3T26A

Orthorhombic trypsin (bovine) in the presence of sarcosine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title The use of trimethylamine N-oxide as a primary precipitating agent and related methylamine osmolytes as cryoprotective agents for macromolecular crystallography.
pubmed doi rcsb
molecule tags Hydrolase
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t26A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t26A02
4D7FA 3GY8A 3ITIA 4YLUA 5FCKA 3HPTB 2SGAA 5EG4A 1Y59T 5T3HA 1P9UA 1JWTA 3GCTF 1TPSA 2XBYA 9LPRA 2FTLE 2FYQA 3SQEE 3LJJA 1H9HE 5LPFA 3QN7A 3G01A 1P2NA 1QRZA 1UCYK 2OBOA 2FOEA 1O3LA 3UNRA 1O2OA 1UTMA 3KF2A 4NG9H 4MNYA 3BG4B 1ZSKA 3M3TA 2LPRA 1GJCB 3MMGA 1UTPA 1GBTA 2ZDNA 1TPOA 3VFEA 1AVGH 1V2WT 1GBBA 1ZOMA 2VNTA 5C3NA 4Y76A 1TOMH 3NZIA 2XW9A 1W7XH 1FY4A 4XBBA 4ISLA 2H9HA 1C5SA 1UHBB 2OUAA 1U6QA 2ZO3H 4Y0YE 5HYOA 2VINA 4ABEA 5JB8S 2P16A 4U30A 3TK6A 1CQQA 1QA7A 2BY9X 1JMOH 1VITH 3BTHE 1OKXA 2BD4A 1BRCE 1K21H 3P70B 3OX7U 2PLXA 2QCYA 1P8VC 2A1DB 1UHBA 3RXSA 1QRXA 1GG6C 1DWBH 4AFQA 4CREA 1L1GA 4NWLA 3QTVH 1Y8TA 4UFFH 1TWXB 2VH0A 2AERH 1SLXB 5K7RA 4AB8A 3LIWA 5EW2H 3E8LA 2SNWA 1UVSH 3CS0A 2VWNA 2UUJB 5E0HA 1EPTC 4HI3A 4NIWA 4RSPA 5EQSA 1A3BH 3FZZA 5HGGA 2F91A 2HVXA 4X6NA 4Y8XA 1TE0A 3VXEH 3QTOH 5K0HA 2WUCA 1GGDC 2BQ6B 1EZSC 4FU9A 2BXUH 3HK3B 2BX3A 5F03A 5F8XA 1TPPA 2BVSH 3VGCB 1ELVA 1PYTD 3Q3KA 2ZGJA 3GCNA 5IYTA 4OS5A 4YOJA 2BOHB 9ESTA 1PJPA 3GDUA 4KELA 1PFXC 1O2JA 1ZSLA 2CV3A 4UDWH 2W26A 2GCTC 1O31A 2ZHFH 3TPIZ 3UR9A 4ZKOU 1GI7B 2BQ7B 3RDZA 1Y5AT 1RTKA 3U1JB 1DE7H 5C5NA 4X1RU 1AE8H 1TQ7B 1LVYA 3TNSA 1EJMA 2AS9A 1LMWB 1GI3A 5AF9H 1TGBA 5DP7A 1TIOA 3ZZ9A 2G4UA 2GT8A 4K8BA 5L2YH 1XVMA 1HRTH 2C90B 3RC5A 3L33A 1IHSH 2ZP0H 1GBCA 1AUJA 2AMDA 1WYKA 1QBVH 1QHRB 5A8ZA 2FOHA 1ZGVA 1Z6EA 3ELAH 1Z8GA 4O3UA 1C1SA 2GVFA 1O5EH 4X6PA 5L6NH 1O2VA 1EP6A 4I31A 1SOZA 2ALVA 5CHAC 3E3TA 3PWBA 4ZHAA 1ESBA 3I77A 3LPRA 1L1NA 4YO9A 1UVPA 3PLBA 4JYUH 1F0SA 3DFLA 2VJ1A 3ZZ5A 3NXPA 4O97A 1YPJH 1P57B 2ZCKP 1BB0B 3K9XB 1LVOA 2RA0A 3K2UA 1Q3XA 1VCPA 1AKSB 1H8IH 1BRUP 3BG4C 4X8TH 2JH5D 4FUJA 4FVDA 4NWKA 2C3SA 1V6DA 2A31A 2ZGXH 4XBCA 1GCTB 1GJ9B 1UK3A 3EYDA 1V2QT 1F0UA 3F6UH 3RXOA 1UTJA 1ZTLA 2AYWA 4BAQB 1QIXB 2P59A 5EODA 2OC8A 4FUBA 1BRBE 1LKAA 1MU8B 2GT7A 2Q6DA 2QAAA 1MKXH 4H4FA 5DP8A 2A4GA 2VIVA 2H5DA 4OS7A 4THNH 3PV4A 2VIQA 1DY9A 3GDVA 3LKWA 1AHTH 1EZXC 1ACBE 1ZRBA 1SGDE 1GBHA 2F9PA 2P3UB 3VXFH 3UIRA 1Y3WA 1GMCF 1TNHA 3VB3A 1ETRH 3SJ9A 1C5NH 2YNBA 3KQBA 4B2AA 2F9OA 1CBWC 4BXWA 2ALPA 1GMDG 1TNKA 4E05H 2SGPE 3D49H 2HNTC 1KDQB 1TONA 2BZ6H 4FUHA 3U1IB 1ELTA 1C1MA 4FXGH 4CH8B 5A8YA 2FWWA 3GOVB 1AZZA 3VEQB 5E0GA 4OS1A 1MKXK 4KGAA 3PMBB 1ZTKA 1FAKH 2VWOA 1HIAB 3A89A 4BAHB 2Q1JA 2C8XB 2HRVA 1TQ0B 3UFAA 1HAHH 3NKKA 1TNGA 3BEUA 1KDQA 3T26A 1BTWA 3P92A 1KSNA 2ODYB 2Z7FE 2P93A 3TJVA 2Z94A 4BANB 3BTGE 1W0YH 1W11U 1QL7A 5CE1A 1D3DB 4NSYA 1CGIE 2GX4A 4X1PU 4X1NU 4A7IB 1FN8A 2BLWA 1NFWA 1GBEA 1TOCB 2G5VA 2H5CA 1MTNB 4KP0A 4JK6A 3SI4H 1F2SE 1P2KA 5L2ZH 1SL3A 1FLEE 3N7OA 1MZAA 4X8UH 1K1LA 1HAZB 1P3CA 3FZDA 4JYTA 3FP7E 4AZ2B 3SUGA 4Q2KA 1T4UH 1W0ZU 5AFYH 1DLEA 4D7GA 3ZZCA 2UWLA 1C2LA 1TALA 1CGHA 1O2YA 2ZU1A 1HGTH 4K2YA 1J17T 4DGJA 3KQEA 4DG4A 3KCGH 3M3VA 3LGWA 4K60A 2XC0A 3TNTA 5EQRA 4XBDA 1VCQA 1V2ST 1OWEA 3SU1A 2PR3A 2SGFE 5FPSA 4O3TA 5JBCS 1WUNH 3SN8A 4D9RA 2PKSB 1F5LA 1QGFA 1C5PA 1V2VT 4MPVA 2J2UA 1PPZA 2R0KA 2ZCHP 1NN6A 2TGPZ 1FUJA 1O3IA 2ZC9H 4AX9H 3E1XB 1EATA 1C2HA 3S7KB 2GMTB 3TGIE 1FZZA 5AVDA 5C1YA 3MU5A 8ESTE 2OP9A 5JBAS 3SJIA 1C1RA 3P17H 1XMNB 1BMNH 1D3PB 4F49A 4CRCA 2FI3E 3EGKH 4ZHLU 1ZHMA 1GMDF 1YBWA 1IQMA 1C1QA 3SZNA 1GCTC 4GLYA 1Y3UA 2PGQB 1AMHA 1BOQA 5FX6A 2BOKA 2BY6X 2AIPA 2G52A 2GZ9A 1GL0E 2IPHA 2ODPA 3TH2H 1KIGH 1XM1A 1J14A 1P2OA 5T6DA 1IQHA 4Y8YA 1AFQC 4FUEA 2G00A 4X2WA 4NZLA 3M61U 3C27B 2P8OB 4YT6H 1S0RA 4K3JA 2HPQH 1LQDB 4B75A 2PUQH 4ABBA 1ANBA 5T6GA 4TWYA 1E35B 3T28A 1YLDA 1JXPA 2AGGX 1HFDA 2ESTE 3D62A 2ZNKH 2BLOA 4DY7B 5TCCA 2QGRA 3MFJA 1DM4B 1GVKB 3RM0H 2BMGB 3PO1B 1AUTC 5CMXH 2FX4A 1EAUA 1PPCE 2FI4E 3GDSA 3SJOA 4GHQA 1O37A 1ID5H 3M7UA 3SBKA 2WV4A 4ZUHA 2BY7X 1DS2E 1TX8A 2A0QB 2G51A 1BCUH 1C5XB 2Y6TA 4D76A 2W3IA 4E7RG 1GDUA 2Y7ZA 3PB1E 1ZGIA 3Q3XA 3MNSA 3T27A 3RC6A 5A09A 2XWBI 1GBKA 1TBQH 3BSQA 3KIDU 2RCEA 3LGIA 1Z8IB 4X6OA 2PGBB 5DP3A 1S6HA 1O5BB 2FTMA 1HUTH 1EB2A 1Q2WA 3ATWA 3VB4A 1C2GA 1JBUH 1N8OB 3KN2A 3UREA 4KTUA 2GDEH 4HZHA 4KKDA 2FOGA 1C4V2 1FJSA 1O2XA 3QK1A 5FX5A 2P3FH 4VGCC 1ZZZA 1SLVB 4JCNA 1V2UT 2FEQH 3GCHC 2SGEE 1UVUH 3E91A 3TJOA 1D3QB 1C9PA 1TABE 1EP5A 1NRPH 1KLTA 4I7YH 1DVAH 3LU9B 1GBIA 2PSXA 4GVUA 3ZZ8A 2PV9B 2WPMS 1SSXA 4XOJA 3O8BA 1Z71A 4AG1A 1HDTH 1XX9A 3W95A 4DURA 4LZ4B 2QXGA 3MNXA 1DWEH 1QFKH 4DJZB 3K6YA 2FS8A 1RFNA 4B71A 3MO9A 4UFEH 1NRNH 4ISHH 2VIWA 4FUGA 3RXIA 1G3CA 2PWXA 1CHOF 2CXVA 1AN1E 4I8LA 1ZMJA 5C1UA 2XYAA 2VIPA 1O2IA 1GWAA 3F9FA 1AD8H 4ABHA 3BIUH 3LGYA 3ZYEA 3PLPA 1A61H 2BTCE 2ULLA 3HATH 3QGJA 5ESBA 1EKBB 3F9GA 1IQIA 3GCOA 4CRBA 1L2EA 1BRAA 2G81E 1O3MA 2I6SA 1ETSH 4ISIH 2BZAA 2OQUA 2GZ7A 4K1EA 2Y80A 1YF4A 3NPSA 3IG6B 4UONA 1BMMH 3SO3A 3DUXH 1LVBA 1V2RT 2ZHQH 8GCHG 3BTTE 3SW2B 1HXFH 1DPOA 2XCFA 5EU8A 3L6PA 1O2UA 1QCPA 1N6XA 3KGPA 2PSYA 3VB7A 1XUHA 4H6TA 3S7HB 1TNLA 2ODQA 3M3SA 3F9HA 2WPIS 1OPHB 2JETC 3A8BA 2Q6FA 1T32A 1Z6JH 3ZVDA 3WY8A 3ZZ3A 1IQGA 3EE0B 1DLKB 1RIWB 5GWZA 3H5CB 4IMQA 1A4WH 3QZRA 3U8TH 3DD2H 3FFGA 1GBLA 3OSYA 2A7JA 1YKTA 3SV7A 1BBRH 1ZHPA 1BHXF 3PO1C 3ATKA 4MPUA 3SORA 3RXCA 3TGJE 5JBTA 3JZ1B 2ZDVH 4B74A 4SGBE 1XKBC 1XUGA 1LDTT 3W94A 4U32A 1O5DH 4RN6A 4GUXA 1QY6A 1ELDE 2FMJA 3D65E 2B0FA 2FXRA 3KHVA 2HWLB 1ZMNA 5DP9A 2Z9IA 3LC3A 3LOXA 4NFEA 2DE8A 5H4IB 2WPKS 2RA3A 3V13A 3SQHE 1FY3A 4BTIB 3LGVA 5FBEA 1W3CA 3OTJE 1ZJDA 4NGAH 2A4OA 1S81A 3A82A 4UFDH 1BBRK 5AFZH 2CHAB 4AGJA 5T6FA 5BRRE 1QJ1B 1AVXA 2A5AA 1QJ7B 2BLQA 1RJXB 1TGCA 2A4QA 2TGDA 1QBOA 1UMAH 1SGIB 5BPEA 4ESTE 5EQQA 2H6MA 1KTSB 2YNAA 4BOHA 1VJ9U 3RLWH 3RXEA 4ZXYH 2BDYA 2R3UA 2V3OH 1D3TB 1SC8U 4Q7ZA 5DPAA 5TJXA 3PLKA 1O32A 1GVLA 3MH6A 1PQ7A 6CHAC 1H9IE 3TVJB 1CT4E 2AGEX 2H2ZA 1SFIA 3MHWU 5FBIA 1SHHB 1F5RA 4AG2A 3U98H 1V2OT 1O35A 4WH6A 2F83A 3SNAA 1SGPE 3T29A 4NIVA 3RU4D 8GCHF 2UWOA 1SGRE 1O5AB 3AAVA 4Y7BA 3E0NB 1BJUA 4DCDA 1CU1A 6ESTA 2HOBA 2BLVA 1G3DA 4ISNA 4OGXA 1O2QA 2TGTA 3MU0A 2OINA 1ZHRA 3ZZBA 2ANKH 2GV7A 1MD8A 2NU1E 4IW4E 2UUYA 1DWDH 3M7QA 2TBSA 3HKIB 3K65B 2FZZA 5J4SA 1P2JA 1SQOA 3LGTA 1TMTH 1P2MA 2GGVB 4DW2U 3DA9B 4CHAC 3LDXH 1W14U 3TK5A 1QNJA 1OP8A 1MQ5A 1NFXA 1ZJKA 5GIBA 1P03A 4B1TA 2SNVA 3ZZDA 3KEEA 1MUEB 1S85A 1KYNA 1DX5M 2XBXA 1UVTH 3URCA 1A3EH 1BITA 4LZ1H 4BAOB 4J1YA 3LT3A 1ELAA 1C2MA 1HAIH 1GMCG 4TY7A 1RS0A 4M7GA 3SV6A 1O3EA 2B8OH 4DOQA 1YCPM 2WYJA 4TPYA 1YM0A 1B7XB 2O9QA 2PUXB 2QV1A 3Q77A 1MCVA 3M35A 5EXLA 2VGCB 3F1SB 1S6FA 1SGQE 4K69A 1SQTA 1O3PB 3ESTA 1IQLA 1RTLA 3GY6A 1XVOA 1IQFA 5DJ7A 1AE5A 1V2NT 1MMJN 2BB4A 4IN1A 1QA0A 2QXJA 1L1JA 1SPJA 3S69A 5E0JA 1Z7KA 3A8CA 3SNCA 1K2I1 4OS2A 1C1OA 1P09A 3MU8A 5HM2A 1OP0A 1H9LB 2G5NA 1DUAA 4XE4A 4DT7B 3P8GA 3M5NA 4AYYB 1G3EA 3SU2A 1C1TA 1GHVH 1BTXA 4YTAA 1W8BH 3V0XA 2Z9GA 2HGTH 1Z1JA 2Q6GA 3HK6B 1NY22 1IAUA 2VIOA 5HMAA 3MO3A 1NC6A 4FUDA 3Q3YA 1O2ZA 1W2KH 1HBTH 2V0BA 1SR5C 2BDBA 3M37A 4A5TS 2F9NA 4Y7AA 1O5GH 1LO6A 2QC2A 4BTTB 4AN7A 1MTUA 5L30H 3GYLB 1MTVA 4GCHF 2QF0A 1HJ8A 5FHTA 1J15A 5LGOA 1N6YA 3SNEA 1PQAA 1D6WA 2QF3A 3RXPA 1GHZA 1GMHF 1LKBA 2CHAC 2GD4B 4NA7A 1S84A 2V3HH 4ABAA 1ZYOA 4UFGH 5E2OA 4WMFA 2A5KA 2AEIH 4MPXA 1C5ZB 1QJ6B 4QT8C 1CT2E 2OD3B 1EUFA 3UOUA 3BN9A 1YPKH 5EXMA 1D9IA 1C1PA 3ZZAA 3PROA 1LVMA 1VCWA 4CBOA 2PHBA 2ZPRA 1NRSH 2FX6A 1MCTA 2ANMH 3PMJA 3DFJA 1GBAA 3FVFB 4MDSA 1LHEH 3H7TA 1FN6A 1IQEA 1JOUB 1C5OH 1AWFH 1IQJA 4AOQA 3LH1A 1C5VA 5A0AE 3IITA 1ABJH 3RXRA 3C1KA 1FNIA 2XNIA 3S0NA 1BT7A 4B73A 1O3BA 2XWAA 1MQ6A 1C5UA 3BTEE 3SUFA 1YYY1 3CENA 1V2KT 1AO5A 2IN2A 2OBQA 1Y5UT 2W5EA 5GCHG 2FI5E 3VGCC 1SMFE 1V3XA 1DY8A 3M36A 3TH3H 2WPLS 1F7ZA 1GJ7B 1ZMLA 2K1QA 4WH8A 1GDQA 1GI2A 1GI0A 4I33A 1LTOA 2J92A 4X2VA 1B5GH 3PMAB 4A1VA 1V2MT 1TMBH 1OX1A 1ELBA 2R9PA 1FV9A 1ETTH 2P94A 2B7DH 3JZ2B 3OYPA 3MH4A 4R8TB 2THFB 1LPKB 1PYTC 7KMEH 3BV9B 1SFQB 1O3AA 1S82A 3PTBA 3A7ZA 3NCLA 1GI1A 2NWNA 4FU8A 1OSSA 3RMNH 3UUZA 5I46H 1KLIH 1BMLA 3GICB 3ZVCA 1OWJA 1YPMH 1NU7B 3KL6A 3HGPA 4Z0KA 3RMOH 1C5TA 1Y3VA 3TITA 1AFEH 1T8NA 3GYMA 1WBGB 2J34A 1A1RA 1VITG 4MNWA 1UTOA 2AH4X 1EOLA 3BEIB 2CGAA 4NA8A 2WPHS 1CA8B 2GZ8A 1O33A 1OP2A 1DXWA 4NIYA 2IJOB 3R0FA 3UQVA 1GBFA 2RDLA 1V2JT 3VPKA 5DO4H 3GY5A 3EDXB 3TIUA 2A4RA 3QX5H 3DHKH 1EZUC 3MWIU 2BD3A 3SGBE 1DICA 5DG6A 1BHXB 1XXFA 2TPIZ 4Q80A 1WSSH 3STIA 1SHYA 2G55A 4O03A 2BYAX 5A8XA 1FONA 4Y11E 1V2TT 2ZG0H 1AB9B 5I25A 5DGJA 4XSKU 2J9NA 1B0FA 2Z3DA 2JH6D 3DT0H 1HJ9A 1KXCA 4ZKSU 1UK2A 4WXVA 4ABFA 2A5IA 2F3CE 2ZECA 1TYNA 3SGQE 3LH3A 5GJ4B 1HAPH 1BTHH 1QL9A 1T8LA 2OTVA 2R2MB 3M5OA 3BTME 3BIVH 3K6ZA 1A0JA 2BQWB 1LHCH 4X8VH 1T4VH 1SOTA 1A0HB 1S83A 2IOTA 2O8LA 1CHOG 4JMYA 3TGKE 4ABIA 2BDIA 1WTHD 1O3KA 1JIRA 5GCHF 4Q7YA 1TX7A 5HXFA 1K1MA 2UUFB 1C1NA 1FIWA 1OWIA 2NU2E 2BDCA 1FPHH 4R0IA 1E0FD 5EGMA 1GCDA 4WMEA 3RMLH 1CVWH 4CRDA 2XC4A 1YP9A 1NTPA 3ATIA 1SGTA 2AGIX 3RXVA 1IQNA 1MTWA 4Y10E 4ZROA 4J2YB 5G4BA 1JIMA 1Y5BT 2LNCA 3UNSA 3S9BA 1FY1A 1GBMA 4Z6AH 1EQ9A 1TNIA 2R3YA 1EAXA 1AIXH 2BVXH 3UNQA 1EXFA 6LPRA 4K5ZA 1P10A 4ZH8A 1YPHC 2ZFPH 1ELFA 1KLJH 3RXFA 2ZFQH 4MVNA 1E37B 3A80A 3PYHA 1CGJE 1ZPBA 1GJBB 1VITF 1X7AC 1PQ5A 1TFXA 1ELGA 1WQVH 2GCHG 1O3JA 2ZFRH 1NESE 3SUEA 1MTNC 4CRFA 1P9SA 1NU9A 3NK8A 3A88A 7GCHG 1PPFE 1GI6A 2O8WA 3A7WA 4YESB 1O2LA 2Y5GA 3SU5A 2A32A 3E6PH 1E38B 1CHGA 4MNVA 4MQAA 2Y81A 2A7CA 2OCVB 3QGNB 3MNBA 2XTTB 4CH2B 5F6MA 2J4IA 1KXDA 2D1JA 4ABGA 2WV5A 1RRKA 1GDNA 1FMGA 3ZZ6A 1LHGH 3MO6A 2BDHA 5EXNA 5DKMA 5TCAA 1AU8A 1A0LA 2FOAA 1OYQA 2HPPH 1C2KA 1GG6B 3LJOA 1VZQH 2PW8H 2BY5X 4KTSA 1GJ6A 1TMUH 2PKSC 4IC6A 3FAOA 4ZKRU 2AMPA 1C2JA 4ZXXH 1BIOA 2ANYA 1O36A 2VIDA 1C5LH 2FPZA 3EA9A 2ZA5A 1P11E 3QZQA 2FP7B 2ZHEH 4WF8A 4BNRA 3SV9A 2GMTC 4NIXA 4I8JA 3ZVEA 3NWUA 2FM2A 1NS3A 2CN0H 3TJUA 2BD8A 1EPTB 3UR6A 4I8GA 2ZZUH 3E0PB 2BXTH 1MH0A 3A7YA 5FPYA 3BEFB 3RXUA 1ARBA 1HAGE 1O2GH 1Z1IA 3U8RH 1DXPA 1GGDB 4Y79A 2ZFSA 3ATMA 3B23B 4A1XA 1UCYE 4GHTA 2GDDA 1WAYB 2VB0A 4Y71A 1AI8H 3KQCA 1EPTA 1DITH 1H8DH 3RM2H 4MLFB 1EAWA 4HTCH 1O30A 3U8OH 1G37A 1YLCA 1THSH 1DANH 4X6MA 2JH0D 1GJDB 1Y3YA 2SGDE 4U2WA 4WJG2 1O2NA 3A7VA 3LGUA 4BXSA 1P12E 2P8OC 4IGDA 3RXAA 2STBE 2TIOA 3GY2A 5ABWA 1WV7H 2GTBA 1XXDA 2Z9KA 1UTNA 2GCHF 2VU8E 1FQ3A 4INHA 5A2MH 1O38A 1D4PB 4CRGA 4NCYA 4X0WU 1Q31A 4ISOA 2CJIA 1QL8A 7GCHF 3KNXA 3ZVAA 4UD9H 4FUIA 1SGEE 2FOFA 2J94A 1EZQA 2EA3A 1VGCB 1E34B 2C8YB 1C5QA 2C8ZB 4FUCA 5ETXA 1QB1A 1SBWA 5DK1A 1KXFA 1YC0A 2EEKA 3RXJA 1K1PA 1V2PT 4U01A 2EI6A 5CHAB 1LQEA 1HAOH 1AGJA 5AHGH 1GHXH 2O8UA 4GSOA 2F9VA 4IMZA 2ASUB 3RXTA 1GHAG 4BAKB 2ZHDA 1L4ZA 1UVOA 2BX4A 1HB0B 3F9EA 2AIQA 2C93B 3CP7A 5C67A 1AVWA 4D8NA 2ZI2H 1N8OC 4YOIA 2QA9E 1K28D 3M5LA 1O3CA 5A0BA 1TB6H 1O3GA 1OOKB 4ABDA 2HLCA 4I8KA 3RXGA 1BTYA 1LHDH 1SLUB 4WVPE 1Z8RA 1P04A 2O8TA 5PTPA 2QN5T 2A2QH 2GV6A 1P2QA 2SFAA 4WY3A 1T7CA 2Y7XA 2Z6BD 4A6LA 1TLDA 1K9OE 1MU6B 1SVPA 1PPGE 3R3GB 4GCHG 2M5TA 1SGCA 5F8TA 3NUMA 4K8YA 1GI5A 1BA8B 5LPEA 1DOJA 1DT2A 1L0ZA 1GMHG 1ANCA 2I6QA 4TPIZ 4ZHMU 3P6ZB 3ZV8A 1YPHE 5IDKA 1LPGB 1MKWH 1GI8B 3PMHB 1GI4A 2QXHA 4ZAEA 1NFUA 2DE9A 2ZU3A 4JYVH 3RXLA 1RD3B 1CBWB 1GBJA 1C4Y2 2QXIA 2OXSA 3UOPA 3ZVGA 4LOYH 5GDSH 3EAJA 2ZF0H 3MTYA 3AASA 3ZVFA 1O2TA 3MOCA 3RLYH 3D23A 4CR5A 1HJAB 1HXEH 1N1LA 2FESH 1L4DA 1O2WA 8KME2 3RP2A 1FI8A 2VWLA 2ZIQH 1YCPH 1H4WA 1QRWA 1GI9B 2ZTZA 1PQ8A 1RXPA 1MKWK 1DSUA 3GY7A 4TY6A 4F4OC 3AW1A 2OLGA 1NT1A 3RXKA 1WU1A 1FAXA 3GISB 1P3EA 3UPEA 5E2PA 3SI3H 1E36B 1A5IA 2ZWLH 2ZGBH 1GHAF 1OS8A 1RIWC 2DUCA 1OWDA 2QYIA 2FOMB 1C1VH 3A7XA 1TGSZ 1OWHA 2D26C 2VH6A 1YCPK 4X1SU 4B2CA 1NM6A 3A87A 1AZ8A 3LC5A 3UTUH 5B6OA 2OC7A 1O34A 8LPRA 5F8ZA 3A83A 1HAXB 3BTQE 3AAUA 3MYWA 2ZTYA 1HYLA 1F0RA 3ZZ7A 1FPCH 1XUFA 1THPB 1C5YB 1GPZA 3S9AA 1QQ4A 1VGCC 1NROH 3H7OA 4AFZA 2Y82A 2EI8A 2SGQE 2ZCLP 1ANDA 1TAWA 1KTTB 3Q00A 2RG3A 1IQKA 2BD7A 1QB9A 4Q7XA 4MTBA 5C20A 3KQDA 5FAHA 1CO7E 2OC1A 2ZEBA 1QQUA 3QWCH 2G4TA 3SNDA 1TA2A 3T5FH 2PTCE 3PTNA 1BMAA 5HM9A 4HGCA 3O8CA 1A5GH 1TPAE 4DVAU 1GJ5H 1P02A 1EAIA 1TBZH 1ZLRA 5DP6A 3RXQA 3UY9A 3UWIA 3B8JA 2VVVA 3L3TA 4LXBH 1O0DH 1INCA 3E16B 3AW0A 4JZEH 1KXAA 3SV8A 4NZQA 1DFPA 4JZDH 2AMQA 4NA9H 2FOCA 1SQAA 2H9EH 3A84A 1GHYH 2UWPA 1WTGH 4AGKA 4GAWA 3O8RA 4ZMAH 5ESTE 3FP8E 4A1TA 1AKSA 1UTLM 1W12U 1TRNA 1NRRH 6GCHG 1C9TA 3STJA 2V35A 4IBLH 4YOGA 3RXMA 3T2NA 1PPHE 2O8MA 2YOLA 1T8MA 1AFQB 3A85A 4MG3A 2ZDLA 1QURH 2ZDMA 5C5OA 1TNJA 2OQ5A 4FVBA 3OY5U 3EA7A 1BJVA 1O39A 3P95A 5JBBS 3M5MA 2ZQ1A 4I8HA 4UEHH 1Z8JB 1BTPA 1P06A 1CA0B 1M9UA 3RXDA 2D2DA 1K1IA 1NO9H 2AFQB 5C1XA 2XBWA 4O9VA 3ODFA 2GP9B 2ILNA 1NFYA 2STAE 1V2LT 1QTFA 1BUIA 3O8DA 4MPWA 3URDA 1C5MD 1MAYA 1W13U 1Y3XA 3T25A 5FPTA 2FODA 1HJAC 1EX3A 2ANWA 3A81A 2C4FH 1RTFB 4RKOB 5JB9S 4AB9A 1J8AA 1SB1H 5EPNA 4OS6A 1SG8B 4X2YA 7LPRA 2ZPSA 2EI7A 1SGYE 3TU7H 2ZU2A 1O5FH 1QB6A 3PM3A 4AYVB 3BF6H 1UO6A 4WMDA 2BD9A 1MAXA 2VGCC 1O3NA 1HIAA 1KXBA 3EA8A 2BHGA 3S9CA 2PTNA 1MBQA 1YPEH 2ZKSA 1G30B 1ZRKA 4HFPB 1ORFA 4IS5A 1C4U2 2VVUA 1S0QA 3EQ0H 1F92A 5EOKA 7ESTE 3SJ8A 1EOJA 3SUDA 1JRTA 3TLOA 3HKJB 4I32A 2ZTXA 4VGCB 3GY3A 3GCHB 1WOFA 3Q76A 3SU0A 2FLBH 3FANA 3LONA 2ZFTA 1G32B 1DDJA 1WQSA 1VR1H 1GBDA 5GPIB 3ZZ4A 1SGNE 1FDPA 1OWKA 3MI4A 2Z9JA 2HNTF 2GKVE 4GPGA 1P2IA 3V3MA 1UK4A 1O3FA 3UWJH 3P8FA 1UTQA 5FXLA 2B5TB 1ZSJA 3M7TA 3MH5A 1GL1A 3SNBA 5DP5A 4YT7H 4YLQH 2CF8H 1G3BA 3SHCH 3I29A 1EJNA 2A2XH 3F68H 2BD2A 3VB5A 4BAMB 3QDZB 1PPEE 6GCHF 1G2LA 1G2MA 1C2IA 3ATLA 1BTZA 1GHWH 2PKAB 1O2HA 3AVZA 1BDAA 2P95A 4AFSA 1HLTH 1J9CH 1DSTA 3RMMH 1HPGA 5EW1H 1ZPCA 2BDAA 3B9FH 2ZDAH 3A8DA 3A86A 2FOBA 3OY6U 1MZDA 2PKAA 4E7NA 1BZXE 4WWYA 3RXBA 2A45B 4KTCA 2NU0E 1P0SH 1O3OA 1H1BA 1J16A 3V7TA 3TH4H 1C2EA 1FXYA 2JKHA 2B9LA 3MH7A 2WUBA 2Y5FA 1YPGH 2WINI 1K22H 1ZR0A 5A0CA 4BTUB 2BVRH 4OGYA 3RXHA 3MNCA 2ZGHA 2H1UA 1TRYA 1UJ1A 4H6SB 1OXGA 3P8NA 1GHBG 2JETB 2CMYA 1A5HA 2QY0B 3PWCA 3TK9A 4SGAE 2UUKB 1DWCH 3U69H 1CT0E 1EJAA 2XRCA 5JDUB 1ARCA 1C5RA 1ZPZA 2ZPQA 3MU1A 1HAVB 1O2KA 1XUIA 4NFFA 1T8OA 3VB6A 5LH8A 1CA0C 2F9UA 4NSVA 4Y0ZE 1SLWB 3ZV9A 1O2RA 2D8WA 1O2SA 1K1NA 2FIRH 1SGFA 1C1UH 1EASA 4OS4A 5J4QA 1QBNA 2J38A 1TGTA 2W3KA 2H9TH 2XC5A 2P3TB 4X1QU 1YGCH 1BTUA 2Z3EA 3IWMA 2ZQ2A 1WCZA 2C8WB 1A46H 2PFEA 2R2WU 1O3DA 2VVCA 1P01A 1HAVA 1LPZB 1CSOE 1O2PA 2R0LA 3CS7A 3SGAE 2FO9A 2BDGA 1C2FA 3E90B 1HV7A 1FIZA 3ENSB 4CRAA 4E06H 2WYGA 3UQOA 2W7SA 1TBRH 2TGAA 3GY4A 5JYIA 2W7UA 1G9IE 1ZTJA 1GJ4H 3P8OA 4AFUA 1DUEA 4X8SH 4PROA 1OYTH 1K1JA 3A8AA 5JPMH 2ZHWH 1GJ8B 3RUOA 4RKJB 4D9QA 1A7SA 4X2XA 3V12A 2FS9A 3SU3A 1RGQA 2KAIB 5E8EH 1XUJA 1ESTA 5SGAE 1MD7A 3FP6E 3ZYDA 1C5WB 2NU3E 1MBMA 2ZU4A 1TRMA 3HGNA 4Y8ZA 1THRH 4Y6DA 3RU4T 1MTSA 3BG8A 4YZUA 2J95A 1O5CB 3SU6A 4WXIA 4ZKNU 3GCTG 2HALA 1ELEE 2KAIA 6CHAB 3OU0A 2BD5A 2A7HA 2TRMA 3U9AH 1W7GH 4B76A 4H42U 4K1SA 3SV2H 5LPRA 3QUMP 1IHTH 3SU4A 2Z3CA 4FU7A 3I78A 3RU4E 3TJNA 2ZU5A 4CBNA 1KXEA 1C2DA 1YPLH 2HNTE 2ZDKA 4XFQA 4IN2A 3RC4A 4ABJA 1W10U 4AORA 1HNEE 1EB1H 2FLRH 5GXPA 1KY9A 1AWHB 2Y5HA 1TA6A 4TYDA 1AY6H 2OC0A 1T31A 4TWWA 1TGNA 1FY5A 1ESAA 3BTWE 4ASHA 2F9BH 1TX6A 1AB9C 1GJAB 1LHFH 4JK5A 1SGFG 2EC9H 1GHBF 1XUKA 1O2MA 4IC5A 1ELCA 2BY8X 4DIIH 3QLPH 4K1TA 2QIQA 2XCNA 3ZVBA 1C1WH 4CHAB 4JZIA 1FY8E 2FDAA 5C2ZA 1SI5H 1HCGA 4A92A 2WPJS 4UE7H 1HAYB 1K1OA 1PPBH 2ZFFH 3BTKE 4MNXA 3A7TA 5FCRA 2XXLA 1GVZA 1VJAU 3SHAH 4INLA 4INKA 1UTKA 1NZQH 4YM9A 1NPMA 4B2BA 2GCTB 4DIHH 1NRQH 1ABIH 1F0TA 2BM2A 2G8TA 1XKAC 1BBRE 4JZ1A 1A2CH 5DP4A 3MU4A 1AQ7A 1CE5A 3BTFE 3SJKA 2Z9LA 1ANEA 1B0EA 2CF9H 3SOSA 3QO6A 2V6NA 4LK4A 3BTDE 1LCYA 4JZFH 3T62A 1UCYH 1G36A 2XBVA 1P05A 2VWMA 5EPYA 1D6RA 1BQYA 3ODDA 1JRSA 1O3HA 1S5SA 4FUFA 1F5KU 2NU4E 4XDEA 2FYRA 2ZGCA 1IOEA 4CR9A 1QR3E
chains in the Genus database with same CATH superfamily
4D7FA 3GY8A 3ITIA 4YLUA 5FCKA 3HPTB 2SGAA 5EG4A 1Y59T 5T3HA 1P9UA 1JWTA 3GCTF 1TPSA 2WPDD 2XBYA 9LPRA 2FTLE 5T1VA 2FYQA 3SQEE 3LJJA 1H9HE 5LPFA 3QN7A 3G01A 1P2NA 1QRZA 1UCYK 2OBOA 2FOEA 1O3LA 3UNRA 1O2OA 1UTMA 3KF2A 4NG9H 4MNYA 2GJGA 3BG4B 1ZSKA 3M3TA 2LPRA 2LP6A 1GJCB 3MMGA 1UTPA 1GBTA 2ZDNA 1TPOA 3VFEA 1AVGH 1V2WT 4AC9A 1GBBA 1ZOMA 2VNTA 5C3NA 4Y76A 1TOMH 3NZIA 2XW9A 1W7XH 1WDIA 1FY4A 4XBBA 4ISLA 2H9HA 1C5SA 1UHBB 2OUAA 1U6QA 2ZO3H 4Y0YE 5HYOA 2VINA 4ABEA 5JB8S 2P16A 4U30A 3TK6A 1CQQA 1QA7A 2BY9X 1JMOH 1VITH 3BTHE 1OKXA 2BD4A 1BRCE 1K21H 3P70B 3OX7U 2PLXA 2QCYA 1P8VC 2A1DB 4I86A 1UHBA 3RXSA 1QRXA 1GG6C 1DWBH 4AFQA 4CREA 1L1GA 4NWLA 3QTVH 1Y8TA 4UFFH 1TWXB 2VH0A 2AERH 1SLXB 5K7RA 4AB8A 3LIWA 5EW2H 3E8LA 2SNWA 1UVSH 3CS0A 2VWNA 2UUJB 5E0HA 2JIZD 2V7QD 1EPTC 4HI3A 4NIWA 4RSPA 5EQSA 1A3BH 3FZZA 5HGGA 2F91A 2HVXA 4X6NA 4Y8XA 1TE0A 3VXEH 3QTOH 5K0HA 2WUCA 1YWUA 1GGDC 2BQ6B 1EZSC 4FU9A 2BXUH 3HK3B 2BX3A 5F03A 5F8XA 1TPPA 2BVSH 3VGCB 1ELVA 1PYTD 3Q3KA 2ZGJA 3F2HA 3GCNA 5IYTA 4OS5A 4YOJA 2BOHB 9ESTA 2KFWA 1PJPA 3GDUA 4KELA 1PFXC 1O2JA 1ZSLA 2CV3A 4UDWH 2W26A 2GCTC 1O31A 2ZHFH 3TPIZ 3UR9A 3PRDA 4ZKOU 1GI7B 2BQ7B 3RDZA 1Y5AT 1RTKA 3U1JB 1DE7H 5C5NA 3FOAA 4X1RU 1AE8H 1TQ7B 1LVYA 2V3MA 3TNSA 1EJMA 2AS9A 1LMWB 3OTPA 1GI3A 5AF9H 1TGBA 5DP7A 1TIOA 3ZZ9A 2G4UA 2GT8A 4K8BA 5L2YH 1XVMA 1HRTH 2C90B 3RC5A 3L33A 5CDFE 1IHSH 2ZP0H 1GBCA 1AUJA 2AMDA 1WYKA 1QBVH 1QHRB 5A8ZA 2FOHA 3U28C 1ZGVA 1Z6EA 3ELAH 1Z8GA 4O3UA 1C1SA 2GVFA 1O5EH 4X6PA 5L6NH 1O2VA 1EP6A 5IK2D 4I31A 1SOZA 2ALVA 5CHAC 3E3TA 3PWBA 4ZHAA 1ESBA 3I77A 3LPRA 1L1NA 4YO9A 1UVPA 3WW7A 3PLBA 4JYUH 1F0SA 3DFLA 5DN6D 2VJ1A 3ZZ5A 3NXPA 4O97A 1YPJH 1P57B 2ZCKP 5HKKD 1BB0B 3K9XB 1LVOA 2RA0A 3K2UA 1Q3XA 1VCPA 1AKSB 1H8IH 1BRUP 3BG4C 4X8TH 2JH5D 4FUJA 4FVDA 4NWKA 2C3SA 1V6DA 2KCPA 2A31A 2ZGXH 4XBCA 3OE7D 1GCTB 1GJ9B 1UK3A 3EYDA 3OFND 1V2QT 1F0UA 3F6UH 3KQ5A 1UTJA 3RXOA 1S6LA 1ZTLA 2AYWA 4BAQB 1QIXB 2P59A 5EODA 2OC8A 4FUBA 1BRBE 1LKAA 1MU8B 2GT7A 2Q6DA 2QAAA 1MKXH 4H4FA 5DP8A 2A4GA 1NBME 2VIVA 5HIZA 2H5DA 3FKSD 4OS7A 4THNH 2XOKD 3PV4A 2VIQA 1DY9A 3GDVA 3LKWA 1AHTH 1EZXC 1ACBE 1ZRBA 1SGDE 1GBHA 2F9PA 3NRLA 2F4LA 2P3UB 3VXFH 3UIRA 1Y3WA 1GMCF 1TNHA 3VB3A 1ETRH 3SJ9A 1C5NH 2YNBA 3KQBA 4B2AA 2F9OA 1CBWC 4BXWA 2ALPA 1GMDG 1TNKA 4E05H 2SGPE 3D49H 2HNTC 1KDQB 1TONA 2BZ6H 4FUHA 3U1IB 1ELTA 1C1MA 1MABB 4FXGH 4CH8B 5A8YA 2FWWA 3GOVB 1AZZA 3VEQB 5E0GA 4OS1A 1MKXK 2KR7A 4KGAA 3PMBB 1ZTKA 1FAKH 2VWOA 1HIAB 3A89A 4BAHB 4DT4A 2Q1JA 2C8XB 2HRVA 1TQ0B 3UFAA 1HAHH 3NKKA 1TNGA 3BEUA 1KDQA 3T26A 1BTWA 3P92A 1KSNA 2ODYB 2Z7FE 2P93A 3TJVA 2Z94A 4BANB 3BTGE 1W0YH 1W11U 1QL7A 5CE1A 1D3DB 4NSYA 1CGIE 2GX4A 4X1PU 4X1NU 4A7IB 1FN8A 2BLWA 1NFWA 1GBEA 1TOCB 2G5VA 2H5CA 1MTNB 4KP0A 4JK6A 3SI4H 1F2SE 1P2KA 5L2ZH 1SL3A 1FLEE 3N7OA 1KMHB 1MZAA 4X8UH 1K1LA 1HAZB 1P3CA 3FZDA 4JYTA 3FP7E 4AZ2B 3SUGA 4Q2KA 1T4UH 1W0ZU 5AFYH 1DLEA 4D7GA 3ZZCA 2UWLA 1C2LA 1TALA 1CGHA 1O2YA 2ZU1A 1HGTH 4K2YA 1J17T 4DGJA 3KQEA 4DG4A 3KCGH 3M3VA 3LGWA 4K60A 2XC0A 3TNTA 5EQRA 4XBDA 1VCQA 1V2ST 1OWEA 3SU1A 2PR3A 2SGFE 5FPSA 4O3TA 5JBCS 1WUNH 3SN8A 4D9RA 2PKSB 1F5LA 1QGFA 1C5PA 1V2VT 4MPVA 2J2UA 1PPZA 2R0KA 2ZCHP 1NN6A 2TGPZ 1FUJA 1O3IA 2ZC9H 4AX9H 3DCLA 3E1XB 5KGOA 1EATA 1C2HA 2QF5A 3S7KB 2GMTB 3TGIE 1FZZA 5AVDA 5C1YA 3MU5A 1H8HD 8ESTE 2OP9A 5JBAS 3SJIA 1C1RA 3P17H 1XMNB 1BMNH 1D3PB 4F49A 4CRCA 2FI3E 3EGKH 4ZHLU 1ZHMA 1GMDF 1YBWA 1IQMA 1C1QA 3SZNA 1GCTC 4GLYA 1Y3UA 2PGQB 1AMHA 1BOQA 5FX6A 2BOKA 2BY6X 2AIPA 2G52A 2GZ9A 1GL0E 2IPHA 1E1QD 2ODPA 3TH2H 1KIGH 1XM1A 1J14A 1P2OA 5T6DA 1IQHA 4Y8YA 1AFQC 4FUEA 2G00A 4X2WA 4NZLA 4Z1MD 3M61U 3WWFA 3C27B 2P8OB 4YT6H 1S0RA 2YMSB 4K3JA 2HPQH 1LQDB 4B75A 2PUQH 4ABBA 4FOUC 1ANBA 5T6GA 4TWYA 1E35B 3T28A 1YLDA 1JXPA 2AGGX 1HFDA 2ESTE 3D62A 2ZNKH 2BLOA 4DY7B 5TCCA 2QGRA 3MFJA 1DM4B 1GVKB 3RM0H 2BMGB 3PO1B 1AUTC 5CMXH 2FX4A 1EAUA 1PPCE 2FI4E 3GDSA 3SJOA 4GHQA 1O37A 1ID5H 3M7UA 3SBKA 2WV4A 4ZUHA 3OEED 2BY7X 4P00A 1DS2E 1TX8A 2A0QB 2G51A 1BCUH 1C5XB 2Y6TA 4D76A 2W3IA 4E7RG 1GDUA 2Y7ZA 3PB1E 1ZGIA 3Q3XA 3MNSA 3T27A 3RC6A 5A09A 2XWBI 1GBKA 1TBQH 3BSQA 3KIDU 2RCEA 3LGIA 1Z8IB 4X6OA 2PGBB 5DP3A 1S6HA 1O5BB 2FTMA 1HUTH 1EB2A 1Q2WA 3ATWA 3VB4A 1C2GA 1JBUH 1N8OB 2XNDD 3KN2A 3UREA 4KTUA 2GDEH 4HZHA 4KKDA 2FOGA 1C4V2 1FJSA 1O2XA 3QK1A 5FX5A 2P3FH 4VGCC 1ZZZA 1SLVB 4JCNA 1V2UT 2FEQH 3GCHC 2SGEE 1UVUH 3E91A 3TJOA 1D3QB 1C9PA 1TABE 1EP5A 1NRPH 1KLTA 4I7YH 1DVAH 3LU9B 1GBIA 2PSXA 4GVUA 4ZCNA 3ZZ8A 2PV9B 2WPMS 1SSXA 4XOJA 2EQNA 3O8BA 1Z71A 4AG1A 1HDTH 1XX9A 3W95A 4DURA 4LZ4B 2QXGA 3MNXA 1DWEH 1QFKH 3KYFA 3K6YA 4DJZB 1E1RD 2FS8A 1RFNA 4B71A 3MO9A 4UFEH 1NRNH 4ISHH 2VIWA 4FUGA 3RXIA 1G3CA 3DSPA 2PWXA 1CHOF 2CXVA 1AN1E 4I8LA 1ZMJA 5C1UA 2XYAA 2VIPA 1O2IA 1GWAA 3F9FA 1AD8H 4ABHA 3BIUH 3LGYA 3ZYEA 3PLPA 1A61H 2BTCE 2ULLA 3HATH 3QGJA 5ESBA 1EKBB 3F9GA 1IQIA 3GCOA 4CRBA 1L2EA 1EFRD 1BRAA 2G81E 1O3MA 2I6SA 1ETSH 2L74A 4ISIH 2BZAA 2OQUA 2GZ7A 4K1EA 2Y80A 1YF4A 3NPSA 3IG6B 4UONA 1BMMH 3SO3A 3DUXH 3FO8D 1LVBA 1V2RT 2ZHQH 8GCHG 3BTTE 3SW2B 1HXFH 1DPOA 2XCFA 5EU8A 1YY3A 3L6PA 1O2UA 1QCPA 1N6XA 3KGPA 2PSYA 3VB7A 1XUHA 4H6TA 3S7HB 1TNLA 2ODQA 3M3SA 3F9HA 2WPIS 1OPHB 2JETC 3A8BA 2Q6FA 1T32A 1Z6JH 5C0UA 3ZVDA 3WY8A 3ZZ3A 1IQGA 3EE0B 2YMSC 1DLKB 1RIWB 5GWZA 3H5CB 4IMQA 1A4WH 3QZRA 2VBCA 3U8TH 3DD2H 3FFGA 1GBLA 3OSYA 2A7JA 2EY4C 2JJ2D 1YKTA 2RDEA 3SV7A 1BBRH 1ZHPA 1BHXF 3PO1C 3ATKA 4MPUA 3SORA 3RXCA 3TGJE 5JBTA 3JZ1B 2ZDVH 4B74A 4SGBE 1XKBC 1XUGA 1LDTT 2HLDD 3W94A 4U32A 1O5DH 4RN6A 4GUXA 1QY6A 1ELDE 2FMJA 3D65E 3UB0A 2B0FA 2FXRA 3KHVA 2HWLB 1ZMNA 5DP9A 2Z9IA 2KM0A 3LC3A 3LOXA 4NFEA 2DE8A 5H4IB 2WPKS 2RA3A 3V13A 3SQHE 1FY3A 4BTIB 3LGVA 5FBEA 1W3CA 3OTJE 1ZJDA 4NGAH 1BMFD 2A4OA 1S81A 3A82A 4UFDH 1BBRK 5AFZH 2CHAB 4AGJA 5T6FA 5BRRE 1QJ1B 1AVXA 2A5AA 1QJ7B 2BLQA 1RJXB 1TGCA 2A4QA 2F43B 1QBOA 1UMAH 1SGIB 2TGDA 5BPEA 4ESTE 5EQQA 2H6MA 1KTSB 3ZIAD 2YNAA 4BOHA 1VJ9U 3RLWH 3RXEA 4ZXYH 2BDYA 2R3UA 2V3OH 1D3TB 1SC8U 4Q7ZA 5DPAA 5TJXA 3PLKA 1O32A 1GVLA 3MH6A 1PQ7A 2J98B 6CHAC 1H9IE 3TVJB 1CT4E 2AGEX 2H2ZA 1SFIA 3MHWU 5FBIA 1SHHB 1F5RA 4AG2A 3U98H 1V2OT 1O35A 4WH6A 2F83A 3SNAA 1SGPE 3T29A 4NIVA 3RU4D 8GCHF 2UWOA 1SGRE 1O5AB 3AAVA 4Y7BA 2J98A 2K8IA 1BJUA 3E0NB 4DCDA 1CU1A 6ESTA 2HOBA 2BLVA 1G3DA 4ISNA 5B6LA 4OGXA 1O2QA 2TGTA 3MU0A 3F0OA 1ZHRA 2OINA 3ZZBA 2ANKH 2GV7A 5CHBA 1MD8A 2NU1E 4IW4E 2UUYA 1DWDH 3M7QA 2TBSA 3HKIB 3K65B 2FZZA 5J4SA 2WZQA 1P2JA 1SQOA 3LGTA 1TMTH 1P2MA 2GGVB 4DW2U 1SKYE 3DA9B 4CHAC 3LDXH 1W14U 3TK5A 1QNJA 1OP8A 1MQ5A 1NFXA 1ZJKA 5GIBA 1P03A 4B1TA 2SNVA 3CNRA 3ZZDA 3KEEA 1MUEB 1S85A 1KYNA 1DX5M 2XBXA 1UVTH 3URCA 1A3EH 1BITA 4LZ1H 4BAOB 4J1YA 3LT3A 1ELAA 1C2MA 1HAIH 1GMCG 4TY7A 1RS0A 4M7GA 3SV6A 1O3EA 2B8OH 4DOQA 1YCPM 2IJD1 2WYJA 4TPYA 1YM0A 1B7XB 2O9QA 2PUXB 2QV1A 3Q77A 1MCVA 3M35A 5EXLA 2VGCB 3F1SB 1S6FA 4TSFD 1SGQE 4K69A 1SQTA 1O3PB 3ESTA 1IQLA 1RTLA 3GY6A 1XVOA 1IQFA 5DJ7A 1AE5A 1V2NT 1MMJN 2BB4A 4IN1A 1QA0A 2QXJA 1L1JA 1SPJA 3S69A 5E0JA 1Z7KA 2AHME 3A8CA 3SNCA 1K2I1 4OS2A 1C1OA 1P09A 4B6EA 3MU8A 5HM2A 1OP0A 1H9LB 2G5NA 1DUAA 4XE4A 4DT7B 3P8GA 3M5NA 4AYYB 5EJZA 1G3EA 3SU2A 1C1TA 1GHVH 1BTXA 4YTAA 1W8BH 3V0XA 2Z9GA 2HGTH 1Z1JA 2Q6GA 3HK6B 1NY22 1IAUA 2VIOA 4RI0A 5HMAA 3MO3A 1NC6A 4FUDA 3Q3YA 1O2ZA 1W2KH 1HBTH 2V0BA 1SR5C 2BDBA 3M37A 4A5TS 2L6OA 2F9NA 2IPQX 4Y7AA 1O5GH 5EJ1A 1LO6A 2QC2A 4BTTB 4AN7A 1MTUA 5L30H 3GYLB 1MTVA 4GCHF 3OEHD 2QF0A 1HJ8A 5FHTA 1J15A 5LGOA 1N6YA 3SNEA 1PQAA 1D6WA 2QF3A 3RXPA 1GHZA 1GMHF 1LKBA 2CHAC 2GD4B 4NA7A 1S84A 2V3HH 4ABAA 1ZYOA 4UFGH 5E2OA 4WMFA 2A5KA 2AEIH 4MPXA 1C5ZB 1QJ6B 4QT8C 1CT2E 2OD3B 5KEDA 1EUFA 3UOUA 3BN9A 1YPKH 5EXMA 1D9IA 1C1PA 3ZZAA 3PROA 1LVMA 1VCWA 4FETA 4CBOA 2PHBA 2ZPRA 1NRSH 2FX6A 1MCTA 2ANMH 3PMJA 3DFJA 1GBAA 3FVFB 4MDSA 1LHEH 3H7TA 1FN6A 1IQEA 1JOUB 1C5OH 1AWFH 1IQJA 4AOQA 3LH1A 1C5VA 5A0AE 3IITA 1ABJH 3RXRA 3C1KA 1FNIA 2XNIA 3S0NA 1BT7A 4B73A 1O3BA 2XWAA 1MQ6A 1C5UA 3BTEE 3SUFA 1YYY1 3CENA 1V2KT 1AO5A 2IN2A 2OBQA 1Y5UT 2W5EA 4OM9A 5GCHG 2FI5E 3VGCC 1SMFE 1V3XA 1DY8A 3M36A 3TH3H 2WPLS 1F7ZA 1GJ7B 1ZMLA 2K1QA 4WH8A 1GDQA 1GI2A 1GI0A 4I33A 1LTOA 2J92A 4X2VA 1B5GH 3PMAB 4A1VA 1V2MT 1TMBH 1OX1A 1ELBA 2R9PA 1FV9A 1ETTH 2P94A 2B7DH 3JZ2B 3OYPA 3MH4A 4R8TB 2THFB 1LPKB 2J97A 1PYTC 7KMEH 3BV9B 1SFQB 1O3AA 1S82A 3PTBA 4RT0A 3A7ZA 3NCLA 1GI1A 2NWNA 4FU8A 1OSSA 3RMNH 3UUZA 5I46H 1KLIH 1BMLA 3GICB 2KCOA 3ZVCA 1OWJA 1YPMH 1NU7B 3KL6A 3HGPA 4Z0KA 3RMOH 1C5TA 1Y3VA 3TITA 1AFEH 1T8NA 3GYMA 1WBGB 2J34A 1A1RA 1VITG 4MNWA 1UTOA 2AH4X 1EOLA 3BEIB 2CGAA 4NA8A 4P02A 2WPHS 3PV2A 1CA8B 2GZ8A 1O33A 4Q63A 1OP2A 1DXWA 4NIYA 2IJOB 3R0FA 3UQVA 1GBFA 2RDLA 1V2JT 3VPKA 5DO4H 3GY5A 3EDXB 3TIUA 2A4RA 3QX5H 3DHKH 1EZUC 3MWIU 2BD3A 3SGBE 1DICA 5DG6A 1BHXB 1XXFA 2TPIZ 4Q80A 1WSSH 3STIA 1SHYA 2G55A 4O03A 3N99A 2BYAX 5A8XA 1FONA 4Y11E 5FL7D 1V2TT 2ZG0H 1AB9B 5I25A 5DGJA 4XSKU 2J9NA 1B0FA 2Z3DA 2JH6D 3DT0H 1HJ9A 1KXCA 4ZKSU 1UK2A 4WXVA 4ABFA 2A5IA 2F3CE 2ZECA 1TYNA 3SGQE 3LH3A 5GJ4B 1HAPH 1BTHH 3DSGA 1QL9A 1T8LA 2OTVA 2R2MB 3M5OA 3BTME 3BIVH 3K6ZA 1A0JA 2BQWB 1LHCH 4X8VH 1T4VH 1SOTA 1A0HB 1S83A 2IOTA 2O8LA 1CHOG 4JMYA 3TGKE 1FX0B 2BDIA 4ABIA 1WTHD 1O3KA 4HG6A 1JIRA 5GCHF 4Q7YA 1TX7A 5HXFA 3W1EA 1K1MA 2UUFB 1C1NA 1FIWA 1OWIA 2NU2E 2BDCA 1FPHH 4R0IA 1E0FD 5EGMA 1GCDA 4WMEA 2PP6A 3RMLH 1CVWH 2OK5A 4CRDA 2XC4A 1YP9A 1NTPA 3ATIA 1SGTA 2AGIX 3RXVA 1IQNA 1MTWA 4Y10E 4ZROA 4J2YB 5G4BA 1JIMA 1Y5BT 2LNCA 3UNSA 3S9BA 1FY1A 1GBMA 4Z6AH 1EQ9A 1TNIA 2R3YA 1EAXA 1AIXH 2BVXH 3UNQA 4F55A 1EXFA 6LPRA 4K5ZA 1P10A 4ZH8A 1YPHC 2ZFPH 1ELFA 1KLJH 3RXFA 2ZFQH 4MVNA 1E37B 3A80A 3PYHA 1CGJE 1ZPBA 1GJBB 1VITF 1X7AC 1PQ5A 1TFXA 1ELGA 1WQVH 4ACBA 5C17A 2GCHG 1O3JA 2ZFRH 1NESE 3SUEA 1MTNC 4CRFA 1P9SA 1NU9A 3NK8A 3A88A 7GCHG 1PPFE 1GI6A 2O8WA 3A7WA 3VG8A 4TT3D 4YESB 1O2LA 2Y5GA 3SU5A 2A32A 3E6PH 1E38B 1CHGA 4MNVA 4MQAA 2Y81A 2A7CA 2OCVB 3QGNB 3MNBA 2XTTB 4CH2B 5F6MA 2J4IA 4XRNA 1KXDA 2D1JA 3PV5A 4ABGA 2WV5A 1RRKA 1GDNA 1FMGA 3ZZ6A 1LHGH 3MO6A 2BDHA 5EXNA 5DKMA 5F53A 4B6FA 5TCAA 1AU8A 1A0LA 2FOAA 1OYQA 2HPPH 1C2KA 1GG6B 3LJOA 1VZQH 2PW8H 2BY5X 4M9FA 4KTSA 1GJ6A 1TMUH 2PKSC 4IC6A 3FAOA 4ZKRU 2AMPA 1C2JA 4ZXXH 1BIOA 2ANYA 1O36A 2VIDA 1C5LH 2FPZA 3EA9A 2WV9A 2ZA5A 1P11E 3QZQA 2FP7B 2ZHEH 4WF8A 4BNRA 3SV9A 1H8ED 2GMTC 3WWBA 4NIXA 4I8JA 3ZVEA 3NWUA 2FM2A 2W6JD 1NS3A 2CN0H 3TJUA 2BD8A 1EPTB 3UR6A 4I8GA 2ZZUH 3E0PB 5EIYA 2BXTH 1MH0A 3A7YA 5FPYA 3BEFB 3RXUA 1ARBA 1HAGE 1O2GH 1Z1IA 3U8RH 1OHHD 1DXPA 1GGDB 4Y79A 2ZFSA 3ATMA 3B23B 2KZ4A 4A1XA 1UCYE 4GHTA 2GDDA 1WAYB 2VB0A 4Y71A 1AI8H 3KQCA 1EPTA 2WSSD 1DITH 1H8DH 3RM2H 4MLFB 1EAWA 4HTCH 1O30A 3U8OH 1G37A 1YLCA 1THSH 1DANH 4X6MA 2JH0D 1GJDB 1Y3YA 2SGDE 4U2WA 4WJG2 1O2NA 3A7VA 3LGUA 4BXSA 1P12E 2P8OC 4IGDA 3RXAA 2STBE 3F3BA 2TIOA 3GY2A 5ABWA 1WV7H 2GTBA 1XXDA 2Z9KA 1UTNA 2GCHF 2VU8E 1FQ3A 4INHA 5A2MH 1O38A 1D4PB 4CRGA 4NCYA 4X0WU 1Q31A 3EE7A 4ISOA 2CJIA 1QL8A 7GCHF 3KNXA 3ZVAA 4UD9H 4FUIA 1SGEE 2FOFA 2J94A 1EZQA 2EA3A 1VGCB 1E34B 2C8YB 1C5QA 2C8ZB 4FUCA 5ETXA 1QB1A 1SBWA 5DK1A 1KXFA 2JDID 1YC0A 2EEKA 3RXJA 1K1PA 1V2PT 4U01A 2EI6A 5CHAB 1LQEA 1HAOH 1AGJA 5AHGH 1K0HA 1GHXH 2O8UA 4GSOA 2F9VA 4IMZA 2ASUB 3RXTA 1GHAG 4BAKB 2ZHDA 1L4ZA 1UVOA 2BX4A 1HB0B 3F9EA 2AIQA 1E79D 2C93B 3CP7A 5C67A 1AVWA 4D8NA 2ZI2H 1N8OC 4YOIA 4XD7D 2QA9E 1K28D 3M5LA 1O3CA 5A0BA 1TB6H 1O3GA 1OOKB 4ABDA 2HLCA 4I8KA 3RXGA 5EJLA 1BTYA 1LHDH 3F0PA 1SLUB 4WVPE 4Q4LA 1Z8RA 1P04A 2O8TA 5PTPA 2QN5T 2A2QH 2GV6A 1P2QA 2SFAA 4WY3A 1T7CA 2Y7XA 2Z6BD 4A6LA 1TLDA 1K9OE 1MU6B 1SVPA 1PPGE 3R3GB 4GCHG 2M5TA 1SGCA 5F8TA 1W0KD 4RT1A 3NUMA 4K8YA 1GI5A 1BA8B 5LPEA 1DOJA 1DT2A 1L0ZA 1GMHG 1ANCA 2I6QA 4TPIZ 4ZHMU 3P6ZB 3ZV8A 1YPHE 5IDKA 1LPGB 1MKWH 1GI8B 3PMHB 1GI4A 2QXHA 4ZAEA 1NFUA 2DE9A 2ZU3A 4JYVH 3RXLA 1RD3B 1CBWB 1GBJA 1C4Y2 2QXIA 2OXSA 3UOPA 3ZVGA 2M2AA 4LOYH 5GDSH 3EAJA 2ZF0H 3MTYA 3AASA 3ZVFA 1O2TA 3MOCA 3RLYH 3D23A 4CR5A 1HJAB 2KX4A 1HXEH 1N1LA 2FESH 1L4DA 1O2WA 8KME2 3RP2A 1FI8A 2VWLA 2ZIQH 1YCPH 1H4WA 1QRWA 1GI9B 2ZTZA 1PQ8A 1RXPA 1MKWK 1DSUA 3GY7A 4TY6A 4F4OC 3AW1A 2OLGA 1NT1A 3RXKA 1WU1A 1FAXA 3GISB 5HIYA 1P3EA 3UPEA 5E2PA 3SI3H 1E36B 1A5IA 2ZWLH 2ZGBH 1GHAF 1OS8A 1RIWC 2DUCA 1OWDA 2QYIA 1QZ8A 2FOMB 3FN8A 5C0TA 1C1VH 3A7XA 1TGSZ 1OWHA 2D26C 2VH6A 1YCPK 4X1SU 4B2CA 1NM6A 3A87A 1AZ8A 3LC5A 3UTUH 5B6OA 2OC7A 1O34A 8LPRA 5F8ZA 3A83A 1HAXB 1YLNA 3AAUA 3BTQE 3MYWA 2ZTYA 1HYLA 1F0RA 3ZZ7A 1FPCH 1XUFA 1THPB 1C5YB 1GPZA 3S9AA 1QQ4A 1VGCC 1NROH 3H7OA 4AFZA 2Y82A 2EI8A 2SGQE 2ZCLP 1ANDA 1TAWA 1KTTB 3Q00A 2RG3A 1IQKA 2BD7A 1QB9A 4Q7XA 4MTBA 5C20A 3KQDA 5FAHA 1CO7E 2OC1A 2ZEBA 1QQUA 3QWCH 2G4TA 3SNDA 1TA2A 3T5FH 1SQRA 2PTCE 3PTNA 1BMAA 5HM9A 4HGCA 3O8CA 1A5GH 1TPAE 4DVAU 1COWD 1GJ5H 1P02A 1EAIA 1TBZH 1ZLRA 5DP6A 3RXQA 3UY9A 3UWIA 3B8JA 2VVVA 3L3TA 4LXBH 1O0DH 1INCA 3E16B 4ASUD 3AW0A 4JZEH 1KXAA 3SV8A 4NZQA 1DFPA 4JZDH 2AMQA 4NA9H 2FOCA 1SQAA 2H9EH 3N7DA 3A84A 1GHYH 2UWPA 1WTGH 4AGKA 4GAWA 3O8RA 4ZMAH 5ESTE 3FP8E 4A1TA 1AKSA 1UTLM 1W12U 1TRNA 1NRRH 6GCHG 1C9TA 3STJA 2V35A 4IBLH 4YOGA 3RXMA 2QE7D 3T2NA 1PPHE 2O8MA 2YOLA 1T8MA 1AFQB 3A85A 4MG3A 2ZDLA 1QURH 2ZDMA 5C5OA 2JJ1D 1TNJA 2CK3D 2OQ5A 4FVBA 3OY5U 3EA7A 3UAIC 1BJVA 1O39A 3P95A 3H09A 5JBBS 3M5MA 2ZQ1A 4I8HA 4UEHH 1Z8JB 1BTPA 3PRBA 1P06A 1CA0B 1M9UA 3RXDA 2D2DA 1K1IA 1NO9H 2AFQB 3KYGA 5C1XA 2XBWA 4O9VA 3ODFA 2GP9B 2ILNA 1NFYA 2STAE 1V2LT 1QTFA 1BUIA 3O8DA 4MPWA 3URDA 1C5MD 1MAYA 1W13U 1Y3XA 3T25A 5FPTA 2FODA 1HJAC 1EX3A 2ANWA 3A81A 2C4FH 1RTFB 4RKOB 3SZEA 5JB9S 4AB9A 1J8AA 1SB1H 5EPNA 4OS6A 1SG8B 4X2YA 7LPRA 2ZPSA 2EI7A 1SGYE 3TU7H 2ZU2A 1O5FH 1QB6A 3PM3A 4AYVB 3BF6H 1UO6A 4WMDA 2BD9A 1MAXA 2VGCC 1O3NA 1HIAA 1KXBA 3EA8A 2BHGA 3S9CA 2PTNA 1MBQA 1YPEH 2ZKSA 1G30B 1ZRKA 4HFPB 1ORFA 4IS5A 1C4U2 2VVUA 1S0QA 3EQ0H 1F92A 5EOKA 7ESTE 3SJ8A 1EOJA 3SUDA 1JRTA 1VKYA 3TLOA 3HKJB 4I32A 2ZTXA 4VGCB 3GY3A 3GCHB 1WOFA 3Q76A 3SU0A 2FLBH 4F48B 3FANA 3LONA 2ZFTA 1G32B 1DDJA 1WQSA 1VR1H 1GBDA 5GPIB 3ZZ4A 1SGNE 1FDPA 1OWKA 3MI4A 2Z9JA 1UW7A 2HNTF 2GKVE 4GPGA 1P2IA 3V3MA 1UK4A 1O3FA 3UWJH 3P8FA 1UTQA 5FXLA 2B5TB 1ZSJA 3M7TA 3MH5A 1GL1A 3SNBA 5DP5A 4YT7H 4YLQH 2CF8H 1G3BA 3SHCH 3I29A 1EJNA 2A2XH 3F68H 1WXRA 2BD2A 3VB5A 4BAMB 3QDZB 1PPEE 6GCHF 1G2LA 1G2MA 1C2IA 3ATLA 1BTZA 4YXWD 1GHWH 2PKAB 1O2HA 3AVZA 1BDAA 2P95A 4AFSA 1HLTH 1J9CH 1DSTA 3RMMH 1HPGA 5EW1H 1ZPCA 2BDAA 3B9FH 2ZDAH 3A8DA 3A86A 2W6ID 2J5UA 2FOBA 3OY6U 1MZDA 2PKAA 4E7NA 2K0QA 1BZXE 4WWYA 3RXBA 2A45B 4KTCA 2NU0E 1P0SH 1O3OA 1H1BA 1J16A 3V7TA 3TH4H 2YMSD 1C2EA 1FXYA 2JKHA 2B9LA 5C94A 3MH7A 2WUBA 2Y5FA 1YPGH 2WINI 1K22H 1NBMD 1ZR0A 4BTUB 5A0CA 2BVRH 4OGYA 3RXHA 3MNCA 2ZGHA 2H1UA 1TRYA 1UJ1A 4H6SB 1OXGA 3P8NA 1GHBG 2JETB 2CMYA 1A5HA 2QY0B 3PWCA 3TK9A 4SGAE 4ACAA 2UUKB 1DWCH 3U69H 1CT0E 1EJAA 2XRCA 5JDUB 1ARCA 1C5RA 1ZPZA 2ZPQA 3MU1A 1HAVB 1O2KA 1XUIA 4NFFA 1T8OA 3VB6A 5LH8A 1CA0C 2F9UA 4NSVA 4Y0ZE 1SLWB 3ZV9A 1O2RA 2D8WA 1O2SA 1K1NA 2FIRH 1SGFA 1C1UH 1EASA 4OS4A 5J4QA 1QBNA 2J38A 3N7EA 1TGTA 2W3KA 2H9TH 2XC5A 2P3TB 4X1QU 1YGCH 1BTUA 2Z3EA 3IWMA 2ZQ2A 1WCZA 2C8WB 1A46H 2PFEA 2R2WU 3F2FA 1O3DA 2VVCA 1P01A 1HAVA 1LPZB 1CSOE 1O2PA 2R0LA 3CS7A 3SGAE 2FO9A 2BDGA 1C2FA 3E90B 2LELA 1HV7A 1FIZA 3ENSB 4CRAA 4E06H 2WYGA 2WHXA 3UQOA 2W7SA 1TBRH 2TGAA 3GY4A 5JYIA 3MQKC 2W7UA 1G9IE 1ZTJA 1GJ4H 3P8OA 4AFUA 1DUEA 4X8SH 4PROA 1OYTH 1K1JA 3A8AA 5JPMH 2ZHWH 1GJ8B 3RUOA 4RKJB 4D9QA 1A7SA 4X2XA 3V12A 2FS9A 3SU3A 1RGQA 2KAIB 5E8EH 1XUJA 1ESTA 5GNDA 5SGAE 1MD7A 3FP6E 3ZYDA 1C5WB 2NU3E 1MBMA 2ZU4A 1TRMA 3HGNA 1W0JD 1THRH 3OAAD 4Y6DA 4Y8ZA 3RU4T 1MTSA 3BG8A 3F2GA 4YZUA 2QF4A 2J95A 1O5CB 3SU6A 4WXIA 4ZKNU 3GCTG 2HALA 1ELEE 2KAIA 6CHAB 3OU0A 2BD5A 3AK5A 2A7HA 3SYJA 2TRMA 3U9AH 1W7GH 4B76A 4H42U 4K1SA 3SV2H 5LPRA 3QUMP 1IHTH 3SU4A 2Z3CA 4FU7A 3I78A 3RU4E 3TJNA 2ZU5A 4CBNA 1KXEA 1C2DA 1YPLH 2HNTE 2ZDKA 4XFQA 4IN2A 3RC4A 4ABJA 1W10U 4AORA 1HNEE 1EB1H 2FLRH 5GXPA 1KY9A 1AWHB 2Y5HA 1TA6A 4TYDA 1AY6H 2OC0A 1T31A 4TWWA 1TGNA 1FY5A 1ESAA 3BTWE 4ASHA 2F9BH 1TX6A 1AB9C 1GJAB 1LHFH 4JK5A 1SGFG 2EC9H 1GHBF 1XUKA 1O2MA 4IC5A 1ELCA 5DSFA 2KCYA 2BY8X 4DIIH 3QLPH 4K1TA 2QIQA 2XCNA 3ZVBA 1C1WH 4CHAB 4JZIA 1FY8E 2FDAA 5C2ZA 1SI5H 2RFKC 2KCAA 1HCGA 4A92A 2WPJS 4UE7H 1HAYB 1K1OA 5KECA 1PPBH 2ZFFH 3BTKE 4MNXA 3A7TA 5FCRA 2XXLA 1GVZA 1VJAU 3SHAH 4INLA 4INKA 1UTKA 1NZQH 4YM9A 1NPMA 4B2BA 2GCTB 4DIHH 1NRQH 1ABIH 1F0TA 2BM2A 2G8TA 1XKAC 1BBRE 4JZ1A 1A2CH 5DP4A 3MU4A 1AQ7A 1CE5A 3BTFE 3SJKA 2Z9LA 1ANEA 1B0EA 2CF9H 3SOSA 3QO6A 2V6NA 4LK4A 3BTDE 1LCYA 4JZFH 3T62A 1UCYH 1G36A 2XBVA 1P05A 2VWMA 5EPYA 1D6RA 1BQYA 3ODDA 1JRSA 1O3HA 1S5SA 3DSOA 4FUFA 1F5KU 2HVYB 2NU4E 4XDEA 2FYRA 2ZGCA 3GS9A 1IOEA 4CR9A 1QR3E
chains in the Genus database with same CATH topology
4D7FA 3GY8A 3ITIA 4YLUA 5FCKA 3HPTB 2SGAA 5EG4A 1Y59T 5T3HA 1P9UA 1JWTA 3GCTF 1TPSA 2XBYA 9LPRA 2FTLE 2FYQA 3SQEE 3LJJA 1H9HE 5LPFA 3QN7A 3G01A 1P2NA 1QRZA 1UCYK 2OBOA 2FOEA 1O3LA 3UNRA 1O2OA 1UTMA 3KF2A 4NG9H 4MNYA 3BG4B 1ZSKA 3M3TA 2LPRA 1GJCB 3MMGA 1UTPA 1GBTA 2ZDNA 1TPOA 3VFEA 1AVGH 1V2WT 1GBBA 1ZOMA 2VNTA 5C3NA 4Y76A 1TOMH 3NZIA 2XW9A 1W7XH 1FY4A 4XBBA 4ISLA 2H9HA 1C5SA 1UHBB 2OUAA 1U6QA 2ZO3H 4Y0YE 5HYOA 2VINA 4ABEA 5JB8S 2P16A 4U30A 3TK6A 1CQQA 1QA7A 2BY9X 1JMOH 1VITH 3BTHE 1OKXA 2BD4A 1BRCE 1K21H 3P70B 3OX7U 2PLXA 2QCYA 1P8VC 2A1DB 1UHBA 3RXSA 1QRXA 1GG6C 1DWBH 4AFQA 4CREA 1L1GA 4NWLA 3QTVH 1Y8TA 4UFFH 1TWXB 2VH0A 2AERH 1SLXB 5K7RA 4AB8A 3LIWA 5EW2H 3E8LA 2SNWA 1UVSH 3CS0A 2VWNA 2UUJB 5E0HA 1EPTC 4HI3A 4NIWA 4RSPA 5EQSA 1A3BH 3FZZA 5HGGA 2F91A 2HVXA 4X6NA 4Y8XA 1TE0A 3VXEH 3QTOH 5K0HA 2WUCA 1GGDC 2BQ6B 1EZSC 4FU9A 2BXUH 3HK3B 2BX3A 5F03A 5F8XA 1TPPA 2BVSH 3VGCB 1ELVA 1PYTD 3Q3KA 2ZGJA 3GCNA 5IYTA 4OS5A 4YOJA 2BOHB 9ESTA 1PJPA 3GDUA 4KELA 1PFXC 1O2JA 1ZSLA 2CV3A 4UDWH 2W26A 2GCTC 1O31A 2ZHFH 3TPIZ 3UR9A 4ZKOU 1GI7B 2BQ7B 3RDZA 1Y5AT 1RTKA 3U1JB 1DE7H 5C5NA 4X1RU 1AE8H 1TQ7B 1LVYA 3TNSA 1EJMA 2AS9A 1LMWB 1GI3A 5AF9H 1TGBA 5DP7A 1TIOA 3ZZ9A 2G4UA 2GT8A 4K8BA 5L2YH 1XVMA 1HRTH 2C90B 3RC5A 3L33A 1IHSH 2ZP0H 1GBCA 1AUJA 2AMDA 1WYKA 1QBVH 1QHRB 5A8ZA 2FOHA 1ZGVA 1Z6EA 3ELAH 1Z8GA 4O3UA 1C1SA 2GVFA 1O5EH 4X6PA 5L6NH 1O2VA 1EP6A 4I31A 1SOZA 2ALVA 5CHAC 3E3TA 3PWBA 4ZHAA 1ESBA 3I77A 3LPRA 1L1NA 4YO9A 1UVPA 3PLBA 4JYUH 1F0SA 3DFLA 2VJ1A 3ZZ5A 3NXPA 4O97A 1YPJH 1P57B 2ZCKP 1BB0B 3K9XB 1LVOA 2RA0A 3K2UA 1Q3XA 1VCPA 1AKSB 1H8IH 1BRUP 3BG4C 4X8TH 2JH5D 4FUJA 4FVDA 4NWKA 2C3SA 1V6DA 2A31A 2ZGXH 4XBCA 1GCTB 1GJ9B 1UK3A 3EYDA 1V2QT 1F0UA 3F6UH 3RXOA 1UTJA 1ZTLA 2AYWA 4BAQB 1QIXB 2P59A 5EODA 2OC8A 4FUBA 1BRBE 1LKAA 1MU8B 2GT7A 2Q6DA 2QAAA 1MKXH 4H4FA 5DP8A 2A4GA 2VIVA 2H5DA 4OS7A 4THNH 3PV4A 2VIQA 1DY9A 3GDVA 3LKWA 1AHTH 1EZXC 1ACBE 1ZRBA 1SGDE 1GBHA 2F9PA 2P3UB 3VXFH 3UIRA 1Y3WA 1GMCF 1TNHA 3VB3A 1ETRH 3SJ9A 1C5NH 2YNBA 3KQBA 4B2AA 2F9OA 1CBWC 4BXWA 2ALPA 1GMDG 1TNKA 4E05H 2SGPE 3D49H 2HNTC 1KDQB 1TONA 2BZ6H 4FUHA 3U1IB 1ELTA 1C1MA 4FXGH 4CH8B 5A8YA 2FWWA 3GOVB 1AZZA 3VEQB 5E0GA 4OS1A 1MKXK 4KGAA 3PMBB 1ZTKA 1FAKH 2VWOA 1HIAB 3A89A 4BAHB 2Q1JA 2C8XB 2HRVA 1TQ0B 3UFAA 1HAHH 3NKKA 1TNGA 3BEUA 1KDQA 3T26A 1BTWA 3P92A 1KSNA 2ODYB 2Z7FE 2P93A 3TJVA 2Z94A 4BANB 3BTGE 1W0YH 1W11U 1QL7A 5CE1A 1D3DB 4NSYA 1CGIE 2GX4A 4X1PU 4X1NU 4A7IB 1FN8A 2BLWA 1NFWA 1GBEA 1TOCB 2G5VA 2H5CA 1MTNB 4KP0A 4JK6A 3SI4H 1F2SE 1P2KA 5L2ZH 1SL3A 1FLEE 3N7OA 1MZAA 4X8UH 1K1LA 1HAZB 1P3CA 3FZDA 4JYTA 3FP7E 4AZ2B 3SUGA 4Q2KA 1T4UH 1W0ZU 5AFYH 1DLEA 4D7GA 3ZZCA 2UWLA 1C2LA 1TALA 1CGHA 1O2YA 2ZU1A 1HGTH 4K2YA 1J17T 4DGJA 3KQEA 4DG4A 3KCGH 3M3VA 3LGWA 4K60A 2XC0A 3TNTA 5EQRA 4XBDA 1VCQA 1V2ST 1OWEA 3SU1A 2PR3A 2SGFE 5FPSA 4O3TA 5JBCS 1WUNH 3SN8A 4D9RA 2PKSB 1F5LA 1QGFA 1C5PA 1V2VT 4MPVA 2J2UA 1PPZA 2R0KA 2ZCHP 1NN6A 2TGPZ 1FUJA 1O3IA 2ZC9H 4AX9H 3E1XB 1EATA 1C2HA 3S7KB 2GMTB 3TGIE 1FZZA 5AVDA 5C1YA 3MU5A 8ESTE 2OP9A 5JBAS 3SJIA 1C1RA 3P17H 1XMNB 1BMNH 1D3PB 4F49A 4CRCA 2FI3E 3EGKH 4ZHLU 1ZHMA 1GMDF 1YBWA 1IQMA 1C1QA 3SZNA 1GCTC 4GLYA 1Y3UA 2PGQB 1AMHA 1BOQA 5FX6A 2BOKA 2BY6X 2AIPA 2G52A 2GZ9A 1GL0E 2IPHA 2ODPA 3TH2H 1KIGH 1XM1A 1J14A 1P2OA 5T6DA 1IQHA 4Y8YA 1AFQC 4FUEA 2G00A 4X2WA 4NZLA 3M61U 3C27B 2P8OB 4YT6H 1S0RA 4K3JA 2HPQH 1LQDB 4B75A 2PUQH 4ABBA 1ANBA 5T6GA 4TWYA 1E35B 3T28A 1YLDA 1JXPA 2AGGX 1HFDA 2ESTE 3D62A 2ZNKH 2BLOA 4DY7B 5TCCA 2QGRA 3MFJA 1DM4B 1GVKB 3RM0H 2BMGB 3PO1B 1AUTC 5CMXH 2FX4A 1EAUA 1PPCE 2FI4E 3GDSA 3SJOA 4GHQA 1O37A 1ID5H 3M7UA 3SBKA 2WV4A 4ZUHA 2BY7X 1DS2E 1TX8A 2A0QB 2G51A 1BCUH 1C5XB 2Y6TA 4D76A 2W3IA 4E7RG 1GDUA 2Y7ZA 3PB1E 1ZGIA 3Q3XA 3MNSA 3T27A 3RC6A 5A09A 2XWBI 1GBKA 1TBQH 3BSQA 3KIDU 2RCEA 3LGIA 1Z8IB 4X6OA 2PGBB 5DP3A 1S6HA 1O5BB 2FTMA 1HUTH 1EB2A 1Q2WA 3ATWA 3VB4A 1C2GA 1JBUH 1N8OB 3KN2A 3UREA 4KTUA 2GDEH 4HZHA 4KKDA 2FOGA 1C4V2 1FJSA 1O2XA 3QK1A 5FX5A 2P3FH 4VGCC 1ZZZA 1SLVB 4JCNA 1V2UT 2FEQH 3GCHC 2SGEE 1UVUH 3E91A 3TJOA 1D3QB 1C9PA 1TABE 1EP5A 1NRPH 1KLTA 4I7YH 1DVAH 3LU9B 1GBIA 2PSXA 4GVUA 3ZZ8A 2PV9B 2WPMS 1SSXA 4XOJA 3O8BA 1Z71A 4AG1A 1HDTH 1XX9A 3W95A 4DURA 4LZ4B 2QXGA 3MNXA 1DWEH 1QFKH 4DJZB 3K6YA 2FS8A 1RFNA 4B71A 3MO9A 4UFEH 1NRNH 4ISHH 2VIWA 4FUGA 3RXIA 1G3CA 2PWXA 1CHOF 2CXVA 1AN1E 4I8LA 1ZMJA 5C1UA 2XYAA 2VIPA 1O2IA 1GWAA 3F9FA 1AD8H 4ABHA 3BIUH 3LGYA 3ZYEA 3PLPA 1A61H 2BTCE 2ULLA 3HATH 3QGJA 5ESBA 1EKBB 3F9GA 1IQIA 3GCOA 4CRBA 1L2EA 1BRAA 2G81E 1O3MA 2I6SA 1ETSH 4ISIH 2BZAA 2OQUA 2GZ7A 4K1EA 2Y80A 1YF4A 3NPSA 3IG6B 4UONA 1BMMH 3SO3A 3DUXH 1LVBA 1V2RT 2ZHQH 8GCHG 3BTTE 3SW2B 1HXFH 1DPOA 2XCFA 5EU8A 3L6PA 1O2UA 1QCPA 1N6XA 3KGPA 2PSYA 3VB7A 1XUHA 4H6TA 3S7HB 1TNLA 2ODQA 3M3SA 3F9HA 2WPIS 1OPHB 2JETC 3A8BA 2Q6FA 1T32A 1Z6JH 3ZVDA 3WY8A 3ZZ3A 1IQGA 3EE0B 1DLKB 1RIWB 5GWZA 3H5CB 4IMQA 1A4WH 3QZRA 3U8TH 3DD2H 3FFGA 1GBLA 3OSYA 2A7JA 1YKTA 3SV7A 1BBRH 1ZHPA 1BHXF 3PO1C 3ATKA 4MPUA 3SORA 3RXCA 3TGJE 5JBTA 3JZ1B 2ZDVH 4B74A 4SGBE 1XKBC 1XUGA 1LDTT 3W94A 4U32A 1O5DH 4RN6A 4GUXA 1QY6A 1ELDE 2FMJA 3D65E 2B0FA 2FXRA 3KHVA 2HWLB 1ZMNA 5DP9A 2Z9IA 3LC3A 3LOXA 4NFEA 2DE8A 5H4IB 2WPKS 2RA3A 3V13A 3SQHE 1FY3A 4BTIB 3LGVA 5FBEA 1W3CA 3OTJE 1ZJDA 4NGAH 2A4OA 1S81A 3A82A 4UFDH 1BBRK 5AFZH 2CHAB 4AGJA 5T6FA 5BRRE 1QJ1B 1AVXA 2A5AA 1QJ7B 2BLQA 1RJXB 1TGCA 2A4QA 2TGDA 1QBOA 1UMAH 1SGIB 5BPEA 4ESTE 5EQQA 2H6MA 1KTSB 2YNAA 4BOHA 1VJ9U 3RLWH 3RXEA 4ZXYH 2BDYA 2R3UA 2V3OH 1D3TB 1SC8U 4Q7ZA 5DPAA 5TJXA 3PLKA 1O32A 1GVLA 3MH6A 1PQ7A 6CHAC 1H9IE 3TVJB 1CT4E 2AGEX 2H2ZA 1SFIA 3MHWU 5FBIA 1SHHB 1F5RA 4AG2A 3U98H 1V2OT 1O35A 4WH6A 2F83A 3SNAA 1SGPE 3T29A 4NIVA 3RU4D 8GCHF 2UWOA 1SGRE 1O5AB 3AAVA 4Y7BA 3E0NB 1BJUA 4DCDA 1CU1A 6ESTA 2HOBA 2BLVA 1G3DA 4ISNA 4OGXA 1O2QA 2TGTA 3MU0A 2OINA 1ZHRA 3ZZBA 2ANKH 2GV7A 1MD8A 2NU1E 4IW4E 2UUYA 1DWDH 3M7QA 2TBSA 3HKIB 3K65B 2FZZA 5J4SA 1P2JA 1SQOA 3LGTA 1TMTH 1P2MA 2GGVB 4DW2U 3DA9B 4CHAC 3LDXH 1W14U 3TK5A 1QNJA 1OP8A 1MQ5A 1NFXA 1ZJKA 5GIBA 1P03A 4B1TA 2SNVA 3ZZDA 3KEEA 1MUEB 1S85A 1KYNA 1DX5M 2XBXA 1UVTH 3URCA 1A3EH 1BITA 4LZ1H 4BAOB 4J1YA 3LT3A 1ELAA 1C2MA 1HAIH 1GMCG 4TY7A 1RS0A 4M7GA 3SV6A 1O3EA 2B8OH 4DOQA 1YCPM 2WYJA 4TPYA 1YM0A 1B7XB 2O9QA 2PUXB 2QV1A 3Q77A 1MCVA 3M35A 5EXLA 2VGCB 3F1SB 1S6FA 1SGQE 4K69A 1SQTA 1O3PB 3ESTA 1IQLA 1RTLA 3GY6A 1XVOA 1IQFA 5DJ7A 1AE5A 1V2NT 1MMJN 2BB4A 4IN1A 1QA0A 2QXJA 1L1JA 1SPJA 3S69A 5E0JA 1Z7KA 3A8CA 3SNCA 1K2I1 4OS2A 1C1OA 1P09A 3MU8A 5HM2A 1OP0A 1H9LB 2G5NA 1DUAA 4XE4A 4DT7B 3P8GA 3M5NA 4AYYB 1G3EA 3SU2A 1C1TA 1GHVH 1BTXA 4YTAA 1W8BH 3V0XA 2Z9GA 2HGTH 1Z1JA 2Q6GA 3HK6B 1NY22 1IAUA 2VIOA 5HMAA 3MO3A 1NC6A 4FUDA 3Q3YA 1O2ZA 1W2KH 1HBTH 2V0BA 1SR5C 2BDBA 3M37A 4A5TS 2F9NA 4Y7AA 1O5GH 1LO6A 2QC2A 4BTTB 4AN7A 1MTUA 5L30H 3GYLB 1MTVA 4GCHF 2QF0A 1HJ8A 5FHTA 1J15A 5LGOA 1N6YA 3SNEA 1PQAA 1D6WA 2QF3A 3RXPA 1GHZA 1GMHF 1LKBA 2CHAC 2GD4B 4NA7A 1S84A 2V3HH 4ABAA 1ZYOA 4UFGH 5E2OA 4WMFA 2A5KA 2AEIH 4MPXA 1C5ZB 1QJ6B 4QT8C 1CT2E 2OD3B 1EUFA 3UOUA 3BN9A 1YPKH 5EXMA 1D9IA 1C1PA 3ZZAA 3PROA 1LVMA 1VCWA 4CBOA 2PHBA 2ZPRA 1NRSH 2FX6A 1MCTA 2ANMH 3PMJA 3DFJA 1GBAA 3FVFB 4MDSA 1LHEH 3H7TA 1FN6A 1IQEA 1JOUB 1C5OH 1AWFH 1IQJA 4AOQA 3LH1A 1C5VA 5A0AE 3IITA 1ABJH 3RXRA 3C1KA 1FNIA 2XNIA 3S0NA 1BT7A 4B73A 1O3BA 2XWAA 1MQ6A 1C5UA 3BTEE 3SUFA 1YYY1 3CENA 1V2KT 1AO5A 2IN2A 2OBQA 1Y5UT 2W5EA 5GCHG 2FI5E 3VGCC 1SMFE 1V3XA 1DY8A 3M36A 3TH3H 2WPLS 1F7ZA 1GJ7B 1ZMLA 2K1QA 4WH8A 1GDQA 1GI2A 1GI0A 4I33A 1LTOA 2J92A 4X2VA 1B5GH 3PMAB 4A1VA 1V2MT 1TMBH 1OX1A 1ELBA 2R9PA 1FV9A 1ETTH 2P94A 2B7DH 3JZ2B 3OYPA 3MH4A 4R8TB 2THFB 1LPKB 1PYTC 7KMEH 3BV9B 1SFQB 1O3AA 1S82A 3PTBA 3A7ZA 3NCLA 1GI1A 2NWNA 4FU8A 1OSSA 3RMNH 3UUZA 5I46H 1KLIH 1BMLA 3GICB 3ZVCA 1OWJA 1YPMH 1NU7B 3KL6A 3HGPA 4Z0KA 3RMOH 1C5TA 1Y3VA 3TITA 1AFEH 1T8NA 3GYMA 1WBGB 2J34A 1A1RA 1VITG 4MNWA