4YLUA

X-ray structure of mers-cov nsp5 protease bound with a non-covalent inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
304
structure length
304
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ORF1a protein
publication title Ligand-induced Dimerization of Middle East Respiratory Syndrome (MERS) Coronavirus nsp5 Protease (3CLpro): IMPLICATIONS FOR nsp5 REGULATION AND THE DEVELOPMENT OF ANTIVIRALS.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
total genus 81
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yluA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yluA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yluA02
2CMYA 1BTYA 4OS5A 3SU1A 2AGIX 2CHAB 1V2MT 1ZPZA 5FCKA 5FAHA 1HAVB 1TX8A 1TQ0B 1TBZH 3MNCA 3GCHB 4CH8B 2J9NA 2G8TA 2VIVA 8GCHF 1O0DH 3E1XB 5E0GA 4YLUA 1P10A 4FU8A 2O8LA 1O31A 5FHTA 2BHGA 2W3IA 1ELTA 1CT4E 1L0ZA 1TGCA 3BIVH 1UVTH 1F92A 4D7FA 4MNWA 4YOJA 1A4WH 2BDIA 3BEFB 3ZZ9A 4NIYA 5F8XA 2Z94A 3KNXA 4KTUA 1D3DB 1GI5A 1MZDA 1YLDA 4X2XA 3GDVA 2VVVA 3SOSA 4FU9A 1CU1A 1AO5A 1KLTA 2FI3E 3LGIA 4JZIA 3T5FH 1ZMNA 2BD3A 3VB5A 1C4V2 3GY5A 4FUBA 2A7HA 5EG4A 3PV4A 2WV5A 1NZQH 4F4OC 1DE7H 5C2ZA 1GI0A 5F8TA 1O2JA 3LOXA 2VH0A 3F6UH 2TIOA 3PO1C 1TPAE 3VGCC 2FOHA 5LGOA 1Y3UA 5DKMA 1BZXE 3UR6A 4E05H 3AW1A 1K1JA 1E38B 5A2MH 3KF2A 1JRSA 4XOJA 3JZ2B 2DE9A 1MMJN 1QBNA 2TBSA 5FPTA 3RU4E 4F49A 1G2MA 1MZAA 1OP2A 6CHAB 4FXGH 4MG3A 4UONA 3B8JA 1CT2E 1SLVB 5AVDA 3CS7A 1M9UA 4GCHF 2R3YA 2QY0B 4MPUA 3EQ0H 1DXWA 2G4TA 1GHVH 3BG4C 1GDQA 1RRKA 4ZHAA 4Z6AH 8GCHG 2VVUA 4NIXA 3MOCA 3RP2A 1MD8A 3MTYA 3RC6A 3RXIA 3A85A 3RXSA 4JYUH 1P2NA 2ZHQH 1ZR0A 2FO9A 4UEHH 3MU0A 1XXFA 1G3BA 3SGQE 1PPHE 3RXMA 3TK9A 2ULLA 1P8VC 1A61H 3PMAB 4AGKA 2W7UA 4FUIA 5T6FA 1JIRA 3E8LA 5DK1A 1SGEE 1Z1IA 2PTCE 4NZLA 3T62A 2VINA 1BHXB 4NIVA 3SV7A 1CA0B 4JK5A 2ZQ2A 3F68H 3L33A 1GJ5H 1L1GA 4Y79A 7ESTE 3EA9A 2WUBA 4WH8A 1HRTH 3ZYDA 1FLEE 2O8WA 1MKXH 1BDAA 3SU5A 1DX5M 1UHBA 2OUAA 1YPMH 4WWYA 3EE0B 3LGWA 2QXHA 4IMZA 1A0HB 4OS6A 1IQGA 1TRYA 4ZMAH 1JIMA 2GMTB 1C1UH 2FOAA 1O3MA 2WPKS 1KXAA 4IN1A 1PYTC 3TU7H 1T31A 5A09A 2H2ZA 1AFQB 1AY6H 1EXFA 3KGPA 1LPKB 3V0XA 4Y10E 1V3XA 5JYIA 2A31A 4GCHG 2J94A 3MI4A 3E3TA 2GDEH 3E90B 1Z6EA 4ZKNU 1P2QA 1CGIE 1ZTJA 1GMCF 4K2YA 1SC8U 2BD2A 1YPGH 4ISHH 4JMYA 2W7SA 1TAWA 3VXFH 3SBKA 5IYTA 2FX6A 1QJ7B 4Q2KA 4Q7ZA 3EAJA 1UTMA 4FUGA 4ABDA 2CN0H 4WXIA 2FOGA 1LHGH 1FY3A 4JYTA 1DWEH 2XCNA 2ZGCA 1AVGH 1NESE 3D49H 4MPXA 3UQOA 1WSSH 4AGJA 3M61U 2YOLA 4YZUA 2A45B 1O3KA 1NRQH 1ORFA 1EP6A 1F0RA 4ESTE 2HWLB 2RA3A 1BRAA 5GPIB 2LPRA 3RXCA 1RD3B 2GZ8A 1BT7A 2NWNA 2JH5D 1HIAA 3HK6B 4R0IA 2H9EH 2WV4A 2UUFB 1G2LA 1V2PT 4Y8YA 4K5ZA 4O97A 3MO9A 3AASA 3BTHE 3NCLA 3SN8A 1W3CA 4ZHMU 1O2NA 1F7ZA 2VIOA 5JB8S 1UVPA 4LOYH 4CR5A 1FQ3A 2Y7ZA 1OOKB 1GI4A 3SZNA 1A1RA 4NCYA 4HFPB 2FOEA 3ZVGA 1LVYA 3L6PA 1UTOA 1P03A 1QY6A 1GHAF 3A7ZA 3KCGH 1WTHD 1KDQB 1H8DH 2UWPA 1JMOH 4LZ1H 1GMCG 2ZTYA 1YPHC 3BG4B 3TH2H 1HCGA 1H9LB 5EQSA 1C2DA 4B71A 1BOQA 1SQTA 1K2I1 1GJ7B 2BLOA 2BQ6B 1XX9A 1YLCA 2FOMB 2RA0A 2BDBA 4AORA 2AMPA 1SB1H 1ELVA 2QV1A 1V2VT 1EZUC 1V2QT 2CXVA 1ZJKA 3ZZ5A 2FI4E 1C1PA 3RMMH 2A7JA 3ZV8A 1C5LH 1O2ZA 4UE7H 3ESTA 1GBJA 1OWIA 1TIOA 2VWNA 3VEQB 2GCHF 2ILNA 3RXEA 3ZVCA 4TY6A 4UD9H 1FONA 3E0PB 3FANA 1A0JA 1DOJA 2K1QA 1BBRE 2P93A 1S82A 1Z8GA 1G37A 3ZZ6A 3Q3YA 4DIHH 1PQ8A 1AWHB 1D4PB 5JBTA 5HGGA 4XFQA 1GI2A 1IQKA 1C2EA 3NXPA 1GBBA 1IQNA 1V2UT 3U8RH 3GYMA 4TPYA 4NFFA 1D3PB 3ZZ8A 1GCTB 5C1UA 2THFB 4NA9H 5LH8A 1N8OC 1QBOA 3E16B 1H8IH 1GHAG 5EQRA 1KXCA 4Y0ZE 4Q80A 3UOUA 1ESAA 1GBEA 1MTNC 1KXDA 3G01A 4NA7A 2FDAA 1K1IA 3A7TA 2TGAA 5BPEA 2A4QA 1NRPH 3ZZDA 1EJNA 3RXVA 5JBBS 1VCPA 1F0TA 1S6FA 4Y7BA 4UFGH 1HNEE 1TGSZ 3PLKA 2DUCA 4Y7AA 1GPZA 3MO3A 3K2UA 3UUZA 1K9OE 1C5SA 4NGAH 2GX4A 1BMNH 3SUFA 3PWBA 4OGXA 2GCHG 4GHQA 4FVDA 4JYVH 2FOCA 3SV9A 1IAUA 3EBNA 1C5VA 4FUCA 4I8GA 1A5HA 5T3HA 2XCFA 1THRH 1SHHB 1ABIH 1PPFE 1MCVA 2VIQA 2UWOA 1D3QB 3QTOH 1EZQA 1SQOA 1B0EA 1HAXB 1OWHA 1FPCH 1P0SH 2FOBA 2Y5GA 4LZ4B 4RKOB 1QJ6B 5E0HA 4UFFH 3RLWH 1TOMH 4BTTB 4X8SH 5JDUB 2M5TA 4H42U 3ZZBA 3S7KB 2Z9GA 1BMLA 1SGFG 2A4RA 3R0FA 3KQCA 1OX1A 5E2PA 5F6MA 2BDCA 1T8OA 2A5KA 4I31A 1ABJH 1NN6A 1QBVH 2BXTH 3A87A 3D23A 2LNCA 1C9TA 3OTJE 3SU4A 1U6QA 1DLEA 2VIWA 5A8YA 5DJ7A 3ODFA 1D6WA 3P17H 1C2HA 1EASA 5GCHF 1HFDA 3LPRA 1TX7A 3ATWA 1SL3A 1HYLA 3LKWA 3BF6H 1EJMA 1CHOG 2H9HA 3I78A 1AMHA 1ANBA 1O5FH 3RXDA 1MQ6A 3EGKH 5GDSH 1ETTH 2AEIH 2QCYA 2Z9KA 3HKIB 3NKKA 3BN9A 4NFEA 1V2TT 3U9AH 4ABHA 2GT7A 3DA9B 1QCPA 2PV9B 4Q7YA 1C5ZB 2VB0A 5EOKA 2R9PA 1P2OA 3NK8A 3BTGE 4MDSA 4A92A 3W95A 2F9UA 4DIIH 2ZFFH 1A5IA 1A3EH 2GP9B 1NRNH 1GL1A 4X8VH 5EODA 4O3UA 2SNVA 2ZEBA 4Q7XA 1OP0A 3D65E 3E91A 4FUFA 2B0FA 2O8TA 1O5BB 7KMEH 1P9SA 5C5OA 1P2MA 5C1YA 4KP0A 2VIDA 1KXEA 1CT0E 2HNTF 3NWUA 4MTBA 2P3FH 2QAAA 2OC0A 4XBCA 4HGCA 1O3GA 3V7TA 2HALA 4YLQH 2ZCLP 3SJ9A 2ZFRH 1CHGA 3MMGA 4XBBA 3PTBA 3OSYA 3SV6A 1MKXK 1L2EA 1N8OB 1QTFA 2NU4E 1OKXA 3SW2B 3K6ZA 2SGQE 5GCHG 3MO6A 1SLWB 2QF3A 1AZZA 1C5YB 1W13U 3FZDA 1C2JA 3IWMA 1MTNB 2Q1JA 1Y3VA 1EJAA 2ZPRA 1LKAA 9ESTA 4INHA 4FUJA 3VB7A 2J2UA 4AB9A 2F9VA 2F9PA 1RFNA 1DWBH 4FU7A 1KTTB 1SSXA 5J4SA 1O5DH 3DFJA 3FP8E 1O2LA 1O39A 1TNLA 2BD5A 2C8WB 5C20A 1LHFH 2ZGHA 4K8YA 3S69A 5A8ZA 1FY4A 1O3CA 1O3AA 5EQQA 4X6NA 1BMMH 1NFUA 1O33A 1PQAA 1Q2WA 2FPZA 3RC4A 4B2BA 3IG6B 1C2KA 3RXPA 1RJXB 3B23B 1AVXA 3H5CB 3P8NA 2XC4A 1HAVA 2SGFE 3GICB 3MNSA 1ARBA 1OYQA 3GCNA 1S83A 3ODDA 3T26A 5FPSA 3V12A 5EU8A 3A7XA 1QR3E 3ATIA 2G00A 1O35A 2SGAA 2ZHWH 1TRNA 1SGTA 3HPTB 1H1BA 5FBEA 1GJBB 3BTME 4K1TA 3PWCA 3PB1E 1NT1A 2ZG0H 3LH3A 2PFEA 1C5NH 1W7GH 2BY9X 1AB9C 5LPRA 3MFJA 1P09A 2ZA5A 1J17T 5C5NA 3CP7A 1C1MA 4DW2U 2NU2E 3ZZ3A 4AFSA 1FDPA 2ZFTA 5HM2A 1MH0A 4WXVA 1L1NA 4ABGA 2BLVA 1ZSKA 2BY5X 4HZHA 1K1PA 4QT8C 4X6MA 2ANWA 3OYPA 2BYAX 4SGAE 1C5XB 1Z71A 1NFYA 1O38A 2VJ1A 1MUEB 3CS0A 4THNH 4ASHA 2FIRH 4X8TH 5EPNA 2P8OC 4ISOA 5FCRA 1ANCA 1J9CH 1QA0A 2O8MA 1E37B 2GZ9A 1TX6A 4ZXXH 1JBUH 5DGJA 1Y5BT 3ZYEA 1QNJA 3M5OA 1TALA 3TJUA 4Y6DA 2Z6BD 3TH4H 1C1OA 2KAIB 1WQVH 1CQQA 1UCYH 3M5MA 1MAXA 3Q00A 5GWZA 1TBRH 2F9BH 1NY22 4I32A 1O2IA 5C3NA 4X2VA 4JZDH 3TK5A 4B2CA 3RXOA 1NFXA 1P2KA 2BZAA 4XDEA 3SU6A 4BXWA 1NO9H 1Y3XA 2J4IA 1F0UA 2G51A 4B75A 1BB0B 2BTCE 3SORA 3ZVDA 4IN2A 1XVMA 4ISNA 2NU3E 4A5TS 1EAIA 4BAMB 2BLQA 3SJKA 2D8WA 1W11U 3BTQE 1XUIA 1ZMLA 3QX5H 5ETXA 1HGTH 4MVNA 2PTNA 1KSNA 2BVXH 1C1VH 4U2WA 3HGPA 4Z0KA 1XXDA 2BZ6H 1GHXH 2YNBA 1CSOE 1EZXC 1O37A 3ZVBA 1O2OA 4TWYA 3RXJA 1T8LA 1HAGE 1GGDC 4K69A 3SO3A 5LPFA 3EA7A 4BAOB 5FXLA 4JZFH 3SUDA 1EAXA 1H9HE 1O3FA 2XBXA 1IOEA 1O2KA 1TNKA 2PW8H 2FM2A 2C3SA 2IJOB 2AGGX 1DWCH 1C5WB 2GV6A 3FP6E 2HPQH 4INLA 1EATA 2BLWA 2FI5E 2G81E 4MNYA 1BHXF 1SFIA 2B9LA 2UWLA 2ZHFH 3SNEA 1SOZA 4X1PU 1EAWA 2PUXB 1AHTH 3HKJB 3LGVA 1O5EH 1UMAH 1WAYB 4GPGA 1TGTA 4UFEH 1GBMA 1YCPM 1TGBA 1DICA 2PKAB 1DXPA 3L3TA 3T29A 3LJOA 1EUFA 3A7YA 1KLIH 3QK1A 2BD4A 1XM1A 2D2DA 4WMEA 1HXFH 1K1OA 4XBDA 5DP6A 3HATH 5EW1H 3LDXH 1WTGH 5AFZH 4GUXA 4MNXA 4H6SB 1FY8E 1UK4A 1KXFA 2HRVA 1LMWB 1SFQB 5H4IB 2RDLA 4Y0YE 1TOCB 3DUXH 2C4FH 3TNSA 1GCTC 2F9OA 3LGYA 1CBWC 3OX7U 2WINI 4PROA 1BMAA 2BVSH 2ZU3A 1C2FA 2BM2A 2G55A 3NZIA 5CHAC 3AVZA 1Q31A 1C4Y2 2FTLE 1IQHA 1NFWA 1O36A 4MLFB 4I8LA 4OS4A 4A1TA 3RXKA 1BTHH 3A7WA 1TMUH 1AB9B 1P2JA 4ABAA 1OYTH 3A8BA 1DITH 1P9UA 3SNAA 1DANH 3UNSA 2ZECA 1QQ4A 3HK3B 4I33A 3PMBB 1EPTC 1Y3YA 3TJVA 3QUMP 1YCPH 1SR5C 2XNIA 3URCA 4YOGA 1SGQE 4BOHA 1JWTA 4U30A 6LPRA 1CA8B 3U8TH 1GI6A 1L1JA 4D9RA 2C8XB 2GVFA 1C5QA 1QFKH 1SGDE 1V6DA 2QC2A 4Y76A 3PM3A 2VWOA 3KQDA 3P8OA 1QQUA 5DO4H 1A3BH 1OSSA 1FJSA 1QB6A 3M36A 3P92A 2P8OB 2GV7A 1W0YH 1HLTH 1TNIA 1GBTA 2QIQA 5PTPA 2K7XA 4AFQA 2XBWA 1IQIA 2FMJA 1C2GA 3TGIE 4GHTA 2FODA 2SGEE 4ZKOU 1AIXH 2ZHDA 5DP8A 2XC0A 1TONA 3KN2A 2ANMH 1LHEH 2YNAA 3M35A 1AI8H 1J16A 1GHBF 1WQSA 1FNIA 1OWDA 3FAOA 1V2OT 1KDQA 2A2XH 1BUIA 4K8BA 1HV7A 1GVKB 3VXEH 3N7OA 1PPBH 1AUJA 1SGRE 1XKAC 1EB1H 4INKA 2BQ7B 4U01A 3A86A 4CRGA 2D26C 1O3BA 3FZZA 3P70B 3TJOA 1BTXA 3NPSA 3M5NA 4U32A 4LK4A 1PYTD 2TGTA 1BJVA 2ZDVH 2PR3A 3MH5A 2FZZA 2ALVA 3SHCH 3S7HB 4KGAA 1SGPE 5E0JA 3LC5A 3SJIA 5A0CA 4X0WU 1THPB 1ZMJA 2Y81A 1ZHRA 3DHKH 3KQEA 4IGDA 1SBWA 1FY5A 1HAHH 4ZH8A 1GGDB 5G4BA 3SJ8A 1VITF 2SFAA 4CHAB 1PFXC 4AZ2B 1N6YA 2FLRH 1NRRH 2R2WU 3RM2H 4A7IB 1DWDH 2ZFSA 2CF8H 3B9FH 5I46H 2H6MA 1UVUH 1TGNA 4XSKU 1AWFH 1C5RA 1AU8A 3R3GB 2F83A 1SGIB 4K3JA 1HUTH 3A89A 1UJ1A 4DGJA 4TPIZ 1HJ8A 1GBHA 1O3NA 5FBIA 3KQBA 2AFQB 3DD2H 4K1EA 3TH3H 1IQMA 3W94A 2OBOA 1T4VH 2OTVA 3K9XB 1O3LA 1GJ8B 1PJPA 1HJ9A 3LGTA 1NPMA 2ASUB 2FS8A 2LIZA 3BTEE 2JETC 3S0NA 3TNTA 1QHRB 2GD4B 4WF8A 5DP7A 3SUEA 1RTKA 1GHBG 4OGYA 4OS7A 3BTKE 2AGEX 3I29A 3ATMA 3PLPA 5AHGH 2ANYA 4BTIB 3VFEA 4CRCA 1PPZA 3A84A 1SI5H 1W12U 1TPPA 1KXBA 2ZIQH 2Z9JA 2OP9A 2BOKA 3C27B 2QF0A 2ODPA 1FPHH 2QXIA 3F9FA 3VPKA 1CBWB 1Y59T 5DP9A 1GMDF 2BY7X 5A0BA 3A83A 5CHAB 1YPLH 1EP5A 1YM0A 2IN2A 1HAIH 5JBAS 4X1RU 2PWXA 1SLXB 3OU0A 1BRBE 2VWMA 1UK2A 1GJ6A 2FEQH 1W0ZU 2GDDA 3SI4H 1A46H 1EPTB 3UQVA 3A88A 1VITG 2I6SA 1GI1A 1YYY1 2ZU2A 1DM4B 2W26A 4B76A 1LPZB 3BTTE 1WCZA 3EYDA 3PYHA 2OC7A 4YO9A 2ODYB 3RXRA 1A5GH 1NU7B 3K65B 1BBRH 1V2ST 2BD8A 3BV9B 2Y82A 1UTJA 1Z8IB 3S9AA 4B1TA 3UTUH 5C1XA 1ZHPA 2P3TB 1PPEE 3SNDA 2G4UA 1V2JT 3TITA 1K28D 2ODQA 4AYYB 2V3HH 3RC5A 1GBAA 1O5GH 2XRCA 1YKTA 1Z6JH 3SUGA 3IITA 1C5MD 2R2MB 4TY7A 2A4OA 4A1XA 3AW0A 1CGHA 1NC6A 1FIZA 2UUYA 2FOFA 2VWLA 4H4FA 4DT7B 5EXNA 3MU5A 2QYIA 3EDXB 3T28A 2AERH 2A4GA 2UUJB 3TK6A 1O3EA 1F2SE 3M7TA 2WPLS 3MHWU 1IHTH 1UTLM 1GMHF 2V3OH 2SNWA 3UOPA 4A1VA 1UCYK 4ZHLU 2ZDAH 1HJAB 2PKSC 4YM9A 3RMOH 5JPMH 4NZQA 3U98H 1GMDG 3UNRA 2SGDE 2BX4A 3A8AA 1RS0A 4NSYA 2P59A 3BTFE 3RXGA 3BEIB 1AFEH 1ZTLA 2WPHS 1C2LA 1ANDA 3ZV9A 1J8AA 1O2MA 3LIWA 5L2ZH 1KLJH 3PROA 2Z3EA 2V0BA 4AFZA 2BMGB 1ZRKA 8KME2 1C5UA 3SV8A 4B74A 1YP9A 2UUKB 2B8OH 3A7VA 1SQAA 2WPJS 1MBMA 2ZCHP 1C4U2 1JRTA 5AF9H 3STIA 2Y7XA 2B5TB 1AE5A 2PHBA 1SPJA 1DVAH 1O3JA 2FWWA 4BANB 1DPOA 5EXMA 1GJCB 1T8NA 4X2WA 3S9BA 1SGCA 1A2CH 1E35B 1P06A 2ZWLH 2QGRA 4X1SU 1LO6A 5ESTE 1NU9A 1GDNA 1H9IE 3RU4D 9LPRA 4HTCH 1Z8JB 1ELAA 1S81A 2PLXA 1QA7A 4ISLA 6GCHF 1V2RT 2CGAA 5EPYA 3VB3A 3C1KA 2V6NA 2JETB 4KELA 4OS2A 3MU4A 3PMJA 4YOIA 4KTCA 1PQ5A 1T7CA 4CRBA 6ESTA 4AG2A 3UWJH 1O2PA 1TWXB 1EX3A 1MTUA 2OC8A 3SJOA 2ZC9H 2OD3B 4DCDA 1CO7E 2OINA 1LQEA 1SMFE 1GI3A 2F91A 1GJAB 1P3CA 2ZQ1A 5HYOA 1VJAU 1TMBH 3M37A 1S0QA 1DY9A 2OCVB 2BDGA 1QL8A 4JCNA 1J15A 2PSXA 1C2IA 4ZUHA 3GDUA 4B2AA 3HGNA 1C1SA 4I8HA 3LJJA 1DS2E 1ELDE 2DE8A 3V13A 4K60A 3LH1A 1S0RA 1OWKA 1O2HA 4KKDA 2SGPE 4O9VA 5BRRE 2ESTE 2ZU4A 3SQEE 2RG3A 2AIQA 5EGMA 1OWEA 2ANKH 2Y5HA 1ZYOA 5GJ4B 3GDSA 3RUOA 1O2WA 2AMQA 1W8BH 5ESBA 2ZO3H 1GCDA 1DSUA 3RXUA 1S6HA 4WY3A 1EB2A 2WPMS 3MNBA 4I8JA 4UDWH 1UVSH 1C5TA 1DT2A 3T25A 2OXSA 5EXLA 5TCAA 2J95A 5DP5A 3F9GA 1V2WT 1YCPK 3Q3KA 2BD9A 1MU8B 1GJ9B 1O3HA 3KHVA 3LT3A 2PGQB 1XUJA 4VGCC 4E06H 1CGJE 6GCHG 1QB1A 2RCEA 1FMGA 1QRXA 4NG9H 1FN6A 1EAUA 3PLBA 2BDHA 4DJZB 1WV7H 2OBQA 1BTZA 4X8UH 3UR9A 1ESTA 5FX5A 3U1IB 5DP4A 1L4ZA 1FXYA 2OQUA 2ZTXA 3MYWA 2GTBA 1AUTC 1AKSB 1MTVA 4OS1A 2ZDMA 2PKSB 2CV3A 3KEEA 3KIDU 1Y5UT 3SQHE 1ZRBA 1LKBA 4D76A 2EEKA 2WYGA 3OY6U 2BVRH 3QDZB 2KAIA 4NWLA 1UCYE 2TRMA 1CE5A 1A7SA 1CVWH 1GI9B 1ETSH 3LC3A 1P01A 3FP7E 1MKWH 5CMXH 3F9HA 2PGBB 3RU4T 1GL0E 3P8GA 1D9IA 1S85A 3ATKA 2ZU5A 4ABJA 1ETRH 4XE4A 3VB4A 3UFAA 1LHDH 4WVPE 2BX3A 4ABIA 3EA8A 2OC1A 3T27A 3A82A 1QGFA 1FI8A 4DURA 2XC5A 1Q3XA 4FUHA 1O5CB 2Y6TA 1BRUP 2PSYA 5IDKA 1QJ1B 1BA8B 4X2YA 4BXSA 2OLGA 1OP8A 1WUNH 2C8ZB 1DUAA 1P05A 3LGUA 3BSQA 7GCHF 1FAKH 3BG8A 3TIUA 2Z9LA 1O2YA 1MTWA 1PQ7A 2B7DH 3RXQA 4E7NA 5K0HA 3Q3XA 1O2XA 2PUQH 2HPPH 4CBNA 2HNTE 2ZGXH 2Z3CA 1ELFA 4GAWA 1VR1H 1OS8A 1LCYA 1O2RA 2FS9A 2IOTA 2G5VA 2Y80A 1ACBE 2VNTA 2ZKSA 1KY9A 2FESH 1L4DA 1AQ7A 1YC0A 5B6OA 1SLUB 1VCQA 4DVAU 1TFXA 1GDUA 1VZQH 4IC5A 3TJNA 3BIUH 1SOTA 1ELBA 1V2LT 4YTAA 1RTLA 4SGBE 8LPRA 1QRWA 2GGVB 2PKAA 2JH6D 4CHAC 2AMDA 3RXLA 1C1QA 5JB9S 1MTSA 2ZNKH 1EQ9A 2XBVA 2ZZUH 5L30H 1LTOA 3GY3A 1EOJA 1MAYA 1W10U 1XUGA 4ZAEA 2BOHB 4Y8ZA 2WUCA 3SI3H 1VGCC 2W5EA 4YT6H 2BD7A 3S9CA 2Z7FE 1MQ5A 1THSH 4FUEA 5E2OA 3SU2A 4X1NU 4DG4A 1AN1E 2TPIZ 1WYKA 1GBLA 2FP7B 1TMTH 1ZPCA 4AX9H 2ZDKA 1B5GH 1TYNA 1TA2A 3U69H 1TB6H 2R0KA 1ZSLA 2A2QH 2ZF0H 7GCHG 3GY7A 1BCUH 2A7CA 3GY2A 4MNVA 1ID5H 1F5RA 4VGCB 2STBE 3SNBA 1NS3A 4WJG2 3LU9B 1K22H 1P12E 1BBRK 4YT7H 4IW4E 1LPGB 1SGNE 2H5DA 1S84A 3D62A 3ZVAA 2TGPZ 1Y3WA 3K6YA 1C1WH 1GBDA 4RSPA 1FUJA 1T32A 4DOQA 1LVBA 1O30A 4WMDA 2GT8A 4J2YB 2BXUH 2EC9H 1ANEA 4TYDA 3QO6A 1S5SA 1D3TB 1IQFA 1BQYA 1TBQH 1P3EA 3M7UA 3FFGA 2C93B 1XUKA 5ABWA 1KYNA 3RXAA 5I25A 3UIRA 2CF9H 1O3DA 2Q6FA 5GXPA 1XVOA 4J1YA 2A1DB 1PPGE 2O8UA 1HAZB 4AG1A 3RXHA 3MWIU 3M3VA 1D6RA 3RM0H 1A0LA 1OWJA 3GCOA 1QB9A 4GVUA 2C8YB 4CH2B 4UFDH 1UHBB 2XW9A 1F5LA 3TPIZ 4WMFA 3A80A 1K1NA 4IMQA 5T6GA 4RKJB 2R3UA 3ZZAA 3QN7A 3ZZCA 1Y8TA 1HXEH 1QL9A 4CREA 1SGYE 2AH4X 3P95A 1GBFA 3U1JB 2JH0D 2XWAA 1QIXB 1E36B 5CE1A 4IC6A 1C1TA 1IHSH 1W7XH 1DLKB 1E34B 2A0QB 1NROH 3QWCH 1O2UA 3TGJE 4D9QA 3H7TA 3GOVB 4ZXYH 2D1JA 1K21H 1IQLA 1W14U 2H1UA 1PPCE 1HJAC 2Q6DA 2W3KA 4ABEA 1OXGA 1P04A 1GI8B 3ZVFA 1TNGA 1V2KT 3P8FA 1O2GH 4ABBA 1TE0A 1ARCA 3M3SA 1GJDB 3JZ1B 1Y5AT 4YESB 1ESBA 2H9TH 4O03A 4AYVB 3PO1B 1G32B 3FVFB 3PTNA 3VGCB 4MQAA 2ZP0H 1TNJA 2FYQA 1Z8RA 3QTVH 1F0SA 5LPEA 1HAPH 1HIAB 3E0NB 5E8EH 4BAQB 3GCTF 4IS5A 1SG8B 2FLBH 2ZFPH 5FPYA 1C9PA 1FAXA 1NRSH 1VGCB 1AGJA 4BTUB 1C1RA 1INCA 1TNHA 3U8OH 3URDA 4FVBA 3ATLA 1RIWC 1O2QA 1FIWA 3ITIA 5AFYH 2FTMA 4ZROA 4A6LA 5A0AE 3PMHB 4H6TA 1NTPA 4AOQA 1IQJA 4NSVA 3TGKE 4CRDA 2FX4A 4KTSA 1O3IA 1MBQA 1O34A 3RXFA 3BTWE 2GCTC 1UTPA 4X6OA 3MH7A 2Z9IA 4K1SA 1WU1A 3O8BA 3MNXA 1V2NT 1EZSC 2GKVE 5J4QA 1LVOA 2BQWB 5SGAE 2HVXA 3AAVA 1ELEE 2OQ5A 1O32A 1JOUB 1EPTA 2Y5FA 5C67A 1HAYB 5K7RA 4FUDA 2ZPQA 1FY1A 1G3EA 5TCCA 1C2MA 2EI6A 2QN5T 1SGFA 2TGDA 3OY5U 2P16A 2VGCC 3CENA 1O3OA 1EKBB 4GSOA 4I8KA 1K1LA 1GG6C 1DUEA 3M3TA 4AFUA 5L2YH 2XTTB 1DFPA 3SV2H 4O3TA 4ISIH 1FN8A 2ZDNA 1TABE 1YGCH 3M5LA 3LONA 1NM6A 2V35A 2FXRA 3GISB 2O9QA 3A8CA 1BJUA 1VCWA 1G3DA 1Z7KA 2HNTC 1H4WA 1DDJA 1DY8A 5FX6A 1F5KU 3UPEA 1O2SA 3GCTG 3ZVEA 2WPIS 4B73A 5DPAA 3TVJB 3SU3A 1P11E 3GY8A 4AN7A 1C5OH 1HAOH 3BEUA 3QZRA 1QRZA 4MPVA 3STJA 4X6PA 2VH6A 1AE8H 4RN6A 3GYLB 1XUHA 3M7QA 2ZGBH 1UTQA 5T6DA 3ZZ7A 1CHOF 2Z3DA 2J38A 1O2VA 1YF4A 1G3CA 2AIPA 1ZGVA 3O8DA 1E0FD 1EOLA 1AZ8A 2JKHA 4ZKRU 4CRAA 1MKWK 2H5CA 1P2IA 3T2NA 2A5AA 3RDZA 3UY9A 3F1SB 1BTWA 4Y11E 4E7RG 1TPSA 5GIBA 2HLCA 1ZGIA 1XMNB 1IQEA 1SVPA 2EI8A 3SGAE 4LXBH 5JBCS 5A8XA 3RMLH 2HGTH 4NA8A 4TWWA 4BAHB 1HPGA 1QL7A 1P02A 2ZDLA 1RXPA 1MD7A 2ZI2H 1W2KH 1YPEH 1J14A 2R0LA 1KIGH 2EA3A 2QA9E 4NIWA 3O8CA 1UTNA 1WOFA 1BIOA 4CR9A 2NU0E 2NU1E 1LVMA 1RGQA 1ZJDA 1XUFA 2HOBA 2Q6GA 5F03A 2G52A 3QZQA 2F3CE 1RTFB 1K1MA 4CBOA 2CHAC 3NUMA 3SGBE 1LQDB 1T8MA 3GCHC 1TA6A 4HI3A 2QXJA 4BNRA 1C5PA 1ZZZA 2WYJA 1LHCH 4WH6A 5F8ZA 2QXGA 2XYAA 1JXPA 3VB6A 1YBWA 1OPHB 3MU8A 3SNCA 3MH6A 1B0FA 1MCTA 1RIWB 1UK3A 2P94A 4JZ1A 1GHWH 1AD8H 3RMNH 1GJ4H 4ABFA 1HB0B 3QGNB 1N6XA 2GCTB 4R8TB 4X1QU 1ZOMA 1WBGB 1O5AB 1BTUA 3GY6A 1VITH 4ZKSU 3ZZ4A 4Y71A 4D7GA 2A5IA 1VJ9U 2BDYA 1YPKH 1ZSJA 4JZEH 4M7GA 2ZFQH 1TPOA 3DT0H 4AB8A 3ELAH 1FV9A 1GMHG 4CRFA 1YPJH 1LDTT 1GI7B 2G5NA 2ZHEH 2ALPA 2VVCA 1MU6B 2VGCB 1GG6B 1GVLA 1QURH 1ZTKA 1GVZA 1TQ7B 3F9EA 5HXFA 6CHAC 4D8NA 4DY7B 1XKBC 7LPRA 2IPHA 2XWBI 3RXTA 1O3PB 5HMAA 3SHAH 4MPWA 3MU1A 2ZPSA 2ZTZA 8ESTE 5DG6A 4GLYA 1BITA 1ELCA 1TLDA 4Y8XA 3QLPH 1O2TA 3UWIA 1UTKA 2STAE 3KL6A 5EW2H 2AYWA 3RXBA 4NWKA 1UVOA 3BTDE 4BAKB 3ENSB 2A32A 1C1NA 2J92A 1BRCE 3WY8A 3I77A 1BTPA 1KTSB 1GBKA 1GBIA 1AKSA 1DSTA 3E6PH 5DP3A 1X7AC 1B7XB 1N1LA 1HBTH 2AS9A 5HM9A 1HDTH 2ZGJA 2P3UB 3A81A 1GWAA 4IBLH 1G30B 1GHZA 1UO6A 1ZHMA 3P6ZB 3V3MA 3QGJA 1CA0C 3TLOA 1TRMA 2GZ7A 3A8DA 3UNQA 1G36A 4I7YH 4JK6A 5TJXA 1ZPBA 2C90B 1T4UH 1YPHE 1Z1JA 2I6QA 1ELGA 2BDAA 2VIPA 3Q76A 1ZLRA 5L6NH 2F9NA 2P95A 2VU8E 3Q77A 3O8RA 1FZZA 2GMTC 3DFLA 2ZU1A 3GY4A 2BY6X 1G9IE 2J34A 2XBYA 1GHYH 2XXLA 1AFQC 3AAUA 1SHYA 3SU0A 3UREA 2ZCKP 1GBCA 3RLYH 1P57B 2BB4A 3H7OA 3MH4A 1AVWA 2EI7A 2FYRA 2BY8X 2CJIA
chains in the Genus database with same CATH superfamily
2CMYA 1BTYA 4OS5A 3SU1A 2AGIX 2CHAB 1V2MT 1ZPZA 5FCKA 5FAHA 1HAVB 1TX8A 1TQ0B 1TBZH 3MNCA 3GCHB 4CH8B 2J9NA 2G8TA 2VIVA 8GCHF 1O0DH 3E1XB 5E0GA 4YLUA 1P10A 4FU8A 2O8LA 1O31A 5FHTA 2BHGA 2RFKC 2W3IA 1ELTA 1CT4E 1L0ZA 1TGCA 3BIVH 1UVTH 4M9FA 1F92A 4D7FA 4MNWA 4YOJA 1A4WH 2BDIA 3BEFB 3ZZ9A 3PV5A 4NIYA 5F8XA 2Z94A 3KNXA 4KTUA 1D3DB 1GI5A 1MZDA 1YLDA 4X2XA 3GDVA 2VVVA 3SOSA 4FU9A 1CU1A 1AO5A 1KLTA 2FI3E 2KCOA 3LGIA 4XD7D 4JZIA 3T5FH 3PRDA 1ZMNA 2BD3A 3VB5A 1C4V2 3GY5A 4FUBA 2A7HA 5EG4A 3PV4A 2WV5A 1NZQH 4F4OC 1DE7H 5C2ZA 1GI0A 5F8TA 1O2JA 1EFRD 3LOXA 2VH0A 3F6UH 2TIOA 3PO1C 1TPAE 2GJGA 3VGCC 4XRNA 2FOHA 5LGOA 1Y3UA 5DKMA 1BZXE 3UR6A 4E05H 3AW1A 1K1JA 1E38B 5A2MH 3KF2A 1JRSA 4XOJA 2WHXA 3JZ2B 2DE9A 1MMJN 1QBNA 2TBSA 5FPTA 3RU4E 4F49A 1G2MA 1MZAA 1OP2A 6CHAB 4FXGH 4MG3A 4UONA 3B8JA 1CT2E 1SLVB 4F48B 5AVDA 3CS7A 1M9UA 4GCHF 2R3YA 2QY0B 4MPUA 3EQ0H 1DXWA 2G4TA 1GHVH 3BG4C 1GDQA 4P00A 1RRKA 4ZHAA 4Z6AH 8GCHG 2VVUA 4NIXA 3DSOA 3MOCA 3RP2A 2F4LA 1MD8A 3MTYA 3RC6A 3RXIA 3A85A 3RXSA 4JYUH 1P2NA 2ZHQH 1ZR0A 5KGOA 2FO9A 4UEHH 3MU0A 1XXFA 1G3BA 3SGQE 1PPHE 3RXMA 3TK9A 2ULLA 1P8VC 1A61H 3PMAB 4AGKA 2W7UA 4FUIA 5T6FA 1JIRA 3E8LA 5DK1A 1SGEE 1Z1IA 2PTCE 4NZLA 3F2HA 3T62A 2VINA 5IK2D 1BHXB 4NIVA 3SV7A 1CA0B 4JK5A 2ZQ2A 3F68H 3L33A 2J98B 1GJ5H 1L1GA 4Y79A 3KQ5A 7ESTE 3EA9A 2WUBA 4WH8A 1HRTH 4I86A 1FLEE 3ZYDA 2O8WA 1MKXH 1BDAA 3SU5A 1DX5M 1UHBA 2OUAA 1YPMH 4WWYA 3EE0B 3LGWA 2QXHA 3H09A 1A0HB 4IMZA 4OS6A 4RT0A 1IQGA 1TRYA 4ZMAH 1JIMA 2GMTB 1C1UH 2FOAA 1O3MA 2WPKS 1KXAA 4IN1A 1COWD 1PYTC 3TU7H 1T31A 5A09A 2H2ZA 1AFQB 1AY6H 1EXFA 3KGPA 5KECA 1LPKB 5CHBA 3V0XA 4Y10E 1V3XA 5JYIA 4F55A 2A31A 4GCHG 2J94A 3MI4A 3E3TA 2GDEH 3E90B 1Z6EA 4ZKNU 1P2QA 1CGIE 1ZTJA 1GMCF 4K2YA 1SC8U 2BD2A 1YPGH 4ISHH 4JMYA 2W7SA 1TAWA 3VXFH 3SBKA 1YWUA 3N7EA 5IYTA 2FX6A 1QJ7B 4Q2KA 4Q7ZA 3EAJA 1UTMA 4FUGA 4ABDA 2CN0H 4WXIA 2FOGA 1LHGH 1FY3A 4JYTA 1DWEH 2XCNA 2ZGCA 1AVGH 1NESE 3D49H 4MPXA 3UQOA 1WSSH 4AGJA 3M61U 2YOLA 4YZUA 2A45B 1O3KA 1NRQH 1ORFA 1EP6A 1F0RA 4ESTE 2HWLB 2RA3A 1BRAA 5GPIB 2LPRA 2KFWA 3RXCA 1RD3B 2GZ8A 1BT7A 2NWNA 2JH5D 1HIAA 3HK6B 4R0IA 2H9EH 4ASUD 2WV4A 2UUFB 1G2LA 1V2PT 4Y8YA 4K5ZA 4O97A 3MO9A 3AASA 3BTHE 3NCLA 3SN8A 1W3CA 4ZHMU 1O2NA 1F7ZA 2VIOA 5JB8S 1UVPA 4LOYH 4CR5A 1FQ3A 2Y7ZA 1OOKB 1GI4A 3SZNA 1A1RA 1QZ8A 4NCYA 4HFPB 2FOEA 3ZVGA 1LVYA 3L6PA 1UTOA 1P03A 1QY6A 1GHAF 3A7ZA 3KCGH 1WTHD 1KDQB 4B6EA 1H8DH 2UWPA 1JMOH 4LZ1H 1GMCG 2ZTYA 3VG8A 1YPHC 3OTPA 3BG4B 3TH2H 1HCGA 1H9LB 5EQSA 1C2DA 4B71A 1BOQA 1SQTA 1K2I1 1GJ7B 2BLOA 2BQ6B 1XX9A 1YLCA 2FOMB 2RA0A 2BDBA 3WW7A 4AORA 2AMPA 1SB1H 1ELVA 2QV1A 1V2VT 1EZUC 3U28C 1V2QT 2CXVA 1ZJKA 3ZZ5A 2FI4E 1C1PA 3RMMH 2A7JA 4Q4LA 3ZV8A 1C5LH 1O2ZA 4UE7H 3ESTA 1GBJA 1OWIA 1TIOA 2VWNA 3VEQB 2GCHF 2ILNA 3RXEA 3ZVCA 3PV2A 4TY6A 4UD9H 1FONA 3E0PB 3FANA 1A0JA 1DOJA 2K1QA 1BBRE 2P93A 1S82A 1Z8GA 1G37A 3ZZ6A 3Q3YA 2QF5A 4DIHH 1PQ8A 1AWHB 1D4PB 5JBTA 5HGGA 4XFQA 1GI2A 1IQKA 1C2EA 3NXPA 2J5UA 1GBBA 1IQNA 1V2UT 3OAAD 3U8RH 3GYMA 4TPYA 4NFFA 1D3PB 3ZZ8A 1GCTB 5C1UA 2THFB 4NA9H 3OE7D 5LH8A 1N8OC 1QBOA 3E16B 1H8IH 5CDFE 1GHAG 5EQRA 1KXCA 4Y0ZE 4Q80A 3UOUA 1ESAA 1GBEA 1MTNC 1KXDA 3G01A 2EY4C 4NA7A 2FDAA 1K1IA 3A7TA 2TGAA 5BPEA 2A4QA 1NRPH 3ZZDA 1EJNA 3RXVA 5JBBS 1VCPA 1F0TA 1S6FA 4Y7BA 4UFGH 1HNEE 1TGSZ 3PLKA 2DUCA 4Y7AA 1GPZA 3MO3A 3K2UA 3UUZA 1K9OE 1C5SA 4NGAH 2GX4A 1BMNH 3SUFA 3PWBA 4OGXA 2GCHG 4GHQA 4FVDA 4JYVH 2FOCA 3SV9A 1IAUA 3EBNA 1C5VA 4FUCA 4I8GA 1A5HA 5T3HA 2XCFA 1THRH 3CNRA 1SHHB 1ABIH 1PPFE 1MCVA 1UW7A 2VIQA 2UWOA 1D3QB 3QTOH 1EZQA 1SQOA 3KYFA 1B0EA 3DCLA 5B6LA 1HAXB 1OWHA 1FPCH 1P0SH 2FOBA 2Y5GA 4LZ4B 4RKOB 1QJ6B 5E0HA 4UFFH 3RLWH 1TOMH 4BTTB 4X8SH 5JDUB 2M5TA 4H42U 3ZZBA 3S7KB 2Z9GA 1BMLA 1SGFG 2A4RA 3R0FA 3KQCA 1OX1A 5E2PA 5F6MA 2BDCA 1T8OA 2A5KA 4I31A 1ABJH 1NN6A 1QBVH 2BXTH 3A87A 3D23A 2LNCA 1C9TA 3OTJE 3SU4A 1U6QA 1DLEA 2VIWA 2QF4A 5A8YA 5DJ7A 3ODFA 1D6WA 3P17H 1C2HA 4ACAA 1EASA 5GCHF 1HFDA 3LPRA 1TX7A 3ATWA 1SL3A 1HYLA 3LKWA 3BF6H 1EJMA 1CHOG 2H9HA 3I78A 1AMHA 1ANBA 1O5FH 3RXDA 1MQ6A 3EGKH 5GDSH 1ETTH 2AEIH 2QCYA 2Z9KA 3HKIB 3NKKA 3BN9A 4NFEA 1V2TT 3U9AH 4ABHA 2GT7A 3DA9B 1QCPA 2PV9B 4Q7YA 1C5ZB 2VB0A 5EOKA 2R9PA 1P2OA 3NK8A 3BTGE 4MDSA 4A92A 3W95A 2F9UA 4DIIH 2ZFFH 1A5IA 1A3EH 2GP9B 1NRNH 1GL1A 4X8VH 5EODA 4O3UA 2SNVA 2ZEBA 4Q7XA 1OP0A 3D65E 3E91A 4FUFA 2B0FA 2O8TA 1O5BB 7KMEH 3AK5A 1P9SA 2VBCA 5C5OA 1P2MA 5C1YA 4KP0A 2VIDA 1KXEA 1CT0E 2HNTF 3NWUA 4MTBA 2P3FH 2QAAA 2OC0A 4XBCA 4HGCA 1O3GA 3V7TA 2HALA 4YLQH 2ZCLP 3SJ9A 2ZFRH 1CHGA 3MMGA 4XBBA 3PTBA 3OSYA 3SV6A 1MKXK 1L2EA 1N8OB 1QTFA 2NU4E 1OKXA 3SW2B 3K6ZA 2SGQE 5GCHG 3MO6A 1SLWB 2QF3A 4OM9A 1AZZA 1C5YB 1W13U 3FZDA 1C2JA 3IWMA 1MTNB 2Q1JA 1Y3VA 1EJAA 2M2AA 2ZPRA 1LKAA 9ESTA 2OK5A 4INHA 4FUJA 3VB7A 2J2UA 4AB9A 2F9VA 2F9PA 1RFNA 1DWBH 4FU7A 1KTTB 1SSXA 5J4SA 1O5DH 3DFJA 3FP8E 1O2LA 1O39A 1TNLA 5HIYA 2BD5A 2C8WB 5C20A 1LHFH 2ZGHA 4K8YA 3S69A 5A8ZA 1FY4A 1O3CA 1O3AA 5EQQA 4X6NA 1BMMH 1NFUA 1O33A 1PQAA 1Q2WA 2FPZA 3RC4A 2LELA 4B2BA 3IG6B 1C2KA 3RXPA 1RJXB 3B23B 1AVXA 3H5CB 3P8NA 2XC4A 1HAVA 2SGFE 3GICB 3MNSA 5C0TA 1ARBA 1OYQA 3GCNA 1S83A 3ODDA 3T26A 5FPSA 3V12A 5EU8A 2JJ1D 3A7XA 1QR3E 3ATIA 2G00A 1O35A 2WV9A 1E1QD 3N99A 2SGAA 3OEED 2ZHWH 1TRNA 1SGTA 3HPTB 1H1BA 5FBEA 1GJBB 2IPQX 3BTME 3PWCA 4K1TA 3PB1E 1NT1A 2ZG0H 5C0UA 3LH3A 2PFEA 1C5NH 1W7GH 2BY9X 1AB9C 5LPRA 3MFJA 1P09A 2ZA5A 1J17T 5C5NA 3CP7A 1C1MA 4DW2U 2NU2E 3ZZ3A 4AFSA 1FDPA 2ZFTA 5HM2A 1MH0A 4WXVA 1L1NA 4ABGA 2BLVA 1ZSKA 2BY5X 4HZHA 1K1PA 4QT8C 4X6MA 2ANWA 2KCAA 3OYPA 2BYAX 4SGAE 1C5XB 1Z71A 1NFYA 1O38A 2VJ1A 1MUEB 3CS0A 4THNH 4ASHA 2FIRH 4X8TH 5EPNA 2P8OC 4ISOA 5FCRA 1ANCA 1J9CH 1QA0A 2O8MA 1E37B 2GZ9A 1TX6A 4ZXXH 1JBUH 5DGJA 1Y5BT 3ZYEA 1QNJA 3M5OA 1TALA 3TJUA 4Y6DA 5T1VA 3SZEA 2Z6BD 3TH4H 1C1OA 2KAIB 1WQVH 1CQQA 1UCYH 3M5MA 1MAXA 3Q00A 5GWZA 1TBRH 2F9BH 1NY22 4I32A 1O2IA 5C3NA 4X2VA 4JZDH 3TK5A 4B2CA 3RXOA 1NFXA 1P2KA 2BZAA 4XDEA 3SU6A 4BXWA 1NO9H 1Y3XA 2J4IA 1F0UA 2G51A 4B75A 1BB0B 4TSFD 2BTCE 3SORA 3OFND 5EJZA 4IN2A 3ZVDA 1XVMA 4ISNA 4TT3D 2NU3E 4A5TS 1EAIA 4BAMB 2BLQA 3MQKC 3SJKA 2D8WA 1W11U 3BTQE 1XUIA 1ZMLA 3QX5H 5ETXA 1HGTH 4MVNA 2PTNA 1KSNA 4ZCNA 2BVXH 1C1VH 4U2WA 3HGPA 4Z0KA 1XXDA 2BZ6H 1GHXH 2YNBA 1CSOE 1EZXC 1O37A 3ZVBA 1O2OA 4TWYA 3RXJA 1T8LA 1HAGE 2EQNA 1GGDC 4K69A 3SO3A 5LPFA 3EA7A 4BAOB 5FXLA 4FETA 4JZFH 3SUDA 1EAXA 1H9HE 1O3FA 2XBXA 1IOEA 1O2KA 1TNKA 2PW8H 2FM2A 2J98A 2C3SA 2IJOB 2AGGX 1DWCH 1NBME 1C5WB 2GV6A 3FP6E 2HPQH 4INLA 1EATA 2BLWA 2FI5E 2G81E 4MNYA 1BHXF 1SFIA 2B9LA 2UWLA 2ZHFH 3SNEA 1SOZA 4X1PU 1EAWA 2PUXB 1AHTH 3HKJB 3LGVA 1O5EH 1UMAH 1WAYB 4GPGA 1TGTA 4UFEH 2RDEA 1GBMA 1YCPM 1TGBA 1DICA 2PKAB 1DXPA 3L3TA 3T29A 3LJOA 1EUFA 3A7YA 1KLIH 3QK1A 2BD4A 1XM1A 2D2DA 4WMEA 1HXFH 1K1OA 4XBDA 5DP6A 3HATH 5EW1H 3LDXH 1WTGH 5AFZH 4GUXA 4MNXA 4H6SB 1FY8E 1UK4A 1KXFA 2HRVA 1LMWB 1SFQB 5H4IB 2RDLA 4Y0YE 1TOCB 3DUXH 2C4FH 2L6OA 3TNSA 1GCTC 2F9OA 3LGYA 1CBWC 3OX7U 3PRBA 2WINI 4PROA 1BMAA 2BVSH 4AC9A 2ZU3A 1C2FA 2BM2A 2G55A 3NZIA 5CHAC 3AVZA 1Q31A 1C4Y2 2FTLE 1IQHA 1NFWA 1O36A 4MLFB 4I8LA 4OS4A 4A1TA 3RXKA 1BTHH 3A7WA 1TMUH 1AB9B 1P2JA 4ABAA 1OYTH 3A8BA 1DITH 1P9UA 3SNAA 1DANH 3UNSA 2ZECA 1QQ4A 3HK3B 4I33A 3PMBB 1EPTC 1Y3YA 3TJVA 3QUMP 5EJLA 3WWFA 1YCPH 1SR5C 2XNIA 3URCA 4YOGA 1SGQE 4BOHA 1JWTA 4U30A 6LPRA 1CA8B 3U8TH 1GI6A 1L1JA 3FKSD 4D9RA 2C8XB 2GVFA 1C5QA 1QFKH 1SGDE 1V6DA 2QC2A 4Y76A 3PM3A 2VWOA 3KQDA 3P8OA 1QQUA 5DO4H 1A3BH 1OSSA 1FJSA 1QB6A 3M36A 3P92A 2P8OB 2GV7A 1W0YH 1HLTH 1TNIA 1GBTA 2QIQA 5PTPA 2K7XA 4AFQA 2XBWA 1IQIA 2FMJA 2CK3D 1C2GA 3TGIE 4GHTA 2FODA 2W6ID 2SGEE 3GS9A 1AIXH 4ZKOU 2ZHDA 5DP8A 2XC0A 1TONA 3KN2A 2ANMH 1LHEH 2YNAA 3M35A 1AI8H 1J16A 4RI0A 1GHBF 1WQSA 1FNIA 1OWDA 5FL7D 3FAOA 1V2OT 1KDQA 2A2XH 1BUIA 4K8BA 1HV7A 1GVKB 3VXEH 3N7OA 1PPBH 1AUJA 1SGRE 1XKAC 1EB1H 4INKA 2BQ7B 4U01A 3A86A 4CRGA 2D26C 1MABB 1O3BA 3FZZA 3P70B 3TJOA 1BTXA 3NPSA 3M5NA 4U32A 4LK4A 1PYTD 2TGTA 1BJVA 2ZDVH 2QE7D 2PR3A 3MH5A 2FZZA 2ALVA 3SHCH 3S7HB 4KGAA 1SGPE 5E0JA 3LC5A 3SJIA 5A0CA 4X0WU 1THPB 1ZMJA 2Y81A 1ZHRA 3DHKH 3KQEA 4IGDA 1SBWA 1FY5A 1HAHH 4ZH8A 1GGDB 5G4BA 3SJ8A 1VITF 2SFAA 4CHAB 1PFXC 4AZ2B 1N6YA 2FLRH 5EJ1A 1NRRH 2R2WU 1OHHD 3RM2H 4A7IB 1DWDH 2ZFSA 3ZIAD 2CF8H 3B9FH 5I46H 2H6MA 1UVUH 5KEDA 1TGNA 4XSKU 1AWFH 1C5RA 1AU8A 3R3GB 2F83A 1SGIB 4K3JA 1HUTH 3A89A 1UJ1A 2F43B 4DGJA 4TPIZ 4DT4A 1HJ8A 1GBHA 1O3NA 5FBIA 3KQBA 2AFQB 3DD2H 4K1EA 3TH3H 1IQMA 3W94A 2OBOA 1SQRA 1T4VH 2OTVA 3K9XB 1O3LA 1GJ8B 1PJPA 1HJ9A 3LGTA 1NPMA 2ASUB 2FS8A 2LIZA 3BTEE 2JETC 3S0NA 3TNTA 1QHRB 2GD4B 4WF8A 5DP7A 3SUEA 1RTKA 1GHBG 4OGYA 4OS7A 3BTKE 2AGEX 3I29A 3ATMA 3PLPA 5AHGH 2ANYA 4BTIB 3VFEA 4CRCA 1PPZA 3A84A 1SI5H 1W12U 1TPPA 1KXBA 2ZIQH 2Z9JA 2OP9A 2BOKA 3C27B 2QF0A 2ODPA 1FPHH 2QXIA 3F9FA 3VPKA 1CBWB 1Y59T 5DP9A 1GMDF 2BY7X 5A0BA 1WDIA 2V3MA 3A83A 5CHAB 1YPLH 1EP5A 1YM0A 2IN2A 1HAIH 5JBAS 4X1RU 2PWXA 1SLXB 3OU0A 1BRBE 2VWMA 1UK2A 1GJ6A 2FEQH 1W0ZU 2GDDA 3SI4H 1A46H 1EPTB 3UQVA 3A88A 1VITG 2I6SA 1GI1A 1YYY1 2ZU2A 1DM4B 2W26A 4B76A 1LPZB 3BTTE 1WCZA 3EYDA 3PYHA 2OC7A 4YO9A 2ODYB 3RXRA 1A5GH 1NU7B 3K65B 1BBRH 1V2ST 2BD8A 3BV9B 2Y82A 1UTJA 1Z8IB 3S9AA 4B1TA 3UTUH 4B6FA 5C1XA 1ZHPA 2P3TB 1PPEE 3SNDA 2G4UA 1V2JT 3TITA 1K28D 2ODQA 4AYYB 2V3HH 3RC5A 1GBAA 1O5GH 2XRCA 1YKTA 1Z6JH 3SUGA 3IITA 1C5MD 2R2MB 4TY7A 2A4OA 4A1XA 3AW0A 1CGHA 1NC6A 1FIZA 2UUYA 2FOFA 2VWLA 4H4FA 4DT7B 5EXNA 3MU5A 2QYIA 3EDXB 3T28A 2AERH 2A4GA 2UUJB 3TK6A 1O3EA 1F2SE 3M7TA 2WPLS 3MHWU 1IHTH 1UTLM 1GMHF 2V3OH 2SNWA 3UOPA 4A1VA 1UCYK 4ZHLU 2ZDAH 2HLDD 1HJAB 2PKSC 4YM9A 3RMOH 5JPMH 4NZQA 3U98H 1GMDG 3UNRA 2SGDE 2BX4A 3A8AA 1RS0A 2KCYA 4Z1MD 4NSYA 2P59A 3BTFE 3RXGA 3BEIB 1AFEH 1ZTLA 2WPHS 1C2LA 1ANDA 3ZV9A 1J8AA 1O2MA 3LIWA 5L2ZH 1KLJH 3PROA 2Z3EA 2V0BA 4AFZA 2BMGB 1ZRKA 8KME2 2KR7A 1C5UA 3SV8A 3F2GA 4B74A 1YP9A 2UUKB 2YMSC 2B8OH 3A7VA 1SQAA 2WPJS 1MBMA 2ZCHP 1C4U2 1JRTA 5AF9H 3STIA 2Y7XA 2B5TB 1AE5A 2PHBA 1SPJA 1DVAH 1O3JA 2FWWA 4BANB 1DPOA 5EXMA 1GJCB 1T8NA 4X2WA 5HIZA 3S9BA 1SGCA 3DSPA 1A2CH 1E35B 1P06A 2ZWLH 2QGRA 4Q63A 1LO6A 4X1SU 5ESTE 1NU9A 1GDNA 1H9IE 3RU4D 9LPRA 4HTCH 1Z8JB 1ELAA 1S81A 2PLXA 1QA7A 4ISLA 6GCHF 1V2RT 2CGAA 5EPYA 3VB3A 3C1KA 2V6NA 2JETB 2KM0A 4KELA 4OS2A 3MU4A 3PMJA 4YOIA 4KTCA 1PQ5A 1T7CA 4CRBA 6ESTA 4AG2A 3UWJH 1O2PA 1TWXB 1EX3A 1MTUA 2OC8A 3SJOA 2ZC9H 2OD3B 4DCDA 1CO7E 2OINA 1LQEA 1SMFE 1GI3A 2F91A 1GJAB 1P3CA 2ZQ1A 5HYOA 1VJAU 1TMBH 2JIZD 3M37A 1S0QA 1DY9A 2OCVB 2BDGA 1QL8A 4JCNA 3FOAA 1J15A 2PSXA 1C2IA 4ZUHA 3GDUA 1K0HA 4B2AA 3HGNA 1C1SA 4I8HA 3LJJA 1DS2E 1ELDE 2DE8A 3V13A 4K60A 3LH1A 1S0RA 1OWKA 1O2HA 4KKDA 2SGPE 4O9VA 5BRRE 2ESTE 2ZU4A 3SQEE 2RG3A 2AIQA 5EGMA 1OWEA 2ANKH 2Y5HA 1ZYOA 5GJ4B 4ACBA 3GDSA 3RUOA 1O2WA 2AMQA 1W8BH 5ESBA 2ZO3H 1GCDA 1DSUA 3RXUA 1S6HA 4WY3A 1EB2A 2WPMS 3MNBA 4I8JA 4UDWH 1UVSH 1C5TA 1DT2A 3T25A 2OXSA 5EXLA 5TCAA 2J95A 5DP5A 2K0QA 3F9GA 1V2WT 1YCPK 3Q3KA 2BD9A 1MU8B 1GJ9B 1O3HA 3KHVA 3LT3A 2PGQB 1XUJA 4VGCC 2XNDD 4E06H 1CGJE 6GCHG 1QB1A 2RCEA 1FMGA 1QRXA 4NG9H 1FN6A 1KMHB 1EAUA 3PLBA 2WPDD 2BDHA 4DJZB 1WV7H 2OBQA 1BTZA 4X8UH 3UR9A 1ESTA 5FX5A 3U1IB 5DP4A 1L4ZA 5HKKD 1FXYA 2OQUA 2ZTXA 3MYWA 2GTBA 1AUTC 1AKSB 1MTVA 4OS1A 2JJ2D 2ZDMA 2PKSB 2CV3A 3KEEA 3KIDU 1Y5UT 3SQHE 1ZRBA 1LKBA 4D76A 2EEKA 2WYGA 3OY6U 2BVRH 3QDZB 2KAIA 4NWLA 1UCYE 2TRMA 1CE5A 1A7SA 1CVWH 1GI9B 2XOKD 1ETSH 3LC3A 1P01A 3FP7E 1MKWH 5CMXH 3F9HA 2PGBB 3RU4T 1GL0E 3P8GA 1D9IA 1S85A 3ATKA 2ZU5A 4ABJA 1ETRH 4XE4A 2YMSB 3VB4A 3UFAA 1LHDH 2KZ4A 4WVPE 2IJD1 2BX3A 4ABIA 3EA8A 2OC1A 4P02A 3T27A 3A82A 1QGFA 1FI8A 4DURA 2XC5A 1Q3XA 4FUHA 1O5CB 2Y6TA 1BRUP 2PSYA 5IDKA 1QJ1B 1BA8B 4X2YA 4BXSA 2OLGA 1OP8A 1WUNH 2C8ZB 1DUAA 1P05A 2K8IA 3LGUA 5DSFA 3BSQA 7GCHF 1FAKH 3BG8A 3TIUA 2Z9LA 1O2YA 1MTWA 1PQ7A 2B7DH 3RXQA 4E7NA 5K0HA 3Q3XA 1O2XA 2PUQH 2HPPH 4CBNA 2HNTE 2ZGXH 2Z3CA 1ELFA 4GAWA 1VR1H 1OS8A 1LCYA 1O2RA 2FS9A 2IOTA 2G5VA 2Y80A 1ACBE 2VNTA 2ZKSA 1KY9A 2FESH 1L4DA 1AQ7A 1YC0A 5B6OA 1SLUB 1VCQA 1H8ED 4DVAU 1TFXA 1E79D 1GDUA 1VZQH 4IC5A 3TJNA 3BIUH 1SOTA 1ELBA 1V2LT 4YTAA 3FO8D 1RTLA 4SGBE 3SYJA 8LPRA 1QRWA 2GGVB 2PKAA 2JH6D 4CHAC 2AMDA 3RXLA 1C1QA 5JB9S 1MTSA 2ZNKH 1EQ9A 2AHME 2XBVA 2ZZUH 5L30H 1LTOA 3GY3A 1EOJA 1MAYA 1W10U 1XUGA 4ZAEA 2BOHB 4Y8ZA 2WUCA 3SI3H 1VGCC 2W5EA 4YT6H 2BD7A 3S9CA 2Z7FE 1MQ5A 1THSH 4FUEA 1YY3A 1BMFD 5E2OA 3SU2A 2W6JD 4X1NU 4DG4A 1AN1E 2TPIZ 1WYKA 1GBLA 2FP7B 1TMTH 1ZPCA 4AX9H 2ZDKA 1B5GH 1TYNA 1TA2A 3U69H 1TB6H 2R0KA 1ZSLA 2A2QH 2ZF0H 7GCHG 3GY7A 1BCUH 2A7CA 3GY2A 4FOUC 4MNVA 1ID5H 1F5RA 4VGCB 2STBE 3SNBA 1NS3A 4WJG2 3LU9B 1K22H 1P12E 1BBRK 4YT7H 4IW4E 1LPGB 1SGNE 2H5DA 1S84A 3D62A 3ZVAA 2TGPZ 1FX0B 1Y3WA 3K6YA 1C1WH 1GBDA 2WZQA 4RSPA 1FUJA 1T32A 4DOQA 3OEHD 1LVBA 1O30A 4WMDA 5DN6D 2GT8A 4J2YB 2BXUH 2EC9H 1ANEA 3EE7A 4TYDA 3QO6A 1S5SA 1D3TB 1IQFA 1BQYA 1TBQH 1P3EA 3M7UA 3FFGA 2C93B 1XUKA 3DSGA 5ABWA 1KYNA 3RXAA 5C17A 3UIRA 5I25A 2CF9H 1O3DA 2Q6FA 5GXPA 1XVOA 4J1YA 2A1DB 1PPGE 2O8UA 1HAZB 4AG1A 3RXHA 3KYGA 3MWIU 3M3VA 3F0PA 1D6RA 3RM0H 1A0LA 1OWJA 3GCOA 1QB9A 4GVUA 2C8YB 4CH2B 4UFDH 1UHBB 4HG6A 2XW9A 1F5LA 3TPIZ 4WMFA 3A80A 1K1NA 4IMQA 5T6GA 4RKJB 2R3UA 3ZZAA 3QN7A 3ZZCA 1Y8TA 1HXEH 1QL9A 4CREA 2V7QD 1SGYE 2AH4X 3P95A 1GBFA 3U1JB 1SKYE 2JH0D 2XWAA 1QIXB 1E36B 5CE1A 4IC6A 1C1TA 1IHSH 1W7XH 1DLKB 5F53A 1E34B 2A0QB 1NROH 3QWCH 1O2UA 3TGJE 4D9QA 3H7TA 3GOVB 3F0OA 4ZXYH 2D1JA 1WXRA 1K21H 1IQLA 1W14U 2H1UA 1PPCE 1HJAC 2Q6DA 2KCPA 2W3KA 4ABEA 1OXGA 1P04A 1GI8B 3ZVFA 1TNGA 1V2KT 3P8FA 1O2GH 4ABBA 1TE0A 1ARCA 3M3SA 1GJDB 3JZ1B 1Y5AT 4YESB 1ESBA 2H9TH 5GNDA 4O03A 4AYVB 3PO1B 1G32B 3FVFB 3PTNA 3VGCB 4MQAA 2ZP0H 1TNJA 2FYQA 1Z8RA 3QTVH 1F0SA 5LPEA 1HAPH 1HIAB 3E0NB 5E8EH 4BAQB 3GCTF 4IS5A 1SG8B 2FLBH 2ZFPH 5FPYA 1C9PA 1FAXA 1NRSH 1VGCB 1AGJA 4BTUB 1C1RA 1INCA 1TNHA 3U8OH 3URDA 4FVBA 3ATLA 1RIWC 1O2QA 1FIWA 3ITIA 5AFYH 2FTMA 4ZROA 4A6LA 5A0AE 3PMHB 4H6TA 1NTPA 4AOQA 1IQJA 4NSVA 3TGKE 4CRDA 2FX4A 4KTSA 1O3IA 1MBQA 1O34A 3RXFA 3BTWE 2GCTC 2PP6A 1UTPA 4X6OA 3MH7A 2Z9IA 3FN8A 4K1SA 1WU1A 3O8BA 2HVYB 3MNXA 3UB0A 1V2NT 1EZSC 2GKVE 5J4QA 1LVOA 2BQWB 2KX4A 5SGAE 2HVXA 3AAVA 1ELEE 2OQ5A 1O32A 1JOUB 1EPTA 2Y5FA 5C67A 1HAYB 5K7RA 4FUDA 2ZPQA 1FY1A 1G3EA 5TCCA 1C2MA 2EI6A 2QN5T 1SGFA 2TGDA 3OY5U 2P16A 2J97A 2VGCC 3CENA 1O3OA 1EKBB 4GSOA 4I8KA 1K1LA 1GG6C 1DUEA 3M3TA 4AFUA 5L2YH 2XTTB 1DFPA 3SV2H 4O3TA 1E1RD 4ISIH 1FN8A 2ZDNA 1TABE 1YGCH 3M5LA 3LONA 1NM6A 2V35A 2FXRA 3GISB 2O9QA 3A8CA 1BJUA 1VCWA 1G3DA 1Z7KA 2HNTC 1H4WA 1DDJA 1DY8A 5FX6A 1F5KU 3UPEA 1O2SA 3GCTG 3ZVEA 2WPIS 4B73A 5DPAA 3TVJB 3SU3A 1P11E 3GY8A 4AN7A 1C5OH 1HAOH 3BEUA 3QZRA 1QRZA 4MPVA 3STJA 4X6PA 3UAIC 2VH6A 1AE8H 4RN6A 3GYLB 1XUHA 3M7QA 2LP6A 2ZGBH 1UTQA 5T6DA 3ZZ7A 1CHOF 2Z3DA 2J38A 1O2VA 3N7DA 1YF4A 1G3CA 2AIPA 1ZGVA 3O8DA 1E0FD 1EOLA 1AZ8A 2JKHA 1W0JD 4ZKRU 4CRAA 1MKWK 2H5CA 1P2IA 3T2NA 2A5AA 3RDZA 3UY9A 3F1SB 1BTWA 4Y11E 4E7RG 1TPSA 3F2FA 5GIBA 2HLCA 1ZGIA 1XMNB 1IQEA 1SVPA 2EI8A 3SGAE 4LXBH 5JBCS 5A8XA 3RMLH 2HGTH 4NA8A 4YXWD 4TWWA 4BAHB 1HPGA 1QL7A 1P02A 2ZDLA 1RXPA 1MD7A 2ZI2H 1W2KH 1YPEH 1J14A 2R0LA 1KIGH 2EA3A 2QA9E 4NIWA 3O8CA 1UTNA 1WOFA 1BIOA 2L74A 4CR9A 2NU0E 2NU1E 1LVMA 1RGQA 1ZJDA 1XUFA 2HOBA 2Q6GA 5F03A 2G52A 1S6LA 3QZQA 2F3CE 1RTFB 1K1MA 4CBOA 2CHAC 3NUMA 3SGBE 1LQDB 1T8MA 3GCHC 1TA6A 4HI3A 2QXJA 4BNRA 1C5PA 1ZZZA 1W0KD 2WYJA 1LHCH 4WH6A 5F8ZA 2QXGA 2XYAA 1JXPA 3VB6A 1YBWA 1OPHB 3MU8A 3SNCA 3MH6A 1B0FA 1MCTA 1RIWB 1UK3A 2P94A 4JZ1A 1GHWH 1AD8H 3RMNH 1GJ4H 4ABFA 1HB0B 3QGNB 1N6XA 2GCTB 4R8TB 4X1QU 1ZOMA 5EIYA 1WBGB 1O5AB 1BTUA 3GY6A 1VITH 4ZKSU 3ZZ4A 4Y71A 4D7GA 3WWBA 2A5IA 1VJ9U 2BDYA 3F3BA 1YPKH 1ZSJA 4JZEH 4M7GA 1NBMD 2ZFQH 1TPOA 3DT0H 4AB8A 3ELAH 4RT1A 1FV9A 1GMHG 4CRFA 1YPJH 1LDTT 1GI7B 2G5NA 2ZHEH 2ALPA 2VVCA 1MU6B 2VGCB 2WSSD 1GG6B 1GVLA 1QURH 1ZTKA 1GVZA 1TQ7B 3F9EA 3NRLA 3W1EA 5HXFA 6CHAC 4D8NA 5C94A 4DY7B 1XKBC 7LPRA 2IPHA 2XWBI 3RXTA 1O3PB 5HMAA 3SHAH 2YMSD 4MPWA 3MU1A 2ZPSA 2ZTZA 8ESTE 5DG6A 4GLYA 1BITA 1ELCA 1TLDA 4Y8XA 3QLPH 1O2TA 3UWIA 1UTKA 2STAE 3KL6A 5EW2H 2AYWA 3RXBA 4NWKA 1UVOA 3BTDE 4BAKB 3ENSB 2A32A 1C1NA 2J92A 1BRCE 3WY8A 3I77A 1BTPA 1YLNA 1KTSB 1GBKA 1GBIA 1AKSA 1DSTA 3E6PH 5DP3A 1X7AC 1B7XB 1N1LA 1HBTH 2AS9A 5HM9A 1HDTH 2ZGJA 2P3UB 3A81A 1GWAA 4IBLH 1G30B 1GHZA 1UO6A 1ZHMA 3P6ZB 3V3MA 3QGJA 1CA0C 3TLOA 1TRMA 2GZ7A 3A8DA 3UNQA 1G36A 4I7YH 4JK6A 5TJXA 1VKYA 1ZPBA 2C90B 1T4UH 1YPHE 1Z1JA 2I6QA 1ELGA 2BDAA 1H8HD 2VIPA 3Q76A 1ZLRA 5L6NH 2F9NA 2P95A 2VU8E 3Q77A 3O8RA 1FZZA 2GMTC 3DFLA 2ZU1A 3GY4A 2BY6X 1G9IE 2J34A 2XBYA 1GHYH 2XXLA 1AFQC 3AAUA 1SHYA 3SU0A 3UREA 2ZCKP 1GBCA 3RLYH 1P57B 2BB4A 3H7OA 3MH4A 1AVWA 2EI7A 2FYRA 2JDID 2BY8X 2CJIA
chains in the Genus database with same CATH topology
2CMYA 1BTYA 4OS5A 3SU1A 2AGIX 2CHAB 1V2MT 1ZPZA 5FCKA 5FAHA 1HAVB 1TX8A 1TQ0B 1TBZH 3MNCA 3GCHB 4CH8B 2J9NA 2G8TA 2VIVA 8GCHF 1O0DH 3E1XB 5E0GA 4YLUA 1P10A 4FU8A 2O8LA 1O31A 5FHTA 2BHGA 2W3IA 1ELTA 1CT4E 1L0ZA 1TGCA 3BIVH 1UVTH 1F92A 4D7FA 4MNWA 4YOJA 1A4WH 2BDIA 3BEFB 3ZZ9A 4NIYA 5F8XA 2Z94A 3KNXA 4KTUA 1D3DB 1GI5A 1MZDA 1YLDA 4X2XA 3GDVA 2VVVA 3SOSA 4FU9A 1CU1A 1AO5A 1KLTA 2FI3E 3LGIA 4JZIA 3T5FH 1ZMNA 2BD3A 3VB5A 1C4V2 3GY5A 4FUBA 2A7HA 5EG4A 3PV4A 2WV5A 1NZQH 4F4OC 1DE7H 5C2ZA 1GI0A 5F8TA 1O2JA 3LOXA 2VH0A 3F6UH 2TIOA 3PO1C 1TPAE 3VGCC 2FOHA 5LGOA 1Y3UA 5DKMA 1BZXE 3UR6A 4E05H 3AW1A 1K1JA 1E38B 5A2MH 3KF2A 1JRSA 4XOJA 3JZ2B 2DE9A 1MMJN 1QBNA 2TBSA 5FPTA 3RU4E 4F49A 1G2MA 1MZAA 1OP2A 6CHAB 4FXGH 4MG3A 4UONA 3B8JA 1CT2E 1SLVB 5AVDA 3CS7A 1M9UA 4GCHF 2R3YA 2QY0B 4MPUA 3EQ0H 1DXWA 2G4TA 1GHVH 3BG4C 1GDQA 1RRKA 4ZHAA 4Z6AH 8GCHG 2VVUA 4NIXA 3MOCA 3RP2A 1MD8A 3MTYA 3RC6A 3RXIA 3A85A 3RXSA 4JYUH 1P2NA 2ZHQH 1ZR0A 2FO9A 4UEHH 3MU0A 1XXFA 1G3BA 3SGQE 1PPHE 3RXMA 3TK9A 2ULLA 1P8VC 1A61H 3PMAB 4AGKA 2W7UA 4FUIA 5T6FA 1JIRA 3E8LA 5DK1A 1SGEE 1Z1IA 2PTCE 4NZLA 3T62A 2VINA 1BHXB 4NIVA 3SV7A 1CA0B 4JK5A 2ZQ2A 3F68H 3L33A 1GJ5H 1L1GA 4Y79A 7ESTE 3EA9A 2WUBA 4WH8A 1HRTH 3ZYDA 1FLEE 2O8WA 1MKXH 1BDAA 3SU5A 1DX5M 1UHBA 2OUAA 1YPMH 4WWYA 3EE0B 3LGWA 2QXHA 4IMZA 1A0HB 4OS6A 1IQGA 1TRYA 4ZMAH 1JIMA 2GMTB 1C1UH 2FOAA 1O3MA 2WPKS 1KXAA 4IN1A 1PYTC 3TU7H 1T31A 5A09A 2H2ZA 1AFQB 1AY6H 1EXFA 3KGPA 1LPKB 3V0XA 4Y10E 1V3XA 5JYIA 2A31A 4GCHG 2J94A 3MI4A 3E3TA 2GDEH 3E90B 1Z6EA 4ZKNU 1P2QA 1CGIE 1ZTJA 1GMCF 4K2YA 1SC8U 2BD2A 1YPGH 4ISHH 4JMYA 2W7SA 1TAWA 3VXFH 3SBKA 5IYTA 2FX6A 1QJ7B 4Q2KA 4Q7ZA 3EAJA 1UTMA 4FUGA 4ABDA 2CN0H 4WXIA 2FOGA 1LHGH 1FY3A 4JYTA 1DWEH 2XCNA 2ZGCA 1AVGH 1NESE 3D49H 4MPXA 3UQOA 1WSSH 4AGJA 3M61U 2YOLA 4YZUA 2A45B 1O3KA 1NRQH 1ORFA 1EP6A 1F0RA 4ESTE 2HWLB 2RA3A 1BRAA 5GPIB 2LPRA 3RXCA 1RD3B 2GZ8A 1BT7A 2NWNA 2JH5D 1HIAA 3HK6B 4R0IA 2H9EH 2WV4A 2UUFB 1G2LA 1V2PT 4Y8YA 4K5ZA 4O97A 3MO9A 3AASA 3BTHE 3NCLA 3SN8A 1W3CA 4ZHMU 1O2NA 1F7ZA 2VIOA 5JB8S 1UVPA 4LOYH 4CR5A 1FQ3A 2Y7ZA 1OOKB 1GI4A 3SZNA 1A1RA 4NCYA 4HFPB 2FOEA 3ZVGA 1LVYA 3L6PA 1UTOA 1P03A 1QY6A 1GHAF 3A7ZA 3KCGH 1WTHD 1KDQB 1H8DH 2UWPA 1JMOH 4LZ1H 1GMCG 2ZTYA 1YPHC 3BG4B 3TH2H 1HCGA 1H9LB 5EQSA 1C2DA 4B71A 1BOQA 1SQTA 1K2I1 1GJ7B 2BLOA 2BQ6B 1XX9A 1YLCA 2FOMB 2RA0A 2BDBA 4AORA 2AMPA 1SB1H 1ELVA 2QV1A 1V2VT 1EZUC 1V2QT 2CXVA 1ZJKA 3ZZ5A 2FI4E 1C1PA 3RMMH 2A7JA 3ZV8A 1C5LH 1O2ZA 4UE7H 3ESTA 1GBJA 1OWIA 1TIOA 2VWNA 3VEQB 2GCHF 2ILNA 3RXEA 3ZVCA 4TY6A 4UD9H 1FONA 3E0PB 3FANA 1A0JA 1DOJA 2K1QA 1BBRE 2P93A 1S82A 1Z8GA 1G37A 3ZZ6A 3Q3YA 4DIHH 1PQ8A 1AWHB 1D4PB 5JBTA 5HGGA 4XFQA 1GI2A 1IQKA 1C2EA 3NXPA 1GBBA 1IQNA 1V2UT 3U8RH 3GYMA 4TPYA 4NFFA 1D3PB 3ZZ8A 1GCTB 5C1UA 2THFB 4NA9H 5LH8A 1N8OC 1QBOA 3E16B 1H8IH 1GHAG 5EQRA 1KXCA 4Y0ZE 4Q80A 3UOUA 1ESAA 1GBEA 1MTNC 1KXDA 3G01A 4NA7A 2FDAA 1K1IA 3A7TA 2TGAA 5BPEA 2A4QA 1NRPH 3ZZDA 1EJNA 3RXVA 5JBBS 1VCPA 1F0TA 1S6FA 4Y7BA 4UFGH 1HNEE 1TGSZ 3PLKA 2DUCA 4Y7AA 1GPZA 3MO3A 3K2UA 3UUZA 1K9OE 1C5SA 4NGAH 2GX4A 1BMNH 3SUFA 3PWBA 4OGXA 2GCHG 4GHQA 4FVDA 4JYVH 2FOCA 3SV9A 1IAUA 3EBNA 1C5VA 4FUCA 4I8GA 1A5HA 5T3HA 2XCFA 1THRH 1SHHB 1ABIH 1PPFE 1MCVA 2VIQA 2UWOA 1D3QB 3QTOH 1EZQA 1SQOA 1B0EA 1HAXB 1OWHA 1FPCH 1P0SH 2FOBA 2Y5GA 4LZ4B 4RKOB 1QJ6B 5E0HA 4UFFH 3RLWH 1TOMH 4BTTB 4X8SH 5JDUB 2M5TA 4H42U 3ZZBA 3S7KB 2Z9GA 1BMLA 1SGFG 2A4RA 3R0FA 3KQCA 1OX1A 5E2PA 5F6MA 2BDCA 1T8OA 2A5KA 4I31A 1ABJH 1NN6A 1QBVH 2BXTH 3A87A 3D23A 2LNCA 1C9TA 3OTJE 3SU4A 1U6QA 1DLEA 2VIWA 5A8YA 5DJ7A 3ODFA 1D6WA 3P17H 1C2HA 1EASA 5GCHF 1HFDA 3LPRA 1TX7A 3ATWA 1SL3A 1HYLA 3LKWA 3BF6H 1EJMA 1CHOG 2H9HA 3I78A 1AMHA 1ANBA 1O5FH 3RXDA 1MQ6A 3EGKH 5GDSH 1ETTH 2AEIH 2QCYA 2Z9KA 3HKIB 3NKKA 3BN9A 4NFEA 1V2TT 3U9AH 4ABHA 2GT7A 3DA9B 1QCPA 2PV9B 4Q7YA 1C5ZB 2VB0A 5EOKA 2R9PA 1P2OA 3NK8A 3BTGE 4MDSA 4A92A 3W95A 2F9UA 4DIIH 2ZFFH 1A5IA 1A3EH 2GP9B 1NRNH 1GL1A 4X8VH 5EODA 4O3UA 2SNVA 2ZEBA 4Q7XA 1OP0A 3D65E 3E91A 4FUFA 2B0FA 2O8TA 1O5BB 7KMEH 1P9SA 5C5OA 1P2MA 5C1YA 4KP0A 2VIDA 1KXEA 1CT0E 2HNTF 3NWUA 4MTBA 2P3FH 2QAAA 2OC0A 4XBCA 4HGCA 1O3GA 3V7TA 2HALA 4YLQH 2ZCLP 3SJ9A 2ZFRH 1CHGA 3MMGA 4XBBA 3PTBA 3OSYA 3SV6A 1MKXK 1L2EA 1N8OB 1QTFA 2NU4E 1OKXA 3SW2B 3K6ZA 2SGQE 5GCHG 3MO6A 1SLWB 2QF3A 1AZZA 1C5YB 1W13U 3FZDA 1C2JA 3IWMA 1MTNB 2Q1JA 1Y3VA 1EJAA 2ZPRA 1LKAA 9ESTA 4INHA 4FUJA 3VB7A 2J2UA 4AB9A 2F9VA 2F9PA 1RFNA 1DWBH 4FU7A 1KTTB 1SSXA 5J4SA 1O5DH 3DFJA 3FP8E 1O2LA 1O39A 1TNLA 2BD5A 2C8WB 5C20A 1LHFH 2ZGHA 4K8YA 3S69A 5A8ZA 1FY4A 1O3CA 1O3AA 5EQQA 4X6NA 1BMMH 1NFUA 1O33A 1PQAA 1Q2WA 2FPZA 3RC4A 4B2BA 3IG6B 1C2KA 3RXPA 1RJXB 3B23B 1AVXA 3H5CB 3P8NA 2XC4A 1HAVA 2SGFE 3GICB 3MNSA 1ARBA 1OYQA 3GCNA 1S83A 3ODDA 3T26A 5FPSA 3V12A 5EU8A 3A7XA 1QR3E 3ATIA 2G00A 1O35A 2SGAA 2ZHWH 1TRNA 1SGTA 3HPTB 1H1BA 5FBEA 1GJBB 3BTME 4K1TA 3PWCA 3PB1E 1NT1A 2ZG0H 3LH3A 2PFEA 1C5NH 1W7GH 2BY9X 1AB9C 5LPRA 3MFJA 1P09A 2ZA5A 1J17T 5C5NA 3CP7A 1C1MA 4DW2U 2NU2E 3ZZ3A 4AFSA 1FDPA 2ZFTA 5HM2A 1MH0A 4WXVA 1L1NA 4ABGA 2BLVA 1ZSKA 2BY5X 4HZHA 1K1PA 4QT8C 4X6MA 2ANWA 3OYPA 2BYAX 4SGAE 1C5XB 1Z71A 1NFYA 1O38A 2VJ1A 1MUEB 3CS0A 4THNH 4ASHA 2FIRH 4X8TH 5EPNA 2P8OC 4ISOA 5FCRA 1ANCA 1J9CH 1QA0A 2O8MA 1E37B 2GZ9A 1TX6A 4ZXXH 1JBUH 5DGJA 1Y5BT 3ZYEA 1QNJA 3M5OA 1TALA 3TJUA 4Y6DA 2Z6BD 3TH4H 1C1OA 2KAIB 1WQVH 1CQQA 1UCYH 3M5MA 1MAXA 3Q00A 5GWZA 1TBRH 2F9BH 1NY22 4I32A 1O2IA 5C3NA 4X2VA 4JZDH 3TK5A 4B2CA 3RXOA 1NFXA 1P2KA 2BZAA 4XDEA 3SU6A 4BXWA 1NO9H 1Y3XA 2J4IA 1F0UA 2G51A 4B75A 1BB0B 2BTCE 3SORA 3ZVDA 4IN2A 1XVMA 4ISNA 2NU3E 4A5TS 1EAIA 4BAMB 2BLQA 3SJKA 2D8WA 1W11U 3BTQE 1XUIA 1ZMLA 3QX5H 5ETXA 1HGTH 4MVNA 2PTNA 1KSNA 2BVXH 1C1VH 4U2WA 3HGPA 4Z0KA 1XXDA 2BZ6H 1GHXH 2YNBA 1CSOE 1EZXC 1O37A 3ZVBA 1O2OA 4TWYA 3RXJA 1T8LA 1HAGE 1GGDC 4K69A 3SO3A 5LPFA 3EA7A 4BAOB 5FXLA 4JZFH 3SUDA 1EAXA 1H9HE 1O3FA 2XBXA 1IOEA 1O2KA 1TNKA 2PW8H 2FM2A 2C3SA 2IJOB 2AGGX 1DWCH 1C5WB 2GV6A 3FP6E 2HPQH 4INLA 1EATA 2BLWA 2FI5E 2G81E 4MNYA 1BHXF 1SFIA 2B9LA 2UWLA 2ZHFH 3SNEA 1SOZA 4X1PU 1EAWA 2PUXB 1AHTH 3HKJB 3LGVA 1O5EH 1UMAH 1WAYB 4GPGA 1TGTA 4UFEH 1GBMA 1YCPM 1TGBA 1DICA 2PKAB 1DXPA 3L3TA 3T29A 3LJOA 1EUFA 3A7YA 1KLIH 3QK1A 2BD4A 1XM1A 2D2DA 4WMEA 1HXFH 1K1OA 4XBDA 5DP6A 3HATH 5EW1H 3LDXH 1WTGH 5AFZH 4GUXA 4MNXA 4H6SB 1FY8E 1UK4A 1KXFA 2HRVA 1LMWB 1SFQB 5H4IB 2RDLA 4Y0YE 1TOCB 3DUXH 2C4FH 3TNSA 1GCTC 2F9OA 3LGYA 1CBWC 3OX7U 2WINI 4PROA 1BMAA 2BVSH 2ZU3A 1C2FA 2BM2A 2G55A 3NZIA 5CHAC 3AVZA 1Q31A 1C4Y2 2FTLE 1IQHA 1NFWA 1O36A 4MLFB 4I8LA 4OS4A 4A1TA 3RXKA 1BTHH 3A7WA 1TMUH 1AB9B 1P2JA 4ABAA 1OYTH 3A8BA 1DITH 1P9UA 3SNAA 1DANH 3UNSA 2ZECA 1QQ4A 3HK3B 4I33A 3PMBB 1EPTC 1Y3YA 3TJVA 3QUMP 1YCPH 1SR5C 2XNIA 3URCA 4YOGA 1SGQE 4BOHA 1JWTA 4U30A 6LPRA 1CA8B 3U8TH 1GI6A 1L1JA 4D9RA 2C8XB 2GVFA 1C5QA 1QFKH 1SGDE 1V6DA 2QC2A 4Y76A 3PM3A 2VWOA 3KQDA 3P8OA 1QQUA 5DO4H 1A3BH 1OSSA 1FJSA 1QB6A 3M36A 3P92A 2P8OB 2GV7A 1W0YH 1HLTH 1TNIA 1GBTA 2QIQA 5PTPA 2K7XA 4AFQA 2XBWA 1IQIA 2FMJA 1C2GA 3TGIE 4GHTA 2FODA 2SGEE 4ZKOU 1AIXH 2ZHDA 5DP8A 2XC0A 1TONA 3KN2A 2ANMH 1LHEH 2YNAA 3M35A 1AI8H 1J16A 1GHBF 1WQSA 1FNIA 1OWDA 3FAOA 1V2OT 1KDQA 2A2XH 1BUIA 4K8BA 1HV7A 1GVKB 3VXEH 3N7OA 1PPBH 1AUJA 1SGRE 1XKAC 1EB1H 4INKA 2BQ7B 4U01A 3A86A 4CRGA 2D26C 1O3BA 3FZZA 3P70B 3TJOA 1BTXA 3NPSA 3M5NA 4U32A 4LK4A 1PYTD 2TGTA 1BJVA 2ZDVH 2PR3A 3MH5A 2FZZA 2ALVA 3SHCH 3S7HB 4KGAA 1SGPE 5E0JA 3LC5A 3SJIA 5A0CA 4X0WU 1THPB 1ZMJA 2Y81A 1ZHRA 3DHKH 3KQEA 4IGDA 1SBWA 1FY5A 1HAHH 4ZH8A 1GGDB 5G4BA 3SJ8A 1VITF 2SFAA 4CHAB 1PFXC 4AZ2B 1N6YA 2FLRH 1NRRH 2R2WU 3RM2H 4A7IB 1DWDH 2ZFSA 2CF8H 3B9FH 5I46H 2H6MA 1UVUH 1TGNA 4XSKU 1AWFH 1C5RA 1AU8A 3R3GB 2F83A 1SGIB 4K3JA 1HUTH 3A89A 1UJ1A 4DGJA 4TPIZ 1HJ8A 1GBHA 1O3NA 5FBIA 3KQBA 2AFQB 3DD2H 4K1EA 3TH3H 1IQMA 3W94A 2OBOA 1T4VH 2OTVA