1O2OA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2oA02
2Y5FA 3UOPA 4D8NA 3BTFE 2BXUH 3F9HA 2OQ5A 3SUDA 1TGSZ 3ZZ7A 1GJ6A 4DURA 1GMHG 1MD8A 3RXBA 4NIYA 1IQGA 2V6NA 3ATMA 3K65B 2BXTH 4H6TA 1PPGE 2BY7X 4FVBA 3MO6A 4Y10E 4UD9H 2A1DB 1S82A 1EB2A 1FQ3A 4E05H 2OC7A 1C2GA 1TGTA 4ZKNU 4DY7B 3P8GA 3SHCH 1TLDA 1BA8B 5A8ZA 4AG1A 3SNDA 1ANDA 4LXBH 4TWWA 1GGDC 1GHVH 1G36A 1K28D 1SOZA 1TX7A 1KIGH 5PTPA 3PMAB 4A1XA 1QA0A 1UVTH 1HRTH 1UTMA 2F9BH 1EATA 1XXFA 1EAWA 3M5NA 4R8TB 2BY6X 2ULLA 2SGAA 1O2GH 3ZZ9A 4OS5A 3URDA 4ABDA 1N6YA 1T32A 1S0RA 1VCQA 3PWCA 4Y8YA 2STAE 4AYYB 3BG4C 3ZV9A 2QN5T 5F8XA 2ZFPH 1NROH 2XRCA 4OS1A 2SGDE 1SGRE 3GICB 1VCWA 1ZSKA 3H7TA 1ZZZA 4JMYA 3QZQA 1P12E 3K9XB 5F8TA 2PTCE 1RXPA 2BVSH 1HAHH 2P3UB 1GVLA 2J95A 4X1SU 3FVFB 1A0JA 5E0GA 2J9NA 1SLXB 5DPAA 1GDQA 4TYDA 1K9OE 3RC5A 2ODPA 1V2ST 1DLEA 1SFQB 1OPHB 4Y8ZA 1ZR0A 3NPSA 1W11U 1C1VH 1NN6A 4UONA 1JRSA 1UVPA 2FTLE 1HJAB 3UPEA 4E7NA 3Q3KA 1C5PA 1J14A 5I46H 1OWKA 1GI1A 1AHTH 1IQMA 1MCTA 2BHGA 2P95A 5E2OA 1C1TA 1Y5BT 5A8XA 3UWIA 3GDVA 3TK5A 4YT7H 2ZKSA 4ZKRU 3UUZA 4I8LA 3ZV8A 3GYMA 4ABIA 4DW2U 1RGQA 2YNBA 3RXUA 1FY8E 3UIRA 1SC8U 2O8TA 4WH8A 3VXFH 1AU8A 3T26A 3O8BA 3PV4A 4GCHG 4AGKA 1K1MA 3D49H 1Z71A 1EP5A 1PPHE 1O3DA 2BD3A 1KLIH 3U8TH 1W7GH 2CHAB 2Y81A 3ZVEA 1HAGE 2J34A 2ZFRH 2NU3E 4ZXYH 3PYHA 3U8RH 3S0NA 1E37B 2H5DA 1TRMA 1RJXB 1OXGA 1C5VA 1GHXH 1SGNE 3VGCB 3KQEA 1O36A 2FOBA 1TGCA 2XBVA 1DWEH 5EG4A 3S9CA 1MBQA 2VVUA 2HPQH 2Y7XA 2FX6A 3IWMA 4MDSA 2F91A 1SB1H 3H5CB 8GCHF 3TGIE 1BRCE 1F2SE 2FYRA 3MO3A 3VEQB 3SQEE 2BDHA 4X8TH 2F9OA 5DP4A 5FX5A 1IQNA 4ABGA 3RM0H 6GCHG 2A5KA 3KQBA 1UK3A 4I31A 1HB0B 3MH4A 2HALA 5K7RA 3UNRA 1O30A 1EOJA 2ZDNA 3TNSA 1BCUH 1B0FA 4Y11E 3M7UA 1GHAG 4WMDA 2R9PA 5SGAE 2FLRH 1BJVA 1GHBF 2GCTB 4BNRA 2ZHWH 1ZPBA 3RXVA 3LPRA 1QB9A 4NGAH 3ZZBA 3EYDA 1P03A 3EA8A 1S83A 3SW2B 5LH8A 1BRAA 4NWKA 4AOQA 5LGOA 2A32A 5A2MH 1S6HA 1WAYB 1SGFG 1NRQH 1P2IA 2Z3CA 1FUJA 1WSSH 2PUQH 3BTTE 3SNEA 4XBDA 4SGBE 1NRNH 3GCTG 3A83A 3BTWE 3K6YA 4O3UA 1FONA 2STBE 3T62A 2GT7A 2BX4A 4QT8C 4JZ1A 1O2ZA 2XC4A 3OU0A 4JZIA 1GJ4H 1FPCH 1TFXA 2R3YA 5DP3A 3PO1C 1KDQA 3PLPA 2TGTA 2ZI2H 1BIOA 1NFXA 2SNVA 1YGCH 4Y8XA 1EB1H 3U98H 2O8WA 2PHBA 1FJSA 2GV6A 4FUBA 4NIXA 5EPNA 4ABJA 2BOHB 1V2OT 4X2WA 1GBLA 3BEUA 5DKMA 1ZTLA 1SOTA 1W13U 2BD7A 2ALPA 1F0TA 1RS0A 1V3XA 4WWYA 1VGCB 1G30B 1AVGH 2G4TA 1T8MA 2FYQA 1VCPA 1QJ7B 1MQ5A 2HNTE 1K22H 3MNXA 3RXPA 3M3SA 2F9UA 1QNJA 5TCAA 4VGCC 4MPXA 1C1OA 2HNTF 5GCHF 2FXRA 4UE7H 5L2YH 1T4UH 1ETRH 4BANB 3MI4A 1O32A 2C3SA 2J94A 1RRKA 3LGWA 2Q6FA 1U6QA 4UFEH 4TWYA 3A81A 3ODDA 1UK4A 2BZAA 2OC1A 1DANH 1TYNA 3RXTA 4KELA 1SGEE 3GY6A 2Y80A 1NFUA 3ZVCA 4U2WA 1MTNB 5C5NA 5BPEA 2A4GA 4ISNA 4OGXA 3GY7A 4CH8B 1QIXB 1GCTB 1TNIA 1Z6EA 1K1IA 3M3TA 4IGDA 4U01A 4B1TA 1O2KA 3ZZ5A 1OYQA 2W5EA 2WYGA 1Z1IA 3FP7E 1T7CA 1W2KH 1OWDA 4X6OA 1G3CA 1DVAH 1P02A 1PQ5A 1E34B 5E0JA 8LPRA 3ZVFA 1P2MA 4ZHMU 2RCEA 2FMJA 2BVRH 1DUEA 4J2YB 1ELFA 4WY3A 2B5TB 4K1SA 1FV9A 1SFIA 1TBRH 2RA3A 4NA8A 4Q7XA 3OX7U 2HLCA 4GHQA 3F9EA 4FU8A 4DOQA 1V2LT 4KKDA 2PKAA 2BDAA 7GCHF 4XSKU 5ESTE 1UTLM 1VZQH 5DP9A 3L3TA 1CA0B 3NWUA 4F49A 6LPRA 1O34A 1C2LA 1O3NA 5JBTA 4E06H 4JYVH 1K1OA 1VR1H 1O2QA 3RXFA 3UR6A 4K2YA 1BB0B 2W3IA 1TPAE 1ESTA 1DXPA 5AFZH 1HXEH 1A0HB 2PLXA 1CU1A 1ESAA 4MNXA 3LJJA 3SOSA 1YPHC 1YLDA 4FU9A 1BTUA 3MYWA 2NU2E 3RXIA 1O2TA 3A87A 2J4IA 2FLBH 4CRFA 3MMGA 5E8EH 5FBEA 1GBDA 3SV9A 1CE5A 2BLOA 1RIWB 3BG8A 1CGJE 1K1JA 2QV1A 1EJNA 3A86A 3LH1A 1SGTA 1RTKA 1MKXH 1TRYA 2GCHF 2AERH 1JRTA 3G01A 1LQEA 3CS0A 1E35B 1O37A 1MTWA 2YOLA 3JZ2B 1ESBA 1D3TB 1FAXA 5DP7A 1C5WB 2BQ6B 1CSOE 1MUEB 1BBRE 3BTME 2ZHQH 1DY9A 2FZZA 2VWNA 1GG6B 3K6ZA 1HIAB 4D7GA 1TPSA 4KP0A 1ZSJA 1MU8B 2OUAA 1GI2A 2ZCLP 4ISOA 1Q2WA 4ISLA 3SU4A 2Z3DA 3M37A 1GBTA 4NZLA 1EPTB 3P6ZB 4BAMB 3U1JB 1QQUA 1GPZA 2QF3A 2YNAA 1NESE 3MO9A 2GGVB 4ESTE 2OBQA 1SLUB 1P2JA 4AFZA 1S5SA 1QL9A 3GCOA 2TIOA 4R0IA 4BAKB 1K21H 1J8AA 1TABE 5AVDA 4Z6AH 4YO9A 3HGNA 3D62A 3JZ1B 3SI3H 2XYAA 3VB4A 2FS9A 1G32B 3NCLA 1UO6A 4K69A 3LONA 1GI5A 1P0SH 4NWLA 5C1UA 1C5XB 1XUKA 2GZ8A 1ZHRA 2ZU1A 2P94A 3E6PH 3SI4H 2GTBA 3E91A 1UHBB 4FXGH 2ZQ2A 3ZZAA 1ZGVA 1OP8A 3QLPH 2HGTH 2A7HA 2ASUB 3A7TA 1ZSLA 2EA3A 1N6XA 1WV7H 4WJG2 4JZDH 4AX9H 3GCNA 4GPGA 2VIWA 1LTOA 4INLA 4X2YA 4D9RA 3TK6A 1XUHA 3KEEA 4AB9A 1O2IA 3L6PA 1YCPH 3TH3H 1GMCG 1HXFH 1SBWA 1ANBA 1KLTA 1HIAA 3PLBA 1P05A 1HFDA 3EE0B 4ABAA 4GLYA 4AYVB 1XUGA 3VB3A 2BY5X 1MU6B 1L1NA 2C4FH 4K3JA 2F83A 4TY7A 5TJXA 9ESTA 1KXFA 1EPTA 1BUIA 1C1QA 1GJAB 1BRBE 4X2VA 4GUXA 2H6MA 2NU1E 4WVPE 2FOMB 1FXYA 1SGYE 2EI6A 5AFYH 1TPPA 2XWBI 3VFEA 4Q2KA 1YC0A 1JMOH 4HGCA 5EGMA 1K1NA 3MU5A 1GGDB 3F9FA 3A7WA 3RXRA 1O2VA 4Y79A 4DIIH 1LHEH 3QX5H 5L6NH 4Y0YE 1KXEA 2PV9B 3GYLB 4I8HA 1F5LA 1HAXB 3UY9A 4ZXXH 1TA2A 1D4PB 3MNSA 2JH6D 1A46H 2GMTC 3MH7A 1UHBA 1V2NT 1Q3XA 3ESTA 3LJOA 4IW4E 2BLQA 1FY4A 1WOFA 4TPYA 4HTCH 3VB7A 1MTUA 1PPBH 4YESB 4ZROA 3BSQA 2FI3E 3U9AH 2CF9H 2VIDA 4WF8A 3A7VA 1O3AA 1OP0A 3BG4B 2A4OA 2BDIA 2BYAX 3Q77A 5LPFA 3W95A 3F6UH 4X0WU 3NZIA 2BZ6H 1JBUH 1O33A 2FOAA 2BDCA 2QXGA 2ZIQH 1C5TA 3FAOA 5FAHA 1A61H 3SZNA 3ZZCA 3RXQA 1ZGIA 3LKWA 2OC0A 1X7AC 1Z8RA 2JETC 3NKKA 4X6MA 1A3EH 5T3HA 1EKBB 2EC9H 1C5UA 2ZWLH 1DS2E 1QJ1B 2BQ7B 1LPZB 1NRRH 1QA7A 2VB0A 2Z6BD 2ALVA 3V3MA 1AB9B 5DP8A 3RP2A 4DCDA 1H1BA 4MPUA 1GVKB 1HAIH 4K8BA 1ELTA 1HJ8A 3TH2H 4OGYA 4XBCA 3FZZA 1CQQA 1GI7B 2ZA5A 1JXPA 3D23A 3MH5A 4XFQA 1GI4A 1NU7B 2A31A 1BITA 1V6DA 3HGPA 1ARCA 2ZEBA 1G37A 1DLKB 1W7XH 4HI3A 1O3JA 1VITG 1KXAA 1LVYA 3HKJB 4K1TA 2ZFSA 5HMAA 5K0HA 3P8NA 2ZCHP 3GY5A 4IN1A 1A3BH 3KGPA 2QIQA 1AKSB 2P8OB 4B75A 2VGCC 2WUBA 5IDKA 1KLJH 1O5CB 1MAXA 1OYTH 1B0EA 2GDDA 3M7QA 4LOYH 2IJOB 2K1QA 3MOCA 2A4QA 2BLVA 3IITA 5EPYA 3SUEA 1YBWA 3RM2H 1O31A 2BX3A 1Y5AT 5EXMA 4DIHH 2FESH 1BT7A 4AFSA 1EAIA 1BTHH 1Z8IB 3LC3A 1SSXA 4LZ1H 1FI8A 2CXVA 2CF8H 1Y3VA 5JB9S 1AY6H 3L33A 2FS8A 5JYIA 1TNLA 4ZMAH 5J4QA 3BIUH 4AZ2B 1G3DA 1ZMNA 2XXLA 3O8CA 2Z9KA 1TOCB 2HPPH 3SNAA 2Q1JA 2ZFTA 3SJOA 1LMWB 1L1JA 4Y7AA 1DUAA 1HCGA 3RXJA 4BXSA 5C67A 5F6MA 2BDBA 3AW0A 4A1TA 3VXEH 1MKWK 5JBBS 1UCYK 3GISB 2AGEX 1W3CA 3Q00A 1F0UA 5GIBA 1CVWH 1ZPZA 1TNGA 2I6SA 3V7TA 1O5FH 4O3TA 1DSUA 3B8JA 1C1PA 2FDAA 3SNCA 1BMAA 1QQ4A 2NWNA 5CHAC 2XBWA 3LOXA 2OXSA 2FX4A 1F92A 1W12U 2EI7A 5C2ZA 4WXIA 2NU4E 3S9AA 4Z0KA 1C2FA 1P9UA 1GBHA 4CRAA 3EDXB 1AE8H 4CRBA 2PGQB 1O2SA 4DT7B 1NM6A 2WPIS 3SGAE 3D65E 2XCFA 4JCNA 2ZU4A 4B73A 1BBRK 4OS2A 4IBLH 2RG3A 1QBNA 1AFQB 3W94A 2H9EH 1FLEE 3UTUH 4X8VH 3Q76A 1DWCH 1F0RA 5E2PA 4CHAC 2H9HA 2HOBA 3ITIA 2BB4A 1ZYOA 2WUCA 1INCA 2QAAA 1QRWA 3E1XB 4B2BA 1OP2A 2OLGA 1TNJA 3KHVA 3LGUA 7LPRA 1WTGH 3IG6B 3LU9B 2THFB 3M36A 5I25A 1Y3YA 3DUXH 1AWFH 3MU1A 1EAXA 1ORFA 3ATKA 3UR9A 3RXDA 2ZFFH 4IS5A 1GWAA 1BOQA 1P04A 3SU6A 2TGPZ 2DE9A 2VVCA 2GP9B 3C1KA 1NPMA 4KGAA 3FP8E 1RTLA 2FI5E 1P3CA 1RD3B 3ATWA 3UFAA 1UTNA 2AH4X 4Y7BA 4I7YH 1RFNA 1E38B 2IPHA 3HKIB 1LPKB 3OTJE 1CT2E 1FPHH 1SPJA 5C1YA 5GXPA 3HK6B 5L30H 3GCHC 1YLCA 1PYTD 1ZRKA 3MU0A 1HAPH 2ZHDA 5ABWA 3TGKE 3V0XA 3UQOA 4I8GA 1T8LA 1Z8JB 5EXNA 4ZHLU 2PR3A 4MTBA 4AG2A 1ZJKA 1O2HA 1G3EA 4YLUA 3SU0A 1Z6JH 3DFJA 5GDSH 2XTTB 3A7ZA 2BDGA 1W0YH 1C2EA 2CHAC 1EZQA 3CS7A 4X8UH 3QWCH 1HJ9A 1JWTA 1HAOH 4KTCA 2XBXA 2W7SA 3GY8A 2OCVB 1O5BB 3RXOA 1L4DA 1DSTA 3RXSA 1K1PA 1YPEH 2ILNA 3UNQA 5DP6A 1W10U 2A45B 1VITH 5FPYA 1IQKA 5JDUB 1CT4E 3RXGA 1ZJDA 1SG8B 2ANYA 3ENSB 1O3CA 2UUFB 3FZDA 8GCHG 4WMFA 2Z7FE 1UMAH 2F9PA 4D76A 2W7UA 2G51A 2A5IA 1ABJH 2QY0B 1BTPA 1H4WA 2EEKA 5GJ4B 2G55A 3GOVB 2W26A 1H8DH 3Q3XA 1LHGH 1GJBB 2FOFA 3LIWA 1BTYA 1G2MA 4X1RU 4D9QA 2ZP0H 1QTFA 2PSXA 3EA9A 1O5DH 3KIDU 1BTWA 1CHOG 2ODQA 1N1LA 1MH0A 1TMUH 3FFGA 1YPLH 3K2UA 1GHBG 3U8OH 1NFYA 1P10A 2GCTC 1C2DA 2ZFQH 4RN6A 4LZ4B 1BQYA 2SGFE 1CBWB 2F9VA 1O3HA 3S9BA 1V2KT 4A5TS 1FN6A 2FOGA 3PTBA 2AYWA 1J17T 2BD5A 1AQ7A 2B8OH 1ZOMA 2VWMA 1ELBA 1BRUP 2J2UA 8ESTE 2WV4A 4MVNA 5A0CA 4DGJA 2ZO3H 1GMDF 3SU1A 4INHA 2G00A 3BTEE 3HPTB 3RU4T 3TIUA 2FO9A 2SNWA 4OS6A 2FEQH 1EP6A 1TRNA 2BQWB 1O2RA 1O3KA 1Y3XA 3MH6A 1PPCE 2ESTE 2ZGBH 3ZZ3A 1F5KU 3QTVH 1CHGA 5ETXA 1GCDA 2VWLA 3HK3B 1XM1A 2O8MA 2R0LA 1ELAA 2G5VA 1IHSH 1C2JA 2ZGXH 1NO9H 1YPKH 1DXWA 1BHXB 3TGJE 1SLWB 1V2MT 1BDAA 1HPGA 2FWWA 4CR9A 1W8BH 3TNTA 2XNIA 4XDEA 1O5AB 3LGIA 3RXKA 1O2PA 2ZQ1A 5DGJA 2Y82A 2A0QB 3M5OA 2VH0A 3AAVA 2VIVA 1VGCC 2Q6DA 3SU3A 3OY6U 6CHAB 1SHYA 1K2I1 2Z9IA 1V2RT 1AMHA 3T29A 4FU7A 1GI0A 5GCHG 3ZVGA 5JB8S 1TQ7B 5HYOA 3F1SB 1Y59T 1SQAA 2BD8A 5CE1A 1NS3A 1O5GH 4YTAA 1TQ0B 1GJ7B 3CENA 1OKXA 3AW1A 2ZC9H 1TNHA 1CT0E 1SQTA 1C1RA 1SGFA 1SHHB 2XBYA 2LPRA 1DDJA 2BMGB 2VH6A 1Z8GA 4X1PU 1EOLA 2GD4B 2BY8X 2IOTA 5G4BA 2P3TB 2ZDMA 4Y0ZE 3RXHA 3LDXH 1MTNC 2UUJB 1OWHA 1F5RA 1WQSA 1O2XA 2PSYA 2QXIA 1G2LA 1FY5A 2O8LA 2AFQB 1V2PT 3MTYA 5FPSA 3TITA 1HNEE 3TJUA 1P06A 3E90B 2PWXA 3GDUA 3M35A 1PJPA 2CV3A 4RSPA 4CBOA 1KTSB 4J1YA 4MLFB 3RU4E 1ELDE 1DPOA 2TGAA 2R0KA 2FOCA 1IAUA 1S0QA 1V2UT 3QK1A 3SBKA 3WY8A 3V13A 3GDSA 3OSYA 2ZDKA 1DWDH 1P57B 4AFQA 1O3BA 4BTUB 1WCZA 3QO6A 2A7JA 1V2TT 1C5RA 3LC5A 5C3NA 1NY22 4DJZB 3PMHB 3BTQE 3FP6E 2ZPRA 3CP7A 4BAQB 1AN1E 7GCHG 1EZXC 1G9IE 2V3HH 1NZQH 3ZVDA 4K1EA 4YOJA 1WYKA 1K1LA 3A85A 5DJ7A 4JZFH 1CO7E 2ANMH 1LPGB 4ISIH 4RKJB 2PGBB 1CA0C 2QC2A 1A2CH 3OY5U 1DFPA 4H6SB 2FP7B 4A7IB 2GMTB 4IC5A 2ZHFH 1AI8H 1FIWA 4Y6DA 1HLTH 4I33A 1SLVB 1DOJA 1T4VH 3E3TA 2WV5A 5FXLA 2D26C 2C8YB 2C8ZB 1LHDH 1EJAA 2ZU5A 1ACBE 1O38A 4JK5A 5E0HA 1A5IA 5EODA 2ZDAH 4YOGA 3O8RA 1ZHMA 4IN2A 1O3GA 1Y5UT 1C4Y2 3ZZ8A 1V2WT 1A5HA 3ZVAA 5A0AE 1H9HE 1O5EH 1MD7A 1C5ZB 2NU0E 4XBBA 7KMEH 1FDPA 1LHFH 3QUMP 2V0BA 4A1VA 1TPOA 1HAYB 1GI3A 1V2JT 2ZGJA 1O0DH 2C8WB 4X2XA 1RIWC 5EXLA 1GMHF 2GCHG 3QDZB 5A09A 1C9TA 1P3EA 3SNBA 4F4OC 3KN2A 4UFFH 1N8OC 2G81E 1M9UA 1T8NA 3T27A 4IC6A 1KSNA 2D2DA 2RA0A 1PPZA 1O2MA 4X1QU 4X6NA 1D3PB 1E0FD 5DP5A 1DICA 3PWBA 3SQHE 1PQ8A 1LKBA 1ETTH 1TALA 1KYNA 5EU8A 2R2MB 3C27B 3TJNA 3F9GA 1DX5M 1O3EA 2ANKH 3H7OA 1UTOA 1AIXH 2C93B 2QXHA 1MCVA 2FODA 2AIPA 2ZTZA 2ZNKH 5FPTA 3SHAH 1HAVB 3RXMA 2H5CA 4MNWA 5FCRA 3EA7A 2ZF0H 1B7XB 2QCYA 1JIRA 3QGJA 3M5LA 1YPGH 1LQDB 3RDZA 2DUCA 2TRMA 2D8WA 3MHWU 4NFEA 1D3QB 3TJVA 1GHYH 5AHGH 2Z9JA 1H9LB 1GJ8B 2A7CA 3I77A 3BIVH 1MTSA 3E0PB 1O2JA 2G8TA 3NK8A 2FOHA 1QBVH 3RMNH 4Y76A 2BDYA 2HNTC 1GBKA 7ESTE 1D3DB 2ZDVH 3OYPA 5J4SA 2VGCB 1O2WA 1PQAA 3MWIU 2IN2A 2GDEH 4YM9A 3S7HB 3BTKE 1SGPE 2GKVE 1BZXE 3SUGA 2P16A 1IQEA 1THSH 4GAWA 1EX3A 4K5ZA 1ARBA 1FY1A 1UTKA 3ZYDA 1TMTH 1SR5C 1QB6A 4LK4A 1O3FA 4B2AA 3SJIA 1PPFE 2CGAA 2B9LA 3A7XA 2PKSC 1Y8TA 3TH4H 4IMQA 1VJ9U 1TBZH 4X1NU 2WPHS 3DHKH 3ZVBA 5GWZA 3KNXA 1V2VT 2UWLA 1G3BA 3RC4A 2GVFA 1HAVA 3RLYH 4FUDA 1TNKA 1QGFA 2P59A 1LVMA 1A1RA 2OINA 1MMJN 4ZAEA 1GHZA 3VB5A 3QN7A 4GCHF 8KME2 3BN9A 4THNH 5CHAB 1FIZA 3RXEA 2FPZA 1T8OA 2M5TA 1GL1A 5CMXH 1SMFE 1XVOA 2A4RA 4MPVA 1O35A 1GJCB 4TY6A 3SGBE 5T6FA 1D9IA 1TB6H 5C5OA 5HGGA 2OTVA 2G52A 1YP9A 3RXAA 1PYTC 2PTNA 1IQFA 3TVJB 4JZEH 2P3FH 3PLKA 3LH3A 4ASHA 1QL7A 2Z9LA 1CGIE 1O3MA 1C5YB 1SQOA 1TX8A 1O2YA 1S84A 1GJ5H 1YM0A 1HGTH 4CHAB 3RLWH 4O97A 1QR3E 2BD4A 1UVUH 1ANEA 3E8LA 3UWJH 1SGIB 1RTFB 2H9TH 3FANA 6GCHF 4K60A 3A8AA 4A6LA 3O8DA 2ANWA 1O2NA 1XUIA 1L2EA 1BMLA 2A2XH 3DT0H 2G5NA 3RMMH 4YT6H 5EW2H 1MKWH 2ZECA 4E7RG 2V35A 1UCYH 1GHAF 3U69H 4NFFA 3DFLA 2GZ9A 4UDWH 1YPHE 3V12A 3UNSA 1AB9C 3LGVA 9LPRA 2GZ7A 4KTUA 1WTHD 4OS4A 5FX6A 4ABHA 2AGGX 2UWOA 2ZTYA 3GCHB 1UTPA 3I78A 3LGYA 1FAKH 3T28A 3Q3YA 4UFDH 1NC6A 3T5FH 1C1UH 4FUIA 3SJ8A 4X8SH 1IQIA 3P92A 1AKSA 1UJ1A 3A80A 1AO5A 1F0SA 1HBTH 1W14U 1YPJH 3MU4A 1BBRH 3GCTF 1W0ZU 2ZU3A 4FUHA 2VNTA 1C1WH 1SVPA 2WPLS 4Q7YA 4H4FA 5A8YA 3VB6A 4H42U 2Z9GA 3ZZ4A 5EQRA 4JK6A 1B5GH 2VIOA 3TPIZ 4ISHH 2Q6GA 4O9VA 4ABFA 3PO1B 3QZRA 3RMOH 1FMGA 1O3OA 3A8BA 2GV7A 1TIOA 2UUKB 1ZHPA 1P2QA 1GBIA 4ZUHA 5JBCS 1MAYA 2P8OC 2BY9X 3MNCA 2WPMS 1GBFA 1BHXF 1XVMA 1TMBH 3DA9B 2A2QH 1EUFA 4AB8A 4MNVA 2PUXB 2OC8A 3QTOH 1C1SA 1TE0A 1OOKB 1UVSH 4JYUH 4KTSA 1KDQB 3EGKH 1HV7A 1MBMA 1THRH 2BVXH 2J92A 2SFAA 3RC6A 1TGNA 1TWXB 1GDNA 1QRZA 1LKAA 2C90B 2VWOA 1SGDE 3RMLH 1D6RA 1QHRB 1H9IE 1C1MA 1FZZA 1HJAC 4D7FA 1DY8A 3STIA 3P17H 2ZHEH 4K8YA 4UFGH 1PQ7A 4GHTA 1ETSH 1WBGB 4XE4A 4NSYA 4VGCB 5FHTA 3ATIA 3RUOA 1GL0E 2Y6TA 4BTIB 3R0FA 1SL3A 1A0LA 4HFPB 1CHOF 4MPWA 1EQ9A 2QYIA 2VVVA 4INKA 2AMDA 4ZKOU 4YZUA 3I29A 5C20A 1ELEE 4WH6A 4B2CA 4ZKSU 2KAIB 1LVBA 4GSOA 1XMNB 2Y5HA 1OX1A 1GBEA 3LGTA 1YPMH 3A8DA 2J38A 2XCNA 1O2UA 1TONA 1DM4B 1BTXA 1GI8B 1C2IA 1DE7H 3AASA 4I8KA 1C2HA 5EW1H 1L4ZA 2XC5A 5F8ZA 1YF4A 4BAHB 4YLQH 2ZTXA 1O39A 4U30A 1MZDA 1QRXA 1GBCA 1AZZA 3TLOA 2GX4A 1TOMH 1PPEE 1V2QT 1MTVA 3VGCC 1GJ9B 5ESBA 2WPKS 1KY9A 1ZMJA 4M7GA 4FUCA 1SGCA 2Z94A 3PM3A 3UREA 1GBMA 1T31A 1O3LA 2FM2A 2B7DH 1AFQC 3STJA 3SGQE 4MNYA 4SGAE 1QFKH 2ZGCA 2SGQE 4NCYA 1C4V2 3RU4D 1IQHA 1IOEA 5L2ZH 2ZG0H 1C9PA 1D6WA 1ZTJA 2CN0H 4NZQA 1O3PB 3MU8A 3SUFA 2HRVA 1BJUA 1ZTKA 2OD3B 2BTCE 1WUNH 1AE5A 1P01A 3M5MA 1UTQA 1OWJA 1EASA 2AIQA 3PROA 4NA7A 1BMNH 4AFUA 3P8FA 3PTNA 2SGPE 4CR5A 2AGIX 1C1NA 4Q7ZA 1QCPA 2WYJA 1AGJA 1Q31A 3LT3A 4NA9H 2PKAB 1Y3WA 1Z7KA 2C8XB 2A5AA 3BF6H 4JYTA 2KAIA 4ABBA 1OSSA 3SU2A 4MG3A 3TJOA 2XWAA 3BV9B 2BD9A 1TA6A 4FUJA 5DO4H 4A92A 1MZAA 1QBOA 3EAJA 4TPIZ 4IMZA 1LCYA 2R3UA 1KXDA 1S85A 1UTJA 1MQ6A 2ZGHA 4Q80A 2F3CE 1O3IA 2GT8A 2VU8E 2ZPSA 3SV6A 5AF9H 2FTMA 2ZDLA 5JPMH 4NIWA 1GI9B 3KF2A 1S81A 4GVUA 1QL8A 1C5MD 1EXFA 1AFEH 1HYLA 1ELVA 5B6OA 2P93A 2Z3EA 4Y71A 3B23B 3T25A 2ZCKP 3SJ9A 1J15A 1C5QA 4I8JA 4ZHAA 1BTZA 1P11E 5DG6A 3DD2H 1GHWH 1Z1JA 4ZH8A 4DVAU 6ESTA 4BXWA 2RDLA 4ABEA 1JIMA 3GY4A 1ELCA 5EOKA 2LNCA 1IQLA 3ZZDA 1UVOA 4FUGA 3BTHE 4I32A 3TK9A 4CBNA 1GBAA 5LPRA 1P09A 3SN8A 2TGDA 3KL6A 3BEIB 4OS7A 3SV7A 1O2OA 2G4UA 5JBAS 1EJMA 2O9QA 3A8CA 1C4U2 1C2KA 3SV8A 4B76A 1XX9A 3RXLA 1P2KA 3M3VA 3SU5A 1AUTC 4WXVA 3ATLA 3ZZ6A 3M7TA 3R3GB 2HVXA 2BLWA 1YCPM 2JH0D 3SORA 1C2MA 1ABIH 5T6DA 2WPJS 2D1JA 4MQAA 3UOUA 2TBSA 3MFJA 1QURH 2QGRA 1GBJA 2ODYB 5F03A 1LVOA 1L0ZA 4DG4A 1AVWA 2V3OH 2EI8A 4FUFA 4XOJA 1JOUB 1QY6A 2FOEA 3P95A 1QJ6B 1TGBA 2CJIA 1WU1A 2VIQA 1ZMLA 3EQ0H 1FN8A 1OWEA 1BMMH 3AVZA 1CBWC 4FUEA 1DT2A 1HDTH 1GBBA 3ZYEA 1J16A 2I6QA 4AGJA 1C5LH 2BM2A 1UCYE 1GJDB 1OWIA 1GCTC 2FI4E 1GMDG 2B0FA 1NT1A 5BRRE 5EQQA 3P70B 1P9SA 2ZPQA 3BEFB 1C5SA 1ZLRA 1GMCF 5HM2A 5IYTA 1ELGA 1KXCA 1LHCH 4WMEA 1ANCA 1N8OB 1YYY1 3BTGE 1TAWA 3A84A 4FVDA 1KTTB 3NUMA 2OQUA 4B71A 1GVZA 1MKXK 2AEIH 1NRPH 3NXPA 5C1XA 3S69A 1A4WH 3KQDA 2Y5GA 5DK1A 1SGQE 1GI6A 1XKAC 1O2LA 1DITH 5LPEA 3F68H 2JKHA 4BOHA 1C5OH 1LO6A 4O03A 3SO3A 2H2ZA 3TU7H 5A0BA 3B9FH 5FBIA 4CH2B 5EQSA 1QB1A 2XW9A 1PFXC 2AMPA 4CREA 3PMJA 1DWBH 3URCA 3BTDE 3SJKA 2QA9E 6CHAC 4BAOB 4AORA 1ID5H 1TX6A 3E16B 4AN7A 1KXBA 2Y7ZA 3A88A 1AUJA 4CRDA 1C5NH 3GY3A 1FNIA 5FCKA 5H4IB 3A82A 2TPIZ 4UEHH 1WQVH 1XUJA 3T2NA 1VJAU 1AZ8A 1IHTH 2UUYA 3PB1E 1J9CH 1FY3A 4HZHA 5GPIB 1EZUC 2OBOA 2JETB 3RXCA 1NRSH 2SGEE 1SI5H 1THPB 4B74A 1XKBC 3VPKA 2QF0A 1H8IH 1Y3UA 2HWLB 3A89A 3PMBB 4CRGA 1HUTH 3M61U 1HAZB 4YOIA 1E36B 1XXDA 2FIRH 2PFEA 1ZRBA 3P8OA 2PKSB 2R2WU 1L1GA 2BD2A 1GG6C 1YCPK 2VJ1A 2F9NA 2UWPA 1GDUA 2AS9A 3ODFA 1P8VC 2QXJA 1P2NA 2O8UA 2OP9A 5T6GA 1EPTC 4PROA 2JH5D 2XC0A 1AWHB 1P2OA 2H1UA 5HXFA 1EZSC 1AD8H 3GY2A 2BOKA 1ZPCA 1NU9A 2PW8H 1S6FA 3AAUA 3ELAH 2WINI 3SV2H 2DE8A 5TCCA 2VINA 4U32A 2CMYA 4BTTB 5HM9A 1A7SA 1VITF 2ZZUH 1UK2A 4CRCA 1EAUA 1XUFA 4X6PA 3A7YA 2VIPA 1NFWA 3E0NB 4RKOB 1LDTT 3KQCA 3MNBA 1F7ZA 2ZU2A 1OS8A 4NSVA 4NG9H 1YKTA 4NIVA 2AMQA 3KCGH 3N7OA 3QGNB 2W3KA 1CA8B 1A5GH 1TBQH 3UQVA 3U1IB 1AVXA 1CGHA 3HATH 1NTPA 1IQJA 3S7KB
chains in the Genus database with same CATH superfamily
2Y5FA 3UOPA 4D8NA 3BTFE 2BXUH 3F9HA 2OQ5A 3SUDA 3RC5A 1TGSZ 3ZZ7A 1GJ6A 4DURA 1GMHG 1MD8A 3RXBA 4NIYA 1IQGA 2V6NA 3ATMA 3K65B 2BXTH 4H6TA 3FO8D 1PPGE 4DT4A 2BY7X 4FVBA 3MO6A 4Y10E 4UD9H 2A1DB 1S82A 1EB2A 1FQ3A 4E05H 2OC7A 1C2GA 1TGTA 4ZKNU 4DY7B 3P8GA 3SHCH 2GJGA 1TLDA 1BA8B 1WDIA 5A8ZA 4AG1A 3SNDA 1ANDA 4LXBH 4TWWA 1GGDC 1GHVH 1G36A 1K28D 1SOZA 1TX7A 1KIGH 5PTPA 3PMAB 4A1XA 1QA0A 1UVTH 1HRTH 1UTMA 2F9BH 1EATA 1XXFA 1EAWA 3M5NA 4R8TB 2BY6X 2ULLA 2SGAA 1O2GH 3ZZ9A 4OS5A 3URDA 4ABDA 1N6YA 1T32A 2RDEA 1S0RA 1VCQA 3PWCA 4Y8YA 2STAE 4AYYB 3BG4C 3ZV9A 2QN5T 5F8XA 2ZFPH 1NROH 2XRCA 4OS1A 2SGDE 1SGRE 3GICB 1VCWA 1ZSKA 3H7TA 1ZZZA 4JMYA 3QZQA 1P12E 3K9XB 5F8TA 2PTCE 2WHXA 2JIZD 1RXPA 2BVSH 4F55A 1HAHH 2P3UB 1GVLA 2J95A 4X1SU 3FVFB 1A0JA 5E0GA 2J9NA 4P00A 1SLXB 5DPAA 1GDQA 4TYDA 1K9OE 2L6OA 2ODPA 1V2ST 1DLEA 1SFQB 1OPHB 4Y8ZA 2KCAA 1ZR0A 3NPSA 1W11U 1C1VH 2WV9A 1NN6A 4UONA 1JRSA 1UVPA 2FTLE 1HJAB 3UPEA 4E7NA 3Q3KA 1C5PA 1J14A 5I46H 1OWKA 1GI1A 1AHTH 1IQMA 1MCTA 2BHGA 2P95A 5E2OA 1C1TA 1Y5BT 5A8XA 3UWIA 3GDVA 3TK5A 4YT7H 2ZKSA 4ZKRU 3UUZA 4I8LA 3ZV8A 3GYMA 4ABIA 4DW2U 1RGQA 2YNBA 3RXUA 1FY8E 3UIRA 1SC8U 2O8TA 4WH8A 3VXFH 1AU8A 2J98A 3T26A 3O8BA 3PV4A 4GCHG 4AGKA 4Z1MD 1K1MA 3D49H 1Z71A 1EP5A 1PPHE 1O3DA 5KECA 2BD3A 1KLIH 3U8TH 1W7GH 2CHAB 2Y81A 3ZVEA 1HAGE 2J34A 2ZFRH 2NU3E 4ZXYH 3PYHA 5EJZA 3U8RH 3EE7A 4B6FA 3S0NA 1E37B 2H5DA 1TRMA 1RJXB 1OXGA 1C5VA 3UAIC 1GHXH 1SGNE 3VGCB 3KQEA 1O36A 2FOBA 1TGCA 2XBVA 1DWEH 5EG4A 3S9CA 1MBQA 2VVUA 2HPQH 2Y7XA 2FX6A 3IWMA 4MDSA 2F91A 1SB1H 3H5CB 8GCHF 3TGIE 1BRCE 1F2SE 2FYRA 3MO3A 3VEQB 3SQEE 2BDHA 4X8TH 2F9OA 5DP4A 5FX5A 1IQNA 4ABGA 3RM0H 6GCHG 2A5KA 3KQBA 1UK3A 4I31A 1HB0B 3MH4A 2HALA 5K7RA 3UNRA 1O30A 1EOJA 2ZDNA 3TNSA 1BCUH 5EJLA 1B0FA 4Y11E 3M7UA 1GHAG 4WMDA 2R9PA 5SGAE 2FLRH 1BJVA 1GHBF 5C0TA 2GCTB 4BNRA 2ZHWH 1ZPBA 3PV2A 3VG8A 3RXVA 3LPRA 1QB9A 4NGAH 3ZZBA 3EYDA 1P03A 3EA8A 1S83A 3SW2B 5LH8A 1BRAA 4NWKA 4AOQA 1EFRD 5LGOA 2A32A 5A2MH 1S6HA 1WAYB 1SGFG 1NRQH 1P2IA 2Z3CA 1FUJA 1WSSH 2PUQH 3BTTE 3SNEA 4XBDA 4SGBE 1NRNH 3GCTG 3A83A 3BTWE 3K6YA 4O3UA 1FONA 2STBE 3T62A 2GT7A 2BX4A 4FETA 4QT8C 4JZ1A 1O2ZA 2XC4A 3OU0A 4JZIA 1GJ4H 1FPCH 1TFXA 2R3YA 5DP3A 3PO1C 1KDQA 3PLPA 2TGTA 2ZI2H 1BIOA 1NFXA 2SNVA 1YGCH 4Y8XA 1EB1H 3U98H 2O8WA 2PHBA 1FJSA 2GV6A 4FUBA 4NIXA 5EPNA 4ABJA 2BOHB 1V2OT 4X2WA 1GBLA 3BEUA 5DKMA 1ZTLA 1SOTA 1W13U 2BD7A 2ALPA 1F0TA 1RS0A 1V3XA 2M2AA 4WWYA 1VGCB 1G30B 1AVGH 2G4TA 1T8MA 2FYQA 1VCPA 1QJ7B 1MQ5A 2HNTE 1K22H 3MNXA 3RXPA 3M3SA 2F9UA 1QNJA 5TCAA 4VGCC 4MPXA 1C1OA 2HNTF 1K0HA 5GCHF 2FXRA 4UE7H 5L2YH 1T4UH 1ETRH 4BANB 3MI4A 1O32A 2C3SA 2J94A 1RRKA 3LGWA 2Q6FA 1U6QA 4UFEH 4TWYA 3A81A 3ODDA 1UK4A 2BZAA 2OC1A 1DANH 1TYNA 3RXTA 4KELA 1SGEE 3GY6A 2Y80A 1NFUA 3ZVCA 4U2WA 1MTNB 5IK2D 5C5NA 5BPEA 1OHHD 2A4GA 4ISNA 3AK5A 4OGXA 3GY7A 4CH8B 1QIXB 3H09A 1GCTB 1TNIA 2HLDD 1Z6EA 1K1IA 3M3TA 4IGDA 4U01A 4B1TA 1O2KA 3ZZ5A 1OYQA 2W5EA 2WYGA 3U28C 5FL7D 1Z1IA 3FP7E 1T7CA 1W2KH 1OWDA 4X6OA 1G3CA 1DVAH 1P02A 1PQ5A 1E34B 5E0JA 8LPRA 4I86A 3ZVFA 1P2MA 4ZHMU 2RCEA 2FMJA 2KM0A 2BVRH 1DUEA 4J2YB 1ELFA 4WY3A 2B5TB 4K1SA 1FV9A 1SFIA 1TBRH 2RA3A 4NA8A 4Q7XA 3OX7U 2HLCA 4GHQA 3F9EA 4FU8A 4AC9A 4DOQA 1V2LT 4KKDA 2PP6A 4RT0A 2PKAA 2BDAA 7GCHF 2IJD1 4XSKU 5ESTE 1UTLM 1VZQH 5DP9A 3L3TA 1CA0B 3NWUA 4F49A 6LPRA 1O34A 1C2LA 1O3NA 5JBTA 4E06H 4JYVH 1K1OA 1VR1H 1O2QA 3RXFA 3UR6A 4K2YA 1BB0B 2W3IA 1TPAE 1ESTA 1DXPA 5AFZH 1HXEH 2WSSD 4M9FA 1A0HB 2PLXA 1W0JD 1CU1A 1ESAA 4MNXA 3LJJA 3SOSA 1YPHC 2XNDD 1YLDA 4FU9A 1BTUA 3MYWA 2NU2E 3RXIA 2KZ4A 1O2TA 3A87A 2J4IA 2FLBH 4CRFA 3MMGA 5E8EH 5FBEA 1GBDA 3SV9A 1CE5A 2BLOA 1RIWB 3N7EA 3BG8A 1CGJE 1K1JA 2QV1A 1EJNA 3A86A 3LH1A 1SGTA 1RTKA 1MKXH 1TRYA 2GCHF 2AERH 1JRTA 3G01A 1LQEA 3CS0A 1E35B 1O37A 1MTWA 2YOLA 3JZ2B 1ESBA 1D3TB 1FAXA 5DP7A 1C5WB 2V7QD 2BQ6B 1CSOE 1MUEB 1BBRE 3BTME 2ZHQH 1VKYA 1DY9A 2FZZA 2VWNA 1GG6B 3K6ZA 1HIAB 4FOUC 1TPSA 4KP0A 4D7GA 1ZSJA 1MU8B 2OUAA 1GI2A 2ZCLP 4ISOA 1Q2WA 4ISLA 3SU4A 2Z3DA 4YXWD 3M37A 1GBTA 4NZLA 1EPTB 3P6ZB 4BAMB 3U1JB 1QQUA 1GPZA 2QF3A 2YNAA 1NESE 3MO9A 2GGVB 4ESTE 2OBQA 1SLUB 1P2JA 4AFZA 1S5SA 1QL9A 3GCOA 2TIOA 4R0IA 4BAKB 1K21H 1J8AA 1TABE 5AVDA 3F0OA 4YO9A 4Z6AH 3HGNA 3D62A 3JZ1B 2K0QA 3SI3H 2XYAA 3MQKC 3VB4A 5C94A 4Q63A 2FS9A 1G32B 3NCLA 1UO6A 4K69A 3LONA 2J5UA 1E1RD 1GI5A 1P0SH 4NWLA 5C1UA 1C5XB 1XUKA 2GZ8A 1ZHRA 2ZU1A 2P94A 3E6PH 3SI4H 2GTBA 3E91A 1UHBB 4FXGH 2ZQ2A 3ZZAA 1ZGVA 1OP8A 1S6LA 3QLPH 2HGTH 2A7HA 2ASUB 3A7TA 1ZSLA 2EA3A 1N6XA 1WV7H 4WJG2 4JZDH 4AX9H 2JJ2D 3GCNA 4GPGA 2VIWA 1LTOA 4INLA 4X2YA 4D9RA 3TK6A 1XUHA 3KEEA 4AB9A 1O2IA 3L6PA 1YCPH 3TH3H 1GMCG 1HXFH 1SBWA 1ANBA 1KLTA 1HIAA 3PLBA 1P05A 1HFDA 3EE0B 4ABAA 4GLYA 4AYVB 1XUGA 3VB3A 2BY5X 1MU6B 2F4LA 1L1NA 2C4FH 4K3JA 2F83A 4TY7A 5TJXA 9ESTA 1KXFA 3UB0A 1EPTA 1BUIA 1C1QA 1GJAB 1BRBE 4X2VA 4GUXA 2H6MA 2NU1E 4WVPE 2FOMB 1FXYA 1SGYE 1E1QD 2EI6A 5AFYH 1TPPA 2XWBI 3VFEA 4P02A 4Q2KA 2K8IA 1YC0A 1JMOH 4HGCA 5EGMA 1K1NA 3OE7D 3MU5A 1GGDB 3F9FA 3A7WA 3RXRA 3DSPA 1O2VA 4Y79A 4DIIH 1LHEH 3QX5H 5L6NH 4Y0YE 1KXEA 2PV9B 3GYLB 4I8HA 1F5LA 1HAXB 3UY9A 4ZXXH 1TA2A 1D4PB 3MNSA 2JH6D 1A46H 2GMTC 3MH7A 1UHBA 1V2NT 1Q3XA 3ESTA 3LJOA 3OAAD 1SKYE 4IW4E 2BLQA 1FY4A 1WOFA 4TPYA 4HTCH 3VB7A 1MTUA 1PPBH 4YESB 4ZROA 3BSQA 2FI3E 3U9AH 2CF9H 2VIDA 4WF8A 3A7VA 1O3AA 1OP0A 3BG4B 2A4OA 2BDIA 2BYAX 3Q77A 5LPFA 3W95A 3F6UH 4X0WU 3NZIA 2BZ6H 1JBUH 1O33A 3W1EA 2FOAA 2BDCA 2QXGA 2ZIQH 1C5TA 3FAOA 5FAHA 1A61H 3SZNA 3ZZCA 3RXQA 1ZGIA 3LKWA 2OC0A 1X7AC 1Z8RA 2JETC 3NKKA 4X6MA 1A3EH 5T3HA 1EKBB 2EC9H 1C5UA 2ZWLH 1DS2E 1QJ1B 2BQ7B 1LPZB 5GNDA 1NRRH 1QA7A 2VB0A 2Z6BD 2ALVA 3V3MA 1AB9B 5DP8A 3RP2A 4DCDA 1H1BA 4MPUA 1GVKB 1HAIH 4K8BA 1ELTA 1HJ8A 3TH2H 4OGYA 4XBCA 3FZZA 1CQQA 1GI7B 2ZA5A 1JXPA 3D23A 3MH5A 4XFQA 1GI4A 1NU7B 2A31A 1BITA 1V6DA 3HGPA 5EIYA 1ARCA 2ZEBA 1G37A 1DLKB 1W7XH 4HI3A 1O3JA 1VITG 1KXAA 1LVYA 3HKJB 4K1TA 2CK3D 2ZFSA 5HMAA 5K0HA 3P8NA 2ZCHP 3GY5A 4IN1A 1A3BH 4TSFD 3KGPA 2QIQA 1AKSB 4TT3D 2P8OB 4B75A 2VGCC 3KQ5A 2WUBA 5IDKA 1KLJH 1O5CB 1MAXA 1OYTH 1B0EA 2GDDA 3M7QA 4LOYH 2IJOB 2K1QA 3MOCA 1WXRA 2A4QA 2BLVA 3IITA 5EPYA 3SUEA 1YBWA 5T1VA 3RM2H 1O31A 2BX3A 1Y5AT 5EXMA 4DIHH 2FESH 1BT7A 4AFSA 1EAIA 1BTHH 1Z8IB 1KMHB 3LC3A 1SSXA 4LZ1H 1FI8A 2CXVA 2CF8H 1Y3VA 5JB9S 1AY6H 3L33A 2FS8A 5JYIA 1TNLA 4ZMAH 5J4QA 3BIUH 4AZ2B 1G3DA 1ZMNA 2XXLA 3O8CA 2Z9KA 1TOCB 2HPPH 3SNAA 2Q1JA 2ZFTA 3SJOA 1LMWB 1L1JA 4Y7AA 1DUAA 1HCGA 3RXJA 4BXSA 5C67A 5F6MA 2BDBA 3AW0A 4A1TA 3VXEH 1MKWK 5JBBS 1UCYK 3GISB 2AGEX 1W3CA 3Q00A 1F0UA 5GIBA 1CVWH 1ZPZA 1TNGA 2I6SA 3V7TA 1O5FH 4O3TA 1DSUA 3B8JA 1C1PA 2FDAA 3SNCA 1BMAA 1QQ4A 2NWNA 5CHAC 2XBWA 3LOXA 2OXSA 2FX4A 1F92A 1W12U 2EI7A 5C2ZA 4WXIA 2NU4E 4RT1A 3S9AA 3OEED 4Z0KA 1C2FA 1P9UA 1GBHA 1QZ8A 4CRAA 3EDXB 1AE8H 4CRBA 2PGQB 1O2SA 4DT7B 1NM6A 2WPIS 3SGAE 3D65E 2XCFA 4JCNA 2ZU4A 4B73A 1BBRK 4OS2A 4IBLH 2RG3A 1QBNA 1AFQB 3W94A 2H9EH 1FLEE 3UTUH 3ZIAD 4X8VH 3Q76A 1DWCH 1F0RA 2HVYB 5E2PA 4CHAC 2H9HA 3F2FA 2HOBA 3ITIA 2BB4A 1ZYOA 2WUCA 1INCA 2QAAA 1QRWA 3E1XB 4B2BA 1OP2A 2OLGA 1TNJA 3KHVA 3LGUA 7LPRA 1WTGH 3IG6B 3LU9B 2THFB 3M36A 5I25A 1Y3YA 3DUXH 1AWFH 3MU1A 1EAXA 1ORFA 3ATKA 3UR9A 3RXDA 2ZFFH 4IS5A 1GWAA 1BOQA 1P04A 3SU6A 2TGPZ 2DE9A 2VVCA 2GP9B 3C1KA 1NPMA 4KGAA 3FP8E 1RTLA 2FI5E 1P3CA 1RD3B 3ATWA 3UFAA 1UTNA 2AH4X 4Y7BA 4I7YH 1RFNA 1E38B 2IPHA 3KYFA 3HKIB 1LPKB 1YWUA 3OTJE 1CT2E 1FPHH 1SPJA 5C1YA 5GXPA 3HK6B 5L30H 3GCHC 1YLCA 1PYTD 1ZRKA 3MU0A 1HAPH 2ZHDA 5ABWA 3TGKE 3V0XA 3UQOA 4I8GA 1T8LA 1Z8JB 5EXNA 4ZHLU 2PR3A 4MTBA 4AG2A 2KR7A 1ZJKA 3SYJA 1O2HA 1G3EA 4YLUA 3SU0A 1Z6JH 3DFJA 5GDSH 2XTTB 3A7ZA 2BDGA 1W0YH 1C2EA 2CHAC 1EZQA 3CS7A 4X8UH 3F2HA 3QWCH 1HJ9A 1JWTA 1HAOH 4KTCA 2XBXA 2W7SA 3GY8A 2OCVB 3F2GA 1O5BB 3RXOA 1L4DA 1DSTA 3RXSA 1K1PA 1YPEH 2ILNA 3UNQA 5DP6A 1W10U 2A45B 1VITH 5FPYA 1IQKA 5C0UA 5DSFA 5JDUB 1CT4E 3RXGA 1ZJDA 1SG8B 1E79D 2ANYA 3ENSB 1O3CA 1COWD 2UUFB 3FZDA 8GCHG 4WMFA 2Z7FE 1UMAH 2F9PA 4XD7D 4D76A 2W7UA 2G51A 2A5IA 1ABJH 2QY0B 1BTPA 1H4WA 2EEKA 5GJ4B 2G55A 3GOVB 2W26A 1H8DH 3Q3XA 1LHGH 1GJBB 2FOFA 3LIWA 1BTYA 1G2MA 4X1RU 4D9QA 2ZP0H 1QTFA 2PSXA 3EA9A 1O5DH 3KIDU 1BTWA 1CHOG 2ODQA 1N1LA 1MH0A 1TMUH 3FFGA 1YPLH 3K2UA 1GHBG 3PRDA 3U8OH 1NFYA 1P10A 2GCTC 1C2DA 2ZFQH 3DCLA 4RN6A 4LZ4B 1BQYA 2SGFE 2LP6A 3N99A 1CBWB 2F9VA 1O3HA 3S9BA 1V2KT 4A5TS 1FN6A 2FOGA 3PTBA 2AYWA 1J17T 2BD5A 1AQ7A 2B8OH 1ZOMA 2VWMA 1ELBA 1BRUP 2J2UA 8ESTE 2WV4A 4MVNA 5A0CA 3WWBA 4DGJA 2ZO3H 1GMDF 3SU1A 4INHA 2G00A 3BTEE 3HPTB 3RU4T 3TIUA 2FO9A 2SNWA 4OS6A 2YMSC 2FEQH 1EP6A 1TRNA 2BQWB 3WWFA 3SZEA 1O2RA 1O3KA 1Y3XA 3MH6A 1PPCE 2ESTE 2ZGBH 3ZZ3A 1F5KU 3QTVH 1CHGA 5ETXA 1GCDA 2VWLA 3HK3B 1XM1A 2O8MA 2R0LA 1ELAA 2G5VA 1IHSH 1C2JA 2ZGXH 1NO9H 1YPKH 1DXWA 1BHXB 3TGJE 1SLWB 1V2MT 5CHBA 1BDAA 1HPGA 2FWWA 4CR9A 1W8BH 3TNTA 2XNIA 4XDEA 1O5AB 3LGIA 3RXKA 1O2PA 2ZQ1A 5DGJA 2Y82A 2A0QB 3M5OA 2VH0A 3AAVA 2VIVA 2KCPA 1VGCC 2Q6DA 3SU3A 3OY6U 6CHAB 1SHYA 2F43B 1K2I1 2Z9IA 1V2RT 1AMHA 3T29A 4FU7A 1GI0A 1FX0B 5GCHG 3ZVGA 5JB8S 1TQ7B 2W6JD 5HYOA 3F1SB 1Y59T 1SQAA 2BD8A 5CE1A 1NS3A 1O5GH 3F0PA 4YTAA 1W0KD 1TQ0B 1GJ7B 3CENA 1OKXA 3AW1A 2ZC9H 1TNHA 1CT0E 1SQTA 1C1RA 1SGFA 1SHHB 2XBYA 2LPRA 1DDJA 2BMGB 2VH6A 1Z8GA 4X1PU 1EOLA 2GD4B 2BY8X 2IOTA 5G4BA 2P3TB 2ZDMA 4Y0ZE 3RXHA 3LDXH 1MTNC 2UUJB 1OWHA 1F5RA 1WQSA 1O2XA 2PSYA 2QXIA 1G2LA 1FY5A 2O8LA 2AFQB 1V2PT 3MTYA 5FPSA 3TITA 1HNEE 3TJUA 1P06A 3E90B 2PWXA 3GDUA 3M35A 1PJPA 2CV3A 4RSPA 4CBOA 1KTSB 4J1YA 4MLFB 3RU4E 1ELDE 1DPOA 3GS9A 2TGAA 2R0KA 2FOCA 1IAUA 1S0QA 1V2UT 3QK1A 3SBKA 3WY8A 3V13A 3GDSA 3OSYA 2ZDKA 3FN8A 1DWDH 1P57B 4AFQA 1O3BA 4BTUB 2J97A 1WCZA 3QO6A 2A7JA 1V2TT 1C5RA 3LC5A 5C3NA 1NY22 4DJZB 3PMHB 3BTQE 3FP6E 2ZPRA 3CP7A 4BAQB 1AN1E 7GCHG 1EZXC 1G9IE 2V3HH 1NZQH 3ZVDA 4K1EA 4YOJA 1WYKA 1K1LA 3A85A 5DJ7A 4JZFH 1CO7E 2ANMH 1LPGB 4ISIH 4RKJB 2PGBB 1CA0C 3OEHD 2QC2A 1A2CH 3OY5U 1DFPA 4H6SB 2FP7B 4A7IB 2GMTB 4IC5A 2ZHFH 1AI8H 1FIWA 4Y6DA 1HLTH 4I33A 1SLVB 1DOJA 1T4VH 3E3TA 2WV5A 5FXLA 2D26C 2C8YB 2C8ZB 1LHDH 1EJAA 2ZU5A 3OFND 1ACBE 1O38A 4JK5A 4ACAA 5E0HA 1A5IA 5EODA 2ZDAH 4YOGA 3O8RA 1ZHMA 4IN2A 1O3GA 1Y5UT 1C4Y2 3ZZ8A 1V2WT 1A5HA 3ZVAA 5A0AE 5C17A 1H9HE 1O5EH 1MD7A 1C5ZB 2NU0E 4XBBA 7KMEH 1FDPA 1LHFH 3QUMP 2V0BA 4A1VA 3DSOA 1TPOA 1HAYB 1GI3A 1V2JT 2ZGJA 1O0DH 2C8WB 4X2XA 1RIWC 5EXLA 2L74A 1GMHF 2GCHG 3QDZB 5A09A 1C9TA 1P3EA 2EQNA 3SNBA 3KN2A 4F4OC 4UFFH 1N8OC 2G81E 1M9UA 1T8NA 3T27A 4IC6A 1KSNA 2D2DA 2RA0A 1PPZA 1O2MA 4X1QU 4X6NA 1D3PB 1E0FD 5DP5A 1DICA 3PWBA 3SQHE 1PQ8A 1LKBA 1ETTH 1TALA 1KYNA 5EU8A 2R2MB 3C27B 3TJNA 3F9GA 1DX5M 5B6LA 1O3EA 2ANKH 3H7OA 1UTOA 1AIXH 2C93B 2QXHA 1MCVA 2FODA 2AIPA 2ZTZA 2ZNKH 5FPTA 3SHAH 1HAVB 3RXMA 2H5CA 4MNWA 1MABB 5FCRA 3KYGA 5F53A 3EA7A 2ZF0H 1B7XB 2QCYA 1JIRA 3QGJA 3M5LA 1YPGH 1LQDB 3RDZA 2DUCA 2TRMA 2D8WA 3MHWU 4NFEA 1D3QB 3TJVA 1GHYH 5AHGH 2Z9JA 1H9LB 1GJ8B 2A7CA 3I77A 3BIVH 1MTSA 3E0PB 1O2JA 2G8TA 3NK8A 2FOHA 1QBVH 3RMNH 4Y76A 2BDYA 2HNTC 1GBKA 7ESTE 1D3DB 2ZDVH 3OYPA 5J4SA 2VGCB 1O2WA 1PQAA 3MWIU 2IN2A 2GDEH 4YM9A 3S7HB 3BTKE 1SGPE 2GKVE 1BZXE 3SUGA 2P16A 1IQEA 1THSH 4GAWA 1EX3A 4K5ZA 1ARBA 1FY1A 1UTKA 3ZYDA 1TMTH 1SR5C 1QB6A 4LK4A 3OTPA 1O3FA 4B2AA 3SJIA 1PPFE 2CGAA 2B9LA 3A7XA 2PKSC 1Y8TA 3TH4H 4IMQA 1VJ9U 1TBZH 4X1NU 2WPHS 3DHKH 3ZVBA 5GWZA 3KNXA 1V2VT 2UWLA 1G3BA 3RC4A 1UW7A 2GVFA 1HAVA 3RLYH 4FUDA 1TNKA 1QGFA 2P59A 1LVMA 1A1RA 2OINA 1MMJN 4ZAEA 1GHZA 3VB5A 3QN7A 4GCHF 8KME2 1YLNA 3BN9A 4THNH 2LELA 4XRNA 5CHAB 1FIZA 3RXEA 2FPZA 1T8OA 2M5TA 1GL1A 5CMXH 1SMFE 1XVOA 2A4RA 4MPVA 1O35A 1GJCB 4TY6A 3SGBE 5T6FA 1D9IA 2J98B 1TB6H 5C5OA 4B6EA 5HGGA 2OTVA 2G52A 2OK5A 1YP9A 3RXAA 1PYTC 2PTNA 1IQFA 3TVJB 4JZEH 2P3FH 3PLKA 3LH3A 4ASHA 4ACBA 1QL7A 2Z9LA 1CGIE 1O3MA 1C5YB 1SQOA 1TX8A 1O2YA 1S84A 1GJ5H 1YM0A 1HGTH 4CHAB 3RLWH 4O97A 1QR3E 2BD4A 1UVUH 2JJ1D 1ANEA 3E8LA 3UWJH 1SGIB 1RTFB 2H9TH 3FANA 6GCHF 4K60A 3A8AA 4A6LA 3O8DA 2ANWA 1O2NA 1XUIA 3CNRA 1L2EA 1BMLA 2A2XH 2IPQX 3DT0H 2G5NA 3RMMH 4YT6H 5EW2H 1MKWH 1NBMD 2ZECA 4E7RG 2V35A 1UCYH 1GHAF 2KCOA 3U69H 4NFFA 3DFLA 2GZ9A 4UDWH 1YPHE 3V12A 3UNSA 2XOKD 1AB9C 3LGVA 9LPRA 2GZ7A 4KTUA 1WTHD 4OS4A 5FX6A 4ABHA 4F48B 2EY4C 2AGGX 2UWOA 2ZTYA 3GCHB 1UTPA 3I78A 3LGYA 1FAKH 3T28A 3Q3YA 4UFDH 1NC6A 3T5FH 1C1UH 4FUIA 3SJ8A 4X8SH 1IQIA 3P92A 1AKSA 1UJ1A 3A80A 1AO5A 1F0SA 1HBTH 1W14U 1YPJH 3MU4A 1BBRH 3GCTF 1W0ZU 2ZU3A 4FUHA 2VNTA 1C1WH 1SVPA 2WPLS 4Q7YA 4H4FA 5A8YA 3VB6A 4H42U 2Z9GA 3ZZ4A 5EQRA 4JK6A 1B5GH 2AHME 2VIOA 3TPIZ 4ISHH 2Q6GA 4O9VA 4ABFA 3PO1B 3QZRA 3RMOH 1FMGA 1O3OA 3A8BA 2GV7A 3F3BA 1TIOA 2UUKB 1ZHPA 1P2QA 1GBIA 4ZUHA 5JBCS 1MAYA 2P8OC 2BY9X 3MNCA 2WPMS 5DN6D 1GBFA 1BHXF 1XVMA 1TMBH 3DA9B 2A2QH 1EUFA 4AB8A 4MNVA 2KFWA 2PUXB 2OC8A 3QTOH 1C1SA 1TE0A 1OOKB 1UVSH 4JYUH 4KTSA 1KDQB 3EGKH 1HV7A 1MBMA 1THRH 2BVXH 2J92A 2SFAA 3RC6A 5HKKD 1TGNA 1TWXB 1GDNA 1QRZA 1LKAA 2C90B 2VWOA 1SGDE 3RMLH 1D6RA 1QHRB 1H9IE 1C1MA 1FZZA 3DSGA 1HJAC 4D7FA 1DY8A 3STIA 3P17H 2ZHEH 4K8YA 4UFGH 1PQ7A 1H8ED 4GHTA 1ETSH 1WBGB 4XE4A 3PV5A 4Q4LA 4NSYA 4VGCB 5FHTA 5HIZA 3ATIA 3RUOA 1GL0E 2Y6TA 4BTIB 3R0FA 1SL3A 1A0LA 4HFPB 1CHOF 4MPWA 1EQ9A 2QYIA 2VVVA 4INKA 2AMDA 4ZKOU 4YZUA 3I29A 5C20A 1ELEE 4WH6A 4B2CA 4ZKSU 2KAIB 1LVBA 4GSOA 1XMNB 2Y5HA 1OX1A 1GBEA 3LGTA 1YPMH 3A8DA 2J38A 2XCNA 1O2UA 1TONA 1DM4B 1BTXA 2RFKC 1GI8B 1C2IA 1DE7H 3AASA 4I8KA 1C2HA 3FKSD 5EW1H 1L4ZA 2XC5A 5F8ZA 1YF4A 4BAHB 2YMSB 4YLQH 2ZTXA 1O39A 4U30A 1MZDA 1QRXA 1GBCA 1AZZA 3TLOA 2GX4A 1TOMH 1PPEE 1V2QT 1MTVA 3VGCC 1GJ9B 5ESBA 2WPKS 5HIYA 1KY9A 2JDID 1ZMJA 4M7GA 4FUCA 1SGCA 2Z94A 3PM3A 3PRBA 3UREA 1GBMA 1T31A 1BMFD 1O3LA 2FM2A 2B7DH 1AFQC 3STJA 1NBME 3SGQE 4MNYA 4SGAE 1QFKH 2ZGCA 2SGQE 4NCYA 1C4V2 4HG6A 3RU4D 1IQHA 1IOEA 5L2ZH 2ZG0H 1C9PA 1D6WA 1ZTJA 2CN0H 4NZQA 1O3PB 3MU8A 5EJ1A 3SUFA 2HRVA 3NRLA 1BJUA 1ZTKA 2OD3B 2BTCE 1WUNH 1AE5A 1P01A 3M5MA 1UTQA 1OWJA 1EASA 2AIQA 3PROA 4NA7A 1BMNH 4AFUA 3P8FA 3PTNA 2SGPE 4CR5A 2AGIX 1C1NA 4Q7ZA 1QCPA 2WYJA 1AGJA 1Q31A 3LT3A 4NA9H 2PKAB 1Y3WA 1Z7KA 2C8XB 2A5AA 3BF6H 4JYTA 2KAIA 4ABBA 1OSSA 2W6ID 3SU2A 4MG3A 3TJOA 2XWAA 3BV9B 2BD9A 1TA6A 4FUJA 5DO4H 4A92A 1MZAA 1QBOA 3EAJA 4TPIZ 4IMZA 1LCYA 2R3UA 1KXDA 1S85A 1UTJA 1MQ6A 2ZGHA 4Q80A 2F3CE 1O3IA 2GT8A 2VU8E 1YY3A 2ZPSA 3SV6A 5AF9H 2FTMA 2ZDLA 5JPMH 4NIWA 1GI9B 3KF2A 1S81A 4GVUA 1QL8A 1C5MD 1EXFA 1AFEH 1HYLA 1ELVA 5B6OA 2P93A 2Z3EA 4Y71A 3B23B 3T25A 2ZCKP 2KCYA 3SJ9A 1J15A 1C5QA 4I8JA 4ZHAA 1BTZA 1P11E 5DG6A 3DD2H 1GHWH 1Z1JA 4ZH8A 4RI0A 4DVAU 6ESTA 4BXWA 2RDLA 4ABEA 1JIMA 3GY4A 1ELCA 5EOKA 2LNCA 1IQLA 3ZZDA 1UVOA 4FUGA 3BTHE 4I32A 3TK9A 4CBNA 1GBAA 5LPRA 1P09A 3SN8A 2TGDA 3KL6A 3BEIB 4OS7A 3SV7A 1O2OA 1SQRA 2G4UA 5JBAS 1EJMA 2O9QA 3A8CA 1C4U2 1C2KA 3SV8A 4B76A 1XX9A 3RXLA 4ZCNA 1P2KA 3M3VA 3SU5A 1AUTC 4WXVA 3ATLA 3ZZ6A 3M7TA 3R3GB 2HVXA 2BLWA 1YCPM 2JH0D 3SORA 1C2MA 1ABIH 5T6DA 2WPJS 2D1JA 4MQAA 3UOUA 2TBSA 3MFJA 1QURH 2QGRA 1GBJA 2ODYB 5F03A 1LVOA 1L0ZA 4DG4A 1AVWA 2V3OH 2EI8A 4FUFA 4XOJA 1JOUB 1QY6A 2FOEA 3P95A 1QJ6B 1TGBA 2CJIA 1WU1A 2VIQA 1ZMLA 3EQ0H 1FN8A 1OWEA 1BMMH 3AVZA 1CBWC 4FUEA 1DT2A 2QF5A 1HDTH 3N7DA 1GBBA 3ZYEA 1J16A 2I6QA 4AGJA 1C5LH 2BM2A 1UCYE 1GJDB 1OWIA 1GCTC 2FI4E 1GMDG 2B0FA 2V3MA 1NT1A 5BRRE 5EQQA 3P70B 1P9SA 2ZPQA 3BEFB 1C5SA 1ZLRA 1GMCF 5KGOA 5HM2A 5IYTA 1ELGA 1KXCA 1LHCH 3FOAA 4WMEA 1ANCA 1N8OB 1YYY1 3BTGE 1TAWA 3A84A 4FVDA 1KTTB 3NUMA 2OQUA 4B71A 1GVZA 1MKXK 2QF4A 2AEIH 1NRPH 3NXPA 5C1XA 3S69A 5CDFE 1A4WH 3KQDA 2Y5GA 5DK1A 1SGQE 1GI6A 1XKAC 1O2LA 1DITH 5LPEA 3F68H 2JKHA 4BOHA 1C5OH 1LO6A 4O03A 3SO3A 2H2ZA 3TU7H 5A0BA 3B9FH 4OM9A 5FBIA 4CH2B 5EQSA 1QB1A 3WW7A 2QE7D 2XW9A 1PFXC 5KEDA 2AMPA 4CREA 3PMJA 1DWBH 3URCA 3BTDE 3SJKA 2QA9E 6CHAC 4BAOB 4AORA 1ID5H 1TX6A 3E16B 4AN7A 1KXBA 2Y7ZA 3A88A 2YMSD 1AUJA 2VBCA 4CRDA 1H8HD 1C5NH 3GY3A 1FNIA 5FCKA 5H4IB 3A82A 2TPIZ 4UEHH 1WQVH 1XUJA 3T2NA 1VJAU 1AZ8A 1IHTH 2UUYA 3PB1E 1J9CH 1FY3A 4HZHA 5GPIB 1EZUC 2OBOA 2JETB 3RXCA 1NRSH 2SGEE 1SI5H 1THPB 4ASUD 4B74A 1XKBC 3VPKA 2QF0A 1H8IH 1Y3UA 2HWLB 3A89A 3PMBB 4CRGA 1HUTH 3M61U 1HAZB 4YOIA 1E36B 1XXDA 2FIRH 2PFEA 1ZRBA 3P8OA 2PKSB 2R2WU 1L1GA 2BD2A 1GG6C 1YCPK 2VJ1A 2F9NA 2UWPA 1GDUA 2AS9A 3ODFA 1P8VC 2QXJA 1P2NA 2O8UA 2OP9A 5T6GA 1EPTC 4PROA 2JH5D 2XC0A 1AWHB 1P2OA 2H1UA 5HXFA 1EZSC 1AD8H 3GY2A 2BOKA 2KX4A 1ZPCA 1NU9A 2PW8H 1S6FA 3AAUA 3ELAH 2WINI 3SV2H 2DE8A 5TCCA 2VINA 4U32A 2CMYA 4BTTB 5HM9A 1A7SA 1VITF 2ZZUH 1UK2A 4CRCA 1EAUA 1XUFA 4X6PA 3A7YA 2VIPA 1NFWA 3E0NB 4RKOB 1LDTT 3KQCA 3MNBA 1F7ZA 2ZU2A 2WPDD 1OS8A 4NSVA 2WZQA 4NG9H 1YKTA 4NIVA 2AMQA 3KCGH 3N7OA 3QGNB 2W3KA 1CA8B 1A5GH 1TBQH 3UQVA 3U1IB 1AVXA 1CGHA 3HATH 1NTPA 1IQJA 3S7KB
chains in the Genus database with same CATH topology
2Y5FA 3UOPA 4D8NA 3BTFE 2BXUH 3F9HA 2OQ5A 3SUDA 1TGSZ 3ZZ7A 1GJ6A 4DURA 1GMHG 1MD8A 3RXBA 4NIYA 1IQGA 2V6NA 3ATMA 3K65B 2BXTH 4H6TA 1PPGE 2BY7X 4FVBA 3MO6A 4Y10E 4UD9H 2A1DB 1S82A 1EB2A 1FQ3A 4E05H 2OC7A 1C2GA 1TGTA 4ZKNU 4DY7B 3P8GA 3SHCH 1TLDA 1BA8B 5A8ZA 4AG1A 3SNDA 1ANDA 4LXBH 4TWWA 1GGDC 1GHVH 1G36A 1K28D 1SOZA 1TX7A 1KIGH 5PTPA 3PMAB 4A1XA 1QA0A 1UVTH 1HRTH 1UTMA 2F9BH 1EATA 1XXFA 1EAWA 3M5NA 4R8TB 2BY6X 2ULLA 2SGAA 1O2GH 3ZZ9A 4OS5A 3URDA 4ABDA 1N6YA 1T32A 1S0RA 1VCQA 3PWCA 4Y8YA 2STAE 4AYYB 3BG4C 3ZV9A 2QN5T 5F8XA 2ZFPH 1NROH 2XRCA 4OS1A 2SGDE 1SGRE 3GICB 1VCWA 1ZSKA 3H7TA 1ZZZA 4JMYA 3QZQA 1P12E 3K9XB 5F8TA 2PTCE 1RXPA 2BVSH 1HAHH 2P3UB 1GVLA 2J95A 4X1SU 3FVFB 1A0JA 5E0GA 2J9NA 1SLXB 5DPAA 1GDQA 4TYDA 1K9OE 3RC5A 2ODPA 1V2ST 1DLEA 1SFQB 1OPHB 4Y8ZA 1ZR0A 3NPSA 1W11U 1C1VH 1NN6A 4UONA 1JRSA 1UVPA 2FTLE 1HJAB 3UPEA 4E7NA 3Q3KA 1C5PA 1J14A 5I46H 1OWKA 1GI1A 1AHTH 1IQMA 1MCTA 2BHGA 2P95A 5E2OA 1C1TA 1Y5BT 5A8XA 3UWIA 3GDVA 3TK5A 4YT7H 2ZKSA 4ZKRU 3UUZA 4I8LA 3ZV8A 3GYMA 4ABIA 4DW2U 1RGQA 2YNBA 3RXUA 1FY8E 3UIRA 1SC8U 2O8TA 4WH8A 3VXFH 1AU8A 3T26A 3O8BA 3PV4A 4GCHG 4AGKA 1K1MA 3D49H 1Z71A 1EP5A 1PPHE 1O3DA 2BD3A 1KLIH 3U8TH 1W7GH 2CHAB 2Y81A 3ZVEA 1HAGE 2J34A 2ZFRH 2NU3E 4ZXYH 3PYHA 3U8RH 3S0NA 1E37B 2H5DA 1TRMA 1RJXB 1OXGA 1C5VA 1GHXH 1SGNE 3VGCB 3KQEA 1O36A 2FOBA 1TGCA 2XBVA 1DWEH 5EG4A 3S9CA 1MBQA 2VVUA 2HPQH 2Y7XA 2FX6A 3IWMA 4MDSA 2F91A 1SB1H 3H5CB 8GCHF 3TGIE 1BRCE 1F2SE 2FYRA 3MO3A 3VEQB 3SQEE 2BDHA 4X8TH 2F9OA 5DP4A 5FX5A 1IQNA 4ABGA 3RM0H 6GCHG 2A5KA 3KQBA 1UK3A 4I31A 1HB0B 3MH4A 2HALA 5K7RA 3UNRA 1O30A 1EOJA 2ZDNA 3TNSA 1BCUH 1B0FA 4Y11E 3M7UA 1GHAG 4WMDA 2R9PA 5SGAE 2FLRH 1BJVA 1GHBF 2GCTB 4BNRA 2ZHWH 1ZPBA 3RXVA 3LPRA 1QB9A 4NGAH 3ZZBA 3EYDA 1P03A 3EA8A 1S83A 3SW2B 5LH8A 1BRAA 4NWKA 4AOQA 5LGOA 2A32A 5A2MH 1S6HA 1WAYB 1SGFG 1NRQH 1P2IA 2Z3CA 1FUJA 1WSSH 2PUQH 3BTTE 3SNEA 4XBDA 4SGBE 1NRNH 3GCTG 3A83A 3BTWE 3K6YA 4O3UA 1FONA 2STBE 3T62A 2GT7A 2BX4A 4QT8C 4JZ1A 1O2ZA 2XC4A 3OU0A 4JZIA 1GJ4H 1FPCH 1TFXA 2R3YA 5DP3A 3PO1C 1KDQA 3PLPA 2TGTA 2ZI2H 1BIOA 1NFXA 2SNVA 1YGCH 4Y8XA 1EB1H 3U98H 2O8WA 2PHBA 1FJSA 2GV6A 4FUBA 4NIXA 5EPNA 4ABJA 2BOHB 1V2OT 4X2WA 1GBLA 3BEUA 5DKMA 1ZTLA 1SOTA 1W13U 2BD7A 2ALPA 1F0TA 1RS0A 1V3XA 4WWYA 1VGCB 1G30B 1AVGH 2G4TA 1T8MA 2FYQA 1VCPA 1QJ7B 1MQ5A 2HNTE 1K22H 3MNXA 3RXPA 3M3SA 2F9UA 1QNJA 5TCAA 4VGCC 4MPXA 1C1OA 2HNTF 5GCHF 2FXRA 4UE7H 5L2YH 1T4UH 1ETRH 4BANB 3MI4A 1O32A 2C3SA 2J94A 1RRKA 3LGWA 2Q6FA 1U6QA 4UFEH 4TWYA 3A81A 3ODDA 1UK4A 2BZAA 2OC1A 1DANH 1TYNA 3RXTA 4KELA 1SGEE 3GY6A 2Y80A 1NFUA 3ZVCA 4U2WA 1MTNB 5C5NA 5BPEA 2A4GA 4ISNA 4OGXA 3GY7A 4CH8B 1QIXB 1GCTB 1TNIA 1Z6EA 1K1IA 3M3TA 4IGDA 4U01A 4B1TA 1O2KA 3ZZ5A 1OYQA 2W5EA 2WYGA 1Z1IA 3FP7E 1T7CA 1W2KH 1OWDA 4X6OA 1G3CA 1DVAH 1P02A 1PQ5A 1E34B 5E0JA 8LPRA 3ZVFA 1P2MA 4ZHMU 2RCEA 2FMJA 2BVRH 1DUEA 4J2YB 1ELFA 4WY3A 2B5TB 4K1SA 1FV9A 1SFIA 1TBRH 2RA3A 4NA8A 4Q7XA 3OX7U 2HLCA 4GHQA 3F9EA 4FU8A 4DOQA 1V2LT 4KKDA 2PKAA 2BDAA 7GCHF 4XSKU 5ESTE 1UTLM 1VZQH 5DP9A 3L3TA 1CA0B 3NWUA 4F49A 6LPRA 1O34A 1C2LA 1O3NA 5JBTA 4E06H 4JYVH 1K1OA 1VR1H 1O2QA 3RXFA 3UR6A 4K2YA 1BB0B 2W3IA 1TPAE 1ESTA 1DXPA 5AFZH 1HXEH 1A0HB 2PLXA 1CU1A 1ESAA 4MNXA 3LJJA 3SOSA 1YPHC 1YLDA 4FU9A 1BTUA 3MYWA 2NU2E 3RXIA 1O2TA 3A87A 2J4IA 2FLBH 4CRFA 3MMGA 5E8EH 5FBEA 1GBDA 3SV9A 1CE5A 2BLOA 1RIWB 3BG8A 1CGJE 1K1JA 2QV1A 1EJNA 3A86A 3LH1A 1SGTA 1RTKA 1MKXH 1TRYA 2GCHF 2AERH 1JRTA 3G01A 1LQEA 3CS0A 1E35B 1O37A 1MTWA 2YOLA 3JZ2B 1ESBA 1D3TB 1FAXA 5DP7A 1C5WB 2BQ6B 1CSOE 1MUEB 1BBRE 3BTME 2ZHQH 1DY9A 2FZZA 2VWNA 1GG6B 3K6ZA 1HIAB 4D7GA 1TPSA 4KP0A 1ZSJA 1MU8B 2OUAA 1GI2A 2ZCLP 4ISOA 1Q2WA 4ISLA 3SU4A 2Z3DA 3M37A 1GBTA 4NZLA 1EPTB 3P6ZB 4BAMB 3U1JB 1QQUA 1GPZA 2QF3A 2YNAA 1NESE 3MO9A 2GGVB 4ESTE 2OBQA 1SLUB 1P2JA 4AFZA 1S5SA 1QL9A 3GCOA 2TIOA 4R0IA 4BAKB 1K21H 1J8AA 1TABE 5AVDA 4Z6AH 4YO9A 3HGNA 3D62A 3JZ1B 3SI3H 2XYAA 3VB4A 2FS9A 1G32B 3NCLA 1UO6A 4K69A 3LONA 1GI5A 1P0SH 4NWLA 5C1UA 1C5XB 1XUKA 2GZ8A 1ZHRA 2ZU1A 2P94A 3E6PH 3SI4H 2GTBA 3E91A 1UHBB 4FXGH 2ZQ2A 3ZZAA 1ZGVA 1OP8A 3QLPH 2HGTH 2A7HA 2ASUB 3A7TA 1ZSLA 2EA3A 1N6XA 1WV7H 4WJG2 4JZDH 4AX9H 3GCNA 4GPGA 2VIWA 1LTOA 4INLA 4X2YA 4D9RA 3TK6A 1XUHA 3KEEA 4AB9A 1O2IA 3L6PA 1YCPH 3TH3H 1GMCG 1HXFH 1SBWA 1ANBA 1KLTA 1HIAA 3PLBA 1P05A 1HFDA 3EE0B 4ABAA 4GLYA 4AYVB 1XUGA 3VB3A 2BY5X 1MU6B 1L1NA 2C4FH 4K3JA 2F83A 4TY7A 5TJXA 9ESTA 1KXFA 1EPTA 1BUIA 1C1QA 1GJAB 1BRBE 4X2VA 4GUXA 2H6MA 2NU1E 4WVPE 2FOMB 1FXYA 1SGYE 2EI6A 5AFYH 1TPPA 2XWBI 3VFEA 4Q2KA 1YC0A 1JMOH 4HGCA 5EGMA 1K1NA 3MU5A 1GGDB 3F9FA 3A7WA 3RXRA 1O2VA 4Y79A 4DIIH 1LHEH 3QX5H 5L6NH 4Y0YE 1KXEA 2PV9B 3GYLB 4I8HA 1F5LA 1HAXB 3UY9A 4ZXXH 1TA2A 1D4PB 3MNSA 2JH6D 1A46H 2GMTC 3MH7A 1UHBA 1V2NT 1Q3XA 3ESTA 3LJOA 4IW4E 2BLQA 1FY4A 1WOFA 4TPYA 4HTCH 3VB7A 1MTUA 1PPBH 4YESB 4ZROA 3BSQA 2FI3E 3U9AH 2CF9H 2VIDA 4WF8A 3A7VA 1O3AA 1OP0A 3BG4B 2A4OA 2BDIA 2BYAX 3Q77A 5LPFA 3W95A 3F6UH 4X0WU 3NZIA 2BZ6H 1JBUH 1O33A 2FOAA 2BDCA 2QXGA 2ZIQH 1C5TA 3FAOA 5FAHA 1A61H 3SZNA 3ZZCA 3RXQA 1ZGIA 3LKWA 2OC0A 1X7AC 1Z8RA 2JETC 3NKKA 4X6MA 1A3EH 5T3HA 1EKBB 2EC9H 1C5UA 2ZWLH 1DS2E 1QJ1B 2BQ7B 1LPZB 1NRRH 1QA7A 2VB0A 2Z6BD 2ALVA 3V3MA 1AB9B 5DP8A 3RP2A 4DCDA 1H1BA 4MPUA 1GVKB 1HAIH 4K8BA 1ELTA 1HJ8A 3TH2H 4OGYA 4XBCA 3FZZA 1CQQA 1GI7B 2ZA5A 1JXPA 3D23A 3MH5A 4XFQA 1GI4A 1NU7B 2A31A 1BITA 1V6DA 3HGPA 1ARCA 2ZEBA 1G37A 1DLKB 1W7XH 4HI3A 1O3JA 1VITG 1KXAA 1LVYA 3HKJB 4K1TA 2ZFSA 5HMAA 5K0HA 3P8NA 2ZCHP 3GY5A 4IN1A 1A3BH 3KGPA 2QIQA 1AKSB 2P8OB 4B75A 2VGCC 2WUBA 5IDKA 1KLJH 1O5CB 1MAXA 1OYTH 1B0EA 2GDDA 3M7QA 4LOYH 2IJOB 2K1QA 3MOCA 2A4QA 2BLVA 3IITA 5EPYA 3SUEA 1YBWA 3RM2H 1O31A 2BX3A 1Y5AT 5EXMA 4DIHH 2FESH 1BT7A 4AFSA 1EAIA 1BTHH 1Z8IB 3LC3A 1SSXA 4LZ1H 1FI8A 2CXVA 2CF8H 1Y3VA 5JB9S 1AY6H 3L33A 2FS8A 5JYIA 1TNLA 4ZMAH 5J4QA 3BIUH 4AZ2B 1G3DA 1ZMNA 2XXLA 3O8CA 2Z9KA 1TOCB 2HPPH 3SNAA 2Q1JA 2ZFTA 3SJOA 1LMWB 1L1JA 4Y7AA 1DUAA 1HCGA 3RXJA 4BXSA 5C67A 5F6MA 2BDBA 3AW0A 4A1TA 3VXEH 1MKWK 5JBBS 1UCYK 3GISB 2AGEX 1W3CA 3Q00A 1F0UA 5GIBA 1CVWH 1ZPZA 1TNGA 2I6SA 3V7TA 1O5FH 4O3TA 1DSUA 3B8JA 1C1PA 2FDAA 3SNCA 1BMAA 1QQ4A 2NWNA 5CHAC 2XBWA 3LOXA 2OXSA 2FX4A 1F92A 1W12U 2EI7A 5C2ZA 4WXIA 2NU4E 3S9AA 4Z0KA 1C2FA 1P9UA 1GBHA 4CRAA 3EDXB 1AE8H 4CRBA 2PGQB 1O2SA 4DT7B 1NM6A 2WPIS 3SGAE 3D65E 2XCFA 4JCNA 2ZU4A 4B73A 1BBRK 4OS2A 4IBLH 2RG3A 1QBNA 1AFQB 3W94A 2H9EH 1FLEE 3UTUH 4X8VH 3Q76A 1DWCH 1F0RA 5E2PA 4CHAC 2H9HA 2HOBA 3ITIA 2BB4A 1ZYOA 2WUCA 1INCA 2QAAA 1QRWA 3E1XB 4B2BA 1OP2A 2OLGA 1TNJA 3KHVA 3LGUA 7LPRA 1WTGH 3IG6B 3LU9B 2THFB 3M36A 5I25A 1Y3YA 3DUXH 1AWFH 3MU1A 1EAXA 1ORFA 3ATKA 3UR9A 3RXDA 2ZFFH 4IS5A 1GWAA 1BOQA 1P04A 3SU6A 2TGPZ 2DE9A 2VVCA 2GP9B 3C1KA 1NPMA 4KGAA 3FP8E 1RTLA 2FI5E 1P3CA 1RD3B 3ATWA 3UFAA 1UTNA 2AH4X 4Y7BA 4I7YH 1RFNA 1E38B 2IPHA 3HKIB 1LPKB 3OTJE 1CT2E 1FPHH 1SPJA 5C1YA 5GXPA 3HK6B 5L30H 3GCHC 1YLCA 1PYTD 1ZRKA 3MU0A 1HAPH 2ZHDA 5ABWA 3TGKE 3V0XA 3UQOA 4I8GA 1T8LA 1Z8JB 5EXNA 4ZHLU 2PR3A 4MTBA 4AG2A 1ZJKA 1O2HA 1G3EA 4YLUA 3SU0A 1Z6JH 3DFJA 5GDSH 2XTTB 3A7ZA 2BDGA 1W0YH 1C2EA 2CHAC 1EZQA 3CS7A 4X8UH 3QWCH 1HJ9A 1JWTA 1HAOH 4KTCA 2XBXA 2W7SA 3GY8A 2OCVB 1O5BB 3RXOA 1L4DA 1DSTA 3RXSA 1K1PA 1YPEH 2ILNA 3UNQA 5DP6A 1W10U 2A45B 1VITH 5FPYA 1IQKA 5JDUB 1CT4E 3RXGA 1ZJDA 1SG8B 2ANYA 3ENSB 1O3CA 2UUFB 3FZDA 8GCHG 4WMFA 2Z7FE 1UMAH 2F9PA 4D76A 2W7UA 2G51A 2A5IA 1ABJH 2QY0B 1BTPA 1H4WA 2EEKA 5GJ4B 2G55A 3GOVB 2W26A 1H8DH 3Q3XA 1LHGH 1GJBB 2FOFA 3LIWA 1BTYA 1G2MA 4X1RU 4D9QA 2ZP0H 1QTFA 2PSXA 3EA9A 1O5DH 3KIDU 1BTWA 1CHOG 2ODQA 1N1LA 1MH0A 1TMUH 3FFGA 1YPLH 3K2UA 1GHBG 3U8OH 1NFYA 1P10A 2GCTC 1C2DA 2ZFQH 4RN6A 4LZ4B 1BQYA 2SGFE 1CBWB 2F9VA 1O3HA 3S9BA 1V2KT 4A5TS 1FN6A 2FOGA 3PTBA 2AYWA 1J17T 2BD5A 1AQ7A 2B8OH 1ZOMA 2VWMA 1ELBA 1BRUP 2J2UA 8ESTE 2WV4A 4MVNA 5A0CA 4DGJA 2ZO3H 1GMDF 3SU1A 4INHA 2G00A 3BTEE 3HPTB 3RU4T 3TIUA 2FO9A 2SNWA