4IN2A

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
181
structure length
173
Chain Sequence
EAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords C-like protease
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus
total genus 29
structure length 173
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4in2A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4in2A01
1DDJA 1SLVB 3AAUA 1O2YA 3SO3A 1OWIA 5FXLA 1UHBB 3SHCH 1YPGH 2R0LA 1ELTA 3DUXH 1W14U 3ZVDA 5CHAB 3MNSA 1EKBB 3E91A 4X8SH 1C1TA 1GJ4H 1F5RA 2QAAA 3MNXA 4IMZA 3ITIA 3RXGA 1Q3XA 2AMDA 1NRPH 1E34B 1GVKB 2BDGA 2A4OA 4MTBA 4IC5A 1O37A 4INHA 3L6PA 2ZA5A 1HXEH 2WYGA 4OGYA 5DP4A 2ZFFH 3RXPA 1O2IA 5EODA 2AGEX 2GV7A 2XC4A 4FU8A 2GZ8A 1SVPA 1FN6A 2GCTC 2BX4A 4GHQA 3BTGE 4R0IA 1GBDA 4A92A 1SGFG 3T62A 1J14A 2BOKA 1K1PA 1TRYA 4JYTA 2W3KA 4OS7A 2STBE 4B74A 1BZXE 1TNIA 2VIDA 2VWLA 2TRMA 1LPKB 5LGOA 3RP2A 1LHGH 3DHKH 2FOEA 3U98H 1GCTC 2W3IA 3F68H 1XUJA 2VVVA 3E16B 2SGPE 2NU2E 4ESTE 1TMTH 1Y5UT 3UWIA 3SGAE 1KSNA 2PV9B 3UREA 4RN6A 1GI7B 4X8TH 4YZUA 1ETRH 5E0HA 2FZZA 3VXFH 1NO9H 1GHBF 4FU7A 1N6YA 1QJ6B 2P93A 1O3HA 3GICB 5EPNA 1OP2A 2EI8A 1AIXH 1KDQA 4HI3A 3TU7H 1V2QT 3GY8A 5G4BA 1P06A 2B9LA 1DVAH 2AMQA 5E0JA 4THNH 2HPPH 2TGDA 1LVBA 4BOHA 2VH0A 3QK1A 2ZIQH 1JIRA 1C2EA 3M61U 3ZZCA 1AVXA 3SHAH 1GI0A 2O8LA 1QURH 3RXEA 1C1PA 2PKSC 1NN6A 2VVCA 2VNTA 1XKBC 1AD8H 3SN8A 2LNCA 3OY6U 1IQFA 4CBOA 1C2IA 5E0GA 3RDZA 1F0TA 1L1GA 1QY6A 2J38A 1SC8U 1SQAA 1FLEE 1V2LT 4UD9H 3RU4E 1GBIA 1CHOF 1V6DA 1O2WA 4K1SA 1G9IE 1ZSKA 4MNWA 4AOQA 1VITF 1O2GH 4X1NU 4AYVB 1SHHB 2G5NA 1C1QA 2B7DH 2OBOA 2RG3A 3I77A 3PTBA 3BTQE 4GPGA 3LGVA 3FP7E 4X1PU 1GMCG 4ABJA 2ZPSA 1UTPA 3S7HB 2A1DB 2A7CA 1IQMA 4K8YA 3LKWA 4TPIZ 3M3SA 1MKXH 1Z8RA 4Q7XA 1PQ7A 1P8VC 3VGCC 2TBSA 2NU0E 1S0QA 2PKAA 1BMMH 3CS7A 3KQDA 2JETB 4BTTB 3VB7A 1GMDF 1GGDC 1KDQB 2H9TH 1GBHA 1OKXA 2AIPA 1AKSA 3LJJA 4DCDA 3LDXH 5FAHA 3ATMA 1HCGA 1P2OA 1HJ8A 2ZU2A 4MDSA 4Y8YA 1C5XB 1L2EA 5GPIB 5A8YA 3ATKA 1TE0A 1FPCH 1P10A 2R2MB 1W10U 3ZVGA 3DFJA 3K2UA 9LPRA 3UTUH 1YC0A 1TWXB 1E37B 1JWTA 3PLPA 1WV7H 2ANYA 3ZZ6A 1FV9A 3SV2H 3LC5A 1LHEH 4BANB 2A2XH 5L30H 1QRXA 3JZ1B 2OP9A 4KTSA 2GMTC 2GT8A 1G32B 1V3XA 1LPGB 4ABHA 2BDYA 4ZKNU 2ZPRA 3MNCA 1ZSJA 2XTTB 3EAJA 1KTSB 3E3TA 7ESTE 3F6UH 2V3HH 3LGWA 3A81A 3RXLA 2BD2A 1Z6EA 3MTYA 3HGNA 1DANH 1SGYE 3T29A 3U1IB 3HK3B 3H7TA 2Y5GA 1ZJKA 1YYY1 4AGJA 2F3CE 1SQTA 2V6NA 1BHXF 1XUGA 2ALPA 1LVYA 2PKAB 2ZGHA 3EA9A 2WPJS 1ZPZA 2ZU4A 2YNBA 4BXSA 2FS8A 7KMEH 4I8GA 4GLYA 1K1LA 5HM2A 4LOYH 2PWXA 2A4RA 4TY6A 3UQVA 1MTSA 1SR5C 4IMQA 2AEIH 4X2XA 1V2OT 2BVSH 3K9XB 4Y8XA 2YOLA 6GCHF 4X6OA 3RXMA 1ZTKA 3RMNH 1TGTA 3TJOA 1HBTH 3SV8A 2BDAA 3QGJA 3VB6A 1C2FA 3Q3YA 1O3AA 2ASUB 5EQQA 2Y5HA 1K28D 1KLIH 5BPEA 2ZDAH 5JB8S 1VGCC 1SFIA 4ABEA 1KXAA 3VPKA 3R0FA 1SI5H 3STIA 3GY4A 5DP6A 1F0SA 2CGAA 4CR9A 4XBCA 1Y5BT 3FANA 1FIWA 5ESBA 2FTLE 2ZKSA 1HGTH 1W0ZU 2ZGCA 2ZQ1A 1T7CA 3KGPA 2HNTC 2CF8H 1TGBA 3NUMA 1FONA 1Y5AT 1FMGA 3RXJA 4CRBA 3TVJB 3QLPH 1TMBH 2VH6A 3UNQA 1THPB 1WBGB 4GCHF 1ID5H 7GCHG 2QF0A 1HAXB 2G55A 2A0QB 2AFQB 2B0FA 3KF2A 4JYVH 3D65E 1O34A 1QB9A 4AORA 1WTGH 1P09A 1MKXK 4J2YB 1O2HA 1K1OA 2BZAA 4OS5A 1A3EH 3KCGH 4O03A 1QCPA 1ZYOA 1ELAA 1UTNA 1Q31A 5K0HA 1N6XA 1O2KA 3UY9A 3VB3A 1K1MA 1OWEA 1EB1H 8GCHF 1O5GH 5F8ZA 2ZHFH 1E38B 2SFAA 4U32A 3SORA 3T25A 4NA7A 1O5AB 2QV1A 3SJ8A 1DPOA 1VJAU 1C5QA 1MTNB 1TNKA 3TGIE 2GCHF 1ETSH 3SUFA 1C1UH 1P3CA 1S82A 3ESTA 2Z9GA 3E1XB 1DWEH 1H9LB 3SV7A 1DSUA 1TNGA 1SOZA 1CBWC 1KXFA 3I78A 1AVWA 1K2I1 5JB9S 1GMDG 1XVOA 1EP6A 2BVRH 1ZGVA 4D76A 2WPHS 3SNBA 2PTNA 2VIOA 1PPFE 3K6YA 3A89A 2A45B 1O2PA 1C4V2 2OLGA 2TGPZ 2BX3A 5CHAC 2P16A 5HMAA 1HAOH 3DFLA 3VFEA 4ZHMU 2OXSA 2OC7A 1AQ7A 3G01A 1HUTH 4H6SB 1DWBH 1O2VA 4NGAH 1RD3B 1DSTA 1VZQH 1EZSC 1SMFE 1S81A 4I8KA 2GVFA 3Q77A 3TJNA 8KME2 4Y6DA 3PWCA 4ABDA 5L6NH 1TGCA 2UUJB 1T31A 1ARBA 1QB1A 1CVWH 3P8NA 1AB9C 1KXEA 5DG6A 1FPHH 1E36B 3LJOA 1O33A 3VB4A 4YOIA 1V2PT 1T32A 4ZKRU 1MTWA 1YPEH 1D4PB 4AGKA 5FX6A 2G4UA 1H4WA 5DP7A 1EP5A 2VGCB 2P3FH 3MH4A 2V35A 1V2UT 1GJDB 5A2MH 5DJ7A 2C4FH 3EGKH 2CXVA 3A88A 1W3CA 5C1XA 2HNTE 1CSOE 1BIOA 1UCYK 2FIRH 3D49H 3BV9B 1BTZA 2G4TA 2BD8A 2QA9E 1DXWA 4D7FA 1T8NA 2FO9A 1Z1IA 1O2JA 2Z9LA 1BBRK 1BQYA 1GPZA 1V2MT 3AASA 1Z7KA 3TITA 3RM2H 5EQRA 1AI8H 4WVPE 3MH6A 4DJZB 4KGAA 1C5LH 1CA8B 3LT3A 1ELFA 1UTOA 1KTTB 1C2KA 4WXVA 2SNVA 1EXFA 2ZI2H 3BF6H 1V2KT 4B73A 5EGMA 4M7GA 2P8OB 3BTME 2F9UA 1S6FA 1GBCA 1JOUB 1NFWA 4PROA 3LGIA 1NROH 2M5TA 4HFPB 2GKVE 3ZZ7A 2ZNKH 2QN5T 1EZUC 1F5KU 1PPHE 1BJVA 1EOJA 3RU4D 1KXBA 1A46H 1ORFA 1GBKA 2F83A 1AE5A 2ZGJA 2WPKS 2EI7A 1ELVA 3E0NB 5TJXA 1HAVA 3EA8A 3RXCA 2QXJA 2WUBA 1ZHPA 2SNWA 4XE4A 5C20A 2ZFSA 1A4WH 1GWAA 3QTOH 1ABJH 3M35A 2QGRA 1AUTC 1Z8GA 1YPMH 4YOJA 1OS8A 2V0BA 1FQ3A 2XC5A 1AFEH 2R9PA 1HDTH 3SJKA 3KHVA 1CU1A 2ZU5A 1C2JA 3QO6A 1OOKB 3Q3KA 1THSH 1IHSH 2EI6A 1H9IE 3UUZA 4UDWH 2F9OA 2GZ7A 1FI8A 1MKWH 4UFEH 4AYYB 1TPAE 1BTYA 1OWDA 4IC6A 3E0PB 1UTLM 2HVXA 2JETC 1NZQH 1NU9A 1YPKH 1YM0A 1AE8H 1BRCE 1Y3XA 3SQHE 1YP9A 5EXLA 4ZUHA 5A0AE 5GIBA 1O5DH 1QB6A 2FXRA 1GHWH 1HXFH 4CHAC 3P8OA 2VB0A 4I8HA 4NFEA 3SGBE 1QQ4A 1MD8A 7LPRA 1ANBA 3SI4H 1X7AC 3M5MA 3TGJE 3PLBA 1KXCA 4U01A 1BRBE 4J1YA 2ZTZA 1G37A 1LVMA 4NA9H 3O8DA 4VGCB 4Q2KA 3M3VA 3SNEA 4B1TA 2ZHDA 1O3JA 1C1NA 4Z6AH 3T5FH 1HAVB 3KL6A 3URCA 4LZ4B 1EASA 2OTVA 3M5OA 1D9IA 2A5AA 4ZHAA 1ZPCA 3UPEA 1V2VT 1GG6C 1P9UA 3GCHB 1BDAA 2BDIA 2CHAB 1EB2A 1P04A 1BTUA 1TABE 1SHYA 1P2QA 1GDUA 2FODA 1TX7A 2O8MA 1LTOA 4K3JA 1G36A 3BIUH 3UR6A 5EG4A 3RXRA 1BRAA 4AX9H 3FVFB 2FOFA 4WMEA 1CA0B 2K1QA 4YESB 1O2SA 2P3UB 1FN8A 1ACBE 1SLWB 3LH1A 3HK6B 1RRKA 1ZHRA 1C5TA 4NG9H 3P8GA 1MTUA 1O3FA 2FMJA 3QX5H 4X2YA 1O3IA 1Z1JA 2SGDE 4NIYA 3SUGA 1XUFA 1FIZA 2PSXA 1LQDB 3LU9B 2FLRH 4KTUA 2W7UA 2A7JA 1EUFA 1SFQB 3F1SB 1S6HA 1QBNA 2GZ9A 2WV5A 1VITH 3PLKA 3SBKA 4NA8A 2C8ZB 4A1TA 2F9BH 2G51A 4A6LA 4FUHA 4TY7A 2C90B 2XWAA 1SPJA 3K6ZA 2ODYB 1O5FH 4CBNA 1UVPA 1MCVA 4HZHA 3KEEA 1V2JT 2FX4A 1DLKB 1XUKA 3T27A 1P11E 1UMAH 4I31A 4XOJA 5A0CA 1U6QA 1PPBH 3BSQA 2BXUH 3R3GB 1E35B 1RTKA 4NSYA 1IAUA 1O5EH 3NWUA 3B23B 4IS5A 1P2IA 1PFXC 1VCWA 5DKMA 4Y0ZE 3S0NA 1TIOA 2ZG0H 1RXPA 4KP0A 3U8TH 2AYWA 1G3CA 1A1RA 1C5SA 2BZ6H 3M5NA 4INKA 5C1UA 5EQSA 2PUQH 3MNBA 3ODFA 2EA3A 2ESTE 2ALVA 2ULLA 1P9SA 4X8UH 3KQCA 3L3TA 4E7RG 1A0HB 2TPIZ 2Q1JA 1WUNH 4SGAE 1V2WT 1C5MD 1MKWK 4I32A 2FESH 3ZZ9A 3RMMH 3VB5A 1YLCA 5A09A 3TNTA 1MUEB 1NESE 1ARCA 2WYJA 4HTCH 1C1RA 2B5TB 2SGAA 4NZQA 3ZZDA 5FCKA 2EC9H 4FUGA 1B0EA 4IW4E 1YKTA 3A82A 2ZZUH 5T3HA 1MTNC 3MO6A 3OYPA 4A7IB 1PPCE 1P0SH 1Q2WA 1F2SE 1FY4A 2H6MA 1HAGE 4Y7AA 1C9TA 3FFGA 5LPEA 3GCOA 1UK4A 3SJOA 3D23A 3EQ0H 1DX5M 1HB0B 4X0WU 1C5VA 1ESBA 5DPAA 3SU1A 1C5NH 2FTMA 4NFFA 2XC0A 4ZAEA 4CREA 3RXUA 3SU6A 1GL1A 1KLTA 3B8JA 1BTXA 4Y71A 4YM9A 4X1SU 2ZO3H 2J4IA 2PTCE 3ODDA 2C3SA 3A8BA 4GHTA 3O8BA 3MU4A 1XKAC 3U8RH 1N8OB 4BNRA 2BY7X 4MVNA 2ZGBH 4YLQH 3BTHE 4IGDA 3SV6A 1QIXB 3MU0A 4ABGA 4BXWA 2AERH 1QJ1B 1GJBB 4BTIB 4Q80A 3S9AA 1C2LA 2Y6TA 4MG3A 1P03A 2QY0B 1FAXA 2BHGA 4WMDA 5HGGA 4IN2A 2GP9B 3RXOA 1ZMNA 1PPGE 4DG4A 1C5UA 2QYIA 1VCQA 3GYLB 3TIUA 1AZZA 3IITA 4BTUB 1SGRE 4ABAA 2ANKH 2BD7A 2FI4E 3OY5U 2D8WA 2QIQA 3EYDA 1O2NA 4CRGA 1YPLH 2IPHA 1O3BA 4TWWA 4UFFH 3HATH 4NSVA 1GMHF 2JH5D 3ATIA 5C5OA 1IHTH 3GCNA 2FS9A 1YPHC 3A8CA 3U9AH 2SGFE 2GDEH 1ZRKA 2JH6D 1MQ6A 1SGCA 1ZMJA 3GCTF 1EJAA 2FI3E 2FOAA 1GBJA 1MZAA 4AZ2B 2A31A 1C5ZB 4ZROA 1ZRBA 1Z6JH 1B0FA 1MCTA 4MNVA 1PQAA 3AVZA 2OQUA 3HPTB 2A5KA 2UUFB 3C1KA 2QCYA 4NIWA 3KNXA 1GBLA 1FXYA 1AKSB 1O3PB 1MAYA 1TOCB 1O39A 5JBTA 1UCYH 1K1JA 4D8NA 3RXIA 3BTKE 1AVGH 1Y3UA 4ZH8A 1AGJA 3ZYEA 4I8LA 3W94A 1EJMA 1CHGA 1G3DA 2ZQ2A 4NWKA 2Z3DA 3SI3H 1HJAC 1BBRH 2ZWLH 1BTHH 1SBWA 2UWOA 2BVXH 1SQOA 3GY7A 1A2CH 4WJG2 3OU0A 1GHBG 2KAIA 3RXDA 4BAOB 1NM6A 2RA3A 3EDXB 1EPTA 2QXIA 1W0YH 1W2KH 3RXAA 2GCTB 3PYHA 2F9NA 3SUEA 1BJUA 4F49A 4MNXA 1HJ9A 3H7OA 4OS1A 4FUFA 3U1JB 3A7WA 2ODPA 4DVAU 1Y59T 4E7NA 4I7YH 1FY8E 1HIAA 3LONA 1P2JA 5E2PA 2DE8A 1ZGIA 3A86A 2CMYA 5DGJA 2FLBH 4H6TA 5FHTA 1NS3A 1O3EA 2HLCA 2R3UA 1XMNB 1GCTB 5SGAE 1P2NA 3MU8A 1ELCA 3UOPA 2JKHA 2PGBB 1ELEE 2ILNA 3LOXA 3RXVA 3PMJA 1BCUH 2P3TB 2PLXA 4XSKU 2OUAA 3GISB 4XDEA 4A1VA 1C1SA 3U69H 3RXTA 3UNRA 2FOBA 1ANEA 4KELA 4X6PA 1DICA 4INLA 3SQEE 1HV7A 1DLEA 3GDUA 5EU8A 3LGYA 3ZVCA 2ZFRH 4K60A 1CHOG 4KTCA 4O3UA 2VIVA 1VITG 2Y80A 4ISIH 2ZCKP 2A5IA 1EX3A 3SNAA 1JRSA 2TGAA 3RUOA 1GBEA 1YF4A 2WINI 2FI5E 1GJCB 3FZZA 1GHAF 1ZTJA 3P70B 2BDBA 3WY8A 3URDA 2PKSB 1YPHE 3TNSA 4JZIA 2ANMH 1TB6H 3SU5A 5J4QA 2HNTF 2OC0A 3LH3A 3GCHC 2Y7ZA 1EAIA 2VJ1A 4X1QU 4ZKSU 5F8XA 2KAIB 3HGPA 3RXFA 3KQBA 4TYDA 4NIVA 1O3DA 1S83A 1EPTB 3SV9A 2ZDMA 3EE0B 1GHYH 1PPEE 2ZFQH 3ATWA 3RU4T 5BRRE 1A0JA 3BEFB 4JZEH 5FBIA 3M37A 1E0FD 1FY1A 2ZECA 3M7UA 1UTJA 3E6PH 2FPZA 4YT7H 3C27B 1CA0C 1MBMA 6CHAB 5FCRA 1XUIA 5C2ZA 2BD3A 5AFYH 4JMYA 4MPUA 2ZTYA 3PB1E 1RS0A 4K1TA 1BMNH 1GJ8B 1DWCH 3GDSA 3QDZB 3RC4A 3DT0H 3UFAA 3PV4A 1GBFA 5J4SA 4O97A 3RXKA 1TNHA 2H2ZA 3TLOA 5K7RA 4UFDH 4CRAA 2O8TA 2H5CA 3A7TA 1EAWA 1PJPA 1O2ZA 1BUIA 4WH6A 2WV4A 2Z3CA 2GV6A 4YT6H 1ZJDA 1BMAA 1CT4E 1HFDA 4DY7B 4AFZA 5DP9A 1GGDB 1DUAA 2IOTA 1ZPBA 1LVOA 8LPRA 2OD3B 3BG4B 1GVZA 1QGFA 5JPMH 4JZ1A 1GJ6A 2D1JA 1TNLA 1GI8B 1GHZA 1WAYB 1GI9B 3TJUA 1P01A 1BRUP 1BHXB 2Z9JA 1GBAA 4D9QA 2GD4B 1GVLA 1O2XA 1QJ7B 3O8CA 2WPMS 4DIIH 2BY5X 3A8DA 3A7YA 1D3QB 1C2HA 1KYNA 4DGJA 2R0KA 4MLFB 4X2WA 3SU0A 4DW2U 1AHTH 4KKDA 3RXQA 2TIOA 2C8WB 3PO1B 1OWJA 1D3DB 5E2OA 1TBQH 2FWWA 2RCEA 2ZCLP 3GY2A 2ZFTA 1NRSH 2BM2A 4QT8C 1XM1A 1KIGH 3SJ9A 5F6MA 1P2MA 1ZOMA 4MPVA 1TPPA 1EZQA 2Y7XA 6GCHG 2J9NA 2QXGA 2RDLA 4BAMB 1F92A 2OQ5A 1Z8JB 2ZHWH 2XBXA 1D3TB 3A7VA 2AGIX 2ZFPH 4ABBA 4JZFH 1LMWB 3MO9A 1T8OA 4F4OC 1T8LA 2BQWB 2ZU1A 1OYQA 3IWMA 3P17H 1UVSH 5JYIA 1GI2A 1INCA 2VIQA 5DP5A 2J2UA 1SG8B 3GY6A 1TQ0B 3OTJE 1O3CA 2HGTH 2PR3A 4FU9A 2P95A 5E8EH 1A3BH 1L0ZA 3S9BA 2QF3A 3BEIB 2ZDNA 1TBRH 1O38A 1UK3A 1GI5A 4BAQB 3RMOH 1K22H 4ISOA 1A5IA 1GBMA 1TQ7B 1S0RA 3A83A 4LXBH 4I33A 3DD2H 1FUJA 2FOHA 1SLUB 1WCZA 5EPYA 5AF9H 4O9VA 4NWLA 1LHFH 4GCHG 3RLYH 3AAVA 4A5TS 3UIRA 1O2LA 5T6DA 1QL8A 1RIWB 2BD9A 1YBWA 5T6FA 1G2LA 1C5WB 4XBBA 1OWHA 2F91A 1XUHA 4YOGA 3A85A 1QNJA 4H4FA 1IQLA 1RFNA 1WQVH 5I25A 1O30A 1D6RA 1QQUA 8GCHG 4Y11E 1RGQA 1C4U2 3NCLA 2FOGA 4NZLA 4YLUA 3SOSA 3GDVA 1C1VH 2VWMA 1CT2E 3S9CA 2XBYA 2GCHG 1F5LA 1TYNA 1O5CB 1XVMA 1LKBA 3D62A 4K69A 4ISNA 5PTPA 1GJ5H 1GL0E 2XBVA 1AWFH 5JDUB 1WU1A 3A87A 3LPRA 4K8BA 5I46H 1UTMA 1XXDA 1V2RT 1L1NA 4JZDH 3CENA 1NFYA 1PYTC 2FX6A 2BY8X 5DP8A 1SGEE 2FOMB 4YTAA 1PQ8A 3P8FA 3IG6B 5F03A 1ESTA 1O3OA 1BB0B 2HPQH 2VINA 2H9EH 1MAXA 4XFQA 1IQKA 1SGTA 3MWIU 2BQ7B 1QRZA 1ELDE 2J94A 3E8LA 1DY8A 1OSSA 3LIWA 2J34A 1K1IA 1Y3YA 5GCHF 2XNIA 5ABWA 3Q3XA 3V0XA 5C5NA 4GVUA 3V13A 2OBQA 2VVUA 4X6NA 2BLVA 3ZVBA 4WXIA 1OYTH 1ZMLA 2Y5FA 3T26A 3ZVAA 1BTPA 1ELGA 4ZMAH 1SGDE 4DURA 1TGNA 1GHXH 1CT0E 2FEQH 1FY5A 3UNSA 3KIDU 4B2BA 1NY22 5EW1H 4GUXA 1TRMA 3V7TA 2R3YA 1AN1E 1EZXC 4HGCA 1BOQA 2D26C 2NU3E 4NCYA 2C8XB 4Y76A 3F9GA 3M5LA 1WQSA 2W7SA 1IQEA 1Y3VA 2WUCA 4WH8A 3EA7A 2FOCA 3MH5A 4Q7YA 2PUXB 3RLWH 1ZHMA 3BTDE 2WPLS 1AY6H 3W95A 1EQ9A 2ZF0H 1WTHD 2BXTH 3A84A 1AB9B 1YCPK 3SNCA 2Z6BD 2ODQA 3UWJH 4GAWA 1W7GH 2ZDKA 5TCAA 4AB9A 3TPIZ 1AO5A 1W13U 3KN2A 1L1JA 1ABIH 1IQHA 4Q7ZA 1ZSLA 1O3GA 2SGEE 3LGTA 1TRNA 5AVDA 4ZKOU 1J15A 1QFKH 2J92A 2P59A 1DUEA 3I29A 2IJOB 5FBEA 4D7GA 2XBWA 1O3NA 3BIVH 1P12E 4OGXA 1UK2A 1CGHA 3LC3A 2BDCA 1SSXA 3RC6A 1PPZA 2PGQB 2ZPQA 3L33A 1B7XB 2JH0D 1LDTT 3NZIA 4FUCA 3Q76A 2BLWA 2R2WU 1JXPA 1MU6B 1CGJE 2AIQA 4FUEA 2UUYA 1TMUH 3JZ2B 1OP8A 1NT1A 2GTBA 4K1EA 5JBCS 1C5YB 2BTCE 3FAOA 4IN1A 3KQEA 3QZRA 3GY5A 1TOMH 4R8TB 3FP6E 1ZLRA 4ZXXH 4B71A 1ETTH 4I8JA 2HOBA 5FPYA 4JCNA 7GCHF 1A5HA 5JBBS 1TPOA 1EPTC 4CRCA 3NXPA 2VU8E 5GXPA 3M36A 3T2NA 1O0DH 2BOHB 4B2AA 1MBQA 2F9PA 5C3NA 1RTFB 1YLDA 3P6ZB 1G3BA 4OS2A 2BLOA 1IOEA 6CHAC 4ABIA 4K2YA 2Y82A 4B76A 1TNJA 1J17T 2EEKA 1EAXA 2XRCA 1DT2A 4OS6A 1UVTH 4DIHH 4JK5A 2A4QA 1THRH 5DO4H 1WOFA 4H42U 1P02A 1SOTA 9ESTA 3OX7U 3ZZ4A 2G5VA 2GX4A 1AMHA 3HKIB 2Q6FA 1GCDA 1D6WA 5HM9A 1O2TA 3PTNA 1RTLA 3E90B 1O31A 1AFQB 1ZZZA 1CQQA 3NK8A 1ESAA 1ZR0A 2VGCC 1LKAA 2Z9KA 3BG4C 2OC8A 2ZHQH 3RMLH 3ZV8A 3RC5A 1P3EA 1TALA 1DOJA 4E06H 4Y8ZA 4CHAB 1O2OA 3QN7A 3A7ZA 1V2ST 1LCYA 5IYTA 3SU4A 4CRDA 3QGNB 1OWKA 2D2DA 1HAYB 4IBLH 3BTWE 5GCHG 2CF9H 5B6OA 4AG1A 4B75A 3A80A 1TAWA 2WPIS 4WF8A 3MU5A 5TCCA 3NPSA 2AS9A 1GHVH 4E05H 2ZDLA 1BMLA 3PO1C 1K9OE 4U2WA 2ZDVH 3BN9A 2OC1A 1S85A 1TA6A 1HNEE 5CE1A 8ESTE 1DY9A 1L4DA 2BLQA 1TONA 2DUCA 3RXHA 1GG6B 1FAKH 3DA9B 1LQEA 2BQ6B 1UO6A 1C2DA 2Z94A 5FPSA 3M7TA 1SL3A 1TFXA 1GDNA 2P8OC 1HAIH 2HWLB 3OSYA 1C5PA 1UVOA 5HYOA 2BD4A 3F9FA 1ELBA 3NKKA 3BG8A 4XBDA 1HPGA 1GI3A 2CN0H 2V3OH 3V3MA 1LO6A 1G3EA 1DWDH 2J95A 3GYMA 5C67A 1FDPA 1O3LA 2G52A 2ZCHP 1D3PB 3RXBA 1GI1A 5EXNA 1C2MA 5DP3A 1SB1H 3ZV9A 1GJAB 1GJ7B 2AMPA 1DXPA 3MOCA 3F9EA 2LPRA 2XCFA 4ZHLU 1QR3E 4RSPA 1FY3A 2ANWA 1A0LA 1LPZB 2UWPA 5GJ4B 2UWLA 2ZEBA 2O8UA 2ZHEH 3TJVA 3TH4H 1GDQA 4X2VA 2OINA 4NIXA 1AZ8A 4FUJA 1DE7H 3SGQE 5EW2H 3SU3A 3PROA 1N1LA 1RIWC 4FUDA 5FPTA 4AG2A 1DS2E 2XW9A 1V2TT 2BYAX 2XXLA 3QUMP 1SGIB 3P92A 3QZQA 3O8RA 1QL7A 1T4UH 1O5BB 3T28A 4Y0YE 1HYLA 1AWHB 1EATA 4ABFA 2A7HA 1O3MA 2HALA 3FZDA 4FVDA 3VXEH 3S69A 5LPFA 5IDKA 4CR5A 4SGBE 3ENSB 4A1XA 2SGQE 4X1RU 1SGQE 1S5SA 1MZDA 3TH2H 3MHWU 3BTFE 3GOVB 1PQ5A 4VGCC 2PSYA 5LPRA 3UR9A 1WYKA 3K65B 3MH7A 2G8TA 1MTVA 1NRRH 2GGVB 4D9RA 1QBOA 1NC6A 1J9CH 2FYRA 5AHGH 1IQIA 1DM4B 5HXFA 3S7KB 1WSSH 2VWNA 1O32A 3QWCH 2Z9IA 2H1UA 3BEUA 5A8ZA 2CHAC 4UEHH 1FNIA 2NWNA 1P05A 1O3KA 5DK1A 3P95A 2QC2A 3SZNA 3HKJB 4CH2B 1NPMA 1TBZH 1EAUA 2A32A 3STJA 3UOUA 4UFGH 1HIAB 3ZYDA 2CV3A 1VJ9U 2IN2A 1P2KA 4Y7BA 1YPJH 2G00A 1MQ5A 1NU7B 2G81E 2BD5A 5GDSH 3TK6A 1C1MA 3TGKE 2PFEA 3MU1A 4OS4A 2HRVA 1G30B 2PHBA 1QRWA 2GT7A 2VIWA 1F7ZA 1M9UA 1HLTH 1SGNE 4DT7B 2VIPA 1GI6A 1KY9A 4WY3A 3PMBB 1TX8A 3VGCB 4CRFA 3PMAB 4LK4A 2C8YB 6LPRA 1K1NA 3ZVFA 5CMXH 3SJIA 1QA0A 4MPXA 1GI4A 4MPWA 2VWOA 1GMHG 1W8BH 4UONA 2BY9X 1W11U 2Z7FE 2ZC9H 2BMGB 3TK9A 1JMOH 2O9QA 2TGTA 1MU8B 2FDAA 3V12A 1IQNA 4FUIA 4X6MA 1HAPH 3LGUA 2XYAA 1TPSA 1QTFA 3GCTG 1Z8IB 3AW1A 3B9FH 2UUKB 1IQGA 1H1BA 1S84A 4ISLA 4MQAA 1YCPM 1VCPA 3ATLA 4AB8A 1C2GA 1H9HE 3FP8E 3TH3H 4WWYA 2AGGX 3ZZ5A 2Z3EA 4BAKB 1GBTA 2NU1E 4ZXYH 1A5GH 2H5DA 1BITA 1UCYE 2GMTB 2STAE 1OX1A 1O2MA 5F8TA 3CS0A 2ZTXA 3MI4A 1MD7A 2BB4A 1A61H 2THFB 1BBRE 1UVUH 1C1OA 3ZZ3A 1NRQH 1C4Y2 1C5RA 1HRTH 2B8OH 3UQOA 4BAHB 1NFXA 1PYTD 1BTWA 1W7XH 2NU4E 1C9PA 3RXSA 4RKJB 1SLXB 1YCPH 1F0RA 5AFZH 1OP0A 2P94A 4JYUH 3ZZBA 3A7XA 1OPHB 2BDHA 3F9HA 1FZZA 1QA7A 2CJIA 1K21H 4FUBA 1JBUH 3QTVH 1A7SA 3PM3A 3SW2B 4WMFA 3ELAH 1Y8TA 2XCNA 3H5CB 4K5ZA 2A2QH 3GY3A 1AUJA 1TLDA 2O8WA 4B2CA 2QXHA 4U30A 1B5GH 5EOKA 6ESTA 2W26A 4GSOA 4YO9A 5C1YA 4AN7A 1C1WH 1GBBA 1CE5A 1SGPE 3SU2A 4FXGH 4CH8B 2ZP0H 5ESTE 4JK6A 1L4ZA 1HJAB 1O35A 4X8VH 1AU8A 5LH8A 2PW8H 4FVBA 3SNDA 1NFUA 3ZZAA 3MFJA 2Q6DA 1MMJN 1DFPA 3AW0A 1T8MA 1VGCB 1O2QA 3MO3A 1F0UA 3TK5A 2W5EA 3MYWA 5JBAS 2OCVB 2RA0A 1UTQA 2Y81A 1ANDA 4O3TA 1HAZB 1QBVH 1UHBA 2H9HA 1O2RA 1QL9A 1N8OC 4AFUA 2ZU3A 3SUDA 2XWBI 1G2MA 4DOQA 3PMHB 1ZTLA 1YGCH 3VEQB 1GHAG 2ZGXH 2A4GA 3Q00A 5EXMA 2F9VA 1C5OH 1P57B 4MNYA 1O2UA 1QHRB 1H8DH 5FX5A 4ISHH 2GDDA 1GJ9B 1XX9A 2FP7B 1EOLA 5L2YH 4TWYA 1Y3WA 1J8AA 1GMCF 1AFQC 1TX6A 2FM2A 4AFSA 4Z0KA 1NRNH 1NTPA 1KXDA 1LHDH 1SGFA 1V2NT 1FJSA 3PWBA 1Z71A 1CO7E 1OXGA 5A0BA 5H4IB 3BTTE 2YNAA 4LZ1H 1UTKA 3A8AA 1EJNA 2BY6X 1W12U 4Y10E 4RKOB 1T4VH 2DE9A 1J16A 1HAHH 3ZZ8A 1TGSZ 2C93B 2I6QA 1JIMA 3U8OH 2FYQA 1DITH 5T6GA 3RM0H 1IQJA 4UE7H 1JRTA 2AH4X 3M7QA 5ETXA 1MH0A 1RJXB 4TPYA 5GWZA 3CP7A 1LHCH 1TA2A 2Q6GA 1UJ1A 2I6SA 1H8IH 4AFQA 3N7OA 1BT7A 1ANCA 3ZVEA 3BTEE 4Y79A 1KLJH 1O36A 1XXFA 5A8XA 3MMGA 4ASHA 1CBWB 1CGIE 5L2ZH 1VR1H 3M3TA 1BA8B
chains in the Genus database with same CATH superfamily
1DDJA 1SLVB 3AAUA 1O2YA 3SO3A 1OWIA 5FXLA 1UHBB 3SHCH 1YPGH 2R0LA 1ELTA 3DUXH 1W14U 3DSOA 3ZVDA 5CHAB 3MNSA 1EKBB 3E91A 4X8SH 1C1TA 1GJ4H 1F5RA 2QAAA 3MNXA 4IMZA 3ITIA 3RXGA 1Q3XA 2AMDA 1NRPH 1E34B 1GVKB 2BDGA 2A4OA 4MTBA 2IPQX 4IC5A 1O37A 4INHA 3L6PA 2ZA5A 1HXEH 2WYGA 4OGYA 5DP4A 2ZFFH 3RXPA 1O2IA 5EODA 2AGEX 2GV7A 2XC4A 4FU8A 2GZ8A 1SVPA 1FN6A 2GCTC 2BX4A 4GHQA 3BTGE 4R0IA 1GBDA 4A92A 1SGFG 3T62A 1J14A 2BOKA 1K1PA 1TRYA 4JYTA 2W3KA 4OS7A 2STBE 4B74A 1BZXE 1TNIA 2VIDA 2VWLA 2TRMA 1LPKB 4F48B 3RP2A 5LGOA 1LHGH 3DHKH 2FOEA 3U98H 1GCTC 2W3IA 3F68H 1XUJA 2VVVA 3E16B 2SGPE 2NU2E 4ESTE 1TMTH 1Y5UT 3UWIA 3SGAE 1KSNA 2PV9B 3UREA 4RN6A 1GI7B 4X8TH 4YZUA 1ETRH 5E0HA 2FZZA 3VXFH 1NO9H 1GHBF 4FU7A 1N6YA 1QJ6B 2KFWA 1O3HA 2P93A 3GICB 5EPNA 1OP2A 2EI8A 1AIXH 1KDQA 4HI3A 3TU7H 1V2QT 3GY8A 5G4BA 1P06A 2B9LA 1DVAH 2AMQA 5E0JA 4THNH 2HPPH 2TGDA 1LVBA 4BOHA 2VH0A 3QK1A 2ZIQH 1JIRA 1C2EA 3M61U 3ZZCA 1AVXA 3SHAH 1GI0A 2O8LA 1QURH 3RXEA 1C1PA 2PKSC 1NN6A 2VVCA 2VNTA 1XKBC 1AD8H 3SN8A 2LNCA 3OY6U 1IQFA 4CBOA 1C2IA 5E0GA 3RDZA 1F0TA 1L1GA 1QY6A 2J38A 1SC8U 1SQAA 2LP6A 2GJGA 1FLEE 1V2LT 4UD9H 3RU4E 1GBIA 1CHOF 1V6DA 1O2WA 4K1SA 1G9IE 1ZSKA 4MNWA 4AOQA 1VITF 1O2GH 4X1NU 4AYVB 1SHHB 2G5NA 1C1QA 2B7DH 2OBOA 2RG3A 3I77A 3PTBA 3BTQE 4GPGA 3ZIAD 3LGVA 3FP7E 4X1PU 1GMCG 4ABJA 2ZPSA 1UTPA 3S7HB 2A1DB 1H8HD 2A7CA 3F2HA 1IQMA 4K8YA 3LKWA 4TPIZ 3M3SA 1MKXH 1Z8RA 4Q7XA 1PQ7A 1P8VC 3VGCC 2TBSA 3OEED 2NU0E 1S0QA 2PKAA 1BMMH 3CS7A 3KQDA 2JETB 4BTTB 3VB7A 1GMDF 1GGDC 1KDQB 2H9TH 1GBHA 1OKXA 2AIPA 1AKSA 3LJJA 4DCDA 3LDXH 5FAHA 3ATMA 1HCGA 1P2OA 1HJ8A 2ZU2A 4MDSA 4Y8YA 1C5XB 1L2EA 5GPIB 5A8YA 3ATKA 1OHHD 1TE0A 1FPCH 1P10A 2R2MB 1W10U 3ZVGA 3DFJA 3K2UA 9LPRA 3UTUH 1YC0A 1TWXB 1E37B 1JWTA 2CK3D 3PLPA 1WV7H 2ANYA 3ZZ6A 1FV9A 3SV2H 3LC5A 1LHEH 4BANB 2A2XH 5L30H 1QRXA 3JZ1B 2OP9A 4KTSA 2GMTC 2GT8A 1G32B 1V3XA 1LPGB 4ABHA 2BDYA 4ZKNU 2ZPRA 3MNCA 1ZSJA 2XTTB 3EAJA 1E1RD 1KTSB 3E3TA 7ESTE 3F6UH 2V3HH 3LGWA 3A81A 3RXLA 2BD2A 1Z6EA 3MTYA 3HGNA 1DANH 1SGYE 3T29A 3U1IB 3HK3B 3H7TA 2Y5GA 1ZJKA 1YYY1 4AGJA 3OEHD 2F3CE 1SQTA 2V6NA 1BHXF 1XUGA 2ALPA 1LVYA 2PKAB 2ZGHA 3EA9A 2WPJS 1ZPZA 2ZU4A 2YNBA 5F53A 4BXSA 2FS8A 7KMEH 4I8GA 1MABB 4GLYA 1K1LA 5HM2A 4LOYH 2PWXA 2A4RA 4TY6A 3UQVA 4ASUD 1MTSA 4AC9A 1SR5C 3VG8A 4IMQA 2AEIH 4X2XA 1V2OT 2BVSH 3K9XB 4Y8XA 2YOLA 6GCHF 4X6OA 3RXMA 1ZTKA 3RMNH 1TGTA 3TJOA 1HBTH 3SV8A 2BDAA 2JJ2D 3QGJA 3VB6A 1C2FA 3Q3YA 1O3AA 2ASUB 5EQQA 2Y5HA 1K28D 1KLIH 5BPEA 2ZDAH 5JB8S 1VGCC 1SFIA 4ABEA 1KXAA 3VPKA 3R0FA 1SI5H 3STIA 3GY4A 5DP6A 5C94A 1F0SA 3FN8A 3KYGA 2CGAA 4CR9A 4XBCA 1Y5BT 3FANA 4XRNA 1FIWA 5ESBA 2FTLE 2ZKSA 1HGTH 1W0ZU 2ZGCA 2ZQ1A 1T7CA 3KGPA 2HNTC 2CF8H 1TGBA 3NUMA 1FONA 1Y5AT 1FMGA 3RXJA 3U28C 4CRBA 3TVJB 3UAIC 3QLPH 1TMBH 2VH6A 3UNQA 1THPB 1WBGB 4GCHF 1ID5H 7GCHG 2QF0A 1HAXB 2G55A 2A0QB 2AFQB 2B0FA 3CNRA 3KF2A 5C17A 4JYVH 3D65E 1O34A 1QB9A 4AORA 1WTGH 1P09A 1MKXK 4J2YB 3FO8D 1O2HA 1K1OA 2BZAA 2QF5A 4OS5A 1A3EH 2K8IA 3KCGH 4O03A 1QCPA 1ZYOA 1ELAA 1UTNA 1Q31A 5K0HA 1N6XA 1O2KA 3UY9A 3VB3A 1K1MA 1OWEA 1EB1H 8GCHF 1O5GH 5F8ZA 2ZHFH 1E38B 2SFAA 4U32A 3SORA 3T25A 4NA7A 1O5AB 2QV1A 3SJ8A 1DPOA 1VJAU 1C5QA 1MTNB 1TNKA 3TGIE 2GCHF 1ETSH 3SUFA 1C1UH 1P3CA 5CHBA 1S82A 3ESTA 2Z9GA 3E1XB 1DWEH 1H9LB 3SV7A 1DSUA 1TNGA 1SOZA 1CBWC 1KXFA 3I78A 1AVWA 1K2I1 5JB9S 1GMDG 1XVOA 1EP6A 2BVRH 1ZGVA 4D76A 3WW7A 2WPHS 3SNBA 2PTNA 2VIOA 3OFND 1PPFE 3K6YA 3A89A 2A45B 1O2PA 1C4V2 2OLGA 2TGPZ 2BX3A 5CHAC 2P16A 5HMAA 1HAOH 3DFLA 3VFEA 4ZHMU 2OXSA 2OC7A 1AQ7A 5IK2D 3G01A 1HUTH 4H6SB 1DWBH 1O2VA 4NGAH 1RD3B 1DSTA 1VZQH 1EZSC 2WSSD 1SMFE 1S81A 4I8KA 2GVFA 3Q77A 3TJNA 8KME2 4Y6DA 3PWCA 4ABDA 5L6NH 1TGCA 2UUJB 1T31A 1ARBA 1QB1A 1CVWH 3F2GA 3P8NA 1AB9C 1KXEA 5DG6A 1FPHH 1E36B 3LJOA 1O33A 3VB4A 4YOIA 1V2PT 4Q63A 1T32A 3F0OA 4ZKRU 1MTWA 1YPEH 1D4PB 4AGKA 5FX6A 2G4UA 1H4WA 5DP7A 1EP5A 2VGCB 2P3FH 3MH4A 2V35A 1V2UT 1GJDB 5A2MH 5DJ7A 2C4FH 3EGKH 2CXVA 3A88A 1W3CA 5C1XA 2HNTE 1CSOE 1BIOA 1UCYK 2FIRH 3D49H 3BV9B 1BTZA 2G4TA 3FKSD 2BD8A 2QA9E 1DXWA 4D7FA 1T8NA 2FO9A 1Z1IA 1O2JA 2Z9LA 1BBRK 1BQYA 1GPZA 1V2MT 3AASA 1Z7KA 3TITA 3RM2H 5EQRA 1AI8H 4WVPE 3MH6A 4DJZB 4KGAA 1C5LH 1CA8B 3LT3A 1ELFA 1UTOA 1KTTB 1C2KA 4WXVA 2SNVA 1EXFA 2ZI2H 3BF6H 1V2KT 5FL7D 4B73A 5EGMA 4M7GA 2P8OB 3BTME 2F9UA 1S6FA 1GBCA 1JOUB 1NFWA 4PROA 3LGIA 1NROH 2M5TA 4HFPB 2GKVE 3ZZ7A 2ZNKH 3H09A 2QN5T 1EZUC 1F5KU 1PPHE 1BJVA 1EOJA 3RU4D 1KXBA 1A46H 1ORFA 1GBKA 2F83A 1AE5A 2ZGJA 2WPKS 2EI7A 1ELVA 3E0NB 5TJXA 1HAVA 3EA8A 3RXCA 2QXJA 2WUBA 1ZHPA 2SNWA 4XE4A 5C0TA 5C20A 2ZFSA 1A4WH 1GWAA 3QTOH 1ABJH 3M35A 2QGRA 1AUTC 1Z8GA 1YPMH 4OM9A 4YOJA 1OS8A 2V0BA 1FQ3A 2XC5A 1AFEH 2R9PA 1HDTH 3SJKA 3KHVA 1CU1A 2ZU5A 1C2JA 3QO6A 2WZQA 1OOKB 3Q3KA 1THSH 1IHSH 2EI6A 1H9IE 3UUZA 4UDWH 2F9OA 2GZ7A 1FI8A 1MKWH 4UFEH 4AYYB 1TPAE 1BTYA 1OWDA 4IC6A 3E0PB 1UTLM 2HVXA 2JETC 1NZQH 1NU9A 1YPKH 1YM0A 4FOUC 1AE8H 1BRCE 2W6ID 1Y3XA 3SQHE 1YP9A 5EXLA 4ZUHA 5A0AE 5GIBA 3SYJA 1O5DH 1QB6A 2FXRA 1GHWH 1HXFH 4CHAC 3P8OA 2VB0A 5B6LA 4I8HA 4NFEA 3SGBE 5DSFA 1QQ4A 1MD8A 7LPRA 1ANBA 3SI4H 1X7AC 1UW7A 4RT1A 3M5MA 3TGJE 3PLBA 1KXCA 4U01A 1BRBE 4J1YA 2ZTZA 1G37A 1LVMA 4NA9H 3O8DA 4VGCB 4Q2KA 3M3VA 3SNEA 4B1TA 2ZHDA 1O3JA 1C1NA 4Z6AH 5HKKD 3T5FH 1HAVB 3KL6A 3URCA 4LZ4B 1EASA 2OTVA 3M5OA 1D9IA 2A5AA 4ZHAA 1ZPCA 3UPEA 1V2VT 1GG6C 1P9UA 3GCHB 1BDAA 5HIYA 2BDIA 2CHAB 1EB2A 1P04A 1BTUA 1TABE 2M2AA 1SHYA 1P2QA 1GDUA 2FODA 1TX7A 2L74A 2XOKD 4ACAA 2O8MA 1LTOA 4K3JA 1G36A 3BIUH 3UR6A 5EG4A 3RXRA 1BRAA 4AX9H 3KYFA 3FVFB 2FOFA 4WMEA 1CA0B 2K1QA 4YESB 1O2SA 2P3UB 1FN8A 1ACBE 1SLWB 3LH1A 3HK6B 1RRKA 1ZHRA 1C5TA 4NG9H 3P8GA 1MTUA 1O3FA 2FMJA 3QX5H 2PP6A 4X2YA 1O3IA 1Z1JA 2SGDE 4NIYA 3SUGA 1XUFA 1FIZA 2PSXA 1LQDB 3LU9B 2FLRH 4KTUA 2W7UA 2A7JA 1EUFA 1SFQB 3F1SB 4M9FA 1S6HA 1QBNA 2GZ9A 2WV5A 1VITH 3PLKA 3SBKA 4NA8A 2C8ZB 4A1TA 2F9BH 2G51A 4A6LA 4FUHA 4TY7A 2C90B 2XWAA 1SPJA 3K6ZA 3OE7D 2ODYB 1O5FH 4CBNA 1UVPA 1MCVA 4HZHA 3KEEA 1V2JT 2FX4A 2YMSB 1DLKB 1XUKA 3T27A 1P11E 1UMAH 4I31A 4XOJA 5A0CA 1U6QA 1PPBH 3BSQA 2BXUH 3R3GB 1E35B 1RTKA 4B6EA 1K0HA 4NSYA 1IAUA 1O5EH 3NWUA 3B23B 4IS5A 1P2IA 1PFXC 1VCWA 5DKMA 4Y0ZE 2VBCA 1TIOA 3S0NA 2ZG0H 1RXPA 4ZCNA 4KP0A 3U8TH 2AYWA 1G3CA 1A1RA 1C5SA 2BZ6H 3M5NA 4INKA 5C1UA 5EQSA 2PUQH 3MNBA 3ODFA 4TT3D 2EA3A 2ESTE 2ALVA 3NRLA 2ULLA 1P9SA 4X8UH 3KQCA 3L3TA 4E7RG 1A0HB 2TPIZ 2Q1JA 1WUNH 4SGAE 1V2WT 1C5MD 5KGOA 1MKWK 4I32A 2FESH 3ZZ9A 3RMMH 3VB5A 1YLCA 5A09A 3TNTA 1MUEB 1NESE 1ARCA 2WYJA 4HTCH 1C1RA 2B5TB 2SGAA 4NZQA 3ZZDA 5FCKA 2EC9H 4FUGA 1B0EA 4IW4E 1YKTA 3A82A 3AK5A 2ZZUH 5T3HA 1MTNC 3MO6A 3OYPA 4A7IB 1PPCE 1P0SH 1Q2WA 1F2SE 1FY4A 2H6MA 1HAGE 4Y7AA 1C9TA 3FFGA 5LPEA 3GCOA 1UK4A 3SJOA 3D23A 3EQ0H 1DX5M 1HB0B 4RT0A 4X0WU 1C5VA 1ESBA 5DPAA 3EE7A 3GS9A 3SU1A 1C5NH 2FTMA 4NFFA 2XC0A 4ZAEA 4CREA 3RXUA 3SU6A 1GL1A 1KLTA 3B8JA 1BTXA 4Y71A 4YM9A 4X1SU 2ZO3H 2J4IA 2PTCE 3ODDA 2C3SA 2WV9A 3A8BA 4GHTA 3O8BA 3MU4A 1XKAC 3U8RH 1N8OB 4BNRA 2BY7X 4MVNA 2ZGBH 4YLQH 3BTHE 4IGDA 3SV6A 1QIXB 3MU0A 4ABGA 4BXWA 2AERH 1QJ1B 1GJBB 4BTIB 4Q80A 3S9AA 1C2LA 2Y6TA 4MG3A 1P03A 2QY0B 1E1QD 1FAXA 2BHGA 4WMDA 5HGGA 4IN2A 2GP9B 3RXOA 1ZMNA 1PPGE 4DG4A 1C5UA 2QYIA 1VCQA 3PV2A 3GYLB 3TIUA 1AZZA 3IITA 4BTUB 1SGRE 4ABAA 2ANKH 2BD7A 2FI4E 3OY5U 2D8WA 2QIQA 3EYDA 1O2NA 2J98A 1YPLH 4CRGA 2IPHA 1O3BA 4TWWA 4UFFH 3HATH 4NSVA 1GMHF 2JH5D 3OTPA 2L6OA 3ATIA 5C5OA 1IHTH 3GCNA 1YLNA 2FS9A 1YPHC 3A8CA 3U9AH 2SGFE 2GDEH 5EJLA 1ZRKA 2JH6D 2AHME 1MQ6A 1SGCA 1ZMJA 3GCTF 1EJAA 2FI3E 2FOAA 1GBJA 1MZAA 1QZ8A 4AZ2B 2A31A 1C5ZB 4ZROA 1ZRBA 1Z6JH 1B0FA 1MCTA 4MNVA 1PQAA 3AVZA 2OQUA 3HPTB 2KX4A 2A5KA 2UUFB 3C1KA 2QCYA 4NIWA 3KNXA 1GBLA 1FXYA 2WPDD 1AKSB 1O3PB 1MAYA 1TOCB 4RI0A 1O39A 5JBTA 1UCYH 1K1JA 4D8NA 3RXIA 3BTKE 1AVGH 1Y3UA 4ZH8A 1AGJA 3ZYEA 4I8LA 3W94A 1EJMA 1CHGA 1G3DA 2ZQ2A 4NWKA 2Z3DA 3SI3H 1HJAC 1BBRH 2ZWLH 1BTHH 1SBWA 2UWOA 2BVXH 1SQOA 3GY7A 1A2CH 4WJG2 3OU0A 1GHBG 2KAIA 3DSGA 3RXDA 1NM6A 4BAOB 2RA3A 3EDXB 1EPTA 2QXIA 1W0YH 1W2KH 3RXAA 2GCTB 3PYHA 2F9NA 3SUEA 1BJUA 4F49A 4MNXA 1HJ9A 3H7OA 4OS1A 4FUFA 3U1JB 3A7WA 2J98B 2ODPA 1Y59T 4DVAU 4E7NA 4I7YH 1FY8E 1HIAA 3LONA 1P2JA 5E2PA 2DE8A 1ZGIA 3A86A 2CMYA 5DGJA 2FLBH 4H6TA 5FHTA 1NS3A 1O3EA 2HLCA 2R3UA 1XMNB 1GCTB 3FOAA 5SGAE 1P2NA 3MU8A 1ELCA 3UOPA 2JKHA 2PGBB 1ELEE 2ILNA 3LOXA 3RXVA 3PMJA 1BCUH 2P3TB 2PLXA 4XSKU 2OUAA 3GISB 4XDEA 4A1VA 1C1SA 3U69H 3RXTA 3UNRA 2FOBA 1ANEA 4KELA 4X6PA 1DICA 3N7DA 4INLA 3SQEE 4DT4A 1HV7A 1DLEA 3GDUA 5EU8A 3LGYA 3ZVCA 2ZFRH 4K60A 3KQ5A 1CHOG 1EFRD 3PRDA 4KTCA 4O3UA 2VIVA 3DSPA 1VITG 2Y80A 4ISIH 2ZCKP 2A5IA 1EX3A 3SNAA 1JRSA 2TGAA 3RUOA 1GBEA 1YF4A 2WINI 2FI5E 1GJCB 3FZZA 1GHAF 1ZTJA 3P70B 2BDBA 3WY8A 3URDA 5EJZA 2PKSB 1YPHE 3TNSA 4JZIA 2ANMH 1TB6H 3SU5A 5J4QA 2HNTF 2OC0A 3LH3A 5T1VA 3GCHC 2Y7ZA 1EAIA 2VJ1A 4X1QU 4ZKSU 5F8XA 2KAIB 3HGPA 3RXFA 3KQBA 4TYDA 4NIVA 1O3DA 1S83A 1EPTB 3SV9A 2ZDMA 3EE0B 1GHYH 1PPEE 2ZFQH 3ATWA 3RU4T 5BRRE 1A0JA 3BEFB 4JZEH 5FBIA 3M37A 1E0FD 1FY1A 2ZECA 3M7UA 1UTJA 3E6PH 2FPZA 3N7EA 4YT7H 5KEDA 3C27B 1CA0C 1MBMA 6CHAB 2W6JD 5FCRA 1XUIA 5C2ZA 2BD3A 3F2FA 5AFYH 4JMYA 4MPUA 2ZTYA 3PB1E 1RS0A 4K1TA 1BMNH 1GJ8B 1DWCH 3GDSA 3QDZB 3RC4A 3DT0H 3UFAA 3PV4A 1GBFA 5J4SA 4O97A 3RXKA 1TNHA 2H2ZA 3N99A 3TLOA 5K7RA 4UFDH 4CRAA 2O8TA 2H5CA 3A7TA 1EAWA 1PJPA 1O2ZA 1BUIA 4WH6A 2WV4A 2Z3CA 2GV6A 4YT6H 1ZJDA 1BMAA 1CT4E 1HFDA 4DY7B 4AFZA 5DP9A 1GGDB 1DUAA 2IOTA 1ZPBA 1LVOA 8LPRA 2OD3B 1YY3A 3BG4B 1GVZA 1QGFA 5JPMH 1SKYE 4JZ1A 1GJ6A 2D1JA 2YMSC 1TNLA 5DN6D 1GI8B 1GHZA 1WAYB 1GI9B 3TJUA 1P01A 4F55A 1BRUP 4Z1MD 1BHXB 2Z9JA 1GBAA 4D9QA 2GD4B 1GVLA 1O2XA 1QJ7B 3O8CA 2WPMS 4DIIH 2BY5X 3A8DA 3A7YA 1D3QB 1C2HA 1KYNA 4DGJA 2R0KA 4MLFB 4X2WA 3SU0A 4DW2U 1AHTH 5GNDA 4KKDA 3RXQA 2TIOA 2C8WB 3PO1B 2HLDD 1OWJA 4B6FA 1D3DB 5E2OA 1TBQH 2FWWA 2RCEA 2ZCLP 3GY2A 2ZFTA 1NRSH 2BM2A 4QT8C 1XM1A 1KIGH 3SJ9A 5F6MA 1P2MA 1ZOMA 4MPVA 1TPPA 1EZQA 2Y7XA 6GCHG 2J9NA 2QXGA 2RDLA 4BAMB 1F92A 2OQ5A 1Z8JB 2ZHWH 2XBXA 1D3TB 3A7VA 2AGIX 2ZFPH 4ABBA 4JZFH 1LMWB 3MO9A 1T8OA 4F4OC 1T8LA 2BQWB 2ZU1A 1OYQA 3IWMA 3P17H 1UVSH 5JYIA 1GI2A 1INCA 2VIQA 5DP5A 2J2UA 1SG8B 3GY6A 1TQ0B 3OTJE 1O3CA 2HGTH 2PR3A 4FU9A 2P95A 5E8EH 1A3BH 1L0ZA 3S9BA 1WDIA 2QF3A 3BEIB 2ZDNA 1TBRH 1O38A 1UK3A 1GI5A 4BAQB 3RMOH 3F0PA 1K22H 4ISOA 1A5IA 1GBMA 1TQ7B 1S0RA 3A83A 4LXBH 4I33A 3DD2H 1FUJA 2FOHA 1SLUB 1WCZA 5EPYA 5AF9H 4O9VA 4NWLA 1LHFH 4GCHG 3RLYH 3AAVA 4A5TS 3UIRA 1O2LA 5T6DA 1QL8A 1RIWB 2BD9A 1YBWA 5T6FA 1G2LA 1C5WB 4XBBA 1OWHA 2F91A 2F43B 1XUHA 4YOGA 3A85A 1QNJA 3PV5A 4H4FA 1IQLA 1RFNA 1WQVH 5I25A 1O30A 2KZ4A 1D6RA 1QQUA 8GCHG 4Y11E 1RGQA 1C4U2 3NCLA 2FOGA 2KCPA 4NZLA 4YLUA 3SOSA 3GDVA 1C1VH 2VWMA 1CT2E 3S9CA 2XBYA 2GCHG 1F5LA 1TYNA 4TSFD 1O5CB 1XVMA 1LKBA 3D62A 2RDEA 4K69A 4ISNA 5PTPA 1GJ5H 1GL0E 2XBVA 2EY4C 1AWFH 5JDUB 1WU1A 3A87A 3LPRA 4K8BA 5I46H 1UTMA 1XXDA 1V2RT 1L1NA 4JZDH 3CENA 1NFYA 1PYTC 2FX6A 2BY8X 4XD7D 5DP8A 1SGEE 2FOMB 4YTAA 1PQ8A 3P8FA 3IG6B 5F03A 1ESTA 1O3OA 1BB0B 2HPQH 2VINA 2H9EH 1MAXA 4XFQA 1IQKA 1SGTA 3MWIU 2BQ7B 1QRZA 1ELDE 2OK5A 2J94A 3E8LA 1DY8A 1OSSA 3LIWA 2J34A 1K1IA 1Y3YA 5GCHF 2XNIA 5ABWA 3Q3XA 3V0XA 5C5NA 4GVUA 3V13A 2OBQA 2VVUA 4X6NA 2BLVA 3ZVBA 4WXIA 1OYTH 1ZMLA 2Y5FA 3T26A 3ZVAA 1BTPA 1ELGA 4ZMAH 1SGDE 4DURA 1TGNA 1GHXH 1CT0E 2FEQH 1FY5A 3UNSA 3KIDU 4B2BA 1NY22 5EW1H 4GUXA 1TRMA 3V7TA 2R3YA 1AN1E 3F3BA 1EZXC 4HGCA 1BOQA 2D26C 2NU3E 4NCYA 2C8XB 4Y76A 3F9GA 3M5LA 1WQSA 2JJ1D 1IQEA 2W7SA 1Y3VA 2WUCA 4WH8A 3EA7A 2FOCA 3MH5A 4Q7YA 2PUXB 3RLWH 1ZHMA 3BTDE 2WPLS 1AY6H 3W95A 1EQ9A 2ZF0H 1WTHD 2BXTH 3A84A 1AB9B 1YCPK 2J5UA 3SNCA 2Z6BD 2ODQA 3UWJH 4GAWA 1W7GH 2ZDKA 5TCAA 4AB9A 3TPIZ 1AO5A 3UB0A 1W13U 3KN2A 1L1JA 1ABIH 1IQHA 4Q7ZA 1ZSLA 1O3GA 2SGEE 3LGTA 1TRNA 5AVDA 4ZKOU 1J15A 1QFKH 2QF4A 2J92A 2P59A 1DUEA 3I29A 2IJOB 5FBEA 4D7GA 2XBWA 1O3NA 3BIVH 1P12E 4OGXA 1UK2A 1CGHA 3LC3A 2BDCA 1SSXA 3RC6A 1PPZA 2PGQB 2ZPQA 3L33A 1B7XB 2JH0D 1LDTT 3NZIA 4FUCA 3Q76A 2BLWA 4P00A 2R2WU 1JXPA 1MU6B 1CGJE 2AIQA 4FUEA 2UUYA 1TMUH 3JZ2B 1OP8A 1NT1A 2GTBA 4K1EA 5JBCS 1C5YB 2BTCE 3FAOA 4IN1A 1WXRA 3KQEA 1H8ED 3QZRA 3GY5A 2KCYA 1TOMH 4I86A 3FP6E 4R8TB 1ZLRA 4ZXXH 3WWBA 4B71A 1ETTH 4I8JA 2HOBA 5FPYA 4JCNA 7GCHF 1A5HA 5JBBS 1TPOA 1EPTC 4CRCA 3NXPA 2VU8E 5GXPA 3M36A 3T2NA 1O0DH 2BOHB 4B2AA 1MBQA 2F9PA 5C3NA 1NBMD 1RTFB 1YLDA 3P6ZB 1G3BA 4OS2A 2BLOA 1SQRA 1IOEA 6CHAC 2QE7D 4ABIA 4K2YA 2Y82A 4B76A 1TNJA 1J17T 2EEKA 1EAXA 2XRCA 1FX0B 1DT2A 4OS6A 1UVTH 4DIHH 4JK5A 2A4QA 1THRH 5DO4H 1WOFA 4H42U 1P02A 1SOTA 9ESTA 3OX7U 3ZZ4A 2G5VA 2GX4A 1AMHA 3HKIB 2Q6FA 1GCDA 1D6WA 5HM9A 1O2TA 3PTNA 1RTLA 3E90B 1O31A 1AFQB 1ZZZA 1CQQA 3NK8A 1ESAA 1ZR0A 2VGCC 1LKAA 2Z9KA 3BG4C 2OC8A 5HIZA 2ZHQH 3RMLH 3ZV8A 3RC5A 1P3EA 1TALA 1DOJA 4E06H 4Y8ZA 4CHAB 1O2OA 3QN7A 3A7ZA 4FETA 1V2ST 1LCYA 4P02A 5IYTA 3SU4A 4CRDA 3WWFA 3QGNB 1OWKA 2D2DA 1HAYB 4IBLH 3BTWE 5GCHG 2CF9H 5B6OA 4AG1A 4B75A 3A80A 1TAWA 5EJ1A 2WPIS 4WF8A 1E79D 3MU5A 2V3MA 5TCCA 3NPSA 2AS9A 1GHVH 4E05H 2ZDLA 1BMLA 3PO1C 1K9OE 4U2WA 2ZDVH 3BN9A 2OC1A 1S85A 1TA6A 1HNEE 5CE1A 2KCAA 1DY9A 1L4DA 8ESTE 2BLQA 1TONA 2DUCA 3RXHA 5EIYA 1GG6B 1FAKH 3DA9B 1LQEA 2BQ6B 1UO6A 1C2DA 2Z94A 5FPSA 3M7TA 1SL3A 1TFXA 1GDNA 2P8OC 1HAIH 2HWLB 3OSYA 1C5PA 1UVOA 5HYOA 2BD4A 3F9FA 1ELBA 3NKKA 3BG8A 4XBDA 1HPGA 1GI3A 2CN0H 2V3OH 3V3MA 1BMFD 1LO6A 1G3EA 1DWDH 2J95A 3GYMA 5C67A 1FDPA 1O3LA 2G52A 2ZCHP 1D3PB 3RXBA 1GI1A 5EXNA 1C2MA 5DP3A 1SB1H 3ZV9A 1GJAB 1GJ7B 2AMPA 1DXPA 3MOCA 3F9EA 2LPRA 2XCFA 4ZHLU 1QR3E 4RSPA 1FY3A 1VKYA 2ANWA 1A0LA 1LPZB 2UWPA 5GJ4B 2UWLA 2ZEBA 2EQNA 2KM0A 2O8UA 2ZHEH 3W1EA 2F4LA 3TJVA 3TH4H 1GDQA 4X2VA 2OINA 4NIXA 1AZ8A 4FUJA 2XNDD 1DE7H 2WHXA 3SGQE 5EW2H 3SU3A 3PROA 1N1LA 1RIWC 4FUDA 5FPTA 4AG2A 1DS2E 2XW9A 1V2TT 2BYAX 2XXLA 3QUMP 1SGIB 3P92A 3QZQA 3O8RA 1QL7A 1T4UH 1O5BB 3T28A 2YMSD 4Y0YE 1HYLA 1AWHB 1EATA 4ABFA 2A7HA 1O3MA 2HALA 3FZDA 4FVDA 3VXEH 3S69A 5LPFA 5IDKA 4CR5A 4SGBE 3ENSB 4A1XA 2SGQE 4X1RU 1SGQE 5CDFE 2V7QD 1S5SA 1MZDA 3TH2H 5C0UA 3PRBA 3MHWU 3BTFE 3GOVB 1PQ5A 4VGCC 2PSYA 5LPRA 3UR9A 1WYKA 3K65B 3MH7A 2G8TA 1MTVA 1NRRH 2GGVB 4D9RA 1QBOA 1KMHB 1NC6A 1J9CH 2FYRA 5AHGH 1IQIA 1DM4B 5HXFA 3S7KB 1WSSH 2VWNA 1O32A 3QWCH 2Z9IA 2H1UA 3BEUA 5A8ZA 2CHAC 2JIZD 4UEHH 1FNIA 2NWNA 1P05A 1O3KA 5DK1A 3P95A 2QC2A 3SZNA 3HKJB 4CH2B 1NPMA 1TBZH 1EAUA 2A32A 3STJA 3UOUA 4UFGH 1HIAB 3ZYDA 2CV3A 1VJ9U 2IN2A 1P2KA 4Y7BA 1YPJH 4ACBA 1NBME 2G00A 1MQ5A 1NU7B 2G81E 2BD5A 4YXWD 5GDSH 3TK6A 1C1MA 3TGKE 2PFEA 3MU1A 4OS4A 2HRVA 1G30B 2PHBA 1QRWA 2GT7A 2VIWA 1F7ZA 1M9UA 1HLTH 1SGNE 4DT7B 2VIPA 1GI6A 1KY9A 4WY3A 3PMBB 1TX8A 3VGCB 4CRFA 2RFKC 3PMAB 4LK4A 2C8YB 6LPRA 1K1NA 3ZVFA 5CMXH 3SJIA 2K0QA 1QA0A 4MPXA 1GI4A 4MPWA 2VWOA 1GMHG 1W8BH 4UONA 2BY9X 1W11U 2Z7FE 2ZC9H 2BMGB 3TK9A 1JMOH 2O9QA 2TGTA 1MU8B 2FDAA 3V12A 1IQNA 4FUIA 4X6MA 1HAPH 3LGUA 2XYAA 1TPSA 1QTFA 1S6LA 3GCTG 1Z8IB 3AW1A 3B9FH 2UUKB 1IQGA 1H1BA 1S84A 2LELA 4ISLA 4MQAA 1YCPM 1VCPA 3ATLA 4AB8A 1C2GA 1H9HE 3FP8E 3TH3H 3OAAD 4WWYA 2AGGX 3ZZ5A 2Z3EA 4BAKB 1GBTA 2IJD1 2NU1E 4ZXYH 1A5GH 2H5DA 1BITA 1UCYE 2GMTB 2STAE 1OX1A 1O2MA 5F8TA 3CS0A 2ZTXA 3MI4A 1MD7A 2BB4A 1A61H 3MQKC 2THFB 1BBRE 1UVUH 1C1OA 3ZZ3A 2JDID 1NRQH 1C4Y2 1C5RA 1HRTH 2B8OH 3UQOA 4BAHB 1NFXA 1PYTD 1BTWA 1W7XH 2NU4E 1C9PA 3RXSA 4RKJB 1SLXB 1W0KD 1YCPH 1F0RA 5AFZH 1OP0A 2P94A 4JYUH 3ZZBA 3A7XA 1OPHB 2BDHA 3F9HA 1FZZA 1QA7A 2CJIA 1K21H 4FUBA 1JBUH 3QTVH 1A7SA 3PM3A 3SW2B 4WMFA 3ELAH 1Y8TA 2XCNA 3H5CB 4K5ZA 3SZEA 2A2QH 3GY3A 1AUJA 1TLDA 2O8WA 4B2CA 2QXHA 4U30A 1B5GH 5EOKA 3DCLA 6ESTA 2W26A 4GSOA 1W0JD 4YO9A 5C1YA 4AN7A 1C1WH 1GBBA 1CE5A 1SGPE 3SU2A 4FXGH 4CH8B 2ZP0H 5ESTE 4JK6A 1L4ZA 1HJAB 1O35A 4X8VH 1AU8A 5LH8A 2PW8H 4FVBA 3SNDA 1NFUA 3ZZAA 3MFJA 2Q6DA 1MMJN 1DFPA 3AW0A 1T8MA 1VGCB 1O2QA 3MO3A 1F0UA 3TK5A 2W5EA 3MYWA 5JBAS 2OCVB 2RA0A 1UTQA 2Y81A 1ANDA 4O3TA 4HG6A 1HAZB 1QBVH 1UHBA 2H9HA 1O2RA 1QL9A 1N8OC 4AFUA 2ZU3A 3SUDA 2XWBI 1G2MA 4DOQA 3PMHB 1ZTLA 1YGCH 3VEQB 1GHAG 2ZGXH 2A4GA 3Q00A 5EXMA 2F9VA 4Q4LA 1C5OH 1P57B 4MNYA 1O2UA 1QHRB 1H8DH 5FX5A 4ISHH 2GDDA 1GJ9B 1XX9A 2FP7B 1EOLA 5L2YH 4TWYA 1Y3WA 1J8AA 1GMCF 1AFQC 1TX6A 2FM2A 4AFSA 4Z0KA 1NRNH 1NTPA 1KXDA 1LHDH 1SGFA 1V2NT 1FJSA 3PWBA 1Z71A 1CO7E 1OXGA 5A0BA 5H4IB 2KCOA 3BTTE 2YNAA 4LZ1H 1UTKA 5KECA 3A8AA 1EJNA 2KR7A 2BY6X 1W12U 4Y10E 4RKOB 1T4VH 2DE9A 1J16A 1HAHH 3ZZ8A 1TGSZ 2C93B 2I6QA 1JIMA 3U8OH 2FYQA 2J97A 1DITH 5T6GA 3RM0H 1IQJA 4UE7H 1JRTA 2AH4X 3M7QA 5ETXA 1MH0A 1RJXB 4TPYA 5GWZA 3CP7A 1LHCH 1TA2A 2Q6GA 1UJ1A 2I6SA 1H8IH 4AFQA 3N7OA 1COWD 1ANCA 1BT7A 3ZVEA 3BTEE 2HVYB 4Y79A 1YWUA 1KLJH 1O36A 1XXFA 5A8XA 3MMGA 4ASHA 1CBWB 1CGIE 5L2ZH 1VR1H 3M3TA 1BA8B
chains in the Genus database with same CATH topology
1DDJA 1SLVB 3AAUA 1O2YA 3SO3A 1OWIA 5FXLA 1UHBB 3SHCH 1YPGH 2R0LA 1ELTA 3DUXH 1W14U 3ZVDA 5CHAB 3MNSA 1EKBB 3E91A 4X8SH 1C1TA 1GJ4H 1F5RA 2QAAA 3MNXA 4IMZA 3ITIA 3RXGA 1Q3XA 2AMDA 1NRPH 1E34B 1GVKB 2BDGA 2A4OA 4MTBA 4IC5A 1O37A 4INHA 3L6PA 2ZA5A 1HXEH 2WYGA 4OGYA 5DP4A 2ZFFH 3RXPA 1O2IA 5EODA 2AGEX 2GV7A 2XC4A 4FU8A 2GZ8A 1SVPA 1FN6A 2GCTC 2BX4A 4GHQA 3BTGE 4R0IA 1GBDA 4A92A 1SGFG 3T62A 1J14A 2BOKA 1K1PA 1TRYA 4JYTA 2W3KA 4OS7A 2STBE 4B74A 1BZXE 1TNIA 2VIDA 2VWLA 2TRMA 1LPKB 5LGOA 3RP2A 1LHGH 3DHKH 2FOEA 3U98H 1GCTC 2W3IA 3F68H 1XUJA 2VVVA 3E16B 2SGPE 2NU2E 4ESTE 1TMTH 1Y5UT 3UWIA 3SGAE 1KSNA 2PV9B 3UREA 4RN6A 1GI7B 4X8TH 4YZUA 1ETRH 5E0HA 2FZZA 3VXFH 1NO9H 1GHBF 4FU7A 1N6YA 1QJ6B 2P93A 1O3HA 3GICB 5EPNA 1OP2A 2EI8A 1AIXH 1KDQA 4HI3A 3TU7H 1V2QT 3GY8A 5G4BA 1P06A 2B9LA 1DVAH 2AMQA 5E0JA 4THNH 2HPPH 2TGDA 1LVBA 4BOHA 2VH0A 3QK1A 2ZIQH 1JIRA 1C2EA 3M61U 3ZZCA 1AVXA 3SHAH 1GI0A 2O8LA 1QURH 3RXEA 1C1PA 2PKSC 1NN6A 2VVCA 2VNTA 1XKBC 1AD8H 3SN8A 2LNCA 3OY6U 1IQFA 4CBOA 1C2IA 5E0GA 3RDZA 1F0TA 1L1GA 1QY6A 2J38A 1SC8U 1SQAA 1FLEE 1V2LT 4UD9H 3RU4E 1GBIA 1CHOF 1V6DA 1O2WA 4K1SA 1G9IE 1ZSKA 4MNWA 4AOQA 1VITF 1O2GH 4X1NU 4AYVB 1SHHB 2G5NA 1C1QA 2B7DH 2OBOA 2RG3A 3I77A 3PTBA 3BTQE 4GPGA 3LGVA 3FP7E 4X1PU 1GMCG 4ABJA 2ZPSA 1UTPA 3S7HB 2A1DB 2A7CA 1IQMA 4K8YA 3LKWA 4TPIZ 3M3SA 1MKXH 1Z8RA 4Q7XA 1PQ7A 1P8VC 3VGCC 2TBSA 2NU0E 1S0QA 2PKAA 1BMMH 3CS7A 3KQDA 2JETB 4BTTB 3VB7A 1GMDF 1GGDC 1KDQB 2H9TH 1GBHA 1OKXA 2AIPA 1AKSA 3LJJA 4DCDA 3LDXH 5FAHA 3ATMA 1HCGA 1P2OA 1HJ8A 2ZU2A 4MDSA 4Y8YA 1C5XB 1L2EA 5GPIB 5A8YA 3ATKA 1TE0A 1FPCH 1P10A 2R2MB 1W10U 3ZVGA 3DFJA 3K2UA 9LPRA 3UTUH 1YC0A 1TWXB 1E37B 1JWTA 3PLPA 1WV7H 2ANYA 3ZZ6A 1FV9A 3SV2H 3LC5A 1LHEH 4BANB 2A2XH 5L30H 1QRXA 3JZ1B 2OP9A 4KTSA 2GMTC 2GT8A 1G32B 1V3XA 1LPGB 4ABHA 2BDYA 4ZKNU 2ZPRA 3MNCA 1ZSJA 2XTTB 3EAJA 1KTSB 3E3TA 7ESTE 3F6UH 2V3HH 3LGWA 3A81A 3RXLA 2BD2A 1Z6EA 3MTYA 3HGNA 1DANH 1SGYE 3T29A 3U1IB 3HK3B 3H7TA 2Y5GA 1ZJKA 1YYY1 4AGJA 2F3CE 1SQTA 2V6NA 1BHXF 1XUGA 2ALPA 1LVYA 2PKAB 2ZGHA 3EA9A 2WPJS 1ZPZA 2ZU4A 2YNBA 4BXSA 2FS8A 7KMEH 4I8GA 4GLYA 1K1LA 5HM2A 4LOYH 2PWXA 2A4RA 4TY6A 3UQVA 1MTSA 1SR5C 4IMQA 2AEIH 4X2XA 1V2OT 2BVSH 3K9XB 4Y8XA 2YOLA 6GCHF 4X6OA 3RXMA 1ZTKA 3RMNH 1TGTA 3TJOA 1HBTH 3SV8A 2BDAA 3QGJA 3VB6A 1C2FA 3Q3YA 1O3AA 2ASUB 5EQQA 2Y5HA 1K28D 1KLIH 5BPEA 2ZDAH 5JB8S 1VGCC 1SFIA 4ABEA 1KXAA 3VPKA 3R0FA 1SI5H 3STIA 3GY4A 5DP6A 1F0SA 2CGAA 4CR9A 4XBCA 1Y5BT 3FANA 1FIWA 5ESBA 2FTLE 2ZKSA 1HGTH 1W0ZU 2ZGCA 2ZQ1A 1T7CA 3KGPA 2HNTC 2CF8H 1TGBA 3NUMA 1FONA 1Y5AT 1FMGA 3RXJA 4CRBA 3TVJB 3QLPH 1TMBH 2VH6A 3UNQA 1THPB 1WBGB 4GCHF 1ID5H 7GCHG 2QF0A 1HAXB 2G55A 2A0QB 2AFQB 2B0FA 3KF2A 4JYVH 3D65E 1O34A 1QB9A 4AORA 1WTGH 1P09A 1MKXK 4J2YB 1O2HA 1K1OA 2BZAA 4OS5A 1A3EH 3KCGH 4O03A 1QCPA 1ZYOA 1ELAA 1UTNA 1Q31A 5K0HA 1N6XA 1O2KA 3UY9A 3VB3A 1K1MA 1OWEA 1EB1H 8GCHF 1O5GH 5F8ZA 2ZHFH 1E38B 2SFAA 4U32A 3SORA 3T25A 4NA7A 1O5AB 2QV1A 3SJ8A 1DPOA 1VJAU 1C5QA 1MTNB 1TNKA 3TGIE 2GCHF 1ETSH 3SUFA 1C1UH 1P3CA 1S82A 3ESTA 2Z9GA 3E1XB 1DWEH 1H9LB 3SV7A 1DSUA 1TNGA 1SOZA 1CBWC 1KXFA 3I78A 1AVWA 1K2I1 5JB9S 1GMDG 1XVOA 1EP6A 2BVRH 1ZGVA 4D76A 2WPHS 3SNBA 2PTNA 2VIOA 1PPFE 3K6YA 3A89A 2A45B 1O2PA 1C4V2 2OLGA 2TGPZ 2BX3A 5CHAC 2P16A 5HMAA 1HAOH 3DFLA 3VFEA 4ZHMU 2OXSA 2OC7A 1AQ7A 3G01A 1HUTH 4H6SB 1DWBH 1O2VA 4NGAH 1RD3B 1DSTA 1VZQH 1EZSC 1SMFE 1S81A 4I8KA 2GVFA 3Q77A 3TJNA 8KME2 4Y6DA 3PWCA 4ABDA 5L6NH 1TGCA 2UUJB 1T31A 1ARBA 1QB1A 1CVWH 3P8NA 1AB9C 1KXEA 5DG6A 1FPHH 1E36B 3LJOA 1O33A 3VB4A 4YOIA 1V2PT 1T32A 4ZKRU 1MTWA 1YPEH 1D4PB 4AGKA 5FX6A 2G4UA 1H4WA 5DP7A 1EP5A 2VGCB 2P3FH 3MH4A 2V35A 1V2UT 1GJDB 5A2MH 5DJ7A 2C4FH 3EGKH 2CXVA 3A88A 1W3CA 5C1XA 2HNTE 1CSOE 1BIOA 1UCYK 2FIRH 3D49H 3BV9B 1BTZA 2G4TA 2BD8A 2QA9E 1DXWA 4D7FA 1T8NA 2FO9A 1Z1IA 1O2JA 2Z9LA 1BBRK 1BQYA 1GPZA 1V2MT 3AASA 1Z7KA 3TITA 3RM2H 5EQRA 1AI8H 4WVPE 3MH6A 4DJZB 4KGAA 1C5LH 1CA8B 3LT3A 1ELFA 1UTOA 1KTTB 1C2KA 4WXVA 2SNVA 1EXFA 2ZI2H 3BF6H 1V2KT 4B73A 5EGMA 4M7GA 2P8OB 3BTME 2F9UA 1S6FA 1GBCA 1JOUB 1NFWA 4PROA 3LGIA 1NROH 2M5TA 4HFPB 2GKVE 3ZZ7A 2ZNKH 2QN5T 1EZUC 1F5KU 1PPHE 1BJVA 1EOJA 3RU4D 1KXBA 1A46H 1ORFA 1GBKA 2F83A 1AE5A 2ZGJA 2WPKS 2EI7A 1ELVA 3E0NB 5TJXA 1HAVA 3EA8A 3RXCA 2QXJA 2WUBA 1ZHPA 2SNWA 4XE4A 5C20A 2ZFSA 1A4WH 1GWAA 3QTOH 1ABJH 3M35A 2QGRA 1AUTC 1Z8GA 1YPMH 4YOJA 1OS8A 2V0BA 1FQ3A 2XC5A 1AFEH 2R9PA 1HDTH 3SJKA 3KHVA 1CU1A 2ZU5A 1C2JA 3QO6A 1OOKB 3Q3KA 1THSH 1IHSH 2EI6A 1H9IE 3UUZA 4UDWH 2F9OA 2GZ7A 1FI8A 1MKWH 4UFEH 4AYYB 1TPAE 1BTYA 1OWDA 4IC6A 3E0PB 1UTLM 2HVXA 2JETC 1NZQH 1NU9A 1YPKH 1YM0A 1AE8H 1BRCE 1Y3XA 3SQHE 1YP9A 5EXLA 4ZUHA 5A0AE 5GIBA 1O5DH 1QB6A 2FXRA 1GHWH 1HXFH 4CHAC 3P8OA 2VB0A 4I8HA 4NFEA 3SGBE 1QQ4A 1MD8A 7LPRA 1ANBA 3SI4H 1X7AC 3M5MA 3TGJE 3PLBA 1KXCA 4U01A 1BRBE 4J1YA 2ZTZA 1G37A 1LVMA 4NA9H 3O8DA 4VGCB 4Q2KA 3M3VA 3SNEA 4B1TA 2ZHDA 1O3JA 1C1NA 4Z6AH 3T5FH 1HAVB 3KL6A 3URCA 4LZ4B 1EASA 2OTVA 3M5OA 1D9IA 2A5AA 4ZHAA 1ZPCA 3UPEA 1V2VT 1GG6C 1P9UA 3GCHB 1BDAA 2BDIA 2CHAB 1EB2A 1P04A 1BTUA 1TABE 1SHYA 1P2QA 1GDUA 2FODA 1TX7A 2O8MA 1LTOA 4K3JA 1G36A 3BIUH 3UR6A 5EG4A 3RXRA 1BRAA 4AX9H 3FVFB 2FOFA 4WMEA 1CA0B 2K1QA 4YESB 1O2SA 2P3UB 1FN8A 1ACBE 1SLWB 3LH1A 3HK6B 1RRKA 1ZHRA 1C5TA 4NG9H 3P8GA 1MTUA 1O3FA 2FMJA 3QX5H 4X2YA 1O3IA 1Z1JA 2SGDE 4NIYA 3SUGA 1XUFA 1FIZA 2PSXA 1LQDB 3LU9B 2FLRH 4KTUA 2W7UA 2A7JA 1EUFA 1SFQB 3F1SB 1S6HA 1QBNA 2GZ9A 2WV5A 1VITH 3PLKA 3SBKA 4NA8A 2C8ZB 4A1TA 2F9BH 2G51A 4A6LA 4FUHA 4TY7A 2C90B 2XWAA 1SPJA 3K6ZA 2ODYB 1O5FH 4CBNA 1UVPA 1MCVA 4HZHA 3KEEA 1V2JT 2FX4A 1DLKB 1XUKA 3T27A 1P11E 1UMAH 4I31A 4XOJA 5A0CA 1U6QA 1PPBH 3BSQA 2BXUH 3R3GB 1E35B 1RTKA 4NSYA 1IAUA 1O5EH 3NWUA 3B23B 4IS5A 1P2IA 1PFXC 1VCWA 5DKMA 4Y0ZE 3S0NA 1TIOA 2ZG0H 1RXPA 4KP0A 3U8TH 2AYWA 1G3CA 1A1RA 1C5SA 2BZ6H 3M5NA 4INKA 5C1UA 5EQSA 2PUQH 3MNBA 3ODFA 2EA3A 2ESTE 2ALVA 2ULLA 1P9SA 4X8UH 3KQCA 3L3TA 4E7RG 1A0HB 2TPIZ 2Q1JA 1WUNH 4SGAE 1V2WT 1C5MD 1MKWK 4I32A 2FESH 3ZZ9A 3RMMH 3VB5A 1YLCA 5A09A 3TNTA 1MUEB 1NESE 1ARCA 2WYJA 4HTCH 1C1RA 2B5TB 2SGAA 4NZQA 3ZZDA 5FCKA 2EC9H 4FUGA 1B0EA 4IW4E 1YKTA 3A82A 2ZZUH 5T3HA 1MTNC 3MO6A 3OYPA 4A7IB 1PPCE 1P0SH 1Q2WA 1F2SE 1FY4A 2H6MA 1HAGE 4Y7AA 1C9TA 3FFGA 5LPEA 3GCOA 1UK4A 3SJOA 3D23A 3EQ0H 1DX5M 1HB0B 4X0WU 1C5VA 1ESBA 5DPAA 3SU1A 1C5NH 2FTMA 4NFFA 2XC0A 4ZAEA 4CREA 3RXUA 3SU6A 1GL1A 1KLTA 3B8JA 1BTXA 4Y71A 4YM9A 4X1SU 2ZO3H 2J4IA 2PTCE 3ODDA 2C3SA 3A8BA 4GHTA 3O8BA 3MU4A 1XKAC 3U8RH 1N8OB 4BNRA 2BY7X 4MVNA 2ZGBH 4YLQH 3BTHE 4IGDA 3SV6A 1QIXB 3MU0A 4ABGA 4BXWA 2AERH 1QJ1B 1GJBB 4BTIB 4Q80A 3S9AA 1C2LA 2Y6TA 4MG3A 1P03A 2QY0B 1FAXA 2BHGA 4WMDA 5HGGA 4IN2A 2GP9B 3RXOA 1ZMNA 1PPGE 4DG4A 1C5UA 2QYIA 1VCQA 3GYLB 3TIUA 1AZZA 3IITA 4BTUB 1SGRE 4ABAA 2ANKH 2BD7A 2FI4E 3OY5U 2D8WA 2QIQA 3EYDA 1O2NA 4CRGA 1YPLH 2IPHA 1O3BA 4TWWA 4UFFH 3HATH 4NSVA 1GMHF 2JH5D 3ATIA 5C5OA 1IHTH 3GCNA 2FS9A 1YPHC 3A8CA 3U9AH 2SGFE 2GDEH 1ZRKA 2JH6D 1MQ6A 1SGCA 1ZMJA 3GCTF 1EJAA 2FI3E 2FOAA 1GBJA 1MZAA 4AZ2B 2A31A 1C5ZB 4ZROA 1ZRBA 1Z6JH 1B0FA 1MCTA 4MNVA 1PQAA 3AVZA 2OQUA 3HPTB 2A5KA 2UUFB 3C1KA 2QCYA 4NIWA 3KNXA 1GBLA 1FXYA 1AKSB 1O3PB 1MAYA 1TOCB 1O39A 5JBTA 1UCYH 1K1JA 4D8NA 3RXIA 3BTKE 1AVGH 1Y3UA 4ZH8A 1AGJA 3ZYEA 4I8LA 3W94A 1EJMA 1CHGA 1G3DA 2ZQ2A 4NWKA 2Z3DA 3SI3H 1HJAC 1BBRH 2ZWLH 1BTHH 1SBWA 2UWOA 2BVXH 1SQOA 3GY7A 1A2CH 4WJG2 3OU0A 1GHBG 2KAIA 3RXDA 4BAOB 1NM6A 2RA3A 3EDXB 1EPTA 2QXIA 1W0YH 1W2KH 3RXAA 2GCTB 3PYHA 2F9NA 3SUEA 1BJUA 4F49A 4MNXA 1HJ9A 3H7OA 4OS1A 4FUFA 3U1JB 3A7WA 2ODPA 4DVAU 1Y59T 4E7NA 4I7YH 1FY8E 1HIAA 3LONA 1P2JA 5E2PA 2DE8A 1ZGIA 3A86A 2CMYA 5DGJA 2FLBH 4H6TA 5FHTA 1NS3A 1O3EA 2HLCA 2R3UA 1XMNB 1GCTB 5SGAE 1P2NA 3MU8A 1ELCA 3UOPA 2JKHA 2PGBB 1ELEE 2ILNA 3LOXA 3RXVA 3PMJA 1BCUH 2P3TB 2PLXA 4XSKU 2OUAA 3GISB 4XDEA 4A1VA 1C1SA 3U69H 3RXTA 3UNRA 2FOBA 1ANEA 4KELA 4X6PA 1DICA 4INLA 3SQEE 1HV7A 1DLEA 3GDUA 5EU8A