4YLUA

X-ray structure of mers-cov nsp5 protease bound with a non-covalent inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
304
structure length
304
Chain Sequence
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF1a protein
publication title Ligand-induced Dimerization of Middle East Respiratory Syndrome (MERS) Coronavirus nsp5 Protease (3CLpro): IMPLICATIONS FOR nsp5 REGULATION AND THE DEVELOPMENT OF ANTIVIRALS.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 81
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yluA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yluA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yluA02
5CMXH 1EZSC 1XX9A 4FXGH 4LOYH 2QAAA 2A7HA 3S7KB 1H9IE 4ISOA 3LOXA 1AI8H 1YGCH 3KCGH 1BA8B 1FV9A 1HB0B 1MTUA 1O3PB 4THNH 3ZZ9A 1H8DH 2OBOA 1DWEH 3DFJA 4ESTE 2SGAA 5FPYA 1PPBH 1MKWH 2BY7X 6CHAC 1EKBB 2O8WA 2ZP0H 5C2ZA 1EP6A 4FU9A 1P3CA 3GOVB 1P2IA 4DJZB 3HK3B 2ZWLH 3SNEA 1ZGVA 3DUXH 2OC7A 2NWNA 3UNSA 3RXJA 2J92A 3UOPA 5JPMH 2WUCA 4WWYA 1A5GH 3E6PH 3ZZ5A 2FS9A 2VWOA 2O9QA 5E2OA 1F0RA 2BDHA 1AVGH 4XBCA 3RXEA 4ZXXH 1DWBH 2XCNA 2ANYA 1UTKA 2ZKSA 4NIVA 2ZDVH 1SSXA 2ODYB 4GSOA 3GCHB 4R8TB 2XW9A 2Y82A 5AFYH 4B71A 1LVYA 1ZOMA 1TX6A 1AGJA 3GDVA 1E37B 3QX5H 1GI2A 5K0HA 4K8YA 1B5GH 1O3LA 1C5XB 1TMTH 3ZZ3A 1MBQA 3DHKH 3N7OA 1HIAA 4YZUA 3TGIE 1NRPH 4Q7ZA 2QV1A 3L6PA 4AZ2B 2CHAB 3GICB 1PPHE 3KNXA 1FXYA 1E38B 4CH8B 4NSYA 1AN1E 2AIQA 3TK5A 4WH8A 1GVLA 4MVNA 5C1YA 1GJ8B 1L2EA 2IPHA 1GJ6A 2Y7ZA 4X6OA 2ZQ1A 1CBWB 3HKIB 5HXFA 3SJIA 1P0SH 2ZF0H 2JH6D 3U8RH 3BIVH 1FY3A 2W26A 1ANDA 2EI6A 4LK4A 5HM9A 1GCTC 4ZROA 1MTWA 7LPRA 5EODA 4ABJA 2H5CA 1C1UH 4HZHA 5JBTA 4HTCH 3TK6A 3SGBE 1OSSA 4GAWA 2ZC9H 3EBNA 4NG9H 2Y80A 2ZGJA 1XKAC 4RSPA 8GCHG 1V2JT 4E06H 3LU9B 1H9LB 4YOIA 1RTLA 1YPHE 5DJ7A 4XDEA 1O3CA 4KELA 3SUFA 2BD7A 1C5YB 1FAKH 1WU1A 1D6WA 1AKSB 1PJPA 8LPRA 3OY5U 4X2XA 2LIZA 3S69A 1IQGA 2ZFFH 1GDQA 1ESBA 2BZAA 1GGDB 2RCEA 2A4RA 1T4UH 3MNCA 1G3DA 3UOUA 1JIRA 1O2NA 1P3EA 2M5TA 3RXQA 1KTTB 2O8LA 4BAMB 1MBMA 1ANCA 3QTOH 3GCTG 2HRVA 3ZVAA 4ABEA 1GJDB 1O3GA 1GBCA 1AQ7A 3SJOA 2ZGCA 1MU6B 4ABBA 2Y5FA 1UO6A 2UWPA 1C4U2 1TGTA 2KAIB 1YLCA 3UWIA 1F7ZA 1Z1IA 1BMLA 1G2MA 5DPAA 1O3OA 3QGNB 1MAYA 1BQYA 2PHBA 1GWAA 2QXJA 1NZQH 3M7TA 5I46H 3BTQE 4Y10E 3Q77A 2PLXA 1O2LA 1V2PT 2WUBA 2FTMA 2UWOA 3RMOH 1CHOG 3SHCH 1HBTH 1ABJH 4DIHH 1BBRE 1TPOA 2P8OB 2FOBA 4U01A 5J4SA 1V2LT 2XBVA 4IMQA 4AORA 2ZDMA 4SGBE 4ASHA 3ATKA 2C8ZB 2OP9A 1O3MA 4A1XA 5C5NA 1O2ZA 3MH7A 2XTTB 1GI1A 5AVDA 2AMDA 3UREA 1BTHH 4RKJB 5T6GA 1UK2A 1DPOA 1GJ7B 2Z9LA 1GBKA 4KTCA 1GBLA 3MU8A 1BT7A 1CGJE 3SJ8A 5J4QA 1IQNA 1CVWH 1W13U 2SNVA 3U69H 1GBAA 1GBBA 4CBNA 2UWLA 2Q6GA 3IITA 1B0FA 1DICA 3PTBA 1BTZA 1WTHD 3BTWE 2XWBI 1GVZA 2FIRH 1C1VH 2J95A 4YM9A 5AFZH 4OS2A 4NGAH 1QIXB 2ESTE 4CH2B 1HNEE 2K7XA 2NU1E 1TNIA 4Y76A 1HAGE 2Z3CA 2WYJA 2YNAA 1P02A 1S0QA 4WH6A 1UVUH 2FMJA 1KXBA 2A45B 3IWMA 1A5IA 1EZXC 4ZMAH 3SNAA 2NU0E 3W94A 2OCVB 1SLXB 3C27B 4JZ1A 5DO4H 1NTPA 1O2HA 3D62A 4WMEA 5EXMA 4XBBA 2TPIZ 3VGCB 5JBAS 1SHHB 1E0FD 3NKKA 5F8ZA 5IDKA 4RKOB 1KLIH 3SZNA 1QA0A 5DKMA 4Y79A 1LKAA 4NCYA 4NFFA 1VCPA 3ZZDA 5TJXA 3GCHC 2G81E 3ZZ7A 3KHVA 2BD9A 1BITA 1AKSA 2ULLA 3BTME 1AZ8A 3KQBA 1HXEH 4K69A 1A5HA 4INKA 1K28D 3Q3KA 3VB5A 4FUGA 4YT6H 5DGJA 1J14A 1DWDH 1SOZA 5EGMA 2ASUB 1MCTA 2C8YB 1FI8A 2WINI 3O8DA 3ZZ4A 1Y5AT 1Z8JB 2HWLB 2FOAA 1C1SA 1HAIH 3UFAA 1FNIA 4MNVA 1QQ4A 1JMOH 5FHTA 2ZFPH 1XVMA 2YOLA 1QL8A 1O2XA 1G3EA 1ZMLA 2THFB 4YTAA 3M7QA 4ZKRU 2CHAC 3SBKA 1DX5M 2RG3A 4IGDA 5E0GA 2YNBA 3SNBA 4FUCA 4MPUA 3O8CA 1ORFA 1S81A 1RD3B 1XUFA 5K7RA 1CBWC 1G9IE 3OX7U 2ZGHA 4JZEH 4D9RA 5GWZA 1LDTT 3MTYA 4GUXA 3D49H 1Y3XA 4JK6A 1MZAA 2AGIX 2FOMB 2O8UA 3RXCA 5C20A 4MQAA 4F49A 2Y6TA 3K65B 3U8TH 3MOCA 2BZ6H 9ESTA 1GJAB 1L1GA 4O97A 2HGTH 1TNKA 2BLWA 3F1SB 4ZH8A 4H6SB 3SU2A 1LPGB 1QR3E 1GI3A 3RM0H 4ZKOU 2F9PA 2Z7FE 1YPHC 1V2ST 1CSOE 1TNGA 1Y8TA 4DIIH 1MMJN 5IYTA 2J4IA 1KXFA 4WVPE 2VIQA 8GCHF 2RA3A 2FXRA 1AVXA 2QF0A 4OS4A 5HM2A 1ABIH 4Y7AA 1JBUH 2F9BH 3TH4H 3RC6A 2FODA 1TALA 2GZ9A 3A82A 4JYUH 1PPCE 1GGDC 4A1VA 1C2EA 3OTJE 3OY6U 1LHEH 3MNXA 3C1KA 2QN5T 1MTVA 3GCTF 4WMFA 1UCYH 3LIWA 2CJIA 3QK1A 1W10U 1QRWA 2Z9IA 4UONA 2TGPZ 4OGXA 1P03A 3P17H 5ESTE 3M7UA 1AUTC 2XBYA 1LHFH 4NIXA 1V2RT 4ZXYH 1AUJA 3ZZ6A 1DLEA 3KEEA 1ESTA 2BY9X 2J9NA 1ZTKA 1BDAA 5FX6A 4MNWA 1MZDA 3T28A 2BVRH 3RXSA 3E8LA 2P8OC 1S6HA 2JETB 1WQSA 4M7GA 1TE0A 4CRFA 3RXHA 3FP6E 7KMEH 1TIOA 2C8WB 2H9EH 3UQOA 1DITH 2A31A 1GDUA 3RXUA 1ELCA 1O2TA 3MO6A 1OP0A 2HNTE 5EQQA 3URCA 3EA9A 1BMNH 4CR5A 5FXLA 3ZV9A 3UPEA 3UR9A 3VB4A 1HJAB 4WF8A 1S83A 4FU8A 3QLPH 1O37A 3FZZA 4B2CA 2OTVA 3ZV8A 1BRCE 4FUBA 1NFYA 5FX5A 4AGKA 4X8VH 1ZSJA 3SOSA 4AX9H 1F2SE 3AAUA 3A85A 2Z94A 3ESTA 5AF9H 1BOQA 1K1IA 1UTJA 1S84A 3V3MA 2FOCA 2FESH 3A7TA 4X6NA 3RXOA 3OSYA 4YT7H 1RFNA 1C9TA 4ISLA 1AVWA 2XYAA 1GI8B 1W3CA 1HXFH 4D9QA 1YPKH 4KGAA 2PGBB 4U30A 2VINA 3QO6A 3VGCC 4E7NA 2OINA 4XSKU 4Q2KA 1O2KA 1TNHA 1PPFE 2VIPA 1Z6EA 1ETRH 3MNSA 1C5ZB 1TNLA 3E0PB 1W11U 2QA9E 5EPYA 3F9HA 3RLYH 1H4WA 2A4QA 1C5RA 1ARBA 4H42U 2VIVA 1WUNH 3E16B 1BTYA 1DT2A 1QJ7B 1MCVA 2C90B 3QZQA 2AIPA 1VCQA 1J9CH 1GBIA 1ZYOA 2QCYA 1INCA 4ZKNU 3H7TA 1C5MD 2B5TB 1L1JA 5DP9A 1XM1A 1AIXH 2TBSA 4ISIH 1RTKA 2XC5A 5H4IB 3MU5A 3RXFA 2HOBA 1QB1A 1TWXB 1IQKA 1EASA 1O2VA 1FUJA 1GVKB 1SGQE 2BD4A 2BQWB 1KXEA 5F6MA 1HIAB 4I8LA 1RS0A 1ZHRA 1UJ1A 5A0BA 1KDQA 1DY9A 2ZHEH 4ZHMU 3M36A 1N1LA 3RXMA 1O2YA 1TAWA 2BDGA 1YKTA 1KIGH 3BG4B 1Y5UT 2XC4A 3ZZBA 1O2SA 1C2DA 1QCPA 1W7XH 3KQEA 3MU0A 1C4V2 2FYRA 1MKWK 2ZHQH 1QTFA 1QA7A 5JBBS 3TK9A 3SW2B 3NCLA 1MQ6A 4B75A 1MTNB 5T3HA 2XNIA 2H1UA 1AWHB 4O3UA 3LGYA 2PKAB 1CGHA 3RU4E 1MTSA 1XUHA 4WY3A 2SGEE 4NFEA 4BAKB 2BX3A 1NRSH 1DWCH 2ZIQH 1JXPA 3IG6B 1PQ8A 1Z7KA 4B76A 4NA8A 1IQIA 2A4OA 5FPSA 1BHXF 3P8FA 1GBHA 4IN2A 5EQRA 4A6LA 1FZZA 1YPMH 4FVDA 1V2OT 4ZAEA 3UY9A 4X2WA 2HPQH 1ZLRA 2FI3E 3ATWA 3VPKA 2P16A 1GBEA 1WOFA 2A7JA 3P92A 4Y7BA 3RXAA 1SI5H 1O2IA 3A81A 3ZVFA 2TGTA 1C9PA 3MYWA 1XUGA 1K1NA 4QT8C 1MAXA 3T62A 1UCYE 4ABFA 1Y5BT 2GP9B 1FLEE 4KKDA 1O3HA 3V12A 1F0TA 2VWMA 3TIUA 3S0NA 3HATH 2A4GA 3Q76A 1AY6H 1YF4A 4BXSA 1P2OA 1C1TA 4MDSA 2VIOA 2ZFSA 5F8TA 5GCHG 1K1OA 2BTCE 3ENSB 5E0JA 1P57B 1LTOA 3RMNH 2ZGBH 1ID5H 3D65E 1WSSH 1DE7H 3F9FA 2IN2A 1LPKB 1P12E 2BD3A 2DE8A 2W3KA 4AFSA 4MG3A 1EP5A 2ZECA 1C5QA 1A3BH 1PPZA 1WCZA 1NFUA 1C4Y2 4CRAA 1ELAA 2PSYA 2I6QA 3SNCA 1A46H 4AG2A 2AEIH 4UEHH 1ELGA 1UK4A 2JETC 2LNCA 2HNTC 2F9NA 2FWWA 1O2WA 1K22H 3QN7A 3P70B 1DXPA 1QRXA 2STBE 2CMYA 4KP0A 4ZUHA 1G2LA 3EDXB 3V0XA 4B73A 2ANMH 2R0LA 2ZU5A 1GI7B 1KLTA 5GDSH 1ELFA 1HJAC 3UWJH 3BTDE 1HJ9A 2ALVA 4X1RU 1GHBG 3Q3XA 2SNWA 3VB7A 2Y5GA 4X2YA 7GCHG 3MH5A 1EB2A 1Q3XA 1XUIA 1OWJA 1NO9H 1L4ZA 1OWDA 1SGIB 3P95A 5GJ4B 3MU4A 4FUDA 1BTWA 3B8JA 4Q7XA 1HPGA 1C2JA 2GCTB 4K3JA 1GMDG 3BTKE 3BEFB 3GY6A 4I8KA 3SI3H 3K6YA 1O36A 1ZTJA 2ZU1A 3LGUA 3W95A 2W7SA 2FI4E 1E34B 1ANBA 1FY4A 4SGAE 2UUJB 3M37A 2FPZA 1GDNA 1J17T 1DUAA 5FAHA 5JDUB 1P2NA 2EC9H 1BTXA 2PKAA 3UUZA 1TFXA 3NK8A 1P06A 1AFQB 2UUFB 1O5AB 1ZSLA 3FP8E 2OD3B 4MNXA 1O3DA 5HYOA 3HGNA 2D1JA 1CT0E 3SV8A 1UVTH 3ODDA 1SB1H 3BTTE 3SJ9A 3PMHB 3ZZCA 2NU3E 5A2MH 1WQVH 4FUEA 2HPPH 3T25A 1T4VH 1FJSA 1OPHB 5EG4A 1EQ9A 1O3JA 4Z0KA 2QC2A 4WXIA 1ZPBA 3BIUH 1RTFB 2BY6X 1NRRH 2ZDLA 2VIWA 3SN8A 5EU8A 1NFWA 1DOJA 1GHXH 1O32A 2PUQH 1IAUA 1U6QA 2GGVB 1C2LA 3TJVA 3PMAB 2HALA 1CA0B 1P11E 1GCDA 2J94A 1C2IA 1GMHF 1LVMA 4UE7H 1PYTC 2C93B 1SPJA 1FMGA 1BRBE 2PGQB 2GT8A 3BSQA 4AFQA 2R2MB 3NUMA 1O2MA 4LZ1H 2QYIA 1FY5A 2PFEA 1ESAA 2F83A 3MU1A 4JK5A 3BG4C 5DP8A 2ZTXA 4X8SH 1F0UA 3PMJA 2BLVA 1C1NA 3ZVGA 2XC0A 2ZHWH 1Z71A 1GJBB 1UVOA 4Y0ZE 1MTNC 3A8AA 1TOMH 4GHTA 2GD4B 5EXLA 1QURH 4DT7B 3CS0A 4K1SA 2OC8A 3RP2A 2P3FH 1TLDA 1AE5A 3LH1A 1NU9A 3A7WA 3RXDA 1GHZA 1M9UA 4ABDA 1O5GH 1P05A 1DLKB 3SO3A 5A0AE 2GDDA 1YM0A 3BV9B 1NC6A 1GBTA 4AGJA 4FVBA 1FY8E 3RXIA 2V3HH 1JRSA 4ABGA 4I31A 5A8XA 2B8OH 1TGBA 1CHGA 2J34A 4UFGH 1HDTH 3M5MA 2Y5HA 3S9CA 5FCRA 1AO5A 4DURA 1C5SA 4U2WA 1JIMA 1XUJA 1QRZA 4JCNA 5A8YA 2LPRA 4VGCB 2FLBH 3A7XA 5GCHF 3HKJB 5BPEA 1P2JA 2I6SA 2G4TA 3OU0A 1LVBA 1ELVA 3KGPA 1Y3UA 3DD2H 2DE9A 3TITA 3LH3A 1O31A 1L0ZA 4MPVA 3KIDU 2GV6A 1GHWH 2ZI2H 4MPXA 2BD5A 5DP7A 3V7TA 1YCPM 5DP3A 3M3SA 3NPSA 5EPNA 2ZPRA 4CRDA 4AB9A 2SGPE 5LH8A 2WPLS 4D7FA 1SGFG 3TGJE 3A7ZA 1O33A 3BTGE 2BX4A 5GPIB 5A0CA 2Y81A 1QL9A 4Z6AH 3LDXH 1O30A 4TPYA 1GHBF 5FBIA 4IC6A 1TBQH 1UTMA 6GCHG 2AS9A 1QNJA 3ZYDA 7GCHF 1G37A 3A84A 1W7GH 3GCNA 1NPMA 3T5FH 3RLWH 1EX3A 4YESB 1W8BH 1CT4E 1BUIA 1HFDA 1N6YA 1TBRH 1FPCH 2GCTC 1LMWB 5DP6A 1GMDF 1SGDE 2PUXB 4AYVB 1IQFA 3DA9B 1UCYK 3EGKH 2W5EA 1TGNA 3LGIA 1AWFH 1Z6JH 8KME2 1HLTH 4MLFB 1VZQH 3SV6A 3TNSA 1AFQC 3GDSA 1HCGA 5CHAB 1C2FA 1TMBH 1EJNA 1PQ5A 1A7SA 3SNDA 1VITG 1AB9B 1K9OE 1O5DH 3T26A 1C2KA 1AZZA 1SGCA 1RXPA 3ATLA 4JZIA 1CT2E 1O2OA 2BDCA 4JZFH 4CBOA 4D7GA 2FOEA 3SU0A 4INHA 1O2RA 2K1QA 4JZDH 1VJ9U 4DGJA 1H1BA 1TX7A 2ALPA 1CO7E 1AD8H 1TPPA 2FLRH 4OS7A 2FX6A 4DW2U 1HV7A 2G5NA 1KSNA 1ZRBA 3CENA 1V6DA 1TOCB 3PB1E 4OGYA 4Y11E 3U1IB 3O8RA 3RXLA 4IBLH 1CA0C 1UTLM 1BZXE 3SUEA 4D76A 1SQTA 3R0FA 4XFQA 2GMTB 1ETSH 1E35B 3M61U 2ZCLP 4NIYA 5FPTA 3UQVA 1WTGH 3SI4H 1IOEA 3AASA 1ELBA 5LPFA 3GDUA 2GDEH 2R3UA 1FN8A 1O3NA 4BXWA 1KLJH 1DS2E 1GBFA 1P10A 1S85A 3RXKA 1L1NA 2A5IA 3M35A 1OYQA 2ZDAH 4CREA 5AHGH 1CQQA 4IS5A 1N8OB 5FBEA 1KDQB 5A8ZA 3P8NA 2WPKS 4JYVH 2XBXA 4ISHH 4NWKA 3R3GB 1UTPA 2GKVE 1FIZA 1TABE 2CV3A 3VFEA 1SLVB 3LC3A 3PO1B 1TRYA 2BMGB 4UFEH 2FX4A 1ZPCA 1QFKH 5E2PA 4A7IB 4TWYA 5I25A 2ZPQA 3RM2H 1V2TT 4JYTA 2AMQA 3M5OA 4GHQA 3SUDA 3I78A 1V3XA 1HAPH 3M3TA 1SHYA 1Q31A 2AMPA 1T7CA 1YP9A 3MNBA 1D3PB 4XBDA 5DG6A 3SGQE 2CXVA 1VJAU 4B2AA 3OYPA 5EXNA 4CHAB 3VEQB 2QY0B 2RDLA 5CE1A 5L30H 2C3SA 2TRMA 1THRH 2VVUA 1T8OA 4OS5A 1Z8IB 1OKXA 3ITIA 1GI9B 5FCKA 1FONA 1D9IA 4TYDA 2B7DH 3NXPA 1GMCG 4OS6A 2BVXH 1EPTB 4WMDA 2P94A 2BD8A 3RXVA 1VR1H 3SHAH 1KXDA 1RIWB 2G52A 3PWBA 4VGCC 1YPJH 1GI0A 1J8AA 1GG6B 2ANWA 4Q80A 1D4PB 2AERH 2NU2E 1T8LA 1ZHMA 1BHXB 2GZ8A 1BIOA 3QUMP 3TJUA 3UR6A 1T31A 2P3UB 3RMLH 1G30B 4RN6A 1E36B 1GPZA 2PR3A 2OC1A 1O5CB 1SQOA 1A3EH 2FO9A 1IHSH 1O3AA 4NSVA 5C1XA 3VB3A 1CU1A 3LKWA 1NROH 3PLKA 5EQSA 2H5DA 1FY1A 2BDBA 1YC0A 2ZFRH 1P8VC 2Z3DA 1OP8A 2QGRA 2CGAA 1EAXA 3E90B 1GL1A 1MQ5A 3RC5A 3RU4T 2A32A 4TY6A 1ARCA 4Y0YE 4K60A 4TPIZ 1QL7A 2ANKH 1EZQA 2UUKB 2ZTYA 5T6FA 1MU8B 2BOKA 1LPZB 2QXHA 2QXGA 1ZTLA 1O5FH 1EZUC 1GMHG 1UTNA 2BB4A 3T29A 6GCHF 3E1XB 3TPIZ 3UTUH 2BQ6B 1OXGA 2EI8A 2BLOA 3FVFB 3FP7E 1HAXB 1GI6A 3SV9A 1MKXH 4X8UH 1QBNA 1P2KA 2P59A 5T6DA 4A5TS 4FUJA 3EYDA 2P93A 1PYTD 2CF9H 2VH6A 1T8NA 3A8CA 2FP7B 4PROA 2HNTF 3LC5A 2J2UA 2ZZUH 3U98H 1SGEE 2ZU4A 1Y3VA 4X1PU 1SLUB 3F9EA 4GVUA 1SGTA 4JMYA 2Z9GA 1QGFA 1YLDA 2EI7A 3LJOA 5CHAC 2OXSA 5B6OA 3MH4A 4K1TA 1QB9A 2Z9KA 2ILNA 1TB6H 1AB9C 3URDA 1TMUH 1VITF 5A09A 1JWTA 1TPSA 4CR9A 1P9SA 2PKSB 1JOUB 3ZZAA 3RU4D 1WV7H 2ZQ2A 1FIWA 5GXPA 1A0JA 1LKBA 2AFQB 4YLUA 3I29A 4I8GA 3B23B 1EOJA 5ETXA 2VIDA 2A2QH 1WYKA 4BTUB 2Y7XA 1CE5A 2A1DB 5SGAE 3T27A 2D2DA 1YCPH 4NIWA 1QHRB 2GX4A 2OQ5A 1NFXA 2SGQE 4ISNA 4GLYA 1ZMJA 2BYAX 1YYY1 3SGAE 1EJAA 1XUKA 1K1MA 3SUGA 1VCWA 2GMTC 1EPTA 5JB8S 1GJ5H 4X1NU 3K2UA 3E3TA 2DUCA 3GCOA 5LPRA 3SQHE 1RRKA 1OYTH 3ZZ8A 3GYMA 1BMMH 2SGDE 2ZO3H 2ODPA 2BY5X 1AFEH 3EE0B 3E0NB 2VJ1A 4A92A 5TCAA 3O8BA 4H4FA 1TQ7B 1PFXC 1ZR0A 2D26C 1LHCH 4BANB 1N8OC 4YOGA 3AW1A 1DSTA 4AYYB 3KL6A 4GCHG 3GY3A 2SGFE 3PLPA 3S7HB 4X2VA 3PO1C 1TQ0B 3QWCH 4Y71A 1TRNA 2OUAA 1X7AC 1O2UA 1C1QA 3RXGA 1C5LH 2V35A 5L2ZH 3F6UH 1EXFA 1YPEH 2FS8A 1AE8H 4Y8XA 3BTEE 1F5LA 3JZ1B 4XE4A 2V0BA 1UMAH 1QB6A 1SFQB 4R0IA 2Z6BD 2WPMS 2RA0A 1BJUA 3E91A 3MHWU 2FOHA 1QY6A 4ZKSU 4I8HA 1DDJA 1TGCA 4CHAC 4UFFH 1THPB 2SFAA 1C5OH 3PMBB 3U9AH 1AMHA 1ZZZA 2BDIA 1SMFE 5JBCS 4UDWH 5GIBA 2FDAA 3PROA 4MTBA 1UK3A 4FUHA 1HJ8A 3QGJA 1C5WB 4BAHB 1A0HB 1LQEA 1ZHPA 4BTIB 1NT1A 2F9OA 1GMCF 3ZVDA 1KXCA 4TWWA 1EPTC 2IJOB 1TNJA 2H9HA 1OWKA 1A1RA 1RIWC 4XOJA 1GG6C 2AGGX 2H9TH 1Y3YA 1UVSH 1C1WH 3SU3A 3BEUA 2ZNKH 3K9XB 1P9UA 1F5RA 1Y59T 4HI3A 3L3TA 3KF2A 5C3NA 5E8EH 4AFZA 6LPRA 1O3EA 1QBOA 4AOQA 3F68H 1THSH 1O38A 2ZU3A 1WBGB 1Q2WA 2ZCKP 5PTPA 1P01A 3FAOA 2WV4A 1ELTA 2JH5D 4FU7A 1SQAA 2A7CA 1QJ1B 1FAXA 1ELEE 2A2XH 4O03A 2C8XB 2IOTA 2GCHG 4K2YA 1V2KT 2FTLE 2V3OH 5EOKA 1FN6A 1K2I1 4WJG2 5F03A 1GBMA 4AG1A 1LHDH 3KQDA 3ZVCA 3HK6B 1KY9A 1V2WT 4LXBH 4HFPB 1GHVH 1V2QT 2Q6FA 3V13A 3RC4A 1V2NT 3MO9A 1ZSKA 4DG4A 1DY8A 2OQUA 5EW1H 3RUOA 3UIRA 4BAQB 1S0RA 1IQHA 2ZDKA 1SGPE 2FYQA 3K6ZA 3PM3A 1C1MA 4X6PA 1ETTH 1EOLA 1TA2A 1LHGH 1LCYA 2JH0D 2VB0A 3P6ZB 1JRTA 1LO6A 1Y3WA 2PTCE 1ZGIA 2QXIA 4OS1A 3STJA 1LVOA 4Y8ZA 1SOTA 1HAVB 4I7YH 4IW4E 2BLQA 2R9PA 1G32B 3GYLB 2Z9JA 4X6MA 5HMAA 1ZJDA 4O3TA 5BRRE 1C2MA 3A7VA 4Q7YA 4AN7A 2G4UA 1K21H 5C67A 2VGCB 2PKSC 2BXTH 1W2KH 1B0EA 1C1OA 1J16A 1NRQH 3LPRA 3MH6A 3I77A 1GHAG 1SGRE 5HGGA 3ELAH 4YOJA 3ATIA 4GPGA 1HUTH 3B9FH 4I8JA 3GY8A 2VVVA 4KTSA 3ZVBA 1CA8B 5F8XA 3EQ0H 3A7YA 1P04A 1BTUA 4IMZA 1NM6A 1EUFA 3A89A 4DCDA 2ZU2A 1UVPA 2QF3A 1HRTH 1BMAA 3QZRA 3LT3A 3T2NA 1EAIA 1OP2A 1AHTH 3P8GA 5DK1A 1H8IH 3MFJA 3KQCA 1VGCB 4BOHA 1C5VA 4X1QU 4BAOB 3NWUA 1S6FA 1C1RA 1D3TB 1O2QA 3ATMA 1HGTH 2A0QB 1A0LA 1KTSB 1XVOA 3P8OA 1O2GH 3A8DA 2BY8X 2PW8H 2ZCHP 1N6XA 2BD2A 4GCHF 1BCUH 3H5CB 2W7UA 1RJXB 4K5ZA 3QDZB 1VITH 2R2WU 3BTHE 1SG8B 2ZFTA 3GY2A 1GJ4H 4H6TA 1W0YH 1AU8A 1G3CA 2FOGA 2A5AA 3LGVA 4AFUA 2ZGXH 1NY22 2ZDNA 5LPEA 1NN6A 1GI5A 1O3FA 1Z1JA 1FQ3A 1NRNH 4BTTB 3CS7A 1DXWA 2FZZA 2HLCA 3RXTA 4B1TA 5C5OA 1PPEE 1IQLA 4UD9H 2QIQA 3EA7A 1OS8A 5E0HA 5ESBA 4YO9A 1F92A 2XCFA 1TPAE 2TGAA 3AVZA 4YLQH 1S82A 1H9HE 1O39A 3Q3YA 4IN1A 3TJOA 2WPHS 1KYNA 1OOKB 3PTNA 1IQJA 1L4DA 1YPGH 2R0KA 1EJMA 3M5NA 1YBWA 3RDZA 5G4BA 1OX1A 1HAZB 1HAVA 2TIOA 4E05H 2VNTA 1O5EH 3M3VA 4X0WU 3ZYEA 2G5VA 2W3IA 4I33A 1LQDB 2XBWA 2AH4X 1T8MA 1P2MA 2KAIA 3GY5A 2D8WA 2UUYA 1SR5C 9LPRA 1BJVA 1UHBB 2V6NA 1O35A 3TLOA 3KN2A 3BG8A 1EB1H 5EW2H 3G01A 2H2ZA 3PWCA 1S5SA 3A87A 1HAOH 4F4OC 2BDYA 3A8BA 1J15A 3SORA 3BTFE 2ZHFH 4O9VA 4UFDH 1TBZH 4DOQA 2GCHF 2P95A 1FDPA 4MPWA 3RXRA 2ZPSA 1W12U 1DM4B 1TYNA 1D6RA 1GBJA 2VWNA 3RXPA 1PQAA 1DFPA 1OWHA 1O0DH 3BN9A 1SVPA 2ODQA 4ZHAA 3VXFH 1DUEA 2XRCA 1YPLH 2BDAA 1NESE 2G00A 1ZJKA 2PWXA 3TNTA 1K1JA 1ELDE 3SJKA 5JB9S 1BRAA 3EAJA 2H6MA 4CRGA 3F9GA 4BNRA 1TRMA 2R3YA 1O2PA 2AYWA 3FANA 2FEQH 2WYGA 2GV7A 5L6NH 4Y8YA 3S9AA 5ABWA 3GY7A 3SU1A 3HGPA 1SLWB 1A2CH 1GHYH 3A88A 2OLGA 4NWLA 4E7RG 3TH3H 1OWIA 1Z8RA 3SU4A 1SC8U 2JKHA 1DANH 1C5UA 3AW0A 2VWLA 2GTBA 1W0ZU 3WY8A 1K1PA 5DP4A 1MH0A 1A61H 2VGCC 3CP7A 6CHAB 3D23A 1GL0E 2O8MA 1O3KA 1F5KU 3PV4A 1GHAF 3BF6H 2WPIS 4HGCA 1O2JA 1GI4A 3BEIB 1P2QA 1TONA 1MD8A 2OC0A 7ESTE 3M5LA 2F91A 3Q00A 4D8NA 1K1LA 3HPTB 1QBVH 3MI4A 1CHOF 1HAYB 2F3CE 3RXBA 3GY4A 1IQMA 2ZA5A 2CF8H 1C5TA 1SGNE 2PTNA 2G51A 3A86A 4A1TA 2ZTZA 1BRUP 2FI5E 4U32A 1O34A 1T32A 2WV5A 2GVFA 4I32A 1F0SA 2EA3A 1C2HA 3ZVEA 1P09A 3VXEH 3MMGA 3PYHA 3UNRA 3LJJA 1SL3A 2GZ7A 2A5KA 2WPJS 3A80A 1D3QB 1VGCC 2FOFA 4X1SU 1SFIA 1GJ9B 1O3BA 4INLA 8ESTE 1C5PA 4K8BA 1QJ6B 3PLBA 1MKXK 4CRCA 2F9VA 1UTOA 4ABIA 3STIA 1UHBA 2F9UA 2VU8E 2G55A 4NZQA 1PQ7A 4AB8A 2BM2A 3FFGA 1EAWA 5LGOA 1ZRKA 1GBDA 2EEKA 1ACBE 1NU7B 4KTUA 4MNYA 1D3DB 3DT0H 4LZ4B 3SQEE 5JYIA 2C4FH 3JZ2B 1XXDA 3H7OA 2Z3EA 4B74A 2ZEBA 1Z8GA 1EAUA 2G8TA 2ZHDA 1V2MT 2B9LA 2B0FA 1G3BA 1HYLA 1C2GA 3LONA 4Y6DA 3UNQA 1UTQA 4IC5A 2BHGA 1GCTB 4X8TH 1OWEA 3RMMH 4NA7A 4K1EA 3TJNA 1NS3A 2VVCA 2XXLA 1IQEA 2BVSH 1TX8A 2STAE 1MD7A 1DVAH 1QQUA 1YCPK 1MUEB 1O5BB 6ESTA 4DVAU 4FUIA 1HAHH 1ZPZA 1A4WH 2J38A 4J2YB 2TGDA 1ANEA 5L2YH 2OBQA 1ZMNA 1BBRK 3MWIU 1C1PA 1GJCB 2ZG0H 1XMNB 4ABHA 5DP5A 2O8TA 3U8OH 2FM2A 4FUFA 4B2BA 2Q1JA 4DY7B 5TCCA 3U1JB 3TVJB 4WXVA 3LGWA 3L33A 3MO3A 1V2VT 1SGFA 2HVXA 3GISB 3ODFA 3QTVH 2VH0A 3TGKE 2XWAA 3FZDA 1BB0B 1WAYB 1V2UT 3SV7A 2BQ7B 1W14U 3VB6A 1SBWA 4CRBA 3TH2H 3AAVA 3EA8A 2BXUH 2PSXA 4ABAA 1BTPA 3SV2H 2Q6DA 4NZLA 1DSUA 5C1UA 1O3IA 1CGIE 3S9BA 1TGSZ 1KXAA 3TU7H 2P3TB 3SU6A 2PV9B 2CN0H 3NZIA 1PPGE 2NU4E 2AGEX 1FPHH 4J1YA 3LGTA 1EATA 1B7XB 2GT7A 1IHTH 1XKBC 1SGYE 1RGQA 1BBRH 2BOHB 4ZHLU 2ZFQH 1TA6A 1C5NH 4TY7A 1XXFA 1G36A 3SU5A 4NA9H 3DFLA 3A83A
chains in the Genus database with same CATH superfamily
2PP6A 5CMXH 1EZSC 1XX9A 4FXGH 4LOYH 2QAAA 2A7HA 2YMSB 3S7KB 1H9IE 4ISOA 3LOXA 1AI8H 1YGCH 3KCGH 1BA8B 1FV9A 1HB0B 1MTUA 1O3PB 4THNH 3ZZ9A 1H8DH 2OBOA 5F53A 1DWEH 3DFJA 4ESTE 2SGAA 5FPYA 1PPBH 1MKWH 2BY7X 6CHAC 1EKBB 2O8WA 2ZP0H 5C2ZA 1EP6A 4FU9A 1P3CA 3GOVB 1P2IA 4DJZB 3HK3B 2ZWLH 3SNEA 1ZGVA 3DUXH 2OC7A 2NWNA 3UNSA 3RXJA 2J92A 3UOPA 5JPMH 2WUCA 4WWYA 1A5GH 3E6PH 3ZZ5A 4YXWD 2FS9A 2VWOA 2O9QA 5E2OA 1F0RA 2BDHA 1AVGH 4XBCA 3H09A 3ZIAD 3RXEA 4ZXXH 1DWBH 2XCNA 2ANYA 1UTKA 2ZKSA 4NIVA 2F43B 2ZDVH 1SSXA 2ODYB 4GSOA 3GCHB 4R8TB 2XW9A 2Y82A 5AFYH 4B71A 1LVYA 1ZOMA 1TX6A 1AGJA 3GDVA 1E37B 3QX5H 3DSOA 1GI2A 5K0HA 2OK5A 4K8YA 1B5GH 1O3LA 1C5XB 1TMTH 3ZZ3A 1MBQA 3DHKH 3N7OA 1HIAA 4YZUA 3TGIE 1NRPH 4Q7ZA 2QV1A 3L6PA 4AZ2B 2CHAB 3GICB 1PPHE 3KNXA 1FXYA 1E38B 4CH8B 4NSYA 1AN1E 2AIQA 3TK5A 4WH8A 1GVLA 4MVNA 5C1YA 1GJ8B 1BMFD 5CHBA 1L2EA 2IPHA 1GJ6A 2Y7ZA 4X6OA 2ZQ1A 1CBWB 3HKIB 5HXFA 3SJIA 1P0SH 1E1QD 2JH6D 2ZF0H 3U8RH 3BIVH 1FY3A 2W26A 1ANDA 2EI6A 4LK4A 5HM9A 3KQ5A 1GCTC 4ZROA 1MTWA 7LPRA 5EODA 4ABJA 2H5CA 1C1UH 4HZHA 5JBTA 4HTCH 3TK6A 3SGBE 1OSSA 4GAWA 2ZC9H 3EBNA 4NG9H 2Y80A 2ZGJA 1XKAC 4RSPA 8GCHG 1V2JT 4E06H 3LU9B 1H9LB 4YOIA 1RTLA 1YPHE 5DJ7A 5KGOA 4XDEA 1O3CA 4KELA 3SUFA 5HIZA 2BD7A 1C5YB 1FAKH 1WU1A 1D6WA 1AKSB 1PJPA 8LPRA 3OY5U 4X2XA 2LIZA 3S69A 1IQGA 2ZFFH 1GDQA 1ESBA 2BZAA 1GGDB 2WZQA 2RCEA 2A4RA 1T4UH 3MNCA 1G3DA 3UOUA 1JIRA 1O2NA 1P3EA 2M5TA 3RXQA 2V3MA 1KTTB 2O8LA 4BAMB 1MBMA 1ANCA 3QTOH 3GCTG 2HRVA 3ZVAA 4ABEA 1GJDB 1O3GA 1GBCA 1AQ7A 2J98B 2ZGCA 3SJOA 1MU6B 4ABBA 2Y5FA 2W6JD 1UO6A 2UWPA 1C4U2 1TGTA 2KAIB 1YLNA 1YLCA 3UWIA 1F7ZA 1Z1IA 1BMLA 1G2MA 5DPAA 1O3OA 3QGNB 1MAYA 1BQYA 2PHBA 1GWAA 2QXJA 1NZQH 3M7TA 5I46H 3BTQE 4Y10E 3Q77A 2PLXA 2QE7D 1O2LA 1V2PT 2WUBA 2FTMA 2UWOA 3RMOH 1CHOG 3SHCH 1HBTH 1ABJH 4DIHH 1NBME 1BBRE 1TPOA 4HG6A 2P8OB 2FOBA 4U01A 5J4SA 1V2LT 2XBVA 4IMQA 4AORA 2ZDMA 4SGBE 4ASHA 2LELA 3ATKA 2C8ZB 2OP9A 1O3MA 4A1XA 5C5NA 1O2ZA 3MH7A 2XTTB 1GI1A 3AK5A 5AVDA 2AMDA 3UREA 1BTHH 4RKJB 5T6GA 1UK2A 1DPOA 1GJ7B 2Z9LA 1GBKA 4KTCA 1GBLA 3MU8A 1BT7A 1CGJE 3SJ8A 5J4QA 1IQNA 1CVWH 1W13U 2SNVA 3U69H 1GBAA 1GBBA 2YMSC 2UWLA 2Q6GA 3IITA 1B0FA 1DICA 3PTBA 4CBNA 1BTZA 1WTHD 3BTWE 2XWBI 1GVZA 2FIRH 1C1VH 2J95A 4YM9A 5AFZH 4OS2A 4NGAH 1QIXB 2ESTE 4CH2B 1H8ED 1HNEE 2K7XA 2NU1E 2M2AA 1TNIA 4Y76A 1HAGE 2Z3CA 2WYJA 2YNAA 1P02A 1S0QA 4WH6A 1UVUH 2FMJA 1KXBA 2A45B 3IWMA 1W0KD 1A5IA 1EZXC 4ZMAH 3SNAA 2NU0E 3EE7A 3W94A 2OCVB 1SLXB 3FO8D 3C27B 2WPDD 4JZ1A 5DO4H 1NTPA 1O2HA 3D62A 4WMEA 1YWUA 5EXMA 4XBBA 2TPIZ 3VGCB 5JBAS 1SHHB 1E0FD 3NKKA 5F8ZA 5IDKA 4RKOB 1KLIH 3SZNA 1QA0A 5DKMA 4Y79A 1LKAA 4NCYA 4NFFA 1VCPA 3ZZDA 5TJXA 3GCHC 2G81E 3ZZ7A 4P00A 3KHVA 2BD9A 1BITA 1AKSA 2ULLA 3BTME 1AZ8A 3KQBA 1HXEH 4K69A 1A5HA 4INKA 1K28D 3Q3KA 3VB5A 4FUGA 4YT6H 5DGJA 4AC9A 1J14A 1DWDH 1SOZA 5EGMA 2ASUB 1MCTA 2C8YB 1FI8A 2WINI 3O8DA 3ZZ4A 1Y5AT 1Z8JB 2HWLB 2FOAA 1C1SA 1HAIH 3UFAA 1FNIA 4MNVA 1QQ4A 1JMOH 5FHTA 2ZFPH 1XVMA 2YOLA 1QL8A 4XRNA 1O2XA 1G3EA 1ZMLA 2THFB 4YTAA 3M7QA 4ZKRU 2CHAC 3SBKA 1DX5M 2RG3A 4IGDA 5E0GA 2YNBA 3SNBA 4FUCA 4MPUA 3O8CA 1ORFA 1S81A 1RD3B 1XUFA 5K7RA 1CBWC 1G9IE 3OX7U 2ZGHA 4JZEH 4D9RA 4F48B 5GWZA 1LDTT 3MTYA 4GUXA 3UAIC 3D49H 1Y3XA 4JK6A 1MZAA 2AGIX 2FOMB 2O8UA 3RXCA 5C20A 4MQAA 4F49A 2Y6TA 3K65B 3U8TH 3MOCA 2BZ6H 2L74A 9ESTA 1GJAB 1L1GA 4O97A 2HGTH 1TNKA 2BLWA 3F1SB 4ZH8A 4H6SB 3SU2A 1LPGB 1QR3E 1GI3A 3RM0H 4ZKOU 2F9PA 2Z7FE 1YPHC 1V2ST 1CSOE 1TNGA 1Y8TA 4DIIH 1MMJN 5IYTA 2J4IA 1KXFA 4WVPE 2VIQA 8GCHF 2RA3A 2KFWA 1YY3A 2FXRA 1AVXA 2QF0A 4OS4A 5HM2A 1ABIH 4Y7AA 1JBUH 2F9BH 3TH4H 3RC6A 2FODA 1TALA 2GZ9A 3A82A 4JYUH 1PPCE 1GGDC 4A1VA 1C2EA 3OTJE 3OY6U 1LHEH 3MNXA 3C1KA 2QN5T 1MTVA 3GCTF 4WMFA 1UCYH 3LIWA 2CJIA 3QK1A 1W10U 1QRWA 2Z9IA 4UONA 2TGPZ 4OGXA 1P03A 3P17H 5ESTE 3M7UA 1AUTC 2XBYA 1LHFH 4NIXA 1V2RT 4ZXYH 1AUJA 3ZZ6A 1DLEA 3KEEA 1ESTA 2BY9X 2J9NA 1ZTKA 1BDAA 5FX6A 4MNWA 1MZDA 3T28A 2BVRH 3RXSA 3E8LA 2P8OC 5DN6D 2J5UA 1S6HA 2JETB 1WQSA 4M7GA 1TE0A 4CRFA 2GJGA 3RXHA 3FP6E 7KMEH 1TIOA 2KCPA 2C8WB 2H9EH 3UQOA 1DITH 2A31A 1GDUA 3RXUA 1ELCA 1O2TA 3MO6A 1OP0A 2HNTE 5EQQA 3URCA 3EA9A 1BMNH 4B6EA 5FXLA 4CR5A 3ZV9A 3UPEA 3UR9A 3VB4A 1HJAB 4WF8A 1S83A 4FU8A 3QLPH 1O37A 3FZZA 4B2CA 2OTVA 3ZV8A 1BRCE 4FUBA 1NFYA 5FX5A 4AGKA 4X8VH 4B6FA 1ZSJA 3SOSA 4AX9H 1F2SE 3AAUA 3A85A 2Z94A 3ESTA 5AF9H 1BOQA 1K1IA 1UTJA 1S84A 3V3MA 2FOCA 2FESH 3A7TA 4X6NA 3RXOA 3OSYA 4YT7H 1RFNA 1C9TA 4ISLA 1AVWA 2XYAA 1GI8B 1W3CA 1HXFH 1SQRA 4D9QA 1YPKH 4KGAA 2PGBB 4U30A 2VINA 3QO6A 3VGCC 4E7NA 2OINA 4XSKU 4Q2KA 1O2KA 1TNHA 1PPFE 2VIPA 1Z6EA 1ETRH 3MNSA 1C5ZB 1TNLA 3E0PB 1W11U 2QA9E 5EPYA 3F9HA 3RLYH 1H4WA 2A4QA 1C5RA 2J97A 1ARBA 4H42U 2VIVA 1WUNH 3E16B 1BTYA 1DT2A 1E1RD 1QJ7B 1MCVA 2C90B 3QZQA 2AIPA 1VCQA 1J9CH 1GBIA 1ZYOA 2QCYA 1INCA 4ZKNU 3H7TA 1C5MD 2B5TB 1L1JA 5DP9A 1XM1A 1AIXH 2TBSA 4ISIH 1RTKA 2XC5A 5H4IB 3MU5A 2K8IA 3RXFA 2HOBA 1QB1A 1TWXB 1IQKA 1EASA 1O2VA 1FUJA 1GVKB 1SGQE 2BD4A 2BQWB 1KXEA 5F6MA 1HIAB 4I8LA 1RS0A 1ZHRA 1UJ1A 3FKSD 5A0BA 1KDQA 1DY9A 2ZHEH 4ZHMU 3UB0A 3M36A 1N1LA 3RXMA 1O2YA 1TAWA 2BDGA 1YKTA 1KIGH 3BG4B 1Y5UT 2XC4A 3ZZBA 1O2SA 1C2DA 1QCPA 1W7XH 3KQEA 3MU0A 1C4V2 2FYRA 1MKWK 2ZHQH 1QTFA 1QA7A 5JBBS 3TK9A 3SW2B 3NCLA 1MQ6A 4B75A 3OEHD 1MTNB 2JJ1D 5T3HA 2XNIA 2H1UA 1AWHB 4O3UA 3LGYA 2PKAB 1CGHA 2EQNA 3RU4E 1MTSA 1XUHA 4WY3A 2SGEE 4NFEA 4BAKB 2BX3A 1NRSH 1DWCH 2ZIQH 1JXPA 3IG6B 1PQ8A 1Z7KA 4B76A 4NA8A 1IQIA 2A4OA 2V7QD 5FPSA 1BHXF 3P8FA 1GBHA 4IN2A 5EQRA 4A6LA 1FZZA 1YPMH 4FVDA 1V2OT 4ZAEA 3UY9A 4X2WA 2HPQH 4DT4A 1ZLRA 2FI3E 3SZEA 3ATWA 3VPKA 2P16A 1GBEA 1WOFA 2A7JA 3P92A 4Y7BA 3RXAA 1SI5H 1O2IA 3A81A 3ZVFA 2TGTA 1C9PA 3MYWA 1XUGA 1K1NA 4QT8C 1MAXA 3T62A 1UCYE 4ABFA 1Y5BT 2GP9B 1FLEE 4KKDA 3VG8A 1O3HA 3V12A 2YMSD 1F0TA 2VWMA 4F55A 3TIUA 3S0NA 3HATH 2A4GA 3Q76A 5DSFA 1AY6H 1S6LA 1YF4A 4BXSA 1P2OA 1C1TA 4MDSA 2VIOA 2ZFSA 5F8TA 5GCHG 1K1OA 2BTCE 3ENSB 5E0JA 1P57B 1LTOA 3RMNH 2ZGBH 1ID5H 3D65E 1WSSH 1DE7H 3F9FA 2IN2A 1LPKB 1P12E 2BD3A 2DE8A 2VBCA 2W3KA 4AFSA 4MG3A 1EP5A 2ZECA 1C5QA 1A3BH 1PPZA 1WCZA 1NFUA 1C4Y2 3WWFA 4CRAA 1ELAA 1EFRD 2PSYA 2I6QA 3SNCA 1A46H 4AG2A 2AEIH 4UEHH 1ELGA 1UK4A 2JETC 2LNCA 2HNTC 2F9NA 2FWWA 1O2WA 1K22H 3QN7A 3P70B 1DXPA 1QRXA 2STBE 2CMYA 4KP0A 4I86A 4ZUHA 1G2LA 3EDXB 3V0XA 4B73A 2ANMH 2R0LA 2ZU5A 1GI7B 1KLTA 5GDSH 1ELFA 1HJAC 3UWJH 3BTDE 1HJ9A 2ALVA 4X1RU 1GHBG 3Q3XA 2SNWA 3VB7A 2Y5GA 4X2YA 7GCHG 3MH5A 1EB2A 1Q3XA 1XUIA 1OWJA 1NO9H 1L4ZA 1OWDA 1SGIB 3P95A 5GJ4B 3MU4A 4FUDA 1BTWA 3B8JA 4Q7XA 1HPGA 1C2JA 2GCTB 4K3JA 1GMDG 2HLDD 5EJ1A 3BTKE 3BEFB 3GY6A 4I8KA 3SI3H 3K6YA 1O36A 1ZTJA 2ZU1A 3LGUA 3W95A 2W7SA 2FI4E 1E34B 1ANBA 1FY4A 4SGAE 2UUJB 2KCYA 3M37A 2FPZA 1GDNA 1J17T 1DUAA 5FAHA 5JDUB 1P2NA 2EC9H 1BTXA 2PKAA 3UUZA 1TFXA 3NK8A 1P06A 1AFQB 2KZ4A 2UUFB 3F2GA 1O5AB 1ZSLA 3FP8E 2OD3B 4MNXA 1O3DA 2XNDD 5HYOA 3HGNA 2D1JA 1CT0E 3SV8A 1UVTH 3ODDA 1SB1H 3BTTE 3SJ9A 3PMHB 3ZZCA 2NU3E 5A2MH 4RT0A 1WQVH 4FUEA 2HPPH 3T25A 5C17A 1T4VH 1FJSA 1OPHB 5EG4A 1EQ9A 1O3JA 4Z0KA 2QC2A 4WXIA 1ZPBA 3BIUH 1RTFB 2BY6X 1NRRH 2ZDLA 2VIWA 3SN8A 5EU8A 1NFWA 1DOJA 1GHXH 1O32A 2PUQH 1IAUA 1U6QA 2GGVB 1C2LA 3TJVA 3PMAB 2HALA 1CA0B 1P11E 1GCDA 2J94A 1C2IA 1GMHF 1LVMA 2KX4A 4UE7H 1PYTC 2C93B 1SPJA 1FMGA 3PV2A 1BRBE 2PGQB 2GT8A 3BSQA 4AFQA 2R2MB 3NUMA 1O2MA 4LZ1H 2QYIA 1FY5A 2PFEA 1ESAA 2F83A 3MU1A 3F0PA 4JK5A 3BG4C 5DP8A 2ZTXA 4X8SH 4FOUC 1F0UA 3OEED 3PMJA 2BLVA 1C1NA 3ZVGA 2XC0A 2ZHWH 1Z71A 1GJBB 1UVOA 4Y0ZE 1MTNC 3A8AA 1TOMH 4GHTA 2GD4B 4Q63A 5EXLA 1QURH 4DT7B 3CS0A 1NBMD 4K1SA 2OC8A 3RP2A 2P3FH 1TLDA 1AE5A 3LH1A 2KCAA 1NU9A 3A7WA 3RXDA 3DCLA 1GHZA 1M9UA 4ABDA 1O5GH 1P05A 4ZCNA 1DLKB 3SO3A 5A0AE 2GDDA 1YM0A 3BV9B 3SYJA 1NC6A 1GBTA 3F3BA 4AGJA 4FVBA 1FY8E 3RXIA 1WDIA 2V3HH 1JRSA 4ABGA 4I31A 5A8XA 2B8OH 1TGBA 4RI0A 1CHGA 2J34A 4UFGH 1HDTH 3M5MA 2Y5HA 3S9CA 5FCRA 1AO5A 4DURA 1C5SA 4U2WA 1JIMA 1XUJA 1QRZA 4JCNA 5A8YA 2LPRA 4VGCB 2FLBH 3A7XA 5GCHF 3HKJB 2K0QA 5EIYA 5BPEA 1P2JA 2I6SA 2G4TA 3OU0A 1LVBA 1ELVA 1WXRA 3KGPA 1Y3UA 3DD2H 2DE9A 3TITA 3LH3A 3OTPA 1O31A 1L0ZA 4MPVA 3KIDU 4ACAA 2GV6A 1GHWH 2ZI2H 4MPXA 2BD5A 5DP7A 3V7TA 1YCPM 5DP3A 3M3SA 3NPSA 5EPNA 2ZPRA 4CRDA 4AB9A 2SGPE 5LH8A 2WPLS 4D7FA 1SGFG 3TGJE 3A7ZA 1KMHB 1O33A 3BTGE 2BX4A 5GPIB 5A0CA 2Y81A 1QL9A 4Z6AH 3LDXH 1O30A 4TPYA 1GHBF 5FBIA 3F2HA 4IC6A 1QZ8A 1TBQH 1UTMA 3N7DA 2AS9A 1QNJA 3ZYDA 6GCHG 7GCHF 1G37A 3A84A 1W7GH 3GCNA 1NPMA 3T5FH 3RLWH 3PV5A 1EX3A 4YESB 1W8BH 1CT4E 3CNRA 1BUIA 1HFDA 1N6YA 1TBRH 1FPCH 2GCTC 1LMWB 5DP6A 1GMDF 1SGDE 2PUXB 4AYVB 1IQFA 3DA9B 1UCYK 3EGKH 2W5EA 1TGNA 3LGIA 1AWFH 1Z6JH 8KME2 1HLTH 4MLFB 1VZQH 3SV6A 3TNSA 1AFQC 3GDSA 1HCGA 5CHAB 1C2FA 1TMBH 1EJNA 1PQ5A 1A7SA 3SNDA 1VITG 1AB9B 1K9OE 1O5DH 3T26A 2WHXA 1C2KA 1AZZA 1SGCA 1RXPA 3DSPA 3ATLA 4JZIA 1CT2E 1O2OA 2BDCA 2KR7A 2JJ2D 4JZFH 4CBOA 4D7GA 2FOEA 3SU0A 2F4LA 4INHA 1O2RA 2K1QA 4JZDH 1VJ9U 4DGJA 1H1BA 1TX7A 2ALPA 1CO7E 1AD8H 1TPPA 2FLRH 4OS7A 2FX6A 4DW2U 1HV7A 2G5NA 1KSNA 1ZRBA 3CENA 1V6DA 1TOCB 3PB1E 4OGYA 4Y11E 3U1IB 3O8RA 3RXLA 4IBLH 1CA0C 1UTLM 1BZXE 3SUEA 4D76A 1SQTA 3R0FA 4XFQA 2GMTB 1ETSH 1E35B 3M61U 2ZCLP 4NIYA 5FPTA 3UQVA 1WTGH 3SI4H 1FX0B 1IOEA 3AASA 1ELBA 5LPFA 3GDUA 2IPQX 2GDEH 2R3UA 1FN8A 1O3NA 4BXWA 1KLJH 1DS2E 1GBFA 1P10A 1S85A 3RXKA 1L1NA 2A5IA 3M35A 1OYQA 2ZDAH 4CREA 5AHGH 2RFKC 1CQQA 4IS5A 1N8OB 5FBEA 1KDQB 5A8ZA 1SKYE 3P8NA 2WPKS 4JYVH 2XBXA 4ISHH 4NWKA 3R3GB 1UTPA 2GKVE 1FIZA 1TABE 2CV3A 3VFEA 1SLVB 3LC3A 3PO1B 1TRYA 2BMGB 4UFEH 2FX4A 1ZPCA 1QFKH 5E2PA 4A7IB 4ACBA 4TWYA 5I25A 2ZPQA 3RM2H 1V2TT 4JYTA 2KCOA 2AMQA 3M5OA 4GHQA 3SUDA 3I78A 3PRBA 1V3XA 1HAPH 3M3TA 1SHYA 1Q31A 2AMPA 1T7CA 1YP9A 3MNBA 1D3PB 4XBDA 5DG6A 3SGQE 2CXVA 1VJAU 4B2AA 3OYPA 5EXNA 4CHAB 3VEQB 2QY0B 2RDLA 5CE1A 5L30H 2C3SA 5HIYA 2TRMA 1THRH 2VVUA 1T8OA 4OS5A 2QF4A 1Z8IB 3KYFA 1OKXA 3ITIA 1GI9B 5FCKA 1FONA 1D9IA 4TYDA 2B7DH 3NXPA 2HVYB 1GMCG 4OS6A 2BVXH 1EPTB 4WMDA 2P94A 3GS9A 2BD8A 3RXVA 1VR1H 3N99A 3SHAH 1KXDA 1K0HA 1RIWB 2G52A 3PWBA 4VGCC 1YPJH 1GI0A 1J8AA 1GG6B 2ANWA 4Q80A 1D4PB 2AERH 2NU2E 1T8LA 1ZHMA 1BHXB 2GZ8A 1BIOA 3QUMP 3TJUA 3UR6A 1T31A 2P3UB 3RMLH 1G30B 5GNDA 4RN6A 1E36B 1GPZA 2PR3A 2OC1A 1O5CB 1SQOA 1A3EH 2FO9A 1IHSH 1O3AA 4NSVA 5C1XA 3VB3A 1CU1A 3LKWA 1NROH 3PLKA 5EQSA 2H5DA 1FY1A 2BDBA 2JIZD 1YC0A 2ZFRH 1P8VC 2Z3DA 1OP8A 2QGRA 2CGAA 1EAXA 3E90B 1GL1A 1MQ5A 3RC5A 3RU4T 2A32A 4TY6A 1ARCA 4Y0YE 4K60A 4TPIZ 1QL7A 2ANKH 1EZQA 2UUKB 2ZTYA 5T6FA 1MU8B 2BOKA 1LPZB 2QXHA 2QXGA 1ZTLA 1O5FH 1EZUC 1GMHG 1UTNA 2BB4A 3T29A 6GCHF 3E1XB 1COWD 3TPIZ 3UTUH 2BQ6B 1OXGA 2EI8A 2BLOA 3FVFB 3FP7E 1HAXB 1GI6A 3SV9A 1MKXH 4X8UH 1QBNA 1P2KA 2P59A 5T6DA 4A5TS 4FUJA 3EYDA 2P93A 1PYTD 2CF9H 2VH6A 1T8NA 3A8CA 2FP7B 4PROA 2HNTF 3LC5A 2J2UA 2ZZUH 3U98H 1SGEE 2ZU4A 1Y3VA 4X1PU 5HKKD 1SLUB 3F9EA 4GVUA 1SGTA 4JMYA 2Z9GA 1QGFA 1YLDA 2EI7A 3LJOA 5CHAC 2OXSA 5B6OA 3MH4A 4K1TA 1QB9A 2Z9KA 2ILNA 1TB6H 1AB9C 3URDA 1TMUH 1VITF 5A09A 1JWTA 1TPSA 4CR9A 1P9SA 2PKSB 1JOUB 3ZZAA 3RU4D 1WV7H 2ZQ2A 1FIWA 5GXPA 1A0JA 1LKBA 2AFQB 4YLUA 3I29A 4I8GA 3B23B 1EOJA 5ETXA 2VIDA 2A2QH 1WYKA 4BTUB 2LP6A 2Y7XA 1CE5A 2A1DB 4FETA 5SGAE 3T27A 2D2DA 1YCPH 4NIWA 1QHRB 2GX4A 2OQ5A 1NFXA 2SGQE 4ISNA 4GLYA 1ZMJA 2BYAX 1YYY1 3SGAE 1EJAA 1XUKA 1K1MA 3SUGA 1VCWA 2GMTC 1EPTA 5JB8S 1GJ5H 4X1NU 3K2UA 3E3TA 2DUCA 3GCOA 5LPRA 3SQHE 1RRKA 1OYTH 3ZZ8A 3GYMA 1BMMH 2SGDE 2ZO3H 2ODPA 3U28C 2BY5X 1AFEH 3EE0B 3E0NB 2VJ1A 4A92A 3PRDA 5TCAA 1W0JD 3O8BA 4H4FA 1TQ7B 1PFXC 1ZR0A 3F0OA 2D26C 1LHCH 4BANB 1N8OC 4YOGA 3AW1A 1DSTA 4AYYB 3KL6A 4GCHG 3GY3A 2SGFE 3PLPA 4ASUD 3S7HB 4X2VA 3PO1C 1TQ0B 3QWCH 4Y71A 1TRNA 3WWBA 2OUAA 1X7AC 1O2UA 1C1QA 3RXGA 1C5LH 2V35A 5L2ZH 3F6UH 3NRLA 1EXFA 1YPEH 2WV9A 2FS8A 1AE8H 4Y8XA 3BTEE 1F5LA 3JZ1B 4XE4A 2V0BA 1UMAH 1QB6A 1SFQB 4R0IA 2Z6BD 2WPMS 2RA0A 1BJUA 3E91A 3MHWU 2FOHA 1QY6A 4ZKSU 4I8HA 1DDJA 1TGCA 4CHAC 4UFFH 1THPB 2SFAA 1C5OH 3PMBB 3U9AH 1AMHA 1ZZZA 2BDIA 1SMFE 5JBCS 4UDWH 5GIBA 2FDAA 3PROA 4MTBA 1UK3A 4FUHA 1HJ8A 3QGJA 1C5WB 4BAHB 1A0HB 1LQEA 1ZHPA 4BTIB 1NT1A 2F9OA 1GMCF 3ZVDA 1KXCA 4TWWA 1EPTC 2IJOB 1TNJA 2H9HA 1OWKA 1A1RA 1RIWC 4XOJA 1GG6C 2AGGX 2H9TH 1Y3YA 1UVSH 3F2FA 1C1WH 3SU3A 3BEUA 2ZNKH 3K9XB 1P9UA 1F5RA 1Y59T 4HI3A 3L3TA 3KF2A 5C3NA 5E8EH 3W1EA 4AFZA 6LPRA 1O3EA 1QBOA 4AOQA 3F68H 1THSH 1O38A 2ZU3A 1WBGB 1Q2WA 2ZCKP 5PTPA 1P01A 3FAOA 2WV4A 1ELTA 2JH5D 4FU7A 1SQAA 2A7CA 1QJ1B 1FAXA 1ELEE 2A2XH 4O03A 2C8XB 2IOTA 2GCHG 4K2YA 1V2KT 4M9FA 2FTLE 2V3OH 5EOKA 1FN6A 1K2I1 4WJG2 5F03A 1GBMA 4AG1A 1LHDH 3KQDA 3ZVCA 3HK6B 1KY9A 5KEDA 1V2WT 4LXBH 4HFPB 1GHVH 1V2QT 2Q6FA 2WSSD 3V13A 3RC4A 1V2NT 3MO9A 1ZSKA 4DG4A 1DY8A 2OQUA 5EW1H 3RUOA 3UIRA 4BAQB 1S0RA 1IQHA 2ZDKA 1SGPE 2FYQA 3K6ZA 3PM3A 1C1MA 4X6PA 1ETTH 1EOLA 1TA2A 1LHGH 4TT3D 3OFND 1LCYA 2JH0D 2VB0A 3P6ZB 1JRTA 1LO6A 1Y3WA 2PTCE 1ZGIA 2QXIA 4OS1A 3STJA 1LVOA 4Y8ZA 1SOTA 1HAVB 4I7YH 4IW4E 2BLQA 2R9PA 1G32B 5KECA 3GYLB 2Z9JA 4X6MA 5HMAA 1ZJDA 4O3TA 5BRRE 1C2MA 3A7VA 4Q7YA 4AN7A 2KM0A 2G4UA 1K21H 5C67A 2VGCB 2PKSC 2BXTH 1W2KH 1B0EA 1C1OA 1J16A 1NRQH 3LPRA 2L6OA 3MH6A 3I77A 1GHAG 1SGRE 5HGGA 3ELAH 4YOJA 3ATIA 4GPGA 1HUTH 3B9FH 4I8JA 3GY8A 3OAAD 2VVVA 3N7EA 4KTSA 3ZVBA 1CA8B 5F8XA 3EQ0H 3A7YA 1P04A 1BTUA 4IMZA 2CK3D 1NM6A 1EUFA 3A89A 4DCDA 2ZU2A 1UVPA 2QF3A 1HRTH 1BMAA 3QZRA 3LT3A 1UW7A 3T2NA 1EAIA 1OP2A 5FL7D 1AHTH 3P8GA 5DK1A 1H8IH 3MFJA 3KQCA 1VGCB 4BOHA 1C5VA 4X1QU 4BAOB 3NWUA 1S6FA 1C1RA 1D3TB 1O2QA 3ATMA 1HGTH 2A0QB 1A0LA 1KTSB 1XVOA 3P8OA 1O2GH 3A8DA 2BY8X 2PW8H 2ZCHP 1N6XA 2BD2A 4GCHF 1BCUH 3H5CB 2W7UA 1RJXB 4K5ZA 3QDZB 1VITH 2R2WU 3BTHE 1H8HD 1SG8B 2ZFTA 4P02A 3GY2A 1GJ4H 4H6TA 1W0YH 1AU8A 1G3CA 2IJD1 2FOGA 2A5AA 3LGVA 4AFUA 2ZGXH 1NY22 2ZDNA 5LPEA 1NN6A 1GI5A 1O3FA 4XD7D 1Z1JA 1FQ3A 1NRNH 4BTTB 3CS7A 4RT1A 1DXWA 2FZZA 2HLCA 3RXTA 4B1TA 5C5OA 1PPEE 1IQLA 4UD9H 2QIQA 3EA7A 1OS8A 5E0HA 5ESBA 4YO9A 1F92A 2XCFA 1TPAE 2TGAA 3AVZA 4YLQH 1S82A 1H9HE 1O39A 3Q3YA 4IN1A 3TJOA 2WPHS 1KYNA 1OOKB 3PTNA 1IQJA 1L4DA 1YPGH 2R0KA 4Z1MD 1EJMA 3M5NA 1YBWA 3RDZA 5G4BA 1OX1A 1HAZB 1HAVA 2TIOA 4E05H 2VNTA 1O5EH 3M3VA 4X0WU 3ZYEA 2J98A 2G5VA 2W3IA 4I33A 1LQDB 3FN8A 2XBWA 2AH4X 1T8MA 4TSFD 1P2MA 2KAIA 3GY5A 2D8WA 2UUYA 1SR5C 9LPRA 1BJVA 1UHBB 2V6NA 3WW7A 1O35A 3TLOA 3KN2A 3BG8A 1EB1H 5EW2H 3G01A 2H2ZA 3PWCA 1S5SA 3A87A 1HAOH 4F4OC 2BDYA 3A8BA 1J15A 3SORA 3BTFE 2ZHFH 4O9VA 4UFDH 1TBZH 4DOQA 2GCHF 2P95A 1FDPA 4MPWA 3RXRA 2ZPSA 1W12U 1DM4B 1TYNA 1D6RA 1GBJA 2VWNA 3RXPA 1PQAA 1DFPA 1OWHA 1O0DH 3BN9A 1SVPA 2ODQA 4ZHAA 3VXFH 1DUEA 2XRCA 1YPLH 2BDAA 1NESE 2G00A 1ZJKA 2PWXA 3TNTA 1K1JA 1ELDE 3SJKA 5JB9S 2RDEA 1BRAA 3EAJA 2H6MA 4CRGA 3F9GA 3FOAA 4BNRA 1TRMA 2R3YA 1O2PA 2AYWA 3FANA 2FEQH 2WYGA 2GV7A 5L6NH 4Y8YA 2XOKD 3S9AA 2QF5A 5ABWA 3GY7A 3SU1A 3HGPA 1SLWB 1A2CH 1GHYH 3A88A 2OLGA 4NWLA 4E7RG 3TH3H 1OWIA 1Z8RA 5EJZA 3SU4A 1SC8U 2JKHA 1DANH 1C5UA 3AW0A 2VWLA 2GTBA 1W0ZU 3WY8A 1K1PA 5DP4A 2JDID 1MH0A 1A61H 2VGCC 3CP7A 3DSGA 6CHAB 3D23A 1GL0E 2O8MA 1O3KA 1F5KU 1VKYA 1GHAF 3BF6H 1MABB 2WPIS 3PV4A 4HGCA 1O2JA 1GI4A 3BEIB 5EJLA 1P2QA 1TONA 1MD8A 2OC0A 5IK2D 7ESTE 3M5LA 2F91A 3Q00A 2AHME 4D8NA 1K1LA 3HPTB 1OHHD 1QBVH 3MI4A 1CHOF 1HAYB 2F3CE 3RXBA 3GY4A 1IQMA 2ZA5A 2W6ID 2CF8H 1C5TA 1SGNE 5C0UA 2PTNA 2G51A 3A86A 4A1TA 2ZTZA 1BRUP 2FI5E 4U32A 1O34A 1T32A 2WV5A 2GVFA 4I32A 1F0SA 2EA3A 1C2HA 3ZVEA 1P09A 3VXEH 3MMGA 3PYHA 3UNRA 3LJJA 1SL3A 2GZ7A 2A5KA 2WPJS 3A80A 1D3QB 1VGCC 2FOFA 1E79D 4X1SU 1SFIA 1GJ9B 1O3BA 4INLA 8ESTE 1C5PA 4K8BA 1QJ6B 3PLBA 1MKXK 4CRCA 2F9VA 1UTOA 4ABIA 3STIA 1UHBA 2F9UA 2VU8E 2G55A 4NZQA 1PQ7A 4AB8A 2BM2A 3FFGA 1EAWA 5LGOA 1ZRKA 1GBDA 2EEKA 1ACBE 3OE7D 1NU7B 4KTUA 4MNYA 1D3DB 3DT0H 4LZ4B 3SQEE 5JYIA 2C4FH 3JZ2B 1XXDA 3H7OA 2Z3EA 4OM9A 2ZEBA 1Z8GA 1EAUA 4B74A 2G8TA 2ZHDA 1V2MT 2B9LA 2B0FA 1G3BA 1HYLA 1C2GA 3LONA 4Y6DA 3UNQA 1UTQA 4IC5A 2BHGA 1GCTB 4X8TH 1OWEA 3RMMH 4NA7A 4K1EA 3TJNA 5B6LA 1NS3A 2VVCA 2XXLA 1IQEA 2BVSH 1TX8A 2STAE 1MD7A 1DVAH 1QQUA 1YCPK 1MUEB 1O5BB 6ESTA 4DVAU 4FUIA 1HAHH 1ZPZA 5C0TA 1A4WH 2J38A 4J2YB 5C94A 2TGDA 1ANEA 3KYGA 5L2YH 2OBQA 1ZMNA 1BBRK 3MWIU 1C1PA 1GJCB 2EY4C 2ZG0H 1XMNB 4ABHA 5DP5A 2O8TA 3U8OH 2FM2A 4FUFA 4B2BA 2Q1JA 4DY7B 5TCCA 3U1JB 3TVJB 4WXVA 3LGWA 3L33A 3MO3A 1V2VT 1SGFA 2HVXA 3GISB 3ODFA 3QTVH 2VH0A 3TGKE 3MQKC 2XWAA 3FZDA 1BB0B 1WAYB 1V2UT 3SV7A 2BQ7B 1W14U 3VB6A 1SBWA 4Q4LA 4CRBA 3TH2H 3AAVA 5CDFE 3EA8A 2BXUH 2PSXA 4ABAA 1BTPA 3SV2H 2Q6DA 4NZLA 1DSUA 5C1UA 1O3IA 1CGIE 3S9BA 1TGSZ 1KXAA 3TU7H 2P3TB 3SU6A 2PV9B 2CN0H 3NZIA 1PPGE 2NU4E 2AGEX 1FPHH 4J1YA 3LGTA 1EATA 1B7XB 2GT7A 1IHTH 1XKBC 1SGYE 1RGQA 1BBRH 5T1VA 2BOHB 4ZHLU 2ZFQH 1TA6A 1C5NH 4TY7A 1XXFA 1G36A 3SU5A 4NA9H 3DFLA 3A83A
chains in the Genus database with same CATH topology
5CMXH 1EZSC 1XX9A 4FXGH 4LOYH 2QAAA 2A7HA 3S7KB 1H9IE 4ISOA 3LOXA 1AI8H 1YGCH 3KCGH 1BA8B 1FV9A 1HB0B 1MTUA 1O3PB 4THNH 3ZZ9A 1H8DH 2OBOA 1DWEH 3DFJA 4ESTE 2SGAA 5FPYA 1PPBH 1MKWH 2BY7X 6CHAC 1EKBB 2O8WA 2ZP0H 5C2ZA 1EP6A 4FU9A 1P3CA 3GOVB 1P2IA 4DJZB 3HK3B 2ZWLH 3SNEA 1ZGVA 3DUXH 2OC7A 2NWNA 3UNSA 3RXJA 2J92A 3UOPA 5JPMH 2WUCA 4WWYA 1A5GH 3E6PH 3ZZ5A 2FS9A 2VWOA 2O9QA 5E2OA 1F0RA 2BDHA 1AVGH 4XBCA 3RXEA 4ZXXH 1DWBH 2XCNA 2ANYA 1UTKA 2ZKSA 4NIVA 2ZDVH 1SSXA 2ODYB 4GSOA 3GCHB 4R8TB 2XW9A 2Y82A 5AFYH 4B71A 1LVYA 1ZOMA 1TX6A 1AGJA 3GDVA 1E37B 3QX5H 1GI2A 5K0HA 4K8YA 1B5GH 1O3LA 1C5XB 1TMTH 3ZZ3A 1MBQA 3DHKH 3N7OA 1HIAA 4YZUA 3TGIE 1NRPH 4Q7ZA 2QV1A 3L6PA 4AZ2B 2CHAB 3GICB 1PPHE 3KNXA 1FXYA 1E38B 4CH8B 4NSYA 1AN1E 2AIQA 3TK5A 4WH8A 1GVLA 4MVNA 5C1YA 1GJ8B 1L2EA 2IPHA 1GJ6A 2Y7ZA 4X6OA 2ZQ1A 1CBWB 3HKIB 5HXFA 3SJIA 1P0SH 2ZF0H 2JH6D 3U8RH 3BIVH 1FY3A 2W26A 1ANDA 2EI6A 4LK4A 5HM9A 1GCTC 4ZROA 1MTWA 7LPRA 5EODA 4ABJA 2H5CA 1C1UH 4HZHA 5JBTA 4HTCH 3TK6A 3SGBE 1OSSA 4GAWA 2ZC9H 3EBNA 4NG9H 2Y80A 2ZGJA 1XKAC 4RSPA 8GCHG 1V2JT 4E06H 3LU9B 1H9LB 4YOIA 1RTLA 1YPHE 5DJ7A 4XDEA 1O3CA 4KELA 3SUFA 2BD7A 1C5YB 1FAKH 1WU1A 1D6WA 1AKSB 1PJPA 8LPRA 3OY5U 4X2XA 2LIZA 3S69A 1IQGA 2ZFFH 1GDQA 1ESBA 2BZAA 1GGDB 2RCEA 2A4RA 1T4UH 3MNCA 1G3DA 3UOUA 1JIRA 1O2NA 1P3EA 2M5TA 3RXQA 1KTTB 2O8LA 4BAMB 1MBMA 1ANCA 3QTOH 3GCTG 2HRVA 3ZVAA 4ABEA 1GJDB 1O3GA 1GBCA 1AQ7A 3SJOA 2ZGCA 1MU6B 4ABBA 2Y5FA 1UO6A 2UWPA 1C4U2 1TGTA 2KAIB 1YLCA 3UWIA 1F7ZA 1Z1IA 1BMLA 1G2MA 5DPAA 1O3OA 3QGNB 1MAYA 1BQYA 2PHBA 1GWAA 2QXJA 1NZQH 3M7TA 5I46H 3BTQE 4Y10E 3Q77A 2PLXA 1O2LA 1V2PT 2WUBA 2FTMA 2UWOA 3RMOH 1CHOG 3SHCH 1HBTH 1ABJH 4DIHH 1BBRE 1TPOA 2P8OB 2FOBA 4U01A 5J4SA 1V2LT 2XBVA 4IMQA 4AORA 2ZDMA 4SGBE 4ASHA 3ATKA 2C8ZB 2OP9A 1O3MA 4A1XA 5C5NA 1O2ZA 3MH7A 2XTTB 1GI1A 5AVDA 2AMDA 3UREA 1BTHH 4RKJB 5T6GA 1UK2A 1DPOA 1GJ7B 2Z9LA 1GBKA 4KTCA 1GBLA 3MU8A 1BT7A 1CGJE 3SJ8A 5J4QA 1IQNA 1CVWH 1W13U 2SNVA 3U69H 1GBAA 1GBBA 4CBNA 2UWLA 2Q6GA 3IITA 1B0FA 1DICA 3PTBA 1BTZA 1WTHD 3BTWE 2XWBI 1GVZA 2FIRH 1C1VH 2J95A 4YM9A 5AFZH 4OS2A 4NGAH 1QIXB 2ESTE 4CH2B 1HNEE 2K7XA 2NU1E 1TNIA 4Y76A 1HAGE 2Z3CA 2WYJA 2YNAA 1P02A 1S0QA 4WH6A 1UVUH 2FMJA 1KXBA 2A45B 3IWMA 1A5IA 1EZXC 4ZMAH 3SNAA 2NU0E 3W94A 2OCVB 1SLXB 3C27B 4JZ1A 5DO4H 1NTPA 1O2HA 3D62A 4WMEA 5EXMA 4XBBA 2TPIZ 3VGCB 5JBAS 1SHHB 1E0FD 3NKKA 5F8ZA 5IDKA 4RKOB 1KLIH 3SZNA 1QA0A 5DKMA 4Y79A 1LKAA 4NCYA 4NFFA 1VCPA 3ZZDA 5TJXA 3GCHC 2G81E 3ZZ7A 3KHVA 2BD9A 1BITA 1AKSA 2ULLA 3BTME 1AZ8A 3KQBA 1HXEH 4K69A 1A5HA 4INKA 1K28D 3Q3KA 3VB5A 4FUGA 4YT6H 5DGJA 1J14A 1DWDH 1SOZA 5EGMA 2ASUB 1MCTA 2C8YB 1FI8A 2WINI 3O8DA 3ZZ4A 1Y5AT 1Z8JB 2HWLB 2FOAA 1C1SA 1HAIH 3UFAA 1FNIA 4MNVA 1QQ4A 1JMOH 5FHTA 2ZFPH 1XVMA 2YOLA 1QL8A 1O2XA 1G3EA 1ZMLA 2THFB 4YTAA 3M7QA 4ZKRU 2CHAC 3SBKA 1DX5M 2RG3A 4IGDA 5E0GA 2YNBA 3SNBA 4FUCA 4MPUA 3O8CA 1ORFA 1S81A 1RD3B 1XUFA 5K7RA 1CBWC 1G9IE 3OX7U 2ZGHA 4JZEH 4D9RA 5GWZA 1LDTT 3MTYA 4GUXA 3D49H 1Y3XA 4JK6A 1MZAA 2AGIX 2FOMB 2O8UA 3RXCA 5C20A 4MQAA 4F49A 2Y6TA 3K65B 3U8TH 3MOCA 2BZ6H 9ESTA 1GJAB 1L1GA 4O97A 2HGTH 1TNKA 2BLWA 3F1SB 4ZH8A 4H6SB 3SU2A 1LPGB 1QR3E 1GI3A 3RM0H 4ZKOU 2F9PA 2Z7FE 1YPHC 1V2ST 1CSOE 1TNGA 1Y8TA 4DIIH 1MMJN 5IYTA 2J4IA 1KXFA 4WVPE 2VIQA 8GCHF 2RA3A 2FXRA 1AVXA 2QF0A 4OS4A 5HM2A 1ABIH 4Y7AA 1JBUH 2F9BH 3TH4H 3RC6A 2FODA 1TALA 2GZ9A 3A82A 4JYUH 1PPCE 1GGDC 4A1VA 1C2EA 3OTJE 3OY6U 1LHEH 3MNXA 3C1KA 2QN5T 1MTVA 3GCTF 4WMFA 1UCYH 3LIWA 2CJIA 3QK1A 1W10U 1QRWA 2Z9IA 4UONA 2TGPZ 4OGXA 1P03A 3P17H 5ESTE 3M7UA 1AUTC 2XBYA 1LHFH 4NIXA 1V2RT 4ZXYH 1AUJA 3ZZ6A 1DLEA 3KEEA 1ESTA 2BY9X 2J9NA 1ZTKA 1BDAA 5FX6A 4MNWA 1MZDA 3T28A 2BVRH 3RXSA 3E8LA 2P8OC 1S6HA 2JETB 1WQSA 4M7GA 1TE0A 4CRFA 3RXHA 3FP6E 7KMEH 1TIOA 2C8WB 2H9EH 3UQOA 1DITH 2A31A 1GDUA 3RXUA 1ELCA 1O2TA 3MO6A 1OP0A 2HNTE 5EQQA 3URCA 3EA9A 1BMNH 4CR5A 5FXLA 3ZV9A 3UPEA 3UR9A 3VB4A 1HJAB 4WF8A 1S83A 4FU8A 3QLPH 1O37A 3FZZA 4B2CA 2OTVA 3ZV8A 1BRCE 4FUBA 1NFYA 5FX5A 4AGKA 4X8VH 1ZSJA 3SOSA 4AX9H 1F2SE 3AAUA 3A85A 2Z94A 3ESTA 5AF9H 1BOQA 1K1IA 1UTJA 1S84A 3V3MA 2FOCA 2FESH 3A7TA 4X6NA 3RXOA 3OSYA 4YT7H 1RFNA 1C9TA 4ISLA 1AVWA 2XYAA 1GI8B 1W3CA 1HXFH 4D9QA 1YPKH 4KGAA 2PGBB 4U30A 2VINA 3QO6A 3VGCC 4E7NA 2OINA 4XSKU 4Q2KA 1O2KA 1TNHA 1PPFE 2VIPA 1Z6EA 1ETRH 3MNSA 1C5ZB 1TNLA 3E0PB 1W11U 2QA9E 5EPYA 3F9HA 3RLYH 1H4WA 2A4QA 1C5RA 1ARBA 4H42U 2VIVA 1WUNH 3E16B 1BTYA 1DT2A 1QJ7B 1MCVA 2C90B 3QZQA 2AIPA 1VCQA 1J9CH 1GBIA 1ZYOA 2QCYA 1INCA 4ZKNU 3H7TA 1C5MD 2B5TB 1L1JA 5DP9A 1XM1A 1AIXH 2TBSA 4ISIH 1RTKA 2XC5A 5H4IB 3MU5A 3RXFA 2HOBA 1QB1A 1TWXB 1IQKA 1EASA 1O2VA 1FUJA 1GVKB 1SGQE 2BD4A 2BQWB 1KXEA 5F6MA 1HIAB 4I8LA 1RS0A 1ZHRA 1UJ1A 5A0BA 1KDQA 1DY9A 2ZHEH 4ZHMU 3M36A 1N1LA 3RXMA 1O2YA 1TAWA 2BDGA 1YKTA 1KIGH 3BG4B 1Y5UT 2XC4A 3ZZBA 1O2SA 1C2DA 1QCPA 1W7XH 3KQEA 3MU0A 1C4V2 2FYRA 1MKWK 2ZHQH 1QTFA 1QA7A 5JBBS 3TK9A 3SW2B 3NCLA 1MQ6A 4B75A 1MTNB 5T3HA 2XNIA 2H1UA 1AWHB 4O3UA 3LGYA 2PKAB 1CGHA 3RU4E 1MTSA 1XUHA 4WY3A 2SGEE 4NFEA 4BAKB 2BX3A 1NRSH 1DWCH 2ZIQH 1JXPA 3IG6B 1PQ8A 1Z7KA 4B76A 4NA8A 1IQIA 2A4OA 5FPSA 1BHXF 3P8FA 1GBHA 4IN2A 5EQRA 4A6LA 1FZZA 1YPMH 4FVDA 1V2OT 4ZAEA 3UY9A 4X2WA 2HPQH 1ZLRA 2FI3E 3ATWA 3VPKA 2P16A 1GBEA 1WOFA 2A7JA 3P92A 4Y7BA 3RXAA 1SI5H 1O2IA 3A81A 3ZVFA 2TGTA 1C9PA 3MYWA 1XUGA 1K1NA 4QT8C 1MAXA 3T62A 1UCYE 4ABFA 1Y5BT 2GP9B 1FLEE 4KKDA 1O3HA 3V12A 1F0TA 2VWMA 3TIUA 3S0NA 3HATH 2A4GA 3Q76A 1AY6H 1YF4A 4BXSA 1P2OA 1C1TA 4MDSA 2VIOA 2ZFSA 5F8TA 5GCHG 1K1OA 2BTCE 3ENSB 5E0JA 1P57B 1LTOA 3RMNH 2ZGBH 1ID5H 3D65E 1WSSH 1DE7H 3F9FA 2IN2A 1LPKB 1P12E 2BD3A 2DE8A 2W3KA 4AFSA 4MG3A 1EP5A 2ZECA 1C5QA 1A3BH 1PPZA 1WCZA 1NFUA 1C4Y2 4CRAA 1ELAA 2PSYA 2I6QA 3SNCA 1A46H 4AG2A 2AEIH 4UEHH 1ELGA 1UK4A 2JETC 2LNCA 2HNTC 2F9NA 2FWWA 1O2WA 1K22H 3QN7A 3P70B 1DXPA 1QRXA 2STBE 2CMYA 4KP0A 4ZUHA 1G2LA 3EDXB 3V0XA 4B73A 2ANMH 2R0LA 2ZU5A 1GI7B 1KLTA 5GDSH 1ELFA 1HJAC 3UWJH 3BTDE 1HJ9A 2ALVA 4X1RU 1GHBG 3Q3XA 2SNWA 3VB7A 2Y5GA 4X2YA 7GCHG 3MH5A 1EB2A 1Q3XA 1XUIA 1OWJA 1NO9H 1L4ZA 1OWDA 1SGIB 3P95A 5GJ4B 3MU4A 4FUDA 1BTWA 3B8JA 4Q7XA 1HPGA 1C2JA 2GCTB 4K3JA 1GMDG 3BTKE 3BEFB 3GY6A 4I8KA 3SI3H 3K6YA 1O36A 1ZTJA 2ZU1A 3LGUA 3W95A 2W7SA 2FI4E 1E34B 1ANBA 1FY4A 4SGAE 2UUJB 3M37A 2FPZA 1GDNA 1J17T 1DUAA 5FAHA 5JDUB 1P2NA 2EC9H 1BTXA 2PKAA 3UUZA 1TFXA 3NK8A 1P06A 1AFQB 2UUFB 1O5AB 1ZSLA 3FP8E 2OD3B 4MNXA 1O3DA 5HYOA 3HGNA 2D1JA 1CT0E 3SV8A 1UVTH 3ODDA 1SB1H 3BTTE 3SJ9A 3PMHB 3ZZCA 2NU3E 5A2MH 1WQVH 4FUEA 2HPPH 3T25A 1T4VH 1FJSA 1OPHB 5EG4A 1EQ9A 1O3JA 4Z0KA 2QC2A 4WXIA 1ZPBA 3BIUH 1RTFB 2BY6X 1NRRH 2ZDLA 2VIWA 3SN8A 5EU8A 1NFWA 1DOJA 1GHXH 1O32A 2PUQH 1IAUA 1U6QA 2GGVB 1C2LA 3TJVA 3PMAB 2HALA 1CA0B 1P11E 1GCDA 2J94A 1C2IA 1GMHF 1LVMA 4UE7H 1PYTC 2C93B 1SPJA 1FMGA 1BRBE 2PGQB 2GT8A 3BSQA 4AFQA 2R2MB 3NUMA 1O2MA 4LZ1H 2QYIA 1FY5A 2PFEA 1ESAA 2F83A 3MU1A 4JK5A 3BG4C 5DP8A 2ZTXA 4X8SH 1F0UA 3PMJA 2BLVA 1C1NA 3ZVGA 2XC0A 2ZHWH 1Z71A 1GJBB 1UVOA 4Y0ZE 1MTNC 3A8AA 1TOMH 4GHTA 2GD4B 5EXLA 1QURH 4DT7B 3CS0A 4K1SA 2OC8A 3RP2A 2P3FH 1TLDA 1AE5A 3LH1A 1NU9A 3A7WA 3RXDA 1GHZA 1M9UA 4ABDA 1O5GH 1P05A 1DLKB 3SO3A 5A0AE 2GDDA 1YM0A 3BV9B 1NC6A 1GBTA 4AGJA 4FVBA 1FY8E 3RXIA 2V3HH 1JRSA 4ABGA 4I31A 5A8XA 2B8OH 1TGBA 1CHGA 2J34A 4UFGH 1HDTH 3M5MA 2Y5HA 3S9CA 5FCRA 1AO5A 4DURA 1C5SA 4U2WA 1JIMA 1XUJA 1QRZA 4JCNA 5A8YA 2LPRA 4VGCB 2FLBH 3A7XA 5GCHF 3HKJB 5BPEA 1P2JA 2I6SA 2G4TA 3OU0A 1LVBA 1ELVA 3KGPA 1Y3UA 3DD2H 2DE9A 3TITA 3LH3A 1O31A 1L0ZA 4MPVA 3KIDU 2GV6A 1GHWH 2ZI2H 4MPXA 2BD5A 5DP7A 3V7TA 1YCPM 5DP3A 3M3SA 3NPSA 5EPNA 2ZPRA 4CRDA 4AB9A 2SGPE 5LH8A 2WPLS 4D7FA 1SGFG 3TGJE 3A7ZA 1O33A 3BTGE 2BX4A 5GPIB 5A0CA 2Y81A 1QL9A 4Z6AH 3LDXH 1O30A 4TPYA 1GHBF 5FBIA 4IC6A 1TBQH 1UTMA 6GCHG 2AS9A 1QNJA 3ZYDA 7GCHF 1G37A 3A84A 1W7GH 3GCNA 1NPMA 3T5FH 3RLWH 1EX3A 4YESB 1W8BH 1CT4E 1BUIA