1O2OA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2oA02
3Q3XA 4Y8YA 2H9TH 1V2PT 2OC1A 3ZVAA 1KXFA 5E2PA 5G4BA 4VGCB 4ABFA 2VIVA 1O2GH 4MPVA 1A4WH 1QURH 2ANYA 1P01A 1WTGH 2ZQ1A 3UOUA 2AIPA 3SO3A 2HNTE 1SFQB 1MQ5A 2WYJA 4YTAA 2ZDVH 5GJ4B 3RXKA 5C3NA 1L0ZA 1Z71A 2SGQE 3BEFB 2TPIZ 2WUCA 1THSH 1O36A 2PSXA 4KTSA 4TWYA 1K1NA 3UPEA 1AVWA 4Q2KA 2HNTF 4ZKOU 4FUDA 1THPB 3MWIU 3GICB 1JWTA 3TGJE 4NCYA 1GDNA 1C2MA 4ABHA 4OS4A 4DIHH 4MNYA 1UVOA 3SOSA 4AN7A 1MTUA 4B2BA 3LOXA 1QL9A 5GCHG 1ZMLA 1L4ZA 3M61U 2XBVA 2A2XH 1HYLA 3SGAE 1P2JA 4X1PU 3A7YA 3TVJB 1SOZA 4GCHF 2O8MA 3GCHB 3T62A 1O2JA 1GBAA 2KAIA 1ETRH 1S0RA 1GMHF 3FANA 3SU3A 2FS9A 3PROA 3RXSA 1FPHH 2FEQH 1TBZH 1J9CH 2QA9E 2FOFA 3RXAA 3U8RH 3NKKA 2BQWB 3F9GA 1O35A 1GBLA 1LVYA 1ORFA 1VCQA 1LKAA 2RG3A 1CT4E 2Q1JA 1XM1A 4AGKA 7KMEH 3MI4A 3F9EA 2NU1E 1BB0B 1UVTH 3Q00A 2ZI2H 1WV7H 2GDDA 3HGPA 3C1KA 5L6NH 2OCVB 3H5CB 3P17H 3E3TA 2AFQB 2NWNA 3RXOA 1ELEE 3RC6A 3ZZ5A 3FP6E 1QB1A 2TRMA 1QHRB 1J17T 3ENSB 1MZAA 1IQMA 1LPGB 2GVFA 1W0YH 3RXMA 4NIVA 1G3BA 1O3KA 1GJ5H 2PUXB 2SNWA 2GX4A 3SUEA 5I25A 1ZLRA 7GCHF 1S6FA 5T6GA 1SGCA 1C5OH 4JYTA 1H9LB 1Z6JH 1BRAA 4YZUA 2FOEA 1JIRA 4CREA 1O3OA 2VH6A 5CMXH 3GYLB 4UEHH 2RCEA 1WYKA 2GV6A 5F6MA 4DIIH 1E34B 3FFGA 4UFDH 3A8CA 1MD8A 1AFEH 1EUFA 1G3EA 4GVUA 1SL3A 2HOBA 2PKAB 3T2NA 5EXLA 3TH3H 1YM0A 1FY5A 3I78A 4Q7XA 2AMDA 4KTCA 1C1PA 3ZZDA 2HGTH 3UQVA 4IW4E 1GHAF 1CHGA 1BRCE 2BVRH 4NZLA 5EQQA 4BTTB 3RXGA 3E1XB 4R8TB 2BVSH 1B0FA 1BTPA 1PPZA 1Z8GA 1W8BH 4FU8A 1OP0A 2I6QA 1P9UA 1AHTH 1J16A 4I31A 2D26C 3UR6A 1BA8B 1PQAA 1HRTH 2V0BA 4MNVA 3BTFE 3BTME 3HKJB 1NESE 2VINA 2OC7A 5FX6A 1CSOE 1C5SA 3W95A 1TONA 1O2WA 1ETTH 3ZYEA 1OPHB 3MO6A 4UONA 1FZZA 1DICA 1PPFE 1GJ4H 4MTBA 1UK2A 3O8CA 1DPOA 2ZF0H 2OBQA 1DY8A 1P04A 1QA7A 4JCNA 3NXPA 4OS5A 1IQJA 5GWZA 2F9PA 4GLYA 2UWLA 5CHAC 2BD8A 4FVDA 1YF4A 1MKXK 4MDSA 3SNBA 4WXIA 1XVOA 2EA3A 5FX5A 2ZU2A 4RKJB 2DE9A 2C93B 3CP7A 1EAWA 3T28A 4O03A 3A7WA 5TJXA 1A7SA 1UVPA 4O97A 5EG4A 1GI3A 4YOGA 2P94A 1SGNE 1O30A 5E0GA 1G37A 3EA7A 4TY6A 2BLOA 1ZTKA 2FX4A 3E6PH 3RC5A 5C2ZA 1GI4A 1AB9C 1AFQB 1L1GA 4ISOA 1DWDH 2GCTC 2OQ5A 1GVLA 1BTZA 1NT1A 3VXEH 1XKBC 3OSYA 1A5HA 4FUHA 1OYTH 4ISIH 2BXTH 3FZZA 1UHBB 3SJ8A 3U69H 1EP5A 2DE8A 4Y79A 4MPXA 1MTNC 1OXGA 2GZ8A 3A7TA 1CU1A 5EXNA 4MPUA 1TOCB 3UIRA 1UTOA 4K1EA 1IQIA 2J92A 1IQFA 4FUEA 2ZHWH 2BDGA 1AWFH 4YT6H 4FUGA 4ZKNU 1GMDG 1HAVA 4NWKA 1BTYA 3M37A 2GZ7A 1T8NA 2A7CA 3S9CA 1IQKA 1C1QA 3PO1B 5EXMA 2I6SA 2XW9A 3A7VA 1MCVA 3FZDA 1GBJA 3ZZ4A 1BJVA 2QXHA 3A87A 1P57B 2B7DH 3B9FH 1SGEE 4NWLA 5C1YA 1DWCH 2ZGJA 4VGCC 5AFZH 3ZV9A 1J14A 1EKBB 2AGEX 4TPIZ 2OTVA 2WV5A 3EDXB 1HAOH 1UTNA 2A4RA 1GHWH 1BITA 4GHTA 1PYTD 1GJCB 3KQCA 1C1RA 3TU7H 3GY5A 1C5PA 5L30H 4DVAU 1XUFA 3EE0B 4Y11E 2H6MA 1XMNB 3KN2A 1NU7B 1O3EA 1G3CA 1HAYB 4IMZA 1MAYA 3NZIA 3P6ZB 1L2EA 1E0FD 2J9NA 3A8AA 1YKTA 3MNXA 4Z0KA 2VIPA 3L3TA 1GHBG 1GJ7B 1WAYB 2ZO3H 1SQTA 3RMNH 4XOJA 4CHAC 3SV9A 4DW2U 1OWIA 3H7OA 2BXUH 1LVBA 1CVWH 1EPTA 2ZU5A 4O3TA 3Q76A 3ZZBA 5E2OA 1AWHB 5E0JA 1AI8H 2BY6X 1C5QA 3E8LA 4X1NU 1ZSKA 8KME2 3M5OA 1NRRH 1B0EA 5FBIA 1BMLA 2J95A 4FUJA 4X2XA 1QJ6B 3VGCB 1DXPA 4FUCA 5JBAS 1NM6A 3RLYH 1A61H 1K21H 1O0DH 1QBVH 2ALPA 3T26A 3MU1A 5L2YH 4GHQA 4NSYA 1V2QT 2Q6DA 1O2VA 3WY8A 2NU3E 1SGFG 1FV9A 3H7TA 2F83A 1OSSA 1D6RA 1GI8B 3MMGA 3SJ9A 1F5KU 4IN1A 4ZHLU 2WPIS 2GCHG 2Y5HA 5DKMA 3TIUA 1QJ7B 3QX5H 1ZZZA 1QJ1B 3RXHA 1N8OC 4XFQA 2UWPA 3ATLA 3KGPA 4AG2A 1ZTJA 1P2OA 4BANB 1TRNA 3PTNA 1MBQA 2VH0A 1JBUH 4Y6DA 1OS8A 4YM9A 2FOMB 4HGCA 1D3PB 1SLUB 4THNH 5LGOA 3R3GB 3SUGA 4A1TA 1GJDB 6CHAC 1TOMH 1K1OA 2GMTC 2XXLA 2OC0A 3GOVB 5DG6A 2PTCE 2EI6A 4X0WU 2BQ6B 3BTKE 4D9QA 1GL1A 2R2WU 1AQ7A 1NFUA 2PKSC 1C1NA 1TRYA 5DP4A 4K8BA 4NSVA 3VB3A 1C2EA 1HJAC 4IC6A 3RC4A 3BTEE 1ANEA 2QV1A 2VB0A 3SJKA 3ZZ6A 1O5BB 1Y5AT 1Z1IA 1FIZA 1HLTH 1HNEE 1WQSA 2W5EA 3V13A 2BLVA 2AIQA 1C4Y2 1A5GH 1LDTT 1C2JA 1C5XB 2CHAB 3LGYA 2ZCKP 2AYWA 1S84A 2XWAA 2RA0A 5PTPA 2V35A 2CGAA 1ELGA 3O8DA 5ETXA 3RXJA 4JK6A 3E90B 1A1RA 4ZHAA 1ETSH 3D62A 1Q3XA 1IHTH 1HIAA 3B8JA 1ESTA 2KAIB 2VWOA 5EU8A 1GMDF 3MHWU 1T8LA 1F7ZA 1O3HA 3V7TA 1UTKA 1SGIB 2FI5E 1BTHH 1H9HE 1OWKA 2JH5D 1C4U2 3AVZA 1IAUA 3EA9A 1WBGB 4ABEA 5IDKA 3M3VA 5BPEA 1RGQA 2FDAA 5FAHA 1DE7H 3ZZ3A 4X2VA 2H5DA 5H4IB 3TH2H 1KXCA 2PLXA 2BD9A 1NRSH 2B5TB 2R0KA 4K3JA 4AFSA 1TA2A 1U6QA 2ALVA 2CF8H 3URCA 5IYTA 2OUAA 1OOKB 1BT7A 1MH0A 2OC8A 3UWIA 2BYAX 3MU4A 4GUXA 2ZFTA 4X6MA 3CS7A 1GJ9B 3SHAH 1TB6H 1RXPA 3AAUA 3S69A 2VIOA 2XCFA 1C1MA 3M5LA 5T6DA 1GGDC 1P10A 2FESH 2O8WA 3RDZA 1XUJA 5A09A 1ELDE 1GL0E 1QNJA 1JRSA 4WVPE 1TGTA 1W7XH 2VIQA 2Z9JA 5FCKA 2ZHFH 3B23B 2A5AA 3VB4A 3BEIB 1J8AA 2VGCB 2ZKSA 1O2RA 3S0NA 2J2UA 3TITA 3GDUA 2FS8A 4X2YA 5FHTA 2BY9X 1P12E 2ZC9H 1TA6A 1LMWB 1KSNA 2ILNA 1S81A 3PWCA 1F5RA 1NTPA 3NUMA 3BV9B 5EW1H 3P92A 1O2UA 1CA0B 1RRKA 1QFKH 4A7IB 1FNIA 4BAHB 1QCPA 3VB6A 3GY3A 1ELBA 2BZ6H 1CO7E 4WMFA 1BMAA 1IQGA 1PPCE 2GKVE 1K2I1 4O9VA 2FOCA 1RIWC 1HAXB 3S9AA 1G9IE 4INLA 4JZDH 1O34A 3S7HB 2AGIX 3P8NA 1YCPK 2ZPRA 1E35B 5FPTA 3FVFB 4K5ZA 2SGFE 5EPYA 2WYGA 4FUFA 1V2TT 1MU6B 3PO1C 2GCHF 1AD8H 1ZGIA 3LIWA 1W7GH 4XBDA 1BTWA 3OU0A 3RMMH 3SUFA 2F91A 4CBOA 1AUTC 3PLBA 1GI1A 1TPAE 1WUNH 2BLQA 3P95A 2QXGA 2QAAA 4FVBA 1O3NA 3VPKA 1ARBA 1EZSC 1MKWK 4OS6A 2XC5A 3HKIB 1FLEE 1V2ST 2Y7XA 4Y8XA 2R3YA 1VR1H 2G5NA 2FXRA 4HZHA 1C5VA 4UFFH 4X1SU 4CR5A 3IG6B 1TQ7B 1QTFA 3AAVA 2HRVA 4AZ2B 5A2MH 1O3AA 1EQ9A 2QXIA 1O3FA 1AN1E 5DK1A 1AKSB 2YNAA 1C1WH 1NS3A 1EATA 4O3UA 1T7CA 1AMHA 1TNLA 5JDUB 1EX3A 2P8OB 5F8XA 3A7XA 1EOJA 1TPPA 2BM2A 4JZ1A 1EB2A 1O32A 1YPLH 2Z6BD 2A4QA 2IPHA 3HATH 1D3QB 2SGDE 4XBBA 1HAZB 2M5TA 1LHEH 1AVXA 2ZNKH 1FQ3A 1TAWA 1K22H 2ZQ2A 2D2DA 2O8LA 1TX6A 2XBXA 3QZQA 1P11E 3VGCC 2ZGHA 1LHCH 1D3DB 4X8SH 3QTOH 1Z6EA 2FP7B 1ELTA 4I32A 1C1UH 1UJ1A 3BTDE 4D76A 1GBFA 3QLPH 5C5NA 3SQEE 3HPTB 4WH6A 3A84A 1ELAA 1C1VH 4B76A 1B5GH 5EOKA 1NFXA 1KLJH 2P59A 3M7QA 3RMLH 5LPFA 1AU8A 4TWWA 2ZHQH 5K7RA 1T31A 1TNKA 1WCZA 2FI3E 1C2DA 3KIDU 4Y71A 4DY7B 1C1TA 1O3MA 1ZSJA 3QGNB 1O2ZA 4I8KA 2BX4A 3ZZCA 3SORA 4ZHMU 3KCGH 1MU8B 1PQ7A 2P93A 2ZA5A 1EZQA 3V3MA 1CT2E 4DJZB 3K9XB 2FYRA 1JRTA 5TCAA 1IQEA 3RXUA 1MMJN 2ZWLH 1TGBA 1C5YB 1IHSH 4UFGH 1CBWC 1CGIE 1O2MA 4UD9H 3AW0A 3KF2A 3RM0H 3EAJA 4X2WA 9LPRA 3SHCH 1UTLM 1YC0A 4I7YH 1BHXF 4BAQB 2A1DB 4JYVH 1BBRK 2R0LA 4AFQA 3Q3KA 3LGIA 3M5MA 1ABIH 1SFIA 4BAKB 1W10U 1ELVA 3MTYA 3ZZ8A 1QA0A 3MH5A 3STIA 1NROH 2BY5X 2AGGX 4A1XA 1EPTB 3FP7E 4IC5A 3UTUH 2BTCE 6GCHG 1VITG 4UDWH 2JETC 2CHAC 1HCGA 1LPZB 2HLCA 4ZUHA 1G30B 3P70B 3S9BA 2FX6A 3TNTA 2BZAA 3URDA 1ANDA 1TFXA 3M3SA 2PFEA 2ZDNA 1TMUH 2ZEBA 2C8WB 2ZFPH 2F9UA 2R3UA 3GY8A 3U1IB 1EASA 1GG6C 2BY7X 1O38A 4DG4A 4ESTE 2OP9A 1O3BA 1BCUH 1LTOA 1A46H 1OWDA 2H9HA 3P8GA 1TX7A 3L6PA 2GT7A 1RFNA 4AORA 4A92A 1CQQA 1JXPA 5GDSH 1O2TA 3EA8A 5EQRA 5A8XA 4YOIA 2ZU1A 1W11U 1ZYOA 1HXEH 1ZGVA 4IMQA 2C4FH 3SU1A 3UNRA 4B73A 1Q2WA 1E36B 1GI7B 4B2CA 2D1JA 2PHBA 4FUIA 3PMAB 2WPHS 1O37A 1E38B 1V2VT 4B2AA 2O9QA 2VWMA 5LPEA 2XNIA 5L2ZH 1GJAB 3DUXH 3LH1A 1TIOA 1WOFA 1PPHE 3HGNA 4BXWA 2FODA 2QF3A 1ZHPA 1GBMA 3QK1A 1Z8IB 2BDIA 5C1XA 1AZZA 5DPAA 2F3CE 2GGVB 1DITH 1HAIH 5B6OA 3GYMA 1O2XA 2PSYA 2XCNA 2UUJB 3DA9B 2QCYA 3SBKA 3TH4H 1SQOA 1MTWA 3BG8A 1VCPA 8ESTE 4JZFH 2XYAA 4U30A 1QB9A 3ODDA 1MBMA 2UWOA 4FU7A 1CGHA 1HJ9A 1UK3A 2BLWA 2UUKB 3A82A 4INHA 2G81E 5GCHF 5A0CA 4Q7ZA 1IQHA 1OKXA 1TNGA 4NG9H 1EAIA 3SGBE 1XKAC 3RXRA 1T8MA 3E0NB 5DP5A 1DT2A 2A2QH 2BOKA 3ATKA 3BTHE 1OYQA 1S83A 2UUFB 4SGBE 2J38A 2ZDMA 1HIAB 3LJJA 3SN8A 2WPKS 3HK3B 1PYTC 2STBE 3W94A 1DDJA 3SW2B 1FONA 1TX8A 3P8FA 2PWXA 4JZIA 2JH0D 1GCTC 4Y7BA 2VVVA 2ZU4A 4CBNA 4WH8A 4ZXYH 1O3GA 2WPLS 2GD4B 2QYIA 2Q6FA 1FAKH 1BOQA 2PGQB 4DGJA 4BAOB 2FZZA 3IITA 1C5RA 4IS5A 3QUMP 3TJUA 4CRBA 2A7JA 2OQUA 4ZKSU 3ZV8A 4YOJA 2P3FH 4Y7AA 1C5MD 2ZFFH 3ZYDA 1L1NA 3KL6A 4CH8B 2GZ9A 1ID5H 5BRRE 2ZU3A 2PV9B 4ZKRU 4K1TA 3ZVBA 4YLQH 3LDXH 3LPRA 1SGFA 4MPWA 1C2LA 4X6NA 4AB8A 1H9IE 1TGCA 4MVNA 2ZTYA 1TBQH 2BY8X 3QGJA 1YCPH 1QRWA 4K8YA 1SMFE 5CE1A 1Y3VA 1TE0A 2ODPA 2ZGBH 2VJ1A 4B74A 1F0SA 1YPGH 1A2CH 2STAE 4IGDA 1TPSA 2BD4A 2DUCA 4IN2A 3RM2H 4LZ1H 2HPQH 4I8LA 5AFYH 2W7UA 5JB9S 4WWYA 1Q31A 3PWBA 3RU4T 6GCHF 3NWUA 2R2MB 1O2LA 8GCHG 1KLIH 3A81A 1O2OA 3KNXA 4OGXA 5C67A 1YLCA 3GDVA 1MKWH 2HPPH 1YP9A 2WV4A 4UE7H 1L1JA 3LH3A 3AASA 3RXBA 2ANKH 3LT3A 3GCHC 2R9PA 1T4UH 1QQUA 1BRBE 2C8ZB 1HXFH 4R0IA 5DP7A 2Z9GA 1P05A 2A4OA 1V2MT 2Y81A 1VJ9U 2JH6D 2WINI 2WUBA 5A0AE 1T32A 2Y6TA 1WU1A 1QIXB 3K6YA 2PW8H 3M36A 1G2LA 2CV3A 1UTPA 3A85A 1C2FA 3RXEA 4CRAA 1FDPA 1FIWA 1PQ5A 4H4FA 1RTFB 1LVMA 2TGTA 2HALA 3U98H 1XUKA 5I46H 4D9RA 2IN2A 3M7TA 1C5ZB 5HMAA 1P2KA 3IWMA 2G4UA 3PB1E 4TPYA 2NU4E 1HDTH 5EPNA 1ZHRA 2Z9LA 2FI4E 1EJMA 3STJA 2BDYA 1ACBE 2XWBI 1VCWA 1NZQH 4MNXA 3ATWA 4D8NA 3SV2H 2ZIQH 1GBDA 2VVCA 4LZ4B 5DJ7A 5GIBA 1TNIA 1MD7A 1P9SA 5C5OA 1HJ8A 5E8EH 1QL7A 1KTTB 1P2MA 1SBWA 3SU0A 1GHYH 3HK6B 1YPMH 1BZXE 2AMPA 4GSOA 3LU9B 1Y3XA 2THFB 1ZMNA 5J4SA 1F92A 2QIQA 3M7UA 3NK8A 4F49A 3SJIA 1VITH 1FN6A 1EB1H 2GT8A 2FTMA 1RD3B 5J4QA 3N7OA 2BVXH 1QR3E 2F9OA 1EAXA 3T5FH 3OX7U 3U9AH 1GJBB 2IJOB 3EYDA 1GI9B 4M7GA 4X6PA 3A86A 2QY0B 2RA3A 5JBBS 3TPIZ 1O33A 1SGYE 2G00A 2Z3DA 1N6XA 3K2UA 1O2YA 2BDAA 3OY5U 4MG3A 1YGCH 3CS0A 2A5IA 1O2NA 2FOHA 1XX9A 4JK5A 3RXPA 3GCNA 3TNSA 3KHVA 4BTIB 4ZXXH 4I8JA 1EAUA 4GCHG 5JB8S 1GI2A 4J2YB 5EODA 3ELAH 4FUBA 1H8IH 1W13U 5SGAE 1SC8U 3E0PB 4NIWA 1J15A 2CXVA 1MTVA 3GY7A 1DY9A 1EJAA 2G5VA 1LPKB 4H6SB 1UCYH 1BBRH 1YPHC 1EZUC 2H5CA 3SJOA 5E0HA 2BOHB 2O8TA 1P09A 2W7SA 3O8RA 2QF0A 3BEUA 3RP2A 3ITIA 1AUJA 1P2NA 1C5LH 1PPBH 4TY7A 3GY6A 4TYDA 5ESTE 1C5NH 1CGJE 1NO9H 2PR3A 2J4IA 3LGWA 1AIXH 1D6WA 3RLWH 1E37B 1HB0B 2PUQH 1EXFA 4ISNA 1O5EH 3TGIE 1KDQA 2BB4A 3UWJH 3NPSA 5T3HA 1RS0A 2Y80A 2Z7FE 1TWXB 2UUYA 1QRZA 1PPEE 3A83A 1GPZA 2H2ZA 1WTHD 3MU5A 4B1TA 2VWNA 1V2WT 5CHAB 1KLTA 4NIXA 3GY2A 1C1OA 1IQNA 1C2GA 3MH7A 3R0FA 3MOCA 2ZGCA 2ZECA 4X1QU 1VJAU 1GHBF 1AFQC 1YYY1 1DANH 4K1SA 7GCHG 1LO6A 4Y0ZE 4WJG2 4CH2B 3BIVH 3MNBA 1C4V2 2SGPE 4XE4A 1NRQH 4NA8A 1ZRKA 8GCHF 1TALA 1Y3WA 3MNSA 3G01A 2TGPZ 3KQDA 9ESTA 3DD2H 2G51A 4WF8A 2F9NA 2FWWA 2OD3B 1MTNB 1O2PA 4PROA 4CRGA 2Z9KA 3RU4E 1UMAH 5HXFA 2PGBB 3MH6A 4U32A 3QWCH 1D9IA 1O31A 3U8TH 4ABBA 1JMOH 2B8OH 1VZQH 2QGRA 3MO9A 4U2WA 1A0JA 2ANWA 2LNCA 3ZZ9A 2GDEH 2AEIH 3U1JB 1NN6A 3GDSA 1FMGA 2P3UB 1GVKB 4CR9A 2FO9A 1BRUP 2OLGA 3ZZ7A 4OS2A 1K1IA 3TK6A 1HFDA 1SLXB 1XVMA 3M35A 2A0QB 5HYOA 3LKWA 1TYNA 1OWHA 1UTJA 2BD3A 4J1YA 1V2LT 5F8TA 3L33A 2AERH 1HAPH 2BD2A 4ZROA 3ZVCA 4D7FA 3MH4A 1VGCB 1WQVH 4ASHA 1Y8TA 3SZNA 1QBNA 3A7ZA 4CRFA 2QN5T 2CMYA 1K9OE 4NIYA 3BTWE 3D23A 1GBKA 4HI3A 1QRXA 2G8TA 2NU0E 2Y5GA 3RMOH 1GBTA 1UVUH 4H6TA 3EGKH 4RKOB 4KKDA 4OS7A 3UQOA 1OX1A 4ZAEA 1FAXA 1OP2A 1K1MA 3KQBA 1YPHE 5DP3A 3TGKE 1KIGH 4Y76A 4BTUB 1QGFA 1GJ8B 1Y59T 3RXQA 3SNCA 5DGJA 1DVAH 4JYUH 4JMYA 2ZG0H 4CHAB 1GVZA 3BSQA 4MNWA 1N1LA 2IOTA 1D4PB 5DP8A 1P0SH 5GXPA 3LC3A 1BDAA 4F4OC 1NRNH 4RSPA 4JZEH 3GY4A 1HAVB 2VNTA 2J94A 1SGPE 2OINA 4LOYH 2BDBA 3UNQA 1FY4A 1GCDA 1TQ0B 4KELA 3E91A 1AE8H 1S85A 3FAOA 7LPRA 1YPJH 3LONA 4I8GA 1QY6A 2V6NA 1GDUA 1ZTLA 2B0FA 3SU2A 3F68H 1F5LA 1H4WA 2V3HH 2ZCLP 3V0XA 2XRCA 3VB7A 3LGTA 1HBTH 4NGAH 1ZMJA 1N8OB 1P3CA 1SLWB 1XUHA 1DLEA 1G2MA 2FPZA 1W0ZU 2BMGB 1THRH 1GBBA 2FLBH 1DWBH 1FY8E 2WPJS 3BTGE 3SNAA 1NFWA 4RN6A 3PMBB 1TBRH 2ZPSA 2Y7ZA 2W26A 1F0RA 2TIOA 3ZVDA 1NC6A 4XDEA 6CHAB 2QC2A 1BQYA 2GMTB 2XC0A 1NY22 1GI0A 1NFYA 1MZDA 4AYYB 5C20A 1DXWA 3D49H 5LPRA 3Q3YA 2ZDKA 1LQEA 1UCYK 2ZDLA 1QL8A 1GI5A 3QTVH 3I29A 2LPRA 2PKSB 4NA7A 1DSUA 1P3EA 1O5DH 2XBWA 4ABDA 2G4TA 1O2HA 2ESTE 1HJAB 4YO9A 4E06H 2ZZUH 4X6OA 2SGAA 1SLVB 1QB6A 1DFPA 1NRPH 3DT0H 1DUAA 2Z3CA 2W3IA 3OYPA 2V3OH 1C5UA 3QZRA 2FOGA 3A8BA 3QDZB 3MFJA 1LVOA 3A89A 5HM9A 4DCDA 1B7XB 4OS1A 4X1RU 5JBTA 4ISLA 3F9HA 5EQSA 5C1UA 2H9EH 4X8TH 2VWLA 3ZVGA 4I33A 3MNCA 2BQ7B 1LKBA 1INCA 1OWJA 3BG4B 1MCTA 3SUDA 3RXVA 6ESTA 1F0UA 1SGDE 2VVUA 1OP8A 4Z6AH 4FU9A 1BTXA 4E7NA 5JBCS 3TK5A 4WXVA 1ZR0A 2A32A 4K2YA 4AFZA 2AH4X 3QN7A 3A88A 3A80A 4B75A 1FPCH 2A45B 1YCPM 1BJUA 3ODFA 1ANBA 2A7HA 1IQLA 1F2SE 1A3BH 1ESBA 1QBOA 2CN0H 5EW2H 1P8VC 3SI4H 3BN9A 1CE5A 3C27B 2Q6GA 3RUOA 1TNHA 2EEKA 3SNEA 5GPIB 2Y5FA 3PLKA 5DP9A 4HFPB 1GGDB 1SR5C 2ZGXH 4Y8ZA 2AS9A 3FP8E 4AYVB 3UOPA 1TPOA 4DURA 1P2IA 4MQAA 2VGCC 2TGAA 4UFEH 3SU4A 1ANCA 1KYNA 3PMHB 4KGAA 4H42U 5DO4H 1FXYA 1AKSA 4ABAA 1HUTH 1CHOG 1H1BA 2C8XB 2SNVA 2FYQA 1Y3UA 1O3PB 1FI8A 3AW1A 2A31A 3OTJE 1CA0C 1BMMH 1XUIA 3DFLA 3PMJA 2ZCHP 1O3LA 3F6UH 2C8YB 1G3DA 2C3SA 2ZHEH 1P02A 1BUIA 5ABWA 1SGRE 4AG1A 1RTLA 5AVDA 1TABE 1RJXB 3RXDA 1S5SA 3GCTG 4YLUA 1BHXB 2FMJA 2ZFQH 4NFFA 4YESB 3SI3H 4ABJA 3ATMA 1KTSB 4AOQA 1RIWB 2GP9B 4INKA 1DLKB 3GCOA 2XC4A 2QXJA 4AB9A 1Y5UT 1GMCG 5DP6A 4BOHA 1KXBA 1PQ8A 3RXFA 1XXFA 1GJ6A 1SVPA 3RXLA 1GI6A 4DT7B 4ZH8A 1TMBH 2YOLA 3M3TA 4Y10E 4HTCH 1DOJA 1GBHA 3ZVFA 1SGTA 3JZ2B 1A5IA 1HAGE 1UO6A 1C2KA 4AX9H 1GBEA 4A5TS 2FLRH 5FPYA 3PTBA 3O8BA 5ESBA 3VEQB 1DUEA 4AFUA 2FOAA 1S82A 3DFJA 3RXCA 2WPMS 1LHFH 3I77A 1KDQB 2ZFRH 3CENA 1SB1H 3SV7A 3LJOA 1VGCC 4AGJA 1ZPCA 1D3TB 1HV7A 2BD7A 2BX3A 2G55A 1F0TA 2TBSA 3S7KB 1Y3YA 2BD5A 2O8UA 2XTTB 1ZJKA 2BDCA 2FOBA 4IBLH 1A3EH 2P16A 5K0HA 1CT0E 4X8UH 2ULLA 2P8OC 2VIWA 4GPGA 3PM3A 3ZZAA 1SGQE 4BAMB 3UNSA 1UVSH 5LH8A 1O2IA 3SV8A 1MAXA 1TGNA 1CA8B 1VITF 1S6HA 2ZHDA 2GV7A 2A5KA 5A0BA 1PPGE 4FXGH 5JYIA 4XSKU 3UR9A 4QT8C 1L4DA 1EZXC 1H8DH 3DHKH 1A0LA 4KP0A 4SGAE 1O3IA 2PKAA 3NCLA 1V2RT 2HVXA 2OBOA 1BIOA 1SOTA 1UCYE 1O2KA 1BBRE 3JZ1B 1GWAA 2VIDA 4NA9H 2NU2E 3EQ0H 1C2HA 1K1PA 2BDHA 3K6ZA 1V2JT 2FTLE 3V12A 1W3CA 1O3CA 1V2NT 1PJPA 1TLDA 3RXIA 1AZ8A 1TNJA 4WMDA 3TJOA 3F1SB 1TMTH 3VFEA 1ELFA 1C1SA 1O3JA 5T6FA 1UTQA 1LQDB 1ZPBA 1YPKH 5A8ZA 3ATIA 1FN8A 1AO5A 4OGYA 5F8ZA 1DS2E 1LCYA 4DOQA 2F9BH 4K60A 7ESTE 1ELCA 3MYWA 3TJNA 1GBCA 1C9TA 1GBIA 1G32B 3KQEA 1V3XA 1C5TA 2AMQA 1DM4B 3SU6A 1G36A 2Z3EA 3UFAA 2ZDAH 5HM2A 5FCRA 1ARCA 1SSXA 2OXSA 1Z8JB 8LPRA 1MTSA 1RTKA 1YBWA 1ZJDA 1AGJA 1FJSA 2C90B 2EC9H 1ZHMA 3TJVA 3VXFH 2A4GA 2RDLA 1CBWB 2P3TB 3T27A 1DWEH 1Y5BT 4MLFB 4CRCA 6LPRA 3BTTE 1W12U 4NZQA 1GHXH 4A1VA 1EPTC 3Q77A 3MU8A 3RXTA 1EOLA 2HWLB 1O5CB 1EP6A 1SHYA 3LC5A 1AY6H 1V2OT 1CHOF 2SFAA 2ANMH 1LHGH 1ZSLA 1V2KT 3MU0A 2JETB 1UHBA 2SGEE 3E16B 3UY9A 1ZRBA 4CRDA 4BXSA 3UUZA 1W2KH 5HGGA 2ODYB 3LGUA 5AHGH 2K1QA 2HNTC 3BF6H 1TGSZ 1ZPZA 1FY1A 3GCTF 2TGDA 1DSTA 1OWEA 3BG4C 2FM2A 4BNRA 1GG6B 1T8OA 1GMHG 3RU4D 5FXLA 1HPGA 5F03A 1DX5M 1W14U 1P03A 3T25A 3UREA 1TRMA 1GMCF 2ZTXA 4XBCA 1C5WB 3GISB 1QQ4A 3SGQE 1Z1JA 5AF9H 1X7AC 1S0QA 1PFXC 1KXAA 2W3KA 1K1JA 2H1UA 1K28D 1Z8RA 4WY3A 1HGTH 2EI7A 2FIRH 5FBEA 1AVGH 1T4VH 4Y0YE 2F9VA 1KXEA 4B71A 4ABGA 2ZPQA 2GTBA 3VB5A 1SQAA 1GHZA 1BMNH 1SI5H 1FUJA 4I8HA 1FY3A 4ISHH 2ASUB 3K65B 3MO3A 4Q80A 1K1LA 2CJIA 5EGMA 1SG8B 3OY6U 2ZTZA 2ZFSA 1YLDA 1AE5A 4NFEA 1P06A 1O2SA 3BIUH 1BTUA 4YT7H 3ESTA 3F9FA 1Z7KA 2ZP0H 3SQHE 4X8VH 4Q7YA 1XXDA 1SPJA 1GDQA 4D7GA 2P95A 5FPSA 4E7RG 1MQ6A 3SV6A 2Y82A 1JIMA 2VU8E 1WSSH 2EI8A 5TCCA 1KY9A 1AB9B 1V2UT 2GCTB 2CF9H 1YPEH 5JPMH 4K69A 1ZOMA 3BTQE 2BHGA 4LK4A 1O39A 1UK4A 1C9PA 4GAWA 1NU9A 3P8OA 3PYHA 3TK9A 2XBYA 3M5NA 1ABJH 1P2QA 2PTNA 4U01A 1IOEA 4A6LA 1LHDH 2JKHA 3T29A 1O2QA 1XUGA 1N6YA 3KEEA 2G52A 1GHAG 2J34A 3PV4A 1MUEB 2ODQA 4WMEA 3LGVA 1JOUB 1KXDA 2YNBA 1HAHH 1O5GH 3TLOA 1SHHB 2Z94A 4ZMAH 3SU5A 1O5FH 3SNDA 3PLPA 3A8DA 3ZVEA 1NPMA 1O5AB 2B9LA 4KTUA 1C2IA 2D8WA 2Z9IA 4ABIA 5A8YA 3QO6A 1M9UA 4E05H 1GCTB 1A0HB 1V6DA 1EJNA 1UTMA 1MKXH 3U8OH 4LXBH 1ESAA 3D65E 1GHVH 1O3DA
chains in the Genus database with same CATH superfamily
3Q3XA 4Y8YA 2H9TH 4RI0A 1V2PT 2OC1A 3ZVAA 1KXFA 5E2PA 5G4BA 4VGCB 4ABFA 2VIVA 1O2GH 4MPVA 1A4WH 1QURH 2ANYA 2KM0A 1P01A 1WTGH 2ZQ1A 3UOUA 2AIPA 4RT1A 3SO3A 2HNTE 1SFQB 1MQ5A 2WYJA 4YTAA 2ZDVH 5GJ4B 3RXKA 5C3NA 1L0ZA 1Z71A 2SGQE 3BEFB 2TPIZ 2WUCA 1THSH 1O36A 2PSXA 4KTSA 4TWYA 1K1NA 3UPEA 1YY3A 1AVWA 4DT4A 4Q2KA 2HNTF 4ZKOU 4FUDA 1THPB 3MWIU 3GICB 1JWTA 3TGJE 4NCYA 1GDNA 1C2MA 4ABHA 4OS4A 4DIHH 4MNYA 1UVOA 3SOSA 4AN7A 1W0JD 1MTUA 4B2BA 3LOXA 1QL9A 5GCHG 1ZMLA 1L4ZA 3M61U 2XBVA 2A2XH 1HYLA 3SGAE 1P2JA 4X1PU 3A7YA 3TVJB 1H8HD 1QZ8A 1SOZA 4GCHF 2O8MA 3GCHB 3T62A 1O2JA 1GBAA 2KAIA 2QF4A 1ETRH 1S0RA 1GMHF 3FANA 3SU3A 2FS9A 3PROA 3RXSA 1FPHH 2FEQH 1TBZH 1J9CH 2QA9E 2FOFA 3RXAA 3U8RH 3NKKA 2BQWB 3F9GA 1O35A 1GBLA 1LVYA 1ORFA 1VCQA 1LKAA 2RG3A 2JIZD 1CT4E 2Q1JA 1XM1A 3MQKC 3DSPA 4AGKA 7KMEH 3MI4A 3F9EA 2NU1E 1BB0B 2M2AA 1UVTH 3Q00A 2ZI2H 1WV7H 2GDDA 2WPDD 3HGPA 3C1KA 5L6NH 2OCVB 3H5CB 3P17H 3E3TA 2AFQB 2NWNA 4ASUD 3RXOA 1ELEE 3RC6A 3ZZ5A 3FP6E 1QB1A 2TRMA 1QHRB 1J17T 3ENSB 1MZAA 1IQMA 1LPGB 2GVFA 1W0YH 3RXMA 5C0TA 4NIVA 1G3BA 1O3KA 1GJ5H 4TSFD 2PUXB 2SNWA 2GX4A 3SUEA 5I25A 1ZLRA 7GCHF 1S6FA 5T6GA 1SGCA 1C5OH 4JYTA 1H9LB 1Z6JH 1BRAA 4YZUA 2FOEA 1JIRA 4CREA 2KCYA 1O3OA 2VH6A 5CMXH 3GYLB 4UEHH 2RCEA 1WYKA 2GV6A 5F6MA 4DIIH 1E34B 3FFGA 4UFDH 3A8CA 1MD8A 1AFEH 1EUFA 2CK3D 1G3EA 1NBME 1SL3A 2HOBA 4GVUA 3SYJA 2PKAB 3T2NA 5EXLA 3TH3H 1YM0A 1FY5A 3I78A 4Q7XA 2AMDA 4KTCA 1C1PA 3ZZDA 2HGTH 3UQVA 4IW4E 1GHAF 1CHGA 1BRCE 2BVRH 4NZLA 5EQQA 4BTTB 3RXGA 3E1XB 4R8TB 2BVSH 1B0FA 1BTPA 1PPZA 1Z8GA 1W8BH 4FU8A 1OP0A 2I6QA 1P9UA 1AHTH 1J16A 4I31A 2D26C 3UR6A 1BA8B 1PQAA 1HRTH 2V0BA 4MNVA 3BTFE 3BTME 3W1EA 3HKJB 1NESE 2VINA 2OC7A 5FX6A 1CSOE 1C5SA 3W95A 1TONA 1O2WA 1ETTH 3ZYEA 1OPHB 3MO6A 4UONA 1FZZA 3PV2A 1DICA 1PPFE 1GJ4H 4MTBA 1UK2A 3O8CA 1DPOA 2ZF0H 2OBQA 1DY8A 1P04A 1QA7A 4JCNA 3NXPA 5DSFA 4OS5A 1IQJA 5GWZA 2F9PA 4GLYA 2UWLA 5CHAC 2BD8A 4FVDA 1YF4A 1MKXK 4MDSA 3SNBA 4WXIA 1XVOA 2EA3A 5FX5A 2ZU2A 4RKJB 2DE9A 2C93B 3CP7A 1EAWA 3T28A 4O03A 3A7WA 5TJXA 1A7SA 1UVPA 4O97A 5EG4A 1GI3A 4YOGA 2P94A 1SGNE 1O30A 5E0GA 1G37A 3EA7A 4TY6A 2BLOA 1ZTKA 2FX4A 3E6PH 3RC5A 5C2ZA 1GI4A 1AB9C 1AFQB 1L1GA 4ISOA 1DWDH 2GCTC 2OQ5A 1GVLA 1BTZA 1NT1A 3VXEH 1XKBC 3OSYA 1A5HA 4FUHA 1OYTH 4ISIH 2BXTH 3FZZA 1UHBB 3SJ8A 3U69H 1EP5A 2DE8A 4Y79A 4MPXA 1MTNC 1OXGA 2GZ8A 3A7TA 1CU1A 5EXNA 4MPUA 1TOCB 3UIRA 1UTOA 4K1EA 1IQIA 2J92A 1IQFA 4FUEA 2ZHWH 2BDGA 1AWFH 4YT6H 4FUGA 4ZKNU 1GMDG 1HAVA 4NWKA 5EIYA 1BTYA 3M37A 2GZ7A 1T8NA 2A7CA 3S9CA 1IQKA 1C1QA 3PO1B 5EXMA 2I6SA 2XW9A 3A7VA 1MCVA 3FZDA 5EJZA 1GBJA 3ZZ4A 1BJVA 2QXHA 3A87A 1P57B 2B7DH 3B9FH 1KMHB 1SGEE 4FOUC 4NWLA 5C1YA 1DWCH 2ZGJA 4VGCC 5AFZH 3ZV9A 1J14A 1EKBB 2AGEX 4TPIZ 2OTVA 2WV5A 3EDXB 1HAOH 1UTNA 2A4RA 1GHWH 1BITA 4GHTA 1PYTD 1GJCB 3KQCA 1C1RA 3TU7H 3GY5A 1C5PA 5L30H 5C17A 4DVAU 1XUFA 3EE0B 4Y11E 2H6MA 1XMNB 3KN2A 1NU7B 1O3EA 1G3CA 1HAYB 4IMZA 1MAYA 3NZIA 3P6ZB 1L2EA 1E0FD 2J9NA 3A8AA 1YKTA 3MNXA 4Z0KA 2VIPA 3L3TA 1GHBG 1GJ7B 1WAYB 2ZO3H 1SQTA 3RMNH 4XOJA 4CHAC 3SV9A 4DW2U 1OWIA 3H7OA 2BXUH 1LVBA 1CVWH 1EPTA 2ZU5A 4O3TA 3OFND 3Q76A 3ZZBA 5E2OA 1AWHB 5E0JA 1AI8H 2BY6X 1C5QA 3E8LA 4X1NU 1ZSKA 8KME2 3M5OA 1NRRH 1B0EA 5FBIA 1BMLA 2J95A 4FUJA 4X2XA 1QJ6B 3VGCB 1DXPA 4FUCA 5JBAS 1NM6A 3RLYH 1A61H 1K21H 1O0DH 1QBVH 2ALPA 3T26A 3MU1A 5L2YH 4GHQA 3OEHD 4NSYA 1V2QT 2Q6DA 1O2VA 3WY8A 2NU3E 1SGFG 1FV9A 3H7TA 2F83A 1OSSA 1D6RA 1GI8B 3MMGA 3SJ9A 1F5KU 4IN1A 4ZHLU 2WPIS 2GCHG 2Y5HA 5DKMA 3TIUA 1QJ7B 3QX5H 1ZZZA 1QJ1B 3RXHA 1N8OC 4XFQA 2UWPA 3ATLA 3KGPA 4AG2A 1ZTJA 1P2OA 4BANB 1TRNA 3PTNA 1MBQA 2VH0A 1JBUH 4Y6DA 1OS8A 4YM9A 2FOMB 4HGCA 1D3PB 1SLUB 4THNH 5LGOA 3R3GB 3SUGA 4A1TA 1GJDB 6CHAC 3F0PA 1TOMH 1K1OA 2GMTC 2XXLA 2OC0A 3GOVB 5DG6A 2K8IA 2PTCE 2EI6A 4X0WU 2BQ6B 3BTKE 4D9QA 1GL1A 2R2WU 1AQ7A 1NFUA 2PKSC 1C1NA 1TRYA 5DP4A 4K8BA 4NSVA 3VB3A 1S6LA 1C2EA 1HJAC 4IC6A 3RC4A 4P00A 3BTEE 1ANEA 2QV1A 2VB0A 3SJKA 3ZZ6A 1O5BB 1Y5AT 1Z1IA 1FIZA 1HLTH 1HNEE 1WQSA 2W5EA 3V13A 2BLVA 2AIQA 2V7QD 1C4Y2 1A5GH 1LDTT 1C2JA 1C5XB 2CHAB 3LGYA 2ZCKP 2AYWA 1S84A 2XWAA 2RA0A 5PTPA 2V35A 2CGAA 1ELGA 3O8DA 5ETXA 3RXJA 4JK6A 3E90B 1A1RA 4ZHAA 1ETSH 3D62A 1Q3XA 1IHTH 1HIAA 3B8JA 1ESTA 2KAIB 2VWOA 5EU8A 3AK5A 1GMDF 3MHWU 1T8LA 1F7ZA 1O3HA 3V7TA 1UTKA 1SGIB 2FI5E 1BTHH 1H9HE 1OWKA 2JH5D 1C4U2 3AVZA 1IAUA 3EA9A 1WBGB 4ABEA 5B6LA 5IDKA 3M3VA 5BPEA 1RGQA 2FDAA 5FAHA 1DE7H 3ZZ3A 4X2VA 2H5DA 5EJLA 5H4IB 3TH2H 1KXCA 2PLXA 2BD9A 1NRSH 2B5TB 2R0KA 4K3JA 4AFSA 1TA2A 1U6QA 2ALVA 2CF8H 3URCA 5IYTA 2OUAA 1OOKB 1BT7A 1MH0A 2OC8A 3UWIA 2BYAX 3MU4A 4GUXA 2ZFTA 4X6MA 3CS7A 1GJ9B 3SHAH 1TB6H 1RXPA 3AAUA 3S69A 2VIOA 2XCFA 1C1MA 3M5LA 5T6DA 1GGDC 1P10A 2YMSC 2XNDD 2FESH 2O8WA 3RDZA 1XUJA 5A09A 1ELDE 1GL0E 1QNJA 1JRSA 4WVPE 1TGTA 1W7XH 3UAIC 2VIQA 2Z9JA 5FCKA 2ZHFH 3B23B 2A5AA 3VB4A 3BEIB 1J8AA 2VGCB 2ZKSA 1O2RA 3S0NA 2J2UA 3TITA 3GDUA 2FS8A 4X2YA 5FHTA 3NRLA 2BY9X 1P12E 2ZC9H 1TA6A 1LMWB 1KSNA 2ILNA 1S81A 3PWCA 1F5RA 1NTPA 3NUMA 3BV9B 5EW1H 3P92A 1O2UA 1CA0B 1RRKA 3OE7D 1QFKH 4A7IB 1FNIA 4BAHB 3PRDA 1QCPA 3VB6A 3GY3A 1ELBA 2BZ6H 1CO7E 4WMFA 1BMAA 1IQGA 1PPCE 2GKVE 1K2I1 4O9VA 2FOCA 1RIWC 1HAXB 3S9AA 3F2GA 3DCLA 1G9IE 4INLA 4JZDH 1O34A 3S7HB 2AGIX 3P8NA 1YCPK 2ZPRA 1E35B 5FPTA 3FVFB 4K5ZA 2SGFE 5EPYA 2WYGA 4FUFA 1V2TT 1MU6B 3PO1C 2GCHF 1AD8H 1ZGIA 3LIWA 1W7GH 4XBDA 1BTWA 3OU0A 3RMMH 3SUFA 2JDID 2F91A 4CBOA 5CDFE 1AUTC 3PLBA 1GI1A 1TPAE 1WUNH 4XRNA 2BLQA 3P95A 2QXGA 2QAAA 4FVBA 1O3NA 3VPKA 1ARBA 1EZSC 1MKWK 4OS6A 2XC5A 2OK5A 3HKIB 2K0QA 1FLEE 1V2ST 2Y7XA 4Y8XA 2R3YA 1VR1H 2G5NA 2FXRA 4HZHA 1C5VA 4UFFH 4X1SU 4CR5A 3IG6B 1TQ7B 1QTFA 3AAVA 2HRVA 4AZ2B 5A2MH 3OEED 3U28C 1O3AA 3WWBA 1EQ9A 2QXIA 1O3FA 1AN1E 5DK1A 1AKSB 2YNAA 1C1WH 1NS3A 1EATA 4O3UA 1T7CA 1AMHA 4Q4LA 1TNLA 5JDUB 1EX3A 2P8OB 5FL7D 5F8XA 3A7XA 1EOJA 1TPPA 2BM2A 4JZ1A 1EB2A 1O32A 1YPLH 2Z6BD 2A4QA 2IPHA 3HATH 1D3QB 2SGDE 4XBBA 1HAZB 2M5TA 1LHEH 1AVXA 2ZNKH 1FQ3A 1TAWA 1K22H 2ZQ2A 2D2DA 2O8LA 1TX6A 2XBXA 3QZQA 1P11E 5F53A 3VGCC 5C94A 2ZGHA 1LHCH 1D3DB 4X8SH 3QTOH 1Z6EA 2FP7B 1ELTA 4F55A 4I32A 1C1UH 1UJ1A 3BTDE 3GS9A 4D76A 1GBFA 3QLPH 5C5NA 3SQEE 3HPTB 3N7DA 4WH6A 3A84A 1ELAA 1C1VH 4B76A 1B5GH 5EOKA 4YXWD 5EJ1A 1NFXA 1KLJH 2P59A 3M7QA 3RMLH 5LPFA 1AU8A 4TWWA 2ZHQH 5K7RA 1T31A 1TNKA 1WCZA 2FI3E 1C2DA 3F3BA 3KIDU 4Y71A 4DY7B 1C1TA 1O3MA 1ZSJA 3QGNB 1O2ZA 4I8KA 5DN6D 2BX4A 3ZZCA 3SORA 4ZHMU 3KCGH 1MU8B 1PQ7A 2P93A 2ZA5A 5HIZA 1EZQA 3V3MA 1CT2E 4DJZB 3K9XB 4F48B 2FYRA 1JRTA 5TCAA 1IQEA 3RXUA 1MMJN 2ZWLH 1TGBA 1C5YB 1IHSH 4UFGH 1CBWC 1CGIE 1O2MA 4UD9H 3AW0A 3KF2A 3RM0H 3EAJA 4X2WA 9LPRA 3SHCH 1UTLM 1YC0A 4I7YH 1BHXF 4BAQB 2A1DB 4JYVH 1BBRK 2R0LA 4AFQA 3Q3KA 3LGIA 3M5MA 1ABIH 1SFIA 4BAKB 1W10U 1ELVA 3MTYA 3ZZ8A 1QA0A 3MH5A 3STIA 1NROH 2BY5X 2AGGX 4A1XA 1EPTB 3FP7E 4IC5A 3UTUH 2BTCE 6GCHG 1VITG 4UDWH 2JETC 2CHAC 1HCGA 1LPZB 2HLCA 4ZUHA 1G30B 3P70B 3S9BA 4HG6A 2FX6A 3TNTA 2BZAA 3URDA 1ANDA 1TFXA 3M3SA 2PFEA 2ZDNA 1TMUH 2ZEBA 2C8WB 2ZFPH 2F9UA 2R3UA 3GY8A 5CHBA 3WWFA 3U1IB 1EASA 2QF5A 1GG6C 2BY7X 1O38A 4DG4A 4ESTE 2OP9A 1O3BA 1BCUH 1LTOA 1A46H 1OWDA 2H9HA 3P8GA 1TX7A 3L6PA 2GT7A 1RFNA 4AORA 4A92A 1CQQA 1JXPA 5GDSH 1O2TA 3EA8A 3FKSD 5EQRA 5A8XA 4YOIA 2ZU1A 1W11U 1ZYOA 1HXEH 1ZGVA 4IMQA 2C4FH 3SU1A 3UNRA 4B73A 1Q2WA 1E36B 1GI7B 4B2CA 2D1JA 2PHBA 4FUIA 3PMAB 2WPHS 1O37A 1E38B 1V2VT 5KEDA 4B2AA 2O9QA 2VWMA 5LPEA 2XNIA 5L2ZH 1GJAB 3DUXH 3LH1A 1TIOA 1WOFA 3SZEA 1PPHE 3HGNA 4BXWA 2FODA 2QF3A 1ZHPA 1GBMA 3QK1A 1Z8IB 2BDIA 5C1XA 1AZZA 2IJD1 5DPAA 2F3CE 2GGVB 1SQRA 1DITH 1HAIH 5B6OA 3GYMA 1O2XA 2PSYA 2XCNA 2UUJB 3DA9B 2QCYA 3SBKA 3TH4H 1SQOA 1MTWA 3BG8A 1VCPA 8ESTE 4JZFH 2XYAA 4U30A 1QB9A 3ODDA 1MBMA 2UWOA 4FU7A 1CGHA 1HJ9A 1UK3A 2BLWA 2UUKB 3A82A 4INHA 2G81E 5GCHF 5A0CA 4Q7ZA 1IQHA 1OKXA 1TNGA 4NG9H 1EAIA 3SGBE 1H8ED 1XKAC 3RXRA 1T8MA 3E0NB 5DP5A 1DT2A 2A2QH 2BOKA 3ATKA 3BTHE 1OYQA 1S83A 2XOKD 2UUFB 4SGBE 2J38A 2ZDMA 1HIAB 3LJJA 3SN8A 2WPKS 3HK3B 1PYTC 2STBE 3W94A 1DDJA 3SW2B 1FONA 1TX8A 3P8FA 2PWXA 4JZIA 2JH0D 1GCTC 4Y7BA 2VVVA 2JJ2D 2ZU4A 5HKKD 4CBNA 2V3MA 5T1VA 4WH8A 4ZXYH 1EFRD 2W6ID 1O3GA 2WPLS 2GD4B 2QYIA 3DSOA 2Q6FA 1FAKH 1BOQA 2PGQB 2AHME 4DGJA 4BAOB 2FZZA 3IITA 1C5RA 4IS5A 3QUMP 3TJUA 4CRBA 2A7JA 2OQUA 4ZKSU 3ZV8A 4YOJA 2P3FH 4Y7AA 1C5MD 2ZFFH 3ZYDA 1L1NA 3KL6A 4CH8B 5C0UA 2GZ9A 1ID5H 5BRRE 2ZU3A 2PV9B 4ZKRU 4K1TA 3ZVBA 4YLQH 3LDXH 3LPRA 1SGFA 4MPWA 1C2LA 4X6NA 4AB8A 1H9IE 1TGCA 4MVNA 2ZTYA 1TBQH 2BY8X 1BMFD 3QGJA 1YCPH 1QRWA 4K8YA 1SMFE 5CE1A 1Y3VA 1TE0A 2ODPA 2ZGBH 2VJ1A 4B74A 1F0SA 1YPGH 2IPQX 1A2CH 2STAE 4IGDA 1TPSA 2BD4A 2DUCA 4IN2A 3RM2H 4LZ1H 2HPQH 4I8LA 2EQNA 2W7UA 5AFYH 5JB9S 4WWYA 1Q31A 3PWBA 3RU4T 6GCHF 3NWUA 2R2MB 1O2LA 8GCHG 1KLIH 3A81A 1O2OA 3KNXA 4OGXA 2WHXA 5C67A 1YLCA 3GDVA 1MKWH 2HPPH 1YP9A 2WV4A 4UE7H 1L1JA 3LH3A 3AASA 3RXBA 2ANKH 4ZCNA 3LT3A 2HVYB 3GCHC 2R9PA 1T4UH 1QQUA 1BRBE 2C8ZB 1HXFH 4R0IA 5DP7A 2Z9GA 1P05A 2A4OA 1V2MT 2Y81A 1VJ9U 2JH6D 2WINI 2WUBA 5A0AE 2KZ4A 1T32A 2Y6TA 2L6OA 3PV5A 1WU1A 1QIXB 3K6YA 2PW8H 3M36A 1G2LA 2CV3A 1UTPA 3A85A 1C2FA 3RXEA 4CRAA 1FDPA 1FIWA 1PQ5A 4H4FA 1RTFB 1LVMA 2TGTA 2HALA 3U98H 1XUKA 5I46H 4D9RA 2IN2A 3M7TA 1C5ZB 5HMAA 1P2KA 3IWMA 2G4UA 3PB1E 4TPYA 2NU4E 1HDTH 5EPNA 1ZHRA 2Z9LA 2FI4E 1EJMA 1SKYE 3STJA 2BDYA 1ACBE 2XWBI 1VCWA 1NZQH 4MNXA 3ATWA 4D8NA 3SV2H 2ZIQH 1GBDA 2VVCA 4LZ4B 5DJ7A 4P02A 5GIBA 1TNIA 4Z1MD 1MD7A 1P9SA 5C5OA 1HJ8A 5E8EH 1QL7A 1KTTB 1P2MA 1SBWA 3SU0A 1GHYH 3HK6B 1YPMH 1BZXE 2AMPA 4GSOA 3LU9B 1Y3XA 2THFB 1ZMNA 5J4SA 4B6EA 1F92A 2QIQA 3M7UA 3NK8A 4F49A 3SJIA 1VITH 1FN6A 1EB1H 2GT8A 2FTMA 1RD3B 5J4QA 3N7OA 3WW7A 2BVXH 1QR3E 2F9OA 1EAXA 3T5FH 3OX7U 3U9AH 1GJBB 2IJOB 3EYDA 1GI9B 4M7GA 4X6PA 3A86A 2QY0B 2RA3A 5JBBS 3TPIZ 1O33A 1SGYE 2G00A 2Z3DA 1N6XA 3K2UA 1O2YA 2BDAA 4ACAA 3OY5U 4MG3A 1YGCH 3CS0A 2A5IA 1O2NA 2FOHA 1XX9A 4JK5A 3RXPA 3GCNA 3TNSA 3KHVA 4BTIB 4ZXXH 4I8JA 1EAUA 4GCHG 5JB8S 1GI2A 4J2YB 5EODA 3ELAH 4FUBA 1H8IH 1W13U 5SGAE 1SC8U 3E0PB 2LP6A 4NIWA 1J15A 2CXVA 1MTVA 3GY7A 1DY9A 1EJAA 2G5VA 1LPKB 4H6SB 1UCYH 1BBRH 1YPHC 1EZUC 2H5CA 3SJOA 5E0HA 2BOHB 2O8TA 1P09A 3OAAD 2W7SA 2QF0A 3O8RA 3BEUA 3RP2A 3ITIA 1AUJA 1P2NA 1C5LH 3PRBA 1PPBH 4TY7A 3GY6A 4TYDA 5ESTE 1C5NH 1CGJE 1NO9H 2PR3A 2J4IA 3LGWA 1AIXH 1D6WA 3RLWH 1E37B 1HB0B 2PUQH 1EXFA 4ISNA 1O5EH 3TGIE 1KDQA 2BB4A 3UWJH 3NPSA 5T3HA 1RS0A 2Y80A 2Z7FE 1TWXB 2UUYA 1QRZA 1PPEE 3A83A 1GPZA 2H2ZA 1WTHD 3MU5A 4B1TA 2VWNA 1V2WT 5CHAB 1KLTA 4NIXA 3GY2A 1C1OA 1IQNA 1C2GA 3MH7A 3R0FA 3MOCA 2ZGCA 2ZECA 4X1QU 1VJAU 1GHBF 1AFQC 1YYY1 1DANH 4K1SA 7GCHG 5IK2D 1LO6A 4Y0ZE 4WJG2 1MABB 4CH2B 3BIVH 3MNBA 1C4V2 2SGPE 4XE4A 1NRQH 4AC9A 4NA8A 1ZRKA 8GCHF 1TALA 1Y3WA 3MNSA 4TT3D 3G01A 2TGPZ 3KQDA 9ESTA 3DD2H 2G51A 4WF8A 1E1QD 3H09A 2F9NA 2FWWA 2OD3B 1MTNB 1O2PA 4PROA 4CRGA 2Z9KA 3RU4E 1UMAH 5HXFA 5KGOA 2PGBB 3MH6A 2YMSD 4U32A 3QWCH 1D9IA 1O31A 3U8TH 4ABBA 1JMOH 2B8OH 1VZQH 2QGRA 3MO9A 4U2WA 1A0JA 2ANWA 2LNCA 3ZZ9A 2GDEH 2AEIH 3U1JB 1NN6A 3GDSA 1FMGA 2P3UB 1GVKB 4CR9A 2FO9A 1BRUP 2OLGA 3ZZ7A 4OS2A 1K1IA 3TK6A 1HFDA 1SLXB 1XVMA 3M35A 2A0QB 5HYOA 3LKWA 1TYNA 2LELA 1OWHA 1UTJA 2BD3A 4J1YA 1V2LT 5F8TA 3L33A 2AERH 1HAPH 2BD2A 4ZROA 3ZVCA 4D7FA 3MH4A 1VGCB 1WQVH 4ASHA 1Y8TA 3SZNA 1QBNA 3A7ZA 4CRFA 2QN5T 2CMYA 1K9OE 2KR7A 4NIYA 3BTWE 3D23A 1GBKA 4HI3A 1QRXA 2KX4A 2G8TA 2NU0E 2Y5GA 3RMOH 1GBTA 1UVUH 4H6TA 1OHHD 3EGKH 4RKOB 4KKDA 4OS7A 3UQOA 1OX1A 4ZAEA 1FAXA 1OP2A 1K1MA 3KQBA 1YPHE 3KYFA 5DP3A 3TGKE 1KIGH 3F2FA 4Y76A 4BTUB 1QGFA 1GJ8B 1UW7A 1Y59T 3RXQA 3SNCA 5DGJA 1DVAH 4JYUH 4JMYA 2ZG0H 4CHAB 1GVZA 3BSQA 1NBMD 4MNWA 1N1LA 2IOTA 1D4PB 5DP8A 2WSSD 1P0SH 5GXPA 3LC3A 1BDAA 4F4OC 1NRNH 4RSPA 4JZEH 3GY4A 1K0HA 1HAVB 2VNTA 2J94A 1SGPE 2OINA 4LOYH 2BDBA 3UNQA 1FY4A 1GCDA 1TQ0B 4KELA 3E91A 1AE8H 1S85A 2KCAA 3FAOA 7LPRA 1YPJH 3LONA 4I8GA 1QY6A 2V6NA 2QE7D 1GDUA 2J98A 1ZTLA 2B0FA 3SU2A 3F68H 1F5LA 1H4WA 2V3HH 2ZCLP 3V0XA 2XRCA 3VB7A 3LGTA 1HBTH 4NGAH 1ZMJA 1N8OB 4B6FA 1P3CA 1SLWB 1XUHA 1DLEA 1G2MA 2FPZA 2RDEA 1W0ZU 2BMGB 1THRH 1GBBA 2FLBH 1DWBH 1FY8E 2WPJS 3BTGE 3SNAA 1NFWA 4RN6A 3PMBB 1TBRH 2ZPSA 2Y7ZA 2F4LA 2W26A 1F0RA 3FN8A 2TIOA 3ZVDA 4Q63A 1NC6A 4XDEA 6CHAB 2QC2A 1BQYA 2GMTB 2XC0A 1NY22 1GI0A 1NFYA 1MZDA 4AYYB 5C20A 1DXWA 3D49H 5LPRA 3Q3YA 2ZDKA 1LQEA 1UCYK 2ZDLA 1QL8A 1GI5A 3QTVH 3I29A 2LPRA 2PKSB 4NA7A 1DSUA 1P3EA 1O5DH 2XBWA 4ABDA 2G4TA 1O2HA 2ESTE 1HJAB 4YO9A 4E06H 2ZZUH 4X6OA 2SGAA 2KCOA 1SLVB 1QB6A 1DFPA 1NRPH 3DT0H 1DUAA 2Z3CA 2W3IA 3OYPA 2V3OH 1C5UA 2HLDD 3QZRA 2FOGA 3A8BA 3QDZB 3MFJA 1LVOA 3A89A 5HM9A 4DCDA 5KECA 1B7XB 4OS1A 4X1RU 5JBTA 4ISLA 3F9HA 5EQSA 5C1UA 2H9EH 4X8TH 2VWLA 3ZVGA 4I33A 3MNCA 2BQ7B 1LKBA 1INCA 1OWJA 2JJ1D 3BG4B 1MCTA 3SUDA 3RXVA 6ESTA 1F0UA 3KYGA 1SGDE 2VVUA 1OP8A 4Z6AH 4FU9A 3CNRA 1BTXA 4E7NA 1VKYA 5JBCS 3TK5A 4WXVA 1ZR0A 2A32A 4K2YA 2EY4C 4AFZA 2AH4X 3QN7A 3A88A 3A80A 4B75A 1FPCH 2A45B 1YCPM 1BJUA 3ODFA 1ANBA 2A7HA 1IQLA 1F2SE 1A3BH 1ESBA 1QBOA 2CN0H 5EW2H 1P8VC 3SI4H 3BN9A 1CE5A 2KFWA 3C27B 2Q6GA 3RUOA 1TNHA 2EEKA 3SNEA 5GPIB 2Y5FA 3PLKA 5DP9A 4HFPB 1GGDB 1SR5C 2ZGXH 4Y8ZA 2AS9A 2YMSB 3FP8E 3N7EA 4AYVB 3UOPA 1TPOA 4DURA 1P2IA 4MQAA 2VGCC 2TGAA 4UFEH 3SU4A 1ANCA 1KYNA 3PMHB 4KGAA 4H42U 5DO4H 1FXYA 1AKSA 3KQ5A 4ABAA 1HUTH 1CHOG 1H1BA 2C8XB 2SNVA 2FYQA 1Y3UA 1O3PB 1FI8A 3AW1A 2A31A 3OTJE 1CA0C 2KCPA 1BMMH 1XUIA 3DFLA 3PMJA 2ZCHP 3FO8D 1O3LA 3F6UH 2C8YB 1G3DA 2C3SA 2ZHEH 4OM9A 1P02A 1BUIA 5ABWA 1SGRE 4AG1A 1RTLA 5AVDA 1TABE 1RJXB 3RXDA 1S5SA 3GCTG 4YLUA 1BHXB 2FMJA 2ZFQH 4NFFA 4YESB 3SI3H 4ABJA 3ATMA 1KTSB 4AOQA 1RIWB 2GP9B 4INKA 1DLKB 3GCOA 2XC4A 2QXJA 4AB9A 1Y5UT 1GMCG 5DP6A 4BOHA 1KXBA 1PQ8A 3RXFA 1XXFA 1GJ6A 1SVPA 3RXLA 1GI6A 4DT7B 4ZH8A 1TMBH 2YOLA 3M3TA 4Y10E 4I86A 4HTCH 1DOJA 1GBHA 3ZVFA 1SGTA 3JZ2B 1A5IA 1HAGE 1UO6A 1C2KA 4AX9H 1GBEA 4A5TS 1E1RD 2FLRH 5FPYA 3PTBA 3O8BA 5ESBA 3VEQB 1DUEA 4AFUA 2FOAA 1S82A 4ACBA 3DFJA 3RXCA 2WPMS 1LHFH 3I77A 1KDQB 2ZFRH 3CENA 1SB1H 3SV7A 2WZQA 3LJOA 1VGCC 4AGJA 1ZPCA 1D3TB 1HV7A 2BD7A 2BX3A 2G55A 1F0TA 2TBSA 3S7KB 1Y3YA 2BD5A 2O8UA 2XTTB 1ZJKA 2BDCA 2FOBA 4IBLH 1A3EH 2P16A 5K0HA 1CT0E 4X8UH 2ULLA 2P8OC 2VIWA 1WDIA 4GPGA 1YLNA 3PM3A 3ZZAA 1SGQE 4BAMB 3UNSA 1UVSH 5HIYA 5LH8A 1O2IA 3SV8A 1WXRA 1MAXA 1TGNA 1CA8B 1VITF 1S6HA 1COWD 2ZHDA 2GV7A 2A5KA 2WV9A 5A0BA 1PPGE 4FXGH 5JYIA 4XSKU 3UR9A 4QT8C 4RT0A 1L4DA 1EZXC 1H8DH 3DHKH 1A0LA 4KP0A 4SGAE 1O3IA 2PKAA 3NCLA 1V2RT 2HVXA 2OBOA 1BIOA 1SOTA 1UCYE 1O2KA 1BBRE 3JZ1B 1GWAA 2VIDA 4NA9H 2NU2E 3EQ0H 1C2HA 1K1PA 2BDHA 3K6ZA 1V2JT 2FTLE 3V12A 1W3CA 1O3CA 1V2NT 2J97A 1PJPA 1TLDA 2RFKC 3RXIA 1AZ8A 1TNJA 4M9FA 4WMDA 3TJOA 3F1SB 1TMTH 3VFEA 1ELFA 1C1SA 1O3JA 5T6FA 1UTQA 1LQDB 1ZPBA 1YPKH 5A8ZA 3ATIA 1FN8A 1W0KD 1AO5A 4OGYA 5F8ZA 1DS2E 1LCYA 4DOQA 2F9BH 4K60A 7ESTE 1ELCA 3MYWA 3TJNA 1GBCA 1C9TA 1GBIA 1G32B 3KQEA 1V3XA 1C5TA 2AMQA 1DM4B 3SU6A 1G36A 2Z3EA 3UFAA 2ZDAH 5HM2A 5FCRA 1ARCA 1SSXA 2OXSA 1Z8JB 8LPRA 1MTSA 3OTPA 1RTKA 1YBWA 1ZJDA 1AGJA 1FJSA 2C90B 2EC9H 1ZHMA 3TJVA 3VXFH 2A4GA 2PP6A 2RDLA 1CBWB 2P3TB 3T27A 1DWEH 1Y5BT 4MLFB 4CRCA 6LPRA 3BTTE 1W12U 4NZQA 1GHXH 4A1VA 1EPTC 3Q77A 3MU8A 3RXTA 1EOLA 1FX0B 2HWLB 1O5CB 1EP6A 1SHYA 3LC5A 1AY6H 1V2OT 1CHOF 2SFAA 3FOAA 2ANMH 5GNDA 1LHGH 1YWUA 1ZSLA 1V2KT 3MU0A 2JETB 1UHBA 2SGEE 3E16B 3UY9A 1ZRBA 4CRDA 4BXSA 3UUZA 1W2KH 5HGGA 2ODYB 3LGUA 5AHGH 2K1QA 2HNTC 3BF6H 1TGSZ 1ZPZA 1FY1A 3GCTF 2TGDA 2F43B 1DSTA 1OWEA 3BG4C 2FM2A 4XD7D 4BNRA 1GG6B 1T8OA 1GMHG 2J98B 3RU4D 5FXLA 1HPGA 5F03A 1DX5M 1W14U 3F0OA 1P03A 3T25A 3UREA 1TRMA 1GMCF 2ZTXA 4XBCA 2GJGA 1C5WB 3GISB 1QQ4A 3SGQE 1Z1JA 5AF9H 1X7AC 1S0QA 1PFXC 1KXAA 2W3KA 1K1JA 2H1UA 3N99A 1K28D 1Z8RA 4WY3A 1HGTH 2EI7A 2FIRH 5FBEA 1AVGH 1T4VH 4Y0YE 2F9VA 1KXEA 4B71A 4ABGA 2ZPQA 2GTBA 3VB5A 1SQAA 1GHZA 1BMNH 1SI5H 1FUJA 4I8HA 1FY3A 4ISHH 2ASUB 3K65B 3MO3A 4Q80A 1K1LA 2CJIA 2L74A 5EGMA 1SG8B 3OY6U 2ZTZA 2ZFSA 1YLDA 1AE5A 4NFEA 1P06A 1O2SA 3BIUH 1BTUA 4YT7H 3ESTA 3F9FA 1Z7KA 2ZP0H 3SQHE 4X8VH 4Q7YA 1XXDA 3F2HA 1SPJA 1GDQA 4D7GA 2P95A 5FPSA 4E7RG 1MQ6A 3SV6A 2Y82A 1JIMA 2VU8E 1WSSH 2J5UA 2EI8A 5TCCA 1KY9A 1AB9B 1V2UT 2GCTB 2CF9H 1YPEH 5JPMH 4K69A 1ZOMA 3BTQE 2BHGA 3DSGA 4LK4A 3UB0A 1O39A 1UK4A 2W6JD 1C9PA 4GAWA 1NU9A 3P8OA 3PYHA 3TK9A 2XBYA 3M5NA 1ABJH 1P2QA 2PTNA 4U01A 1IOEA 4A6LA 1LHDH 2JKHA 3EE7A 3T29A 1O2QA 1XUGA 3ZIAD 1N6YA 3KEEA 2G52A 1GHAG 2J34A 3PV4A 1MUEB 3VG8A 2ODQA 1E79D 4WMEA 3LGVA 1JOUB 1KXDA 2YNBA 1HAHH 1O5GH 2VBCA 1SHHB 3TLOA 2Z94A 4ZMAH 3SU5A 1O5FH 3SNDA 3PLPA 3A8DA 3ZVEA 1NPMA 4FETA 1O5AB 2B9LA 4KTUA 1C2IA 2D8WA 2Z9IA 4ABIA 5A8YA 3QO6A 1M9UA 4E05H 1GCTB 1A0HB 1V6DA 1EJNA 1UTMA 1MKXH 3U8OH 4LXBH 1ESAA 3D65E 1GHVH 1O3DA
chains in the Genus database with same CATH topology
3Q3XA 4Y8YA 2H9TH 1V2PT 2OC1A 3ZVAA 1KXFA 5E2PA 5G4BA 4VGCB 4ABFA 2VIVA 1O2GH 4MPVA 1A4WH 1QURH 2ANYA 1P01A 1WTGH 2ZQ1A 3UOUA 2AIPA 3SO3A 2HNTE 1SFQB 1MQ5A 2WYJA 4YTAA 2ZDVH 5GJ4B 3RXKA 5C3NA 1L0ZA 1Z71A 2SGQE 3BEFB 2TPIZ 2WUCA 1THSH 1O36A 2PSXA 4KTSA 4TWYA 1K1NA 3UPEA 1AVWA 4Q2KA 2HNTF 4ZKOU 4FUDA 1THPB 3MWIU 3GICB 1JWTA 3TGJE 4NCYA 1GDNA 1C2MA 4ABHA 4OS4A 4DIHH 4MNYA 1UVOA 3SOSA 4AN7A 1MTUA 4B2BA 3LOXA 1QL9A 5GCHG 1ZMLA 1L4ZA 3M61U 2XBVA 2A2XH 1HYLA 3SGAE 1P2JA 4X1PU 3A7YA 3TVJB 1SOZA 4GCHF 2O8MA 3GCHB 3T62A 1O2JA 1GBAA 2KAIA 1ETRH 1S0RA 1GMHF 3FANA 3SU3A 2FS9A 3PROA 3RXSA 1FPHH 2FEQH 1TBZH 1J9CH 2QA9E 2FOFA 3RXAA 3U8RH 3NKKA 2BQWB 3F9GA 1O35A 1GBLA 1LVYA 1ORFA 1VCQA 1LKAA 2RG3A 1CT4E 2Q1JA 1XM1A 4AGKA 7KMEH 3MI4A 3F9EA 2NU1E 1BB0B 1UVTH 3Q00A 2ZI2H 1WV7H 2GDDA 3HGPA 3C1KA 5L6NH 2OCVB 3H5CB 3P17H 3E3TA 2AFQB 2NWNA 3RXOA 1ELEE 3RC6A 3ZZ5A 3FP6E 1QB1A 2TRMA 1QHRB 1J17T 3ENSB 1MZAA 1IQMA 1LPGB 2GVFA 1W0YH 3RXMA 4NIVA 1G3BA 1O3KA 1GJ5H 2PUXB 2SNWA 2GX4A 3SUEA 5I25A 1ZLRA 7GCHF 1S6FA 5T6GA 1SGCA 1C5OH 4JYTA 1H9LB 1Z6JH 1BRAA 4YZUA 2FOEA 1JIRA 4CREA 1O3OA 2VH6A 5CMXH 3GYLB 4UEHH 2RCEA 1WYKA 2GV6A 5F6MA 4DIIH 1E34B 3FFGA 4UFDH 3A8CA 1MD8A 1AFEH 1EUFA 1G3EA 4GVUA 1SL3A 2HOBA 2PKAB 3T2NA 5EXLA 3TH3H 1YM0A 1FY5A 3I78A 4Q7XA 2AMDA 4KTCA 1C1PA 3ZZDA 2HGTH 3UQVA 4IW4E 1GHAF 1CHGA 1BRCE 2BVRH 4NZLA 5EQQA 4BTTB 3RXGA 3E1XB 4R8TB 2BVSH 1B0FA 1BTPA 1PPZA 1Z8GA 1W8BH 4FU8A 1OP0A 2I6QA 1P9UA 1AHTH 1J16A 4I31A 2D26C 3UR6A 1BA8B 1PQAA 1HRTH 2V0BA 4MNVA 3BTFE 3BTME 3HKJB 1NESE 2VINA 2OC7A 5FX6A 1CSOE 1C5SA 3W95A 1TONA 1O2WA 1ETTH 3ZYEA 1OPHB 3MO6A 4UONA 1FZZA 1DICA 1PPFE 1GJ4H 4MTBA 1UK2A 3O8CA 1DPOA 2ZF0H 2OBQA 1DY8A 1P04A 1QA7A 4JCNA 3NXPA 4OS5A 1IQJA 5GWZA 2F9PA 4GLYA 2UWLA 5CHAC 2BD8A 4FVDA 1YF4A 1MKXK 4MDSA 3SNBA 4WXIA 1XVOA 2EA3A 5FX5A 2ZU2A 4RKJB 2DE9A 2C93B 3CP7A 1EAWA 3T28A 4O03A 3A7WA 5TJXA 1A7SA 1UVPA 4O97A 5EG4A 1GI3A 4YOGA 2P94A 1SGNE 1O30A 5E0GA 1G37A 3EA7A 4TY6A 2BLOA 1ZTKA 2FX4A 3E6PH 3RC5A 5C2ZA 1GI4A 1AB9C 1AFQB 1L1GA 4ISOA 1DWDH 2GCTC 2OQ5A 1GVLA 1BTZA 1NT1A 3VXEH 1XKBC 3OSYA 1A5HA 4FUHA 1OYTH 4ISIH 2BXTH 3FZZA 1UHBB 3SJ8A 3U69H 1EP5A 2DE8A 4Y79A 4MPXA 1MTNC 1OXGA 2GZ8A 3A7TA 1CU1A 5EXNA 4MPUA 1TOCB 3UIRA 1UTOA 4K1EA 1IQIA 2J92A 1IQFA 4FUEA 2ZHWH 2BDGA 1AWFH 4YT6H 4FUGA 4ZKNU 1GMDG 1HAVA 4NWKA 1BTYA 3M37A 2GZ7A 1T8NA 2A7CA 3S9CA 1IQKA 1C1QA 3PO1B 5EXMA 2I6SA 2XW9A 3A7VA 1MCVA 3FZDA 1GBJA 3ZZ4A 1BJVA 2QXHA 3A87A 1P57B 2B7DH 3B9FH 1SGEE 4NWLA 5C1YA 1DWCH 2ZGJA 4VGCC 5AFZH 3ZV9A 1J14A 1EKBB 2AGEX 4TPIZ 2OTVA 2WV5A 3EDXB 1HAOH 1UTNA 2A4RA 1GHWH 1BITA 4GHTA 1PYTD 1GJCB 3KQCA 1C1RA 3TU7H 3GY5A 1C5PA 5L30H 4DVAU 1XUFA 3EE0B 4Y11E 2H6MA 1XMNB 3KN2A 1NU7B 1O3EA 1G3CA 1HAYB 4IMZA 1MAYA 3NZIA 3P6ZB 1L2EA 1E0FD 2J9NA 3A8AA 1YKTA 3MNXA 4Z0KA 2VIPA 3L3TA 1GHBG 1GJ7B 1WAYB 2ZO3H 1SQTA 3RMNH 4XOJA 4CHAC 3SV9A 4DW2U 1OWIA 3H7OA 2BXUH 1LVBA 1CVWH 1EPTA 2ZU5A 4O3TA 3Q76A 3ZZBA 5E2OA 1AWHB 5E0JA 1AI8H 2BY6X 1C5QA 3E8LA 4X1NU 1ZSKA 8KME2 3M5OA 1NRRH 1B0EA 5FBIA 1BMLA 2J95A 4FUJA 4X2XA 1QJ6B 3VGCB 1DXPA 4FUCA 5JBAS 1NM6A 3RLYH 1A61H 1K21H 1O0DH 1QBVH 2ALPA 3T26A 3MU1A 5L2YH 4GHQA 4NSYA 1V2QT 2Q6DA 1O2VA 3WY8A 2NU3E 1SGFG 1FV9A 3H7TA 2F83A 1OSSA 1D6RA 1GI8B 3MMGA 3SJ9A 1F5KU 4IN1A 4ZHLU 2WPIS 2GCHG 2Y5HA 5DKMA 3TIUA 1QJ7B 3QX5H 1ZZZA 1QJ1B 3RXHA 1N8OC 4XFQA 2UWPA 3ATLA 3KGPA 4AG2A 1ZTJA 1P2OA 4BANB 1TRNA 3PTNA 1MBQA 2VH0A 1JBUH 4Y6DA 1OS8A 4YM9A 2FOMB 4HGCA 1D3PB 1SLUB 4THNH 5LGOA 3R3GB 3SUGA 4A1TA 1GJDB 6CHAC 1TOMH 1K1OA 2GMTC 2XXLA 2OC0A 3GOVB 5DG6A 2PTCE 2EI6A 4X0WU 2BQ6B 3BTKE 4D9QA 1GL1A 2R2WU 1AQ7A 1NFUA 2PKSC 1C1NA 1TRYA 5DP4A 4K8BA 4NSVA 3VB3A 1C2EA 1HJAC 4IC6A 3RC4A 3BTEE 1ANEA 2QV1A 2VB0A 3SJKA 3ZZ6A 1O5BB 1Y5AT 1Z1IA 1FIZA 1HLTH 1HNEE 1WQSA 2W5EA 3V13A 2BLVA 2AIQA 1C4Y2 1A5GH 1LDTT 1C2JA 1C5XB 2CHAB 3LGYA 2ZCKP 2AYWA 1S84A 2XWAA 2RA0A 5PTPA 2V35A 2CGAA 1ELGA 3O8DA 5ETXA 3RXJA 4JK6A 3E90B 1A1RA 4ZHAA 1ETSH 3D62A 1Q3XA 1IHTH 1HIAA 3B8JA 1ESTA 2KAIB 2VWOA 5EU8A 1GMDF 3MHWU 1T8LA 1F7ZA 1O3HA 3V7TA 1UTKA 1SGIB 2FI5E 1BTHH 1H9HE 1OWKA 2JH5D 1C4U2 3AVZA 1IAUA 3EA9A 1WBGB 4ABEA 5IDKA 3M3VA 5BPEA 1RGQA 2FDAA 5FAHA 1DE7H 3ZZ3A 4X2VA 2H5DA 5H4IB 3TH2H 1KXCA 2PLXA 2BD9A 1NRSH 2B5TB 2R0KA 4K3JA 4AFSA 1TA2A 1U6QA 2ALVA 2CF8H 3URCA 5IYTA 2OUAA 1OOKB 1BT7A 1MH0A 2OC8A 3UWIA 2BYAX 3MU4A 4GUXA 2ZFTA 4X6MA 3CS7A 1GJ9B 3SHAH 1TB6H 1RXPA 3AAUA 3S69A 2VIOA 2XCFA 1C1MA 3M5LA 5T6DA 1GGDC 1P10A 2FESH 2O8WA 3RDZA 1XUJA 5A09A 1ELDE 1GL0E 1QNJA 1JRSA 4WVPE 1TGTA 1W7XH 2VIQA 2Z9JA 5FCKA 2ZHFH 3B23B 2A5AA 3VB4A 3BEIB 1J8AA 2VGCB 2ZKSA 1O2RA 3S0NA 2J2UA 3TITA 3GDUA 2FS8A 4X2YA 5FHTA 2BY9X 1P12E 2ZC9H 1TA6A 1LMWB 1KSNA 2ILNA 1S81A 3PWCA 1F5RA 1NTPA 3NUMA 3BV9B 5EW1H 3P92A 1O2UA 1CA0B 1RRKA 1QFKH 4A7IB 1FNIA 4BAHB 1QCPA 3VB6A 3GY3A 1ELBA 2BZ6H 1CO7E 4WMFA 1BMAA 1IQGA 1PPCE 2GKVE 1K2I1 4O9VA 2FOCA 1RIWC 1HAXB 3S9AA 1G9IE 4INLA 4JZDH 1O34A 3S7HB 2AGIX 3P8NA 1YCPK 2ZPRA 1E35B 5FPTA 3FVFB 4K5ZA 2SGFE 5EPYA 2WYGA 4FUFA 1V2TT 1MU6B 3PO1C 2GCHF 1AD8H 1ZGIA 3LIWA 1W7GH 4XBDA 1BTWA 3OU0A 3RMMH 3SUFA 2F91A 4CBOA 1AUTC 3PLBA 1GI1A 1TPAE 1WUNH 2BLQA 3P95A 2QXGA 2QAAA 4FVBA 1O3NA 3VPKA 1ARBA 1EZSC 1MKWK 4OS6A 2XC5A 3HKIB 1FLEE 1V2ST 2Y7XA 4Y8XA 2R3YA 1VR1H 2G5NA 2FXRA 4HZHA 1C5VA 4UFFH 4X1SU 4CR5A 3IG6B 1TQ7B 1QTFA 3AAVA 2HRVA 4AZ2B 5A2MH 1O3AA 1EQ9A 2QXIA 1O3FA 1AN1E 5DK1A 1AKSB 2YNAA 1C1WH 1NS3A 1EATA 4O3UA 1T7CA 1AMHA 1TNLA 5JDUB 1EX3A 2P8OB 5F8XA 3A7XA 1EOJA 1TPPA 2BM2A 4JZ1A 1EB2A 1O32A 1YPLH 2Z6BD 2A4QA 2IPHA 3HATH 1D3QB 2SGDE 4XBBA 1HAZB 2M5TA 1LHEH 1AVXA 2ZNKH 1FQ3A 1TAWA 1K22H 2ZQ2A 2D2DA 2O8LA 1TX6A 2XBXA 3QZQA 1P11E 3VGCC 2ZGHA 1LHCH 1D3DB 4X8SH 3QTOH 1Z6EA 2FP7B 1ELTA 4I32A 1C1UH 1UJ1A 3BTDE 4D76A 1GBFA 3QLPH 5C5NA 3SQEE 3HPTB 4WH6A 3A84A 1ELAA 1C1VH 4B76A 1B5GH 5EOKA 1NFXA 1KLJH 2P59A 3M7QA 3RMLH 5LPFA 1AU8A 4TWWA 2ZHQH 5K7RA 1T31A 1TNKA 1WCZA 2FI3E 1C2DA 3KIDU 4Y71A 4DY7B 1C1TA 1O3MA 1ZSJA 3QGNB 1O2ZA 4I8KA 2BX4A 3ZZCA 3SORA 4ZHMU 3KCGH 1MU8B 1PQ7A 2P93A 2ZA5A 1EZQA 3V3MA 1CT2E 4DJZB 3K9XB 2FYRA 1JRTA 5TCAA 1IQEA 3RXUA 1MMJN 2ZWLH 1TGBA 1C5YB 1IHSH 4UFGH 1CBWC 1CGIE 1O2MA 4UD9H 3AW0A 3KF2A 3RM0H 3EAJA 4X2WA 9LPRA 3SHCH 1UTLM 1YC0A 4I7YH 1BHXF 4BAQB 2A1DB 4JYVH 1BBRK 2R0LA 4AFQA 3Q3KA 3LGIA 3M5MA 1ABIH 1SFIA 4BAKB 1W10U 1ELVA 3MTYA 3ZZ8A 1QA0A 3MH5A 3STIA 1NROH 2BY5X 2AGGX 4A1XA 1EPTB 3FP7E 4IC5A 3UTUH 2BTCE 6GCHG 1VITG 4UDWH 2JETC 2CHAC 1HCGA 1LPZB 2HLCA 4ZUHA 1G30B 3P70B 3S9BA 2FX6A 3TNTA 2BZAA 3URDA 1ANDA 1TFXA 3M3SA 2PFEA 2ZDNA 1TMUH 2ZEBA 2C8WB 2ZFPH 2F9UA 2R3UA 3GY8A 3U1IB 1EASA 1GG6C 2BY7X 1O38A 4DG4A 4ESTE 2OP9A 1O3BA 1BCUH 1LTOA 1A46H 1OWDA 2H9HA 3P8GA 1TX7A 3L6PA 2GT7A 1RFNA 4AORA 4A92A 1CQQA 1JXPA 5GDSH 1O2TA 3EA8A 5EQRA 5A8XA 4YOIA 2ZU1A 1W11U 1ZYOA 1HXEH 1ZGVA 4IMQA 2C4FH 3SU1A 3UNRA 4B73A 1Q2WA 1E36B 1GI7B 4B2CA 2D1JA 2PHBA 4FUIA 3PMAB 2WPHS 1O37A 1E38B 1V2VT 4B2AA 2O9QA 2VWMA 5LPEA 2XNIA 5L2ZH 1GJAB 3DUXH 3LH1A 1TIOA 1WOFA 1PPHE 3HGNA 4BXWA 2FODA 2QF3A 1ZHPA 1GBMA 3QK1A 1Z8IB 2BDIA 5C1XA 1AZZA 5DPAA 2F3CE 2GGVB 1DITH 1HAIH 5B6OA 3GYMA 1O2XA 2PSYA 2XCNA 2UUJB 3DA9B 2QCYA 3SBKA 3TH4H 1SQOA 1MTWA 3BG8A 1VCPA 8ESTE 4JZFH 2XYAA 4U30A 1QB9A 3ODDA 1MBMA 2UWOA 4FU7A 1CGHA 1HJ9A 1UK3A 2BLWA 2UUKB 3A82A 4INHA 2G81E 5GCHF 5A0CA 4Q7ZA 1IQHA 1OKXA 1TNGA 4NG9H 1EAIA 3SGBE 1XKAC 3RXRA 1T8MA 3E0NB 5DP5A 1DT2A 2A2QH 2BOKA 3ATKA 3BTHE 1OYQA 1S83A 2UUFB 4SGBE 2J38A 2ZDMA 1HIAB 3LJJA 3SN8A 2WPKS 3HK3B 1PYTC 2STBE 3W94A 1DDJA 3SW2B 1FONA 1TX8A 3P8FA 2PWXA 4JZIA 2JH0D 1GCTC 4Y7BA 2VVVA 2ZU4A 4CBNA 4WH8A 4ZXYH 1O3GA 2WPLS 2GD4B 2QYIA 2Q6FA 1FAKH 1BOQA 2PGQB 4DGJA 4BAOB 2FZZA 3IITA 1C5RA 4IS5A 3QUMP 3TJUA 4CRBA 2A7JA 2OQUA 4ZKSU 3ZV8A 4YOJA 2P3FH 4Y7AA 1C5MD 2ZFFH 3ZYDA 1L1NA 3KL6A 4CH8B 2GZ9A 1ID5H 5BRRE 2ZU3A 2PV9B 4ZKRU 4K1TA 3ZVBA 4YLQH 3LDXH 3LPRA 1SGFA 4MPWA 1C2LA 4X6NA 4AB8A 1H9IE 1TGCA 4MVNA 2ZTYA 1TBQH 2BY8X