4JK6A

Human urokinase-type plasminogen activator (upa) in complex with a bicyclic peptide inhibitor (uk18-d-aba)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Improving binding affinity and stability of Peptide ligands by substituting glycines with d-amino acids.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2013-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jk6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jk6A01
1NTPA 4WH8A 1SG8B 3RM2H 2HRVA 4UD9H 2B5TB 1N8OB 1TRMA 1EP5A 4YOJA 3BEFB 4X1SU 1FN8A 1XUFA 1GMCG 1C5LH 2F9UA 1TMBH 1YBWA 3LGYA 2JETC 3P17H 1JBUH 3QTOH 4RSPA 3BIVH 5L6NH 2QY0B 3ZYEA 3PMAB 4HZHA 1DSTA 2TIOA 2HLCA 1H9LB 5C2ZA 4GHQA 1Z8JB 2GT8A 4O03A 1ESTA 1Q2WA 1TNLA 4X2XA 3DHKH 1HUTH 3BTQE 2ZPSA 1P9SA 3W95A 1RD3B 2H9EH 1TGNA 1GJ6A 1GJ8B 1QRXA 1RGQA 2OQUA 4INKA 2BOHB 7LPRA 1OOKB 2RDLA 2A7JA 1CE5A 1O3CA 5FPTA 1WCZA 4X0WU 4AOQA 3VB6A 5CHAC 3S9CA 1FMGA 1DSUA 2ZQ2A 1TNKA 1XUKA 1A0LA 1YC0A 4ZAEA 1GBFA 2AIPA 1Z1IA 1QR3E 3SU3A 1QA0A 4AGJA 1P11E 2JETB 1ETRH 1MTVA 1KSNA 2BLWA 2QAAA 5AVDA 4NA8A 2XC5A 1TA2A 4TYDA 5EW2H 1IQJA 3SV8A 1D9IA 1V6DA 2SFAA 1SC8U 2BD9A 2ALPA 1VJAU 2A45B 1BMLA 3ATMA 5GIBA 1EB2A 1GI8B 3NZIA 1MTUA 4ABBA 1SMFE 5DP3A 3K6ZA 2ZGCA 1DFPA 1K1IA 1O2TA 1BMNH 5EOKA 2UUFB 4Q7YA 1P02A 3CS7A 1AVXA 1S85A 1VGCC 3PLKA 1MD7A 5JB9S 5GPIB 2WUCA 2SGPE 2PTNA 2BLQA 3G01A 3QGJA 2EI8A 3UWJH 1EZXC 1SGEE 1MKXH 2GV6A 3TGKE 2FZZA 2OBOA 4FU7A 1SBWA 3MH6A 1ZMJA 5CHAB 2WPHS 1YPLH 1O2OA 2BB4A 3AAVA 3OU0A 4ZH8A 1NROH 4ABAA 1H8DH 2GCTC 4K1EA 1GCTC 1P09A 3GY4A 3M7TA 5F03A 2QN5T 2W3KA 1SGCA 3RXRA 1DICA 2FI5E 2H2ZA 2PGQB 3D62A 3MH4A 4Y10E 1L4ZA 1CBWC 1OP8A 3A85A 1G36A 1WUNH 2ZHFH 1QIXB 3A8BA 3SW2B 3S9AA 4XBDA 3RXLA 3U1JB 5L2ZH 4CR5A 3A89A 1MZAA 1TBRH 4ISNA 1JWTA 1K2I1 1DXPA 2BD2A 1GBJA 1H8IH 1O35A 1SGFG 1XVOA 1V2TT 4JMYA 4KP0A 4MLFB 2PSYA 4A7IB 1N6YA 1SGIB 1YPEH 3UNQA 1BRUP 4MPWA 1HIAA 1ANBA 1GBLA 2HVXA 1ZHPA 3GDSA 5C20A 1T8OA 5FBEA 2BDCA 1C2EA 2BDYA 1GDQA 5EPNA 1FPHH 4YOIA 3SJIA 2Z9GA 3GY6A 1LQDB 1C2KA 1A5GH 1G2MA 5HMAA 4X6MA 2GCTB 3VB4A 1OS8A 2ZECA 3SNAA 1GCTB 1YKTA 2J95A 1SPJA 4TPYA 1HCGA 1O2QA 1L1NA 1O2IA 5J4SA 1DLEA 1BTXA 5JDUB 2FDAA 2FOMB 2H1UA 3VB7A 4AFQA 4A6LA 1MD8A 1UTQA 3M7QA 4MPXA 3MNSA 2BVSH 3BTEE 4K1TA 1SOTA 1GBTA 4B1TA 1HAPH 3MU0A 2OP9A 3PTBA 5ABWA 4DIIH 2FYRA 4BAMB 3LPRA 4ZHMU 4JYUH 4ZUHA 1EX3A 2ZFSA 5BPEA 1TONA 4FUJA 3MMGA 1WAYB 4IMZA 5AF9H 1U6QA 3MO6A 4XE4A 3MO9A 4GUXA 3V0XA 2CGAA 1C1RA 1ZTLA 4BTIB 3TJNA 2QGRA 1LQEA 2ZDNA 1QJ6B 3P70B 2R0LA 3S9BA 1J16A 1FIZA 2PUXB 5HM2A 1O2ZA 1UCYH 2UWLA 4X8UH 1UJ1A 2Q6DA 1GI0A 1F2SE 1OX1A 1PPZA 4FUEA 1CT0E 2GZ9A 3RXJA 4JZFH 4KELA 1LHFH 1UTMA 1C2FA 1O2WA 3M5NA 3SUDA 1BITA 5SGAE 2VINA 1AUTC 3EYDA 1MCVA 3OYPA 1THRH 1FN6A 1O2XA 3TJUA 1K28D 1OPHB 2HPPH 1O2MA 4Y8ZA 1ZYOA 3SOSA 1DWDH 1P2MA 4NZQA 2JH6D 2H5CA 1EZUC 1AQ7A 2OLGA 1XXFA 4O9VA 1Z6JH 1ESAA 1GBMA 3K2UA 3BTKE 7ESTE 4CHAC 2BDHA 2NU2E 2J4IA 1ZGIA 1H9IE 5E2OA 5DGJA 4A92A 3BF6H 3ZZ9A 2FI3E 1GHXH 1D6WA 2QXJA 2ZFFH 1QJ7B 2G81E 3VPKA 4YT6H 4FUBA 1O0DH 2Y7ZA 4ISLA 2M5TA 5DP5A 2OD3B 4GSOA 3Q3KA 3DUXH 3MU8A 1A4WH 1TRNA 9LPRA 2Q6FA 1P3EA 2CXVA 1O3JA 1CO7E 1HIAB 2QIQA 4K8BA 1ZRKA 1P05A 2A5IA 4MDSA 4RKOB 2PLXA 4Q7XA 1NRNH 1W13U 1O2RA 1SGTA 1YCPH 1GHVH 3ZZ3A 3SNEA 3A8AA 1IQHA 2FPZA 3KQBA 1LPGB 1EZQA 1UK4A 3UWIA 2Y7XA 2WYJA 1TQ0B 4UONA 4CRFA 4Y8XA 3W94A 2Z3DA 1IQIA 3RXTA 2GDEH 5C5NA 2AMQA 1BTHH 4XFQA 1GHAF 2ZEBA 1ELCA 2P3FH 1EOJA 2ZU5A 2WV4A 3RC4A 1W2KH 4CHAB 2WV5A 2F9VA 4X8SH 2ZA5A 1DS2E 1QL9A 1FI8A 3GCOA 3U8OH 3RXAA 1OWEA 3TGJE 5EPYA 4Q2KA 4AGKA 5EU8A 3T2NA 2Y6TA 5F6MA 3BG4C 5PTPA 3M37A 2ZZUH 4FUGA 4F49A 4D7GA 1ZJDA 1BUIA 1EAIA 1NFWA 3SNDA 4IMQA 2VIDA 1EJAA 1AE5A 1FJSA 3BIUH 4UFGH 2VU8E 2BY7X 3KQEA 4ABFA 4LXBH 3BEIB 3UFAA 3SU0A 2ESTE 1XKBC 2WPLS 3GDVA 3UR9A 1AN1E 1E36B 2FLBH 2ZPRA 3E1XB 6GCHG 3PWCA 4NZLA 1QQUA 4I7YH 4ABEA 2VIWA 1NM6A 1V2MT 4XBBA 4LOYH 1GMDF 1T8MA 4FUDA 1O3FA 5DK1A 3UQVA 3ZVAA 1FV9A 5C1XA 4I8GA 1TWXB 3RC5A 4Q80A 3B23B 1DX5M 1FNIA 4J1YA 1MQ6A 4D76A 4BTTB 1Z7KA 2BD3A 4X2YA 2PV9B 3A88A 2BQ7B 2BY6X 4NGAH 2H5DA 2G00A 1Y5BT 4H6TA 2ZDKA 3SJ8A 4JZ1A 3BG4B 4HGCA 5F8ZA 3HGPA 4X2VA 2XRCA 1C9TA 1V2VT 1OWJA 4ZROA 1BTWA 3A83A 4WH6A 4E05H 1ZMNA 3EA8A 4B76A 1THPB 3AAUA 2WPJS 1PPCE 1UTNA 7GCHF 1TGCA 3SU1A 3ENSB 4RKJB 3KQDA 3ZZ8A 3RUOA 3NKKA 4TY6A 3AW1A 2ULLA 4IN1A 1TX7A 1W7XH 2J38A 1ZTJA 2VWLA 2VH6A 1G37A 2FOCA 1SFQB 1ACBE 1AIXH 1GHWH 2C8YB 1C1WH 2ZFTA 2ZU4A 1F7ZA 4GCHG 2QCYA 3Q3YA 1HXEH 1MTWA 3LDXH 2O9QA 5I25A 1GBEA 3PWBA 1W8BH 3RXSA 1HPGA 2WUBA 1C5NH 5IYTA 5E0HA 3SU5A 5DPAA 1FXYA 3RXDA 1MKWK 2OCVB 3KHVA 1G3DA 5BRRE 1J9CH 1BTYA 1G32B 4DCDA 1GJ9B 3NXPA 1UK3A 1IQLA 2VIVA 3MU5A 2JKHA 3RXCA 3HGNA 1P8VC 3HKIB 3I78A 3OTJE 1ARBA 2OINA 4WWYA 2IJOB 1QRZA 3FANA 5C1UA 5ESTE 1C5QA 3M36A 1QBVH 4GHTA 3P8GA 2FX4A 1C5MD 1C5VA 3BN9A 3O8BA 4WVPE 4ABGA 3PYHA 4B2CA 2ZHWH 1O5DH 4JZDH 1S81A 2HNTC 3VFEA 1PPGE 1GJAB 1JIMA 1G30B 1UVSH 1VITF 2DE9A 4X1QU 3RXEA 2AIQA 4Y71A 4Y11E 1V2PT 2EA3A 2XTTB 3CS0A 2ZCKP 3SJKA 1NU9A 1SQAA 1UMAH 1A5HA 1O39A 3MYWA 1K9OE 1T8NA 1VITH 3ZZBA 2J9NA 1VCQA 3B8JA 2CV3A 2YNBA 4DY7B 3A7TA 2AYWA 3MU1A 3PTNA 5HYOA 1BBRH 2FO9A 1KDQB 1OWKA 3S7KB 1AU8A 2F91A 4ZKRU 3QZQA 2ZTZA 3RMNH 2ZHEH 1F0UA 2GCHG 1XXDA 3GOVB 1EJNA 1OP2A 4AFZA 3UNSA 4KKDA 1KXEA 5DP6A 1SGQE 1Z1JA 2A31A 1UTKA 3MO3A 3QUMP 1YM0A 1GI9B 1A7SA 1SGPE 1T8LA 3ITIA 1Z8IB 1EAXA 1SLXB 5FPYA 2PWXA 3R3GB 5F8TA 2FOEA 3RMOH 4AB8A 5ETXA 1DE7H 3SUEA 2A7CA 4TPIZ 5DKMA 2BLVA 2ZDAH 4A5TS 4FVBA 1UVUH 3HK3B 1C9PA 1GI3A 1C1QA 3EA7A 1X7AC 3HK6B 3LJJA 2FOAA 1AZZA 2WINI 1HJAB 1NFUA 1M9UA 2QXIA 4OS1A 2RA3A 5GCHG 1GI2A 4CRGA 3KN2A 4Y0YE 1PPHE 3E91A 1ANCA 4X1NU 3LIWA 2ZGBH 3UIRA 4WXIA 3U1IB 4YM9A 3D49H 3E0PB 1GHZA 2TRMA 1AZ8A 2ZDLA 1LPKB 4YLUA 1ZTKA 4NFFA 3ZVBA 1W10U 1W11U 3GCTF 3LH1A 4HI3A 2A4RA 4HFPB 2ZTYA 1JOUB 1ANEA 1FIWA 1EQ9A 2NU0E 4X1PU 2GDDA 2TBSA 4X8VH 5AFYH 1SL3A 2FODA 3URCA 3GISB 1KY9A 3UNRA 3A7ZA 1G3BA 2P93A 1JXPA 1RS0A 1YPHC 1CHOF 3E16B 3E0NB 1OWDA 4Y8YA 1V2RT 3BTME 1C5TA 1SB1H 3L3TA 3ZZCA 1PPFE 3BTHE 3SZNA 1N1LA 1BT7A 1XUHA 4MG3A 1UTPA 3M3VA 1XVMA 1NFXA 5C5OA 4NFEA 4MVNA 4X8TH 4CR9A 2BQ6B 3QWCH 3TH4H 2ASUB 1A3BH 2R9PA 1GI7B 2VWOA 3SHCH 2HPQH 3A7XA 1KLTA 3ATWA 1D6RA 2F9NA 2FS8A 1AVGH 1O5FH 1BA8B 1P2KA 4CRCA 5JBBS 3SU2A 1IOEA 3SGQE 3STJA 1BRBE 4YOGA 5A8ZA 3RXFA 1FZZA 1O2HA 1OSSA 1FY8E 1O5CB 8KME2 2FIRH 2XBWA 1CGIE 1UTOA 2ZFRH 1P3CA 5DO4H 2GKVE 4UFDH 1GMHG 2GP9B 5DP9A 3S69A 3SJOA 4VGCC 3SI4H 1C5SA 2VB0A 3Q77A 2ZP0H 2BM2A 1FLEE 3BTTE 3DFLA 3STIA 2BLOA 2ZI2H 3I29A 1EAWA 2A0QB 2Z6BD 1O2VA 1TX8A 4JYTA 1Q31A 1O31A 1ZSLA 5F8XA 3CP7A 1EKBB 1WU1A 1EPTC 4R0IA 3QDZB 2ZCLP 3A8CA 1BJUA 5EQRA 1LCYA 1UK2A 5DP8A 2P95A 1DM4B 1AI8H 1AVWA 2UWOA 3BV9B 2XCNA 1VJ9U 1WQSA 2F83A 1LO6A 1GBHA 1LPZB 4NA7A 1EP6A 3RU4T 4DJZB 2W26A 3RLYH 2DUCA 4OGXA 8ESTE 2NU3E 1VGCB 2Z94A 4B2AA 1W0ZU 4IBLH 5E2PA 4CH8B 2J92A 1SR5C 1FY5A 3HATH 2FYQA 4I32A 4CBOA 1EXFA 5T6FA 4ZKSU 1C5OH 6CHAC 4AN7A 1GJ5H 1NC6A 2PGBB 4VGCB 1V3XA 1A3EH 2ZC9H 3RXIA 4AYVB 2QV1A 1Y3XA 4UFEH 2SGEE 1FY1A 1V2NT 1O34A 4DT7B 1GBAA 3SV2H 1YLCA 3MNCA 3PMBB 1K22H 4NCYA 4Y79A 5TJXA 1EPTB 5GXPA 1K1LA 4B75A 2BDIA 1C2HA 1CBWB 1BRCE 1QCPA 1ELFA 1CHGA 3BTWE 1GHBG 3F9EA 1Z6EA 3LU9B 5EODA 2XWBI 3FP8E 4MPUA 8GCHF 1LHEH 2P59A 4PROA 3RMLH 4BAHB 1ELAA 3RP2A 3LT3A 2C93B 2WPIS 4AZ2B 5E0JA 2CN0H 3C27B 1GJBB 3NPSA 1BTUA 3GCHC 1W0YH 5FHTA 4ISOA 1O3PB 3V7TA 1O5AB 1O3DA 1QY6A 1NRRH 2A2XH 2STBE 1BHXF 4CBNA 4DGJA 9ESTA 4H42U 4Y7BA 1P10A 3T5FH 6CHAB 2BX4A 2FX6A 1O33A 3RXGA 2I6SA 4BOHA 1C5ZB 1KXAA 3LC3A 1EJMA 4MQAA 1S0RA 3DA9B 1YPJH 4NIXA 1O5BB 1ELVA 2TGPZ 4BAOB 2SGQE 5EQSA 1IQFA 5J4QA 2ZKSA 2AMPA 1RTLA 2R0KA 3SN8A 1KYNA 1O3MA 2ZQ1A 3M7UA 4YZUA 1D3QB 3RU4E 3RXUA 1SGRE 3PMJA 1ZPZA 3SU4A 2LPRA 2OXSA 2ZU1A 4ISIH 1C1UH 1SHHB 2CF9H 2LNCA 1OYQA 3SUGA 4B71A 1V2KT 2AERH 1SLWB 3MNBA 5FCKA 3VB3A 2VIPA 1TPAE 1IQMA 1DWBH 1MAYA 1O38A 1HAOH 5FPSA 1ELTA 3GCHB 2KAIB 1Z8GA 2PTCE 3TPIZ 1BQYA 2FOHA 5G4BA 2A4QA 5K7RA 4Y6DA 4WF8A 5DP7A 1SQOA 1YPKH 4XBCA 3TNSA 4AFUA 5IDKA 4OS2A 4GPGA 1LVOA 2GTBA 2GVFA 2D2DA 2I6QA 3UR6A 4JYVH 4ABIA 4OGYA 1C2DA 2SNWA 4OS5A 3TH3H 3RXMA 1UVTH 3DT0H 3M61U 3RXPA 5C67A 2ZNKH 2GV7A 1C4Y2 1ZPCA 2VWNA 3VXFH 4O3TA 2A5KA 2XBVA 4MNVA 2AGEX 3T28A 4FVDA 1K1MA 1G3EA 3V12A 1C5PA 4I8KA 5H4IB 4BANB 1C2JA 1YLDA 4ZMAH 4D9RA 3UOPA 1IAUA 1C5XB 1QGFA 1E35B 1HDTH 3T29A 2CJIA 3NCLA 3MTYA 2J34A 5I46H 4MNYA 3VGCC 1CQQA 4FU9A 1HJ8A 3QK1A 3SQHE 1W7GH 1OYTH 5FBIA 1A0HB 2Z3EA 2ZG0H 4R8TB 1H4WA 4E7RG 4CRAA 1ZRBA 4DG4A 1IQEA 3N7OA 3EDXB 2C4FH 5EXMA 2BOKA 4AB9A 1GMCF 3ATLA 3KNXA 1GGDC 1HAYB 3QO6A 2BZ6H 2ODPA 4X6OA 1O2PA 6LPRA 5CE1A 1KXDA 2JH0D 1CGHA 1W14U 3MHWU 1P12E 1KXFA 4K60A 1NRQH 1S5SA 2AGGX 3PLPA 1Y3YA 3TVJB 3ZZ4A 4Q7ZA 1SGDE 1J8AA 1SVPA 1KXCA 2D26C 1TIOA 1LHGH 2AEIH 1QRWA 1JMOH 3BTDE 3I77A 1DWCH 2NU4E 1BHXB 1C2GA 3ODDA 5JB8S 1QL8A 2G5VA 3VGCB 4GAWA 4JZEH 3CENA 1BOQA 2VIQA 1TA6A 1TNGA 1HFDA 1E34B 1LMWB 1F5KU 2BY8X 1KDQA 2O8LA 3U98H 1V2LT 1OKXA 1MAXA 4K1SA 1HGTH 1J17T 2EC9H 1C1PA 1AMHA 1VR1H 1C5WB 4K3JA 1CT2E 4NSYA 4UE7H 1B7XB 4WJG2 3OSYA 3T27A 2A4GA 2FOFA 3T26A 2BY5X 4X1RU 3LGIA 1IQKA 2ZU2A 3UOUA 1XKAC 3ZYDA 4AFSA 1B0EA 1WTHD 1GI4A 5EXNA 1KTSB 4K8YA 1EUFA 1OWIA 1AUJA 1P04A 3ZV8A 2PSXA 5A0AE 1GPZA 2JH5D 1HAVA 3R0FA 2EEKA 1DPOA 2ANKH 3F9HA 3VB5A 3BTFE 3FFGA 1AO5A 1FQ3A 2OBQA 2GMTC 3GDUA 4CRBA 3AVZA 4NIYA 3LGVA 1HBTH 1NY22 1FPCH 3QTVH 4DW2U 1BIOA 1HAIH 1V2WT 4ZKOU 4D8NA 1LVBA 2ZFQH 1ZLRA 2TGTA 2H9HA 2ANWA 4KTCA 1C1NA 1AE8H 1AB9C 1Y5AT 3M5LA 2SNVA 1TBZH 4I8HA 1ELGA 5AFZH 1CGJE 3TJOA 1L1GA 4WMEA 1P2JA 2ZIQH 3GYLB 1T31A 2BD4A 4FUIA 3A7WA 2GD4B 2B7DH 2QYIA 2P8OC 3SI3H 3FP6E 2ZWLH 4ZXXH 3IITA 3TITA 4ZHLU 2GZ8A 1GVKB 4AYYB 1Y3WA 2OUAA 5FAHA 5A8XA 1C5YB 1W3CA 3K6YA 4RN6A 4ISHH 2W5EA 2PKSC 3RMMH 3RXQA 7KMEH 3S0NA 3SNCA 2GZ7A 2NU1E 5EQQA 2DE8A 3O8DA 5LGOA 2BDGA 4NG9H 1YF4A 3GY3A 3GY5A 1TALA 1SHYA 1QFKH 1BB0B 5EGMA 1LHCH 1B0FA 2F9OA 1C5UA 2Y5GA 1DY8A 1P2QA 4KTUA 2P3UB 1P01A 3LGTA 1F0RA 1G2LA 2BVXH 2AGIX 2G52A 2Y82A 2GMTB 3P95A 1PPEE 1QBNA 1TMUH 1BTZA 1V2ST 5FX6A 2CF8H 3OY6U 5C1YA 5T6DA 1UTLM 2ZU3A 1HB0B 4IW4E 1A46H 2ZGXH 5ESBA 1HNEE 1AB9B 1HAZB 1W12U 2PKAA 2OC7A 4UEHH 1MUEB 1GJDB 1WV7H 2VIOA 1YGCH 2ZF0H 4X6NA 4BAQB 3OX7U 3TNTA 4SGBE 4D7FA 1KXBA 1UHBA 5FXLA 1RXPA 1WTGH 2P8OB 1EB1H 2B8OH 1INCA 2FP7B 4ZHAA 4LZ4B 2OQ5A 3TK5A 5A2MH 4THNH 2A1DB 2FEQH 3AW0A 2J2UA 3PM3A 4YTAA 1O3GA 3U69H 1S6HA 2FI4E 3TJVA 1ZHMA 2PKSB 1DITH 4M7GA 3GYMA 1AHTH 1MKXK 3ODFA 3P8FA 3TH2H 2Y5FA 3A84A 5EXLA 1O3OA 4DURA 2QF3A 1MTNC 2PW8H 1V2QT 1ZR0A 1C2MA 3SU6A 4H4FA 4OS4A 5JBAS 2AFQB 4LZ1H 3QN7A 1WSSH 3SGAE 4Y76A 4F4OC 1PYTC 2Y5HA 3ELAH 3SV9A 1TE0A 1O5EH 1TPOA 3S7HB 1AWHB 1S0QA 3NWUA 1GHAG 1O30A 1LVMA 2BD7A 4IC6A 4Y0ZE 1HAVB 3UREA 1C2IA 3SORA 1XX9A 5L30H 2R2MB 1SLUB 3JZ1B 3PROA 3UUZA 2GX4A 3TU7H 1KLJH 1O3KA 2Y80A 3E6PH 1ETSH 1GL0E 4LK4A 2OC0A 1B5GH 3H5CB 3ZVEA 3F6UH 1EATA 2PR3A 2ANYA 1CU1A 4CRDA 4DIHH 1EPTA 2FMJA 4FUCA 1Y3VA 1MBQA 3U9AH 1MKWH 1L0ZA 1RJXB 2V6NA 5HXFA 3VEQB 3FAOA 1E37B 4X2WA 1MTNB 1S82A 2BZAA 2BD5A 3O8RA 1DOJA 1EASA 2XBXA 4IN2A 1FY3A 3RXKA 4AG2A 4ABJA 3BSQA 2UUJB 4AORA 1BCUH 2UUKB 2V3OH 3FP7E 3M3TA 3M35A 1BJVA 1D3TB 1RTKA 3ESTA 1FY4A 2BXTH 1ESBA 1GDNA 1N6XA 3BEUA 2EI7A 1GVZA 2NWNA 2V3HH 2ZDMA 3KEEA 1CA8B 3MU4A 3TIUA 1O3IA 1GMDG 3LOXA 5LH8A 4NIWA 3SUFA 2BTCE 2A5AA 4TWWA 4NIVA 2A32A 3NK8A 3C1KA 1OXGA 4D9QA 1HJ9A 1NT1A 3ZVGA 1MH0A 1YYY1 2XYAA 4DOQA 1WOFA 4KTSA 1QNJA 1DANH 1ZOMA 4MPVA 1UVOA 2ODYB 2A7HA 4J2YB 5JPMH 1XMNB 2HWLB 1O2YA 3SNBA 3EE0B 3GY7A 2F9PA 2PKAB 2TGAA 1NPMA 1PQ7A 2ZFPH 4YO9A 1AFEH 3RXBA 3IWMA 2XXLA 2ZTXA 4BXWA 1K1OA 2RCEA 2OC1A 1Y8TA 2O8MA 1UCYK 1UHBB 2A4OA 2XWAA 4BAKB 1RFNA 1IHTH 2W3IA 4XDEA 1GI6A 4K69A 1DDJA 2TGDA 3MNXA 7GCHG 1KTTB 2AS9A 1C1SA 2KAIA 1ZPBA 1LHDH 1YP9A 3A82A 4B73A 1HV7A 2VVUA 4JK6A 2G4UA 2BX3A 2QC2A 1P2IA 4JZIA 1HXFH 3QX5H 2V0BA 2SGDE 2Q6GA 4INHA 5A8YA 3QGNB 2O8WA 5E8EH 3RDZA 1TFXA 3JZ2B 1T32A 1ETTH 1GBIA 4KGAA 1DT2A 1TYNA 1ORFA 1P06A 2ANMH 1Y5UT 3H7TA 1SSXA 3Q76A 1A0JA 4H6SB 1QQ4A 1K1JA 4ABDA 1IHSH 6GCHF 2XCFA 1TBQH 2BD8A 1CT4E 1TNJA 3SGBE 3Q3XA 3RU4D 2VVCA 1DLKB 1S6FA 3K65B 4GVUA 1PQ8A 2XNIA 2OC8A 4ESTE 1ELDE 1MTSA 1QJ1B 1UCYE 1SLVB 3SV6A 4I8JA 1G3CA 4CREA 1O36A 4ASHA 2VNTA 4XSKU 2A2QH 1O2GH 3E8LA 1GI5A 3MOCA 4JK5A 1HYLA 1DUAA 1ELEE 1VITG 4E7NA 1YCPK 3SJ9A 3TK9A 3URDA 3EA9A 2Q1JA 2ZDVH 4K2YA 3MFJA 2IPHA 4O97A 4NSVA 3ZZ6A 3ZZ5A 4U01A 1D3PB 1HAGE 2OTVA 3RXHA 4IS5A 1GJCB 1MU8B 2BQWB 3EQ0H 2C3SA 1PPBH 1GBDA 1ZMLA 1MZDA 1GBBA 1ARCA 2ILNA 5TCAA 1O32A 3LGWA 4I8LA 3AASA 3GY2A 2G55A 1SOZA 1DY9A 1QB9A 2WPKS 3ATKA 4A1XA 2IOTA 3P8NA 4FUFA 1O2SA 1FAKH 1OWHA 2QF0A 2QA9E 1A61H 4FU8A 5T3HA 1C4U2 4GCHF 5FCRA 1SFIA 5A0BA 1O3HA 2CMYA 4K5ZA 4AG1A 1J14A 2F9BH 1MMJN 3KGPA 2WPMS 4SGAE 1TMTH 2P16A 2SGAA 3EGKH 3PO1C 1BMAA 5LPEA 2ZPQA 4Z6AH 1GCDA 1YPGH 3SV7A 3H7OA 1XUJA 3KF2A 1JIRA 3ZZ7A 1IQGA 1GJ4H 1LKBA 1BDAA 1ABJH 2C90B 5JBCS 2W7UA 1TGTA 1ELBA 4NWLA 3WY8A 3KCGH 3TLOA 3PB1E 3F9FA 3B9FH 4FUHA 5T6GA 1PJPA 1QURH 3ZVFA 1RTFB 1P03A 1QHRB 1A2CH 4UFFH 1VCWA 3EAJA 4E06H 1P2OA 3LH3A 1SI5H 2TPIZ 4QT8C 4ZXYH 5GWZA 5DG6A 3RC6A 3UPEA 3KIDU 1NFYA 1ID5H 2H6MA 4ABHA 3D65E 1PFXC 5DP4A 1IQNA 1WBGB 1Q3XA 2FLRH 2FOBA 3UQOA 3E90B 3GCTG 4U32A 1EAUA 1F5LA 2D8WA 3BG8A 5AHGH 1F92A 1AWFH 1GHYH 1ZZZA 6ESTA 1C1OA 1JRSA 2FWWA 1TGSZ 2G5NA 4IGDA 3PO1B 1ZSKA 1TPSA 1P57B 2BDBA 2AMDA 5GDSH 3MH5A 3U8TH 2HALA 3ZVCA 1GL1A 2ODQA 1CHOG 1DWEH 1G9IE 2UWPA 1NRPH 2YOLA 1L1JA 1TPPA 4X6PA 1GJ7B 2Z9JA 1GWAA 1EOLA 1JRTA 2H9TH 1HRTH 1KLIH 2GCHF 2Y81A 4YT7H 1YCPM 2STAE 2G8TA 3A86A 1ZGVA 1BMMH 1O37A 2C8XB 3F1SB 3FVFB 1GBCA 1T4UH 1C2LA 1TGBA 1CA0C 3NUMA 1F0TA 1PYTD 4MTBA 1UO6A 5JYIA 1F5RA 1BZXE 3SHAH 1XUGA 3K9XB 1DXWA 2J94A 1O3NA 3A8DA 1NU7B 1L2EA 3M3SA 3GCNA 3D23A 3A7VA 1TX6A 4A1TA 1CVWH 1J15A 5E0GA 2UUYA 3PV4A 5GCHF 1HAXB 2GT7A 1FDPA 1NS3A 1TABE 1TAWA 1BRAA 2EI6A 2FTMA 1C4V2 4I33A 3F9GA 2HNTE 3UTUH 3RM0H 5EG4A 1LVYA 1YPMH 3KQCA 3QZRA 1PQAA 1QB6A 1FONA 3MI4A 2FM2A 5CMXH 4U30A 2R3YA 2XC4A 4ZKNU 3RXVA 1SGNE 1A5IA 1Z71A 2ZGJA 2VWMA 1AY6H 1OP0A 2Z9LA 2VVVA 2PFEA 1UTJA 3ZV9A 4OS6A 3V13A 2BY9X 5HM9A 1CA0B 4WMDA 1O5GH 4MNWA 4OS7A 1LDTT 1O2NA 1S84A 2K1QA 1GGDB 2XBYA 3F68H 4WMFA 1NN6A 2BYAX 1NRSH 2P3TB 3MWIU 1DVAH 1CSOE 3PMHB 4MNXA 2AH4X 2D1JA 2XW9A 2XC0A 2QXHA 4I31A 1MCTA 3T62A 3HPTB 1TNHA 3P8OA 1NZQH 2BDAA 1NO9H 1BBRK 4DVAU 5EW1H 2IN2A 1T4VH 3TK6A 2ALVA 4NA9H 1A1RA 1L4DA 2R2WU 2WYGA 5GJ4B 1GDUA 1H9HE 1AKSA 1O2UA 3RXOA 3SO3A 3DFJA 1QBOA 1QTFA 4U2WA 3LKWA 4B74A 5TCCA 2B9LA 8LPRA 1E0FD 2Z3CA 3HKJB 2O8UA 1MU6B 1VZQH 1C1TA 2HNTF 3ZZAA 3ZVDA 3A7YA 4HTCH 1Y3UA 1V2OT 1THSH 2C8WB 3M5MA 1NESE 2PUQH 4IC5A 3M5OA 1C1VH 1GMHF 1SQTA 3SQEE 3P6ZB 8GCHG 1GVLA 2CHAC 3IG6B 2Z7FE 2HGTH 3ATIA 2VH0A 4INLA 1AFQC 4CH2B 1MQ5A 4A1VA 4TWYA 1Y59T 1RRKA 1H1BA 3T25A 4NWKA 5FX5A 1VCPA 4BNRA 2BVRH 3L6PA 2C8ZB 1O3BA 3BTGE 3L33A 4UDWH 4XOJA 3KL6A 1ZSJA 2ZHDA 1XUIA 1ABIH 3FZZA 5A0CA 2THFB 1K21H 2Z9KA 2ZCHP 1F0SA 1V2UT 3A87A 3P92A 2V35A 1BBRE 2BMGB 1K1NA 1O3EA 3LC5A 2P94A 1QL7A 4Y7AA 2ZHQH 1TLDA 1YPHE 3E3TA 2BHGA 1TNIA 2O8TA 1RIWC 3LGUA 1HAHH 2G51A 4WXVA 1AGJA 1SGFA 2VGCC 1O2JA 1SGYE 2R3UA 3LONA 4WY3A 3UY9A 2FTLE 1XM1A 1S83A 2PHBA 2QXGA 3MH7A 1GI1A 3ZZDA 3PLBA 2BXUH 2FS9A 2FXRA 1V2JT 1E38B 1C1MA 3LJOA 1P0SH 3V3MA 5LPFA 2CHAB 5L2YH 1AD8H 1P9UA 5HGGA 3VXEH 5C3NA 1T7CA 4TY7A 5DJ7A 2RG3A 1KIGH 1AFQB 1GBKA 1QA7A 1O3LA 4FXGH 4GLYA 1FUJA 3RLWH 1WQVH 2HOBA 1GG6C 2VJ1A 4Z0KA 4O3UA 1ZHRA 3QLPH 2ZO3H 1TB6H 1N8OC 2G4TA 1WYKA 3GICB 1TOCB 3O8CA 1TRYA 4B2BA 4AX9H 1EZSC 2GGVB 5K0HA 1GHBF 3OY5U 5LPRA 4YLQH 4BXSA 4BTUB 2ZGHA 5JBTA 3U8RH 2YNAA 1D4PB 2Z9IA 2FOGA 1QB1A 3Q00A 3A80A 1P2NA 5B6OA 1HJAC 5A09A 1FAXA 1D3DB 1LTOA 1ANDA 3DD2H 2SGFE 1RIWB 1ZJKA 1O3AA 2VGCB 1TOMH 1TQ7B 2F3CE 1DUEA 1LKAA 1PQ5A 4YESB 3SBKA 2W7SA 1HLTH 3TGIE 3FZDA 3A81A 2RA0A 2B0FA 1C5RA 1UVPA 1AKSB 1BTPA 1Z8RA 3GY8A 4JCNA 1MBMA 2FESH 1K1PA 1O2KA 1O2LA 1GG6B
chains in the Genus database with same CATH superfamily
1NTPA 4WH8A 2F43B 1SG8B 3RM2H 2HRVA 4UD9H 2KFWA 2B5TB 1N8OB 1TRMA 1EP5A 4YOJA 3BEFB 4X1SU 1FN8A 1XUFA 1GMCG 1C5LH 5C0UA 2F9UA 1TMBH 1YBWA 3LGYA 2JETC 3P17H 1JBUH 3QTOH 4Z1MD 4RSPA 3BIVH 5L6NH 2QY0B 3ZYEA 3PMAB 4HZHA 1DSTA 2TIOA 2EQNA 2HLCA 1H9LB 5C2ZA 4GHQA 3SZEA 1Z8JB 2GT8A 4O03A 1ESTA 1Q2WA 1TNLA 4XRNA 4X2XA 3DHKH 1HUTH 3BTQE 2ZPSA 1P9SA 3ZIAD 3W95A 1RD3B 2H9EH 1TGNA 1GJ6A 1GJ8B 1QRXA 1RGQA 2OQUA 4INKA 2BOHB 7LPRA 4F48B 1OOKB 2RDLA 2A7JA 1CE5A 1O3CA 5FPTA 1WCZA 4X0WU 4AOQA 3VB6A 5CHAC 3S9CA 1FMGA 1DSUA 2ZQ2A 1TNKA 1XUKA 1A0LA 1YC0A 4ZAEA 1KMHB 1GBFA 2AIPA 1Z1IA 1QR3E 3SU3A 1QA0A 4AGJA 1P11E 2JETB 1ETRH 1MTVA 1KSNA 2BLWA 2WSSD 2QAAA 5AVDA 4NA8A 2XC5A 1TA2A 4TYDA 4XD7D 1IQJA 3SV8A 5EW2H 1D9IA 3N7DA 1V6DA 2SFAA 1SC8U 2BD9A 2IPQX 2ALPA 1VJAU 2A45B 5C17A 1BMLA 3ATMA 5GIBA 1EB2A 1GI8B 3NZIA 1MTUA 4ABBA 1SMFE 5DP3A 3K6ZA 2ZGCA 1DFPA 1K1IA 1WDIA 1O2TA 1BMNH 5EOKA 2UUFB 4Q7YA 1P02A 3CS7A 1AVXA 1S85A 2KCPA 1VGCC 3PLKA 1MD7A 5JB9S 5GPIB 2WUCA 2SGPE 2PTNA 2PP6A 2BLQA 3G01A 3QGJA 2EI8A 3UWJH 1EZXC 1SGEE 1MKXH 2GV6A 3TGKE 2FZZA 2OBOA 5CDFE 4FU7A 1SBWA 3MH6A 1ZMJA 5CHAB 2WPHS 1YPLH 1O2OA 2BB4A 3AAVA 3OU0A 4ZH8A 1NROH 4ABAA 1H8DH 2GCTC 4K1EA 1GCTC 1P09A 1YWUA 3GY4A 5DN6D 3M7TA 5F03A 2QN5T 2W3KA 1SGCA 3RXRA 1DICA 2FI5E 2H2ZA 2PGQB 3D62A 3MH4A 4Y10E 1L4ZA 1CBWC 1OP8A 3A85A 1G36A 1WUNH 2ZHFH 1QIXB 3A8BA 3SW2B 3S9AA 4XBDA 3RXLA 3U1JB 5L2ZH 4CR5A 3A89A 1MZAA 1TBRH 4ISNA 1JWTA 1K2I1 1DXPA 2BD2A 1GBJA 1H8IH 1O35A 1SGFG 1XVOA 1V2TT 4JMYA 4KP0A 4MLFB 2PSYA 4A7IB 1N6YA 1SGIB 1YPEH 3UNQA 1BRUP 4MPWA 1HIAA 1ANBA 1GBLA 2HVXA 3DSOA 1ZHPA 3GDSA 5C20A 1T8OA 5FBEA 2BDCA 1C2EA 2BDYA 1GDQA 5EPNA 1FPHH 4YOIA 3SJIA 2Z9GA 3GY6A 1LQDB 1C2KA 1A5GH 1G2MA 5HMAA 4X6MA 2GCTB 3VB4A 1OS8A 2ZECA 3F0OA 3SNAA 1GCTB 1YKTA 2J95A 1SPJA 4TPYA 1HCGA 1O2QA 1L1NA 1O2IA 5J4SA 1DLEA 1BTXA 5JDUB 4ZCNA 2FDAA 2FOMB 2H1UA 3VB7A 3OEHD 4A6LA 4AFQA 1MD8A 1UTQA 3M7QA 4MPXA 3MNSA 2BVSH 3BTEE 4K1TA 1SOTA 1GBTA 4B1TA 1HAPH 2YMSC 3MU0A 2OP9A 3PTBA 5ABWA 4DIIH 2FYRA 4BAMB 3LPRA 4ZHMU 4JYUH 4ZUHA 1EX3A 2ZFSA 5BPEA 1TONA 4FUJA 3MMGA 1WAYB 4IMZA 5AF9H 1U6QA 3MO6A 4XE4A 3MO9A 4GUXA 3V0XA 2CGAA 1C1RA 1ZTLA 4BTIB 3TJNA 2QGRA 1LQEA 2ZDNA 1QJ6B 3P70B 2R0LA 3S9BA 1J16A 1FIZA 2PUXB 5HM2A 1O2ZA 1UCYH 2UWLA 4X8UH 1UJ1A 2Q6DA 1GI0A 1F2SE 1OX1A 1PPZA 4FUEA 1CT0E 2GZ9A 3RXJA 4JZFH 4KELA 1LHFH 1UTMA 1C2FA 1O2WA 3M5NA 3H09A 3SUDA 1BITA 5SGAE 2VINA 1AUTC 3EYDA 1MCVA 3OYPA 1THRH 1FN6A 1O2XA 3TJUA 1K28D 1OPHB 2HPPH 1O2MA 4Y8ZA 1ZYOA 3SOSA 1DWDH 1P2MA 4NZQA 2JH6D 2H5CA 1EZUC 1AQ7A 2OLGA 1XXFA 4O9VA 1Z6JH 1ESAA 1GBMA 3K2UA 3BTKE 7ESTE 4CHAC 2JJ2D 2BDHA 2NU2E 2J4IA 1ZGIA 1H9IE 5E2OA 5DGJA 4A92A 3BF6H 3ZZ9A 3OFND 2W6ID 2FI3E 1GHXH 1D6WA 2QXJA 2ZFFH 1QJ7B 2G81E 3VPKA 4YT6H 4FUBA 1O0DH 2Y7ZA 4ISLA 2M5TA 5DP5A 2OD3B 4GSOA 1OHHD 3Q3KA 3DUXH 3MU8A 1A4WH 1TRNA 9LPRA 2Q6FA 1P3EA 2CXVA 1O3JA 1CO7E 1HIAB 2QIQA 2W6JD 4K8BA 1ZRKA 1P05A 2A5IA 4MDSA 4RKOB 2PLXA 4Q7XA 1NRNH 1W13U 1O2RA 1SGTA 1YCPH 1GHVH 3ZZ3A 3SNEA 3A8AA 1IQHA 2FPZA 3KQBA 1LPGB 1EZQA 1UK4A 3UWIA 2Y7XA 2WYJA 1TQ0B 4UONA 4CRFA 4Y8XA 3W94A 2Z3DA 1IQIA 3RXTA 2GDEH 5C5NA 2AMQA 1BTHH 4XFQA 1GHAF 2ZEBA 1ELCA 2P3FH 1EOJA 2ZU5A 2WV4A 3RC4A 1W2KH 4CHAB 2WV5A 2F9VA 4X8SH 2ZA5A 1DS2E 1NBMD 1QL9A 1FI8A 3GCOA 3U8OH 3RXAA 1OWEA 3TGJE 5EPYA 4Q2KA 4AGKA 5EU8A 3T2NA 2Y6TA 5F6MA 3BG4C 5PTPA 3M37A 2ZZUH 4FUGA 4F49A 4D7GA 1ZJDA 1BUIA 1EAIA 1NFWA 3SNDA 4IMQA 2VIDA 3FN8A 1EJAA 1AE5A 1FJSA 3BIUH 4UFGH 2VU8E 2BY7X 3KQEA 4ABFA 4LXBH 3BEIB 3UFAA 3SU0A 2ESTE 1XKBC 2WPLS 3GDVA 3UR9A 1AN1E 1E36B 2FLBH 2ZPRA 3E1XB 6GCHG 3PWCA 4NZLA 1QQUA 4I7YH 4ABEA 2VIWA 1NM6A 1V2MT 4XBBA 4LOYH 3U28C 1GMDF 1T8MA 4FUDA 1O3FA 5DK1A 3UQVA 3ZVAA 4TT3D 1FV9A 5C1XA 4I8GA 1TWXB 3RC5A 4Q80A 3B23B 1DX5M 1FNIA 4J1YA 1MQ6A 4D76A 4BTTB 1Z7KA 2BD3A 4X2YA 2PV9B 3A88A 2BQ7B 2BY6X 4NGAH 2H5DA 2G00A 1Y5BT 3WW7A 4H6TA 2ZDKA 3SJ8A 4JZ1A 3BG4B 3PV5A 4HGCA 5F8ZA 3HGPA 4X2VA 2XRCA 1C9TA 1V2VT 1OWJA 4ZROA 1BTWA 3A83A 4WH6A 4E05H 1ZMNA 3EA8A 3WWBA 4B76A 1THPB 3AAUA 5FL7D 2WPJS 1PPCE 1UTNA 7GCHF 1TGCA 3SU1A 3ENSB 4RKJB 3KQDA 3ZZ8A 4DT4A 3RUOA 3NKKA 4TY6A 3AW1A 2ULLA 4IN1A 2GJGA 1TX7A 1W7XH 2J38A 1ZTJA 2VWLA 2VH6A 1G37A 2FOCA 3PRBA 1SFQB 1ACBE 1AIXH 1GHWH 2C8YB 1C1WH 2ZFTA 2ZU4A 1F7ZA 4GCHG 2QCYA 3Q3YA 1HXEH 1SKYE 1MTWA 3LDXH 2O9QA 5I25A 1GBEA 3PWBA 1W8BH 3RXSA 1HPGA 2WUBA 3F2HA 1C5NH 5IYTA 5E0HA 3SU5A 3UAIC 5DPAA 1FXYA 2J5UA 1MKWK 2JDID 3RXDA 5EIYA 2OCVB 3KHVA 1G3DA 5BRRE 1J9CH 1BTYA 1G32B 4DCDA 1GJ9B 3NXPA 1UK3A 1IQLA 2VIVA 3MU5A 2JKHA 3RXCA 3HGNA 1P8VC 3HKIB 3I78A 3OTJE 2KZ4A 1ARBA 2OINA 4WWYA 2IJOB 1QRZA 3FANA 5C1UA 5ESTE 1C5QA 3M36A 1QBVH 4GHTA 3P8GA 2FX4A 1C5MD 1C5VA 3BN9A 3O8BA 4WVPE 4ABGA 3PYHA 4B2CA 2ZHWH 1O5DH 4JZDH 1S81A 2HNTC 3VFEA 1PPGE 1GJAB 1JIMA 1G30B 1UVSH 1VITF 2DE9A 4X1QU 3RXEA 5EJ1A 2AIQA 4Y71A 4Y11E 1V2PT 2EA3A 2XTTB 3CS0A 2ZCKP 3SJKA 1NU9A 1SQAA 1UMAH 1A5HA 1O39A 3MYWA 1K9OE 1T8NA 1VITH 3ZZBA 2J9NA 1VCQA 3B8JA 2CV3A 2YMSD 2YNBA 4DY7B 3A7TA 2AYWA 3MU1A 3PTNA 5HYOA 1BBRH 2FO9A 1KDQB 1OWKA 3S7KB 1AU8A 2F91A 4ZKRU 3QZQA 2ZTZA 3EE7A 3RMNH 2ZHEH 1F0UA 2GCHG 1XXDA 3GOVB 1EJNA 1OP2A 4AFZA 3UNSA 4KKDA 1KXEA 5DP6A 1SGQE 1Z1JA 2A31A 1UTKA 3F3BA 3MO3A 3QUMP 1YM0A 1GI9B 1A7SA 1SGPE 1T8LA 3ITIA 1Z8IB 1EAXA 1SLXB 5FPYA 2PWXA 3R3GB 5F8TA 2FOEA 2VBCA 3RMOH 4AB8A 5ETXA 1DE7H 3SUEA 2A7CA 4TPIZ 5DKMA 2BLVA 2ZDAH 4A5TS 4FVBA 1UVUH 3HK3B 1C9PA 1GI3A 1C1QA 5EJZA 3EA7A 1X7AC 4OM9A 3HK6B 3LJJA 2FOAA 1AZZA 2WINI 1HJAB 1NFUA 1M9UA 2QXIA 4OS1A 2RA3A 5GCHG 1GI2A 4CRGA 3KN2A 4Y0YE 3N99A 1PPHE 3E91A 1ANCA 4X1NU 2JJ1D 5B6LA 3LIWA 2ZGBH 1E1QD 3UIRA 4WXIA 2QF5A 3U1IB 4YM9A 3D49H 3E0PB 1GHZA 2TRMA 1AZ8A 2ZDLA 1LPKB 3PV2A 4YLUA 1E79D 1ZTKA 4I86A 4NFFA 3ZVBA 1W10U 1W11U 3GCTF 3LH1A 4HI3A 2A4RA 4HFPB 2ZTYA 1JOUB 1ANEA 1FIWA 1EQ9A 2NU0E 4X1PU 4P02A 2GDDA 2TBSA 4X8VH 5AFYH 1SL3A 2FODA 3URCA 3GISB 1KY9A 3UNRA 3A7ZA 1G3BA 2P93A 1JXPA 1RS0A 2IJD1 2XOKD 1YPHC 1CHOF 3E16B 3E0NB 1OWDA 4Y8YA 1V2RT 3BTME 1C5TA 1SB1H 3L3TA 3ZZCA 2HVYB 1PPFE 3BTHE 3SZNA 1N1LA 1BT7A 1XUHA 4MG3A 1UTPA 3M3VA 1XVMA 1NFXA 5C5OA 4NFEA 4MVNA 4X8TH 4CR9A 2BQ6B 3QWCH 3TH4H 2ASUB 1A3BH 2R9PA 1GI7B 2VWOA 4RT0A 3SHCH 2HPQH 3A7XA 1KLTA 3ATWA 1D6RA 2F9NA 2FS8A 1AVGH 1O5FH 1BA8B 1P2KA 4CRCA 5JBBS 3SU2A 1IOEA 3SGQE 3STJA 1BRBE 4YOGA 5A8ZA 3RXFA 1FZZA 1O2HA 1OSSA 5HIYA 1FY8E 1O5CB 8KME2 2FIRH 2XBWA 2XNDD 1CGIE 1UTOA 2ZFRH 3MQKC 1P3CA 5DO4H 2GKVE 4UFDH 1GMHG 2GP9B 5DP9A 3S69A 3SJOA 4VGCC 3SI4H 1C5SA 2VB0A 3Q77A 2ZP0H 2BM2A 1FLEE 3BTTE 3DFLA 3STIA 2BLOA 2ZI2H 3I29A 1EAWA 2A0QB 2Z6BD 1O2VA 1TX8A 4JYTA 3DSPA 1Q31A 1O31A 1ZSLA 5F8XA 3CP7A 1EKBB 2JIZD 1WU1A 1EPTC 4R0IA 3QDZB 2ZCLP 3A8CA 1BJUA 5EQRA 1LCYA 1UK2A 5DP8A 2P95A 1DM4B 1AI8H 1AVWA 2UWOA 3BV9B 2XCNA 1VJ9U 1WQSA 2F83A 1LO6A 1GBHA 1LPZB 4NA7A 1EP6A 3RU4T 4DJZB 2W26A 3RLYH 2DUCA 4OGXA 8ESTE 2NU3E 1VGCB 2Z94A 4B2AA 1W0ZU 4IBLH 2KM0A 5E2PA 2J92A 1SR5C 1FY5A 4CH8B 3HATH 2FYQA 4I32A 4CBOA 1EXFA 5T6FA 4ZKSU 1C5OH 6CHAC 4AN7A 1GJ5H 1NC6A 2PGBB 4VGCB 1V3XA 1A3EH 2ZC9H 3RXIA 4AYVB 2QV1A 1Y3XA 4UFEH 2SGEE 1FY1A 1V2NT 4P00A 1O34A 4DT7B 1GBAA 3SV2H 1YLCA 3MNCA 3PMBB 1K22H 4NCYA 4Y79A 5TJXA 1EPTB 5GXPA 1K1LA 4B75A 2BDIA 1C2HA 1CBWB 1BRCE 1QCPA 1ELFA 1CHGA 3BTWE 1GHBG 2AHME 3F9EA 1Z6EA 3LU9B 5EODA 2XWBI 3FP8E 4MPUA 8GCHF 1LHEH 2P59A 4PROA 3RMLH 4BAHB 1ELAA 3RP2A 3LT3A 2C93B 2WPIS 4AZ2B 1YY3A 5E0JA 2L6OA 2CN0H 3C27B 1GJBB 3NPSA 1BTUA 3GCHC 1W0YH 5FHTA 4ISOA 1O3PB 3V7TA 1O5AB 1H8HD 1O3DA 1QY6A 1NRRH 2A2XH 2STBE 3OEED 1BHXF 4CBNA 4HG6A 4DGJA 9ESTA 4H42U 4Y7BA 1P10A 3T5FH 2V7QD 2LP6A 2BX4A 6CHAB 2FX6A 1O33A 2K0QA 2I6SA 3RXGA 4BOHA 1C5ZB 2L74A 1KXAA 3LC3A 1EJMA 4MQAA 1S0RA 3DA9B 1YPJH 4NIXA 1O5BB 1ELVA 2TGPZ 4BAOB 2SGQE 5EQSA 5KECA 1IQFA 5J4QA 2ZKSA 2AMPA 1RTLA 2R0KA 3SN8A 1KYNA 1O3MA 2ZQ1A 3M7UA 4YZUA 1D3QB 3RU4E 3RXUA 1SGRE 3PMJA 2KCYA 1ZPZA 3SU4A 2LPRA 2OXSA 2ZU1A 4ISIH 1C1UH 1SHHB 2CF9H 2LNCA 1OYQA 3SUGA 4B71A 1V2KT 2YMSB 2AERH 1SLWB 3MNBA 5FCKA 3VB3A 2VIPA 1TPAE 1IQMA 1DWBH 1MAYA 1O38A 1HAOH 5FPSA 1ELTA 3GCHB 2KAIB 1Z8GA 2PTCE 3TPIZ 1BQYA 2FOHA 5G4BA 2A4QA 5K7RA 4Y6DA 4WF8A 5DP7A 1SQOA 1YPKH 4XBCA 3TNSA 4AFUA 5IDKA 4OS2A 2KX4A 4GPGA 1LVOA 2GTBA 2GVFA 2D2DA 2I6QA 3UR6A 4JYVH 4ABIA 4OGYA 1C2DA 2SNWA 4OS5A 3TH3H 3RXMA 1UVTH 3DT0H 3M61U 3RXPA 5C67A 2ZNKH 2GV7A 1C4Y2 1ZPCA 2VWNA 3VXFH 4O3TA 2A5KA 2XBVA 4MNVA 2AGEX 3T28A 4FVDA 1K1MA 1G3EA 3V12A 1C5PA 4I8KA 5H4IB 4BANB 1C2JA 1YLDA 4ZMAH 4D9RA 3UOPA 1IAUA 1C5XB 1QGFA 1E35B 1HDTH 3T29A 2CJIA 3NCLA 3MTYA 2J34A 5I46H 4MNYA 1FX0B 3VGCC 1CQQA 4FU9A 4Q4LA 1HJ8A 3QK1A 3SQHE 1W7GH 1OYTH 5FBIA 1A0HB 2Z3EA 2ZG0H 4R8TB 1H4WA 4E7RG 4CRAA 1ZRBA 4DG4A 1IQEA 3N7OA 3EDXB 2C4FH 5EXMA 2BOKA 4AB9A 1GMCF 3ATLA 3KNXA 1GGDC 1HAYB 3QO6A 2BZ6H 2ODPA 4X6OA 1O2PA 6LPRA 5CE1A 1KXDA 2JH0D 1CGHA 1W14U 3MHWU 1P12E 1KXFA 4K60A 1NRQH 1S5SA 2AGGX 3PLPA 1Y3YA 3TVJB 3ZZ4A 4Q7ZA 1SGDE 3SYJA 1J8AA 1SVPA 1KXCA 2D26C 1TIOA 1LHGH 2AEIH 1QRWA 1JMOH 3BTDE 3I77A 4B6EA 1DWCH 2NU4E 1BHXB 1C2GA 3ODDA 5JB8S 1QL8A 2G5VA 3VGCB 4GAWA 4JZEH 3CENA 3N7EA 1BOQA 2VIQA 1TA6A 1TNGA 1HFDA 1E34B 1LMWB 1F5KU 2BY8X 1KDQA 3KYFA 2O8LA 3U98H 1V2LT 1OKXA 5KEDA 1MAXA 4K1SA 1HGTH 1J17T 2EC9H 1C1PA 1AMHA 1VR1H 1C5WB 4K3JA 1CT2E 4NSYA 4UE7H 1B7XB 4WJG2 3OSYA 3T27A 2A4GA 2FOFA 3T26A 2BY5X 4X1RU 3LGIA 2HLDD 1IQKA 2ZU2A 4ASUD 3UOUA 1XKAC 3ZYDA 3OE7D 4AFSA 1B0EA 1WTHD 1GI4A 5EXNA 5F53A 1KTSB 4K8YA 1BMFD 1EUFA 1OWIA 1AUJA 1P04A 2RFKC 3ZV8A 2PSXA 5A0AE 1GPZA 2JH5D 1HAVA 3R0FA 4ACAA 2EEKA 1DPOA 2ANKH 2V3MA 3F9HA 3VB5A 3BTFE 3FFGA 1AO5A 1FQ3A 2OBQA 1QZ8A 4M9FA 2GMTC 3GDUA 4CRBA 3AVZA 4NIYA 3LGVA 1HBTH 1NY22 1FPCH 3QTVH 4DW2U 1BIOA 1HAIH 1V2WT 4ZKOU 4D8NA 1LVBA 2ZFQH 1ZLRA 2TGTA 2H9HA 2ANWA 4KTCA 1C1NA 1AE8H 1AB9C 1Y5AT 3M5LA 2SNVA 1TBZH 4I8HA 1ELGA 5AFZH 5KGOA 1CGJE 3TJOA 1L1GA 4WMEA 4ACBA 1P2JA 2ZIQH 3GYLB 1T31A 2BD4A 4FUIA 3A7WA 2GD4B 2B7DH 2QYIA 2P8OC 3SI3H 3FP6E 5EJLA 2ZWLH 4ZXXH 3IITA 3TITA 4ZHLU 2QF4A 2GZ8A 1GVKB 4AYYB 1Y3WA 2OUAA 5FAHA 3DCLA 5A8XA 1C5YB 1W3CA 3K6YA 4RN6A 4ISHH 2W5EA 2PKSC 3RMMH 3RXQA 7KMEH 3S0NA 3SNCA 2GZ7A 2NU1E 5EQQA 2DE8A 3O8DA 5LGOA 2BDGA 4NG9H 1YF4A 3GY3A 3GY5A 1TALA 1SHYA 1QFKH 1BB0B 5EGMA 1LHCH 1B0FA 2F9OA 1C5UA 2Y5GA 1DY8A 1P2QA 4KTUA 2P3UB 1P01A 3LGTA 1F0RA 1G2LA 2BVXH 2AGIX 2G52A 2Y82A 2GMTB 3P95A 1PPEE 1QBNA 1TMUH 1BTZA 1V2ST 5FX6A 2CF8H 3OY6U 5C1YA 5T6DA 1UTLM 2ZU3A 1HB0B 4IW4E 1A46H 2ZGXH 5ESBA 1HNEE 1AB9B 1HAZB 1W12U 2PKAA 2OC7A 4UEHH 1MUEB 1GJDB 1WV7H 2VIOA 1YGCH 2ZF0H 4X6NA 4BAQB 3OX7U 3TNTA 4SGBE 4D7FA 1KXBA 1YLNA 1UHBA 5FXLA 1RXPA 1WTGH 2P8OB 1EB1H 2B8OH 1INCA 2FP7B 4ZHAA 4LZ4B 2OQ5A 3TK5A 5A2MH 4THNH 2A1DB 1EFRD 2FEQH 3AW0A 2J2UA 3PM3A 4YTAA 1O3GA 3U69H 1S6HA 2FI4E 3FKSD 3TJVA 1ZHMA 2PKSB 1DITH 4M7GA 3GYMA 1AHTH 1MKXK 3ODFA 4RT1A 3P8FA 3TH2H 2Y5FA 3A84A 5EXLA 1O3OA 4DURA 2QF3A 1MTNC 2PW8H 1V2QT 1ZR0A 1C2MA 3SU6A 4H4FA 4OS4A 5JBAS 2AFQB 4LZ1H 3QN7A 1WSSH 3SGAE 2KR7A 4Y76A 4F4OC 1PYTC 2Y5HA 3ELAH 3SV9A 1TE0A 1O5EH 1TPOA 3S7HB 1AWHB 1S0QA 3F2GA 3NWUA 1GHAG 1O30A 1LVMA 2BD7A 4IC6A 4Y0ZE 1HAVB 3UREA 1C2IA 3SORA 1XX9A 5L30H 2R2MB 1SLUB 3JZ1B 3PROA 3UUZA 2GX4A 3TU7H 1KLJH 1O3KA 2Y80A 4FOUC 3E6PH 1ETSH 1GL0E 4LK4A 2OC0A 1B5GH 3H5CB 3ZVEA 3F6UH 1EATA 2PR3A 2ANYA 1CU1A 4CRDA 4DIHH 1EPTA 2FMJA 4FUCA 1Y3VA 1MBQA 3U9AH 1MKWH 1L0ZA 1RJXB 2V6NA 5HXFA 3VEQB 3FAOA 1E37B 4X2WA 1MTNB 1S82A 2BZAA 2BD5A 3O8RA 3F0PA 1DOJA 1EASA 2XBXA 4IN2A 1FY3A 3RXKA 4AG2A 4ABJA 3BSQA 2UUJB 4AORA 2LELA 1BCUH 2UUKB 2V3OH 3FP7E 3M3TA 3M35A 1BJVA 1D3TB 1RTKA 3ESTA 1FY4A 2BXTH 1ESBA 1GDNA 1N6XA 3BEUA 2EI7A 1GVZA 1VKYA 2NWNA 2V3HH 2ZDMA 1CA8B 3KEEA 3MU4A 3TIUA 1O3IA 1GMDG 3LOXA 5LH8A 4NIWA 3SUFA 2BTCE 2A5AA 4TWWA 4NIVA 2A32A 3NK8A 3C1KA 1OXGA 4D9QA 1HJ9A 1NT1A 3ZVGA 1MH0A 1YYY1 2XYAA 5HIZA 4DOQA 1WOFA 4KTSA 1QNJA 1DANH 1ZOMA 4MPVA 1UVOA 2ODYB 2A7HA 4J2YB 5JPMH 1XMNB 2HWLB 1O2YA 3SNBA 3EE0B 3GY7A 2F9PA 2PKAB 2TGAA 1NPMA 1PQ7A 2ZFPH 4YO9A 1AFEH 3KQ5A 3RXBA 3IWMA 2XXLA 2ZTXA 4BXWA 1K1OA 2RCEA 2OC1A 1Y8TA 2O8MA 1UCYK 1UHBB 2A4OA 2XWAA 4BAKB 1RFNA 1IHTH 2W3IA 4XDEA 1GI6A 4K69A 1DDJA 2TGDA 3MNXA 7GCHG 1KTTB 2AS9A 1C1SA 2KAIA 1ZPBA 1LHDH 1YP9A 3A82A 4B73A 1HV7A 2VVUA 4YXWD 4JK6A 2G4UA 2BX3A 2QC2A 1P2IA 4JZIA 1HXFH 3QX5H 2V0BA 2SGDE 2Q6GA 4INHA 5A8YA 3QGNB 2QE7D 2O8WA 5E8EH 3RDZA 1TFXA 3JZ2B 1T32A 1ETTH 1GBIA 4KGAA 1DT2A 1TYNA 1ORFA 1P06A 3OAAD 2ANMH 1Y5UT 3H7TA 1SSXA 3Q76A 1A0JA 4H6SB 1QQ4A 1K1JA 4ABDA 1IHSH 5C94A 6GCHF 2XCFA 3VG8A 1TBQH 2BD8A 1CT4E 1TNJA 3SGBE 4RI0A 3Q3XA 3RU4D 2VVCA 1DLKB 1S6FA 3K65B 4GVUA 1PQ8A 2XNIA 2OC8A 4ESTE 2J97A 1ELDE 2WZQA 1MTSA 1QJ1B 1UCYE 2EY4C 1SLVB 3SV6A 4I8JA 1G3CA 4CREA 1O36A 4ASHA 2J98A 2VNTA 4XSKU 2A2QH 1O2GH 2KCOA 3E8LA 1GI5A 3MOCA 4JK5A 1HYLA 1DUAA 1ELEE 1VITG 4E7NA 1YCPK 3SJ9A 3TK9A 3URDA 5GNDA 3EA9A 4F55A 2Q1JA 2ZDVH 4K2YA 3MFJA 2IPHA 4O97A 4NSVA 3ZZ6A 3ZZ5A 4U01A 1D3PB 1HAGE 2OTVA 3RXHA 4IS5A 1GJCB 1MU8B 2BQWB 3EQ0H 2C3SA 1PPBH 1GBDA 1ZMLA 1MZDA 1GBBA 1ARCA 3GS9A 2ILNA 5TCAA 1O32A 3LGWA 4I8LA 3AASA 3GY2A 2G55A 1SOZA 1DY9A 1QB9A 2WPKS 3ATKA 4A1XA 2IOTA 3P8NA 4FUFA 1O2SA 1FAKH 1OWHA 2QF0A 2QA9E 1A61H 4FU8A 5T3HA 5IK2D 1C4U2 3DSGA 4GCHF 5FCRA 1SFIA 5A0BA 1O3HA 2CMYA 4K5ZA 4AG1A 1J14A 2F9BH 1MMJN 3KGPA 2WPMS 4SGAE 1TMTH 2P16A 2SGAA 3EGKH 3PO1C 1BMAA 5LPEA 2ZPQA 4Z6AH 1GCDA 1YPGH 3SV7A 3H7OA 1XUJA 3KF2A 1JIRA 3ZZ7A 1IQGA 1GJ4H 1LKBA 1BDAA 1COWD 1ABJH 2C90B 5JBCS 2W7UA 1TGTA 1ELBA 4NWLA 3WY8A 3KCGH 3TLOA 3PB1E 3F9FA 2CK3D 3B9FH 4FUHA 5T6GA 1PJPA 1QURH 2WV9A 1RTFB 3UB0A 1P03A 3ZVFA 1QHRB 1A2CH 4UFFH 1VCWA 3EAJA 4E06H 1P2OA 3LH3A 1SI5H 2TPIZ 4QT8C 4ZXYH 2M2AA 5GWZA 5DG6A 3RC6A 3UPEA 3KIDU 1NFYA 1ID5H 2H6MA 4ABHA 3D65E 1PFXC 5DP4A 1IQNA 1WBGB 1Q3XA 2FLRH 2FOBA 3UQOA 3E90B 3GCTG 4U32A 1EAUA 1F5LA 2D8WA 3BG8A 5AHGH 5CHBA 1F92A 3CNRA 1AWFH 1GHYH 1ZZZA 6ESTA 1C1OA 1JRSA 2FWWA 1TGSZ 2G5NA 4IGDA 1W0JD 3PO1B 1ZSKA 1TPSA 1W0KD 1P57B 2BDBA 2AMDA 5GDSH 3MH5A 3U8TH 2HALA 3NRLA 3ZVCA 4FETA 1GL1A 2ODQA 1CHOG 1DWEH 1G9IE 2UWPA 1NRPH 2YOLA 1L1JA 1TPPA 4X6PA 1GJ7B 2Z9JA 1GWAA 1EOLA 1JRTA 5T1VA 2H9TH 1HRTH 1KLIH 2GCHF 2Y81A 4YT7H 1YCPM 2STAE 2G8TA 3A86A 1ZGVA 1BMMH 1O37A 2C8XB 3F1SB 3FVFB 3PRDA 1UW7A 1GBCA 3W1EA 1T4UH 1C2LA 1TGBA 2J98B 1CA0C 3NUMA 1F0TA 4AC9A 1PYTD 4MTBA 1UO6A 5JYIA 1F5RA 3AK5A 2K8IA 1BZXE 3SHAH 2KCAA 1XUGA 3K9XB 1DXWA 1SQRA 3FOAA 2J94A 1O3NA 3A8DA 3OTPA 1NU7B 1L2EA 3M3SA 3GCNA 3D23A 5DSFA 3A7VA 1TX6A 4A1TA 1CVWH 1J15A 5E0GA 2UUYA 3PV4A 5GCHF 1HAXB 2GT7A 1FDPA 1NS3A 1TABE 1TAWA 1BRAA 2EI6A 2FTMA 1C4V2 4I33A 3F9GA 2HNTE 3UTUH 3RM0H 5EG4A 1LVYA 1YPMH 3KQCA 3QZRA 1PQAA 1QB6A 1FONA 3MI4A 2FM2A 5CMXH 4U30A 2R3YA 2XC4A 4ZKNU 3RXVA 1SGNE 1A5IA 1Z71A 2ZGJA 1E1RD 2VWMA 1AY6H 2OK5A 1OP0A 2Z9LA 2VVVA 2PFEA 1UTJA 3ZV9A 4OS6A 3V13A 2BY9X 5HM9A 1WXRA 1CA0B 4WMDA 1O5GH 4MNWA 4OS7A 1LDTT 1O2NA 1S84A 2K1QA 1GGDB 2XBYA 3F68H 4WMFA 1NN6A 2BYAX 1NRSH 2P3TB 3MWIU 1DVAH 1CSOE 3PMHB 4MNXA 2AH4X 2D1JA 2XW9A 2XC0A 3WWFA 2QXHA 4I31A 1MCTA 3T62A 3HPTB 1TNHA 3P8OA 1NZQH 2BDAA 1NO9H 1BBRK 4DVAU 5EW1H 2IN2A 4TSFD 1T4VH 3TK6A 2ALVA 4NA9H 1A1RA 1L4DA 2R2WU 2WYGA 5GJ4B 1GDUA 1H9HE 1AKSA 1O2UA 3RXOA 3SO3A 3DFJA 1QBOA 1QTFA 4U2WA 3LKWA 4B74A 5TCCA 2B9LA 8LPRA 1E0FD 2Z3CA 3HKJB 2O8UA 1MU6B 1VZQH 1C1TA 1MABB 2HNTF 3ZZAA 3ZVDA 3A7YA 4HTCH 1Y3UA 1V2OT 1THSH 2C8WB 3M5MA 1NESE 1NBME 2PUQH 4IC5A 3M5OA 1C1VH 1GMHF 1SQTA 3SQEE 2WHXA 3P6ZB 8GCHG 1GVLA 2CHAC 3IG6B 2Z7FE 2HGTH 3ATIA 2VH0A 4INLA 1AFQC 4CH2B 1MQ5A 4A1VA 4TWYA 1Y59T 1RRKA 1H1BA 3T25A 4NWKA 5FX5A 2RDEA 1VCPA 4BNRA 2BVRH 3L6PA 2C8ZB 1O3BA 3BTGE 3L33A 4UDWH 4XOJA 1K0HA 3KL6A 1ZSJA 2ZHDA 1XUIA 1ABIH 3FZZA 2WPDD 5A0CA 2THFB 1K21H 2Z9KA 2ZCHP 1F0SA 1V2UT 3A87A 3P92A 2V35A 1BBRE 4B6FA 2BMGB 1K1NA 1O3EA 3LC5A 2P94A 1QL7A 4Y7AA 2ZHQH 1TLDA 1YPHE 3E3TA 2BHGA 1TNIA 2O8TA 1RIWC 3LGUA 1HAHH 2G51A 4WXVA 1AGJA 1SGFA 2VGCC 1O2JA 1SGYE 2R3UA 3LONA 4WY3A 3UY9A 2FTLE 1XM1A 1S83A 2PHBA 2QXGA 3MH7A 1GI1A 3ZZDA 3PLBA 2BXUH 2FS9A 5C0TA 2FXRA 5HKKD 1V2JT 1E38B 1C1MA 3LJOA 1P0SH 3V3MA 5LPFA 2CHAB 5L2YH 1AD8H 1P9UA 3F2FA 5HGGA 3VXEH 5C3NA 1T7CA 4TY7A 5DJ7A 2RG3A 1KIGH 1AFQB 4Q63A 1GBKA 1QA7A 1O3LA 4FXGH 4GLYA 1FUJA 3RLWH 1WQVH 2HOBA 1GG6C 2VJ1A 4Z0KA 4O3UA 1ZHRA 3QLPH 2ZO3H 1TB6H 1N8OC 2G4TA 1WYKA 3GICB 1TOCB 3KYGA 3O8CA 1TRYA 4B2BA 3FO8D 4AX9H 1EZSC 1H8ED 2GGVB 5K0HA 1GHBF 2F4LA 3OY5U 5LPRA 4YLQH 4BXSA 4BTUB 2ZGHA 5JBTA 3U8RH 2YNAA 1D4PB 2Z9IA 2FOGA 1QB1A 3Q00A 3A80A 1P2NA 5B6OA 1S6LA 1HJAC 5A09A 1FAXA 1D3DB 1LTOA 1ANDA 3DD2H 2SGFE 1RIWB 1ZJKA 1O3AA 2VGCB 1TOMH 1TQ7B 2F3CE 1DUEA 1LKAA 1PQ5A 4YESB 3SBKA 2W7SA 1HLTH 3TGIE 3FZDA 3A81A 2RA0A 2B0FA 1C5RA 1UVPA 1AKSB 1BTPA 1Z8RA 3GY8A 4JCNA 1MBMA 2FESH 1K1PA 1O2KA 1O2LA 1GG6B
chains in the Genus database with same CATH topology
1NTPA 4WH8A 1SG8B 3RM2H 2HRVA 4UD9H 2B5TB 1N8OB 1TRMA 1EP5A 4YOJA 3BEFB 4X1SU 1FN8A 1XUFA 1GMCG 1C5LH 2F9UA 1TMBH 1YBWA 3LGYA 2JETC 3P17H 1JBUH 3QTOH 4RSPA 3BIVH 5L6NH 2QY0B 3ZYEA 3PMAB 4HZHA 1DSTA 2TIOA 2HLCA 1H9LB 5C2ZA 4GHQA 1Z8JB 2GT8A 4O03A 1ESTA 1Q2WA 1TNLA 4X2XA 3DHKH 1HUTH 3BTQE 2ZPSA 1P9SA 3W95A 1RD3B 2H9EH 1TGNA 1GJ6A 1GJ8B 1QRXA 1RGQA 2OQUA 4INKA 2BOHB 7LPRA 1OOKB 2RDLA 2A7JA 1CE5A 1O3CA 5FPTA 1WCZA 4X0WU 4AOQA 3VB6A 5CHAC 3S9CA 1FMGA 1DSUA 2ZQ2A 1TNKA 1XUKA 1A0LA 1YC0A 4ZAEA 1GBFA 2AIPA 1Z1IA 1QR3E 3SU3A 1QA0A 4AGJA 1P11E 2JETB 1ETRH 1MTVA 1KSNA 2BLWA 2QAAA 5AVDA 4NA8A 2XC5A 1TA2A 4TYDA 5EW2H 1IQJA 3SV8A 1D9IA 1V6DA 2SFAA 1SC8U 2BD9A 2ALPA 1VJAU 2A45B 1BMLA 3ATMA 5GIBA 1EB2A 1GI8B 3NZIA 1MTUA 4ABBA 1SMFE 5DP3A 3K6ZA 2ZGCA 1DFPA 1K1IA 1O2TA 1BMNH 5EOKA 2UUFB 4Q7YA 1P02A 3CS7A 1AVXA 1S85A 1VGCC 3PLKA 1MD7A 5JB9S 5GPIB 2WUCA 2SGPE 2PTNA 2BLQA 3G01A 3QGJA 2EI8A 3UWJH 1EZXC 1SGEE 1MKXH 2GV6A 3TGKE 2FZZA 2OBOA 4FU7A 1SBWA 3MH6A 1ZMJA 5CHAB 2WPHS 1YPLH 1O2OA 2BB4A 3AAVA 3OU0A 4ZH8A 1NROH 4ABAA 1H8DH 2GCTC 4K1EA 1GCTC 1P09A 3GY4A 3M7TA 5F03A 2QN5T 2W3KA 1SGCA 3RXRA 1DICA 2FI5E 2H2ZA 2PGQB 3D62A 3MH4A 4Y10E 1L4ZA 1CBWC 1OP8A 3A85A 1G36A 1WUNH 2ZHFH 1QIXB 3A8BA 3SW2B 3S9AA 4XBDA 3RXLA 3U1JB 5L2ZH 4CR5A 3A89A 1MZAA 1TBRH 4ISNA 1JWTA 1K2I1 1DXPA 2BD2A 1GBJA 1H8IH 1O35A 1SGFG 1XVOA 1V2TT 4JMYA 4KP0A 4MLFB 2PSYA 4A7IB 1N6YA 1SGIB 1YPEH 3UNQA 1BRUP 4MPWA 1HIAA 1ANBA 1GBLA 2HVXA 1ZHPA 3GDSA 5C20A 1T8OA 5FBEA 2BDCA 1C2EA 2BDYA 1GDQA 5EPNA 1FPHH 4YOIA 3SJIA 2Z9GA 3GY6A 1LQDB 1C2KA 1A5GH 1G2MA 5HMAA 4X6MA 2GCTB 3VB4A 1OS8A 2ZECA 3SNAA 1GCTB 1YKTA 2J95A 1SPJA 4TPYA 1HCGA 1O2QA 1L1NA 1O2IA 5J4SA 1DLEA 1BTXA 5JDUB 2FDAA 2FOMB 2H1UA 3VB7A 4AFQA 4A6LA 1MD8A 1UTQA 3M7QA 4MPXA 3MNSA 2BVSH 3BTEE 4K1TA 1SOTA 1GBTA 4B1TA 1HAPH 3MU0A 2OP9A 3PTBA 5ABWA 4DIIH 2FYRA 4BAMB 3LPRA 4ZHMU 4JYUH 4ZUHA 1EX3A 2ZFSA 5BPEA 1TONA 4FUJA 3MMGA 1WAYB 4IMZA 5AF9H 1U6QA 3MO6A 4XE4A 3MO9A 4GUXA 3V0XA 2CGAA 1C1RA 1ZTLA 4BTIB 3TJNA 2QGRA 1LQEA 2ZDNA 1QJ6B 3P70B 2R0LA 3S9BA 1J16A 1FIZA 2PUXB 5HM2A 1O2ZA 1UCYH 2UWLA 4X8UH 1UJ1A 2Q6DA 1GI0A 1F2SE 1OX1A 1PPZA 4FUEA 1CT0E 2GZ9A 3RXJA 4JZFH 4KELA 1LHFH 1UTMA 1C2FA 1O2WA 3M5NA 3SUDA 1BITA 5SGAE 2VINA 1AUTC 3EYDA 1MCVA 3OYPA 1THRH 1FN6A 1O2XA 3TJUA 1K28D 1OPHB 2HPPH 1O2MA 4Y8ZA 1ZYOA 3SOSA 1DWDH 1P2MA 4NZQA 2JH6D 2H5CA 1EZUC 1AQ7A 2OLGA 1XXFA 4O9VA 1Z6JH 1ESAA 1GBMA 3K2UA 3BTKE 7ESTE 4CHAC 2BDHA 2NU2E 2J4IA 1ZGIA 1H9IE 5E2OA 5DGJA 4A92A 3BF6H 3ZZ9A 2FI3E 1GHXH 1D6WA 2QXJA 2ZFFH 1QJ7B 2G81E 3VPKA 4YT6H 4FUBA 1O0DH 2Y7ZA 4ISLA 2M5TA 5DP5A 2OD3B 4GSOA 3Q3KA 3DUXH 3MU8A 1A4WH 1TRNA 9LPRA 2Q6FA 1P3EA 2CXVA 1O3JA 1CO7E 1HIAB 2QIQA 4K8BA 1ZRKA 1P05A 2A5IA 4MDSA 4RKOB 2PLXA 4Q7XA 1NRNH 1W13U 1O2RA 1SGTA 1YCPH 1GHVH 3ZZ3A 3SNEA 3A8AA 1IQHA 2FPZA 3KQBA 1LPGB 1EZQA 1UK4A 3UWIA 2Y7XA 2WYJA 1TQ0B 4UONA 4CRFA 4Y8XA 3W94A 2Z3DA 1IQIA 3RXTA 2GDEH 5C5NA 2AMQA 1BTHH 4XFQA 1GHAF 2ZEBA 1ELCA 2P3FH 1EOJA 2ZU5A 2WV4A 3RC4A 1W2KH 4CHAB 2WV5A 2F9VA 4X8SH 2ZA5A 1DS2E 1QL9A 1FI8A 3GCOA 3U8OH 3RXAA 1OWEA 3TGJE 5EPYA 4Q2KA 4AGKA 5EU8A 3T2NA 2Y6TA 5F6MA 3BG4C 5PTPA 3M37A 2ZZUH 4FUGA 4F49A 4D7GA 1ZJDA 1BUIA 1EAIA 1NFWA 3SNDA 4IMQA 2VIDA 1EJAA 1AE5A 1FJSA 3BIUH 4UFGH 2VU8E 2BY7X 3KQEA 4ABFA 4LXBH 3BEIB 3UFAA 3SU0A 2ESTE 1XKBC 2WPLS 3GDVA 3UR9A 1AN1E 1E36B 2FLBH 2ZPRA 3E1XB 6GCHG 3PWCA 4NZLA 1QQUA 4I7YH 4ABEA 2VIWA 1NM6A 1V2MT 4XBBA 4LOYH 1GMDF 1T8MA 4FUDA 1O3FA 5DK1A 3UQVA 3ZVAA 1FV9A 5C1XA 4I8GA 1TWXB 3RC5A 4Q80A 3B23B 1DX5M 1FNIA 4J1YA 1MQ6A 4D76A 4BTTB 1Z7KA 2BD3A 4X2YA 2PV9B 3A88A 2BQ7B 2BY6X 4NGAH 2H5DA 2G00A 1Y5BT 4H6TA 2ZDKA 3SJ8A 4JZ1A 3BG4B 4HGCA 5F8ZA 3HGPA 4X2VA 2XRCA 1C9TA 1V2VT 1OWJA 4ZROA 1BTWA 3A83A 4WH6A 4E05H 1ZMNA 3EA8A 4B76A 1THPB 3AAUA 2WPJS 1PPCE 1UTNA 7GCHF 1TGCA 3SU1A 3ENSB 4RKJB 3KQDA 3ZZ8A 3RUOA 3NKKA 4TY6A 3AW1A 2ULLA 4IN1A 1TX7A 1W7XH 2J38A 1ZTJA 2VWLA 2VH6A 1G37A 2FOCA 1SFQB 1ACBE 1AIXH 1GHWH 2C8YB 1C1WH 2ZFTA 2ZU4A 1F7ZA 4GCHG 2QCYA 3Q3YA 1HXEH 1MTWA 3LDXH 2O9QA 5I25A 1GBEA 3PWBA 1W8BH 3RXSA 1HPGA 2WUBA 1C5NH 5IYTA 5E0HA 3SU5A 5DPAA 1FXYA 3RXDA 1MKWK 2OCVB 3KHVA 1G3DA 5BRRE 1J9CH 1BTYA 1G32B 4DCDA 1GJ9B 3NXPA 1UK3A 1IQLA 2VIVA 3MU5A 2JKHA 3RXCA 3HGNA 1P8VC 3HKIB 3I78A 3OTJE 1ARBA 2OINA 4WWYA 2IJOB 1QRZA 3FANA 5C1UA 5ESTE 1C5QA 3M36A 1QBVH 4GHTA 3P8GA 2FX4A 1C5MD 1C5VA 3BN9A 3O8BA 4WVPE 4ABGA 3PYHA 4B2CA 2ZHWH 1O5DH 4JZDH 1S81A 2HNTC 3VFEA 1PPGE 1GJAB 1JIMA 1G30B 1UVSH 1VITF 2DE9A 4X1QU 3RXEA 2AIQA 4Y71A 4Y11E 1V2PT 2EA3A 2XTTB 3CS0A 2ZCKP 3SJKA 1NU9A 1SQAA 1UMAH 1A5HA 1O39A 3MYWA 1K9OE 1T8NA 1VITH 3ZZBA 2J9NA 1VCQA 3B8JA 2CV3A 2YNBA 4DY7B 3A7TA 2AYWA 3MU1A 3PTNA 5HYOA 1BBRH 2FO9A 1KDQB 1OWKA 3S7KB 1AU8A 2F91A 4ZKRU 3QZQA 2ZTZA 3RMNH 2ZHEH 1F0UA 2GCHG 1XXDA 3GOVB 1EJNA 1OP2A 4AFZA 3UNSA 4KKDA 1KXEA 5DP6A 1SGQE 1Z1JA 2A31A 1UTKA 3MO3A 3QUMP 1YM0A 1GI9B 1A7SA 1SGPE 1T8LA 3ITIA 1Z8IB 1EAXA 1SLXB 5FPYA 2PWXA 3R3GB 5F8TA 2FOEA 3RMOH 4AB8A 5ETXA 1DE7H 3SUEA 2A7CA 4TPIZ 5DKMA 2BLVA 2ZDAH 4A5TS 4FVBA 1UVUH 3HK3B 1C9PA 1GI3A 1C1QA 3EA7A 1X7AC 3HK6B 3LJJA 2FOAA 1AZZA 2WINI 1HJAB 1NFUA 1M9UA 2QXIA 4OS1A 2RA3A 5GCHG 1GI2A 4CRGA 3KN2A 4Y0YE 1PPHE 3E91A 1ANCA 4X1NU 3LIWA 2ZGBH 3UIRA 4WXIA 3U1IB 4YM9A 3D49H 3E0PB 1GHZA 2TRMA 1AZ8A 2ZDLA 1LPKB 4YLUA 1ZTKA 4NFFA 3ZVBA 1W10U 1W11U 3GCTF 3LH1A 4HI3A 2A4RA 4HFPB 2ZTYA 1JOUB 1ANEA 1FIWA 1EQ9A 2NU0E 4X1PU 2GDDA 2TBSA 4X8VH 5AFYH 1SL3A 2FODA 3URCA 3GISB 1KY9A 3UNRA 3A7ZA 1G3BA 2P93A 1JXPA 1RS0A 1YPHC 1CHOF 3E16B 3E0NB 1OWDA 4Y8YA 1V2RT 3BTME 1C5TA 1SB1H 3L3TA 3ZZCA 1PPFE 3BTHE 3SZNA 1N1LA 1BT7A 1XUHA 4MG3A 1UTPA 3M3VA 1XVMA 1NFXA 5C5OA 4NFEA 4MVNA 4X8TH 4CR9A 2BQ6B 3QWCH 3TH4H 2ASUB 1A3BH 2R9PA 1GI7B 2VWOA 3SHCH 2HPQH 3A7XA 1KLTA 3ATWA 1D6RA 2F9NA 2FS8A 1AVGH 1O5FH 1BA8B 1P2KA 4CRCA 5JBBS 3SU2A 1IOEA 3SGQE 3STJA 1BRBE 4YOGA 5A8ZA 3RXFA 1FZZA 1O2HA 1OSSA 1FY8E 1O5CB 8KME2 2FIRH 2XBWA 1CGIE 1UTOA 2ZFRH 1P3CA 5DO4H 2GKVE 4UFDH 1GMHG 2GP9B 5DP9A 3S69A 3SJOA 4VGCC 3SI4H 1C5SA 2VB0A 3Q77A 2ZP0H 2BM2A 1FLEE 3BTTE 3DFLA 3STIA 2BLOA 2ZI2H 3I29A 1EAWA 2A0QB 2Z6BD 1O2VA 1TX8A 4JYTA 1Q31A 1O31A 1ZSLA 5F8XA 3CP7A 1EKBB 1WU1A 1EPTC 4R0IA 3QDZB 2ZCLP 3A8CA 1BJUA 5EQRA 1LCYA 1UK2A 5DP8A 2P95A 1DM4B 1AI8H 1AVWA 2UWOA 3BV9B 2XCNA 1VJ9U 1WQSA 2F83A 1LO6A 1GBHA 1LPZB 4NA7A 1EP6A 3RU4T 4DJZB 2W26A 3RLYH 2DUCA 4OGXA 8ESTE 2NU3E 1VGCB 2Z94A 4B2AA 1W0ZU 4IBLH 5E2PA 4CH8B 2J92A 1SR5C 1FY5A 3HATH 2FYQA 4I32A 4CBOA 1EXFA 5T6FA 4ZKSU 1C5OH 6CHAC 4AN7A 1GJ5H 1NC6A 2PGBB 4VGCB 1V3XA 1A3EH 2ZC9H 3RXIA 4AYVB 2QV1A 1Y3XA 4UFEH 2SGEE 1FY1A 1V2NT 1O34A 4DT7B 1GBAA 3SV2H 1YLCA 3MNCA 3PMBB 1K22H 4NCYA 4Y79A 5TJXA 1EPTB 5GXPA 1K1LA 4B75A 2BDIA 1C2HA 1CBWB 1BRCE 1QCPA 1ELFA 1CHGA 3BTWE 1GHBG 3F9EA 1Z6EA 3LU9B 5EODA 2XWBI 3FP8E 4MPUA 8GCHF 1LHEH 2P59A 4PROA 3RMLH 4BAHB 1ELAA 3RP2A 3LT3A 2C93B 2WPIS 4AZ2B 5E0JA 2CN0H 3C27B 1GJBB 3NPSA 1BTUA 3GCHC 1W0YH 5FHTA 4ISOA 1O3PB 3V7TA 1O5AB 1O3DA 1QY6A 1NRRH 2A2XH 2STBE 1BHXF 4CBNA 4DGJA 9ESTA 4H42U 4Y7BA 1P10A 3T5FH 6CHAB 2BX4A 2FX6A 1O33A 3RXGA 2I6SA 4BOHA 1C5ZB 1KXAA 3LC3A 1EJMA 4MQAA 1S0RA 3DA9B 1YPJH 4NIXA 1O5BB 1ELVA 2TGPZ 4BAOB 2SGQE 5EQSA 1IQFA 5J4QA 2ZKSA 2AMPA 1RTLA 2R0KA 3SN8A 1KYNA 1O3MA 2ZQ1A 3M7UA 4YZUA 1D3QB 3RU4E 3RXUA 1SGRE 3PMJA 1ZPZA 3SU4A 2LPRA 2OXSA 2ZU1A 4ISIH 1C1UH 1SHHB 2CF9H 2LNCA 1OYQA 3SUGA 4B71A 1V2KT 2AERH 1SLWB 3MNBA 5FCKA 3VB3A 2VIPA 1TPAE 1IQMA 1DWBH 1MAYA 1O38A 1HAOH 5FPSA 1ELTA 3GCHB 2KAIB 1Z8GA 2PTCE 3TPIZ 1BQYA 2FOHA 5G4BA 2A4QA 5K7RA 4Y6DA 4WF8A 5DP7A 1SQOA 1YPKH 4XBCA 3TNSA 4AFUA 5IDKA 4OS2A 4GPGA 1LVOA 2GTBA 2GVFA 2D2DA 2I6QA 3UR6A 4JYVH 4ABIA 4OGYA 1C2DA 2SNWA 4OS5A 3TH3H 3RXMA 1UVTH 3DT0H 3M61U 3RXPA 5C67A 2ZNKH 2GV7A 1C4Y2 1ZPCA 2VWNA 3VXFH 4O3TA 2A5KA 2XBVA 4MNVA 2AGEX 3T28A 4FVDA 1K1MA 1G3EA 3V12A 1C5PA 4I8KA 5H4IB 4BANB 1C2JA 1YLDA 4ZMAH 4D9RA 3UOPA 1IAUA 1C5XB 1QGFA 1E35B