1O2OA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2oA02
2XWBI 1KLTA 3QGJA 1GG6B 8LPRA 2V0BA 1GBEA 3PMHB 3M7TA 2P16A 3ZZ3A 2BVSH 3ZZAA 4Q7ZA 2QYIA 2ZCKP 1FZZA 5T6GA 1FDPA 1SGIB 1TRYA 2P8OB 2G81E 2GD4B 1S6FA 4M7GA 1C2MA 3A81A 4ZAEA 5A8YA 1PPZA 1TA2A 3SNBA 1CVWH 1B5GH 1PQ7A 3G01A 4FUCA 5EODA 1GBCA 3SQHE 4LZ1H 1O0DH 1N1LA 1YF4A 3SV8A 1XUJA 2OTVA 1HUTH 3MO6A 2V35A 1C1UH 2QCYA 2ZPRA 2ULLA 2VWMA 4NA9H 3V0XA 1QFKH 4K69A 1FN8A 3RMMH 4WMDA 2P95A 1W7XH 4NWLA 1ANCA 1OXGA 1EJNA 1SGRE 4FUGA 2Z3EA 2B0FA 4DIIH 4YO9A 3MNXA 2Q6GA 1F2SE 1BDAA 1F5RA 2FI4E 4AB9A 1QRZA 2UUYA 3VXFH 4B71A 3E0PB 1GHBG 1XUFA 1BRCE 2PFEA 1QTFA 1HAYB 3EYDA 3PM3A 4X8SH 4ZROA 3LGVA 3UTUH 2BDGA 2FWWA 1TNHA 1O3NA 3UR9A 1T31A 3MO3A 4JZFH 3S69A 1NFYA 3V7TA 2QGRA 1AY6H 1TOMH 1C1NA 3QTVH 1LHEH 1MTSA 2AMPA 1LPGB 3URDA 1ELVA 1XVOA 2A4QA 4INKA 3KGPA 2IOTA 1PPCE 1FLEE 4JZDH 3PYHA 4NWKA 2C3SA 2OC8A 5BPEA 3MI4A 1GDUA 1UTJA 2Z9KA 4YOJA 1HAGE 2BY7X 1O2RA 1LCYA 1ESTA 1KTSB 2R3YA 5IYTA 3MMGA 1EATA 1HRTH 1UCYE 1NRPH 2WPLS 3MYWA 1Y3VA 1OWKA 2G00A 1Z8RA 3LGIA 3MFJA 1RXPA 1A4WH 3QDZB 3IWMA 4ABFA 4X1NU 3V13A 2GDEH 1W0ZU 2ZC9H 1NY22 2TPIZ 1EX3A 5FBIA 5C1XA 3U1JB 3QO6A 1DVAH 1GBKA 1BJVA 2EC9H 3VB3A 1D6RA 1BCUH 1BMAA 1TX8A 1KDQA 1IQIA 3QX5H 2SGAA 3LT3A 3ZVDA 3KL6A 1ZGVA 4X8TH 4GUXA 3UNQA 1OS8A 4WMFA 2A4GA 3T62A 7GCHF 1PPHE 3BN9A 4AFSA 3A7XA 3MNCA 4NIWA 4KP0A 1F0SA 3ESTA 3BTTE 3K6YA 1ZMJA 1SGFA 3TGJE 3O8BA 1GI1A 4BAHB 1E36B 1THRH 4AFUA 1GBJA 3SNEA 2UUKB 1O2XA 5C5NA 3KQDA 1CA0B 3NK8A 1P06A 2P93A 1UHBA 4BTIB 2FYQA 2BZAA 1W13U 4YOGA 1SR5C 1XX9A 3U1IB 1SLUB 1UK2A 2FO9A 3KCGH 4GLYA 4TWWA 4UEHH 2A31A 1AQ7A 1ELDE 3M35A 4ABHA 3MU5A 7KMEH 5K7RA 2VVUA 1AN1E 4UFFH 3FVFB 1CT4E 3SV9A 1E34B 1PQ5A 2BX4A 5FHTA 1A46H 3S7KB 1KXAA 3HATH 1HJAB 1O5EH 1K1NA 2A4OA 1V2QT 2H1UA 3H5CB 1C1OA 3OY6U 3P8NA 4MTBA 1GCDA 1M9UA 3K6ZA 2BHGA 4TY7A 3F1SB 5FBEA 4Y11E 2VJ1A 2STAE 4ZUHA 2HGTH 4Y7AA 2BDCA 4ABGA 1ESBA 4LOYH 4BAOB 2WPKS 1O5BB 3VB4A 2OXSA 2J38A 1CBWC 1EB1H 5LGOA 1H9LB 1YP9A 3F6UH 3M61U 5HYOA 3UNSA 4X6NA 1ANBA 1DITH 1C5LH 1FQ3A 4OS1A 4UE7H 2FODA 2UUFB 5EU8A 1AKSA 3MU4A 2GX4A 4DJZB 3ATIA 5A2MH 3TGIE 2FIRH 2A1DB 1GHBF 1QBNA 1PJPA 2QIQA 2BQWB 4NZLA 1GHAG 2OD3B 3BTQE 3MU1A 2AS9A 3RXAA 1MKWH 3C27B 3IG6B 5I25A 2D8WA 3ZZ4A 5CHAC 4ZKNU 1F0UA 2W7SA 2CGAA 1W0YH 2PTNA 2BD8A 3DHKH 1GPZA 1ARBA 1GI9B 3SW2B 1JRTA 1GMDG 2GKVE 5ETXA 2Y5GA 4JZ1A 2H5CA 4INHA 3QN7A 1LQDB 1TNKA 2TGPZ 3RXRA 1HXEH 2GMTC 1HJ9A 4K3JA 1ZLRA 4Y79A 1HAVA 2BD4A 1GBTA 1XXFA 2IN2A 4XBCA 1QGFA 3R3GB 1MKXK 3PWBA 5C3NA 2R2MB 1YCPM 1E35B 1SGQE 5CHAB 1B0EA 3BSQA 1QL9A 3AW0A 1EZXC 1GHXH 1A1RA 1EZQA 1OKXA 1LVYA 1GBIA 3NKKA 2VU8E 2ZHWH 3GY2A 4CR5A 3URCA 1O5AB 2C8XB 4ABBA 4PROA 1TPPA 1EP5A 1AI8H 1ELGA 3BTHE 3QTOH 1BTZA 2EA3A 2GMTB 1ZOMA 2M5TA 4BTTB 1FIWA 1G3EA 1EXFA 4TYDA 1F5KU 2PV9B 4X8VH 1GBDA 1C2LA 1BHXF 3U69H 1GVKB 5DK1A 1O2LA 3I77A 4D9RA 5GWZA 3UQOA 2P94A 1H9IE 1QCPA 2Z3DA 1ELTA 1KTTB 5HM9A 4JZIA 3PROA 3F9HA 1BZXE 4CHAC 4OS2A 4XDEA 2H6MA 3RMNH 3M7QA 4E7NA 1GVZA 2SGDE 4KGAA 1T32A 1SSXA 1A0JA 3RU4D 2VWNA 2AFQB 3A8AA 2FZZA 1RRKA 1TPAE 2PSXA 3BTWE 3TJNA 2XYAA 1HAOH 3VGCC 1D3TB 4B2AA 3MOCA 3ZZCA 4FU8A 1XKBC 2B5TB 4FU7A 2BD3A 1WU1A 3SV2H 1CGIE 5CE1A 3STJA 2GT8A 4CRCA 3VB6A 1Y3UA 5EGMA 3W95A 4OS5A 4CHAB 2ZA5A 4MPUA 1DXWA 1CGHA 1O3PB 5EQRA 4Y8ZA 5A09A 1UVUH 1V2NT 1Q3XA 2XCFA 3SUEA 1SQTA 2KAIA 4B1TA 1THPB 4MPWA 2PTCE 1Z6JH 2VWLA 3U8RH 1INCA 2V3HH 1TWXB 2BDBA 3FANA 1AHTH 3M37A 1L1GA 1SQOA 2CMYA 1LPKB 1W14U 3TNTA 2AGIX 1GBBA 1RGQA 4JYVH 3KIDU 2VWOA 3F9EA 4ABAA 1KDQB 2RDLA 5A0AE 5E0HA 4A1TA 2ZIQH 5FAHA 1C1RA 1ETSH 1SLWB 2BM2A 3UWJH 4D76A 1GI5A 4MVNA 2ZHEH 2FYRA 2W3IA 1GI6A 3LC5A 1QQ4A 4UDWH 4D8NA 2OBOA 3MH7A 1EOJA 1AO5A 4MLFB 1Z6EA 2BOKA 1F7ZA 2AEIH 3M3SA 1Z1JA 1ELFA 2BD2A 1QB1A 3KQBA 3FP8E 1LO6A 3SJIA 1BMNH 1P9SA 1V2WT 1HNEE 5EXLA 3HK6B 2ODYB 1ZMNA 1UHBB 8KME2 1EB2A 5F6MA 3SI4H 4ABIA 1N6XA 2D2DA 3D65E 1JIMA 4DG4A 1Z8GA 1GMDF 1T8LA 5JYIA 1VJ9U 3UWIA 4JZEH 2AIQA 4CRAA 1XUHA 1QJ6B 1O2TA 3SNDA 1BTXA 3FZDA 2ZP0H 1EOLA 2ALPA 3ZVCA 2NU1E 3BTKE 2IJOB 3ELAH 2Q1JA 1LKBA 3UPEA 1A3BH 2ZDKA 3BTEE 1DANH 3P17H 5F03A 2XNIA 3FP7E 2OINA 2ZFRH 1O2GH 3BF6H 4WH8A 2TGAA 2A4RA 4BNRA 3ATLA 3SJOA 3RXJA 2QA9E 3V3MA 3T25A 1WAYB 1G3BA 3BIUH 1HIAA 1MBQA 2PUXB 3ZZBA 5C1UA 2ODQA 5DG6A 1YBWA 4Z6AH 4GPGA 1WSSH 4RKJB 1C2GA 2WV4A 1LTOA 5E8EH 1L1JA 1ZR0A 2C4FH 2F3CE 5TJXA 1YM0A 3SU3A 1IQNA 4UFDH 2VIOA 1LVMA 1YLDA 3EDXB 3Q76A 4NZQA 4FUDA 2ZU1A 2OLGA 1AKSB 1DWCH 2FM2A 1BTUA 4YT7H 1FY8E 2NU3E 3T2NA 1SL3A 3A7TA 5DP5A 2Y7XA 4XBBA 2B8OH 4FUFA 3QGNB 1Y5UT 2BX3A 1UVSH 5T6DA 1UTNA 1YPHC 3E0NB 4FUIA 3SN8A 1TGSZ 1CU1A 2FX6A 1FY3A 2SNVA 1C5SA 1PFXC 1G2MA 2QXHA 5A8ZA 2HLCA 1QL8A 3KEEA 1OP2A 2NU4E 4X0WU 4ZHMU 3O8DA 2PR3A 1GL0E 4CBOA 1YPGH 1AFQB 2W26A 3D23A 4B75A 4AG2A 3P6ZB 1TE0A 2FPZA 1MZDA 1EPTA 5AFYH 3EA9A 2BD5A 4NIYA 1A5GH 2HNTC 2ZG0H 2VH6A 1O3BA 5HXFA 1CQQA 1Y5AT 1O3EA 1K1PA 2Y82A 1QURH 4WF8A 1HAIH 1GJCB 1MBMA 3BTDE 3RU4E 1FMGA 3VFEA 1JIRA 1HBTH 2F91A 3LOXA 4RKOB 3DFLA 1UCYK 1DSUA 3A7ZA 1AWHB 3EAJA 1HAZB 5EQSA 1ZSLA 2J2UA 1UTOA 2QXGA 2ZCLP 3BEUA 3FP6E 1BBRH 1AUJA 1MAYA 3S9AA 1S82A 1BMLA 1N8OC 3RUOA 5J4SA 3UR6A 1TYNA 3BG4C 1K1JA 1GI8B 2HVXA 4WXIA 3TJVA 3ZZ9A 2Q6FA 2FMJA 2G4TA 3Q3YA 3TH4H 3MH4A 1ELAA 4GAWA 1BTYA 1NROH 3MTYA 3T26A 1HCGA 6GCHG 5DP3A 3E16B 1IQKA 2SNWA 2A5KA 1GJDB 1LHDH 3LC3A 1MD7A 3U9AH 1KXCA 5DP6A 4ZKRU 1UVPA 3ZZ7A 4GHTA 3SU4A 3RXDA 4DOQA 1C5UA 3LJOA 1MTUA 2C93B 1P2OA 1N8OB 1HJ8A 2A32A 3BG4B 3GCNA 2ZTXA 3SHAH 4NA7A 3GY3A 4U01A 3GICB 3UY9A 2H5DA 3Q00A 1CO7E 2V3OH 1WV7H 3E6PH 1E0FD 2BZ6H 1NFUA 3CS7A 2TIOA 5GCHF 1TBZH 1TGBA 2D26C 5TCCA 2ZKSA 2KAIB 3NCLA 3M36A 1WCZA 3P70B 4JMYA 1P02A 3DT0H 1ZJDA 3CS0A 1G30B 1PPGE 4AN7A 4FVBA 1J14A 2PKAA 1AZ8A 2CF9H 4AB8A 4HGCA 1ZMLA 1W11U 2GCHG 2THFB 1A5HA 4TPIZ 2A2XH 1EP6A 1O33A 4DW2U 4IW4E 1HAHH 3MNBA 3RXOA 1SMFE 1YLCA 1F92A 2WYGA 3PMJA 1ZHRA 5SGAE 8GCHF 4TY6A 2JETC 1UTMA 3L6PA 1V2VT 1O3GA 1HGTH 5E2OA 1TBRH 1OWIA 1UO6A 2TGDA 3QZRA 1P04A 4Q2KA 1P03A 1Z71A 3GDSA 5HGGA 3V12A 1TNGA 1GBFA 1GJ7B 1V2OT 4J2YB 2VINA 2QF3A 1DLEA 1C1SA 4HTCH 2H9HA 1CHGA 4NGAH 4NSVA 4H6TA 1BQYA 3K2UA 3A8DA 2I6QA 3M5NA 1MD8A 5JB9S 2UWLA 2PSYA 1P57B 1MMJN 2Z9GA 2H9TH 4U30A 2GDDA 1DY9A 3SUDA 1C5YB 2QAAA 2WUCA 2OP9A 1QBOA 4ISLA 4WMEA 3RU4T 4XFQA 3KNXA 2NU0E 1D4PB 1DWBH 2H2ZA 1DM4B 1P2JA 2HNTE 3AASA 5DP9A 5LPFA 3MNSA 1HIAB 2VIQA 3SNAA 4K1TA 1O36A 4MNVA 4NFFA 1TMBH 1YPEH 1YYY1 3OY5U 1LKAA 2EEKA 1YGCH 1YC0A 3AAVA 2XBYA 3SUFA 1G3CA 3SHCH 5EXNA 6GCHF 1EPTC 2ZI2H 2C8WB 1IQMA 4Y76A 3D62A 2ZHDA 3EQ0H 1J8AA 1O3MA 1GJ6A 1FY4A 1QRXA 3GY6A 3UQVA 3SU6A 1DE7H 2AH4X 1NZQH 1FV9A 3ZVFA 2ZU3A 3ATKA 2WPJS 3CP7A 4Z0KA 1TABE 2STBE 2J94A 2GTBA 1OWEA 1K22H 3P95A 3TH3H 1TX6A 1P11E 3LGTA 1ETRH 5DKMA 3SJKA 4H4FA 3WY8A 4K2YA 4AYYB 1ZJKA 2WYJA 4O97A 3SU0A 1O3IA 1GBHA 1MH0A 1FUJA 1GI7B 1YCPK 1H1BA 1LVOA 1S0RA 2BDIA 1EPTB 1C4U2 1DICA 4DY7B 1P2MA 2ANYA 1NT1A 1GJ4H 2BLVA 4UFEH 1TNIA 4J1YA 3M5MA 5GXPA 2FOMB 1OYQA 1MZAA 2ZGCA 1OWJA 2JH6D 3ZYEA 1F5LA 2GVFA 3LPRA 2FTMA 2ZFQH 2Y80A 3SO3A 1TIOA 5J4QA 3RXGA 2BTCE 1SFQB 1SLXB 1ZHPA 2G51A 1O34A 1RD3B 2Z7FE 1LHFH 3SU1A 2D1JA 3Q77A 1TB6H 1MCTA 1QHRB 1P2QA 4I32A 1G2LA 1VR1H 4RN6A 5GIBA 4CR9A 2SGEE 2GCHF 1WQSA 1RFNA 3GCTF 1W3CA 1JWTA 3GY7A 1FNIA 1K1LA 3RC6A 4TWYA 2ANMH 2I6SA 2O8MA 1SB1H 2Y5FA 1GL1A 2WINI 4TPYA 1QB9A 1SVPA 4YOIA 1CT2E 1ANEA 3P92A 1CBWB 1P3CA 4JYUH 3TGKE 2G5NA 1TQ0B 4Y0YE 5A8XA 2P3TB 4B2CA 1V2UT 2ZGJA 4CRBA 1BT7A 2ZHFH 1Q31A 4R8TB 1WQVH 4DVAU 2ZDVH 1YKTA 3PTBA 4A1VA 1AZZA 3O8RA 1UVTH 3P8FA 3OX7U 1GVLA 3RC5A 1E38B 3RXBA 1A61H 2ZDMA 1KY9A 4I8HA 3EGKH 3FFGA 4A7IB 1DFPA 1OOKB 2A0QB 1V2PT 3VB5A 4VGCC 3SV6A 4YTAA 1PYTD 4AZ2B 1GI0A 4HFPB 5FCKA 3A7WA 4F49A 1HXFH 1NRQH 3UIRA 1C5TA 1HAXB 4XSKU 4GSOA 3KN2A 5L2ZH 4K5ZA 1PYTC 3LH1A 1RTFB 1S81A 3TIUA 1O2MA 5JPMH 2ZQ1A 3T5FH 1TNJA 1C1PA 2ZWLH 1FY5A 2PKAB 1GDQA 1C4V2 2QXIA 2ANWA 1MTVA 2Y5HA 3GISB 1C5QA 2XW9A 4X1RU 1K2I1 2ESTE 2F83A 4JK5A 3A7YA 2SGPE 3A80A 4YLUA 2FOEA 2G55A 5L30H 1GBMA 4VGCB 1SI5H 4Y71A 1HFDA 1D3DB 1HDTH 5GJ4B 3KQEA 2OCVB 1AGJA 2J9NA 1O2ZA 1V2JT 1YPMH 4H6SB 1UTKA 4MNWA 4WJG2 1QRWA 3T28A 3RXFA 2F9NA 1K9OE 1EAIA 1MU6B 2OC0A 4IMZA 2J4IA 4ZH8A 4OS7A 3NZIA 2UWPA 2ZFTA 1ELCA 4BAMB 3E8LA 1ZRKA 1TFXA 1C1TA 1D3QB 4GHQA 4X2XA 1TQ7B 1C5RA 1MU8B 2ILNA 4Y8YA 2GZ9A 2XCNA 3RXQA 7ESTE 1V2LT 1BA8B 2F9BH 1A3EH 3PTNA 3QK1A 1SOTA 1DOJA 4NFEA 3SZNA 3PMAB 3NXPA 5GPIB 2ODPA 1HV7A 2R0KA 1QB6A 4A92A 5ABWA 1C5MD 3BTME 3BV9B 1VJAU 2FI5E 1OYTH 1GCTC 2ZO3H 1D6WA 1TPOA 4I33A 4O3UA 3VGCB 5I46H 2GZ7A 2O8WA 1CSOE 2BY6X 2BY5X 1DWDH 2A7CA 1V3XA 2BQ6B 1OWDA 1W7GH 1O3KA 4JYTA 2FOCA 4LZ4B 1OX1A 4AX9H 1DUAA 1O5FH 1MQ6A 2JKHA 2J95A 3HGNA 4ABDA 3PB1E 2PGQB 1H8IH 1J17T 1T4UH 1LHGH 5DP7A 3M5LA 1O2VA 2TBSA 4K1SA 5C5OA 5JBTA 4ISIH 5JDUB 2HPQH 1BITA 5GDSH 3QLPH 1NC6A 5AHGH 1TOCB 1SGEE 1J9CH 3A87A 3S9CA 5AF9H 1O3JA 3T27A 1KLJH 4LXBH 3ZV8A 2LNCA 2ZU2A 5L6NH 2XWAA 4WY3A 5C67A 1BBRE 3Q3XA 3HKJB 1J15A 2VB0A 3TPIZ 4AFZA 1PPBH 1LQEA 4Y8XA 2QF0A 1T8NA 4AG1A 2BDAA 1GDNA 3HK3B 1ZSKA 1CHOF 1TRNA 1O5CB 3PLPA 1KXBA 2ZDLA 1LHCH 4BXWA 4ZMAH 1RJXB 2FLRH 2XBXA 3RXSA 5GCHG 3SJ9A 3TK9A 4DCDA 3AW1A 1ZGIA 1TALA 3LGUA 3RLYH 1NFXA 1P8VC 3CENA 3LKWA 4GVUA 3A86A 1FPHH 2FEQH 2J34A 1AU8A 1TAWA 1SC8U 3BTGE 3JZ1B 1YPKH 4KTUA 1ACBE 3NPSA 1V6DA 1Y3XA 2XBVA 1EASA 1BTPA 1GI2A 1XKAC 2F9OA 1SOZA 1LPZB 3RXCA 2SGFE 1XUGA 1IQHA 2VH0A 2ZPSA 1C5PA 3SBKA 1Y5BT 2HOBA 1DT2A 1LVBA 1H8DH 1P05A 1P2IA 2A7HA 2OQ5A 2WUBA 5E0JA 1XM1A 3QWCH 1C2IA 3GYLB 8GCHG 4I8JA 3ZVAA 2VIVA 1KLIH 1L4ZA 2OC1A 1OWHA 1NTPA 1ABJH 1KYNA 1O31A 1ELBA 2WPHS 2NU2E 3JZ2B 4THNH 1ZTKA 2JH0D 5FPYA 1IQGA 1GHWH 1JRSA 5F8ZA 3VXEH 1EKBB 2QV1A 1G32B 2GGVB 4JCNA 2O8LA 4YT6H 4B73A 3UFAA 1BMMH 2ZF0H 3GCHC 1N6YA 3ZVEA 1T4VH 2BXTH 1CGJE 3I78A 1A0LA 3P8GA 1NPMA 5FXLA 2PKSC 1ZPZA 1HAVB 1P2NA 1E37B 2ALVA 5JBBS 3SGAE 3TK5A 4CH8B 1BUIA 2XC4A 3BG8A 4CRGA 3RMLH 5CMXH 3UNRA 4SGAE 1QR3E 4Y10E 1IHSH 1IQJA 2RG3A 1TPSA 2GP9B 1P2KA 1BTHH 2ASUB 2A2QH 3GCHB 1O2OA 2CHAC 4CH2B 3GDUA 1S5SA 2IPHA 5DJ7A 6ESTA 1MKWK 1ZHMA 4MG3A 4B2BA 4BOHA 5LPEA 2XTTB 2PKSB 3TJOA 1V2KT 1BTWA 3LONA 1Q2WA 3VB7A 4U32A 3Q3KA 3LH3A 1VCQA 2C8YB 4FUEA 1O35A 2F9UA 1FAKH 2Z3CA 1NO9H 1W12U 1WTHD 2YNBA 1GG6C 4YM9A 4WXVA 4ZKSU 1BOQA 1MKXH 3RXIA 5A0BA 1P9UA 2A7JA 3F9FA 3MH6A 4XE4A 2CHAB 3B8JA 3L3TA 2BB4A 4MDSA 2P8OC 2W3KA 4WH6A 1H4WA 3E1XB 5T3HA 4GCHF 1AE5A 3H7TA 4IC6A 1HAPH 4NSYA 1V2RT 2ZECA 3EE0B 1BRAA 4AFQA 1O37A 1DDJA 3K9XB 1O32A 1VITG 1Z8JB 1VZQH 1C2DA 3S7HB 2VVCA 1QJ1B 2BXUH 5C20A 1C1MA 2AGEX 1SHYA 1ZTLA 1MQ5A 4K8YA 6CHAC 1AVGH 3RC4A 1O3OA 1YPJH 2BVRH 3ZYDA 1G36A 1WYKA 1DLKB 1P0SH 1MTNC 1SGNE 2BOHB 2Q6DA 3FZZA 4DURA 1O2SA 2F9VA 1KXFA 4FVDA 1FIZA 3ENSB 1NN6A 2OC7A 3PLBA 2FXRA 3A8CA 4AORA 3UREA 1GHVH 2ZHQH 2ZGHA 2GT7A 1C2EA 1H9HE 1VITH 2P3UB 4NCYA 3RXMA 1T8MA 5EXMA 2G8TA 2BD7A 6CHAB 2CJIA 1Z1IA 1O3DA 3GCTG 2ZFPH 2GV6A 3LJJA 4NIXA 4DGJA 3F9GA 5JB8S 1MTNB 4IBLH 1PQ8A 4MPVA 3O8CA 2FS9A 2VNTA 4MNXA 3ATMA 1CA8B 2YNAA 1QY6A 2DE8A 3BEIB 4X1PU 1Y59T 4NIVA 5LPRA 3I29A 4E05H 3OSYA 3TVJB 2K1QA 3AAUA 1ZRBA 4FUBA 1C2FA 1S6HA 4OGYA 3SGBE 3A82A 2FOAA 3LDXH 1TX7A 5H4IB 1NM6A 1TONA 1ESAA 3A89A 3ITIA 1LDTT 3K65B 4WVPE 1EAXA 1O2PA 3GYMA 5C1YA 1Z7KA 1NRSH 1SGFG 2HRVA 2HPPH 2VIDA 4QT8C 4Q7YA 1YPHE 1ELEE 2JETB 4FUJA 5EQQA 2ZFFH 4XBDA 1UTPA 4O3TA 1VGCC 3RXUA 2PUQH 1O2QA 1NRRH 4ASHA 3U8TH 1O30A 1GI4A 5JBCS 1O3AA 1SGYE 4FXGH 3B23B 3DD2H 3IITA 5FX6A 3RM0H 1GGDC 3RDZA 1V2MT 1ZYOA 2FX4A 3RM2H 3PWCA 4DT7B 1IQFA 1MUEB 1NESE 1HB0B 1P12E 1SGTA 1SPJA 1UK3A 2TRMA 2FOHA 2W5EA 3GY8A 1Y3WA 1TNLA 2ZGXH 4JK6A 1EJMA 1GHZA 1VGCB 1A2CH 1C5ZB 2FTLE 2W7UA 3NWUA 1AMHA 4CRDA 3PV4A 4FU9A 2VVVA 3VPKA 1AUTC 1CA0C 1VCPA 1GGDB 3SJ8A 1K1IA 1O3LA 4A5TS 4I8GA 3GOVB 1F0RA 2ZU4A 1C2KA 4X1SU 5HM2A 3R0FA 1DY8A 1TGCA 1L0ZA 4DIHH 1P3EA 1GBLA 3MH5A 4F4OC 1P09A 1RS0A 3KQCA 1HYLA 1C4Y2 3LGWA 3GDVA 2OBQA 4H42U 3MWIU 1V2TT 3SU5A 4A1XA 1WBGB 2FLBH 1HJAC 1NS3A 2G5VA 1UK4A 2BVXH 5E2PA 1DPOA 3EA7A 1VITF 4X2WA 1W8BH 3SV7A 2FOFA 4E7RG 1WOFA 2EI8A 2P3FH 3NUMA 3AVZA 4Y6DA 4INLA 2BY8X 1CT0E 1W2KH 4X8UH 2XRCA 2ZQ2A 1DSTA 1S0QA 5FX5A 4BAQB 1TGTA 1OSSA 3C1KA 3SNCA 3RXVA 3OYPA 3A83A 1CE5A 4BXSA 4ESTE 2Z94A 1C9PA 1D9IA 9ESTA 1FY1A 2VGCC 2CXVA 1K1OA 1EAWA 2VIWA 1QNJA 1C5NH 2FOBA 5ESBA 1ANDA 2Y81A 2V6NA 1TBQH 2BDHA 1ZTJA 4KTCA 1O2WA 3ODDA 6LPRA 4K8BA 1DX5M 3RXTA 1O5DH 1FPCH 3E90B 1P01A 2PLXA 5AVDA 5LH8A 1SBWA 4IN2A 3M3TA 2EI6A 3SOSA 1NRNH 2R3UA 2VGCB 1A0HB 3MU8A 1AIXH 3MU0A 4HI3A 4WWYA 2G52A 1UCYH 1TLDA 4FUHA 2XXLA 1CHOG 2ZDAH 1ARCA 1BB0B 4IS5A 3RXLA 1C5OH 3RMOH 1ZPBA 4U2WA 5DP8A 4YESB 1SQAA 1QL7A 1BBRK 2P59A 2ZCHP 1C5VA 3M3VA 1ID5H 1MTWA 2SGQE 1BIOA 4D7GA 1GMCG 2RA3A 1L2EA 1EZUC 3A8BA 2XC0A 3D49H 1XUIA 2BD9A 1VCWA 1WTGH 3MO9A 2CN0H 5F8TA 3ZZ6A 2OQUA 2GCTC 2ZTZA 2PHBA 2O9QA 2PGBB 3QZQA 1W10U 2DUCA 1O2IA 5EPYA 1EZSC 3GY4A 2Z9JA 4BANB 1GI3A 1MAXA 2G4UA 5PTPA 1JBUH 3SUGA 1GJAB 1HPGA 1RIWC 2AERH 1ZPCA 1O3CA 3TITA 5DPAA 2AMQA 2BYAX 4ABJA 3B9FH 1GWAA 1UTQA 5F8XA 1GMHG 4IN1A 1Y3YA 9LPRA 3LIWA 1AVWA 1A7SA 1KXDA 1TRMA 3FAOA 1C1QA 1C5XB 1GJ9B 2FI3E 2C90B 3MHWU 4X6PA 2HWLB 1YPLH 3U98H 2GCTB 5K0HA 2BLQA 3DUXH 8ESTE 3ZVGA 2B7DH 2ZU5A 2O8UA 4AYVB 1X7AC 4MQAA 1K21H 1FXYA 5AFZH 1L4DA 4KKDA 1RIWB 4IMQA 2AGGX 3E91A 1U6QA 4Q80A 4KELA 1FI8A 4K1EA 2Z6BD 2BY9X 1T7CA 2BDYA 4AOQA 1B0FA 1ZZZA 2CV3A 3BIVH 1C2HA 4I8LA 1B7XB 2QC2A 4X1QU 2PWXA 4B76A 1KSNA 1C1WH 2ZDNA 1QJ7B 1KIGH 1WUNH 3U8OH 3TLOA 1HLTH 4NA8A 2GZ8A 5T6FA 5E0GA 5G4BA 1BJUA 3LU9B 1EAUA 3ZZ8A 4D7FA 4Y7BA 3M7UA 1RTKA 4OGXA 4Y0ZE 3VEQB 1ZSJA 2HALA 2R0LA 3RXHA 3SORA 1C1VH 1AD8H 4IGDA 4CREA 1XVMA 1ORFA 4UD9H 1SGDE 1QQUA 4NG9H 4CRFA 4CBNA 1TGNA 1Z8IB 3RXKA 3E3TA 4HZHA 1NFWA 1A5IA 1ABIH 4ZHAA 1O2UA 1GCTB 1SGCA 1V2ST 1QA0A 2UWOA 1AE8H 1XUKA 5EOKA 3A84A 1IHTH 2A5IA 3DFJA 4GCHG 1SHHB 1O2KA 5B6OA 4X2VA 4I31A 3ZVBA 2HNTF 4A6LA 3ZV9A 3A7VA 1THSH 1LMWB 3L33A 3P8OA 3PMBB 3QUMP 2FP7B 1DWEH 1FAXA 1PPEE 2QY0B 1PPFE 1G9IE 4O9VA 2R9PA 2TGTA 1GHAF 4RSPA 3OU0A 2ZZUH 3RP2A 1OPHB 4O03A 5FPTA 3SGQE 3RXPA 4UONA 3TJUA 5DO4H 5C2ZA 5JBAS 1OP8A 1TMTH 3GY5A 1QBVH 2AYWA 3STIA 2BLOA 4MPXA 4ZXYH 3ZZ5A 4YLQH 2XC5A 3F68H 3EA8A 3UOUA 3PLKA 1GMCF 1IQEA 1EQ9A 3BTFE 5DGJA 4B74A 3HGPA 2AIPA 2F9PA 1BRBE 1F0TA 1JMOH 4X6OA 4BTUB 1GHYH 2PW8H 2SFAA 1C5WB 4BAKB 1TA6A 1BRUP 1O2NA 2A45B 4ZXXH 3UOPA 2RA0A 3SU2A 5FCRA 1BHXB 1MCVA 2ZFSA 3BEFB 3TH2H 5EW2H 1TMUH 1AB9C 4KTSA 1K28D 4E06H 2OUAA 1T8OA 1SFIA 1NU7B 1O2HA 5A0CA 1S83A 4OS4A 1YCPH 3A85A 1D3PB 1K1MA 1AFEH 3RXEA 1S84A 1O38A 4IC5A 2Y7ZA 2Z9IA 5EG4A 3OTJE 1QA7A 4Q7XA 1P10A 2VIPA 4ISOA 4XOJA 4MNYA 1FONA 1GMHF 1DUEA 5HMAA 2ZPQA 5BRRE 1IQLA 1C2JA 2O8TA 2JH5D 2RCEA 5TCAA 1AFQC 4D9QA 2B9LA 1L1NA 1UJ1A 2FOGA 4SGBE 2QXJA 1O39A 2BQ7B 2CF8H 2ZEBA 1AB9B 2R2WU 1IOEA 1IAUA 3S0NA 1SGPE 1GJBB 1G37A 2NWNA 1UVOA 2H9EH 3T29A 2EI7A 2UUJB 1ETTH 1AWFH 1JXPA 2DE9A 3DA9B 4LK4A 2QN5T 4R0IA 4AGJA 2A5AA 1S85A 2WPIS 2AMDA 4OS6A 3ZZDA 3ODFA 3W94A 3LGYA 4X2YA 3TK6A 4I7YH 1O5GH 1EJAA 3ATWA 1GJ8B 1DS2E 2FDAA 5DP4A 1SG8B 3SQEE 1O3FA 2ZGBH 2J92A 1O2YA 2ANKH 3UUZA 2BMGB 1G3DA 4K60A 5EW1H 3HPTB 1UMAH 4ABEA 1JOUB 4YZUA 3GCOA 1XMNB 1C9TA 3PO1C 4X6MA 1QIXB 2LPRA 2XBWA 1GJ5H 1KXEA 2GV7A 3N7OA 5ESTE 1FN6A 1GBAA 1XXDA 1EUFA 3H7OA 7LPRA 3KF2A 2YOLA 4AGKA 4ISHH 3A88A 4ZHLU 2WPMS 1UTLM 1AVXA 7GCHG 3M5OA 5IDKA 3TU7H 2ZTYA 2C8ZB 2BLWA 1SLVB 2Y6TA 4UFGH 1OP0A 1DXPA 1NU9A 3TNSA 1RTLA 3HKIB 3PO1B 1J16A 3SI3H 2ZNKH 4I8KA 3S9BA 3RLWH 2FS8A 1Y8TA 4ISNA 1O3HA 1FJSA 1PQAA 2WV5A 5FPSA 5EPNA 4ZKOU 5L2YH 2Z9LA 2FESH 3KHVA 1O2JA
chains in the Genus database with same CATH superfamily
2XWBI 1KLTA 3QGJA 1GG6B 8LPRA 1E1RD 1GBEA 2V0BA 3PMHB 3M7TA 2P16A 3ZZ3A 2BVSH 3ZZAA 4Q7ZA 2QYIA 4ACBA 2ZCKP 1FZZA 5T6GA 3NRLA 1FDPA 1SGIB 1TRYA 2P8OB 2G81E 2GD4B 1S6FA 4M7GA 1C2MA 3A81A 4ZAEA 5A8YA 1PPZA 1TA2A 3SNBA 1CVWH 1B5GH 1PQ7A 3G01A 3PV5A 4FUCA 5EODA 1GBCA 3SQHE 4LZ1H 1O0DH 1N1LA 3FO8D 1YF4A 3SV8A 1XUJA 2OTVA 1HUTH 5C17A 3MO6A 2V35A 1C1UH 2QCYA 2ZPRA 2ULLA 2VWMA 4NA9H 3V0XA 1QFKH 4K69A 1FN8A 3RMMH 4WMDA 2P95A 1W7XH 4NWLA 1ANCA 1OXGA 1EJNA 1SGRE 4FUGA 2Z3EA 2B0FA 4DIIH 4YO9A 3MNXA 2Q6GA 1F2SE 1BDAA 1F5RA 2FI4E 4AB9A 1QRZA 2UUYA 3VXFH 4B71A 3E0PB 1GHBG 1XUFA 1BRCE 2PFEA 1QTFA 1HAYB 4XD7D 3EYDA 3PM3A 4X8SH 4ZROA 3LGVA 3UTUH 2BDGA 2FWWA 1TNHA 1O3NA 3UR9A 1T31A 3MO3A 4JZFH 3S69A 1NFYA 3V7TA 2QGRA 2V3MA 1AY6H 1TOMH 1C1NA 3UB0A 3QTVH 1LHEH 1MTSA 2AMPA 1LPGB 2VBCA 1ELVA 1XVOA 2A4QA 3URDA 4INKA 3KGPA 2IOTA 1PPCE 1FLEE 4JZDH 3PYHA 4NWKA 2C3SA 2OC8A 5BPEA 3MI4A 5EJ1A 1GDUA 1UTJA 2Z9KA 4YOJA 1HAGE 2BY7X 1O2RA 1LCYA 1ESTA 1KTSB 2R3YA 5IYTA 3MMGA 1EATA 1HRTH 1UCYE 1EFRD 3KYGA 1NRPH 2WPLS 3MYWA 1Y3VA 1OWKA 2G00A 1Z8RA 3LGIA 3MFJA 1RXPA 1A4WH 3QDZB 3IWMA 4ABFA 4X1NU 3V13A 2GDEH 1W0ZU 2ZC9H 1NY22 2TPIZ 1EX3A 5FBIA 2J97A 5C1XA 3U1JB 3QO6A 1DVAH 1GBKA 1BJVA 2EC9H 3VB3A 1D6RA 1BCUH 1BMAA 1TX8A 1KDQA 1IQIA 3QX5H 2SGAA 3LT3A 3ZVDA 3KL6A 1ZGVA 4X8TH 4GUXA 3UNQA 1OS8A 4WMFA 2A4GA 3T62A 7GCHF 1OHHD 3F0PA 1PPHE 3BN9A 4AFSA 3A7XA 3MNCA 4NIWA 4KP0A 1F0SA 4ASUD 3ESTA 3BTTE 3K6YA 1ZMJA 1SGFA 3TGJE 3O8BA 1GI1A 1S6LA 4BAHB 1E36B 1THRH 4AFUA 1GBJA 3SNEA 2UUKB 1O2XA 5C5NA 3KQDA 1CA0B 3NK8A 1P06A 2P93A 1UHBA 4BTIB 2FYQA 2BZAA 1W13U 4YOGA 2KCOA 1SR5C 1XX9A 3U1IB 1SLUB 1UK2A 2FO9A 3KCGH 4GLYA 4TWWA 4UEHH 2A31A 1AQ7A 1ELDE 3M35A 4ABHA 3MU5A 7KMEH 5K7RA 2VVUA 1AN1E 4UFFH 3FVFB 1CT4E 3SV9A 1E34B 1PQ5A 2BX4A 5FHTA 1A46H 3S7KB 1KXAA 3HATH 1HJAB 1O5EH 1K1NA 2A4OA 1V2QT 2H1UA 3H5CB 1C1OA 3OY6U 3P8NA 4MTBA 1GCDA 1M9UA 3K6ZA 2BHGA 4TY7A 3F1SB 5FBEA 4Y11E 2VJ1A 2STAE 4ZUHA 2HGTH 4Y7AA 2BDCA 4ABGA 1ESBA 4LOYH 4BAOB 2WPKS 1O5BB 5T1VA 3VB4A 2OXSA 1MABB 2J38A 1CBWC 1EB1H 5LGOA 1H9LB 1YP9A 3F6UH 3M61U 5HYOA 3UNSA 4X6NA 1ANBA 1DITH 1C5LH 1FQ3A 4OS1A 4UE7H 2FODA 2UUFB 5EU8A 1AKSA 3MU4A 2GX4A 4DJZB 3ATIA 5A2MH 3TGIE 2FIRH 2A1DB 1GHBF 1QBNA 1PJPA 2QIQA 2BQWB 4NZLA 1GHAG 2OD3B 3BTQE 3MU1A 2AS9A 3RXAA 1MKWH 3C27B 3IG6B 5I25A 2D8WA 3ZZ4A 5CHAC 4ZKNU 1F0UA 2W7SA 2CGAA 1W0YH 2PTNA 2BD8A 3DHKH 1GPZA 1ARBA 1GI9B 3SW2B 1JRTA 1GMDG 2GKVE 5ETXA 2Y5GA 4JZ1A 2H5CA 4INHA 3QN7A 1LQDB 1TNKA 2TGPZ 3RXRA 1HXEH 2KFWA 2GMTC 1HJ9A 4K3JA 1ZLRA 4Y79A 1HAVA 2BD4A 1GBTA 1XXFA 2IN2A 4XBCA 1QGFA 4FETA 3R3GB 1MKXK 3PWBA 5C3NA 2YMSC 2R2MB 1YCPM 1E35B 1SGQE 5CHAB 1B0EA 3BSQA 3WWBA 1QL9A 3AW0A 1EZXC 1GHXH 1A1RA 1EZQA 1OKXA 1LVYA 1GBIA 3NKKA 2VU8E 2ZHWH 3GY2A 4CR5A 3URCA 2AHME 1O5AB 2C8XB 2JIZD 4ABBA 4PROA 1TPPA 1EP5A 1AI8H 1ELGA 3BTHE 3QTOH 1BTZA 2EA3A 2GMTB 1ZOMA 2M5TA 3PRDA 4BTTB 1FIWA 1G3EA 1EXFA 4TYDA 1F5KU 2PV9B 4X8VH 1GBDA 1C2LA 1BHXF 3U69H 1GVKB 5DK1A 1O2LA 3I77A 4D9RA 5GWZA 3UQOA 2P94A 1H9IE 1QCPA 2Z3DA 1ELTA 1KTTB 5HM9A 2KCYA 2KR7A 3PROA 4JZIA 3F9HA 1BZXE 4CHAC 4OS2A 4XDEA 2H6MA 3RMNH 3M7QA 4E7NA 3DSPA 1GVZA 2SGDE 4KGAA 1T32A 1SSXA 1A0JA 3RU4D 2VWNA 2AFQB 3A8AA 2FZZA 1RRKA 1TPAE 2PSXA 3BTWE 3TJNA 2XYAA 1HAOH 3VGCC 1D3TB 4B2AA 3MOCA 3ZZCA 4FU8A 1XKBC 2B5TB 4FU7A 2BD3A 1WU1A 3SV2H 1CGIE 1QZ8A 5CE1A 3STJA 2GT8A 4CRCA 3VB6A 1Y3UA 5EGMA 3W95A 4OS5A 4CHAB 2ZA5A 4MPUA 1DXWA 1CGHA 1O3PB 5EQRA 4Y8ZA 5A09A 1UVUH 1V2NT 1Q3XA 2XCFA 3SUEA 1SQTA 2KAIA 4B1TA 1THPB 4MPWA 2PTCE 1Z6JH 2VWLA 3U8RH 1INCA 2V3HH 1TWXB 2BDBA 3FANA 1AHTH 3M37A 1L1GA 1SQOA 2CMYA 4AC9A 5EJLA 1LPKB 1W14U 3TNTA 2AGIX 1GBBA 1RGQA 4JYVH 3KIDU 2VWOA 3F9EA 4ABAA 1KDQB 2RDLA 5A0AE 4RI0A 5E0HA 4A1TA 2ZIQH 5FAHA 1WXRA 3F2GA 1C1RA 1ETSH 1SLWB 2BM2A 3UWJH 4D76A 1GI5A 4MVNA 2ZHEH 2FYRA 3KYFA 2W3IA 1GI6A 3LC5A 5CDFE 1QQ4A 4UDWH 4D8NA 2OBOA 3MH7A 1EOJA 1AO5A 4MLFB 1Z6EA 2BOKA 1F7ZA 2AEIH 3M3SA 1Z1JA 1ELFA 2BD2A 3PRBA 1QB1A 3KQBA 3FP8E 1LO6A 3SJIA 1BMNH 1P9SA 1V2WT 1HNEE 5EXLA 3HK6B 2ODYB 1ZMNA 1UHBB 8KME2 1EB2A 5F6MA 3SI4H 4ABIA 1N6XA 2D2DA 3D65E 1JIMA 4DG4A 1Z8GA 1GMDF 1T8LA 5JYIA 1VJ9U 3UWIA 4JZEH 2AIQA 4CRAA 1XUHA 1QJ6B 1O2TA 3SNDA 1BTXA 3FZDA 2ZP0H 1EOLA 2ALPA 3ZVCA 2NU1E 3BTKE 2IJOB 3OEED 3ELAH 2Q1JA 1LKBA 3UPEA 1A3BH 2ZDKA 3BTEE 1DANH 3P17H 5F03A 2XNIA 3FP7E 2OINA 2ZFRH 1O2GH 3BF6H 4WH8A 2TGAA 2A4RA 4BNRA 3ATLA 3SJOA 3RXJA 2QA9E 3V3MA 3T25A 1WAYB 1G3BA 3BIUH 1HIAA 1MBQA 2PUXB 3ZZBA 5C1UA 2ODQA 3EE7A 5DG6A 1YBWA 4Z6AH 4GPGA 1WSSH 4RKJB 1C2GA 2WV4A 1LTOA 5E8EH 1L1JA 1ZR0A 2C4FH 2F3CE 5TJXA 1YM0A 3SU3A 1IQNA 4UFDH 2VIOA 1LVMA 1YLDA 3EDXB 3Q76A 4NZQA 4FUDA 2ZU1A 2OLGA 1AKSB 1DWCH 2FM2A 1BTUA 5GNDA 4YT7H 1FY8E 2NU3E 3T2NA 3N99A 1SL3A 3A7TA 5DP5A 2Y7XA 4XBBA 2B8OH 4FUFA 3QGNB 1Y5UT 2BX3A 1UVSH 5T6DA 1UTNA 1YPHC 3E0NB 4FUIA 3SN8A 1TGSZ 1CU1A 2FX6A 1FY3A 2SNVA 1C5SA 1PFXC 3OE7D 1G2MA 2QXHA 5A8ZA 2HLCA 1QL8A 3KEEA 1OP2A 2NU4E 4X0WU 4ZHMU 3O8DA 2PR3A 1GL0E 4CBOA 1YPGH 1AFQB 2W26A 3D23A 4B75A 4AG2A 3P6ZB 1TE0A 2FPZA 1MZDA 1EPTA 5AFYH 3EA9A 2BD5A 4NIYA 1A5GH 2RFKC 2HNTC 2ZG0H 2VH6A 1O3BA 5HXFA 1CQQA 1Y5AT 1O3EA 1K1PA 2Y82A 1QURH 4WF8A 1HAIH 1GJCB 1MBMA 3BTDE 3RU4E 1FMGA 3VFEA 1JIRA 3H09A 5EIYA 1HBTH 2F91A 3LOXA 4RKOB 3DFLA 1UCYK 1DSUA 3A7ZA 1AWHB 3EAJA 1HAZB 5EQSA 1ZSLA 2J2UA 1UTOA 2QXGA 2ZCLP 3BEUA 3FP6E 1BBRH 1AUJA 1MAYA 3S9AA 1S82A 1BMLA 1N8OC 3RUOA 5J4SA 3UR6A 1TYNA 3BG4C 1K1JA 1GI8B 2HVXA 4WXIA 3TJVA 3ZZ9A 2Q6FA 2FMJA 2K8IA 2G4TA 3Q3YA 3TH4H 3MH4A 1ELAA 4GAWA 1BTYA 1NROH 3MTYA 3T26A 1HCGA 6GCHG 5DP3A 3E16B 1IQKA 2SNWA 2A5KA 1GJDB 1LHDH 3LC3A 1MD7A 3U9AH 1KXCA 5DP6A 4ZKRU 1UVPA 3ZZ7A 4GHTA 3SU4A 3RXDA 4DOQA 1C5UA 3LJOA 1MTUA 2XNDD 2C93B 1P2OA 1N8OB 1HJ8A 2A32A 3BG4B 3GCNA 2ZTXA 3SHAH 4NA7A 3GY3A 4U01A 3GICB 3UY9A 2H5DA 3Q00A 2WPDD 1CO7E 3N7EA 2V3OH 1WV7H 3E6PH 1E0FD 2BZ6H 1NFUA 3CS7A 2TIOA 5GCHF 1TBZH 1TGBA 2D26C 5TCCA 2ZKSA 2KAIB 3NCLA 3M36A 2IPQX 1WCZA 1YLNA 3P70B 4JMYA 1P02A 3DT0H 1ZJDA 3CS0A 1G30B 1PPGE 4AN7A 4FVBA 1J14A 2F43B 2PKAA 1AZ8A 2CF9H 4AB8A 4HGCA 1ZMLA 1W11U 2GCHG 2THFB 1A5HA 4TPIZ 2A2XH 1EP6A 1O33A 4DW2U 4IW4E 1HAHH 3MNBA 3RXOA 1SMFE 1YLCA 1F92A 2WYGA 3PMJA 1ZHRA 2WSSD 5SGAE 8GCHF 4TY6A 2JETC 1UTMA 3L6PA 1KMHB 1V2VT 1O3GA 1HGTH 5E2OA 1TBRH 1OWIA 1UO6A 2TGDA 3QZRA 1P04A 4Q2KA 1P03A 1Z71A 3GDSA 5HKKD 5HGGA 3V12A 1TNGA 1GBFA 1GJ7B 1V2OT 4J2YB 2VINA 2QF3A 1DLEA 1C1SA 2HVYB 4HTCH 2H9HA 2WHXA 1CHGA 4NGAH 4NSVA 4H6TA 1BQYA 3K2UA 3A8DA 2I6QA 3M5NA 1MD8A 5JB9S 2UWLA 2PSYA 1P57B 1MMJN 2Z9GA 2H9TH 4U30A 2GDDA 1DY9A 3KQ5A 3SUDA 1C5YB 2QAAA 2WUCA 2OP9A 1QBOA 4ISLA 4WMEA 2J98A 3RU4T 4XFQA 5DN6D 3KNXA 2NU0E 1D4PB 1DWBH 2H2ZA 1DM4B 1P2JA 2HNTE 3AASA 5DP9A 1E1QD 5LPFA 3MNSA 1HIAB 2VIQA 1H8HD 2J5UA 4B6FA 3SNAA 4XRNA 4K1TA 1O36A 4MNVA 4NFFA 1TMBH 1YPEH 1YYY1 3OY5U 1LKAA 2EEKA 1YGCH 1YC0A 3AAVA 3UAIC 5IK2D 2XBYA 3SUFA 1G3CA 3SHCH 5EXNA 6GCHF 1EPTC 2ZI2H 2C8WB 1IQMA 4Y76A 3D62A 2ZHDA 3EQ0H 1J8AA 1O3MA 1GJ6A 1FY4A 1QRXA 3GY6A 3UQVA 3SU6A 1DE7H 2AH4X 1NZQH 1FV9A 3ZVFA 2ZU3A 3ATKA 2LELA 2WPJS 3CP7A 4Z0KA 1TABE 2STBE 3W1EA 2J94A 2GTBA 1OWEA 1K22H 3P95A 3TH3H 3ZIAD 1TX6A 1P11E 2W6ID 3LGTA 1ETRH 5DKMA 3SJKA 4H4FA 3WY8A 4K2YA 4AYYB 1ZJKA 2WYJA 4O97A 3SU0A 1O3IA 1GBHA 1MH0A 1FUJA 1GI7B 1YCPK 1H1BA 1LVOA 1S0RA 2BDIA 1EPTB 1C4U2 1DICA 4DY7B 1P2MA 2ANYA 1NT1A 1GJ4H 2BLVA 4UFEH 1TNIA 4J1YA 3M5MA 5GXPA 2FOMB 1OYQA 1MZAA 2ZGCA 1OWJA 2JH6D 4B6EA 3ZYEA 1F5LA 2GVFA 5KEDA 3LPRA 2FTMA 2ZFQH 2Y80A 3SO3A 1TIOA 5J4QA 3RXGA 2BTCE 1SFQB 5B6LA 1SLXB 2V7QD 1FX0B 1ZHPA 2G51A 1O34A 1RD3B 2Z7FE 1LHFH 3SU1A 2D1JA 3Q77A 1TB6H 1MCTA 1QHRB 1P2QA 4I32A 3SZEA 1G2LA 1VR1H 4RN6A 5GIBA 4CR9A 2SGEE 2GCHF 1WQSA 1RFNA 3GCTF 1W3CA 1JWTA 3GY7A 1FNIA 1K1LA 3RC6A 4TWYA 2ANMH 2I6SA 2O8MA 4RT1A 1SB1H 2Y5FA 1GL1A 2WINI 4TPYA 1QB9A 1SVPA 4YOIA 1CT2E 1ANEA 3P92A 1CBWB 1P3CA 4JYUH 3TGKE 2G5NA 3CNRA 1TQ0B 2RDEA 4Y0YE 5A8XA 2P3TB 4B2CA 1V2UT 2ZGJA 4CRBA 1BT7A 2ZHFH 5HIYA 1Q31A 4R8TB 1WQVH 4DVAU 2ZDVH 1YKTA 3PTBA 2YMSD 4A1VA 1AZZA 3O8RA 1UVTH 3P8FA 3OX7U 1GVLA 3RC5A 1E38B 3RXBA 1A61H 2ZDMA 1KY9A 4I8HA 3EGKH 3FFGA 4A7IB 1DFPA 1OOKB 2A0QB 1V2PT 3VB5A 4VGCC 5HIZA 3SV6A 4YTAA 2EQNA 1PYTD 4AZ2B 1GI0A 4HFPB 5FCKA 3A7WA 5C94A 4F49A 1HXFH 1NRQH 3UIRA 1C5TA 1HAXB 4XSKU 4GSOA 3KN2A 5L2ZH 4K5ZA 1PYTC 3LH1A 1RTFB 1S81A 3TIUA 1O2MA 5JPMH 2ZQ1A 3T5FH 1TNJA 1C1PA 2ZWLH 1FY5A 2PKAB 1GDQA 1C4V2 2QXIA 2ANWA 1MTVA 2Y5HA 3GISB 1C5QA 2XW9A 1SQRA 2YMSB 1K2I1 2ESTE 4X1RU 2F83A 4JK5A 3A7YA 2SGPE 3A80A 4YLUA 4M9FA 2FOEA 2G55A 5L30H 1GBMA 4VGCB 1SI5H 4Y71A 1HFDA 1D3DB 1HDTH 5GJ4B 3KQEA 2JJ2D 4ACAA 2OCVB 1AGJA 2J9NA 1O2ZA 1V2JT 1YPMH 4H6SB 1UTKA 3FOAA 4MNWA 4WJG2 1QRWA 3T28A 3RXFA 2F9NA 1K9OE 1EAIA 1MU6B 2OC0A 4IMZA 2J4IA 2K0QA 4ZH8A 4OS7A 3NZIA 2UWPA 2KCAA 5KECA 2ZFTA 1ELCA 4BAMB 3E8LA 1ZRKA 1TFXA 1C1TA 1D3QB 4GHQA 4X2XA 1TQ7B 1C5RA 1MU8B 2ILNA 4Y8YA 2GZ9A 2XCNA 3RXQA 7ESTE 1V2LT 1BA8B 2F9BH 1A3EH 3PTNA 3QK1A 1SOTA 2L6OA 1DOJA 4NFEA 3SZNA 3PMAB 3NXPA 5DSFA 5GPIB 2ODPA 1HV7A 2R0KA 1QB6A 4A92A 5ABWA 1C5MD 3BTME 3BV9B 1VJAU 2FI5E 1OYTH 1GCTC 2ZO3H 1D6WA 1TPOA 4I33A 4O3UA 3VGCB 5I46H 2GZ7A 2O8WA 1CSOE 2BY6X 2BY5X 1DWDH 2A7CA 1V3XA 2BQ6B 1OWDA 1W7GH 1O3KA 4JYTA 2FOCA 4LZ4B 3DSGA 1OX1A 4AX9H 1DUAA 1O5FH 1MQ6A 2JKHA 2J95A 3HGNA 4ABDA 3PB1E 2PGQB 1H8IH 1J17T 1T4UH 1LHGH 5DP7A 3M5LA 1O2VA 2TBSA 4K1SA 5C5OA 5JBTA 4ISIH 5JDUB 2HPQH 1BITA 5GDSH 3QLPH 1NC6A 5AHGH 1TOCB 1SGEE 1J9CH 3A87A 3S9CA 5AF9H 1O3JA 3T27A 1KLJH 4LXBH 3ZV8A 2LNCA 2ZU2A 5L6NH 2XWAA 4WY3A 5C67A 1BBRE 4ZCNA 3Q3XA 3HKJB 1J15A 2VB0A 3TPIZ 4AFZA 1PPBH 1VKYA 1LQEA 1YWUA 4Y8XA 2QF0A 1T8NA 4AG1A 2BDAA 1GDNA 3HK3B 1ZSKA 1CHOF 1TRNA 3N7DA 1O5CB 3PLPA 1KXBA 2ZDLA 4YXWD 1LHCH 4BXWA 3AK5A 4ZMAH 1RJXB 2JDID 3F0OA 1SKYE 2FLRH 2XBXA 3RXSA 5GCHG 3SJ9A 3TK9A 4DCDA 3AW1A 1ZGIA 1TALA 3LGUA 3RLYH 1NFXA 1P8VC 3CENA 3LKWA 4GVUA 5C0UA 3A86A 1FPHH 2FEQH 2J34A 1AU8A 1TAWA 1SC8U 3BTGE 3JZ1B 1YPKH 4KTUA 1ACBE 3NPSA 1V6DA 1Y3XA 2F4LA 2XBVA 1NBMD 1EASA 1BTPA 5CHBA 1GI2A 1XKAC 2F9OA 1SOZA 1LPZB 3RXCA 2SGFE 1XUGA 1IQHA 2VH0A 2ZPSA 1C5PA 3SBKA 2GJGA 1Y5BT 2HOBA 1DT2A 1LVBA 1H8DH 1P05A 1P2IA 2A7HA 2OQ5A 2WUBA 4FOUC 4P00A 5E0JA 1XM1A 3QWCH 1C2IA 3GYLB 8GCHG 4I8JA 3ZVAA 2VIVA 1KLIH 1L4ZA 2OC1A 1OWHA 1UW7A 1NTPA 1ABJH 1KYNA 1O31A 1ELBA 2WPHS 1BMFD 2NU2E 3JZ2B 4THNH 1ZTKA 2JH0D 5FPYA 1IQGA 1GHWH 1JRSA 5F8ZA 3VXEH 1EKBB 2QV1A 1G32B 2GGVB 4JCNA 2O8LA 4YT6H 4B73A 3UFAA 1BMMH 2ZF0H 3GCHC 1N6YA 3ZVEA 1T4VH 2BXTH 1CGJE 3I78A 2CK3D 1A0LA 3P8GA 1NPMA 5FXLA 2PKSC 1ZPZA 1HAVB 1P2NA 1E37B 2ALVA 5JBBS 3SGAE 3TK5A 4CH8B 1BUIA 2XC4A 3BG8A 4CRGA 3F2FA 3RMLH 5CMXH 3UNRA 4SGAE 1QR3E 4Y10E 1IHSH 1IQJA 2RG3A 1TPSA 2GP9B 1P2KA 1BTHH 2ASUB 2A2QH 3GCHB 1O2OA 2CHAC 4CH2B 3GDUA 1S5SA 2IPHA 5DJ7A 6ESTA 1MKWK 1ZHMA 4MG3A 4B2BA 4BOHA 5LPEA 2XTTB 2OK5A 2PKSB 3TJOA 1V2KT 4Q63A 4F48B 1BTWA 3LONA 1Q2WA 3VB7A 4U32A 3Q3KA 3LH3A 3FKSD 1VCQA 2C8YB 4FUEA 1O35A 2F9UA 1FAKH 2Z3CA 1NO9H 1W12U 1WTHD 2YNBA 1GG6C 4YM9A 4WXVA 4ZKSU 1BOQA 1MKXH 3RXIA 5A0BA 1P9UA 2L74A 2KM0A 2A7JA 3F9FA 3MH6A 4XE4A 2CHAB 3B8JA 3L3TA 1W0KD 2BB4A 4MDSA 2P8OC 2W3KA 4WH6A 1H4WA 3E1XB 5T3HA 4GCHF 3U28C 1AE5A 3H7TA 4IC6A 3GS9A 1HAPH 4NSYA 1V2RT 2ZECA 3EE0B 1BRAA 4AFQA 1O37A 1DDJA 3K9XB 1O32A 1VITG 1Z8JB 1VZQH 1C2DA 3S7HB 2VVCA 1QJ1B 2BXUH 5C20A 1C1MA 2AGEX 1SHYA 1ZTLA 1MQ5A 4K8YA 4Z1MD 6CHAC 1AVGH 3RC4A 1O3OA 1YPJH 2BVRH 3ZYDA 1G36A 1WYKA 1DLKB 1P0SH 1MTNC 1SGNE 2BOHB 2Q6DA 3FZZA 4DT4A 4DURA 1O2SA 2F9VA 1KXFA 4FVDA 4TSFD 1FIZA 3ENSB 1NN6A 2OC7A 3PLBA 2FXRA 3A8CA 2QE7D 4AORA 3UREA 1GHVH 2ZHQH 2ZGHA 2GT7A 1C2EA 1H9HE 1VITH 2P3UB 4NCYA 3RXMA 1T8MA 5EXMA 2G8TA 2BD7A 6CHAB 3VG8A 2CJIA 1Z1IA 1O3DA 3GCTG 2ZFPH 2GV6A 3LJJA 4NIXA 4DGJA 3F9GA 5JB8S 1MTNB 4IBLH 1PQ8A 4MPVA 3O8CA 2FS9A 2VNTA 4MNXA 3ATMA 1CA8B 2YNAA 1QY6A 2DE8A 3BEIB 4X1PU 1NBME 1Y59T 4NIVA 5LPRA 3I29A 4E05H 3OSYA 3TVJB 2K1QA 3AAUA 1ZRBA 4FUBA 1C2FA 1S6HA 4OGYA 3SGBE 3A82A 2FOAA 3LDXH 1TX7A 5H4IB 1NM6A 1TONA 1ESAA 3A89A 3ITIA 1LDTT 3K65B 4WVPE 1EAXA 1O2PA 3GYMA 5C1YA 1Z7KA 1NRSH 1SGFG 2HRVA 2HPPH 2VIDA 4QT8C 4Q7YA 1YPHE 1ELEE 2JETB 4FUJA 4I86A 5EQQA 2ZFFH 4XBDA 1UTPA 4O3TA 1VGCC 2KX4A 3RXUA 2PUQH 1O2QA 1NRRH 4ASHA 3U8TH 1O30A 1GI4A 5JBCS 1O3AA 1SGYE 4FXGH 3B23B 3DD2H 3IITA 5FX6A 3RM0H 1GGDC 3RDZA 1V2MT 1ZYOA 2FX4A 3RM2H 3PWCA 4DT7B 1IQFA 1MUEB 1NESE 1HB0B 3OEHD 1P12E 1SGTA 1SPJA 1UK3A 2TRMA 2FOHA 2W5EA 3GY8A 1Y3WA 1TNLA 2ZGXH 4JK6A 1EJMA 1GHZA 1VGCB 1A2CH 1C5ZB 2FTLE 2W7UA 3NWUA 1AMHA 4CRDA 3PV4A 4FU9A 2VVVA 3VPKA 1AUTC 1CA0C 4F55A 1VCPA 1GGDB 3SJ8A 1K1IA 1O3LA 4A5TS 4I8GA 3GOVB 1F0RA 2ZU4A 1C2KA 4X1SU 5HM2A 3F2HA 4Q4LA 3R0FA 4OM9A 1DY8A 1TGCA 1L0ZA 4DIHH 1P3EA 1GBLA 3MH5A 4F4OC 1P09A 1RS0A 3KQCA 1HYLA 1C4Y2 3LGWA 3GDVA 2OBQA 4H42U 3MWIU 1V2TT 3SU5A 3F3BA 4A1XA 1WBGB 2FLBH 3WW7A 1HJAC 1NS3A 2G5VA 1UK4A 1H8ED 2BVXH 5E2PA 1DPOA 3EA7A 1VITF 4X2WA 1W8BH 3SV7A 2FOFA 4E7RG 1WOFA 2EI8A 2P3FH 3NUMA 3AVZA 4Y6DA 4INLA 5C0TA 2BY8X 1CT0E 1W2KH 4X8UH 2XRCA 2ZQ2A 1DSTA 1S0QA 5FX5A 4BAQB 1TGTA 1OSSA 3C1KA 3SNCA 3RXVA 3OYPA 3A83A 1CE5A 4BXSA 4ESTE 2Z94A 2EY4C 1C9PA 1D9IA 9ESTA 1FY1A 2VGCC 2CXVA 1K1OA 1EAWA 2VIWA 1QNJA 3OTPA 1C5NH 2FOBA 2WV9A 5ESBA 1ANDA 2Y81A 2V6NA 1TBQH 2BDHA 1ZTJA 3DSOA 4KTCA 3FN8A 1O2WA 3ODDA 6LPRA 4K8BA 1DX5M 3RXTA 1O5DH 3WWFA 1FPCH 3E90B 1P01A 2PLXA 5AVDA 5LH8A 1SBWA 4IN2A 3M3TA 2EI6A 3SOSA 1NRNH 2R3UA 2VGCB 1A0HB 3MU8A 1AIXH 3MU0A 4HI3A 4WWYA 2G52A 1E79D 1UCYH 1TLDA 4FUHA 2XXLA 1CHOG 2ZDAH 1ARCA 1BB0B 4IS5A 3RXLA 5FL7D 1C5OH 3RMOH 1ZPBA 4U2WA 5DP8A 4YESB 1SQAA 1QL7A 2KZ4A 1BBRK 2P59A 2ZCHP 1C5VA 3M3VA 1ID5H 1MTWA 2SGQE 1BIOA 4D7GA 1GMCG 2RA3A 1L2EA 1EZUC 3A8BA 2XC0A 3D49H 1XUIA 2BD9A 1VCWA 1WTGH 3MO9A 2CN0H 5F8TA 3OAAD 2KCPA 3ZZ6A 2OQUA 2PP6A 4TT3D 3MQKC 2GCTC 2ZTZA 2PHBA 2O9QA 2PGBB 3QZQA 1W10U 2DUCA 1O2IA 5EPYA 1EZSC 3GY4A 2Z9JA 4BANB 1GI3A 1MAXA 2G4UA 5PTPA 1JBUH 3SUGA 5KGOA 1GJAB 1HPGA 1RIWC 2AERH 1ZPCA 1O3CA 3TITA 5DPAA 2AMQA 2IJD1 2BYAX 4ABJA 3B9FH 1GWAA 1UTQA 5F8XA 1GMHG 4IN1A 2WZQA 1Y3YA 9LPRA 3LIWA 1AVWA 1A7SA 1KXDA 1TRMA 3FAOA 1C1QA 1C5XB 1GJ9B 2FI3E 2C90B 3MHWU 4X6PA 2HWLB 1YPLH 3U98H 2GCTB 5K0HA 2BLQA 3DUXH 8ESTE 3ZVGA 2B7DH 2ZU5A 2O8UA 4AYVB 1X7AC 4MQAA 1K21H 1FXYA 5AFZH 1W0JD 1L4DA 4KKDA 1RIWB 4HG6A 2LP6A 4IMQA 2AGGX 3E91A 2QF4A 1U6QA 1COWD 4Q80A 4KELA 1FI8A 4K1EA 2Z6BD 2BY9X 1T7CA 2BDYA 4AOQA 1B0FA 1ZZZA 2CV3A 3BIVH 1C2HA 4I8LA 1B7XB 2QC2A 4X1QU 2PWXA 4B76A 1KSNA 1C1WH 2ZDNA 1QJ7B 1KIGH 1WUNH 2J98B 3U8OH 3TLOA 1HLTH 4NA8A 2GZ8A 5T6FA 5E0GA 5G4BA 1BJUA 3LU9B 1EAUA 3ZZ8A 4D7FA 4Y7BA 3M7UA 1RTKA 4OGXA 4Y0ZE 3VEQB 1ZSJA 2HALA 2R0LA 3RXHA 3SORA 1C1VH 1AD8H 4IGDA 4CREA 1XVMA 1ORFA 4UD9H 1SGDE 1QQUA 4NG9H 4CRFA 4CBNA 1TGNA 1Z8IB 3OFND 3E3TA 3RXKA 4HZHA 1NFWA 1A5IA 1ABIH 4ZHAA 1O2UA 1GCTB 1SGCA 1V2ST 1QA0A 2UWOA 1AE8H 1XUKA 5EOKA 3A84A 1IHTH 2A5IA 3DFJA 4GCHG 1SHHB 1O2KA 5B6OA 4X2VA 4I31A 1YY3A 3ZVBA 2HNTF 4A6LA 3ZV9A 1WDIA 3A7VA 1THSH 1LMWB 3L33A 3P8OA 3PMBB 3QUMP 2FP7B 1DWEH 1FAXA 1PPEE 2QY0B 1PPFE 5EJZA 1G9IE 4O9VA 2R9PA 2TGTA 1GHAF 4RSPA 3OU0A 2ZZUH 3RP2A 4P02A 1OPHB 4O03A 5FPTA 2HLDD 3SGQE 3RXPA 4UONA 3TJUA 5DO4H 5C2ZA 5JBAS 1OP8A 1TMTH 3GY5A 1QBVH 2AYWA 3STIA 2BLOA 4MPXA 4ZXYH 3PV2A 3ZZ5A 4YLQH 2XC5A 3F68H 3EA8A 3UOUA 3PLKA 1GMCF 1IQEA 1EQ9A 3BTFE 5DGJA 4B74A 3HGPA 2AIPA 2F9PA 1BRBE 1F0TA 1JMOH 4X6OA 4BTUB 1GHYH 2PW8H 2SFAA 1C5WB 4BAKB 1TA6A 1BRUP 1O2NA 2A45B 4ZXXH 3UOPA 2RA0A 3SU2A 5FCRA 1BHXB 1MCVA 2ZFSA 3BEFB 3TH2H 5EW2H 1TMUH 1AB9C 4KTSA 4RT0A 1K28D 2QF5A 4E06H 2OUAA 1T8OA 1SFIA 1NU7B 1O2HA 5A0CA 1S83A 4OS4A 1YCPH 3A85A 1D3PB 1K1MA 1AFEH 3RXEA 1S84A 1O38A 4IC5A 2Y7ZA 2Z9IA 5EG4A 3OTJE 1QA7A 4Q7XA 1P10A 2VIPA 4ISOA 4XOJA 4MNYA 1FONA 1GMHF 1DUEA 5HMAA 2ZPQA 5BRRE 1IQLA 1C2JA 2O8TA 2JH5D 2RCEA 5TCAA 1AFQC 4D9QA 2B9LA 1L1NA 1UJ1A 2FOGA 4SGBE 2QXJA 1O39A 2BQ7B 2CF8H 2ZEBA 1AB9B 2R2WU 1IOEA 1IAUA 3S0NA 1SGPE 5F53A 1GJBB 1G37A 2NWNA 1UVOA 2H9EH 3T29A 2EI7A 2UUJB 1ETTH 1AWFH 1JXPA 2DE9A 3DA9B 4LK4A 2QN5T 4R0IA 4AGJA 2A5AA 1S85A 2WPIS 2AMDA 4OS6A 3ZZDA 3ODFA 3W94A 3LGYA 4X2YA 1K0HA 3TK6A 4I7YH 1O5GH 1EJAA 3ATWA 1GJ8B 1DS2E 2FDAA 5DP4A 1SG8B 3SQEE 1O3FA 2ZGBH 2J92A 1O2YA 2ANKH 3UUZA 2BMGB 3SYJA 1G3DA 2XOKD 4K60A 5EW1H 3HPTB 1UMAH 4ABEA 1JOUB 4YZUA 3GCOA 1XMNB 1C9TA 3PO1C 4X6MA 1QIXB 2LPRA 2XBWA 1GJ5H 1KXEA 2GV7A 3N7OA 5ESTE 1FN6A 1GBAA 1XXDA 1EUFA 3H7OA 7LPRA 3KF2A 2YOLA 2W6JD 4AGKA 4ISHH 2M2AA 3A88A 4ZHLU 2WPMS 1UTLM 2JJ1D 1AVXA 7GCHG 3M5OA 3DCLA 5IDKA 3TU7H 2ZTYA 2C8ZB 2BLWA 1SLVB 2Y6TA 4UFGH 1OP0A 1DXPA 1NU9A 3TNSA 1RTLA 3HKIB 3PO1B 1J16A 3SI3H 2ZNKH 4I8KA 3S9BA 3RLWH 2FS8A 1Y8TA 4ISNA 1O3HA 1FJSA 1PQAA 2WV5A 5FPSA 5EPNA 4ZKOU 5L2YH 2Z9LA 2FESH 3KHVA 1O2JA
chains in the Genus database with same CATH topology
2XWBI 1KLTA 3QGJA 1GG6B 8LPRA 2V0BA 1GBEA 3PMHB 3M7TA 2P16A 3ZZ3A 2BVSH 3ZZAA 4Q7ZA 2QYIA 2ZCKP 1FZZA 5T6GA 1FDPA 1SGIB 1TRYA 2P8OB 2G81E 2GD4B 1S6FA 4M7GA 1C2MA 3A81A 4ZAEA 5A8YA 1PPZA 1TA2A 3SNBA 1CVWH 1B5GH 1PQ7A 3G01A 4FUCA 5EODA 1GBCA 3SQHE 4LZ1H 1O0DH 1N1LA 1YF4A 3SV8A 1XUJA 2OTVA 1HUTH 3MO6A 2V35A 1C1UH 2QCYA 2ZPRA 2ULLA 2VWMA 4NA9H 3V0XA 1QFKH 4K69A 1FN8A 3RMMH 4WMDA 2P95A 1W7XH 4NWLA 1ANCA 1OXGA 1EJNA 1SGRE 4FUGA 2Z3EA 2B0FA 4DIIH 4YO9A 3MNXA 2Q6GA 1F2SE 1BDAA 1F5RA 2FI4E 4AB9A 1QRZA 2UUYA 3VXFH 4B71A 3E0PB 1GHBG 1XUFA 1BRCE 2PFEA 1QTFA 1HAYB 3EYDA 3PM3A 4X8SH 4ZROA 3LGVA 3UTUH 2BDGA 2FWWA 1TNHA 1O3NA 3UR9A 1T31A 3MO3A 4JZFH 3S69A 1NFYA 3V7TA 2QGRA 1AY6H 1TOMH 1C1NA 3QTVH 1LHEH 1MTSA 2AMPA 1LPGB 3URDA 1ELVA 1XVOA 2A4QA 4INKA 3KGPA 2IOTA 1PPCE 1FLEE 4JZDH 3PYHA 4NWKA 2C3SA 2OC8A 5BPEA 3MI4A 1GDUA 1UTJA 2Z9KA 4YOJA 1HAGE 2BY7X 1O2RA 1LCYA 1ESTA 1KTSB 2R3YA 5IYTA 3MMGA 1EATA 1HRTH 1UCYE 1NRPH 2WPLS 3MYWA 1Y3VA 1OWKA 2G00A 1Z8RA 3LGIA 3MFJA 1RXPA 1A4WH 3QDZB 3IWMA 4ABFA 4X1NU 3V13A 2GDEH 1W0ZU 2ZC9H 1NY22 2TPIZ 1EX3A 5FBIA 5C1XA 3U1JB 3QO6A 1DVAH 1GBKA 1BJVA 2EC9H 3VB3A 1D6RA 1BCUH 1BMAA 1TX8A 1KDQA 1IQIA 3QX5H 2SGAA 3LT3A 3ZVDA 3KL6A 1ZGVA 4X8TH 4GUXA 3UNQA 1OS8A 4WMFA 2A4GA 3T62A 7GCHF 1PPHE 3BN9A 4AFSA 3A7XA 3MNCA 4NIWA 4KP0A 1F0SA 3ESTA 3BTTE 3K6YA 1ZMJA 1SGFA 3TGJE 3O8BA 1GI1A 4BAHB 1E36B 1THRH 4AFUA 1GBJA 3SNEA 2UUKB 1O2XA 5C5NA 3KQDA 1CA0B 3NK8A 1P06A 2P93A 1UHBA 4BTIB 2FYQA 2BZAA 1W13U 4YOGA 1SR5C 1XX9A 3U1IB 1SLUB 1UK2A 2FO9A 3KCGH 4GLYA 4TWWA 4UEHH 2A31A 1AQ7A 1ELDE 3M35A 4ABHA 3MU5A 7KMEH 5K7RA 2VVUA 1AN1E 4UFFH 3FVFB 1CT4E 3SV9A 1E34B 1PQ5A 2BX4A 5FHTA 1A46H 3S7KB 1KXAA 3HATH 1HJAB 1O5EH 1K1NA 2A4OA 1V2QT 2H1UA 3H5CB 1C1OA 3OY6U 3P8NA 4MTBA 1GCDA 1M9UA 3K6ZA 2BHGA 4TY7A 3F1SB 5FBEA 4Y11E 2VJ1A 2STAE 4ZUHA 2HGTH 4Y7AA 2BDCA 4ABGA 1ESBA 4LOYH 4BAOB 2WPKS 1O5BB 3VB4A 2OXSA 2J38A 1CBWC 1EB1H 5LGOA 1H9LB 1YP9A 3F6UH 3M61U 5HYOA 3UNSA 4X6NA 1ANBA 1DITH 1C5LH 1FQ3A 4OS1A 4UE7H 2FODA 2UUFB 5EU8A 1AKSA 3MU4A 2GX4A 4DJZB 3ATIA 5A2MH 3TGIE 2FIRH 2A1DB 1GHBF 1QBNA 1PJPA 2QIQA 2BQWB 4NZLA 1GHAG 2OD3B 3BTQE 3MU1A 2AS9A 3RXAA 1MKWH 3C27B 3IG6B 5I25A 2D8WA 3ZZ4A 5CHAC 4ZKNU 1F0UA 2W7SA 2CGAA 1W0YH 2PTNA 2BD8A 3DHKH 1GPZA 1ARBA 1GI9B 3SW2B 1JRTA 1GMDG 2GKVE 5ETXA 2Y5GA 4JZ1A 2H5CA 4INHA 3QN7A 1LQDB 1TNKA 2TGPZ 3RXRA 1HXEH 2GMTC 1HJ9A 4K3JA 1ZLRA 4Y79A 1HAVA 2BD4A 1GBTA 1XXFA 2IN2A 4XBCA 1QGFA 3R3GB 1MKXK 3PWBA 5C3NA 2R2MB 1YCPM 1E35B 1SGQE 5CHAB 1B0EA 3BSQA 1QL9A 3AW0A 1EZXC 1GHXH 1A1RA 1EZQA 1OKXA 1LVYA 1GBIA 3NKKA 2VU8E 2ZHWH 3GY2A 4CR5A 3URCA 1O5AB 2C8XB 4ABBA 4PROA 1TPPA 1EP5A 1AI8H 1ELGA 3BTHE 3QTOH 1BTZA 2EA3A 2GMTB 1ZOMA 2M5TA 4BTTB 1FIWA 1G3EA 1EXFA 4TYDA 1F5KU 2PV9B 4X8VH 1GBDA 1C2LA 1BHXF 3U69H 1GVKB 5DK1A 1O2LA 3I77A 4D9RA 5GWZA 3UQOA 2P94A 1H9IE 1QCPA 2Z3DA 1ELTA 1KTTB 5HM9A 4JZIA 3PROA 3F9HA 1BZXE 4CHAC 4OS2A 4XDEA 2H6MA 3RMNH 3M7QA 4E7NA 1GVZA 2SGDE 4KGAA 1T32A 1SSXA 1A0JA 3RU4D 2VWNA 2AFQB 3A8AA 2FZZA 1RRKA 1TPAE 2PSXA 3BTWE 3TJNA 2XYAA 1HAOH 3VGCC 1D3TB 4B2AA 3MOCA 3ZZCA 4FU8A 1XKBC 2B5TB 4FU7A 2BD3A 1WU1A 3SV2H 1CGIE 5CE1A 3STJA 2GT8A 4CRCA 3VB6A 1Y3UA 5EGMA 3W95A 4OS5A 4CHAB 2ZA5A 4MPUA 1DXWA 1CGHA 1O3PB 5EQRA 4Y8ZA 5A09A 1UVUH 1V2NT 1Q3XA 2XCFA 3SUEA 1SQTA 2KAIA 4B1TA 1THPB 4MPWA 2PTCE 1Z6JH 2VWLA 3U8RH 1INCA 2V3HH 1TWXB 2BDBA 3FANA 1AHTH 3M37A 1L1GA 1SQOA 2CMYA 1LPKB 1W14U 3TNTA 2AGIX 1GBBA 1RGQA 4JYVH 3KIDU 2VWOA 3F9EA 4ABAA 1KDQB 2RDLA 5A0AE 5E0HA 4A1TA 2ZIQH 5FAHA 1C1RA 1ETSH 1SLWB 2BM2A 3UWJH 4D76A 1GI5A 4MVNA 2ZHEH 2FYRA 2W3IA 1GI6A 3LC5A 1QQ4A 4UDWH 4D8NA 2OBOA 3MH7A 1EOJA 1AO5A 4MLFB 1Z6EA 2BOKA 1F7ZA 2AEIH 3M3SA 1Z1JA 1ELFA 2BD2A 1QB1A 3KQBA 3FP8E 1LO6A 3SJIA 1BMNH 1P9SA 1V2WT 1HNEE 5EXLA 3HK6B 2ODYB 1ZMNA 1UHBB 8KME2 1EB2A 5F6MA 3SI4H 4ABIA 1N6XA 2D2DA 3D65E 1JIMA 4DG4A 1Z8GA 1GMDF 1T8LA 5JYIA 1VJ9U 3UWIA 4JZEH 2AIQA 4CRAA 1XUHA 1QJ6B 1O2TA 3SNDA 1BTXA 3FZDA 2ZP0H 1EOLA 2ALPA 3ZVCA 2NU1E 3BTKE 2IJOB 3ELAH 2Q1JA 1LKBA 3UPEA 1A3BH 2ZDKA 3BTEE 1DANH 3P17H 5F03A 2XNIA 3FP7E 2OINA 2ZFRH 1O2GH 3BF6H 4WH8A 2TGAA 2A4RA 4BNRA 3ATLA 3SJOA 3RXJA 2QA9E 3V3MA 3T25A 1WAYB 1G3BA 3BIUH 1HIAA 1MBQA 2PUXB 3ZZBA 5C1UA 2ODQA 5DG6A 1YBWA 4Z6AH 4GPGA 1WSSH 4RKJB 1C2GA 2WV4A 1LTOA 5E8EH 1L1JA 1ZR0A 2C4FH 2F3CE 5TJXA 1YM0A 3SU3A 1IQNA 4UFDH 2VIOA 1LVMA 1YLDA 3EDXB 3Q76A 4NZQA 4FUDA 2ZU1A 2OLGA 1AKSB 1DWCH 2FM2A 1BTUA 4YT7H 1FY8E 2NU3E 3T2NA 1SL3A 3A7TA 5DP5A 2Y7XA 4XBBA 2B8OH 4FUFA 3QGNB 1Y5UT 2BX3A 1UVSH 5T6DA 1UTNA 1YPHC 3E0NB 4FUIA 3SN8A 1TGSZ 1CU1A 2FX6A 1FY3A 2SNVA 1C5SA 1PFXC 1G2MA 2QXHA 5A8ZA 2HLCA 1QL8A 3KEEA 1OP2A 2NU4E 4X0WU 4ZHMU 3O8DA 2PR3A 1GL0E 4CBOA 1YPGH 1AFQB 2W26A 3D23A 4B75A 4AG2A 3P6ZB 1TE0A 2FPZA 1MZDA 1EPTA 5AFYH 3EA9A 2BD5A 4NIYA 1A5GH 2HNTC 2ZG0H 2VH6A 1O3BA 5HXFA 1CQQA 1Y5AT 1O3EA 1K1PA 2Y82A 1QURH 4WF8A 1HAIH 1GJCB 1MBMA 3BTDE 3RU4E 1FMGA 3VFEA 1JIRA 1HBTH 2F91A 3LOXA 4RKOB 3DFLA 1UCYK 1DSUA 3A7ZA 1AWHB 3EAJA 1HAZB 5EQSA 1ZSLA 2J2UA 1UTOA 2QXGA 2ZCLP 3BEUA 3FP6E 1BBRH 1AUJA 1MAYA 3S9AA 1S82A 1BMLA 1N8OC 3RUOA 5J4SA 3UR6A 1TYNA 3BG4C 1K1JA 1GI8B 2HVXA 4WXIA 3TJVA 3ZZ9A 2Q6FA 2FMJA 2G4TA 3Q3YA 3TH4H 3MH4A 1ELAA 4GAWA 1BTYA 1NROH 3MTYA 3T26A 1HCGA 6GCHG 5DP3A 3E16B 1IQKA 2SNWA 2A5KA 1GJDB 1LHDH 3LC3A 1MD7A 3U9AH 1KXCA 5DP6A 4ZKRU 1UVPA 3ZZ7A 4GHTA 3SU4A 3RXDA 4DOQA 1C5UA 3LJOA 1MTUA 2C93B 1P2OA 1N8OB 1HJ8A 2A32A 3BG4B 3GCNA 2ZTXA 3SHAH 4NA7A 3GY3A 4U01A 3GICB 3UY9A 2H5DA 3Q00A 1CO7E 2V3OH 1WV7H 3E6PH 1E0FD 2BZ6H 1NFUA 3CS7A 2TIOA 5GCHF 1TBZH 1TGBA 2D26C 5TCCA 2ZKSA 2KAIB 3NCLA 3M36A 1WCZA 3P70B 4JMYA 1P02A 3DT0H 1ZJDA 3CS0A 1G30B 1PPGE 4AN7A 4FVBA 1J14A 2PKAA 1AZ8A 2CF9H 4AB8A 4HGCA 1ZMLA 1W11U 2GCHG 2THFB 1A5HA 4TPIZ 2A2XH 1EP6A 1O33A 4DW2U 4IW4E 1HAHH 3MNBA 3RXOA 1SMFE 1YLCA 1F92A 2WYGA 3PMJA 1ZHRA 5SGAE 8GCHF 4TY6A 2JETC 1UTMA 3L6PA 1V2VT 1O3GA 1HGTH 5E2OA 1TBRH 1OWIA 1UO6A 2TGDA 3QZRA 1P04A 4Q2KA 1P03A 1Z71A 3GDSA 5HGGA 3V12A 1TNGA 1GBFA 1GJ7B 1V2OT 4J2YB 2VINA 2QF3A 1DLEA 1C1SA 4HTCH 2H9HA 1CHGA 4NGAH 4NSVA 4H6TA 1BQYA 3K2UA 3A8DA 2I6QA 3M5NA 1MD8A 5JB9S 2UWLA 2PSYA 1P57B 1MMJN 2Z9GA 2H9TH 4U30A 2GDDA 1DY9A 3SUDA 1C5YB 2QAAA 2WUCA 2OP9A 1QBOA 4ISLA 4WMEA 3RU4T 4XFQA 3KNXA 2NU0E 1D4PB 1DWBH 2H2ZA 1DM4B 1P2JA 2HNTE 3AASA 5DP9A 5LPFA 3MNSA 1HIAB 2VIQA 3SNAA 4K1TA 1O36A 4MNVA 4NFFA 1TMBH 1YPEH 1YYY1 3OY5U 1LKAA 2EEKA 1YGCH 1YC0A 3AAVA 2XBYA 3SUFA 1G3CA 3SHCH 5EXNA 6GCHF 1EPTC 2ZI2H 2C8WB 1IQMA 4Y76A 3D62A 2ZHDA 3EQ0H 1J8AA 1O3MA 1GJ6A 1FY4A 1QRXA 3GY6A 3UQVA 3SU6A 1DE7H 2AH4X 1NZQH 1FV9A 3ZVFA 2ZU3A 3ATKA 2WPJS 3CP7A 4Z0KA 1TABE 2STBE 2J94A 2GTBA 1OWEA 1K22H 3P95A 3TH3H 1TX6A 1P11E 3LGTA 1ETRH 5DKMA 3SJKA 4H4FA 3WY8A 4K2YA 4AYYB 1ZJKA 2WYJA 4O97A 3SU0A 1O3IA 1GBHA 1MH0A 1FUJA 1GI7B 1YCPK 1H1BA 1LVOA 1S0RA 2BDIA 1EPTB 1C4U2 1DICA 4DY7B 1P2MA 2ANYA 1NT1A 1GJ4H 2BLVA 4UFEH 1TNIA 4J1YA 3M5MA 5GXPA 2FOMB 1OYQA 1MZAA 2ZGCA 1OWJA 2JH6D 3ZYEA 1F5LA 2GVFA 3LPRA 2FTMA 2ZFQH 2Y80A 3SO3A 1TIOA 5J4QA 3RXGA 2BTCE 1SFQB 1SLXB 1ZHPA 2G51A 1O34A 1RD3B 2Z7FE 1LHFH 3SU1A 2D1JA 3Q77A 1TB6H 1MCTA 1QHRB 1P2QA 4I32A 1G2LA 1VR1H 4RN6A 5GIBA 4CR9A 2SGEE 2GCHF 1WQSA 1RFNA 3GCTF 1W3CA 1JWTA 3GY7A 1FNIA 1K1LA 3RC6A 4TWYA 2ANMH 2I6SA 2O8MA 1SB1H 2Y5FA 1GL1A 2WINI 4TPYA 1QB9A 1SVPA 4YOIA 1CT2E 1ANEA 3P92A 1CBWB 1P3CA 4JYUH 3TGKE 2G5NA 1TQ0B 4Y0YE 5A8XA 2P3TB 4B2CA 1V2UT 2ZGJA 4CRBA 1BT7A 2ZHFH 1Q31A 4R8TB 1WQVH 4DVAU 2ZDVH 1YKTA 3PTBA 4A1VA 1AZZA 3O8RA 1UVTH 3P8FA 3OX7U 1GVLA 3RC5A 1E38B 3RXBA 1A61H 2ZDMA 1KY9A 4I8HA 3EGKH 3FFGA 4A7IB 1DFPA 1OOKB 2A0QB 1V2PT 3VB5A 4VGCC 3SV6A 4YTAA 1PYTD 4AZ2B 1GI0A 4HFPB 5FCKA 3A7WA 4F49A 1HXFH 1NRQH 3UIRA 1C5TA 1HAXB 4XSKU 4GSOA 3KN2A 5L2ZH 4K5ZA 1PYTC 3LH1A 1RTFB 1S81A 3TIUA 1O2MA 5JPMH 2ZQ1A 3T5FH 1TNJA 1C1PA 2ZWLH 1FY5A 2PKAB 1GDQA 1C4V2 2QXIA 2ANWA 1MTVA 2Y5HA 3GISB 1C5QA 2XW9A 4X1RU 1K2I1 2ESTE 2F83A 4JK5A 3A7YA 2SGPE 3A80A