3NZIA

Substrate induced remodeling of the active site regulates htra1 activity
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
EDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase substrate
molecule keywords Serine protease HTRA1
publication title Substrate-induced remodeling of the active site regulates human HTRA1 activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2010-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nziA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nziA02
1FIWA 1YM0A 3GCTG 1NS3A 3FP8E 3M3SA 4OS7A 1AWHB 2TIOA 1P2KA 2ZU4A 2ZC9H 3Q3YA 2IPHA 1SLUB 1OP0A 3B23B 4B74A 5J4SA 1BITA 1THSH 1NU9A 2D2DA 1T8NA 1MTSA 1CHOG 1Z8JB 1V2WT 1S5SA 2NWNA 3A82A 4ZXXH 1C1NA 1CVWH 1E36B 3A85A 2Y80A 5L2ZH 4Y10E 1DUEA 4Y8ZA 3TGJE 1O31A 5HM9A 3SV2H 4ZROA 1KTTB 5G4BA 4FUCA 1LVMA 1ZPBA 1J17T 4IGDA 1E0FD 4ZAEA 4ZKSU 4MNXA 3RMLH 2IJOB 3PROA 1NESE 5L6NH 4X2WA 3RXOA 2TGTA 1SGQE 2W5EA 1C1TA 1BRBE 3RU4D 3SHAH 1MTWA 2FOGA 3RXPA 3MMGA 1V2KT 2AIPA 2A2QH 2BVRH 1GBEA 1ETRH 1A3EH 2KAIB 1Y5AT 1ELBA 2PW8H 3BIUH 1ZTJA 3VGCC 1GHAF 1Y59T 1PPZA 4K60A 1MKWH 1ZHPA 2CGAA 1BMLA 1WBGB 1L4ZA 6GCHG 1LMWB 2CJIA 2FTMA 2Q6GA 2ZDNA 1M9UA 3ZYEA 2Z6BD 2ZI2H 4AFZA 1BBRH 1GI4A 2P94A 3EYDA 1SLVB 5AHGH 3KNXA 3I77A 1O2GH 1KXBA 1C2DA 3LJOA 3P8GA 4CH2B 1HAVB 3BV9B 2QXIA 2OBQA 4H4FA 1MCTA 2H5DA 1CQQA 2J94A 1C5SA 1BMMH 1PYTC 1OPHB 3BTTE 1C1WH 1FY4A 1EZUC 4ZHAA 1GHYH 1V2NT 1Y3VA 3ATIA 1DWDH 1O3IA 3QO6A 2FYQA 1SLWB 1AVXA 2AGEX 2BDCA 4DY7B 2VWOA 4IMZA 4XBCA 2ZDMA 3T26A 2GVFA 4E06H 1YPMH 3HPTB 4DOQA 4HZHA 3FP6E 2BD7A 1H9LB 5LPEA 1NFXA 4Y8XA 3BTKE 1UHBB 5CHAC 4R0IA 1NROH 3F9GA 3MO9A 4HFPB 2SGPE 1O5BB 1KXAA 2D1JA 3GY3A 1HNEE 5DP4A 1GI6A 3CS0A 2XXLA 1JRSA 1LHFH 4TWYA 1AKSB 2P3UB 1UVSH 1GHBG 1PPHE 3ZZ3A 2BX4A 3QLPH 2K1QA 4DW2U 1E37B 3RC6A 3SNEA 1C5UA 3M37A 3TJOA 1KY9A 3A7WA 1PJPA 3M7UA 1UVPA 1LHEH 2OC8A 1HJAB 3SUEA 2V3HH 1N6XA 1DOJA 2BDAA 7GCHF 4O97A 2GD4B 4JYTA 3RXHA 4OGXA 2ZGXH 3FZZA 2H2ZA 3UQVA 3VPKA 5L2YH 1IQNA 5E0HA 5T6DA 5EW2H 2BY7X 2STAE 1P3CA 3GCNA 5T6FA 1GWAA 3GY4A 2VU8E 1YP9A 3KIDU 4BAMB 2GCHG 1CBWB 4BTTB 1QJ1B 3A88A 1ELCA 2A5IA 1ELEE 1SSXA 1TALA 3SV7A 2VH6A 3P17H 1ZMLA 1ID5H 3A89A 1MKXH 4CRDA 5A8XA 1GI3A 4J1YA 1P57B 2VB0A 4X6NA 1C5TA 3EA9A 1EP6A 2C3SA 1NC6A 3ZZDA 1W14U 1W0ZU 1D6WA 2C8ZB 2ZGHA 2FI5E 1L1JA 3SU6A 1FDPA 5ESBA 2JETB 1QY6A 1S6FA 1SHHB 1S83A 2QA9E 3M3VA 1C2KA 8ESTE 2VJ1A 4CBOA 5FBIA 2BQ7B 1A0LA 3DA9B 6LPRA 1BTHH 2BD5A 2BZ6H 1EPTA 6CHAB 3AW1A 3TJUA 1IQHA 4ISNA 2HGTH 4JZEH 1RS0A 3A7VA 3ATWA 2AMDA 1O3JA 3BEUA 2XW9A 5TCAA 5IDKA 1NRSH 4X6MA 4RKJB 1C5WB 4AFSA 3SU3A 2G52A 3F9EA 1W13U 3UFAA 3MU0A 4XOJA 1O2LA 1TFXA 1HXEH 1XUHA 1P06A 1C5XB 4O9VA 4DG4A 1D3DB 5C5OA 4ZHMU 3A7TA 3W95A 1T4VH 1VITH 4BANB 1CE5A 1BT7A 1K28D 2FLBH 3F1SB 1GJ5H 2BDGA 4CREA 2I6QA 2SGDE 1TNKA 2UUJB 1AB9B 2STBE 3LJJA 3NWUA 4IBLH 1NN6A 1TABE 4MLFB 1C1UH 3M7TA 4XDEA 1C5NH 2A4RA 1MTVA 3VEQB 2VVVA 1AU8A 1KDQA 5ESTE 1TPOA 3Q3XA 3FANA 1IHSH 1VCQA 1GVLA 3QTVH 1RIWB 3PLKA 2Z3CA 1LVBA 2VIQA 2Z9JA 2VVUA 1O3LA 2ZTXA 3SORA 1SQTA 3E3TA 5I25A 4MPXA 1V6DA 3EDXB 1YGCH 2RCEA 1E35B 3GY2A 1FV9A 1BHXF 1HAYB 3GCHB 3GCOA 1SPJA 4O03A 2GP9B 2GV6A 4KTCA 4MVNA 4LK4A 2VVCA 4K1EA 3SNBA 2G8TA 2J92A 5E0JA 4M7GA 3QGNB 3AAUA 4IC6A 2BZAA 1QGFA 1UTLM 3SJ9A 2ZFFH 1JBUH 5DG6A 1O2KA 1C2GA 1G3BA 1UK3A 4CRBA 1GDQA 1S85A 1B0EA 1A5HA 2ESTE 2A4OA 3ODDA 1F5LA 3BEIB 1NRPH 1FPHH 2FWWA 4WMFA 2AGIX 5A8YA 1CSOE 1HAPH 1H9HE 1YLDA 3RXDA 2SNVA 1THRH 5LGOA 2GGVB 3GCTF 3S69A 4Y71A 1KXDA 1G37A 1WQSA 1OOKB 1O35A 1JXPA 2FMJA 1HAHH 2F9BH 1QQUA 3LPRA 3M3TA 4NFFA 3ZV9A 1UCYH 3RXTA 2ZU5A 1F7ZA 1WU1A 4THNH 3Q77A 1SQOA 2WPMS 2PKAB 4PROA 2OQ5A 4XBDA 1SQAA 1ORFA 1TX6A 3F9FA 5DP9A 1EPTC 4FUBA 2BXUH 4Q80A 3TK6A 3RUOA 1K1OA 1K1IA 1RTKA 2SNWA 1CA0C 4AFUA 4B76A 2V6NA 1OP8A 3SBKA 1NT1A 1S81A 1CGJE 3TJVA 2XBVA 3BG8A 4OGYA 1ZTKA 2FYRA 1NTPA 3E0PB 4LOYH 1SGYE 5GPIB 1FY3A 1GCTC 3ZZCA 4OS5A 3RXJA 3ZZ5A 2HOBA 3LGYA 4AN7A 1BCUH 1ZLRA 2OCVB 1GGDC 2GCTB 1DY8A 1P2MA 5EG4A 2OQUA 4AORA 5EQQA 2HALA 2PUXB 1XKAC 1TPPA 5DP6A 2WPKS 2AMQA 4X6PA 1TNGA 1HDTH 3QK1A 2AEIH 3IITA 6GCHF 2BY9X 2RA3A 1YPGH 4DT7B 1BTWA 4AX9H 1MQ6A 3ZVEA 2FEQH 3NCLA 1K22H 4X1RU 4BAQB 1O3MA 1O2UA 1J16A 4JZFH 1S82A 1LHDH 1GL0E 3RM0H 4NCYA 4TY7A 1C5ZB 2F9UA 1S0RA 3LC3A 3MI4A 3L3TA 1G3EA 1DLKB 4BNRA 1GBFA 3EQ0H 3MU5A 4DCDA 3S9AA 3SNCA 3VGCB 4U01A 2A32A 1V2ST 3LIWA 3RXGA 3RXVA 3AW0A 4WH8A 1F0SA 2XWBI 3K65B 1TMUH 2G4UA 1HUTH 1H4WA 1QBOA 2Z94A 1P9UA 3KF2A 3PMBB 2ZDLA 1GBDA 1ZJDA 5C1XA 1UVOA 3A7YA 3BN9A 4ESTE 2XWAA 1GJDB 1KXEA 1AZ8A 4X1SU 3LONA 1L4DA 3STIA 1C5LH 3NUMA 3SNDA 1DANH 1TNLA 2FOEA 3RC4A 1QFKH 3U69H 3SU5A 3MU1A 2NU3E 2ZHWH 1TGCA 1ZSKA 1C9PA 3MH7A 2O8WA 2ZEBA 1GBKA 1GHBF 3M5NA 1O5FH 2A4QA 2F3CE 4MPUA 1ELTA 3UR9A 3VXEH 1RTFB 2ZNKH 3OY5U 2ZTZA 1VCWA 3RU4T 3GDUA 1VGCB 4X2VA 1GVZA 2XBWA 2GT8A 4NGAH 1VJAU 1B7XB 2Z9IA 2OLGA 1UTNA 2CXVA 2WPLS 5CHAB 2BVSH 1O3NA 1O3DA 5C67A 3D62A 1RFNA 1O2MA 1PFXC 1C5PA 1HGTH 4Y8YA 1FAKH 1V2LT 2B0FA 2J4IA 1P2QA 7ESTE 1DX5M 1QNJA 1ZPZA 1OWDA 3KQBA 2OC0A 4DIIH 2ZPSA 4I8GA 4MG3A 5F03A 2GCHF 1WYKA 2FOBA 4FUGA 3TH4H 1GI5A 2ANWA 1L1NA 3AASA 3ATLA 4FU9A 4AG1A 4D76A 3RXKA 1FI8A 2OD3B 4ISLA 1V2TT 9LPRA 1ZRBA 1OWKA 1P01A 1QR3E 1T32A 3TGKE 5TJXA 3N7OA 5E0GA 1ZGVA 1LCYA 2W26A 4AGJA 1N8OC 1P12E 4GCHG 5DJ7A 1UMAH 2B5TB 2Z9GA 5I46H 3WY8A 2A5KA 1YLCA 1GBHA 1LPGB 1UTQA 2LNCA 3LGWA 1OXGA 2NU2E 2ZU3A 3SU2A 3O8BA 3PO1C 2VWMA 1X7AC 3FP7E 2A5AA 1VITG 4UONA 2FOFA 5A0AE 1H9IE 1EOLA 2PUQH 4X8SH 3SQHE 2FOHA 4JCNA 3W94A 2GKVE 1CGHA 4JK5A 3SU0A 4X1QU 3TIUA 1OS8A 3UTUH 4WMEA 1V2MT 4Q7YA 1SOZA 3BTFE 4ABJA 4NA9H 3HKJB 1SGFG 3BTEE 1C2FA 1LPZB 1TMBH 3LDXH 2VIPA 1C1OA 2XCNA 3R0FA 1A4WH 3RXSA 4ZXYH 2ZDVH 3EE0B 3PV4A 4X0WU 4X8TH 1FUJA 3KQEA 1B5GH 4YLUA 1O38A 1OYQA 3E8LA 1EZXC 2F9VA 1MTUA 3D23A 1Y3UA 1EAUA 1YCPM 4QT8C 2H9TH 4SGBE 2FI4E 4U2WA 1DM4B 1WTHD 4ABAA 3E91A 3NZIA 1BRCE 2QXHA 4FVBA 5DGJA 1C4U2 4IS5A 1K1MA 5A0CA 3Q00A 1HIAA 3ZV8A 1HJ8A 2CMYA 1MUEB 4Y11E 2PLXA 3RXFA 2ANKH 5A8ZA 1QL7A 2Y7ZA 4D7FA 1O30A 1OYTH 3C1KA 3F68H 1HXFH 2XBYA 1P9SA 4AG2A 1ESAA 3SGAE 5FHTA 3ESTA 1CT2E 3ELAH 2FOAA 1XX9A 1ZZZA 1UTKA 4GSOA 3M5OA 1FLEE 4GVUA 1ZRKA 2AFQB 2ZU1A 2EC9H 4WXVA 2WPHS 4INKA 3TGIE 4X1PU 1H8DH 5EPYA 4CBNA 4JZDH 3T27A 1F5RA 1C2JA 1RGQA 1MAXA 3KCGH 1DXPA 5BRRE 2PSXA 2ALVA 1LVYA 4CR9A 5JBTA 2RA0A 3DUXH 4ZKOU 2QGRA 3EGKH 1DWEH 5FCKA 4J2YB 1TBRH 3HGNA 5E2OA 3UIRA 1T4UH 2QXGA 1AFQC 3IG6B 1UVUH 4KTSA 1XUGA 4ABDA 1O2YA 1O3OA 4MNYA 3A83A 3V0XA 1DSUA 9ESTA 2ZFQH 3EAJA 2IOTA 1OKXA 4KGAA 3U98H 4F49A 3URDA 2FX4A 3HKIB 2XC5A 1O34A 3PWBA 5F8XA 1UTOA 1B0FA 1DITH 3PB1E 4I32A 2H9HA 3SV9A 3MU8A 3UNSA 1CHGA 2C8WB 4Y76A 1MCVA 2CV3A 4I8JA 1Y3YA 2NU4E 1DFPA 3E1XB 4Q7ZA 2SFAA 4FUFA 3PMAB 2NU0E 2Y6TA 2ZDAH 1ESTA 1QHRB 1AE8H 1THPB 1D9IA 1P0SH 1TLDA 1GJ9B 2SGAA 3FZDA 4A1TA 1PQ7A 3SGBE 1AUJA 1JWTA 2H1UA 2QIQA 4FU8A 1W7XH 2W3KA 1SI5H 4AZ2B 1YPJH 1EAWA 4AB8A 4I7YH 2BY5X 2GZ8A 3MNCA 4ABBA 4ABGA 2I6SA 1TA2A 1BZXE 3A8BA 1Q31A 1TWXB 1EPTB 5PTPA 1W3CA 4B71A 1CA0B 4Y7AA 3L6PA 3LGVA 1N6YA 4F4OC 2WV4A 1LTOA 3DFJA 4TPIZ 1HV7A 2ZFTA 1Z6EA 1FJSA 2BLVA 4R8TB 1GCTB 2P8OB 4MTBA 2C8XB 1WOFA 3GICB 4XFQA 2VGCC 1GMDG 1NY22 1QA7A 1GGDB 5HGGA 1LO6A 4CHAC 2A7JA 5EXLA 2ZGJA 1LHGH 4ZKNU 2ZWLH 2FO9A 2Y7XA 1Z1IA 1A5IA 2EI6A 1G3DA 2FOCA 2SGFE 1IQJA 1TRYA 4O3UA 3ATMA 3MHWU 1TA6A 2TBSA 8KME2 2BVXH 3BTHE 4H42U 4K2YA 7KMEH 5F6MA 1GMHG 1KDQB 5JDUB 1CT0E 1GHVH 3F6UH 1BHXB 2PSYA 3PMHB 1O2SA 3K2UA 5CE1A 1MH0A 3SU4A 3ITIA 1NFWA 1GI1A 3RXMA 3UUZA 2QF3A 2OINA 1G30B 4CRGA 1GJ7B 1MU6B 3SN8A 1LQDB 1Z8IB 1O2HA 1VCPA 3PM3A 1K1NA 3S9CA 4TY6A 1N1LA 1FPCH 3TH3H 1LPKB 2W3IA 2XCFA 4CRFA 1UHBA 5EXNA 1C2IA 1W10U 4X2XA 2BD3A 1HAXB 1O5DH 2ZA5A 5AFYH 2Z3DA 4WWYA 4KP0A 1XM1A 3UQOA 1AUTC 1C1RA 2Z9LA 4BXSA 4X1NU 4JMYA 1O3HA 3UR6A 4X2YA 4MPVA 2EI8A 2C93B 3BTME 4IN1A 2BLOA 4MPWA 1MKWK 3A8DA 4A1XA 1TX8A 2OXSA 8LPRA 1GI9B 2ZPRA 1KLJH 2FLRH 2SGEE 1BBRE 2AIQA 4ZHLU 1BTYA 3O8DA 3SNAA 2GMTB 3C27B 2A7HA 1XXFA 4GCHF 2ZFRH 1DUAA 1H8IH 2VIWA 2ZGCA 3NPSA 5DP7A 5JBAS 1AQ7A 2QF0A 1GBIA 1GJ6A 2G5VA 3BF6H 3HATH 4TWWA 1FNIA 2D8WA 1VITF 1DWCH 1O3AA 1GPZA 1QA0A 1ZJKA 1SGFA 2A1DB 1O33A 3K6ZA 4K3JA 1QIXB 1YCPH 2R2MB 4I8KA 3SJOA 2BD4A 5A2MH 4TYDA 1V2OT 2W7SA 5ABWA 3SUDA 1A46H 4FUHA 1DPOA 5AF9H 3ZZ9A 2A7CA 1C2HA 2H6MA 5FCRA 1O3GA 1N8OB 3RM2H 3FVFB 1SGCA 2ZDKA 3QX5H 3JZ1B 1O2NA 1CGIE 3TH2H 2UWPA 1T31A 1HAZB 1SR5C 3H7OA 4D9RA 4Z6AH 1ANEA 1K21H 1DSTA 3RMMH 6ESTA 1MAYA 3IWMA 1GCDA 3A87A 1ZSJA 1PQ8A 1YYY1 2ULLA 1P8VC 1INCA 3P92A 1G32B 1AVGH 2O8MA 4DGJA 1C9TA 1QRWA 3SQEE 2CHAC 1NRQH 3LKWA 2WPIS 1IQIA 5FBEA 4BAKB 4FUIA 1GI0A 4U32A 1C5MD 5GJ4B 2WYJA 1P11E 2HLCA 4A92A 1CHOF 1EB1H 1C2MA 1ZSLA 1O36A 3B9FH 2BTCE 1AVWA 1IQLA 1HB0B 1O2TA 4NWKA 4IW4E 1GJ8B 5DP8A 1WQVH 2V0BA 2BDIA 3ZVFA 5E2PA 4A6LA 1NRNH 3TK5A 1OSSA 1GDUA 1O5CB 4K8YA 3T25A 2V3OH 3KGPA 1TBZH 3A8CA 1ABJH 4UFDH 5BPEA 1SGEE 1OP2A 4I33A 4B2CA 2QN5T 2TGDA 4KTUA 1YPKH 1MKXK 2D26C 1Y3XA 1P02A 3MNXA 3RC5A 1KTSB 3CP7A 2A45B 2R9PA 4YOGA 1AFEH 1XUKA 1BTPA 3QWCH 1A61H 1Z6JH 3QDZB 3VXFH 1KSNA 3F9HA 1WV7H 2XYAA 1QCPA 4YOIA 1S0QA 5L30H 3ZZAA 1O3KA 5J4QA 2ODQA 1EASA 1EX3A 2F9OA 1ELDE 1DLEA 1HPGA 4D8NA 3S7KB 1K1JA 2HPPH 2R0KA 1DVAH 1ETTH 2ZCKP 1BQYA 2WUCA 4GHTA 1MMJN 3SOSA 3ZYDA 3BG4C 3M5MA 1F2SE 2P95A 3A7ZA 4Z0KA 5B6OA 1ARBA 1EAXA 4YOJA 3UNRA 1SBWA 1Y3WA 4GHQA 2YNBA 1SB1H 1SGIB 2AERH 1KXCA 1O5AB 2G51A 1V2QT 1AFQB 1L2EA 5EW1H 2BDYA 2ZQ2A 1EJMA 4XSKU 3T2NA 4Y79A 5AFZH 3S7HB 2FOMB 3OX7U 1O2PA 1NRRH 1MD7A 2PTNA 4I31A 1MBQA 1ZYOA 3UOUA 1DDJA 2FP7B 2A0QB 1G3CA 3JZ2B 1HRTH 5DP3A 4MDSA 1O2VA 1EP5A 4YT6H 4CRCA 1TBQH 1PPFE 2HWLB 1LVOA 1TRNA 1QTFA 5H4IB 1P04A 1C5VA 1DICA 1ETSH 5EOKA 1YPEH 2ZFPH 5K7RA 3E6PH 2VH0A 3Q76A 1FXYA 1K1LA 2ZHFH 3BTWE 2WYGA 1W12U 4FUDA 1SHYA 3GYLB 3B8JA 1QL9A 3HK6B 1G9IE 1PPGE 1UTMA 3M61U 1TQ0B 2QV1A 3Q3KA 1U6QA 3ZVGA 4E7RG 3MYWA 1TB6H 1LKBA 4OS6A 3KQDA 1C2EA 2F9NA 2ZCLP 5K0HA 3MH5A 2ZGBH 1KLTA 1GMDF 3SJKA 1TYNA 4UEHH 2BY8X 1T8LA 2QXJA 4NZLA 3TJNA 1MTNC 2ANYA 2TRMA 1FZZA 3BSQA 2QCYA 1Q3XA 3GOVB 1HIAB 4ZH8A 2GT7A 3ATKA 4DURA 1T8OA 3LT3A 1GMHF 1E38B 3M7QA 1NFUA 2HPQH 1O2QA 1ELGA 4Y0YE 1V2UT 3GDSA 3UPEA 3FFGA 2UUFB 3PTNA 1FAXA 1C5OH 4ASHA 1BMNH 1J15A 1C4Y2 1F92A 1NO9H 1TNIA 2BMGB 2C8YB 2OTVA 3VFEA 8GCHG 5JPMH 1SGPE 3MO3A 1UCYE 2J2UA 2VGCB 3PMJA 1HJ9A 2AH4X 1QQ4A 1GHXH 1UCYK 2ZIQH 3V13A 1ARCA 2RG3A 4AGKA 1IOEA 1SC8U 1JRTA 2ZTYA 3SI3H 3LOXA 1CT4E 4IMQA 4D7GA 1GI2A 1P09A 1O37A 1CU1A 3RP2A 2JKHA 4Y6DA 1P2IA 3M35A 1XXDA 1UVTH 1JMOH 1SOTA 1C5YB 2Z9KA 3RXQA 4YT7H 2FX6A 3ZVAA 3ODFA 3A7XA 3VB6A 1H1BA 2HNTF 5FX6A 1ZMNA 3RXEA 1GJCB 2CN0H 1TPAE 2BXTH 1W0YH 1IHTH 1BUIA 5TCCA 5AVDA 1ZPCA 1UK4A 1GBLA 1ZHRA 3SO3A 3S9BA 2ZU2A 3MWIU 1G2MA 2BYAX 1TPSA 1W2KH 1GDNA 1LKAA 1DY9A 1F0RA 1EATA 4HI3A 3OTJE 1RRKA 4GUXA 2ASUB 1FN6A 3SJ8A 1JOUB 1ACBE 1PPBH 1Y5UT 3TK9A 2ODPA 4DJZB 5FAHA 5A09A 5LPFA 4LZ1H 1SG8B 5HMAA 4H6SB 4K1TA 3ZZ6A 4B75A 3U8RH 1EJNA 1W7GH 4Y0ZE 1BA8B 3T62A 1TQ7B 3UREA 5C1YA 2GCTC 4I8HA 5A0BA 1DE7H 4NSYA 1Z1JA 2OC1A 2Z7FE 1QB6A 1O3CA 3ZVDA 3MNBA 5GXPA 4NA8A 2TPIZ 1MZAA 3TNTA 4A5TS 5GCHG 1F5KU 4NIXA 3NK8A 1ANDA 1V2PT 2CF9H 2YNAA 3P8NA 5FX5A 3URCA 4ZUHA 3OY6U 4A7IB 1P10A 2PKSC 3M5LA 1P03A 7LPRA 3ENSB 4OS2A 4AOQA 1GI7B 1EUFA 3A81A 2VIDA 4AB9A 3VB7A 4B1TA 2BD8A 3E0NB 3P8FA 2PTCE 2VINA 1OWEA 1V3XA 1IAUA 1L1GA 1KXFA 1MQ5A 2G55A 1TE0A 1NM6A 3K9XB 4NA7A 4NWLA 4UFGH 1FIZA 2HRVA 2IN2A 1UJ1A 2BDHA 2ZF0H 2Q6DA 1C4V2 1JIMA 3SUGA 4NIYA 4E7NA 4FVDA 4ABEA 2OC7A 5E8EH 1ABIH 1TGBA 1HYLA 2UWLA 1ZMJA 1BJVA 1VR1H 3RXRA 2QC2A 2HNTC 2B7DH 5FPTA 3EA8A 1QJ7B 3RXAA 3SGQE 2BOKA 5C3NA 2FIRH 2H5CA 3KQCA 4AYYB 2A4GA 3UY9A 3G01A 2PV9B 1ZOMA 1P3EA 1G2LA 1ESBA 4KELA 4OS4A 1WSSH 3QN7A 2CHAB 5C20A 4MQAA 1GBCA 3BTDE 2O8LA 2ILNA 2ZCHP 1C1MA 3A8AA 4Q2KA 4VGCC 1UO6A 4DIHH 1Y8TA 2ZHQH 2P93A 4K8BA 4ZMAH 1L0ZA 1VGCC 2ZG0H 2OBOA 1GI8B 2HNTE 2PFEA 5C1UA 3M36A 2XBXA 4NG9H 1GHZA 1BRAA 2A2XH 3MH6A 1GJAB 1MD8A 1VJ9U 2BD9A 4NIVA 1KIGH 5FPSA 2WPJS 3V3MA 1YPLH 2GZ7A 3VB5A 3TVJB 1ZR0A 1Y5BT 3TU7H 3SZNA 3LGUA 3QUMP 3AAVA 1MBMA 4XE4A 2FI3E 1K2I1 1TOMH 3R3GB 3UWIA 3ZZBA 5GDSH 1GJ4H 4X8VH 4IN2A 3STJA 1XVOA 1XUJA 2KAIA 4KKDA 3CENA 1SGRE 1A5GH 1OWJA 2AYWA 1KYNA 3OU0A 1EQ9A 3T29A 4HGCA 1PPEE 3I29A 4RSPA 1BOQA 1TNJA 5GIBA 2GV7A 1D4PB 2BM2A 4BAHB 1XKBC 3SI4H 1GHWH 1AI8H 3RXCA 5JBBS 2UWOA 1BRUP 1BTZA 1FMGA 4ABHA 2P59A 1LQEA 1HAVA 1SVPA 3KHVA 5GWZA 1EXFA 2GTBA 2XNIA 1A3BH 2Q6FA 1GG6C 3CS7A 2UUKB 3BG4B 2ZHDA 1D3TB 1QBVH 1QRXA 2FXRA 2GZ9A 2DE8A 5DP5A 1JIRA 3OYPA 1DT2A 5T6GA 5JBCS 1D3QB 3MH4A 3GDVA 1AN1E 4RKOB 1OWHA 4X6OA 4YM9A 1S6HA 4ABFA 2Y81A 2R3UA 4Y7BA 3V7TA 2VNTA 3LGTA 5F8TA 2BB4A 3LH3A 5JB9S 1LHCH 1HBTH 3SW2B 2JH6D 4FU7A 3RU4E 4YZUA 3ZZ4A 2TGPZ 2WUBA 2XC0A 4BOHA 4U30A 1AKSA 4INHA 3KEEA 1BB0B 3D49H 1OWIA 1W11U 2JH0D 1GBBA 2GDEH 3BTGE 1AO5A 4B73A 4H6TA 3P70B 1XVMA 1TMTH 1O3BA 4BTUB 3UWJH 1EZQA 2Z3EA 2O8UA 5DPAA 3LU9B 1MZDA 2QY0B 1CA8B 2ANMH 4UD9H 2VWNA 2TGAA 4K69A 3GISB 4A1VA 1ANBA 1BBRK 2VIVA 1AIXH 1GMCG 1RXPA 2H9EH 2ZPQA 1ELFA 4FXGH 4WJG2 1ELAA 2FODA 8GCHF 2Y82A 2BLQA 3H7TA 4O3TA 3U1IB 3RMOH 1UK2A 5DKMA 1O0DH 1ZTLA 1UTPA 2LPRA 3A84A 1PQAA 1MTNB 2FDAA 2R0LA 2FS9A 2XRCA 5EGMA 3GY7A 3TNSA 3ZVBA 4MNWA 1TONA 4GPGA 1QURH 3A80A 2O8TA 3PLBA 1T8MA 2ZKSA 3V12A 5F8ZA 1A1RA 1Z8GA 1HCGA 3SV6A 2W7UA 1J8AA 1WTGH 2G5NA 1O2XA 2AMPA 3TITA 3QTOH 1CO7E 3PO1B 2ZFSA 1J14A 3SUFA 1TIOA 2FTLE 2ZZUH 3TPIZ 2G81E 3ZVCA 3MO6A 1E34B 2Q1JA 2ZQ1A 1AY6H 1O2JA 1S84A 2B9LA 1GHAG 3A86A 1BDAA 1SFIA 1SMFE 4NZQA 2PGBB 1GBAA 1QB1A 2AS9A 3LH1A 1TGSZ 1DS2E 4LZ4B 5T3HA 1SL3A 1A0JA 1P2OA 3O8CA 2FS8A 3DT0H 4B2BA 3MOCA 2WV5A 5ETXA 1IQGA 1FONA 1O3EA 1O2WA 1TNHA 1P05A 4WXIA 1T7CA 1XUIA 4XBBA 1EJAA 3HK3B 2BQWB 2XTTB 1C1VH 1AWFH 1C2LA 1Z8RA 1O2RA 1O3PB 2YOLA 3GY5A 2QYIA 3MNSA 2BX3A 3BIVH 5JB8S 1O2IA 4I8LA 3RMNH 1V2RT 1YC0A 1Z71A 5GCHF 2GX4A 2OUAA 2SGQE 1QB9A 1O39A 1TAWA 3EA7A 4LXBH 2BY6X 1FY1A 1FN8A 1TRMA 1DXWA 4GAWA 1O2OA 3RLWH 4WVPE 1SLXB 3MFJA 1NZQH 1K1PA 3PYHA 1HJAC 1BTUA 1BJUA 1PPCE 3U1JB 2DUCA 3UOPA 1ELVA 2P8OC 1GBMA 1EAIA 1O5EH 4WY3A 1K9OE 3PTBA 3LC5A 1ZHMA 2RDLA 1NPMA 4NSVA 5FPYA 1V2JT 2PHBA 4FUJA 4CH8B 3ZZ8A 2V35A 1O32A 2AGGX 4WH6A 3GYMA 3RXUA 3P8OA 1O3FA 4RN6A 1IQEA 1PQ5A 5EXMA 1AZZA 1CBWC 2QAAA 4YTAA 5EU8A 3PWCA 5EODA 4YLQH 1EOJA 2F91A 2PKSB 2Y5HA 5LH8A 2EEKA 2HVXA 3SV8A 3T28A 5EQRA 3SHCH 1P2JA 1AD8H 1HAOH 2THFB 7GCHG 1WUNH 2VIOA 4AFQA 4ISHH 3PLPA 5FXLA 1P2NA 3RXBA 1V2VT 3RXLA 1RJXB 2B8OH 3QZQA 1GBJA 4ISIH 4FUEA 1HLTH 2ZECA 2JETC 3LGIA 3BEFB 4TPYA 3NXPA 1AGJA 1G36A 1AE5A 1XMNB 2JH5D 3P95A 1AHTH 4UFEH 3HGPA 3S0NA 2PKAA 4SGAE 1GJBB 3UNQA 2J95A 4UE7H 2G00A 6CHAC 4K5ZA 2NU1E 4K1SA 4BXWA 4JZ1A 2BD2A 2Y5FA 4CRAA 1SGNE 1NFYA 1SGTA 4ISOA 4BAOB 2OP9A 3E90B 1YPHC 4HTCH 1FQ3A 1C1QA 1BMAA 1YBWA 2P3FH 1DWBH 1WCZA 3L33A 1BTXA 1YCPK 2R3YA 5JYIA 2FESH 2P3TB 4JYUH 1EB2A 4NFEA 1TGTA 4YO9A 4IC5A 4Q7XA 2XC4A 1MU8B 1TGNA 4JZIA 1C5RA 3VB4A 3VB3A 1HFDA 4VGCB 1EKBB 2F9PA 3I78A 3DHKH 1GL1A 2DE9A 1F0UA 1SGDE 2J38A 1AB9C 5SGAE 1Z7KA 5C2ZA 3AVZA 1ZGIA 3T5FH 4YESB 1IQFA 4E05H 4AYVB 1UTJA 1BIOA 2GMTC 1C1PA 2BOHB 1D6RA 2BHGA 3P6ZB 2VWLA 1W8BH 3QZRA 5DK1A 3NKKA 1QBNA 1YPHE 2ODYB 4UDWH 1LDTT 1RIWC 4JYVH 3BTQE 2O9QA 5EQSA 5HYOA 2FM2A 1QL8A 2FPZA 2PWXA 3K6YA 2ZP0H 1TOCB 2C4FH 3GY6A 1HAGE 2ALPA 3SU1A 3TLOA 1F0TA 1FY5A 5HM2A 4X8UH 2G4TA 5C5NA 4D9QA 3KN2A 4OS1A 4CHAB 4ZKRU 4B2AA 3GCHC 1RTLA 4INLA 1YF4A 1VZQH 1ANCA 1IQKA 3QGJA 2WINI 1KLIH 3RXIA 5IYTA 1QJ6B 1A7SA 1YKTA 3DD2H 3OSYA 1EZSC 3E16B 2BDBA 3SJIA 4ABIA 5LPRA 3MTYA 1A2CH 4BTIB 1GVKB 2F83A 5EPNA 2BLWA 1AMHA 1GG6B 1O5GH 1HAIH 1SFQB 1C1SA 4JK6A 2EI7A 5CMXH 2BQ6B 3GY8A 1J9CH 4UFFH 1O2ZA 2A31A 2GDDA 1IQMA 4CR5A 1FY8E 2M5TA 3FAOA 1Q2WA 4DVAU 4MNVA 2EA3A 1C5QA 3H5CB 1A0HB 1OX1A 5HXFA 3U8OH 2ZHEH 2J34A 3ZZ7A 1GBTA 2FZZA 5DO4H 3KL6A 4WF8A 1PYTD 3O8RA 1TX7A 3RDZA 2R2WU 2J9NA 3DFLA 1XUFA 2CF8H 3D65E 4GLYA 3U9AH 2P16A 1GMCF 1QRZA 3MU4A 1RD3B 1WAYB 3U8TH 4NIWA 2Y5GA 1NU7B 4WMDA 3RLYH 1D3PB 2PR3A 2PGQB 2C90B 2ZO3H 2UUYA
chains in the Genus database with same CATH superfamily
1FIWA 1YM0A 3GCTG 1NS3A 3FP8E 3M3SA 4OS7A 1AWHB 2TIOA 1P2KA 2ZU4A 2ZC9H 3Q3YA 2IPHA 1SLUB 1OP0A 3B23B 4B74A 5J4SA 1BITA 1THSH 1NU9A 2D2DA 1T8NA 1MTSA 1CHOG 2KX4A 1Z8JB 1V2WT 2W6JD 1S5SA 2NWNA 3A82A 4ZXXH 1C1NA 1CVWH 1E36B 3A85A 2Y80A 5L2ZH 4Y10E 1DUEA 4Y8ZA 3TGJE 1O31A 5HM9A 3SV2H 4ZROA 4Q4LA 1KTTB 5G4BA 4FUCA 4OM9A 1LVMA 1ZPBA 1J17T 4IGDA 1E0FD 2F4LA 4ZAEA 4ZKSU 4MNXA 3RMLH 2IJOB 3PROA 1NESE 5L6NH 4X2WA 3RXOA 2TGTA 1SGQE 2W5EA 1C1TA 1BRBE 3RU4D 3SHAH 1MTWA 2FOGA 3RXPA 3MMGA 1V2KT 2AIPA 2LELA 2A2QH 2BVRH 1GBEA 1ETRH 1A3EH 2KAIB 4ZCNA 1Y5AT 1ELBA 2PW8H 3BIUH 1ZTJA 3VGCC 1GHAF 1Y59T 1PPZA 4K60A 1MKWH 1ZHPA 2CGAA 1BMLA 1WBGB 1L4ZA 6GCHG 1LMWB 2CJIA 2FTMA 2Q6GA 2ZDNA 1M9UA 3ZYEA 2Z6BD 2ZI2H 4AFZA 1BBRH 1GI4A 2P94A 3EYDA 1SLVB 5AHGH 3KNXA 3I77A 1O2GH 1KXBA 1C2DA 3LJOA 3P8GA 4CH2B 1HAVB 3BV9B 2QXIA 2OBQA 4H4FA 1MCTA 2H5DA 3FO8D 3F0OA 1CQQA 2J94A 4B6FA 1C5SA 1BMMH 1PYTC 1OPHB 3BTTE 1C1WH 1FY4A 1EZUC 4ZHAA 1YLNA 1GHYH 1V2NT 1Y3VA 3ATIA 1DWDH 1O3IA 3QO6A 2FYQA 1SLWB 1AVXA 2AGEX 2BDCA 4DY7B 2RFKC 3N7DA 2VWOA 4IMZA 4XBCA 2ZDMA 3T26A 2GVFA 4E06H 1YPMH 3HPTB 4DOQA 4HZHA 3FP6E 2BD7A 1H9LB 1W0JD 1NFXA 5LPEA 4Y8XA 3BTKE 1UHBB 5CHAC 4R0IA 1NROH 3F9GA 3MO9A 4HFPB 2SGPE 1O5BB 1KXAA 2D1JA 3GY3A 1HNEE 5DP4A 1GI6A 3CS0A 2XXLA 1JRSA 1LHFH 4TWYA 1AKSB 2P3UB 1UVSH 1GHBG 3KQ5A 1PPHE 3ZZ3A 2BX4A 3H09A 3QLPH 2K1QA 4DW2U 1E37B 3RC6A 3SNEA 1C5UA 3GS9A 3M37A 3TJOA 1KY9A 3A7WA 1PJPA 3M7UA 1UVPA 1LHEH 2OC8A 1HJAB 3SUEA 2V3HH 1N6XA 1DOJA 2BDAA 7GCHF 2K8IA 2GD4B 4JYTA 4O97A 3RXHA 4OGXA 2ZGXH 3FZZA 2H2ZA 3UQVA 3VPKA 5L2YH 1IQNA 5E0HA 5T6DA 5EW2H 2BY7X 2STAE 1P3CA 3GCNA 5T6FA 1GWAA 3GY4A 2VU8E 1YP9A 3KIDU 4BAMB 2GCHG 1CBWB 4BTTB 1QJ1B 3A88A 1ELCA 2A5IA 1ELEE 1SSXA 1TALA 3SV7A 2VH6A 3P17H 1ZMLA 1ID5H 3A89A 5CHBA 1MKXH 4CRDA 5A8XA 1GI3A 4J1YA 1SKYE 1P57B 2VB0A 4X6NA 1C5TA 3EA9A 1EP6A 2C3SA 5HIZA 1NC6A 3ZZDA 1W14U 1W0ZU 1D6WA 2WPDD 2C8ZB 2ZGHA 2FI5E 1L1JA 3SU6A 1FDPA 5ESBA 2JETB 1QY6A 4FETA 1S6FA 1SHHB 1S83A 5DN6D 2QA9E 3M3VA 1C2KA 8ESTE 2VJ1A 4CBOA 5FBIA 2BQ7B 1A0LA 3DA9B 6LPRA 1BTHH 2BD5A 2BZ6H 1EPTA 6CHAB 3AW1A 2KCAA 3TJUA 1IQHA 4ISNA 2HGTH 4JZEH 1RS0A 3A7VA 3ATWA 2AMDA 1O3JA 3BEUA 2XW9A 5TCAA 5IDKA 1NRSH 4X6MA 4RKJB 1C5WB 4AFSA 3SU3A 2G52A 3F9EA 1W13U 3UFAA 3MU0A 4XOJA 1O2LA 1TFXA 1HXEH 1XUHA 1P06A 1C5XB 4O9VA 4DG4A 1D3DB 5C5OA 4ZHMU 3A7TA 3W95A 1T4VH 1VITH 4BANB 3U28C 1CE5A 1BT7A 1K28D 2FLBH 3F1SB 1GJ5H 2BDGA 4CREA 2I6QA 2SGDE 1TNKA 2UUJB 1AB9B 2STBE 3LJJA 3NWUA 4IBLH 1NN6A 1TABE 4MLFB 1C1UH 3M7TA 4XDEA 1C5NH 2A4RA 1MTVA 3VEQB 2VVVA 1AU8A 1KDQA 5ESTE 1TPOA 2LP6A 3Q3XA 3FANA 1IHSH 1VCQA 1GVLA 3QTVH 1RIWB 3PLKA 2Z3CA 3OE7D 1LVBA 2VIQA 2Z9JA 2VVUA 1O3LA 2ZTXA 3SORA 1SQTA 3E3TA 5I25A 4MPXA 1V6DA 1WDIA 3EDXB 3OAAD 1YGCH 2RCEA 1E35B 3GY2A 1FV9A 1BHXF 1HAYB 3GCHB 3GCOA 3WWFA 1SPJA 4O03A 2GP9B 2GV6A 4KTCA 4MVNA 4LK4A 2VVCA 4K1EA 3SNBA 2G8TA 2J92A 5E0JA 4M7GA 3QGNB 3AAUA 4IC6A 2BZAA 1QGFA 1UTLM 3SJ9A 2ZFFH 1JBUH 5DG6A 1O2KA 1C2GA 1G3BA 1UK3A 4CRBA 1GDQA 1S85A 1B0EA 1A5HA 2ESTE 2A4OA 3ODDA 1F5LA 3BEIB 1NRPH 1FPHH 2FWWA 4WMFA 2AGIX 5A8YA 3F0PA 1CSOE 1HAPH 1H9HE 1YLDA 3RXDA 2SNVA 1THRH 5LGOA 2GGVB 3GCTF 3S69A 4Y71A 1KXDA 1G37A 1WQSA 1OOKB 1O35A 1JXPA 2FMJA 1HAHH 2F9BH 1QQUA 3LPRA 3M3TA 4NFFA 3PRDA 3ZV9A 1UCYH 3RXTA 3F3BA 2ZU5A 1F7ZA 1WU1A 4THNH 3Q77A 1SQOA 2WPMS 2PKAB 4PROA 2OQ5A 4XBDA 1SQAA 1ORFA 1TX6A 3F9FA 5DP9A 1EPTC 4FUBA 2BXUH 4Q80A 3TK6A 3RUOA 1K1OA 3PRBA 5T1VA 1K1IA 1RTKA 2SNWA 1CA0C 4AFUA 4B76A 1KMHB 2V6NA 1OP8A 3SBKA 5EJLA 1NT1A 1S81A 1CGJE 3TJVA 2XBVA 3BG8A 4OGYA 5F53A 1ZTKA 2FYRA 1NTPA 3E0PB 4LOYH 1SGYE 1COWD 1FY3A 1GCTC 2QF4A 5GPIB 3ZZCA 4OS5A 3RXJA 3ZZ5A 2HOBA 3LGYA 4AN7A 1BCUH 1ZLRA 2OCVB 1GGDC 2GCTB 1DY8A 1P2MA 5EG4A 2OQUA 4AORA 1VKYA 5EQQA 2HALA 2PUXB 2JIZD 1XKAC 1TPPA 5DP6A 2WPKS 2AMQA 4X6PA 1TNGA 1HDTH 3QK1A 2AEIH 3IITA 6GCHF 2BY9X 2RA3A 1YPGH 4DT7B 1BTWA 4AX9H 1MQ6A 3ZVEA 2FEQH 3NCLA 1K22H 4X1RU 4BAQB 1O3MA 1O2UA 1J16A 4JZFH 1S82A 1LHDH 1GL0E 3RM0H 4NCYA 4TY7A 1C5ZB 2F9UA 1S0RA 3LC3A 3MI4A 2KZ4A 3L3TA 1G3EA 1DLKB 4BNRA 1GBFA 3EQ0H 3MU5A 4ACAA 4TSFD 4DCDA 3S9AA 3SNCA 3VGCB 4U01A 2A32A 1V2ST 3LIWA 3RXGA 3RXVA 3AW0A 4WH8A 1F0SA 2XWBI 3K65B 1TMUH 2G4UA 1HUTH 1H4WA 1QBOA 2Z94A 1P9UA 3KF2A 3PMBB 2ZDLA 1GBDA 1ZJDA 5C1XA 1UVOA 3A7YA 3BN9A 4ESTE 2XWAA 1GJDB 1KXEA 1AZ8A 4X1SU 3LONA 1L4DA 3CNRA 3STIA 1C5LH 1H8ED 3NUMA 3SNDA 1DANH 1TNLA 2FOEA 3RC4A 1QFKH 3U69H 3SU5A 3MU1A 2NU3E 2ZHWH 1TGCA 1ZSKA 1C9PA 3MH7A 2O8WA 2ZEBA 1GBKA 1GHBF 3M5NA 1O5FH 2A4QA 2F3CE 4MPUA 1ELTA 3UR9A 3VXEH 1RTFB 2ZNKH 3OY5U 2ZTZA 1VCWA 3RU4T 3GDUA 1VGCB 4X2VA 1GVZA 2XBWA 2GT8A 4NGAH 1VJAU 1B7XB 2Z9IA 2OLGA 1UTNA 2CXVA 2WPLS 5CHAB 2BVSH 1O3NA 1O3DA 5C67A 3D62A 1RFNA 1O2MA 5EJZA 5C0TA 1PFXC 1C5PA 1HGTH 4Y8YA 1FAKH 1V2LT 2B0FA 4F48B 2J4IA 3MQKC 1P2QA 7ESTE 1DX5M 1QNJA 1ZPZA 1OWDA 3KQBA 2OC0A 4DIIH 2ZPSA 4I8GA 4MG3A 5F03A 2GCHF 1WYKA 2FOBA 4FUGA 3TH4H 1GI5A 2ANWA 1L1NA 3AASA 3ATLA 4FU9A 4AG1A 4D76A 1OHHD 3RXKA 1FI8A 2OD3B 4ISLA 1V2TT 9LPRA 1ZRBA 1OWKA 1P01A 1QR3E 1T32A 3TGKE 5TJXA 3N7OA 5E0GA 1ZGVA 1LCYA 2W26A 4AGJA 1N8OC 1P12E 4GCHG 5DJ7A 1UMAH 2B5TB 2Z9GA 5I46H 3WY8A 2A5KA 1YLCA 1GBHA 1LPGB 1UTQA 2LNCA 2WHXA 3LGWA 1OXGA 2NU2E 2ZU3A 3SU2A 3O8BA 3F2HA 3PO1C 2VWMA 1X7AC 3FP7E 2A5AA 1VITG 4UONA 2FOFA 5A0AE 1H9IE 1EOLA 4F55A 2PUQH 1E79D 4X8SH 3SQHE 2FOHA 4JCNA 3W94A 2GKVE 1CGHA 4JK5A 3SU0A 4X1QU 3TIUA 1OS8A 3UTUH 4WMEA 1V2MT 4Q7YA 1SOZA 3BTFE 4ABJA 4NA9H 3HKJB 1SGFG 3BTEE 1C2FA 1LPZB 1TMBH 5DSFA 3LDXH 2VIPA 1C1OA 2XCNA 3R0FA 1A4WH 3RXSA 4ZXYH 2RDEA 2ZDVH 3EE0B 3PV4A 4X0WU 4X8TH 1FUJA 3KQEA 1B5GH 4YLUA 1O38A 1OYQA 3E8LA 1EZXC 2F9VA 1MTUA 3D23A 1Y3UA 1EAUA 1YCPM 4QT8C 2H9TH 4SGBE 2FI4E 4U2WA 1DM4B 1WTHD 4ABAA 3E91A 3NZIA 1BRCE 2QXHA 4FVBA 5DGJA 1C4U2 4IS5A 1K1MA 5A0CA 3Q00A 1HIAA 3ZV8A 1HJ8A 2CMYA 3UB0A 1MUEB 4Y11E 2PLXA 3RXFA 2ANKH 5A8ZA 1QL7A 2Y7ZA 4D7FA 1O30A 1OYTH 3C1KA 3F68H 1HXFH 2XBYA 1P9SA 4AG2A 1ESAA 3SGAE 5FHTA 3ESTA 1CT2E 3ELAH 2FOAA 1XX9A 1ZZZA 1UTKA 4GSOA 1YY3A 1BMFD 3M5OA 1FLEE 4GVUA 1ZRKA 2AFQB 2ZU1A 2EC9H 4WXVA 2WPHS 4INKA 2WSSD 3TGIE 4X1PU 1H8DH 5EPYA 4CBNA 4JZDH 3T27A 1F5RA 1C2JA 1RGQA 1MAXA 3KCGH 1DXPA 5BRRE 2PSXA 2ALVA 1LVYA 4CR9A 5JBTA 2RA0A 3DUXH 4ZKOU 2QGRA 3EGKH 1DWEH 5FCKA 4J2YB 1TBRH 3HGNA 5E2OA 3UIRA 1T4UH 2QXGA 1AFQC 3IG6B 1UVUH 4KTSA 1XUGA 4ABDA 2WV9A 1O2YA 1O3OA 4MNYA 3A83A 3V0XA 1E1RD 1DSUA 9ESTA 1EFRD 2ZFQH 3EAJA 2IOTA 1OKXA 4KGAA 2VBCA 3U98H 4F49A 3URDA 2FX4A 3HKIB 2XC5A 1O34A 3PWBA 5C94A 5F8XA 1UTOA 1B0FA 1DITH 3PB1E 4I32A 2H9HA 3SV9A 3MU8A 3UNSA 1CHGA 2C8WB 4Y76A 1MCVA 2CV3A 4I8JA 1Y3YA 2NU4E 1DFPA 3E1XB 4Q7ZA 2SFAA 4FUFA 3PMAB 2NU0E 3OTPA 2Y6TA 2ZDAH 1ESTA 1QHRB 1AE8H 1THPB 1D9IA 1P0SH 1TLDA 1GJ9B 2SGAA 1H8HD 3FZDA 4A1TA 1PQ7A 3SGBE 1AUJA 1JWTA 2H1UA 2QIQA 4FU8A 1W7XH 2W3KA 1SI5H 4AZ2B 1YPJH 1EAWA 4AB8A 4I7YH 2BY5X 2GZ8A 3MNCA 4ABBA 4ABGA 2I6SA 1TA2A 1BZXE 3A8BA 3FKSD 1Q31A 1TWXB 1EPTB 4P00A 5PTPA 1W3CA 4B71A 1CA0B 4Y7AA 3L6PA 3LGVA 4RT0A 1N6YA 4F4OC 2WV4A 1LTOA 3DFJA 4TPIZ 1HV7A 2ZFTA 1Z6EA 1FJSA 2BLVA 4R8TB 1GCTB 2P8OB 4MTBA 2C8XB 1WOFA 3GICB 4XFQA 2VGCC 5HIYA 1GMDG 1NY22 1QA7A 1GGDB 5HGGA 1LO6A 4CHAC 2A7JA 5EXLA 2V3MA 2ZGJA 1LHGH 4ZKNU 2ZWLH 2FO9A 2Y7XA 1Z1IA 1A5IA 2EI6A 1G3DA 2FOCA 2SGFE 1IQJA 1TRYA 4O3UA 3ATMA 3MHWU 1TA6A 4I86A 2TBSA 8KME2 2BVXH 3BTHE 4H42U 4K2YA 7KMEH 5F6MA 1GMHG 1KDQB 5JDUB 4Q63A 1CT0E 1GHVH 3F6UH 2J98A 1BHXB 2PSYA 3PMHB 1O2SA 3K2UA 5CE1A 1MH0A 3SU4A 3ITIA 1NFWA 1GI1A 3RXMA 3DSOA 3UUZA 2QF3A 2OINA 1G30B 4CRGA 1GJ7B 1MU6B 3SN8A 1LQDB 1Z8IB 1O2HA 1VCPA 3PM3A 1K1NA 3S9CA 4TY6A 1N1LA 1FPCH 3TH3H 3OEED 1LPKB 2W3IA 2XCFA 4CRFA 1UHBA 5EXNA 1C2IA 1W10U 4X2XA 2BD3A 1HAXB 1O5DH 2ZA5A 5AFYH 2Z3DA 4WWYA 4KP0A 1XM1A 3UQOA 1AUTC 1C1RA 2Z9LA 4BXSA 3F2GA 4X1NU 3WWBA 4JMYA 1O3HA 3UR6A 4X2YA 4MPVA 2EI8A 2C93B 3BTME 4IN1A 2BLOA 4MPWA 1MKWK 3A8DA 4A1XA 1TX8A 2J5UA 2OXSA 8LPRA 1GI9B 2ZPRA 1KLJH 2FLRH 2SGEE 3OFND 3AK5A 1BBRE 2AIQA 4ZHLU 1BTYA 3O8DA 3SNAA 2GMTB 3C27B 2A7HA 1XXFA 4GCHF 2ZFRH 1DUAA 1H8IH 2YMSB 2VIWA 2ZGCA 3NPSA 5DP7A 5JBAS 1AQ7A 2QF0A 1GBIA 1GJ6A 2G5VA 2IJD1 3BF6H 3HATH 4TWWA 1FNIA 2D8WA 1VITF 1DWCH 1O3AA 1GPZA 3KYFA 3UAIC 2QE7D 1QA0A 1ZJKA 2IPQX 1SGFA 2A1DB 1O33A 3K6ZA 4K3JA 1QIXB 1YCPH 2R2MB 4I8KA 3SJOA 2BD4A 5A2MH 4TYDA 1V2OT 2W7SA 5ABWA 3SUDA 1A46H 4FUHA 1DPOA 5AF9H 3ZZ9A 2A7CA 1C2HA 2H6MA 5FCRA 1O3GA 1N8OB 3RM2H 3FVFB 1SGCA 2ZDKA 3QX5H 3JZ1B 1O2NA 1CGIE 3TH2H 2UWPA 1T31A 1HAZB 1SR5C 3H7OA 4D9RA 4Z6AH 1ANEA 1K21H 1DSTA 3RMMH 6ESTA 1MAYA 3IWMA 1GCDA 3A87A 1ZSJA 1PQ8A 1YYY1 2ULLA 1P8VC 1INCA 3P92A 2JJ2D 1G32B 1AVGH 2O8MA 4DGJA 1C9TA 1QRWA 3SQEE 2CHAC 1NRQH 3LKWA 2WPIS 1IQIA 5FBEA 4BAKB 4FUIA 1GI0A 4U32A 1C5MD 3EE7A 5GJ4B 2WYJA 1P11E 2HLCA 4A92A 1CHOF 1EB1H 2V7QD 1C2MA 1ZSLA 1O36A 3B9FH 2BTCE 1AVWA 1IQLA 1HB0B 1NBMD 1O2TA 4NWKA 4IW4E 1GJ8B 5DP8A 1WQVH 2V0BA 2BDIA 3ZVFA 5E2PA 4A6LA 1NRNH 3TK5A 2HVYB 1OSSA 1GDUA 1O5CB 4K8YA 3T25A 5KGOA 2M2AA 3DSGA 2V3OH 3KGPA 1TBZH 3A8CA 1ABJH 4UFDH 5BPEA 1SGEE 1OP2A 4I33A 4B2CA 2QN5T 2TGDA 4KTUA 1YPKH 1MKXK 2D26C 1Y3XA 1P02A 3MNXA 3RC5A 1KTSB 3CP7A 2A45B 2R9PA 4YOGA 1AFEH 1XUKA 1BTPA 3QWCH 1A61H 1Z6JH 3QDZB 3VXFH 1KSNA 3F9HA 1WV7H 2XYAA 1QCPA 3NRLA 4YOIA 1S0QA 5L30H 3ZZAA 1O3KA 5J4QA 2ODQA 1EASA 1EX3A 2F9OA 1ELDE 1DLEA 1HPGA 4D8NA 3S7KB 1K1JA 2HPPH 2R0KA 1DVAH 1ETTH 2ZCKP 1BQYA 2WUCA 4GHTA 1MMJN 3SOSA 3ZYDA 3BG4C 3M5MA 1F2SE 2P95A 3A7ZA 4Z0KA 5B6OA 1ARBA 1EAXA 4YOJA 3UNRA 1SBWA 1Y3WA 4GHQA 2YNBA 1SB1H 1SGIB 2AERH 1KXCA 1O5AB 2G51A 1V2QT 1AFQB 1L2EA 5EW1H 2BDYA 2ZQ2A 1EJMA 4XSKU 5CDFE 3T2NA 4Y79A 5AFZH 3S7HB 2FOMB 3OX7U 1O2PA 1NRRH 1MD7A 2PTNA 4I31A 1MBQA 1ZYOA 3UOUA 1DDJA 2FP7B 2A0QB 1G3CA 3JZ2B 1HRTH 5DP3A 4MDSA 1O2VA 1EP5A 4YT6H 4CRCA 1TBQH 2KM0A 1PPFE 2HWLB 1LVOA 1QZ8A 1TRNA 1QTFA 3KYGA 5H4IB 1P04A 1C5VA 1DICA 1ETSH 5EOKA 1YPEH 2ZFPH 5K7RA 3E6PH 2VH0A 3Q76A 1FXYA 1K1LA 2ZHFH 3BTWE 2WYGA 1W12U 4FUDA 1SHYA 3GYLB 3B8JA 1QL9A 3HK6B 1G9IE 1PPGE 1UTMA 3M61U 1TQ0B 2QV1A 2WZQA 3Q3KA 1U6QA 3ZVGA 2EQNA 2K0QA 4E7RG 3MYWA 1TB6H 1LKBA 4OS6A 3KQDA 1C2EA 2F9NA 2ZCLP 5K0HA 3MH5A 2ZGBH 1KLTA 1GMDF 3SJKA 2OK5A 1TYNA 4UEHH 2BY8X 1T8LA 2QXJA 4NZLA 3TJNA 1MTNC 2ANYA 2JDID 2TRMA 4B6EA 1FZZA 3BSQA 1NBME 2QCYA 1Q3XA 2XNDD 3GOVB 1HIAB 4ZH8A 2GT7A 3ATKA 4DURA 1T8OA 3LT3A 1GMHF 1E38B 3M7QA 1NFUA 2HPQH 3PV2A 1O2QA 1ELGA 4Y0YE 1V2UT 3GDSA 5FL7D 3UPEA 3FFGA 3OEHD 2UUFB 3PTNA 1FAXA 1C5OH 4ASHA 1BMNH 1J15A 1C4Y2 1F92A 1NO9H 1TNIA 2BMGB 2C8YB 2OTVA 3VFEA 8GCHG 5JPMH 1SGPE 3MO3A 1UCYE 2J2UA 2VGCB 3PMJA 1HJ9A 2AH4X 1W0KD 2W6ID 1QQ4A 1GHXH 1UCYK 2ZIQH 3V13A 1ARCA 2RG3A 4AGKA 1IOEA 1SC8U 1JRTA 2ZTYA 3SI3H 3LOXA 1CT4E 4IMQA 4D7GA 1GI2A 1P09A 1O37A 1CU1A 4ASUD 3SZEA 3RP2A 2JKHA 4Y6DA 1P2IA 3M35A 2L74A 1XXDA 1UVTH 1JMOH 1SOTA 1C5YB 2Z9KA 3RXQA 4YT7H 2FX6A 3ZVAA 3SYJA 3ODFA 3A7XA 3VB6A 1H1BA 2HNTF 5FX6A 1ZMNA 3RXEA 1GJCB 2CN0H 1TPAE 3VG8A 2BXTH 1W0YH 1IHTH 1BUIA 5TCCA 5AVDA 1ZPCA 1UK4A 1GBLA 1ZHRA 5KECA 3SO3A 3S9BA 2KCOA 2ZU2A 1G2MA 3MWIU 2BYAX 1TPSA 1W2KH 1GDNA 1LKAA 1DY9A 1F0RA 1EATA 4HI3A 3OTJE 1RRKA 4GUXA 2ASUB 1FN6A 3SJ8A 1JOUB 1ACBE 1PPBH 1Y5UT 3TK9A 2ODPA 4DJZB 5FAHA 5A09A 5LPFA 4LZ1H 1SG8B 5HMAA 4H6SB 4K1TA 3ZZ6A 4B75A 3U8RH 1EJNA 1W7GH 4Y0ZE 1BA8B 3T62A 1TQ7B 3UREA 5C1YA 2GCTC 4I8HA 5A0BA 1DE7H 4NSYA 4XD7D 5HKKD 2KR7A 1Z1JA 2OC1A 2Z7FE 1QB6A 1O3CA 3ZVDA 3MNBA 5GXPA 4NA8A 2TPIZ 1MZAA 3TNTA 4A5TS 5GCHG 1F5KU 4NIXA 3NK8A 1ANDA 1V2PT 2CF9H 2YNAA 3P8NA 5FX5A 3URCA 4ZUHA 3OY6U 4A7IB 1P10A 2PKSC 3M5LA 1P03A 7LPRA 3ENSB 4OS2A 4AOQA 1GI7B 1EUFA 3A81A 2VIDA 4AB9A 3VB7A 4B1TA 2BD8A 3E0NB 3P8FA 2PTCE 2VINA 1OWEA 1V3XA 1IAUA 1L1GA 1KXFA 1MQ5A 2G55A 1TE0A 1NM6A 3K9XB 4NA7A 4NWLA 4UFGH 1FIZA 2HRVA 2IN2A 1UJ1A 2BDHA 2ZF0H 2KFWA 2Q6DA 1C4V2 1JIMA 3SUGA 3DCLA 4NIYA 4E7NA 4FVDA 4ABEA 2OC7A 5E8EH 3N99A 1ABIH 1TGBA 1HYLA 2UWLA 1ZMJA 1BJVA 1VR1H 3RXRA 4TT3D 2QC2A 2HNTC 2B7DH 5FPTA 3EA8A 1QJ7B 3RXAA 3SGQE 2BOKA 5C3NA 2FIRH 2H5CA 3KQCA 4AYYB 2J98B 2A4GA 3UY9A 3G01A 2PV9B 1ZOMA 1P3EA 1G2LA 1ESBA 4KELA 4OS4A 1WSSH 3QN7A 2CHAB 5C20A 4MQAA 1GBCA 3BTDE 2O8LA 2ILNA 2ZCHP 1C1MA 3A8AA 4Q2KA 4VGCC 1UO6A 4DIHH 1Y8TA 2ZHQH 2P93A 4K8BA 4ZMAH 1L0ZA 1VGCC 2ZG0H 2OBOA 1GI8B 2HNTE 2PFEA 5C1UA 3M36A 2XBXA 4NG9H 1GHZA 1BRAA 2A2XH 3MH6A 1GJAB 1MD8A 1VJ9U 2BD9A 4NIVA 1KIGH 5FPSA 1S6LA 2WPJS 3V3MA 1YPLH 2GZ7A 3VB5A 3TVJB 1ZR0A 1Y5BT 3TU7H 3SZNA 3LGUA 3QUMP 4XRNA 3AAVA 5B6LA 1MBMA 4XE4A 2FI3E 1K2I1 1TOMH 3R3GB 3UWIA 3F2FA 3ZZBA 5GDSH 1GJ4H 4X8VH 4IN2A 3STJA 1XVOA 1XUJA 2KAIA 4KKDA 1SQRA 1SGRE 3CENA 1A5GH 1OWJA 2AYWA 1KYNA 3OU0A 1UW7A 1EQ9A 3T29A 4HGCA 1PPEE 3I29A 4RSPA 1BOQA 1TNJA 5GIBA 2GV7A 4RT1A 1D4PB 2BM2A 4BAHB 1XKBC 3SI4H 5C0UA 1GHWH 1AI8H 3RXCA 5JBBS 2UWOA 1BRUP 1BTZA 1FMGA 4ABHA 2P59A 1LQEA 1HAVA 1SVPA 3KHVA 5GWZA 1EXFA 2GTBA 2XNIA 1A3BH 2Q6FA 1GG6C 3CS7A 2UUKB 3BG4B 2ZHDA 1D3TB 1QBVH 1QRXA 2FXRA 2GZ9A 2DE8A 4HG6A 5DP5A 1JIRA 3OYPA 1DT2A 5T6GA 5JBCS 1D3QB 3MH4A 3GDVA 1AN1E 4RKOB 1OWHA 4X6OA 4YM9A 1S6HA 4ABFA 2Y81A 2R3UA 4Y7BA 3V7TA 2VNTA 3LGTA 5F8TA 2BB4A 3LH3A 5JB9S 1LHCH 1HBTH 3SW2B 2JH6D 4FU7A 3RU4E 4YZUA 3ZZ4A 2TGPZ 2WUBA 2XC0A 4BOHA 4U30A 1AKSA 4INHA 3KEEA 1BB0B 3D49H 1OWIA 1W11U 2JH0D 1GBBA 2GDEH 3BTGE 1AO5A 4B73A 4H6TA 3P70B 1XVMA 1TMTH 1O3BA 4BTUB 3UWJH 1EZQA 2Z3EA 2O8UA 5DPAA 3LU9B 1MZDA 2QY0B 1CA8B 2ANMH 4UD9H 2VWNA 2TGAA 4K69A 3GISB 4A1VA 1ANBA 1BBRK 2VIVA 1AIXH 1GMCG 1RXPA 2H9EH 2ZPQA 1ELFA 4FXGH 4WJG2 1ELAA 2FODA 8GCHF 1E1QD 2Y82A 2BLQA 3H7TA 4O3TA 3U1IB 3RMOH 2J97A 1UK2A 5DKMA 1O0DH 1ZTLA 1K0HA 1UTPA 2LPRA 3A84A 1PQAA 1MTNB 2FDAA 2R0LA 2FS9A 2XRCA 5EGMA 3GY7A 3TNSA 3ZVBA 4MNWA 1TONA 4GPGA 1QURH 3A80A 4FOUC 5GNDA 2O8TA 3PLBA 1T8MA 2ZKSA 3V12A 4YXWD 5F8ZA 1A1RA 1Z8GA 2PP6A 1HCGA 3SV6A 2W7UA 1J8AA 1WTGH 2JJ1D 2F43B 2G5NA 1O2XA 2AMPA 3TITA 3QTOH 1CO7E 3PO1B 2ZFSA 1J14A 3SUFA 1TIOA 2FTLE 2ZZUH 3TPIZ 2G81E 3ZVCA 3MO6A 1E34B 2Q1JA 2ZQ1A 1AY6H 1O2JA 1S84A 2B9LA 1GHAG 3A86A 1BDAA 1SFIA 1SMFE 4NZQA 2PGBB 2GJGA 1GBAA 1QB1A 2AS9A 3LH1A 1TGSZ 1DS2E 4LZ4B 5T3HA 1SL3A 1A0JA 1P2OA 3O8CA 2FS8A 3DT0H 4B2BA 3MOCA 2WV5A 5ETXA 1IQGA 1FONA 1O3EA 1O2WA 1TNHA 1P05A 4WXIA 1T7CA 1XUIA 4XBBA 1EJAA 3HK3B 3DSPA 2BQWB 2XTTB 1C1VH 1AWFH 1C2LA 1Z8RA 1O2RA 1O3PB 2YOLA 3GY5A 2QYIA 3MNSA 2BX3A 3BIVH 5JB8S 1O2IA 4I8LA 3RMNH 1V2RT 1YC0A 1Z71A 2AHME 3ZIAD 5GCHF 2GX4A 2OUAA 2SGQE 1FX0B 1QB9A 1O39A 1TAWA 3EA7A 4LXBH 2BY6X 1FY1A 1FN8A 3W1EA 1TRMA 1DXWA 4GAWA 1O2OA 3RLWH 4WVPE 1SLXB 3MFJA 1NZQH 1K1PA 3PYHA 1HJAC 1BTUA 1BJUA 1PPCE 3U1JB 2DUCA 2YMSD 3UOPA 1ELVA 2P8OC 1GBMA 1EAIA 1O5EH 4WY3A 1K9OE 5EJ1A 3PTBA 3LC5A 1ZHMA 2RDLA 1NPMA 4NSVA 5FPYA 1V2JT 2PHBA 4FUJA 4CH8B 3ZZ8A 2V35A 1O32A 2AGGX 4WH6A 3GYMA 3RXUA 3P8OA 1O3FA 4RN6A 1IQEA 1PQ5A 3FN8A 5EXMA 1AZZA 1CBWC 2QAAA 4YTAA 5EU8A 2L6OA 3PWCA 5EODA 4YLQH 1EOJA 2F91A 2PKSB 2Y5HA 5LH8A 2EEKA 2HVXA 3SV8A 3T28A 5EQRA 3SHCH 1P2JA 1AD8H 2XOKD 1HAOH 2THFB 1WXRA 7GCHG 1WUNH 2VIOA 4AFQA 4ISHH 3PLPA 5FXLA 1P2NA 3RXBA 1V2VT 3RXLA 1RJXB 2B8OH 3QZQA 4ACBA 1GBJA 4ISIH 4FUEA 1HLTH 2ZECA 2JETC 3LGIA 3BEFB 4TPYA 3NXPA 1AGJA 1G36A 1AE5A 1XMNB 2JH5D 3P95A 3PV5A 1AHTH 4UFEH 2HLDD 3HGPA 3S0NA 2PKAA 4SGAE 1GJBB 3UNQA 2J95A 4UE7H 2G00A 6CHAC 4K5ZA 2NU1E 4K1SA 4BXWA 4JZ1A 2BD2A 2Y5FA 4CRAA 1SGNE 1NFYA 1SGTA 4ISOA 4BAOB 2OP9A 3E90B 1YPHC 4HTCH 1FQ3A 1C1QA 1BMAA 1YBWA 2P3FH 1DWBH 1WCZA 3L33A 1BTXA 1YCPK 2R3YA 5JYIA 2FESH 2P3TB 4JYUH 1EB2A 1MABB 1TGTA 2KCYA 4IC5A 4NFEA 4P02A 4Q7XA 4YO9A 2XC4A 1MU8B 1TGNA 4JZIA 1C5RA 3VB4A 3VB3A 1HFDA 4VGCB 1EKBB 2F9PA 3I78A 3DHKH 1GL1A 4M9FA 2DE9A 1F0UA 1SGDE 4DT4A 2J38A 1AB9C 5SGAE 1Z7KA 5C2ZA 3AVZA 1ZGIA 3T5FH 4YESB 1IQFA 4E05H 4AYVB 1UTJA 1BIOA 2GMTC 1C1PA 2KCPA 2BOHB 1D6RA 2BHGA 3P6ZB 2VWLA 1W8BH 3QZRA 5DK1A 2YMSC 3NKKA 1QBNA 1YPHE 2ODYB 4UDWH 1LDTT 1RIWC 4JYVH 3BTQE 2O9QA 5EQSA 5HYOA 2FM2A 1QL8A 2FPZA 2PWXA 3K6YA 2ZP0H 1TOCB 2C4FH 3GY6A 1HAGE 2ALPA 4RI0A 3SU1A 3TLOA 1F0TA 3N7EA 1FY5A 5HM2A 4X8UH 2G4TA 5C5NA 4D9QA 3KN2A 4OS1A 4CHAB 4ZKRU 4B2AA 3GCHC 1RTLA 4INLA 1YF4A 1VZQH 1ANCA 1IQKA 3QGJA 2WINI 5IK2D 1KLIH 3RXIA 5IYTA 1QJ6B 1A7SA 1YKTA 5KEDA 3DD2H 3OSYA 1EZSC 3E16B 2BDBA 3SJIA 4ABIA 5LPRA 3MTYA 5C17A 1A2CH 4BTIB 1GVKB 2F83A 5EPNA 2EY4C 2BLWA 1AMHA 1GG6B 1O5GH 1HAIH 1SFQB 1C1SA 4JK6A 2EI7A 5CMXH 2BQ6B 1YWUA 3GY8A 1J9CH 4UFFH 1O2ZA 2A31A 2GDDA 1IQMA 4CR5A 1FY8E 2M5TA 3FAOA 1Q2WA 4DVAU 4MNVA 2EA3A 1C5QA 3H5CB 1A0HB 1OX1A 5HXFA 3U8OH 2ZHEH 2J34A 3ZZ7A 3WW7A 1GBTA 2FZZA 5DO4H 3KL6A 4WF8A 1PYTD 2QF5A 5EIYA 3O8RA 1TX7A 4Z1MD 3RDZA 2R2WU 4AC9A 2J9NA 3DFLA 3FOAA 1XUFA 2CF8H 3D65E 4GLYA 3U9AH 2P16A 1GMCF 1QRZA 3MU4A 1RD3B 1WAYB 3U8TH 4NIWA 2Y5GA 1NU7B 2CK3D 4WMDA 3RLYH 1D3PB 2PR3A 2PGQB 2C90B 2ZO3H 2UUYA
chains in the Genus database with same CATH topology
1FIWA 1YM0A 3GCTG 1NS3A 3FP8E 3M3SA 4OS7A 1AWHB 2TIOA 1P2KA 2ZU4A 2ZC9H 3Q3YA 2IPHA 1SLUB 1OP0A 3B23B 4B74A 5J4SA 1BITA 1THSH 1NU9A 2D2DA 1T8NA 1MTSA 1CHOG 1Z8JB 1V2WT 1S5SA 2NWNA 3A82A 4ZXXH 1C1NA 1CVWH 1E36B 3A85A 2Y80A 5L2ZH 4Y10E 1DUEA 4Y8ZA 3TGJE 1O31A 5HM9A 3SV2H 4ZROA 1KTTB 5G4BA 4FUCA 1LVMA 1ZPBA 1J17T 4IGDA 1E0FD 4ZAEA 4ZKSU 4MNXA 3RMLH 2IJOB 3PROA 1NESE 5L6NH 4X2WA 3RXOA 2TGTA 1SGQE 2W5EA 1C1TA 1BRBE 3RU4D 3SHAH 1MTWA 2FOGA 3RXPA 3MMGA 1V2KT 2AIPA 2A2QH 2BVRH 1GBEA 1ETRH 1A3EH 2KAIB 1Y5AT 1ELBA 2PW8H 3BIUH 1ZTJA 3VGCC 1GHAF 1Y59T 1PPZA 4K60A 1MKWH 1ZHPA 2CGAA 1BMLA 1WBGB 1L4ZA 6GCHG 1LMWB 2CJIA 2FTMA 2Q6GA 2ZDNA 1M9UA 3ZYEA 2Z6BD 2ZI2H 4AFZA 1BBRH 1GI4A 2P94A 3EYDA 1SLVB 5AHGH 3KNXA 3I77A 1O2GH 1KXBA 1C2DA 3LJOA 3P8GA 4CH2B 1HAVB 3BV9B 2QXIA 2OBQA 4H4FA 1MCTA 2H5DA 1CQQA 2J94A 1C5SA 1BMMH 1PYTC 1OPHB 3BTTE 1C1WH 1FY4A 1EZUC 4ZHAA 1GHYH 1V2NT 1Y3VA 3ATIA 1DWDH 1O3IA 3QO6A 2FYQA 1SLWB 1AVXA 2AGEX 2BDCA 4DY7B 2VWOA 4IMZA 4XBCA 2ZDMA 3T26A 2GVFA 4E06H 1YPMH 3HPTB 4DOQA 4HZHA 3FP6E 2BD7A 1H9LB 5LPEA 1NFXA 4Y8XA 3BTKE 1UHBB 5CHAC 4R0IA 1NROH 3F9GA 3MO9A 4HFPB 2SGPE 1O5BB 1KXAA 2D1JA 3GY3A 1HNEE 5DP4A 1GI6A 3CS0A 2XXLA 1JRSA 1LHFH 4TWYA 1AKSB 2P3UB 1UVSH 1GHBG 1PPHE 3ZZ3A 2BX4A 3QLPH 2K1QA 4DW2U 1E37B 3RC6A 3SNEA 1C5UA 3M37A 3TJOA 1KY9A 3A7WA 1PJPA 3M7UA 1UVPA 1LHEH 2OC8A 1HJAB 3SUEA 2V3HH 1N6XA 1DOJA 2BDAA 7GCHF 4O97A 2GD4B 4JYTA 3RXHA 4OGXA 2ZGXH 3FZZA 2H2ZA 3UQVA 3VPKA 5L2YH 1IQNA 5E0HA 5T6DA 5EW2H 2BY7X 2STAE 1P3CA 3GCNA 5T6FA 1GWAA 3GY4A 2VU8E 1YP9A 3KIDU 4BAMB 2GCHG 1CBWB 4BTTB 1QJ1B 3A88A 1ELCA 2A5IA 1ELEE 1SSXA 1TALA 3SV7A 2VH6A 3P17H 1ZMLA 1ID5H 3A89A 1MKXH 4CRDA 5A8XA 1GI3A 4J1YA 1P57B 2VB0A 4X6NA 1C5TA 3EA9A 1EP6A 2C3SA 1NC6A 3ZZDA 1W14U 1W0ZU 1D6WA 2C8ZB 2ZGHA 2FI5E 1L1JA 3SU6A 1FDPA 5ESBA 2JETB 1QY6A 1S6FA 1SHHB 1S83A 2QA9E 3M3VA 1C2KA 8ESTE 2VJ1A 4CBOA 5FBIA 2BQ7B 1A0LA 3DA9B 6LPRA 1BTHH 2BD5A 2BZ6H 1EPTA 6CHAB 3AW1A 3TJUA 1IQHA 4ISNA 2HGTH 4JZEH 1RS0A 3A7VA 3ATWA 2AMDA 1O3JA 3BEUA 2XW9A 5TCAA 5IDKA 1NRSH 4X6MA 4RKJB 1C5WB 4AFSA 3SU3A 2G52A 3F9EA 1W13U 3UFAA 3MU0A 4XOJA 1O2LA 1TFXA 1HXEH 1XUHA 1P06A 1C5XB 4O9VA 4DG4A 1D3DB 5C5OA 4ZHMU 3A7TA 3W95A 1T4VH 1VITH 4BANB 1CE5A 1BT7A 1K28D 2FLBH 3F1SB 1GJ5H 2BDGA 4CREA 2I6QA 2SGDE 1TNKA 2UUJB 1AB9B 2STBE 3LJJA 3NWUA 4IBLH 1NN6A 1TABE 4MLFB 1C1UH 3M7TA 4XDEA 1C5NH 2A4RA 1MTVA 3VEQB 2VVVA 1AU8A 1KDQA 5ESTE 1TPOA 3Q3XA 3FANA 1IHSH 1VCQA 1GVLA 3QTVH 1RIWB 3PLKA 2Z3CA 1LVBA 2VIQA 2Z9JA 2VVUA 1O3LA 2ZTXA 3SORA 1SQTA 3E3TA 5I25A 4MPXA 1V6DA 3EDXB 1YGCH 2RCEA 1E35B 3GY2A 1FV9A 1BHXF 1HAYB 3GCHB 3GCOA 1SPJA 4O03A 2GP9B 2GV6A 4KTCA 4MVNA 4LK4A 2VVCA 4K1EA 3SNBA 2G8TA 2J92A 5E0JA 4M7GA 3QGNB 3AAUA 4IC6A 2BZAA 1QGFA 1UTLM 3SJ9A 2ZFFH 1JBUH 5DG6A 1O2KA 1C2GA 1G3BA 1UK3A 4CRBA 1GDQA 1S85A 1B0EA 1A5HA 2ESTE 2A4OA 3ODDA 1F5LA 3BEIB 1NRPH 1FPHH 2FWWA 4WMFA 2AGIX 5A8YA 1CSOE 1HAPH 1H9HE 1YLDA 3RXDA 2SNVA 1THRH 5LGOA 2GGVB 3GCTF 3S69A 4Y71A 1KXDA 1G37A 1WQSA 1OOKB 1O35A 1JXPA 2FMJA 1HAHH 2F9BH 1QQUA 3LPRA 3M3TA 4NFFA 3ZV9A 1UCYH 3RXTA 2ZU5A 1F7ZA 1WU1A 4THNH 3Q77A 1SQOA 2WPMS 2PKAB 4PROA 2OQ5A 4XBDA 1SQAA 1ORFA 1TX6A 3F9FA 5DP9A 1EPTC 4FUBA 2BXUH 4Q80A 3TK6A 3RUOA 1K1OA 1K1IA 1RTKA 2SNWA 1CA0C 4AFUA 4B76A 2V6NA 1OP8A 3SBKA 1NT1A 1S81A 1CGJE 3TJVA 2XBVA 3BG8A 4OGYA 1ZTKA 2FYRA 1NTPA 3E0PB 4LOYH 1SGYE 5GPIB 1FY3A 1GCTC 3ZZCA 4OS5A 3RXJA 3ZZ5A 2HOBA 3LGYA 4AN7A 1BCUH 1ZLRA 2OCVB 1GGDC 2GCTB 1DY8A 1P2MA 5EG4A 2OQUA 4AORA 5EQQA 2HALA 2PUXB 1XKAC 1TPPA 5DP6A 2WPKS 2AMQA 4X6PA 1TNGA 1HDTH 3QK1A 2AEIH 3IITA 6GCHF 2BY9X 2RA3A 1YPGH 4DT7B 1BTWA 4AX9H 1MQ6A 3ZVEA 2FEQH 3NCLA 1K22H 4X1RU 4BAQB 1O3MA 1O2UA 1J16A 4JZFH 1S82A 1LHDH 1GL0E 3RM0H 4NCYA 4TY7A 1C5ZB 2F9UA 1S0RA 3LC3A 3MI4A 3L3TA 1G3EA 1DLKB 4BNRA 1GBFA 3EQ0H 3MU5A 4DCDA 3S9AA 3SNCA 3VGCB 4U01A 2A32A 1V2ST 3LIWA 3RXGA 3RXVA 3AW0A 4WH8A 1F0SA 2XWBI 3K65B 1TMUH 2G4UA 1HUTH 1H4WA 1QBOA 2Z94A 1P9UA 3KF2A 3PMBB 2ZDLA 1GBDA 1ZJDA 5C1XA 1UVOA 3A7YA 3BN9A 4ESTE 2XWAA 1GJDB 1KXEA 1AZ8A 4X1SU 3LONA 1L4DA 3STIA 1C5LH 3NUMA 3SNDA 1DANH 1TNLA 2FOEA 3RC4A 1QFKH 3U69H 3SU5A 3MU1A 2NU3E 2ZHWH 1TGCA 1ZSKA 1C9PA 3MH7A 2O8WA 2ZEBA 1GBKA 1GHBF 3M5NA 1O5FH 2A4QA 2F3CE 4MPUA 1ELTA 3UR9A 3VXEH 1RTFB 2ZNKH 3OY5U 2ZTZA 1VCWA 3RU4T 3GDUA 1VGCB 4X2VA 1GVZA 2XBWA 2GT8A 4NGAH 1VJAU 1B7XB 2Z9IA 2OLGA 1UTNA 2CXVA 2WPLS 5CHAB 2BVSH 1O3NA 1O3DA 5C67A 3D62A 1RFNA 1O2MA 1PFXC 1C5PA 1HGTH 4Y8YA 1FAKH 1V2LT 2B0FA 2J4IA 1P2QA 7ESTE 1DX5M 1QNJA 1ZPZA 1OWDA 3KQBA 2OC0A 4DIIH 2ZPSA 4I8GA 4MG3A 5F03A 2GCHF 1WYKA 2FOBA 4FUGA 3TH4H 1GI5A 2ANWA 1L1NA 3AASA 3ATLA 4FU9A 4AG1A 4D76A 3RXKA 1FI8A 2OD3B 4ISLA 1V2TT 9LPRA 1ZRBA 1OWKA 1P01A 1QR3E 1T32A 3TGKE 5TJXA 3N7OA 5E0GA 1ZGVA 1LCYA 2W26A 4AGJA 1N8OC 1P12E 4GCHG 5DJ7A 1UMAH 2B5TB 2Z9GA 5I46H 3WY8A 2A5KA 1YLCA 1GBHA 1LPGB 1UTQA 2LNCA 3LGWA 1OXGA 2NU2E 2ZU3A 3SU2A 3O8BA 3PO1C 2VWMA 1X7AC 3FP7E 2A5AA 1VITG 4UONA 2FOFA 5A0AE 1H9IE 1EOLA 2PUQH 4X8SH 3SQHE 2FOHA 4JCNA 3W94A 2GKVE 1CGHA 4JK5A 3SU0A 4X1QU 3TIUA 1OS8A 3UTUH 4WMEA 1V2MT 4Q7YA 1SOZA 3BTFE 4ABJA 4NA9H 3HKJB 1SGFG 3BTEE 1C2FA 1LPZB 1TMBH 3LDXH 2VIPA 1C1OA 2XCNA 3R0FA 1A4WH 3RXSA 4ZXYH 2ZDVH 3EE0B 3PV4A 4X0WU 4X8TH 1FUJA 3KQEA 1B5GH 4YLUA 1O38A 1OYQA 3E8LA 1EZXC 2F9VA 1MTUA 3D23A 1Y3UA 1EAUA 1YCPM 4QT8C 2H9TH 4SGBE 2FI4E 4U2WA 1DM4B 1WTHD 4ABAA 3E91A 3NZIA 1BRCE 2QXHA 4FVBA 5DGJA 1C4U2 4IS5A 1K1MA 5A0CA 3Q00A 1HIAA 3ZV8A 1HJ8A 2CMYA 1MUEB 4Y11E 2PLXA 3RXFA 2ANKH 5A8ZA 1QL7A 2Y7ZA 4D7FA 1O30A 1OYTH 3C1KA 3F68H 1HXFH 2XBYA 1P9SA 4AG2A 1ESAA 3SGAE 5FHTA 3ESTA 1CT2E 3ELAH 2FOAA 1XX9A 1ZZZA 1UTKA 4GSOA 3M5OA 1FLEE 4GVUA 1ZRKA 2AFQB 2ZU1A 2EC9H 4WXVA 2WPHS 4INKA 3TGIE 4X1PU 1H8DH 5EPYA 4CBNA 4JZDH 3T27A 1F5RA 1C2JA 1RGQA 1MAXA 3KCGH 1DXPA 5BRRE 2PSXA 2ALVA 1LVYA 4CR9A 5JBTA 2RA0A 3DUXH 4ZKOU 2QGRA 3EGKH 1DWEH 5FCKA 4J2YB 1TBRH 3HGNA 5E2OA 3UIRA 1T4UH 2QXGA 1AFQC 3IG6B 1UVUH 4KTSA 1XUGA 4ABDA 1O2YA 1O3OA 4MNYA 3A83A 3V0XA 1DSUA 9ESTA 2ZFQH 3EAJA 2IOTA 1OKXA 4KGAA 3U98H 4F49A 3URDA 2FX4A 3HKIB 2XC5A 1O34A 3PWBA 5F8XA 1UTOA 1B0FA 1DITH 3PB1E 4I32A 2H9HA 3SV9A 3MU8A 3UNSA 1CHGA 2C8WB 4Y76A 1MCVA 2CV3A 4I8JA 1Y3YA 2NU4E 1DFPA 3E1XB 4Q7ZA 2SFAA 4FUFA 3PMAB 2NU0E 2Y6TA 2ZDAH 1ESTA 1QHRB 1AE8H 1THPB 1D9IA 1P0SH 1TLDA 1GJ9B 2SGAA 3FZDA 4A1TA 1PQ7A 3SGBE 1AUJA 1JWTA 2H1UA 2QIQA 4FU8A 1W7XH 2W3KA 1SI5H 4AZ2B 1YPJH 1EAWA 4AB8A 4I7YH 2BY5X 2GZ8A 3MNCA 4ABBA 4ABGA 2I6SA 1TA2A 1BZXE 3A8BA 1Q31A 1TWXB 1EPTB 5PTPA 1W3CA 4B71A 1CA0B 4Y7AA 3L6PA 3LGVA 1N6YA 4F4OC 2WV4A 1LTOA 3DFJA 4TPIZ 1HV7A 2ZFTA 1Z6EA 1FJSA 2BLVA 4R8TB 1GCTB 2P8OB 4MTBA 2C8XB 1WOFA 3GICB 4XFQA 2VGCC 1GMDG 1NY22 1QA7A 1GGDB 5HGGA 1LO6A 4CHAC 2A7JA 5EXLA 2ZGJA 1LHGH 4ZKNU 2ZWLH 2FO9A 2Y7XA 1Z1IA 1A5IA 2EI6A 1G3DA 2FOCA 2SGFE 1IQJA 1TRYA 4O3UA 3ATMA 3MHWU 1TA6A 2TBSA 8KME2 2BVXH 3BTHE 4H42U 4K2YA 7KMEH 5F6MA 1GMHG 1KDQB 5JDUB 1CT0E 1GHVH 3F6UH 1BHXB 2PSYA 3PMHB 1O2SA 3K2UA 5CE1A 1MH0A 3SU4A 3ITIA 1NFWA 1GI1A 3RXMA 3UUZA 2QF3A 2OINA 1G30B 4CRGA 1GJ7B 1MU6B 3SN8A 1LQDB 1Z8IB 1O2HA 1VCPA 3PM3A 1K1NA 3S9CA 4TY6A 1N1LA 1FPCH 3TH3H 1LPKB 2W3IA 2XCFA 4CRFA 1UHBA 5EXNA 1C2IA 1W10U 4X2XA 2BD3A 1HAXB 1O5DH 2ZA5A 5AFYH 2Z3DA 4WWYA 4KP0A 1XM1A 3UQOA 1AUTC 1C1RA 2Z9LA 4BXSA 4X1NU 4JMYA 1O3HA 3UR6A 4X2YA 4MPVA 2EI8A 2C93B 3BTME 4IN1A 2BLOA 4MPWA 1MKWK 3A8DA 4A1XA 1TX8A 2OXSA 8LPRA 1GI9B 2ZPRA 1KLJH 2FLRH 2SGEE 1BBRE 2AIQA 4ZHLU 1BTYA 3O8DA 3SNAA 2GMTB 3C27B 2A7HA 1XXFA 4GCHF 2ZFRH 1DUAA 1H8IH 2VIWA 2ZGCA 3NPSA 5DP7A 5JBAS 1AQ7A 2QF0A 1GBIA 1GJ6A 2G5VA 3BF6H 3HATH 4TWWA 1FNIA 2D8WA 1VITF 1DWCH 1O3AA 1GPZA 1QA0A 1ZJKA 1SGFA 2A1DB 1O33A 3K6ZA 4K3JA 1QIXB 1YCPH 2R2MB 4I8KA 3SJOA 2BD4A 5A2MH 4TYDA 1V2OT 2W7SA 5ABWA 3SUDA 1A46H 4FUHA 1DPOA 5AF9H 3ZZ9A 2A7CA 1C2HA 2H6MA 5FCRA 1O3GA 1N8OB 3RM2H 3FVFB 1SGCA 2ZDKA 3QX5H 3JZ1B 1O2NA 1CGIE 3TH2H 2UWPA 1T31A 1HAZB 1SR5C 3H7OA 4D9RA 4Z6AH