA 1RGQA 1TRYA 3LKWA 1P2NA 3ZZBA 4YOJA 1O33A 2D2DA 3FFGA 4WVPE 3RXQA 3SHCH 5FAHA 4DY7B 4VGCB 1UTPA 3CS0A 1A61H 1O3AA 4CREA 5A0BA 2HPQH 1S0RA 1GL1A 2P93A 1C2GA 2FOEA 2VWOA 1RD3B 1TMTH 2BDCA 3MO9A 3E90B 1SMFE 1ZSKA 1YF4A 1YC0A 4YOGA 3QTVH 1PYTD 4I8LA 1AIXH 4DIIH 2SGEE 1UCYK 3SGQE 1O34A 4FUDA 1IAUA 2PR3A 2ZP0H 5JBBS 1JWTA 1OSSA 4Y79A 4UFEH 3RXEA 2J95A 4I32A 5F8ZA 3DT0H 3LGYA 1BTWA 2ZGXH 4I7YH 4IGDA 4Y8XA 1MQ5A 1F92A 1DE7H 2KAIB 3ZVDA 3TLOA 1OPHB 4JYTA 3E1XB 5EPYA 3ZZAA 4GHQA 4BAHB 3ZZ5A 2F9VA 1C5TA 1A0JA 1TNIA 1JRSA 1LPKB 4O9VA 4MQAA 3M3VA 4IW4E 2ASUB 1GJ9B 1FN8A 3RXFA 2FWWA 2ZFFH 3M3SA 1HUTH 1TPOA 5C5NA 4YM9A 1YPLH 3SBKA 3VB3A 4BOHA 1DITH 4GUXA 3TVJB 2G5VA 1GHBF 3GDVA 3U9AH 5EQRA 1JIMA 3UOUA 1Y3YA 1YM0A 2RA0A 1OYQA 5DP8A 3URDA 4BAMB 1B5GH 1XUHA 1A2CH 3G01A 3UNRA 1GDUA 1LHCH 1AKSA 2F9PA 2FS8A 1MTWA 1P9SA 2ZCHP 2VVUA 3VPKA 3PLPA 3B9FH 1OXGA 2ZHEH 2ZKSA 4JZDH 3M5OA 1O36A 1EZXC 1OWDA 2AGEX 4H6TA 3PMHB 2P95A 2G55A 4ZKRU 2Z3DA 1C2FA 1E34B 2CV3A 2WINI 1SLXB 4QT8C 4JK5A 1GI4A 1RFNA 1S5SA 2EEKA 1EP5A 2QAAA 2EI8A 3T62A 7GCHF 3BTWE 2ZF0H 2WYGA 1G9IE 3T27A 1GBLA 1HGTH 4TY6A 3A82A 3EYDA 5LPFA 3MO6A 3BEUA 1DOJA 1H8DH 1O2GH 1PQAA 5K7RA 4B2CA 9ESTA 4I8JA 1PQ5A 2YNAA 1GVZA 4WMFA 2C8ZB 1D6WA 1WUNH 3A81A 9LPRA 2Y7ZA 1FZZA 1G2LA 4ZKSU 3KIDU 2BX3A 2GT7A 1C4V2 3D62A 1AUJA 3BTGE 1CHGA 4RSPA 3VGCB 2ZTYA 4NSYA 2AEIH 5E2OA 2ZZUH 1OP0A 1C1RA 1WOFA 1MH0A 4HGCA 1BTXA 3ZZ8A 1XMNB 1NT1A 1XUIA 5LGOA 1WQVH 2Z9JA 1T8OA 4BANB 2JH5D 1W14U 4Z0KA 1CA0C 3PMBB 5I46H 3IITA 2CN0H 1QBVH 1WV7H 4GCHF 4AB8A 1WTHD 2ZU1A 4JZ1A 2GCTC 2BY8X 1EXFA 1GI1A 1C5VA 1CA8B 1TABE 5E2PA 2WPKS 4WMEA 1N8OC 1RXPA 5F8XA 2AGGX 1CU1A 2Y80A 2QYIA 3NXPA 2FI5E 1ZMJA 1L4ZA 1OS8A 4U32A 5EG4A 1ELTA 2AERH 1TYNA 1N6YA 1ZTKA 3EA9A 4IN1A 3LH3A 2B0FA 1QURH 3E6PH 2QA9E 4Q80A 3UPEA 1QIXB 1O37A 1UHBB 4CRAA 4CBOA 1BHXB 4MNVA 1SGQE 5EW2H 2FEQH 1MKXH 2PGQB 2PUQH 2FOBA 1MBMA 1TMBH 4Y8ZA 3HK6B 1P02A 3ZZ4A 2C8WB 4UEHH 1G3DA 3P8FA 1Z6EA 3P8OA 1N1LA 1ZMLA 1BTYA 1UVTH 4FXGH 3NZIA 4Q7YA 2FOFA 4FUIA 1BRBE 3UR6A 4X8SH 1GG6B 1QJ6B 4X2XA 1LO6A 2IOTA 5E8EH 2Z7FE 1GJCB 3RXUA 4THNH 1GMDG 1FN6A 4X2YA 3U98H 4AG1A 1C2HA 1O3HA 1RJXB 1P05A 1K1IA 3AW1A 1BTZA 2PW8H 1HXFH 4K3JA 3ATMA 2BY7X 4NA8A 3RUOA 1Y3WA 1K1LA 5B6OA 1UVOA 1GJBB 4ABBA 2F91A 3F9EA 2YNBA 3GOVB 1RTLA 1BMLA 1ZGIA 3W95A 2GZ7A 2THFB 3K6ZA 4NCYA 2UWLA 2Z9LA 3BTHE 3RM2H 2H1UA 2OBQA 3SV9A 1TBZH 2ZCLP 1CT4E 1VR1H 1YP9A 1UK2A 2K1QA 3LGWA 5EU8A 2Q6FA 2Y5FA 3Q77A 4I8KA 1AO5A 4AG2A 2G8TA 3RXAA 4LXBH 1MCTA 3AAVA 1PJPA 2Y81A 3R0FA 2Y5GA 3M37A 3P92A 2VWNA 4Y10E 1DXWA 1Q2WA 3S69A 2VH0A 4DIHH 1ZJDA 2GVFA 2ZGHA 2WUCA 1LCYA 1DLEA 1SLVB 1HAIH 1P8VC 3M5NA 4MLFB 4A7IB 3VB4A 4DT7B 3SU0A 1HAYB 5HM9A 4RKJB 4YOIA 2AIPA 5JYIA 4NFEA 5DP6A 3AAUA 1IQIA 2BYAX 2ZG0H 1HAZB 1QFKH 4JZEH 1GBIA 1LHGH 2CMYA 2QXJA 1J9CH 3V13A 1W12U 1NFWA 1V2TT 2A4OA 2JKHA 3BG4B 5T6GA 1D9IA 1HAVA 1NRRH 1AFQB 3BTFE 2YOLA 1PFXC 1CT0E 4BTIB 1TNJA 2Q1JA 3QZRA 3S7KB 3CP7A 4NSVA 1A0LA 2FZZA 1KYNA 2R3YA 2ZEBA 2HNTE 2FI4E 2BZ6H 3ZYEA 4AORA 3O8BA 2ODPA 3TGJE 3EQ0H 1UVUH 3A8CA 1SGPE 2VIVA 4X1NU 3LONA 1CA0B 1TONA 3PROA 1J14A 2BLVA 1PPGE 2FM2A 2WPMS 3UY9A 1T7CA 3SZNA 2BD7A 1Z6JH 1QQUA 3FANA 4KTCA 2QV1A 1N8OB 1ESTA 1W8BH 2EI6A 2AMQA 1ACBE 3LC5A 5A09A 1ZRBA 1DUEA 1YLCA 3FZDA 3RXKA 3SU3A 1L1GA 2UUJB 1YKTA 1QL8A 1OX1A 1H9LB 3SJIA 3WY8A 1SQOA 1XXFA 1LVBA 1FV9A 2CF8H 4ZROA 1QJ1B 2B9LA 2BY5X 1F5LA 2KAIA 1KTSB 1LPZB 1AVXA 3MOCA 3OY5U 3BTKE 4AFUA 1AZZA 3RXGA 3KCGH 1PQ7A 3RXTA 5GWZA 1G3CA 4YZUA 1O2MA 3PLKA 4ISIH 1SGTA 3GY8A 2PLXA 3N7OA 4LK4A 3SNBA 5BRRE 4RKOB 3I77A 8LPRA 3I29A 1MU8B 2VH6A 4ZXXH 1S82A 2CXVA 2A2QH 2PKAB