3NZIA

Substrate induced remodeling of the active site regulates htra1 activity
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
b'EDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease HTRA1
publication title Substrate-induced remodeling of the active site regulates human HTRA1 activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase substrate
total genus 47
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2010-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nziA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nziA02
5K7RA 2Z3DA 1TWXB 3A80A 2HNTE 3GICB 2OQUA 1AB9B 1QBVH 3PV4A 1W8BH 1SGFG 1BBRK 2ALVA 3STIA 2F9OA 4NA8A 1SHHB 2ZNKH 3EE0B 2VIQA 1INCA 1O2PA 2ZPQA 4OS7A 3URCA 5T6GA 1OX1A 2GTBA 1NZQH 1GPZA 1TOMH 4ABEA 3VB5A 1LPKB 4X2VA 1IQMA 1O2UA 3ODDA 2IPHA 1EJAA 1BRAA 4BAMB 1EAIA 1M9UA 1ESBA 4QT8C 3VFEA 1YC0A 4IMQA 2SGAA 2JKHA 1IQHA 1EQ9A 1UTKA 2ILNA 1EATA 1Y3VA 5DP8A 3GY5A 1ZPZA 4FU9A 3LIWA 3IG6B 3PMHB 4J1YA 2Z9IA 2A5IA 2AERH 2ANKH 3DA9B 4I7YH 2ZG0H 1BJUA 3D23A 2JETB 1W10U 3UFAA 3SU3A 4BAOB 3BEFB 1OKXA 1DFPA 3ZZCA 1UTNA 2A32A 1K1LA 1E37B 1P01A 4IGDA 1WOFA 3GYMA 3STJA 3LGWA 3RUOA 5T3HA 3A87A 1HAXB 1HAZB 3JZ1B 3SGAE 1NN6A 2ZTZA 2BB4A 6CHAC 2R9PA 2BD7A 4B71A 2XBYA 1S84A 1V3XA 4IS5A 1CGHA 1O5CB 2SGQE 3RXGA 1RIWB 1MBQA 2SNVA 2BDGA 3N7OA 3RC4A 1O32A 4HTCH 1ZMLA 3SU4A 2Y7ZA 1BB0B 1TGNA 3A7TA 5EPYA 3RU4E 4E7NA 4JMYA 1ARBA 1GHYH 3P95A 3PTBA 3MMGA 1BOQA 3A88A 3PLBA 1OS8A 2NU0E 2XBWA 1CBWC 1EZQA 3PMJA 3PO1B 3ATWA 1HAVB 2GV7A 3EA9A 3GCNA 2NU2E 3QTVH 4UFGH 1DOJA 3GCHB 3QX5H 5TCCA 4I33A 1C1WH 4MPXA 3SQHE 2FTLE 1FPCH 1LQDB 2PSYA 4IMZA 4MTBA 4NIYA 3A8CA 2JH0D 1BMAA 1O3CA 3MH7A 1FDPA 2BX4A 5DP3A 1O36A 1G3EA 4X2WA 1C1TA 1O2HA 3RDZA 4IBLH 1ZHRA 5BRRE 3M3TA 1V2LT 3RXSA 1HJ9A 4K8YA 4RSPA 3MI4A 2ZKSA 3LGTA 3BG8A 1H8DH 5CMXH 3RU4T 4ZUHA 2FP7B 4Q7XA 1NRNH 4YTAA 2GMTC 2G8TA 3M37A 3G01A 4BTIB 3F9FA 1IQKA 1ELDE 1GHAF 2W3IA 2PUQH 4UFEH 4CHAC 1Q3XA 4NIXA 1GMCG 1H8IH 2FIRH 1IQIA 3CP7A 3SUFA 1WSSH 3BIVH 4YO9A 5C20A 1Y5AT 3ATIA 1C5YB 4Y10E 1C5XB 1MQ5A 1K28D 1J8AA 5FCKA 4X6OA 4UEHH 3QLPH 2Y81A 1D3TB 2FS9A 4BNRA 2RDLA 2GCTC 1CT2E 1UTLM 1AQ7A 3BTHE 2BDIA 4NA9H 1ETTH 1NRPH 8LPRA 5GWZA 1EPTC 1VGCC 1C2HA 4D8NA 2VWLA 2HNTF 5EXNA 4IC5A 3HKIB 3NKKA 1C2FA 2SGPE 1GJDB 2FTMA 2ZHQH 5E0JA 1AZZA 3LJJA 1U6QA 2VIVA 4M7GA 2UWOA 1RGQA 1T7CA 4H6TA 3MYWA 1ESTA 1IQFA 1OOKB 3AVZA 4AORA 5LPRA 1C1UH 4I8GA 2V3OH 3EGKH 1Y3XA 4NGAH 1KLTA 1C5VA 3R3GB 3SOSA 1BMMH 4INHA 1GI6A 4AGKA 5C1XA 4I8HA 4B2BA 5HXFA 1HB0B 1D3DB 3LGUA 3ZZ7A 1JRSA 1TAWA 3V12A 4JK5A 2A2QH 4KP0A 2ZFQH 4ZKOU 1UVSH 1NFXA 4DT7B 4AFZA 2Z7FE 2OP9A 1LKAA 1GJ8B 1ZR0A 1Q31A 1XXFA 1C2IA 2XTTB 4JZ1A 3BTGE 2UWPA 1PQ8A 2P95A 2ZA5A 1BA8B 3SJOA 1P3EA 1GG6C 2W7UA 2A2XH 2V35A 1UMAH 1DY9A 2DE8A 1DXWA 1L2EA 1LKBA 3BTTE 2R2MB 1QQUA 1SGPE 2QXJA 2AMDA 1RTLA 3MH4A 1OYTH 1NO9H 2KAIA 3Q00A 3FP8E 5T6DA 1C5QA 2I6SA 3UNQA 4X1SU 1O3IA 4UONA 3DHKH 4FXGH 5A0BA 1O3LA 4DJZB 3RXAA 1MD8A 1O2NA 1EAUA 2O8UA 1E36B 1Q2WA 3MH5A 3QO6A 2B8OH 5AFZH 1YPLH 1MTWA 5EPNA 1AZ8A 1OWJA 2UUFB 1P02A 1GI0A 2CF8H 1FAXA 1QL8A 1WQSA 2ZI2H 4ISIH 1F7ZA 3GDSA 1TGTA 1LO6A 4X8UH 2ZGJA 2WYJA 2P8OB 2VIDA 2Z94A 2QC2A 3ZZ5A 1NPMA 7KMEH 2EC9H 3SV7A 3A85A 3P8GA 2PKSB 1PPEE 2BD3A 1TIOA 2ZU4A 3ZZ6A 4ABFA 3A7YA 3RXBA 1DPOA 2UUYA 2WINI 1C2KA 1KLIH 1TNJA 2VVUA 4WXIA 1NFWA 3UNRA 2GP9B 1S81A 1Z7KA 1GI7B 2BDCA 1K1JA 1DY8A 4ISOA 3F9GA 3IITA 1Y3WA 4MQAA 1GHBG 1ANEA 4AB8A 1HIAA 4GCHF 3TNSA 1C1NA 3DFJA 1B0FA 4BOHA 3Q3YA 2ANYA 4FUFA 1A1RA 1DLEA 2ASUB 1HRTH 5HM2A 2JH5D 5LPEA 4ISNA 2Z6BD 4K1SA 1GMCF 1AVGH 3SBKA 1W12U 2C93B 1RTKA 2ZGCA 4K5ZA 3GOVB 4DVAU 1KSNA 4ZHAA 2ZHEH 2LNCA 3KQEA 2FOBA 3GY3A 5DGJA 1SGDE 2GT7A 2ZF0H 1C2EA 2ZECA 4ABGA 2R0KA 3RXKA 1GMHG 3BTWE 3A8AA 2CJIA 2HOBA 2VINA 3M5OA 2NU4E 3SV9A 1O3MA 4B2CA 7ESTE 1V2RT 4WWYA 4Y7AA 1C4U2 3QTOH 1TNKA 4R8TB 1BHXF 1TONA 1QY6A 1RFNA 1S83A 4B75A 2QGRA 2ZHFH 2BY9X 5E2PA 1T4VH 1TX8A 1EAXA 3LC5A 1VR1H 5I46H 5C5OA 4AGJA 3BTDE 3MNCA 1FIWA 1N8OB 3RXVA 1DVAH 1Y3UA 1BTUA 1O2IA 5A0CA 1O3FA 1O5GH 4OS6A 1FLEE 3FAOA 1A0JA 1DSTA 1LHFH 4FUEA 3QZRA 1EASA 2QCYA 4HFPB 4ZAEA 1SLWB 3WY8A 1DS2E 3IWMA 1KXCA 2ZCKP 5EODA 3D49H 3OSYA 4AG1A 2D1JA 1TPAE 1SHYA 1TMBH 5F8TA 2FMJA 1LQEA 4FVDA 1FN6A 4MPWA 2H9EH 2CHAC 4VGCC 5GXPA 3W94A 1G3DA 2W3KA 2Q1JA 4D9RA 2XRCA 2UUJB 4LK4A 1ZPCA 5L6NH 2ODQA 1O5EH 2BD2A 2VU8E 2OC7A 1AHTH 2O8MA 2AIPA 1SGNE 1UTQA 5HYOA 1A46H 1C5PA 3U1IB 1C1PA 1V2ST 5EW2H 1UVPA 3QWCH 1WTGH 2ESTE 3SGBE 3BIUH 2AGEX 1B5GH 2ANMH 4TPIZ 1KIGH 5FXLA 1ABIH 5JBAS 3DFLA 5DKMA 2BHGA 2FLRH 2FO9A 1P12E 1TABE 1CA8B 4MPUA 1JMOH 2Q6DA 1ELEE 3E1XB 1SGQE 2XCNA 3FZZA 3LH3A 4KTCA 1TQ0B 4MNYA 1Z8IB 3GCTG 4O9VA 1NU7B 2FLBH 1SOZA 3BTFE 1LVBA 1TALA 2STBE 1DWDH 1GBLA 4YOIA 4U30A 4GHTA 2FOGA 1YPMH 8ESTE 1ZSJA 3RMMH 1ANBA 1CU1A 4A7IB 3KN2A 4ABIA 1G9IE 2GDEH 1P05A 5A8ZA 2ZP0H 1FI8A 4ZROA 4O03A 1FZZA 1E0FD 1EZSC 1ZPBA 2ZIQH 4NFFA 1TRMA 4X2XA 2J95A 1C4Y2 2R0LA 3LKWA 1V2JT 2PV9B 1JOUB 4MNWA 2ZTYA 1K9OE 3NCLA 5LPFA 8KME2 1TX7A 1O35A 1YBWA 2GKVE 1GDNA 1QB9A 3E91A 1O2WA 2WPLS 3P70B 4TYDA 1D6WA 1SFIA 3HK6B 1ZGIA 1GHAG 1DICA 2HWLB 2ODPA 1G2LA 1SGTA 1C5NH 1KXFA 1HJAC 1YM0A 3TU7H 4B2AA 1YKTA 1H9HE 1WYKA 4INKA 1XXDA 1YPHC 1F0RA 2TGPZ 3KCGH 1HAVA 3MO3A 4UD9H 2XC0A 4DIIH 1GBFA 3T28A 1TRNA 1S5SA 3CENA 3L33A 1EJMA 2G52A 1LHEH 1GMHF 1GJCB 1SLUB 3KIDU 1TYNA 1WTHD 1O2SA 1TA6A 1P04A 2HALA 1BTXA 3F9EA 3V0XA 4UDWH 1QFKH 4ISHH 1THSH 4SGBE 2PKAB 5ETXA 1O2JA 2XC4A 1C5SA 1CHGA 3A7WA 4DG4A 1TBRH 4AB9A 2EI6A 1MQ6A 1RXPA 4NWLA 2AMPA 5SGAE 2VIOA 4ABHA 1MMJN 2A5KA 3MFJA 1W3CA 3TH3H 3SZNA 1RS0A 4NWKA 2B7DH 4LZ1H 2ZDLA 4NG9H 4U2WA 1H9IE 1ZTLA 2A7HA 2BDHA 3OY6U 3FFGA 4PROA 4O3UA 1K1MA 4FU8A 4AFQA 4CRBA 1MU6B 4CRCA 1QL7A 4D9QA 2BOKA 3TH2H 3JZ2B 3UOUA 3GY8A 1P2QA 2WV5A 3BV9B 1S85A 2AYWA 3RXCA 1P10A 3LH1A 1HAGE 1GL0E 2ZFPH 2GVFA 5BPEA 2OC8A 1BIOA 1YPHE 1L1GA 1MH0A 3ATKA 1L0ZA 3K65B 4HZHA 5AVDA 1C4V2 4Y0ZE 4YT7H 1DITH 1HNEE 1AVXA 1CGIE 1K21H 1ZHPA 4I8KA 2QYIA 3SNAA 1GHVH 1IHSH 1G30B 4IN1A 1HLTH 1C5MD 4TWYA 1NRRH 4XSKU 2PGQB 4WVPE 5FX5A 2ZGHA 1GJ7B 1SGEE 3PROA 1CSOE 1W0ZU 5DP9A 1O2QA 1P0SH 1XUKA 3K6ZA 8GCHF 3SU6A 1DE7H 2BDBA 1V2NT 2FYQA 3V3MA 3A7ZA 1O2LA 4CR5A 3LPRA 1LHCH 2H9TH 2FX4A 2QY0B 1TBZH 2EI8A 3B9FH 4E7RG 1GVKB 3GCTF 1PQAA 3O8BA 4E06H 4JYVH 3NZIA 3RC6A 1F0UA 4X6PA 5E2OA 1CVWH 5F03A 3SJ8A 3S9AA 1MZAA 3O8RA 1MUEB 3FANA 1O38A 4YLUA 3U1JB 1DX5M 4D76A 3T29A 1F0SA 1T8LA 4DGJA 2P93A 1TFXA 1VCQA 1J17T 2BTCE 3SNCA 2CGAA 2BVSH 2FPZA 1O3JA 2ZCHP 2OUAA 3A8DA 2P94A 3BG4C 4TY7A 4Y11E 4AZ2B 3TGJE 1SQAA 1BRCE 1O5FH 2GX4A 2D2DA 1D4PB 4K1TA 1V2UT 2Y6TA 1GHWH 3K2UA 1AFQC 1TMUH 4ASHA 2AFQB 2BOHB 2HGTH 3T25A 1TA2A 5EW1H 2G5VA 3LDXH 5TCAA 1O2RA 2UUKB 4FUBA 1CA0C 1IAUA 2BD5A 3UTUH 1ESAA 2ALPA 2IJOB 1EZUC 1O3NA 4GCHG 4BAKB 2C8ZB 2DUCA 1EP6A 3UWIA 2V6NA 2I6QA 1A0LA 1DXPA 2GD4B 2F91A 1GCTC 2PUXB 4YM9A 1Y5UT 3TGKE 3OY5U 3FVFB 2Z9JA 3ZZ3A 3SO3A 4JYUH 2J2UA 3RXDA 3SQEE 3P8NA 2ZO3H 1AUTC 1BTPA 3LJOA 1HXEH 1P2MA 1GJ6A 2PR3A 1TOCB 1QHRB 5G4BA 3SUEA 4FUDA 1T8NA 1YPEH 2F9VA 4Y8XA 2VIWA 3P6ZB 1GBKA 1L1JA 1YPKH 4RKJB 3UREA 2BD8A 3VB7A 1BRBE 3BTQE 4CREA 3S9BA 2TGAA 2OINA 1NFUA 2IOTA 1BDAA 2VVCA 1SPJA 1C5OH 1CO7E 1XKAC 2XCFA 1C2GA 3EDXB 1PPHE 1ZHMA 3SI3H 1EAWA 1G3CA 1V2PT 3RXUA 1Z1JA 5DK1A 4CBNA 4JZDH 1GGDC 1S82A 1TPPA 3K6YA 3P17H 5C1YA 3VEQB 1NT1A 2FS8A 3GDUA 1KXAA 2ZU3A 2B5TB 5CHAC 1LPZB 6GCHF 4VGCB 3RXQA 2ZU1A 1EKBB 1FY5A 5DO4H 1A5IA 5DP6A 1SVPA 2D26C 3KL6A 1O3BA 4H4FA 1HAOH 1S0RA 1T8OA 1TNGA 2VNTA 1WCZA 6ESTA 1V2TT 1ZMNA 5A8XA 2BQ7B 1Z8RA 3P8FA 1EX3A 1KYNA 1JXPA 3PLPA 1UVUH 3M5MA 4TY6A 2BY7X 3KNXA 1GDUA 4MNVA 3UIRA 3LOXA 2BLWA 3RMOH 2FI3E 4DW2U 3ZYDA 4WXVA 1O39A 1QB6A 1FAKH 1H4WA 5EQRA 2BXTH 4RKOB 1O33A 1OP2A 1MKWH 3M3SA 1A5GH 1EXFA 1KLJH 1LMWB 1HAIH 1SLVB 3U8RH 4A1XA 5I25A 1T4UH 1J14A 2H9HA 1NC6A 1L4DA 2AS9A 1OWDA 1KXBA 4XBDA 2WPIS 2FOFA 1Z6JH 1O3GA 2ZTXA 5FPTA 1TQ7B 3LONA 2ZFRH 2A7JA 3PB1E 1V2OT 1HGTH 2XW9A 4RN6A 5J4QA 4NIVA 2SNWA 4JYTA 4ISLA 1IQLA 4K2YA 4UFFH 1AB9C 1UK2A 1SG8B 2ZQ2A 4U32A 1GHXH 2D8WA 2C8XB 1P2IA 5HMAA 3SHAH 3BTEE 1GVZA 2BY5X 1TBQH 1C9PA 1ZMJA 2FOEA 5DJ7A 1EOJA 1XMNB 3FZDA 1IQGA 2C3SA 2THFB 1XUIA 2BD4A 2BQWB 4TPYA 4XOJA 4AFUA 5C1UA 1HYLA 2ZQ1A 1SI5H 1HAPH 4THNH 4F4OC 4JZFH 4Q7YA 1DWBH 2V3HH 1P2KA 1PPFE 4JK6A 2OBQA 5A2MH 3PTNA 1VZQH 5L30H 1DLKB 5A0AE 9ESTA 1GVLA 3TJVA 3NK8A 1ZTKA 1N6YA 4KGAA 1ETRH 4KKDA 4NIWA 3ZVEA 3LGIA 5JPMH 4WY3A 3GISB 1B7XB 1SQOA 3MH6A 1XM1A 4FUJA 4KELA 1Z1IA 3SNBA 2QA9E 1V2VT 3H7OA 2JETC 1OSSA 1OWHA 3M35A 1KTSB 5EXLA 2G55A 3BEUA 2F9PA 2ZWLH 3K9XB 3M5NA 4B1TA 3VGCB 3RLWH 3GY6A 1SC8U 3E90B 2AMQA 1CQQA 1LTOA 3AW0A 2PW8H 1FNIA 2AGIX 2A7CA 1N6XA 2QIQA 3F6UH 3HPTB 1BJVA 2SGDE 1TGCA 2BDAA 2DE9A 2FI5E 2HLCA 2ZU5A 2W26A 1QJ7B 5EOKA 1PPZA 2J92A 2TIOA 3U8OH 4Q80A 2J38A 1RIWC 2H2ZA 1WUNH 2WUCA 1YP9A 1GBHA 1ACBE 1DDJA 2NWNA 1GWAA 5CE1A 2W5EA 4BTTB 3SNDA 4CBOA 1RRKA 1QB1A 1HV7A 5E8EH 2WPMS 4U01A 3BTME 5LH8A 2ZHDA 3E6PH 2SGFE 1QBNA 4CH2B 3PO1C 1NROH 1AKSB 4H6SB 4A1TA 1F5LA 5C67A 3SJIA 5L2ZH 2RA3A 4FUHA 5C2ZA 1BQYA 3GCHC 2B9LA 3MU0A 4YZUA 4X1QU 2BXUH 1NU9A 1TPSA 1AN1E 2A4QA 5HGGA 1K1NA 2NU3E 2PHBA 3ZZ9A 3ATLA 1TRYA 1C2LA 5DP5A 3S9CA 3A7VA 3KEEA 1O5DH 1FONA 1XKBC 4ZKSU 1QRXA 3ESTA 2PWXA 1O3DA 2Y7XA 1XVMA 1GDQA 1GJ4H 1HCGA 2CN0H 1ELFA 2QXIA 2TPIZ 5JB8S 1T31A 2BY6X 3OYPA 5L2YH 5K0HA 1J16A 2CMYA 3T62A 3RXRA 1UTJA 4GLYA 2G00A 5JB9S 4AG2A 5PTPA 3RMLH 5H4IB 4DOQA 1GI4A 3ODFA 3RLYH 1GJ9B 4O3TA 1VITG 5FHTA 1P06A 1SGIB 2XWAA 4ABJA 4DURA 1LHGH 3OX7U 6CHAB 4CRDA 5DP7A 1XUJA 3AAVA 1EOLA 1SL3A 3UWJH 1SFQB 1JIMA 7GCHF 1SSXA 1X7AC 5EGMA 1E35B 2EEKA 4HI3A 3U69H 4OGYA 1SMFE 2SFAA 3TGIE 3E0PB 1O3HA 1LVOA 2YNAA 3LT3A 3SNEA 3SUDA 2G4UA 2CF9H 1PQ7A 1MCTA 2Q6FA 3BEIB 4B74A 4ABAA 1D9IA 2P3TB 1ZGVA 3PYHA 3DT0H 1CBWB 3TK9A 4Y8ZA 1UCYE 3ENSB 5EU8A 4ABBA 1FQ3A 1BUIA 1K1IA 2G4TA 1W11U 3RXHA 2FESH 4AOQA 8GCHG 1WBGB 3ZVAA 2FODA 2O8TA 1FN8A 1G37A 2BD9A 1NESE 3M61U 3A84A 3SU1A 4IC6A 1BHXB 3SV8A 3MO9A 1O2YA 1ZOMA 3TH4H 3MO6A 2P3FH 3M7QA 1AFQB 3MU5A 4FUIA 1GMDF 4D7GA 4DY7B 1G32B 4XE4A 1CGJE 4YOGA 4YESB 4X0WU 1CA0B 3E3TA 1EUFA 2FXRA 2EI7A 4BXWA 1MKXK 1MKWK 1MTNC 5JBCS 2AIQA 1O0DH 3QK1A 4SGAE 1KTTB 1P2NA 1V6DA 3S7KB 1F5RA 2GMTB 3M7TA 2PFEA 1L1NA 3V7TA 1OPHB 3ITIA 3GY2A 4CHAB 4WF8A 3UQVA 2LPRA 3C27B 2R3YA 3T5FH 9LPRA 1UO6A 3S7HB 2G5NA 2OXSA 3DD2H 3CS0A 2J9NA 1O2TA 1NS3A 1OP0A 1P9UA 1BTZA 2GCTB 3QGNB 4A5TS 1GJ5H 3HKJB 3SUGA 1AE5A 2AEIH 1KDQB 2BY8X 2B0FA 2Y82A 5GCHG 5ESTE 4AYYB 1C5WB 2Y80A 2GV6A 4ZHMU 2FOCA 1ANDA 1EPTB 1VGCB 1F2SE 2F9UA 3M36A 1FY3A 3EYDA 2VJ1A 3SV6A 4I31A 3QZQA 5GIBA 3PLKA 1TGBA 3SI4H 3ZZAA 1K2I1 4BANB 2QV1A 3O8CA 1O2VA 1TE0A 2O9QA 3NPSA 1C5UA 1OWEA 2VVVA 3PWBA 1GI3A 2FYRA 1JWTA 1DWEH 2FOMB 2Z9KA 2H5CA 1QA0A 4Z0KA 4Y8YA 3Q76A 4K8BA 4LOYH 1Y59T 2J94A 4BAHB 2HPPH 2P8OC 5FCRA 1TLDA 1TNLA 1PPBH 2PKSC 2YOLA 2VH0A 2OLGA 1MD7A 1F92A 4I8LA 2RG3A 1TMTH 1H9LB 1V2WT 1RJXB 4X6MA 6GCHG 1W2KH 1DSUA 2Q6GA 2A4RA 2SGEE 1HAHH 2TRMA 1P9SA 1FY8E 2FX6A 1K1OA 2ZHWH 4UFDH 3UR6A 1GBMA 1UVOA 1MTUA 3I29A 3EQ0H 1IQEA 2QXHA 1GG6B 1NFYA 5F8ZA 1PPCE 3MNBA 4ZKRU 1T8MA 2H1UA 4ZKNU 2ZGXH 2C4FH 3BSQA 1ETSH 1VITF 2Z9GA 1AVWA 2H5DA 4WMEA 3L6PA 3KQCA 1A3EH 3HATH 5DPAA 2PLXA 1QBOA 1QQ4A 4FUGA 1SGYE 2XWBI 1G3BA 2W7SA 2WUBA 1GBIA 3TJNA 5B6OA 2ULLA 1QR3E 4HGCA 1MU8B 2XC5A 2ZPRA 4NZQA 4CRGA 3R0FA 1C5RA 1WV7H 2QF0A 1QIXB 1UHBB 2VH6A 3SJKA 1D3PB 3SU0A 5EG4A 1UJ1A 4X6NA 1BBRE 1YCPM 1GBAA 2VB0A 1IOEA 1EJNA 1SBWA 1WAYB 5E0GA 2ZFFH 2AH4X 1UK3A 2F9BH 2QN5T 1W13U 3CS7A 3E8LA 1J15A 1O2MA 3RXIA 1O3KA 3ZV9A 5LGOA 1CHOF 1K1PA 4MG3A 3H5CB 1NTPA 3ZV8A 4H42U 2Z3CA 3F1SB 1YPGH 3OU0A 1AGJA 4MLFB 3TK5A 3OTJE 1E38B 3KHVA 1C1QA 1BTHH 3VB4A 4XDEA 1N8OC 4B76A 2FM2A 3E0NB 5AHGH 3TLOA 2TGTA 1ELBA 4MNXA 2VWOA 3F68H 4Y6DA 1DUEA 2QXGA 2V0BA 2FOAA 1A0HB 1BRUP 2F3CE 1GBTA 1S0QA 1QRWA 1BT7A 1O37A 5J4SA 1P57B 1EB2A 1HXFH 3FP7E 1ORFA 1AUJA 1ZTJA 1PYTC 3ZYEA 2G51A 2P3UB 1P3CA 4MDSA 4K60A 4NA7A 4IW4E 4LXBH 1ID5H 1L4ZA 2UWLA 5A09A 1IQNA 4B73A 2C90B 1LDTT 2ZEBA 1VITH 1YLCA 3UPEA 4BXSA 2XBXA 1GCDA 1XUFA 4R0IA 4X8TH 1SGFA 5GCHF 1TNIA 3ATMA 3QDZB 1OYQA 1QNJA 4XBBA 5GPIB 1V2MT 1B0EA 3UUZA 1ZJKA 5F6MA 4JZEH 1LPGB 3RXMA 1GI9B 3RXLA 3D65E 3MNXA 1AFEH 2ODYB 1YPJH 2A45B 1JIRA 1ANCA 4X1NU 1QA7A 5JBTA 1K22H 2P16A 1UCYH 3O8DA 3LGYA 1GHZA 1ZZZA 4ESTE 1C5TA 4JCNA 1P2JA 4BTUB 1LHDH 1G2MA 1LVYA 5IYTA 2WYGA 1ZSKA 1AWFH 2GCHG 1ZRBA 2PSXA 3A8BA 3RXEA 1F0TA 3SORA 3M5LA 1GBJA 2HRVA 2OC1A 1O2ZA 1BITA 5DP4A 1MTSA 2VGCC 3GCOA 3PMBB 3QUMP 3ZVBA 1O2XA 3RXOA 1FUJA 3MU1A 4X8VH 2CXVA 3RXPA 4CRFA 4F49A 4AX9H 4Y76A 3BTKE 3BN9A 2CHAB 3AAUA 3HGNA 4NZLA 3S0NA 1QTFA 2WV4A 4AN7A 2A1DB 1UK4A 1MZDA 2C8WB 3BF6H 2RCEA 2PTNA 1C1MA 1YCPH 4MPVA 5F8XA 1QJ6B 1CE5A 3RXTA 4ZMAH 1FJSA 1RD3B 1ELVA 3C1KA 2XBVA 2O8LA 1FY1A 1TGSZ 3RXFA 1EP5A 5AF9H 5GDSH 1THPB 4WH8A 1QJ1B 1H1BA 2OBOA 7GCHG 3PM3A 2BQ6B 4OS2A 1ZYOA 1MKXH 3MHWU 4ABDA 1WQVH 1D3QB 1SGRE 1AKSA 2GZ7A 1HJ8A 3I77A 1MCVA 1J9CH 5T6FA 4Y71A 4KTSA 1MTNB 2R3UA 5JBBS 1V2KT 1AO5A 2VIPA 3KF2A 3A89A 1IQJA 1O3OA 1O5BB 2ZFTA 3RXJA 2OQ5A 1C1RA 1GI8B 2QF3A 2VWMA 2Y5FA 3L3TA 1SB1H 3SGQE 2H6MA 1O34A 1AWHB 3ZZ8A 1YYY1 1BMNH 1ABJH 1Z8JB 4KTUA 5IDKA 3T2NA 1O2GH 1AY6H 4NSYA 4X8SH 3U9AH 2FI4E 1FXYA 2YNBA 5JDUB 4OS1A 4XFQA 1NRSH 1N1LA 4YOJA 1GMDG 1THRH 3W95A 4NCYA 4IN2A 1G36A 1P03A 3HK3B 1C1VH 3SU2A 1C5ZB 4Q7ZA 1A2CH 2ZC9H 4Y7BA 3MNSA 1Z6EA 1YF4A 4I8JA 1C2MA 1GBDA 1OWKA 1A4WH 1SOTA 1W7XH 2BZ6H 1CT4E 3M3VA 3M7UA 1AD8H 1LCYA 5EXMA 3TK6A 1BZXE 6LPRA 1HJAB 2BX3A 1PJPA 4Y0YE 3MOCA 2GZ9A 2XYAA 4DIHH 1QL9A 2OD3B 4Q2KA 3SJ9A 1A61H 4GPGA 2ZPSA 3PMAB 4J2YB 4E05H 5TJXA 1NRQH 4ZH8A 2BZAA 3T26A 3A83A 2BM2A 1A7SA 1VCWA 4OS5A 3QGJA 2XNIA 2BVXH 1GJBB 3GYLB 1W0YH 1Z8GA 3AASA 3QN7A 2OCVB 1A5HA 4OGXA 3ZVDA 3VXEH 3Q3KA 3RMNH 3VB3A 3SHCH 5JYIA 5A8YA 2XXLA 2ZDNA 1HPGA 1SLXB 3P92A 2A0QB 2WPHS 1UTPA 1WU1A 1V2QT 2FOHA 1Y8TA 2RA0A 1GJAB 1HDTH 1BBRH 5C5NA 4TWWA 1MTVA 4A92A 4XBCA 2GDDA 2VWNA 1OP8A 1P09A 1UTMA 2ZFSA 5EQSA 1XUHA 1AMHA 1GBBA 2QAAA 2ANWA 1P2OA 3ZZ4A 4DCDA 3AW1A 3RC5A 2BYAX 3U98H 2GCHF 1AE8H 3EAJA 4WJG2 1GBEA 3ZZBA 1KXDA 3A7XA 2FZZA 4WH6A 3SN8A 1AI8H 4K1EA 3A81A 3D62A 3KGPA 2ZU2A 4GAWA 5FPSA 1BTYA 3UR9A 3RM2H 4OS4A 5FX6A 4ZXYH 4NSVA 3S69A 1C2DA 1TPOA 3DUXH 2FWWA 5E0HA 2BDYA 2ZGBH 1XUGA 4INLA 2F9NA 1KDQA 5ESBA 4YLQH 3NWUA 1O5AB 3RP2A 1EPTA 3ZVGA 3TJOA 1Y3YA 1ARCA 2OTVA 1FY4A 1ELGA 4WMDA 1DM4B 1W7GH 1PPGE 3NXPA 3A86A 1MAYA 4GUXA 1FV9A 4D7FA 1P11E 1XX9A 5C3NA 4NFEA 1QURH 5FBIA 1HUTH 4K69A 1S6HA 1PFXC 3A82A 3GDVA 1UCYK 4MVNA 2HVXA 3PWCA 3VB6A 2TBSA 4AYVB 2PTCE 1BTWA 2J4IA 3ELAH 1OWIA 1ELAA 4GHQA 2M5TA 2A4OA 1E34B 5HM9A 4AFSA 2KAIB 4ZXXH 3KQDA 1O2OA 5EQQA 3UNSA 1HBTH 3P8OA 1CT0E 3H7TA 2ZDKA 4GSOA 1C1SA 3EA7A 2BLQA 4I32A 1ZSLA 2O8WA 2PKAA 4YT6H 1NM6A 2ZDMA 1FMGA 1QGFA 2PGBB 4FU7A 2GGVB 1EB1H 1ZJDA 1A3BH 1VJ9U 3UOPA 4X1PU 1AIXH 2Y5GA 1ELCA 1CHOG 1YCPK 3BG4B 1XVOA 2A4GA 1YGCH 4X1RU 3MU4A 1SR5C 2FDAA 2BVRH 3ZVCA 4FUCA 1O3PB 5FPYA 5AFYH 1AU8A 1C5LH 1C9TA 3B8JA 1GBCA 1P8VC 2STAE 1QCPA 2HPQH 1O3EA 4UE7H 4ZHLU 3EA8A 4WMFA 3MWIU 2NU1E 3MTYA 2WPJS 1ZRKA 1GCTB 1HIAB 1DUAA 1YLDA 3TITA 3VPKA 2WPKS 3VXFH 1TB6H 3SV2H 3I78A 1O2KA 1GI1A 1UHBA 1FIZA 1VCPA 1O3AA 1RTFB 1DANH 3GY4A 3Q77A 2P59A 2BLOA 1O31A 1O30A 1KY9A 1PQ5A 1OXGA 1F5KU 4BAQB 4K3JA 3B23B 3UQOA 3RU4D 1IHTH 2CV3A 1SGCA 3TVJB 2GZ8A 2F83A 3HGPA 3ZZDA 1JBUH 3F9HA 4A1VA 1VJAU 1LVMA 2ZDVH 1JRTA 1MAXA 3TIUA 1BMLA 2VGCB 5FAHA 2A31A 2HNTC 1Y5BT 1Z71A 4LZ4B 1D6RA 1GGDB 3TNTA 1EZXC 1NY22 2R2WU 3KQBA 2Z3EA 1KXEA 1W14U 2OC0A 3Q3XA 3TJUA 5CHAB 3UY9A 4FVBA 1TNHA 2ZCLP 2Y5HA 2AGGX 3V13A 5DG6A 5GJ4B 1TX6A 1UTOA 1GL1A 3LC3A 3SW2B 2J34A 2TGDA 2BMGB 1GHBF 3U8TH 1ZLRA 4A6LA 3FP6E 2GT8A 1C1OA 1FPHH 1DT2A 4GVUA 4Z6AH 2G81E 1BCUH 2Z9LA 2ZZUH 3TPIZ 1UVTH 4X2YA 3GY7A 1ELTA 3T27A 2BLVA 5ABWA 1T32A 1GI5A 3ZVFA 3URDA 4CRAA 3LU9B 2FEQH 2EA3A 2ZDAH 2C8YB 3SU5A 2JH6D 3RM0H 3NUMA 4JZIA 1HAYB 7LPRA 3MU8A 1QRZA 2A5AA 1SQTA 1PYTD 5FBEA 1MBMA 2IN2A 1C2JA 4Y79A 4CH8B 4O97A 3LGVA 4CR9A 1GI2A 3E16B 3VGCC 1S6FA 1DWCH 2K1QA 1HFDA
chains in the Genus database with same CATH superfamily
5K7RA 2YMSD 2Z3DA 1TWXB 3A80A 2HNTE 3GICB 2OQUA 1AB9B 1QBVH 3PV4A 1W8BH 1SGFG 1BBRK 2ALVA 3STIA 2F9OA 4NA8A 1SHHB 2ZNKH 3EE0B 2VIQA 1INCA 1O2PA 2ZPQA 4OS7A 3URCA 5T6GA 1OX1A 4F55A 2GTBA 3SZEA 1NZQH 1GPZA 1TOMH 4ABEA 3VB5A 1LPKB 4X2VA 1IQMA 1O2UA 3ODDA 3NRLA 2IPHA 1EJAA 1BRAA 4BAMB 2W6JD 1EAIA 1M9UA 1ESBA 4QT8C 3VFEA 4ACBA 1YC0A 4IMQA 2SGAA 2JKHA 1IQHA 1EQ9A 1UTKA 2ILNA 1EATA 2KFWA 1Y3VA 5DP8A 3GY5A 1ZPZA 4FU9A 3LIWA 3IG6B 3PMHB 4J1YA 2Z9IA 2A5IA 2AERH 2ANKH 3DA9B 4I7YH 2KR7A 2ZG0H 1BJUA 3D23A 2JETB 1W10U 3UFAA 3SU3A 4BAOB 3BEFB 1OKXA 1DFPA 3ZZCA 1UTNA 2A32A 1K1LA 1E37B 1P01A 4IGDA 1WOFA 3GYMA 3STJA 3LGWA 3RUOA 5T3HA 3A87A 1HAXB 1HAZB 2L74A 3JZ1B 3SGAE 1NN6A 2ZTZA 2BB4A 6CHAC 2R9PA 2J98A 2BD7A 4B71A 2XBYA 1S84A 1V3XA 4IS5A 1CGHA 1O5CB 2SGQE 3RXGA 1RIWB 1MBQA 2SNVA 2BDGA 3N7OA 3RC4A 1O32A 4HTCH 1ZMLA 3SU4A 2Y7ZA 1BB0B 1TGNA 3A7TA 5EPYA 3RU4E 4E7NA 4JMYA 1ARBA 1GHYH 3P95A 3FN8A 3PTBA 3MMGA 1BOQA 3A88A 3PLBA 1OS8A 2NU0E 2XBWA 2WHXA 1CBWC 1EZQA 3PMJA 3PO1B 3ATWA 1HAVB 2GV7A 3EA9A 3GCNA 2NU2E 2LP6A 3QTVH 2YMSC 4UFGH 4F48B 1DOJA 3GCHB 3QX5H 5TCCA 4I33A 1C1WH 4MPXA 3SQHE 2FTLE 1FPCH 1LQDB 2PSYA 4IMZA 4MTBA 4NIYA 3A8CA 2JH0D 1BMAA 1O3CA 3MH7A 1FDPA 2BX4A 5DP3A 1O36A 1G3EA 4X2WA 1C1TA 1O2HA 3RDZA 4IBLH 1ZHRA 5BRRE 3M3TA 1V2LT 3RXSA 1HJ9A 4K8YA 4RSPA 3MI4A 4XRNA 2ZKSA 3LGTA 3BG8A 4AC9A 1H8DH 5CMXH 3RU4T 4ZUHA 2FP7B 4Q7XA 1NRNH 4YTAA 2GMTC 2G8TA 3M37A 3G01A 4BTIB 3F9FA 1IQKA 1ELDE 1GHAF 2W3IA 2PUQH 4UFEH 4CHAC 1Q3XA 3GS9A 4NIXA 2KCOA 1GMCG 1H8IH 2FIRH 1IQIA 3CP7A 4FETA 3SUFA 1WSSH 3BIVH 4YO9A 5C20A 4ZCNA 1Y5AT 3ATIA 1C5YB 4Y10E 1C5XB 1MQ5A 1K28D 1J8AA 5FCKA 4X6OA 4UEHH 3QLPH 2Y81A 1D3TB 2FS9A 4BNRA 2RDLA 2GCTC 1CT2E 1UTLM 1AQ7A 3BTHE 2BDIA 4NA9H 1ETTH 1NRPH 8LPRA 5GWZA 1EPTC 1VGCC 1C2HA 4D8NA 2VWLA 2HNTF 5EXNA 4IC5A 3HKIB 3NKKA 1C2FA 2SGPE 1GJDB 2FTMA 2ZHQH 5E0JA 1AZZA 3LJJA 1U6QA 2VIVA 4M7GA 2UWOA 1RGQA 5CHBA 1T7CA 4H6TA 3MYWA 1ESTA 1IQFA 1OOKB 3AVZA 4AORA 5LPRA 1C1UH 4I8GA 2V3OH 3EGKH 1Y3XA 4NGAH 1KLTA 1C5VA 3R3GB 3SOSA 1BMMH 4INHA 1GI6A 4AGKA 5C1XA 4I8HA 4B2BA 5HXFA 1HB0B 1D3DB 3LGUA 3ZZ7A 1JRSA 1TAWA 3V12A 4JK5A 2A2QH 4KP0A 2ZFQH 3ZIAD 5CDFE 4ZKOU 1UVSH 1NFXA 4DT7B 4AFZA 2Z7FE 2OP9A 2K0QA 1LKAA 1GJ8B 1ZR0A 1Q31A 1XXFA 1C2IA 2XTTB 4JZ1A 3BTGE 2UWPA 1PQ8A 2P95A 2ZA5A 1BA8B 3SJOA 1P3EA 1GG6C 2W7UA 2A2XH 2V35A 1UMAH 1DY9A 2DE8A 1DXWA 1L2EA 1LKBA 3BTTE 2R2MB 1QQUA 1SGPE 2QXJA 2AMDA 5IK2D 2IJD1 3F2FA 1RTLA 3MH4A 5B6LA 1OYTH 1NO9H 2KAIA 3Q00A 3FP8E 5T6DA 1C5QA 2I6SA 3UNQA 4X1SU 2WZQA 1O3IA 4UONA 3DHKH 4FXGH 5A0BA 1O3LA 4DJZB 3RXAA 1MD8A 1O2NA 1EAUA 2O8UA 1E36B 1Q2WA 3MH5A 3QO6A 2B8OH 5AFZH 1FX0B 1YPLH 1MTWA 5EPNA 1AZ8A 1OWJA 2UUFB 1P02A 1GI0A 2CF8H 1FAXA 1QL8A 1WQSA 2ZI2H 4ISIH 1F7ZA 3GDSA 1TGTA 1LO6A 4X8UH 2ZGJA 2WYJA 2P8OB 2VIDA 2Z94A 2QC2A 3ZZ5A 1NPMA 7KMEH 2EC9H 3SV7A 3A85A 3P8GA 5KGOA 2PKSB 1PPEE 2BD3A 1TIOA 2ZU4A 3ZZ6A 4ABFA 3A7YA 3RXBA 1DPOA 2UUYA 2WINI 1C2KA 1KLIH 1TNJA 2VVUA 4WXIA 1NFWA 3UNRA 2GP9B 1S81A 1SQRA 1Z7KA 1GI7B 2BDCA 3WW7A 1K1JA 1DY8A 4ISOA 3F9GA 3IITA 1Y3WA 1COWD 3DSGA 4MQAA 1GHBG 1ANEA 4AB8A 1HIAA 4GCHF 3TNSA 1C1NA 3DFJA 1B0FA 4BOHA 3Q3YA 2ANYA 4FUFA 1A1RA 1DLEA 2ASUB 1HRTH 5HM2A 2JH5D 3SYJA 5LPEA 4ISNA 2Z6BD 4K1SA 1GMCF 1AVGH 3SBKA 1W12U 2C93B 1RTKA 3KYGA 2ZGCA 3N7EA 4K5ZA 3GOVB 1E1QD 4DVAU 1KSNA 2JIZD 4ZHAA 2ZHEH 2LNCA 3KQEA 3AK5A 2FOBA 3GY3A 5DGJA 1SGDE 2GT7A 2ZF0H 1C2EA 2ZECA 4ABGA 2R0KA 3RXKA 1GMHG 4Z1MD 3BTWE 3A8AA 2CJIA 2HOBA 2VINA 3M5OA 2NU4E 3SV9A 1O3MA 4B2CA 2VBCA 7ESTE 1V2RT 4WWYA 4Y7AA 1C4U2 3QTOH 1TNKA 4R8TB 1BHXF 1QZ8A 1TONA 1QY6A 1RFNA 1S83A 4B75A 2QGRA 2ZHFH 2BY9X 5E2PA 1T4VH 1TX8A 1EAXA 3LC5A 1VR1H 5I46H 5C5OA 4AGJA 3BTDE 3MNCA 1FIWA 1N8OB 3RXVA 1DVAH 1Y3UA 1BTUA 1O2IA 5A0CA 1O3FA 1O5GH 4OS6A 1MABB 1FLEE 3FAOA 1A0JA 1DSTA 1LHFH 4FUEA 3QZRA 1EASA 2QCYA 4HFPB 2OK5A 4ZAEA 1SLWB 3WY8A 1DS2E 3IWMA 1KXCA 2ZCKP 5EODA 2EQNA 3D49H 3OSYA 4AG1A 2D1JA 1TPAE 1SHYA 1TMBH 5F8TA 2FMJA 1LQEA 4FVDA 1FN6A 4MPWA 2H9EH 2CHAC 4VGCC 5GXPA 3W94A 1G3DA 2W3KA 2Q1JA 4D9RA 2XRCA 2UUJB 4LK4A 1ZPCA 5L6NH 2ODQA 1O5EH 2BD2A 2VU8E 2OC7A 1AHTH 2O8MA 2AIPA 1SGNE 1UTQA 5HYOA 2YMSB 2KM0A 1A46H 1C5PA 3U1IB 1C1PA 1V2ST 5EW2H 1UVPA 3QWCH 1WTGH 2ESTE 3SGBE 3BIUH 2AGEX 1B5GH 2ANMH 4TPIZ 1KIGH 5FXLA 1ABIH 5JBAS 3DFLA 5DKMA 2BHGA 2FLRH 2FO9A 1P12E 1TABE 1CA8B 4MPUA 1JMOH 2Q6DA 1ELEE 3E1XB 1SGQE 2XCNA 3FZZA 3LH3A 4KTCA 1TQ0B 4MNYA 1Z8IB 3GCTG 4O9VA 1NU7B 2FLBH 1SOZA 2V3MA 3BTFE 1LVBA 1K0HA 1TALA 2STBE 1DWDH 1GBLA 3DSOA 4YOIA 4U30A 4GHTA 2FOGA 4FOUC 1YPMH 8ESTE 1ZSJA 3RMMH 1ANBA 1CU1A 4A7IB 3KN2A 4ABIA 1G9IE 2GDEH 1P05A 5A8ZA 2ZP0H 2AHME 1FI8A 2KCPA 4ZROA 2WV9A 4O03A 1FZZA 2KCYA 1E0FD 1EZSC 1ZPBA 2ZIQH 4NFFA 1TRMA 3PV5A 5EIYA 4X2XA 5GNDA 2J95A 1C4Y2 2R0LA 3LKWA 2J5UA 1V2JT 2PV9B 1JOUB 4MNWA 2ZTYA 1K9OE 3NCLA 5LPFA 8KME2 1TX7A 1O35A 1YBWA 2GKVE 1GDNA 1QB9A 3E91A 1O2WA 2WPLS 3P70B 4TYDA 1D6WA 1SFIA 3HK6B 1ZGIA 1GHAG 1DICA 2HWLB 2ODPA 1G2LA 3N7DA 1SGTA 1C5NH 1KXFA 1HJAC 1YM0A 3TU7H 4B2AA 1YKTA 1H9HE 1WYKA 4INKA 4RT1A 1XXDA 1YWUA 1YPHC 1F0RA 2TGPZ 3KCGH 1HAVA 3MO3A 1WXRA 4UD9H 2XC0A 4DIIH 1GBFA 3T28A 1TRNA 1S5SA 3CENA 3L33A 1EJMA 2G52A 1LHEH 1GMHF 1GJCB 1SLUB 3KIDU 1TYNA 1WTHD 1O2SA 1TA6A 1P04A 2HALA 1BTXA 3F9EA 3V0XA 4UDWH 1QFKH 4ISHH 1THSH 4SGBE 2PKAB 5ETXA 1O2JA 2XC4A 1C5SA 1CHGA 3A7WA 4DG4A 1TBRH 4AB9A 3W1EA 2EI6A 1MQ6A 1RXPA 4NWLA 2AMPA 5SGAE 2VIOA 4ABHA 2V7QD 1MMJN 2A5KA 3MFJA 1W3CA 3TH3H 3SZNA 1RS0A 4NWKA 2B7DH 4LZ1H 2ZDLA 4NG9H 4U2WA 1H9IE 1ZTLA 3OEED 2A7HA 2BDHA 3OY6U 3FFGA 4PROA 4O3UA 1K1MA 4FU8A 4AFQA 4CRBA 1MU6B 4CRCA 1QL7A 4D9QA 2BOKA 5C0TA 3TH2H 3JZ2B 3UOUA 3GY8A 1P2QA 2WV5A 2XNDD 3BV9B 1S85A 2AYWA 3RXCA 1P10A 3LH1A 1H8HD 1HAGE 1GL0E 2ZFPH 2GVFA 5BPEA 2OC8A 1BIOA 1YPHE 1L1GA 1MH0A 3ATKA 1L0ZA 3K65B 4HZHA 5AVDA 1C4V2 4Y0ZE 4YT7H 1DITH 1HNEE 1AVXA 1CGIE 1K21H 1ZHPA 4I8KA 2QYIA 3SNAA 1GHVH 1IHSH 1G30B 4IN1A 1HLTH 1C5MD 4TWYA 1NRRH 4XSKU 2PGQB 4WVPE 5FX5A 2ZGHA 1GJ7B 1SGEE 3PROA 1CSOE 1W0ZU 5DP9A 1O2QA 1P0SH 1XUKA 3K6ZA 8GCHF 4TT3D 3SU6A 1DE7H 2BDBA 1V2NT 2FYQA 3V3MA 3A7ZA 1O2LA 4CR5A 3LPRA 1LHCH 2H9TH 2FX4A 2QE7D 1TBZH 2EI8A 2QY0B 3B9FH 4E7RG 1GVKB 3GCTF 1PQAA 3O8BA 4E06H 4JYVH 3NZIA 3RC6A 1F0UA 4X6PA 5E2OA 1CVWH 5F03A 3SJ8A 3S9AA 1MZAA 5EJZA 3PRDA 3O8RA 1MUEB 3FANA 4RI0A 1O38A 5DN6D 4YLUA 4P00A 3U1JB 1DX5M 4D76A 3T29A 1F0SA 1T8LA 4DGJA 2P93A 1TFXA 1VCQA 1J17T 2BTCE 3SNCA 2CGAA 3MQKC 2BVSH 2FPZA 1O3JA 2ZCHP 2OUAA 3A8DA 2P94A 3BG4C 4TY7A 4Y11E 4AZ2B 3TGJE 1SQAA 1BRCE 1O5FH 2GX4A 2D2DA 1D4PB 4K1TA 1V2UT 2Y6TA 1GHWH 3K2UA 1AFQC 1TMUH 4HG6A 4ASHA 2AFQB 2BOHB 2HGTH 3T25A 1TA2A 5EW1H 2G5VA 3LDXH 5TCAA 1O2RA 2UUKB 4FUBA 1CA0C 1IAUA 2BD5A 3UTUH 1ESAA 2ALPA 2IJOB 1EZUC 1O3NA 4GCHG 4BAKB 2C8ZB 2DUCA 1EP6A 3UWIA 2V6NA 2I6QA 1A0LA 1DXPA 2GD4B 2F91A 1GCTC 2PUXB 4YM9A 1Y5UT 3TGKE 3OY5U 3FVFB 2Z9JA 3ZZ3A 3SO3A 4JYUH 2J2UA 3RXDA 3SQEE 3P8NA 2ZO3H 1AUTC 1BTPA 3LJOA 1HXEH 1P2MA 1GJ6A 1NBMD 2PR3A 5C17A 1TOCB 1QHRB 5G4BA 3SUEA 4FUDA 1T8NA 1YPEH 2F9VA 4Y8XA 2VIWA 3P6ZB 1GBKA 1L1JA 1YPKH 2JJ2D 4RKJB 3UREA 2BD8A 3VB7A 1BRBE 3BTQE 4CREA 3S9BA 2TGAA 2OINA 1NFUA 2IOTA 1BDAA 2VVCA 1SPJA 1C5OH 1CO7E 1XKAC 2XCFA 1C2GA 3EDXB 1PPHE 1ZHMA 3SI3H 1EAWA 1G3CA 1V2PT 3RXUA 1Z1JA 5DK1A 4CBNA 4JZDH 1GGDC 1S82A 1TPPA 3K6YA 3P17H 5C1YA 3VEQB 1NT1A 3KQ5A 2FS8A 3GDUA 1KXAA 2ZU3A 2B5TB 3F0PA 5CHAC 1LPZB 6GCHF 4VGCB 3RXQA 2ZU1A 1EKBB 1FY5A 5DO4H 1A5IA 5DP6A 1SVPA 2D26C 3KL6A 1O3BA 2F43B 4H4FA 1HAOH 1S0RA 1T8OA 1TNGA 2VNTA 1WCZA 6ESTA 1V2TT 1ZMNA 5A8XA 2BQ7B 1Z8RA 3P8FA 1EX3A 1KYNA 1JXPA 3PLPA 1UVUH 3M5MA 4TY6A 2BY7X 3KNXA 1GDUA 4MNVA 3UIRA 3LOXA 2BLWA 3RMOH 2FI3E 4DW2U 3ZYDA 4WXVA 1O39A 1QB6A 1FAKH 1H4WA 5EQRA 2BXTH 3N99A 4RKOB 1O33A 1OP2A 1MKWH 3M3SA 1A5GH 1EXFA 1KLJH 1LMWB 1HAIH 1SLVB 3U8RH 4A1XA 5I25A 1T4UH 1J14A 2H9HA 1NC6A 1L4DA 2AS9A 1OWDA 1KXBA 4XBDA 2WPIS 2FOFA 1Z6JH 1O3GA 2ZTXA 5FPTA 1TQ7B 3LONA 2ZFRH 2A7JA 3PB1E 1V2OT 1HGTH 2XW9A 4RN6A 5J4QA 4NIVA 2SNWA 4JYTA 4ISLA 1IQLA 4K2YA 4UFFH 1AB9C 1UK2A 1SG8B 2ZQ2A 4U32A 1GHXH 2D8WA 2C8XB 1P2IA 5HMAA 3SHAH 3BTEE 1GVZA 2BY5X 1TBQH 1C9PA 1ZMJA 2FOEA 5DJ7A 1EOJA 1XMNB 3FZDA 1IQGA 2C3SA 2THFB 1XUIA 2BD4A 2BQWB 4TPYA 4XOJA 4AFUA 5C1UA 1HYLA 2ZQ1A 1SI5H 1HAPH 4THNH 4F4OC 4JZFH 4Q7YA 1DWBH 2V3HH 1P2KA 1PPFE 3DSPA 4JK6A 2OBQA 5A2MH 3PTNA 1VZQH 5L30H 4ASUD 1DLKB 5A0AE 9ESTA 1GVLA 3TJVA 3NK8A 3KYFA 1ZTKA 1N6YA 4KGAA 1ETRH 4KKDA 4NIWA 3ZVEA 3LGIA 5JPMH 4WY3A 3GISB 3PRBA 1B7XB 1SQOA 3MH6A 1XM1A 4FUJA 4KELA 1Z1IA 3SNBA 2QA9E 1V2VT 3H7OA 2JETC 1OSSA 1OWHA 3M35A 1KTSB 5EXLA 2G55A 3BEUA 2F9PA 2ZWLH 2M2AA 3K9XB 3M5NA 4B1TA 2PP6A 3VGCB 3RLWH 3GY6A 1SC8U 3E90B 2AMQA 1CQQA 1LTOA 3PV2A 3AW0A 5C0UA 2PW8H 1FNIA 5EJ1A 1YLNA 2AGIX 2K8IA 2RFKC 2A7CA 1N6XA 2QIQA 3F6UH 3HPTB 1BJVA 2SGDE 1TGCA 2BDAA 2DE9A 2FI5E 2HLCA 2ZU5A 2W26A 1QJ7B 5EOKA 1PPZA 2J92A 2TIOA 3U8OH 4Q80A 2J38A 1RIWC 1NBME 2H2ZA 1WUNH 2WUCA 1YP9A 1GBHA 1ACBE 1DDJA 2NWNA 1GWAA 5CE1A 2W5EA 2KX4A 4BTTB 3SNDA 4CBOA 1RRKA 1QB1A 1HV7A 5E8EH 2WPMS 4U01A 3BTME 5LH8A 2ZHDA 3E6PH 2SGFE 1QBNA 4CH2B 3PO1C 1NROH 1AKSB 4H6SB 4A1TA 1F5LA 5C67A 3SJIA 5L2ZH 2RA3A 2HVYB 4FUHA 5C2ZA 1BQYA 3GCHC 3F2HA 2B9LA 3MU0A 4YZUA 4X1QU 2BXUH 1NU9A 1TPSA 1AN1E 2A4QA 5HGGA 1K1NA 2NU3E 2PHBA 3ZZ9A 3ATLA 1TRYA 1C2LA 5DP5A 3S9CA 1UW7A 3A7VA 3KEEA 1O5DH 1FONA 1XKBC 4ZKSU 1QRXA 3ESTA 2XOKD 2PWXA 1O3DA 2Y7XA 1XVMA 1GDQA 1GJ4H 1HCGA 2CN0H 1ELFA 2QXIA 2TPIZ 5JB8S 1T31A 2BY6X 3OYPA 5L2YH 5K0HA 1J16A 2CMYA 3T62A 3RXRA 1UTJA 4GLYA 2G00A 5JB9S 4AG2A 5PTPA 3RMLH 5H4IB 4DOQA 1GI4A 3ODFA 3RLYH 1GJ9B 4O3TA 1VITG 5FHTA 1P06A 1SGIB 2XWAA 4ABJA 4DURA 1LHGH 3OX7U 6CHAB 4CRDA 4ACAA 5DP7A 1XUJA 3AAVA 1EOLA 1SL3A 3UWJH 1SFQB 1JIMA 7GCHF 1SSXA 1X7AC 5EGMA 1E35B 2EEKA 4HI3A 3U69H 4OGYA 1SMFE 2SFAA 3TGIE 3E0PB 1O3HA 1LVOA 2YNAA 3LT3A 3SNEA 3SUDA 2G4UA 2CF9H 1PQ7A 1MCTA 2Q6FA 3BEIB 3FKSD 4B74A 4ABAA 1D9IA 2P3TB 1ZGVA 3OEHD 3PYHA 3DT0H 1CBWB 3TK9A 4Y8ZA 1UCYE 3ENSB 5EU8A 4ABBA 1FQ3A 1BUIA 1K1IA 2JJ1D 2G4TA 1W11U 3RXHA 2FESH 4DT4A 4AOQA 8GCHG 1WBGB 3ZVAA 2FODA 2O8TA 1FN8A 1G37A 2BD9A 1NESE 3M61U 3A84A 3SU1A 4IC6A 1BHXB 3SV8A 3MO9A 1O2YA 1ZOMA 3TH4H 3MO6A 2P3FH 3M7QA 1AFQB 3MU5A 4Q63A 4FUIA 1GMDF 4D7GA 4DY7B 1G32B 4XE4A 1CGJE 5T1VA 1S6LA 4YOGA 4YESB 4X0WU 1CA0B 3E3TA 1EUFA 2FXRA 2EI7A 4BXWA 2CK3D 1MKXK 1MKWK 1MTNC 5JBCS 2AIQA 1O0DH 3QK1A 4SGAE 1KTTB 1P2NA 1V6DA 3S7KB 1F5RA 2GMTB 3M7TA 2PFEA 1L1NA 3V7TA 1OPHB 3ITIA 3GY2A 4CHAB 4WF8A 3UQVA 2LPRA 3C27B 2R3YA 3T5FH 9LPRA 1UO6A 3S7HB 5C94A 2G5NA 2OXSA 3DD2H 3CS0A 2J9NA 1O2TA 1NS3A 1OP0A 1P9UA 1BTZA 2LELA 2GCTB 5DSFA 3QGNB 4A5TS 1GJ5H 3HKJB 3SUGA 1AE5A 2AEIH 1KDQB 2BY8X 2B0FA 2Y82A 5GCHG 5ESTE 4AYYB 1C5WB 2Y80A 2GV6A 4ZHMU 2FOCA 1ANDA 1EPTB 1VGCB 2F4LA 1F2SE 2F9UA 3M36A 1FY3A 3EYDA 2VJ1A 3SV6A 4I31A 3QZQA 5GIBA 3PLKA 1TGBA 3SI4H 3ZZAA 1K2I1 4BANB 2QV1A 3O8CA 1O2VA 1TE0A 2O9QA 3NPSA 1C5UA 1OWEA 2VVVA 3PWBA 1GI3A 2FYRA 1JWTA 1DWEH 2FOMB 2Z9KA 2H5CA 1QA0A 4Z0KA 4Y8YA 3Q76A 4K8BA 2KZ4A 4LOYH 1Y59T 2J94A 4BAHB 2HPPH 2P8OC 5FCRA 1TLDA 1TNLA 1PPBH 2PKSC 2YOLA 2VH0A 2OLGA 1MD7A 1F92A 4I8LA 2RG3A 1TMTH 1H9LB 1V2WT 1RJXB 4X6MA 6GCHG 1W2KH 1DSUA 4TSFD 2Q6GA 2A4RA 2SGEE 1HAHH 2TRMA 1P9SA 1FY8E 2FX6A 1K1OA 2ZHWH 4UFDH 3UR6A 1GBMA 1UVOA 1MTUA 3I29A 3EQ0H 1IQEA 2QXHA 1GG6B 1NFYA 5F8ZA 1PPCE 3MNBA 4ZKRU 1T8MA 2H1UA 4ZKNU 2ZGXH 2C4FH 3BSQA 1ETSH 1VITF 2Z9GA 1AVWA 2H5DA 4WMEA 3L6PA 3KQCA 1A3EH 3HATH 5DPAA 3OTPA 2PLXA 1QBOA 1QQ4A 4FUGA 1SGYE 2XWBI 1E1RD 1G3BA 2W7SA 2WUBA 1GBIA 3TJNA 5B6OA 2ULLA 1QR3E 4HGCA 1MU8B 2XC5A 2J97A 1W0JD 1YY3A 2ZPRA 4NZQA 4CRGA 3R0FA 1C5RA 1WV7H 2QF0A 1QIXB 1UHBB 2VH6A 3SJKA 1D3PB 3SU0A 5EG4A 1UJ1A 4X6NA 1BBRE 1YCPM 1GBAA 2VB0A 1IOEA 1EJNA 3F0OA 1SBWA 1WAYB 5E0GA 2ZFFH 2AH4X 1UK3A 2F9BH 2QF4A 2QN5T 1W13U 3CS7A 5FL7D 3E8LA 1J15A 1O2MA 3RXIA 1O3KA 3ZV9A 5LGOA 1CHOF 1K1PA 4MG3A 3H5CB 1NTPA 3ZV8A 4H42U 2Z3CA 3F1SB 1YPGH 3OU0A 1AGJA 4MLFB 3TK5A 3OTJE 1E38B 3KHVA 1C1QA 1BTHH 2RDEA 3VB4A 4XDEA 1N8OC 4B76A 2FM2A 3E0NB 5AHGH 3TLOA 2TGTA 1ELBA 4MNXA 2VWOA 3F68H 3FO8D 4Y6DA 1DUEA 2QXGA 2V0BA 2FOAA 1SKYE 1A0HB 1BRUP 2F3CE 1GBTA 1S0QA 1QRWA 1BT7A 1O37A 5J4SA 1P57B 1EB2A 1HXFH 4YXWD 3FP7E 1ORFA 1AUJA 1ZTJA 1PYTC 3ZYEA 2G51A 2P3UB 1P3CA 4MDSA 4K60A 4NA7A 4IW4E 4LXBH 1ID5H 1L4ZA 2UWLA 5A09A 2IPQX 1IQNA 4B73A 2C90B 1LDTT 2ZEBA 1VITH 1YLCA 3UPEA 4BXSA 1VKYA 2XBXA 1GCDA 1XUFA 4R0IA 4X8TH 1SGFA 5GCHF 4OM9A 1TNIA 3ATMA 3QDZB 1OYQA 1QNJA 4XBBA 5GPIB 1V2MT 1B0EA 3UUZA 1ZJKA 5F6MA 4JZEH 1LPGB 3RXMA 1GI9B 4XD7D 3RXLA 3D65E 3MNXA 1AFEH 2ODYB 1YPJH 2A45B 1JIRA 1ANCA 4X1NU 1QA7A 5EJLA 5JBTA 1K22H 2P16A 1UCYH 3O8DA 3LGYA 1GHZA 1ZZZA 4ESTE 1C5TA 4JCNA 3UAIC 1P2JA 4BTUB 1LHDH 1G2MA 1LVYA 5IYTA 2WYGA 1ZSKA 1AWFH 2GCHG 1ZRBA 2PSXA 3A8BA 3RXEA 1F0TA 3OE7D 3M5LA 3SORA 1GBJA 2HRVA 2OC1A 1O2ZA 1BITA 5DP4A 1MTSA 2VGCC 3GCOA 3PMBB 3QUMP 4P02A 3ZVBA 1O2XA 3RXOA 1FUJA 3MU1A 4X8VH 2CXVA 3RXPA 4CRFA 2W6ID 1BMFD 4F49A 4AX9H 4Y76A 3BTKE 3BN9A 2CHAB 3AAUA 3HGNA 4NZLA 3CNRA 3S0NA 1QTFA 2WV4A 4M9FA 4AN7A 2A1DB 1UK4A 1MZDA 2C8WB 3BF6H 2RCEA 2PTNA 1C1MA 1YCPH 4MPVA 5F8XA 1QJ6B 1CE5A 3RXTA 4ZMAH 1FJSA 1RD3B 1ELVA 3C1KA 2XBVA 2O8LA 1FY1A 1TGSZ 3RXFA 1EP5A 5AF9H 5GDSH 1THPB 4WH8A 1QJ1B 1H1BA 2OBOA 7GCHG 3PM3A 2BQ6B 4OS2A 1ZYOA 1MKXH 3MHWU 4ABDA 2J98B 1WQVH 1D3QB 1SGRE 1AKSA 2GZ7A 2QF5A 1HJ8A 3I77A 1MCVA 1J9CH 5T6FA 4Y71A 4KTSA 1MTNB 2R3UA 5JBBS 1V2KT 1AO5A 2VIPA 3KF2A 3A89A 1IQJA 1O3OA 3EE7A 1O5BB 2ZFTA 3RXJA 2OQ5A 1C1RA 1GI8B 2QF3A 2VWMA 2Y5FA 2WPDD 1SB1H 3L3TA 2H6MA 3SGQE 1O34A 1AWHB 3ZZ8A 1YYY1 1BMNH 1ABJH 1Z8JB 4KTUA 5IDKA 3T2NA 1O2GH 4RT0A 1AY6H 4NSYA 4X8SH 3U9AH 2FI4E 1FXYA 2YNBA 5JDUB 4OS1A 4XFQA 1NRSH 2JDID 1N1LA 4YOJA 3U28C 1GMDG 1THRH 3W95A 4NCYA 4IN2A 1G36A 1P03A 3HK3B 1C1VH 3SU2A 1C5ZB 4Q7ZA 1A2CH 2ZC9H 3UB0A 4Y7BA 3MNSA 1Z6EA 1YF4A 4I8JA 3FOAA 1C2MA 1GBDA 1OWKA 1A4WH 1SOTA 1W7XH 2BZ6H 1CT4E 3M3VA 3M7UA 1AD8H 1LCYA 5EXMA 3TK6A 1BZXE 5HIYA 6LPRA 1HJAB 2BX3A 1PJPA 4Y0YE 3MOCA 2GZ9A 3OAAD 2XYAA 4DIHH 1QL9A 2OD3B 4Q2KA 3SJ9A 1A61H 4GPGA 2ZPSA 3PMAB 4J2YB 4E05H 5TJXA 1NRQH 4ZH8A 5KEDA 2BZAA 4I86A 3T26A 3A83A 2BM2A 1A7SA 1VCWA 4OS5A 3QGJA 5KECA 2XNIA 2BVXH 1GJBB 3GYLB 1W0YH 1Z8GA 3AASA 3QN7A 2OCVB 1A5HA 4OGXA 3ZVDA 3VXEH 3Q3KA 3RMNH 3VB3A 3SHCH 5JYIA 5A8YA 1KMHB 2GJGA 2XXLA 2ZDNA 1HPGA 1SLXB 3P92A 3H09A 2A0QB 2WPHS 1WDIA 1UTPA 1WU1A 1V2QT 2FOHA 1Y8TA 2RA0A 1GJAB 1HDTH 1BBRH 3DCLA 5C5NA 4TWWA 1MTVA 4A92A 4XBCA 2GDDA 2VWNA 1OP8A 1P09A 1UTMA 2ZFSA 5EQSA 1XUHA 1AMHA 1GBBA 2QAAA 2ANWA 1P2OA 3ZZ4A 4DCDA 3AW1A 3RC5A 2BYAX 3U98H 2GCHF 1AE8H 3EAJA 4WJG2 1GBEA 3ZZBA 1KXDA 3A7XA 2FZZA 4WH6A 3SN8A 1AI8H 4K1EA 3A81A 3D62A 3KGPA 3WWFA 2ZU2A 5F53A 4GAWA 5FPSA 1BTYA 3UR9A 3RM2H 4OS4A 5FX6A 4ZXYH 4NSVA 3S69A 1C2DA 1TPOA 3DUXH 2FWWA 5E0HA 2BDYA 2ZGBH 1XUGA 4INLA 2F9NA 1KDQA 5ESBA 4YLQH 3NWUA 1O5AB 3RP2A 1EPTA 3ZVGA 3TJOA 1Y3YA 1ARCA 2OTVA 1FY4A 1ELGA 4WMDA 1DM4B 1W7GH 1PPGE 3NXPA 3A86A 1MAYA 4GUXA 1FV9A 4D7FA 1P11E 1XX9A 5C3NA 4NFEA 1QURH 5FBIA 1HUTH 3WWBA 4K69A 1S6HA 1PFXC 3A82A 3GDVA 1UCYK 4MVNA 2HVXA 3PWCA 3VB6A 2TBSA 4AYVB 2PTCE 1BTWA 2J4IA 3ELAH 1OWIA 1ELAA 4GHQA 2M5TA 2A4OA 1E34B 5HM9A 4AFSA 2KAIB 4ZXXH 3KQDA 1O2OA 5EQQA 3UNSA 1HBTH 3P8OA 1CT0E 3H7TA 3VG8A 2ZDKA 1EFRD 4GSOA 1C1SA 4B6FA 3EA7A 2BLQA 4I32A 1ZSLA 2O8WA 2PKAA 4YT6H 1NM6A 2WSSD 2ZDMA 1FMGA 1QGFA 2PGBB 4FU7A 2GGVB 1EB1H 1ZJDA 1A3BH 1VJ9U 3UOPA 4X1PU 4B6EA 1AIXH 2Y5GA 1ELCA 3F3BA 1CHOG 1YCPK 3BG4B 1XVOA 2A4GA 1YGCH 4X1RU 3MU4A 1SR5C 2FDAA 2BVRH 1W0KD 3ZVCA 4FUCA 1O3PB 5FPYA 5AFYH 1AU8A 1C5LH 1C9TA 3B8JA 1GBCA 1P8VC 2STAE 1QCPA 2HPQH 1O3EA 2HLDD 4UE7H 4ZHLU 3EA8A 4WMFA 3MWIU 2NU1E 3MTYA 2WPJS 1ZRKA 1GCTB 1HIAB 1DUAA 1YLDA 3TITA 3VPKA 2WPKS 3VXFH 1TB6H 3SV2H 3I78A 3F2GA 1O2KA 1GI1A 1UHBA 1FIZA 1VCPA 1O3AA 1RTFB 1DANH 3GY4A 3Q77A 2P59A 2BLOA 1O31A 1O30A 1KY9A 1PQ5A 1OXGA 1F5KU 4BAQB 4K3JA 3B23B 3UQOA 3RU4D 1IHTH 2CV3A 1SGCA 3TVJB 2GZ8A 2F83A 3HGPA 3ZZDA 1JBUH 3F9HA 4A1VA 1VJAU 1LVMA 2ZDVH 1JRTA 1E79D 1MAXA 1BMLA 3OFND 3TIUA 2VGCB 5FAHA 2A31A 2HNTC 1Y5BT 1Z71A 4LZ4B 1D6RA 1GGDB 3TNTA 1EZXC 1NY22 2R2WU 3KQBA 2Z3EA 1KXEA 1W14U 2OC0A 3Q3XA 3TJUA 5CHAB 2KCAA 3UY9A 4FVBA 1TNHA 2ZCLP 2Y5HA 2AGGX 3V13A 5DG6A 5GJ4B 1TX6A 1UTOA 1GL1A 3LC3A 3SW2B 2J34A 2TGDA 2BMGB 1GHBF 3U8TH 1ZLRA 4A6LA 3FP6E 2GT8A 1C1OA 1FPHH 1DT2A 4GVUA 4Z6AH 1H8ED 2G81E 1BCUH 2Z9LA 2ZZUH 3TPIZ 1UVTH 4X2YA 3GY7A 1ELTA 3T27A 2BLVA 5ABWA 1T32A 1GI5A 3ZVFA 3URDA 4CRAA 3LU9B 2FEQH 2EA3A 4Q4LA 2ZDAH 2C8YB 3SU5A 2JH6D 3RM0H 2L6OA 5HIZA 5HKKD 3NUMA 4JZIA 1HAYB 7LPRA 3MU8A 1QRZA 2A5AA 1OHHD 1PYTD 1SQTA 5FBEA 1MBMA 2IN2A 1C2JA 4Y79A 4CH8B 4O97A 3LGVA 4CR9A 1GI2A 2EY4C 3E16B 3VGCC 1S6FA 1DWCH 2K1QA 1HFDA
chains in the Genus database with same CATH topology
5K7RA 2Z3DA 1TWXB 3A80A 2HNTE 3GICB 2OQUA 1AB9B 1QBVH 3PV4A 1W8BH 1SGFG 1BBRK 2ALVA 3STIA 2F9OA 4NA8A 1SHHB 2ZNKH 3EE0B 2VIQA 1INCA 1O2PA 2ZPQA 4OS7A 3URCA 5T6GA 1OX1A 2GTBA 1NZQH 1GPZA 1TOMH 4ABEA 3VB5A 1LPKB 4X2VA 1IQMA 1O2UA 3ODDA 2IPHA 1EJAA 1BRAA 4BAMB 1EAIA 1M9UA 1ESBA 4QT8C 3VFEA 1YC0A 4IMQA 2SGAA 2JKHA 1IQHA 1EQ9A 1UTKA 2ILNA 1EATA 1Y3VA 5DP8A 3GY5A 1ZPZA 4FU9A 3LIWA 3IG6B 3PMHB 4J1YA 2Z9IA 2A5IA 2AERH 2ANKH 3DA9B 4I7YH 2ZG0H 1BJUA 3D23A 2JETB 1W10U 3UFAA 3SU3A 4BAOB 3BEFB 1OKXA 1DFPA 3ZZCA 1UTNA 2A32A 1K1LA 1E37B 1P01A 4IGDA 1WOFA 3GYMA 3STJA 3LGWA 3RUOA 5T3HA 3A87A 1HAXB 1HAZB 3JZ1B 3SGAE 1NN6A 2ZTZA 2BB4A 6CHAC 2R9PA 2BD7A 4B71A 2XBYA 1S84A 1V3XA 4IS5A 1CGHA 1O5CB 2SGQE 3RXGA 1RIWB 1MBQA 2SNVA 2BDGA 3N7OA 3RC4A 1O32A 4HTCH 1ZMLA 3SU4A 2Y7ZA 1BB0B 1TGNA 3A7TA 5EPYA 3RU4E 4E7NA 4JMYA 1ARBA 1GHYH 3P95A 3PTBA 3MMGA 1BOQA 3A88A 3PLBA 1OS8A 2NU0E 2XBWA 1CBWC 1EZQA 3PMJA 3PO1B 3ATWA 1HAVB 2GV7A 3EA9A 3GCNA 2NU2E 3QTVH 4UFGH 1DOJA 3GCHB 3QX5H 5TCCA 4I33A 1C1WH 4MPXA 3SQHE 2FTLE 1FPCH 1LQDB 2PSYA 4IMZA 4MTBA 4NIYA 3A8CA 2JH0D 1BMAA 1O3CA 3MH7A 1FDPA 2BX4A 5DP3A 1O36A 1G3EA 4X2WA 1C1TA 1O2HA 3RDZA 4IBLH 1ZHRA 5BRRE 3M3TA 1V2LT 3RXSA 1HJ9A 4K8YA 4RSPA 3MI4A 2ZKSA 3LGTA 3BG8A 1H8DH 5CMXH 3RU4T 4ZUHA 2FP7B 4Q7XA 1NRNH 4YTAA 2GMTC 2G8TA 3M37A 3G01A 4BTIB 3F9FA 1IQKA 1ELDE 1GHAF 2W3IA 2PUQH 4UFEH 4CHAC 1Q3XA 4NIXA 1GMCG 1H8IH 2FIRH 1IQIA 3CP7A 3SUFA 1WSSH 3BIVH 4YO9A 5C20A 1Y5AT 3ATIA 1C5YB 4Y10E 1C5XB 1MQ5A 1K28D 1J8AA 5FCKA 4X6OA 4UEHH 3QLPH 2Y81A 1D3TB 2FS9A 4BNRA 2RDLA 2GCTC 1CT2E 1UTLM 1AQ7A 3BTHE 2BDIA 4NA9H 1ETTH 1NRPH 8LPRA 5GWZA 1EPTC 1VGCC 1C2HA 4D8NA 2VWLA 2HNTF 5EXNA 4IC5A 3HKIB 3NKKA 1C2FA 2SGPE 1GJDB 2FTMA 2ZHQH 5E0JA 1AZZA 3LJJA 1U6QA 2VIVA 4M7GA 2UWOA 1RGQA 1T7CA 4H6TA 3MYWA 1ESTA 1IQFA 1OOKB 3AVZA 4AORA 5LPRA 1C1UH 4I8GA 2V3OH 3EGKH 1Y3XA 4NGAH 1KLTA 1C5VA 3R3GB 3SOSA 1BMMH 4INHA 1GI6A 4AGKA 5C1XA 4I8HA 4B2BA 5HXFA 1HB0B 1D3DB 3LGUA 3ZZ7A 1JRSA 1TAWA 3V12A 4JK5A 2A2QH 4KP0A 2ZFQH 4ZKOU 1UVSH 1NFXA 4DT7B 4AFZA 2Z7FE 2OP9A 1LKAA 1GJ8B 1ZR0A 1Q31A 1XXFA 1C2IA 2XTTB 4JZ1A 3BTGE 2UWPA 1PQ8A 2P95A 2ZA5A 1BA8B 3SJOA 1P3EA 1GG6C 2W7UA 2A2XH 2V35A 1UMAH 1DY9A 2DE8A 1DXWA 1L2EA 1LKBA 3BTTE 2R2MB 1QQUA 1SGPE 2QXJA 2AMDA 1RTLA 3MH4A 1OYTH 1NO9H 2KAIA 3Q00A 3FP8E 5T6DA 1C5QA 2I6SA 3UNQA 4X1SU 1O3IA 4UONA 3DHKH 4FXGH 5A0BA 1O3LA 4DJZB 3RXAA 1MD8A 1O2NA 1EAUA 2O8UA 1E36B 1Q2WA 3MH5A 3QO6A 2B8OH 5AFZH 1YPLH 1MTWA 5EPNA 1AZ8A 1OWJA 2UUFB 1P02A 1GI0A 2CF8H 1FAXA 1QL8A 1WQSA 2ZI2H 4ISIH 1F7ZA 3GDSA 1TGTA 1LO6A 4X8UH 2ZGJA 2WYJA 2P8OB 2VIDA 2Z94A 2QC2A 3ZZ5A 1NPMA 7KMEH 2EC9H 3SV7A 3A85A 3P8GA 2PKSB 1PPEE 2BD3A 1TIOA 2ZU4A 3ZZ6A 4ABFA 3A7YA 3RXBA 1DPOA 2UUYA 2WINI 1C2KA 1KLIH 1TNJA 2VVUA 4WXIA 1NFWA 3UNRA 2GP9B 1S81A 1Z7KA 1GI7B 2BDCA 1K1JA 1DY8A 4ISOA 3F9GA 3IITA 1Y3WA 4MQAA 1GHBG 1ANEA 4AB8A 1HIAA 4GCHF 3TNSA 1C1NA 3DFJA 1B0FA 4BOHA 3Q3YA 2ANYA 4FUFA 1A1RA 1DLEA 2ASUB 1HRTH 5HM2A 2JH5D 5LPEA 4ISNA 2Z6BD 4K1SA 1GMCF 1AVGH 3SBKA 1W12U 2C93B 1RTKA 2ZGCA 4K5ZA 3GOVB 4DVAU 1KSNA 4ZHAA 2ZHEH 2LNCA 3KQEA 2FOBA 3GY3A 5DGJA 1SGDE 2GT7A 2ZF0H 1C2EA 2ZECA 4ABGA 2R0KA 3RXKA 1GMHG 3BTWE 3A8AA 2CJIA 2HOBA 2VINA 3M5OA 2NU4E 3SV9A 1O3MA 4B2CA 7ESTE 1V2RT 4WWYA 4Y7AA 1C4U2 3QTOH 1TNKA 4R8TB 1BHXF 1TONA 1QY6A 1RFNA 1S83A 4B75A 2QGRA 2ZHFH 2BY9X 5E2PA 1T4VH 1TX8A 1EAXA 3LC5A 1VR1H 5I46H 5C5OA 4AGJA 3BTDE 3MNCA 1FIWA 1N8OB 3RXVA 1DVAH 1Y3UA 1BTUA 1O2IA 5A0CA 1O3FA 1O5GH 4OS6A 1FLEE 3FAOA 1A0JA 1DSTA 1LHFH 4FUEA 3QZRA 1EASA 2QCYA 4HFPB 4ZAEA 1SLWB 3WY8A 1DS2E 3IWMA 1KXCA 2ZCKP 5EODA 3D49H 3OSYA 4AG1A 2D1JA 1TPAE 1SHYA 1TMBH 5F8TA 2FMJA 1LQEA 4FVDA 1FN6A 4MPWA 2H9EH 2CHAC 4VGCC 5GXPA 3W94A 1G3DA 2W3KA 2Q1JA 4D9RA 2XRCA 2UUJB 4LK4A 1ZPCA 5L6NH 2ODQA 1O5EH 2BD2A 2VU8E 2OC7A 1AHTH 2O8MA 2AIPA 1SGNE 1UTQA 5HYOA 1A46H 1C5PA 3U1IB 1C1PA 1V2ST 5EW2H 1UVPA 3QWCH 1WTGH 2ESTE 3SGBE 3BIUH 2AGEX 1B5GH 2ANMH 4TPIZ 1KIGH 5FXLA 1ABIH 5JBAS 3DFLA 5DKMA 2BHGA 2FLRH 2FO9A 1P12E 1TABE 1CA8B 4MPUA 1JMOH 2Q6DA 1ELEE 3E1XB 1SGQE 2XCNA 3FZZA 3LH3A 4KTCA 1TQ0B 4MNYA 1Z8IB 3GCTG 4O9VA 1NU7B 2FLBH 1SOZA 3BTFE 1LVBA 1TALA 2STBE 1DWDH 1GBLA 4YOIA 4U30A 4GHTA 2FOGA 1YPMH 8ESTE 1ZSJA 3RMMH 1ANBA 1CU1A 4A7IB 3KN2A 4ABIA 1G9IE 2GDEH 1P05A 5A8ZA 2ZP0H 1FI8A 4ZROA 4O03A 1FZZA 1E0FD 1EZSC 1ZPBA 2ZIQH 4NFFA 1TRMA 4X2XA 2J95A 1C4Y2 2R0LA 3LKWA 1V2JT 2PV9B 1JOUB 4MNWA 2ZTYA 1K9OE 3NCLA 5LPFA 8KME2 1TX7A 1O35A 1YBWA 2GKVE 1GDNA 1QB9A 3E91A 1O2WA 2WPLS 3P70B 4TYDA 1D6WA 1SFIA 3HK6B 1ZGIA 1GHAG 1DICA 2HWLB 2ODPA 1G2LA 1SGTA 1C5NH 1KXFA 1HJAC 1YM0A 3TU7H 4B2AA 1YKTA 1H9HE 1WYKA 4INKA 1XXDA 1YPHC 1F0RA 2TGPZ 3KCGH 1HAVA 3MO3A 4UD9H 2XC0A 4DIIH 1GBFA 3T28A 1TRNA 1S5SA 3CENA 3L33A 1EJMA 2G52A 1LHEH 1GMHF 1GJCB 1SLUB 3KIDU 1TYNA 1WTHD 1O2SA 1TA6A 1P04A 2HALA 1BTXA 3F9EA 3V0XA 4UDWH 1QFKH 4ISHH 1THSH 4SGBE 2PKAB 5ETXA 1O2JA 2XC4A 1C5SA 1CHGA 3A7WA 4DG4A 1TBRH 4AB9A 2EI6A 1MQ6A 1RXPA 4NWLA 2AMPA 5SGAE 2VIOA 4ABHA 1MMJN 2A5KA 3MFJA 1W3CA 3TH3H 3SZNA 1RS0A 4NWKA 2B7DH 4LZ1H 2ZDLA 4NG9H 4U2WA 1H9IE 1ZTLA 2A7HA 2BDHA 3OY6U 3FFGA 4PROA 4O3UA 1K1MA 4FU8A 4AFQA 4CRBA 1MU6B 4CRCA 1QL7A 4D9QA 2BOKA 3TH2H 3JZ2B 3UOUA 3GY8A 1P2QA 2WV5A 3BV9B 1S85A 2AYWA 3RXCA 1P10A 3LH1A 1HAGE 1GL0E 2ZFPH 2GVFA 5BPEA 2OC8A 1BIOA 1YPHE 1L1GA 1MH0A 3ATKA 1L0ZA 3K65B 4HZHA 5AVDA 1C4V2 4Y0ZE 4YT7H 1DITH 1HNEE 1AVXA 1CGIE 1K21H 1ZHPA 4I8KA 2QYIA 3SNAA 1GHVH 1IHSH 1G30B 4IN1A 1HLTH 1C5MD 4TWYA 1NRRH 4XSKU 2PGQB 4WVPE 5FX5A 2ZGHA 1GJ7B 1SGEE 3PROA 1CSOE 1W0ZU 5DP9A 1O2QA 1P0SH 1XUKA 3K6ZA 8GCHF 3SU6A 1DE7H 2BDBA 1V2NT 2FYQA 3V3MA 3A7ZA 1O2LA 4CR5A 3LPRA 1LHCH 2H9TH 2FX4A 2QY0B 1TBZH 2EI8A 3B9FH 4E7RG 1GVKB 3GCTF 1PQAA 3O8BA 4E06H 4JYVH 3NZIA 3RC6A 1F0UA 4X6PA 5E2OA 1CVWH 5F03A 3SJ8A 3S9AA 1MZAA 3O8RA 1MUEB 3FANA 1O38A 4YLUA 3U1JB 1DX5M 4D76A 3T29A 1F0SA 1T8LA 4DGJA 2P93A 1TFXA 1VCQA 1J17T 2BTCE 3SNCA 2CGAA 2BVSH 2FPZA 1O3JA 2ZCHP 2OUAA 3A8DA 2P94A 3BG4C 4TY7A 4Y11E 4AZ2B 3TGJE 1SQAA 1BRCE 1O5FH 2GX4A 2D2DA 1D4PB 4K1TA 1V2UT 2Y6TA 1GHWH 3K2UA 1AFQC 1TMUH 4ASHA 2AFQB 2BOHB 2HGTH 3T25A 1TA2A 5EW1H 2G5VA 3LDXH 5TCAA 1O2RA 2UUKB 4FUBA 1CA0C 1IAUA 2BD5A 3UTUH 1ESAA 2ALPA 2IJOB 1EZUC 1O3NA 4GCHG 4BAKB 2C8ZB 2DUCA 1EP6A 3UWIA 2V6NA 2I6QA 1A0LA 1DXPA 2GD4B 2F91A 1GCTC 2PUXB 4YM9A 1Y5UT 3TGKE 3OY5U 3FVFB 2Z9JA 3ZZ3A 3SO3A 4JYUH 2J2UA 3RXDA 3SQEE 3P8NA 2ZO3H 1AUTC 1BTPA 3LJOA 1HXEH 1P2MA 1GJ6A 2PR3A 1TOCB 1QHRB 5G4BA 3SUEA 4FUDA 1T8NA 1YPEH 2F9VA 4Y8XA 2VIWA 3P6ZB 1GBKA 1L1JA 1YPKH 4RKJB 3UREA 2BD8A 3VB7A 1BRBE 3BTQE 4CREA 3S9BA 2TGAA 2OINA 1NFUA 2IOTA 1BDAA 2VVCA 1SPJA 1C5OH 1CO7E 1XKAC 2XCFA 1C2GA 3EDXB 1PPHE 1ZHMA 3SI3H 1EAWA 1G3CA 1V2PT 3RXUA 1Z1JA 5DK1A 4CBNA 4JZDH 1GGDC 1S82A 1TPPA 3K6YA 3P17H 5C1YA 3VEQB 1NT1A 2FS8A 3GDUA 1KXAA 2ZU3A 2B5TB 5CHAC 1LPZB 6GCHF 4VGCB 3RXQA 2ZU1A 1EKBB 1FY5A 5DO4H 1A5IA 5DP6A 1SVPA 2D26C 3KL6A 1O3BA 4H4FA 1HAOH 1S0RA 1T8OA 1TNGA 2VNTA 1WCZA 6ESTA 1V2TT 1ZMNA 5A8XA 2BQ7B 1Z8RA 3P8FA 1EX3A 1KYNA 1JXPA 3PLPA 1UVUH 3M5MA 4TY6A 2BY7X 3KNXA 1GDUA 4MNVA 3UIRA 3LOXA 2BLWA 3RMOH 2FI3E 4DW2U 3ZYDA 4WXVA 1O39A 1QB6A 1FAKH 1H4WA 5EQRA 2BXTH 4RKOB 1O33A 1OP2A 1MKWH 3M3SA 1A5GH 1EXFA 1KLJH 1LMWB 1HAIH 1SLVB 3U8RH 4A1XA 5I25A 1T4UH 1J14A 2H9HA 1NC6A 1L4DA 2AS9A 1OWDA 1KXBA 4XBDA 2WPIS 2FOFA 1Z6JH 1O3GA 2ZTXA 5FPTA 1TQ7B 3LONA 2ZFRH 2A7JA 3PB1E 1V2OT 1HGTH 2XW9A 4RN6A 5J4QA 4NIVA 2SNWA 4JYTA 4ISLA 1IQLA 4K2YA 4UFFH 1AB9C 1UK2A 1SG8B 2ZQ2A 4U32A 1GHXH 2D8WA 2C8XB 1P2IA 5HMAA 3SHAH 3BTEE 1GVZA 2BY5X 1TBQH 1C9PA 1ZMJA 2FOEA 5DJ7A 1EOJA 1XMNB 3FZDA 1IQGA 2C3SA 2THFB 1XUIA 2BD4A 2BQWB 4TPYA 4XOJA 4AFUA 5C1UA 1HYLA 2ZQ1A 1SI5H 1HAPH 4THNH 4F4OC 4JZFH 4Q7YA 1DWBH 2V3HH 1P2KA 1PPFE 4JK6A 2OBQA 5A2MH 3PTNA 1VZQH 5L30H 1DLKB 5A0AE 9ESTA 1GVLA 3TJVA 3NK8A 1ZTKA 1N6YA 4KGAA 1ETRH 4KKDA 4NIWA 3ZVEA 3LGIA 5JPMH 4WY3A 3GISB 1B7XB 1SQOA 3MH6A 1XM1A 4FUJA 4KELA