3P8FA

Crystal structure of mt-sp1 in complex with sfti-1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ST14 protein
publication title Structure of catalytic domain of Matriptase in complex with Sunflower trypsin inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA01
3RP2A 4X8VH 2VIQA 3BG8A 1FUJA 1LQEA 1FNIA 4INLA 1FMGA 3A8CA 1AKSB 1GJDB 2VIDA 4K69A 2OC0A 1LHDH 1ZTJA 2F9OA 2BDBA 1LDTT 3RXCA 4FUEA 1LVOA 1DPOA 4RSPA 2D8WA 3BTHE 4WVPE 2O8LA 2VU8E 1T32A 1O3EA 1V2JT 4ABDA 1LQDB 1V2MT 2SGPE 4UE7H 4B74A 1M9UA 4MVNA 3GY5A 5JYIA 1KSNA 3K2UA 3TGIE 2FOHA 3RM0H 1K28D 1P06A 1Z71A 3JZ2B 3MU8A 1G2MA 1O2KA 1C5LH 1YP9A 5JPMH 2ZEBA 1MTSA 1WAYB 4KKDA 1GJAB 3DFLA 3H7OA 1DANH 2P3UB 2BZAA 2JETB 2ZZUH 3OX7U 1BMAA 2H9EH 2QF0A 3NXPA 2H1UA 1WBGB 4H6SB 2Z3CA 1MKXH 3RXEA 1HBTH 1GWAA 1EJMA 4KTSA 1DWCH 8ESTE 1C5MD 4ASHA 4JCNA 4ZROA 1FY8E 2XBWA 3ZZ3A 2R2MB 1DWDH 2Y6TA 4KP0A 2R0LA 1HDTH 1KXEA 1O3MA 3SUDA 1HUTH 1SC8U 3A7VA 4FUBA 3A89A 4I8HA 4KELA 4F49A 3C1KA 4JYTA 1P3CA 1FI8A 3A81A 1QL7A 3RXSA 5FAHA 3MNCA 5L30H 4UD9H 1OWDA 1P2QA 4FUCA 1NRQH 1NC6A 1YPKH 4AGJA 1UTMA 2A32A 1UK2A 3P8GA 1NY22 2GCHF 1DFPA 1ZJDA 2BVSH 2C4FH 1TMBH 1ZTKA 1HAPH 1TMUH 1XUHA 2JH0D 5EQQA 1FQ3A 2WPJS 1BTXA 4OS4A 1SGRE 1SFQB 2JH5D 1DUAA 3U8OH 2QYIA 1HAVB 1TQ7B 2C8YB 3PO1C 2CF9H 3TH4H 2DE9A 3TLOA 5L2ZH 5C1XA 3U8RH 2PUXB 1OP2A 5F8TA 1NRNH 1IOEA 2CXVA 1LMWB 1KTSB 2FEQH 4FUGA 3SU5A 1AVWA 1PPFE 4AG1A 1MTNB 1W13U 2BB4A 1G37A 3UIRA 1IQJA 4CR5A 2BDHA 1SHHB 1S0RA 2B0FA 3DFJA 2BM2A 1MBMA 2BY7X 1BBRK 3M3TA 1EX3A 5T3HA 1CT4E 4X6NA 5FBEA 2VJ1A 3RXJA 4WH6A 4D8NA 1QGFA 1QQ4A 1WTHD 3AASA 4FUJA 3M3VA 3PYHA 1HLTH 3SU2A 1HJAB 3LC5A 4MPWA 3M36A 1O33A 1TBQH 2VH0A 1UCYK 1O2VA 5HGGA 1O3PB 4XOJA 1TRYA 1LO6A 5EW1H 1C2EA 1QRWA 1HRTH 3T27A 4O9VA 1SGQE 3P8NA 3SZNA 4BTUB 1XKBC 4BAOB 1C2KA 1A46H 2VINA 5EODA 4ABBA 1O2GH 3O8RA 1D9IA 2V0BA 2NU4E 4U01A 3RU4T 1TA2A 1E37B 4UFEH 2R3YA 1NZQH 3STIA 1NROH 3A8AA 3MO6A 2CV3A 1ARBA 2IN2A 1FPCH 1Y3WA 2XC0A 2ANYA 1ZGVA 1T8LA 2A7HA 4LXBH 4I33A 3F9EA 1P11E 2NU2E 1CA0C 1T4VH 3UNSA 4K8BA 1F5LA 1ZRBA 4XBDA 3O8CA 3ZZCA 1SG8B 4X8SH 1ACBE 2RA0A 1HIAA 2WUBA 3K65B 4NIWA 1Z1JA 3U1JB 4ABAA 4SGBE 1JMOH 1AI8H 4K8YA 1AWHB 2CHAC 2ZU5A 2PUQH 3RC4A 1LVYA 4FUFA 3SGBE 4X1NU 1PQ8A 1SSXA 3FP6E 1EZXC 1FV9A 5TJXA 4ZXXH 2FIRH 4BTIB 3CS0A 3E1XB 1C2HA 3U69H 4BOHA 3SJ8A 2A4OA 4FXGH 1OYTH 3KQDA 1Z1IA 4YT7H 5AFZH 2BXTH 1Y8TA 1HGTH 3VXFH 4YOJA 4MPXA 1ZPBA 2WV4A 1O3NA 2A4QA 2ZPRA 4ZH8A 5FBIA 3BEIB 2PR3A 1TBRH 2AEIH 3GDVA 5T6GA 4CHAC 2ANKH 1A5GH 2G4TA 1TBZH 1E34B 3GY7A 2BZ6H 2UUKB 3U9AH 4DY7B 5J4QA 2STBE 2C8XB 3ZYEA 3E8LA 3T25A 4AFZA 3BTGE 1OP8A 3EYDA 4X1PU 1DLKB 1P2KA 3MU1A 1YPHC 3HK6B 2BX4A 4TYDA 2SFAA 4Y8YA 1C1UH 2EC9H 1O2JA 4QT8C 2OQUA 1FY1A 2PWXA 1C5YB 2BD4A 3ODDA 3KGPA 1O3IA 4XFQA 2SNVA 2GMTB 1EKBB 2Z9LA 3HGPA 2LPRA 2VGCB 1RTLA 1O3GA 2ZFTA 3CP7A 3SV8A 1BRAA 3TGKE 5HYOA 1QB9A 1YPMH 4X2VA 2W5EA 4X6MA 1NFUA 3EAJA 1NS3A 2M5TA 2HWLB 3ZZ4A 3RXFA 1UVPA 1CSOE 1ETTH 2FOAA 1OXGA 3TU7H 4CREA 1W0ZU 1A3BH 3GY8A 4MPVA 1QTFA 2ZDNA 1V2WT 2OD3B 3UPEA 1CBWB 1THPB 1Z8RA 1ZYOA 4ZHLU 1P12E 1C1NA 5DP8A 3ODFA 3Q3XA 1EOLA 4Y6DA 1TX6A 1BUIA 3EQ0H 2OBQA 1LKBA 2J4IA 1XMNB 1JWTA 3QDZB 1C5TA 1TE0A 2BQ6B 2STAE 5DJ7A 3TK6A 1BTPA 2HPQH 1EATA 2BY5X 2FOEA 3KQEA 2GX4A 1WOFA 2QXJA 1FY4A 1PPZA 4X8UH 3MO3A 3SGQE 1SGYE 1GI7B 1F0SA 5TCAA 4IW4E 9LPRA 3OTJE 4JMYA 3MU5A 4ESTE 2FOGA 2EI7A 2IOTA 4OS6A 1BIOA 2FS9A 2P3FH 2VIOA 1GI5A 3ELAH 3ZVFA 3SQEE 2RCEA 2J95A 1VGCC 4AORA 2UUJB 4ABJA 1F92A 3DUXH 4XE4A 1L4ZA 4LZ1H 2D1JA 4HTCH 5DGJA 2G4UA 3EA9A 4PROA 1GMHG 3AAUA 2W26A 1DXPA 4BAMB 2PSYA 2IPHA 1TONA 1H9IE 1P01A 1TGBA 3F9GA 1O0DH 3URCA 1H4WA 3K6YA 3E91A 4TY7A 2BLQA 1OWKA 4Y0YE 1MAXA 1Y59T 4AX9H 3TVJB 4IC6A 1O31A 2FPZA 1QA7A 1YBWA 3GY4A 2TGPZ 1QBNA 3PMBB 4K5ZA 4GHTA 2I6SA 2OXSA 6CHAB 1OP0A 2AH4X 1F5RA 5GJ4B 1SFIA 5EXLA 1PQ5A 2VIPA 3SNDA 2BDCA 1G3DA 2FOFA 3KQCA 1QJ7B 3VB5A 3SU1A 2QC2A 1CQQA 1E38B 4AFSA 5DO4H 5LPEA 1UVSH 1PPBH 5FPSA 1NM6A 2WINI 2FI4E 3PMJA 3RXVA 1DSUA 2VWOA 1XUKA 5FCRA 3KL6A 1FPHH 1EPTA 1K22H 1LVMA 1T8MA 2O8TA 2OINA 2ESTE 1C5XB 4D7GA 4NSYA 3V3MA 1P10A 1THRH 2B5TB 2UUFB 3O8DA 3RXDA 1O2QA 5G4BA 2ZFSA 2ZU3A 1UHBB 1UMAH 1O3OA 1AE8H 1O3FA 3RXQA 3RXBA 2XRCA 1K1PA 2EI6A 3M37A 1EAUA 1AB9C 1GBCA 3M5NA 2PLXA 2VB0A 2Q6DA 3SV6A 2A5AA 1BTWA 5DG6A 2UUYA 1BBRE 4H6TA 2FX4A 1SOZA 3SBKA 1BZXE 2ODPA 1O2XA 3ATIA 5DP4A 4LZ4B 1E0FD 3I78A 4YO9A 1P2IA 1SQAA 5IYTA 2FI5E 4JZEH 1TA6A 4K1TA 4O3UA 2GT7A 5GXPA 3RMLH 1PPHE 2HNTC 2HALA 2QIQA 1QBOA 2JETC 2ZA5A 2ANMH 3GCHC 1U6QA 1MZDA 3SU6A 3LH1A 3MU0A 1S6HA 4Y10E 1W3CA 1LPGB 2YNBA 3ZVEA 1RIWB 1W8BH 1C5QA 3M5LA 2J9NA 1W14U 1CVWH 2WV5A 3QGNB 4RKJB 2DE8A 1O35A 4WH8A 3SUEA 1IQMA 1HFDA 3GOVB 4AOQA 1V3XA 2D26C 2FLRH 1YCPK 2QF3A 3SI4H 4BAQB 3LKWA 1O5GH 1VJ9U 1XUGA 1ZHRA 3QTVH 2ZDAH 1AWFH 1GJ5H 3BN9A 5LGOA 2O8UA 2XBYA 2FODA 2WYGA 1DS2E 3QO6A 2XCFA 3GISB 1GJ8B 3TK5A 1WQVH 3Q00A 5HXFA 2FTLE 1DITH 1VZQH 3ZV8A 4Y7BA 2AS9A 1O5BB 1DUEA 2H5CA 1V2LT 1DVAH 1O3CA 1SLUB 2H9TH 2WUCA 2OC7A 1AE5A 4RKOB 3GDUA 3ZZ6A 3FP8E 1V2KT 1MQ5A 1GMHF 4IN1A 1D3DB 2R3UA 5BPEA 1YC0A 5CMXH 3DD2H 5C67A 3A7YA 4D76A 4NZQA 1OPHB 1GHVH 3NWUA 2XW9A 1ZR0A 3MH7A 7ESTE 4BXWA 4DVAU 3IITA 1MTNC 4MNWA 1F5KU 3RXHA 1C2JA 3Q3KA 4NA8A 2PHBA 3KF2A 3GCNA 3RC5A 1SQTA 3M3SA 3SW2B 1UJ1A 2BVXH 4Y76A 2ZGCA 2XBXA 1EZQA 1ELDE 1HV7A 1C5SA 1GI0A 3QGJA 2OLGA 4AZ2B 4XSKU 2V6NA 1ORFA 1TOMH 2ZHDA 1HJAC 1GVLA 3SHCH 4BAKB 1O3KA 1SGDE 1SPJA 4OGYA 5A8XA 1O5DH 1EUFA 3LGTA 4WXIA 1AB9B 2XXLA 4MDSA 4GVUA 1PPEE 1N6XA 2QXHA 3RMNH 5C5OA 1WQSA 1FLEE 1BBRH 3LONA 2CN0H 2Z9KA 2XWBI 1JIMA 1TALA 4FUDA 5JDUB 1TLDA 5JBBS 2AFQB 1J17T 2ZI2H 1DXWA 2NU3E 5DP5A 1AUTC 3GCHB 4Q7ZA 1IQFA 1VCPA 4Y7AA 3FFGA 3MH6A 1EP6A 2GTBA 1CT2E 2BD8A 2C93B 1NRRH 4NWKA 1TX7A 1QB1A 1YPGH 1QRXA 1XXDA 1OX1A 2EA3A 1ETRH 1C4V2 5FXLA 3D62A 1BJVA 3E90B 4VGCB 4E7RG 2CGAA 2G51A 3A8BA 4FVDA 1OSSA 5DP6A 1TNIA 3M35A 2ILNA 1FZZA 1S83A 1K9OE 4YOGA 2KAIA 1UVTH 4RN6A 1HJ9A 1AIXH 1TPOA 1TNKA 3SUGA 1DY8A 3SV2H 1QJ1B 2BYAX 2PW8H 4ABIA 2XWAA 2Y81A 1T31A 3RMMH 2JKHA 1EAXA 2B9LA 2QV1A 4BNRA 3RXPA 1SGFA 3U98H 4NZLA 2Z3EA 2XC5A 1NRSH 4OS5A 3GCTG 1H8DH 1ABIH 3M5OA 1IQHA 1C5WB 2GZ7A 1O2TA 1Y5BT 3KEEA 3A83A 4JZFH 4WXVA 2ZGXH 1A4WH 1ANCA 1GBDA 5HMAA 3V12A 3HKIB 2AIQA 3D49H 4I8KA 1EJNA 1QBVH 2FMJA 1GJ9B 1P03A 1O38A 1C5UA 2SNWA 4U32A 1GI2A 1JBUH 2W7UA 3NKKA 3E0PB 3RXMA 1QNJA 1O5CB 4HI3A 1HIAB 1SGFG 2UWLA 1GDQA 1GI3A 1Z6EA 3A85A 1MUEB 1SI5H 3V7TA 3ATLA 1TAWA 3MH4A 1BRUP 1LKAA 3NK8A 5I46H 2VWLA 3SOSA 5A0BA 3WY8A 4CRCA 4ABGA 1P9SA 4XBBA 1UTQA 6ESTA 1ARCA 4X0WU 3H5CB 2GCTB 1VITG 2K1QA 1G30B 4FUIA 1PYTC 1UVUH 3TPIZ 1YCPM 4A5TS 1AD8H 2Y5GA 3BTWE 2G5VA 2GMTC 5C2ZA 1P05A 2OBOA 2P95A 2VGCC 2A4RA 2FOCA 5E8EH 1BOQA 1BMLA 3PWBA 1HXFH 2QXIA 3VB4A 2GT8A 1P0SH 1Y3YA 3KHVA 2HOBA 1T4UH 4GLYA 2G81E 1C2MA 5ESBA 2WPMS 4NCYA 1EQ9A 2ALVA 5E0JA 1FY3A 1K1LA 2VWNA 3KIDU 3AVZA 1O2ZA 2FX6A 2ZHEH 1D6RA 2ZP0H 2A31A 1GMCG 2Z9IA 3V0XA 2FOBA 3MMGA 3LJJA 2AGGX 1CBWC 1NESE 3CS7A 3L6PA 3Q3YA 3QLPH 3GYLB 1AUJA 1QIXB 2PGQB 1D4PB 3TNSA 1A0LA 3KNXA 3BSQA 3RU4D 2F9VA 1W10U 1YKTA 4I31A 3UR6A 1MCVA 1L0ZA 1ZSKA 1BT7A 2F9BH 1HAIH 4E05H 1W0YH 1GI6A 1ESAA 2FM2A 1QQUA 2ALPA 1BTUA 2FO9A 4NFFA 3SQHE 5T6DA 1AMHA 2FI3E 4I8GA 1Z8IB 3EE0B 3NZIA 1MZAA 3B9FH 1Q2WA 4ZHMU 4A1TA 4OS1A 1QJ6B 2EI8A 1K1IA 1O3BA 5L2YH 2BTCE 1SMFE 1ZOMA 1SQOA 1TGCA 3E6PH 1ZJKA 4AB9A 5PTPA 4INHA 1AU8A 2TIOA 3S7KB 2YOLA 1C1OA 4NFEA 5DPAA 1Z7KA 2ZO3H 1J16A 4B76A 1VCQA 5JBCS 3BG4B 1C9TA 1ZSJA 1SVPA 3D23A 1MD8A 4DG4A 3M7QA 1GJCB 2SGFE 3TJNA 3F9FA 3UWIA 2HLCA 3G01A 3GCTF 1DM4B 2GDEH 4IGDA 4E06H 4IBLH 1L2EA 1L1GA 2Z9JA 2GV6A 4XBCA 1ETSH 6CHAC 1Q31A 3UWJH 3T28A 3ZV9A 1J14A 3VPKA 1GBLA 4Z6AH 4UONA 4CR9A 1RXPA 3PMHB 1ZRKA 2LNCA 2G00A 3ZVDA 2RDLA 1LHEH 2ZTYA 4JK5A 3S0NA 5A0AE 1F0UA 2FZZA 3URDA 1GI1A 3A86A 3SI3H 4H42U 1A2CH 3ATMA 3W94A 3VGCB 3MOCA 3AAVA 3GICB 4KTCA 1VITF 2FP7B 1GBHA 1S85A 3EA7A 3TJVA 1P04A 1A1RA 3TIUA 3T2NA 4DJZB 2GKVE 3LDXH 2ZCLP 5A0CA 4E7NA 2QCYA 4CBOA 4WF8A 3KQBA 1C1TA 1JRTA 2WPLS 2FS8A 1GI4A 1O2IA 3U1IB 2XC4A 2ZTZA 1YF4A 3AW0A 1GCTB 2ZCKP 2ZPSA 1N6YA 2GDDA 2P16A 3PM3A 3LC3A 2F91A 3DA9B 2HNTF 1SOTA 1DY9A 3SN8A 4GHQA 3A7ZA 4CRBA 4Q80A 1W12U 3LGIA 4J2YB 1GMCF 1KIGH 4FU9A 4FVBA 5DP7A 5C5NA 1ANDA 1PPCE 4IN2A 2J2UA 1HAYB 2A2XH 1EPTB 2BOKA 4KGAA 4B75A 4THNH 2ZFQH 1C2LA 1C2FA 3PTBA 1RIWC 5C20A 2AGIX 2H9HA 1DX5M 1K1JA 5A2MH 3GDSA 3T26A 2O8MA 5E0GA 1EP5A 2C90B 2A2QH 1YM0A 4CBNA 1O3JA 1W11U 1O5EH 1GGDB 1A5IA 1SL3A 1GG6B 1MKWK 1UK4A 5EPYA 5EW2H 2PKAA 1BRCE 1NT1A 3DHKH 3RXTA 2BLOA 2ZIQH 5A8ZA 1DSTA 1V6DA 3S9AA 3RLYH 2ZNKH 3EA8A 1A61H 4X1QU 1S0QA 3PTNA 8LPRA 1THSH 1BITA 1ELVA 1ZPCA 4B71A 5EU8A 2ZFPH 4NIVA 3TGJE 3RUOA 2G8TA 2XBVA 2DUCA 1RRKA 4U30A 1O39A 2FOMB 1RS0A 2BDIA 1YCPH 1WCZA 1BMMH 2BQWB 1FAXA 2ODQA 1HPGA 1HAOH 3VEQB 1TGTA 2A4GA 1C1RA 3OY5U 2P59A 1TPAE 1YLCA 5C3NA 3ZZ7A 2QAAA 1A5HA 1UTPA 2BOHB 2ZKSA 5FX6A 3RU4E 1B7XB 1AZZA 2Q1JA 5E2OA 8GCHG 3BV9B 5C1YA 4FUHA 4BANB 3ZVBA 1SGNE 4NSVA 1AZ8A 1GL0E 1O36A 3GCOA 2W7SA 1UTOA 3FANA 4GCHG 1OWIA 1L1NA 2BDAA 2I6QA 2GV7A 1O37A 3MI4A 1NN6A 1NO9H 3F1SB 1Z6JH 4WJG2 2SGDE 3BTQE 3B8JA 1YPLH 3A7XA 1HAGE 5F6MA 1GI8B 1W7GH 3SV7A 4ISLA 1AN1E 1S82A 4MLFB 4ZKOU 5AF9H 3SV9A 1PPGE 4JZ1A 3S69A 1IQLA 2ASUB 1KDQA 1ZHMA 2PV9B 3A84A 1DDJA 1DOJA 5FHTA 3UREA 3N7OA 5HM2A 1CHOG 1TFXA 5C1UA 5GCHG 3BEUA 3PLKA 1F0RA 1Z8JB 4A6LA 3KCGH 2AMPA 4CH8B 4D9RA 1GVKB 1DWBH 5AVDA 1FXYA 4GAWA 2Z9GA 1HYLA 2HNTE 1UCYE 1W2KH 2ZGHA 1GDNA 1AFQB 1ELCA 3UR9A 1XVOA 4BAHB 1DWEH 4MG3A 1ESBA 1PYTD 3SJKA 3KN2A 2VIVA 5EQRA 3VFEA 1WU1A 1INCA 5DP3A 1JXPA 1O2UA 2H6MA 3E16B 1CE5A 3VB6A 3QWCH 4Y0ZE 1Y3VA 5FX5A 5CHAB 1VJAU 2Z94A 4VGCC 3FZZA 1H9LB 1OWEA 2XNIA 2GZ9A 1OWJA 5JBTA 5FPYA 1V2RT 4CRAA 2J92A 2FYRA 1BHXF 1C2IA 1LVBA 3ZVGA 2A7CA 1C5OH 1BTZA 4DIHH 1ESTA 3EDXB 1SGCA 2WPKS 1TNHA 3MNBA 1NU9A 1O3LA 1TPPA 2ZQ2A 4Y11E 2FTMA 2QGRA 1O2HA 3RC6A 1C1WH 3O8BA 2YNAA 3PLPA 1JRSA 3LT3A 6GCHG 1SB1H 1MU8B 4YTAA 1FN6A 1OWHA 1ELGA 4HZHA 5SGAE 1IQNA 2W3KA 3OYPA 1X7AC 1UHBA 5EPNA 1RGQA 2ZG0H 1V2VT 3QZRA 4B2CA 1J8AA 1ABJH 2P3TB 1UTKA 4X6OA 5E0HA 1O3DA 1EXFA 3ITIA 4YLQH 5ABWA 5LPFA 1FJSA 1ELBA 1XXFA 5EXMA 1E35B 4M7GA 3PROA 1JIRA 4ISIH 2KAIB 3ZVAA 1GDUA 4MNVA 1SLXB 2AYWA 4R8TB 2GCTC 3C27B 2WPHS 2ZHQH 1DICA 1LHCH 1TGNA 1GBJA 4X6PA 2WPIS 2BY8X 3P92A 3RLWH 4JZDH 4YM9A 8GCHF 1RD3B 1VITH 1PFXC 1S6FA 1MBQA 4UFDH 5A09A 7KMEH 4R0IA 3LJOA 4DGJA 1ELFA 4GCHF 1LHGH 1MTVA 4TPIZ 1WUNH 3SHAH 4F4OC 2OCVB 1LCYA 2ZTXA 1Z8GA 1IQEA 4JZIA 2VVCA 1P3EA 3SU3A 2H5DA 1XKAC 1AVXA 1AY6H 2BX3A 4IS5A 2OTVA 1BJUA 2OC1A 4UDWH 3RXKA 1C1MA 3ZZAA 2QN5T 1UCYH 2SGAA 1FY5A 2O8WA 5EXNA 1P2OA 2VNTA 1P02A 2H2ZA 1V2NT 3K9XB 1GJ7B 1K1MA 3ZYDA 1SGPE 3IG6B 1CHOF 1AFEH 5GCHF 1V2OT 3F68H 3ZZ9A 4ISOA 1GVZA 4A7IB 1P57B 1E36B 5L6NH 1O2YA 1C4Y2 1QY6A 4HGCA 2W3IA 3UNQA 1FAKH 1KLJH 1TRMA 1A0HB 3BTKE 2ZU2A 2ZCHP 1D3PB 3FZDA 3E3TA 3BF6H 3TJOA 1H1BA 1P09A 5F8ZA 1V2PT 2A1DB 4HFPB 2NU0E 3TH2H 1GBAA 3R3GB 4TPYA 2HRVA 1V2TT 2A0QB 4ZKNU 3P8OA 3F9HA 4X2XA 1GBMA 3GY6A 4LK4A 4WMFA 2ZQ1A 3SO3A 1YLDA 1QHRB 3UTUH 2PKSB 3QN7A 4WMDA 2FYQA 3ZVCA 1CGJE 1TIOA 3LH3A 1ZMLA 3P6ZB 1YYY1 4GPGA 1AKSA 1ZMNA 1FIWA 1O3AA 1O34A 4MTBA 1GJBB 4YT6H 1O2MA 4I7YH 4ZXYH 2Y5HA 2R2WU 2AMQA 3VB3A 3LOXA 2RA3A 3VXEH 1B5GH 4NA9H 3BG4C 2SGEE 2ZDLA 3SU0A 1VR1H 2F83A 3S9BA 1EOJA 1TNJA 1V2QT 2BHGA 1KY9A 1XVMA 1QRZA 2RG3A 1J9CH 4O3TA 1TRNA 3ATWA 2A5IA 4NGAH 2ZU4A 4MPUA 5GPIB 1GCDA 1H8IH 6GCHF 1O2SA 5A8YA 1CHGA 3LIWA 3UQOA 3P17H 3HGNA 1LPKB 2J34A 2P8OB 2QY0B 3K6ZA 3I77A 4TWYA 5DK1A 1C5NH 5AFYH 1KXAA 1NFWA 1QL8A 4Y71A 3CENA 3RDZA 2GD4B 1TMTH 2A5KA 2Z6BD 4X1RU 4YLUA 1G3BA 1A0JA 1GBIA 5DKMA 3BEFB 3MWIU 3JZ1B 1GHZA 4YESB 2EEKA 2AIPA 2CJIA 2OC8A 2ZFFH 2V35A 1VCWA 3HATH 2ANWA 5DP9A 3B23B 1HB0B 1N1LA 1BRBE 2PTCE 3MHWU 1EB2A 3A7TA 3VGCC 1B0EA 4B2BA 3RXOA 3F6UH 1ZMJA 2FDAA 1O5AB 1F2SE 3SNBA 3UOUA 2ODYB 1BTHH 3BTME 2GVFA 4SGAE 1NRPH 1KXDA 1OYQA 2V3HH 1MKXK 1W7XH 1HAZB 3TK9A 4ZMAH 2O9QA 4OS7A 4DIIH 3MU4A 3A7WA 3BIVH 5ESTE 7LPRA 4UFGH 4JYVH 1T8NA 2ULLA 4Z0KA 1C2DA 5B6OA 1GMDG 2P94A 2ZPQA 2ZDVH 2ZU1A 1HCGA 1GHBG 4D7FA 1GCTC 2C8WB 1HAXB 2ZFRH 7GCHG 1QFKH 3QK1A 4K1EA 5FPTA 3I29A 1Y3XA 5GIBA 4KTUA 3UQVA 2PTNA 3EGKH 3FP7E 1A7SA 1G9IE 1N8OC 3PLBA 1YPEH 4IMZA 1G32B 1C5PA 3SJIA 1HAVA 1MMJN 3LPRA 1ELTA 1IQGA 4ZKRU 1ID5H 1GHAG 2Y82A 2OP9A 3UNRA 1EPTC 1K1OA 2BD9A 5FCKA 3S9CA 4NIXA 2ZDMA 3QTOH 2FXRA 2VVVA 4DCDA 2AGEX 1NPMA 4BXSA 2BQ7B 4JK6A 3SGAE 1ELAA 4UEHH 1GGDC 1GG6C 1G36A 5AHGH 1V2UT 4Q2KA 3V13A 4IC5A 2VWMA 1BDAA 1BHXB 1QR3E 1ANBA 2F9NA 3PB1E 5TCCA 2B8OH 1KYNA 1S5SA 3R0FA 4ZAEA 5HM9A 1TQ0B 2BY9X 3SNAA 2BY6X 2HVXA 1GBKA 4ZKSU 2G52A 1HAHH 2XYAA 3GY2A 4K2YA 1MCTA 1O30A 3LGYA 4INKA 3LGUA 3GY3A 1UTNA 3E0NB 2AMDA 1TABE 4K3JA 1AO5A 1MKWH 4IMQA 4MNYA 1YPHE 3PO1B 5GDSH 1O2LA 1MD7A 4Q7XA 1K2I1 1GJ4H 1CGHA 1TNLA 2QXGA 2ZF0H 2CF8H 1LTOA 3BTEE 2F9UA 1ANEA 1CGIE 1RFNA 6LPRA 1P2MA 1J15A 5J4SA 3FVFB 5JB9S 2IJOB 4X1SU 2BD2A 1B0FA 3T62A 1C5ZB 2UWOA 4GUXA 3M7TA 1H9HE 3A82A 1G3CA 5CE1A 2G55A 3OU0A 2PKAB 1SBWA 3AW1A 1RJXB 1P2NA 1IQIA 2TGTA 1OS8A 4ZUHA 1OKXA 4J1YA 3TH3H 4ABEA 2TBSA 3M5MA 1CT0E 3RM2H 4DT7B 1G3EA 1TB6H 1EASA 4NG9H 3ZZBA 4WY3A 1XX9A 1FONA 1TPSA 4Q7YA 4WWYA 1BMNH 1LHFH 2ZGBH 1XUFA 4AG2A 3ZZ5A 4AN7A 1F7ZA 1TX8A 5K7RA 1RTKA 3MNSA 5E2PA 2B7DH 4X8TH 4GSOA 4OGXA 2R9PA 1O2PA 3A88A 4I8LA 2OQ5A 1Q3XA 3HPTB 3OSYA 4Y79A 4OS2A 2BMGB 1MU6B 2TGAA 3M7UA 2A7JA 2ZC9H 4Y8ZA 2GGVB 2J94A 1V2ST 1Y5UT 2CMYA 3A80A 4NWLA 4YOIA 3MO9A 1N8OB 1ZGIA 1ZTLA 5JBAS 3P70B 4H4FA 5EQSA 1AFQC 1EZSC 1CA0B 5IDKA 3A8DA 1GMDF 3LU9B 1EAWA 5EOKA 1YGCH 4X2YA 4U2WA 4Y8XA 1D6WA 4CRDA 4O97A 2Y7XA 4UFFH 1GHBF 3RXIA 1NFXA 1JOUB 1YPJH 5LPRA 3TJUA 7GCHF 3VB7A 1KXBA 4FU8A 5CHAC 1UO6A 3GYMA 3SUFA 1TGSZ 3MH5A 2CHAB 5EG4A 3NUMA 1C4U2 4DOQA 4YZUA 4ABHA 1QL9A 4AYYB 2AERH 3BIUH 2NU1E 4AFQA 4AGKA 1KDQB 1GHAF 1MH0A 5GWZA 2Y5FA 3Q76A 1AQ7A 1BQYA 3W95A 1CA8B 3MYWA 1GBFA 2BVRH 2PSXA 1CO7E 1MTWA 3L3TA 1SHYA 1KXCA 3SJ9A 1GL1A 2BLWA 1NU7B 4AYVB 4I32A 3OY6U 5F8XA 2J38A 4CRFA 1GHWH 1C9PA 1EJAA 3P95A 2BDYA 1C5RA 3RXLA 1O2WA 1XUIA 1GPZA 3DT0H 1SGIB 1TNGA 2ZDKA 4CHAB 1ZPZA 1UTLM 1C1PA 2R0KA 3BTDE 3RMOH 2FLBH 3MFJA 2F3CE 1GHXH 3S7HB 1EAIA 2JH6D 1TOCB 1UTJA 3Q77A 1C1QA 4TWWA 4ISNA 3PWCA 3NCLA 2XTTB 2VVUA 3TITA 3T5FH 1MAYA 2QA9E 4B1TA 1O2RA 3UUZA 5BRRE 1CU1A 3H7TA 1G2LA 4NIYA 1P8VC 2V3OH 2BD3A 1O32A 3ZZ8A 4ZHAA 9ESTA 2TGDA 4A92A 1LPZB 3IWMA 8KME2 1GBTA 1EZUC 1SLWB 4LOYH 5H4IB 1C2GA 1XUJA 1IHSH 1KXFA 1ZHPA 3MNXA 1AVGH 1SR5C 1GI9B 1C1SA 3ESTA 1IHTH 3HK3B 3UY9A 1WTGH 3PV4A 2THFB 1AGJA 1K1NA 2ZGJA 2VIWA 1A3EH 5F03A 3SNEA 2ZECA 1HXEH 2OUAA 3SJOA 1P2JA 1O2NA 1O5FH 2Q6FA 2BD7A 3M61U 3NPSA 2C8ZB 2G5NA 2BLVA 3MTYA 1D3QB 2A45B 2ZWLH 4DW2U 1NTPA 2PFEA 1WV7H 3ATKA 2BXUH 2UWPA 1NFYA 1HNEE 2P93A 3ENSB 4CH2B 5ETXA 1TWXB 3T29A 4MNXA 3SORA 1Y5AT 2HPPH 4WMEA 4O03A 1EB1H 2WYJA 2Y80A 2GP9B 1F0TA 1FDPA 2FWWA 1O3HA 1IQKA 1K21H 1ZSLA 1BTYA 1MQ6A 1DT2A 1AHTH 4CRGA 4I8JA 1S84A 2BDGA 4NA7A 4TY6A 3RXUA 1QB6A 2NWNA 3PMAB 3LGWA 4B73A 4ISHH 1SGEE 2VH6A 1FN8A 1DE7H 1QURH 4D9QA 2PGBB 2Y7ZA 2Z3DA 1VGCB 4BTTB 1UVOA 1ELEE 1ZLRA 2C3SA 2ZHFH 2HGTH 5T6FA 1GHYH 1GJ6A 1WSSH 5JB8S 3U8TH 1SLVB 2GCHG 3ZZDA 4A1VA 5K0HA 3RXAA 1GBBA 2PKSC 3RXRA 4B2AA 1ZZZA 4AB8A 3UOPA 1SGTA 1QCPA 4XDEA 1L4DA 4DURA 1D3TB 1KTTB 1WYKA 2F9PA 3D65E 4JYUH 3QZQA 4A1XA 4AFUA 1L1JA 1OOKB 1KLTA 1MTUA 3SNCA 3QX5H 3STJA 3RXGA 1RTFB 2SGQE 1DLEA 4X2WA 3QUMP 1IAUA 3FAOA 3TNTA 5EGMA 1BB0B 1BA8B 2TRMA 1O2OA 1PQ7A 1UK3A 1PQAA 1C1VH 5I25A 3BTTE 1KLIH 3BTFE 3L33A 1TYNA 2XCNA 3LGVA 3A87A 1C5VA 2D2DA 4ABFA 5LH8A 1BCUH 1Y3UA 1S81A 2ZHWH 4K1SA 3SU4A 1P9UA 4MQAA 2TPIZ 3HKJB 3P8FA 3UFAA 2P8OC 4K60A 1GBEA 1PJPA 1QA0A 2Q6GA 1HJ8A 1XM1A 2BD5A 4FU7A 1FIZA 1T7CA 1T8OA 2GZ8A 2FESH 2Z7FE
chains in the Genus database with same CATH superfamily
3RP2A 4X8VH 2VIQA 3BG8A 1FUJA 1LQEA 1FNIA 4INLA 1FMGA 3A8CA 1AKSB 1GJDB 2VIDA 4K69A 2OC0A 1LHDH 1ZTJA 2F9OA 2BDBA 1LDTT 3RXCA 4FUEA 1LVOA 1DPOA 4RSPA 2HLDD 2D8WA 3BTHE 4WVPE 2O8LA 2VU8E 1T32A 1O3EA 1V2JT 4ABDA 1LQDB 1V2MT 2SGPE 4UE7H 4B74A 1M9UA 4MVNA 3GY5A 5JYIA 1KSNA 3K2UA 3TGIE 1SQRA 2FOHA 3RM0H 1K28D 1P06A 1Z71A 3JZ2B 3MU8A 1G2MA 1O2KA 1C5LH 1YP9A 5JPMH 2ZEBA 1MTSA 1WAYB 4KKDA 1GJAB 3DFLA 3H7OA 1DANH 2CK3D 5CHBA 2P3UB 2BZAA 2JETB 2ZZUH 3OX7U 1BMAA 2H9EH 2QF0A 3NXPA 2H1UA 1WBGB 4AC9A 4H6SB 2Z3CA 1MKXH 3RXEA 1HBTH 3UAIC 1GWAA 1EJMA 4KTSA 1DWCH 8ESTE 1C5MD 4ASHA 4JCNA 4ZROA 1FY8E 3GS9A 2XBWA 2YMSC 3ZZ3A 2R2MB 4B6FA 1DWDH 2Y6TA 4KP0A 2R0LA 1HDTH 1KXEA 4XD7D 1O3MA 3SUDA 1HUTH 1SC8U 3A7VA 4FUBA 3A89A 4I8HA 4KELA 4F49A 3C1KA 4JYTA 1P3CA 1FI8A 3A81A 1QL7A 3RXSA 5FAHA 3MNCA 5L30H 4UD9H 1OWDA 1P2QA 4FUCA 1NRQH 1NC6A 1YPKH 4AGJA 1UTMA 2A32A 1UK2A 3P8GA 1NY22 2GCHF 1DFPA 1ZJDA 2BVSH 2C4FH 1TMBH 1ZTKA 1HAPH 1TMUH 2KCYA 1XUHA 2JH0D 5EQQA 1FQ3A 2WPJS 1BTXA 4OS4A 1SGRE 1SFQB 2JH5D 1DUAA 3U8OH 2QYIA 1HAVB 1TQ7B 2C8YB 3PO1C 2CF9H 3TH4H 2DE9A 3TLOA 3H09A 5L2ZH 5C1XA 3U8RH 2PUXB 1OP2A 5F8TA 1NRNH 1IOEA 2CXVA 1LMWB 1KTSB 2FEQH 4FUGA 4HG6A 3SU5A 1AVWA 1PPFE 4AG1A 1MTNB 1W13U 2BB4A 1G37A 3UIRA 1IQJA 4CR5A 2KZ4A 2BDHA 1SHHB 1S0RA 2B0FA 3DFJA 2BM2A 1MBMA 2BY7X 1BBRK 3M3TA 1EX3A 5T3HA 1CT4E 4X6NA 5FBEA 2VJ1A 3RXJA 4WH6A 4D8NA 1QGFA 1QQ4A 2WSSD 1E79D 2JDID 1NBME 1WTHD 3AASA 4FUJA 3M3VA 3PYHA 1HLTH 3SU2A 1HJAB 3LC5A 4MPWA 3M36A 1O33A 1TBQH 2VH0A 1UCYK 1O2VA 5HGGA 1O3PB 4XOJA 1W0JD 1TRYA 1LO6A 5EW1H 1C2EA 1QRWA 1HRTH 3T27A 4O9VA 1WXRA 1SGQE 3P8NA 3SZNA 4BTUB 1XKBC 4BAOB 1C2KA 1A46H 2VINA 5EODA 4ABBA 1O2GH 3O8RA 1D9IA 2V0BA 2NU4E 4U01A 3RU4T 1TA2A 1E37B 4UFEH 2R3YA 1NZQH 3STIA 1NROH 3A8AA 3MO6A 2CV3A 1ARBA 2IN2A 1FPCH 1Y3WA 2XC0A 2ANYA 1ZGVA 1T8LA 2A7HA 4LXBH 4I33A 3F9EA 1P11E 5HIYA 2NU2E 1CA0C 1T4VH 3UNSA 4K8BA 1F5LA 1ZRBA 4XBDA 3O8CA 3ZZCA 1SG8B 4X8SH 1ACBE 2RA0A 1HIAA 2WUBA 3K65B 4NIWA 1Z1JA 3U1JB 4ABAA 4SGBE 1JMOH 1AI8H 4K8YA 1AWHB 2CHAC 2J97A 2ZU5A 2PUQH 3RC4A 1LVYA 4FUFA 3SGBE 4X1NU 1PQ8A 1SSXA 3FP6E 3WWFA 1EZXC 1FV9A 5TJXA 4ZXXH 2FIRH 4BTIB 3CS0A 3E1XB 1C2HA 3U69H 4BOHA 3SJ8A 2A4OA 4FXGH 1OYTH 3KQDA 1Z1IA 4YT7H 5AFZH 2BXTH 1Y8TA 1HGTH 3VXFH 4YOJA 4MPXA 1ZPBA 2WV4A 1O3NA 2A4QA 2ZPRA 4ZH8A 5FBIA 3BEIB 2PR3A 1TBRH 2AEIH 3GDVA 5T6GA 4CHAC 2ANKH 1A5GH 2G4TA 1TBZH 1E34B 3GY7A 2BZ6H 2UUKB 3U9AH 4DY7B 5J4QA 2STBE 2C8XB 3ZYEA 3E8LA 3N99A 3T25A 4AFZA 3BTGE 1OP8A 3EYDA 4X1PU 1DLKB 1P2KA 3MU1A 1YPHC 3HK6B 2BX4A 4TYDA 2SFAA 4Y8YA 1C1UH 2EC9H 1O2JA 4QT8C 2OQUA 1FY1A 3DSOA 2PWXA 1C5YB 2BD4A 3ODDA 3OAAD 3KGPA 1O3IA 4XFQA 2SNVA 2GMTB 1EKBB 2Z9LA 3HGPA 2LPRA 2VGCB 1RTLA 1O3GA 2ZFTA 3CP7A 3SV8A 1BRAA 3TGKE 5HYOA 1QB9A 1YPMH 4X2VA 2W5EA 4X6MA 1NFUA 3EAJA 1NS3A 2M5TA 2HWLB 3ZZ4A 3RXFA 1UVPA 1CSOE 1ETTH 2FOAA 1OXGA 3TU7H 4CREA 1W0ZU 1A3BH 3GY8A 4MPVA 1QTFA 2ZDNA 1V2WT 2OD3B 3UPEA 1CBWB 1THPB 1Z8RA 1ZYOA 4ZHLU 1P12E 1C1NA 5DP8A 3ODFA 3Q3XA 1EOLA 4Y6DA 1TX6A 1BUIA 2AHME 2XNDD 3EQ0H 2OBQA 1LKBA 2J4IA 2W6JD 1XMNB 1JWTA 3QDZB 1C5TA 1TE0A 2BQ6B 2STAE 5DJ7A 3TK6A 1BTPA 2HPQH 1EATA 2BY5X 2FOEA 3KQEA 2GX4A 1WOFA 4F55A 2QXJA 1FY4A 1PPZA 4X8UH 3MO3A 3SGQE 1SGYE 1GI7B 1F0SA 5TCAA 4IW4E 9LPRA 3OTJE 4JMYA 3MU5A 4ESTE 2FOGA 2EI7A 2IOTA 4OS6A 1BIOA 2FS9A 2P3FH 2VIOA 1GI5A 3ELAH 3F0OA 3ZVFA 3SQEE 2RCEA 2J95A 1VGCC 4AORA 2UUJB 5DSFA 5FL7D 4ABJA 1F92A 3DUXH 4XE4A 1L4ZA 4LZ1H 2D1JA 4HTCH 5DGJA 2G4UA 3EA9A 4PROA 1GMHG 3AAUA 2W26A 1DXPA 4BAMB 2PSYA 2IPHA 1TONA 1H9IE 1P01A 3N7EA 1TGBA 3F9GA 1O0DH 3URCA 2QF5A 1H4WA 3K6YA 3E91A 4TY7A 2BLQA 1OWKA 4Y0YE 1MAXA 1Y59T 4AX9H 3TVJB 4IC6A 1O31A 2FPZA 1QA7A 1YBWA 3GY4A 2TGPZ 1QBNA 3PMBB 4K5ZA 4GHTA 2I6SA 2OXSA 6CHAB 1OP0A 2AH4X 1F5RA 5GJ4B 1SFIA 5EXLA 1PQ5A 2VIPA 3SNDA 2BDCA 2JJ2D 1G3DA 2FOFA 3KQCA 1QJ7B 3VB5A 3SU1A 2QC2A 1CQQA 1E38B 4AFSA 5DO4H 5LPEA 1UVSH 1PPBH 5FPSA 1NM6A 2WINI 4RT1A 2FI4E 3PMJA 2WPDD 1DSUA 3RXVA 2VWOA 1XUKA 5FCRA 3KL6A 1FPHH 1EPTA 1K22H 1LVMA 1T8MA 2O8TA 2OINA 2ESTE 1C5XB 4D7GA 4NSYA 3V3MA 1P10A 1THRH 2B5TB 2UUFB 3O8DA 2JIZD 3RXDA 1O2QA 5G4BA 2ZFSA 2ZU3A 2HVYB 1UHBB 1UMAH 1O3OA 1AE8H 1O3FA 3RXQA 3RXBA 2XRCA 1K1PA 2EI6A 3F3BA 3M37A 1EAUA 1AB9C 1GBCA 3M5NA 2PLXA 2VB0A 2Q6DA 3SV6A 2A5AA 1BTWA 5DG6A 2UUYA 1BBRE 4H6TA 2FX4A 1SOZA 3SBKA 1BZXE 2ODPA 1O2XA 3ATIA 5DP4A 4LZ4B 1BMFD 1E0FD 3I78A 2K0QA 4YO9A 1P2IA 1SQAA 5IYTA 2FI5E 4JZEH 1TA6A 4K1TA 4O3UA 2GT7A 5GXPA 3RMLH 1PPHE 2HNTC 2HALA 2QIQA 1QBOA 2JETC 2ZA5A 2ANMH 3GCHC 1U6QA 5KECA 1MZDA 3SU6A 3LH1A 3MU0A 1S6HA 4Y10E 1W3CA 1LPGB 2YNBA 3ZVEA 1RIWB 1W8BH 1C5QA 3M5LA 2QF4A 2J9NA 1W14U 1CVWH 2WV5A 3QGNB 5CDFE 4RKJB 2DE8A 1O35A 4WH8A 3SUEA 1IQMA 2L74A 1HFDA 3GOVB 4AOQA 1V3XA 1W0KD 2D26C 2FLRH 1YCPK 2QF3A 3SI4H 4BAQB 3LKWA 1O5GH 1VJ9U 1XUGA 1ZHRA 3QTVH 2ZDAH 1AWFH 1GJ5H 3BN9A 5LGOA 2O8UA 2XBYA 2FODA 2WYGA 3KQ5A 1DS2E 3QO6A 2XCFA 3GISB 1GJ8B 3TK5A 5C0TA 1WQVH 3U28C 3Q00A 5HXFA 2FTLE 1DITH 1VZQH 3ZV8A 2W6ID 4Y7BA 2AS9A 1O5BB 1DUEA 2H5CA 1V2LT 1DVAH 3KYGA 1O3CA 1SLUB 2H9TH 2WUCA 2OC7A 1AE5A 4RKOB 3GDUA 3ZZ6A 3FP8E 1V2KT 1MQ5A 1GMHF 3MQKC 4IN1A 1D3DB 2R3UA 5BPEA 1YC0A 5CMXH 3DD2H 5C67A 3A7YA 4D76A 4NZQA 4I86A 1OPHB 1GHVH 3NWUA 2XW9A 1ZR0A 3MH7A 7ESTE 4BXWA 4P00A 4DVAU 3IITA 1MTNC 4MNWA 1F5KU 3RXHA 1C2JA 3Q3KA 1E1RD 2PHBA 3KF2A 4NA8A 3GCNA 3RC5A 1SQTA 2KR7A 3M3SA 3SW2B 1UJ1A 2BVXH 4Y76A 2ZGCA 1S6LA 2XBXA 1EZQA 1ELDE 1HV7A 1C5SA 1GI0A 2V3MA 3QGJA 2OLGA 3F2HA 4XSKU 4AZ2B 2V6NA 1ORFA 1TOMH 4TT3D 2ZHDA 1HJAC 1GVLA 3SHCH 4BAKB 1O3KA 1SGDE 1SPJA 4OGYA 5EJZA 5A8XA 1O5DH 1EUFA 3LGTA 4WXIA 1AB9B 2XXLA 4MDSA 4GVUA 1PPEE 1N6XA 2QXHA 3RMNH 5C5OA 1WQSA 1FLEE 1BBRH 3LONA 2CN0H 2Z9KA 2XWBI 1JIMA 1TALA 4FUDA 5JDUB 1TLDA 5JBBS 2AFQB 1J17T 2ZI2H 1DXWA 2NU3E 5DP5A 1AUTC 3GCHB 4Q7ZA 1IQFA 1VCPA 4Y7AA 3FFGA 3MH6A 1EP6A 2GTBA 1CT2E 2BD8A 2C93B 1NRRH 3PRBA 4NWKA 1TX7A 1QB1A 1YPGH 1QRXA 1XXDA 1OX1A 2EA3A 1ETRH 1C4V2 5FXLA 3D62A 1BJVA 3E90B 4VGCB 4E7RG 2CGAA 2G51A 3A8BA 4FVDA 1OSSA 5DP6A 1TNIA 3M35A 2ILNA 1FZZA 1S83A 1K9OE 4YOGA 2KAIA 1UVTH 4RN6A 4YXWD 1HJ9A 1AIXH 1TPOA 1TNKA 3SUGA 1DY8A 3SV2H 1QJ1B 2BYAX 2PW8H 4ABIA 5EJLA 2XWAA 2Y81A 1T31A 3RMMH 2JKHA 1EAXA 2B9LA 2QV1A 4BNRA 3RXPA 1SGFA 3U98H 4NZLA 2Z3EA 2XC5A 1NRSH 4OS5A 3GCTG 1K0HA 1H8DH 1ABIH 3M5OA 1IQHA 1C5WB 2GZ7A 1O2TA 1Y5BT 3KEEA 3A83A 4JZFH 4WXVA 2ZGXH 1A4WH 1ANCA 1GBDA 5HMAA 3V12A 3HKIB 2AIQA 3D49H 4I8KA 1EJNA 1QBVH 2FMJA 1GJ9B 1P03A 1O38A 1C5UA 2SNWA 4U32A 1GI2A 1JBUH 2W7UA 3NKKA 3E0PB 3RXMA 1QNJA 1O5CB 4HI3A 1HIAB 1SGFG 4Q63A 2UWLA 1GDQA 1GI3A 1Z6EA 3A85A 1MUEB 1SI5H 3V7TA 3ATLA 1TAWA 3MH4A 1BRUP 1LKAA 3NK8A 5I46H 2VWLA 3SOSA 5A0BA 3WY8A 4CRCA 4ABGA 1P9SA 4XBBA 1UTQA 6ESTA 1ARCA 4X0WU 3H5CB 2GCTB 1VITG 2K1QA 1G30B 4FUIA 1PYTC 3F2FA 1UVUH 3TPIZ 1YCPM 4A5TS 2JJ1D 1AD8H 2Y5GA 3BTWE 2G5VA 2GMTC 5C2ZA 2KM0A 1P05A 2OBOA 2P95A 3OEED 2VGCC 2A4RA 2FOCA 5E8EH 1BOQA 1BMLA 3PWBA 1HXFH 2QXIA 3VB4A 2GT8A 1P0SH 1Y3YA 3KHVA 2HOBA 1T4UH 4GLYA 2G81E 1C2MA 5ESBA 4B6EA 2WPMS 4NCYA 1EQ9A 2ALVA 5E0JA 1FY3A 1K1LA 2VWNA 3KIDU 3AVZA 1O2ZA 3SYJA 2FX6A 2ZHEH 1D6RA 2ZP0H 2A31A 1GMCG 2Z9IA 3V0XA 2FOBA 3MMGA 3LJJA 2AGGX 1CBWC 1NESE 3CS7A 3L6PA 3N7DA 3Q3YA 3QLPH 3GYLB 1AUJA 1QIXB 1D4PB 2PGQB 3TNSA 1A0LA 3KNXA 3BSQA 3RU4D 2F9VA 1W10U 1YKTA 4I31A 3UR6A 1MCVA 1L0ZA 1ZSKA 1BT7A 3KYFA 2F9BH 1HAIH 4E05H 1W0YH 4M9FA 1GI6A 1ESAA 2FM2A 1QQUA 1E1QD 1BTUA 2ALPA 2FO9A 4NFFA 3SQHE 5T6DA 1AMHA 2FI3E 4I8GA 1Z8IB 3EE0B 3NZIA 1MZAA 3B9FH 1Q2WA 4ZHMU 4A1TA 4OS1A 1QJ6B 2EI8A 1K1IA 1O3BA 5L2YH 2BTCE 1SMFE 1ZOMA 1SQOA 2EQNA 1TGCA 5C94A 3E6PH 1ZJKA 4AB9A 5PTPA 4INHA 1AU8A 2TIOA 3S7KB 2YOLA 1C1OA 4NFEA 5DPAA 1Z7KA 2ZO3H 1J16A 4B76A 3F2GA 1VCQA 5JBCS 3BG4B 1C9TA 1ZSJA 1SVPA 2IJD1 3D23A 1MD8A 4DG4A 3M7QA 1GJCB 2SGFE 3TJNA 3F9FA 3UWIA 2HLCA 3G01A 3GCTF 1DM4B 2GDEH 4IGDA 4E06H 4Z1MD 2WHXA 4IBLH 1L2EA 1L1GA 2Z9JA 2GV6A 4XBCA 1ETSH 6CHAC 1Q31A 3DCLA 3UWJH 3T28A 3ZV9A 1J14A 3VPKA 1GBLA 4Z6AH 4UONA 4CR9A 1RXPA 3PMHB 1ZRKA 2LNCA 2G00A 3ZVDA 2RDLA 1LHEH 2ZTYA 4JK5A 3S0NA 5A0AE 1F0UA 2FZZA 3URDA 1GI1A 3A86A 3SI3H 3DSPA 4H42U 2QE7D 1A2CH 3ATMA 3W94A 3VGCB 3MOCA 4DT4A 3AAVA 3GICB 4KTCA 1VITF 2FP7B 1GBHA 1S85A 3EA7A 3TJVA 1P04A 1A1RA 3TIUA 3T2NA 4DJZB 2GKVE 2L6OA 3LDXH 2ZCLP 5A0CA 4E7NA 2QCYA 4CBOA 4WF8A 3KQBA 1C1TA 1JRTA 2WPLS 2FS8A 1GI4A 1O2IA 3U1IB 2XC4A 2F4LA 2ZTZA 1YF4A 3AW0A 1GCTB 2ZCKP 2ZPSA 1N6YA 2GDDA 2P16A 3PM3A 3LC3A 2F91A 3DA9B 2HNTF 1SOTA 1DY9A 3SN8A 4GHQA 5T1VA 3A7ZA 2LP6A 4CRBA 4Q80A 1W12U 3LGIA 4J2YB 1GMCF 1KIGH 4FU9A 4FVBA 5DP7A 5C5NA 1ANDA 1PPCE 5HIZA 4IN2A 2J2UA 1HAYB 2A2XH 1EPTB 2BOKA 4KGAA 5EIYA 4B75A 4THNH 2ZFQH 1C2LA 1C2FA 2LELA 3PTBA 1RIWC 5C20A 2AGIX 2H9HA 1DX5M 1K1JA 5A2MH 3GDSA 3T26A 5GNDA 2O8MA 5E0GA 1EP5A 2C90B 2A2QH 1YM0A 5KGOA 1O3JA 4CBNA 1W11U 1O5EH 1GGDB 1A5IA 1SL3A 1GG6B 1MKWK 1UK4A 5EPYA 5EW2H 2PKAA 1BRCE 1NT1A 3DHKH 3RXTA 2BLOA 2ZIQH 3PV2A 5HKKD 5A8ZA 1DSTA 1V6DA 3S9AA 3RLYH 2ZNKH 3EA8A 1A61H 4X1QU 1S0QA 3PTNA 8LPRA 1THSH 1BITA 1ELVA 1ZPCA 4B71A 5EU8A 2ZFPH 4NIVA 3TGJE 3RUOA 2G8TA 2XBVA 2DUCA 1RRKA 4U30A 1O39A 2FOMB 2KCPA 1RS0A 2BDIA 1YWUA 1YCPH 1WCZA 1BMMH 2BQWB 1FAXA 2ODQA 1HPGA 1HAOH 3VEQB 1TGTA 2A4GA 2YMSD 1C1RA 3OY5U 2P59A 1TPAE 1YLCA 5C3NA 3ZZ7A 2QAAA 1A5HA 1UTPA 2BOHB 2ZKSA 5FX6A 3RU4E 1B7XB 1AZZA 2Q1JA 1FX0B 5E2OA 8GCHG 1QZ8A 3BV9B 5C1YA 4FUHA 4BANB 3ZVBA 1SGNE 4NSVA 1AZ8A 1GL0E 1O36A 3GCOA 2W7SA 1UTOA 3FANA 4GCHG 1OWIA 1L1NA 2BDAA 2I6QA 2GV7A 1O37A 3MI4A 1NN6A 1NO9H 3F1SB 1Z6JH 2RFKC 4WJG2 2SGDE 3BTQE 3B8JA 1YPLH 3A7XA 1HAGE 5F6MA 1GI8B 1W7GH 3SV7A 4ISLA 1AN1E 1S82A 4MLFB 4ZKOU 5AF9H 3SV9A 5EJ1A 1PPGE 4JZ1A 3S69A 1IQLA 2ASUB 1KDQA 1ZHMA 2PV9B 3A84A 1DDJA 1DOJA 5FHTA 3UREA 3N7OA 4FETA 5HM2A 1CHOG 1TFXA 5C1UA 5GCHG 3BEUA 3PLKA 1F0RA 1Z8JB 4A6LA 3KCGH 2AMPA 4CH8B 4D9RA 1GVKB 1DWBH 3CNRA 5AVDA 1FXYA 4GAWA 3SZEA 2Z9GA 1HYLA 2HNTE 1UCYE 1W2KH 2ZGHA 1GDNA 1AFQB 1ELCA 3UR9A 1XVOA 4BAHB 1DWEH 4MG3A 1ESBA 1PYTD 3SJKA 3KN2A 2VIVA 3NRLA 5EQRA 3VFEA 1WU1A 1INCA 5DP3A 1JXPA 1O2UA 2H6MA 3E16B 1CE5A 3VB6A 3QWCH 4Y0ZE 1Y3VA 5FX5A 5CHAB 1VJAU 2Z94A 4VGCC 3FZZA 1H9LB 1OWEA 2XNIA 2GZ9A 1OWJA 5JBTA 5FPYA 1V2RT 4CRAA 2J92A 2FYRA 1BHXF 3PRDA 1C2IA 2J5UA 1LVBA 3OTPA 3ZVGA 2A7CA 1C5OH 1BTZA 5C17A 1ESTA 3EDXB 4DIHH 1SGCA 2WPKS 1TNHA 3MNBA 1NU9A 1O3LA 1TPPA 2ZQ2A 4Y11E 2FTMA 2QGRA 1O2HA 3RC6A 1C1WH 3O8BA 2YNAA 3PLPA 4Q4LA 1JRSA 3LT3A 6GCHG 1SB1H 1MU8B 4YTAA 1FN6A 1OWHA 1ELGA 4HZHA 3ZIAD 5SGAE 1IQNA 2W3KA 3OYPA 1X7AC 1UHBA 5EPNA 1RGQA 2ZG0H 1V2VT 3QZRA 4B2CA 1J8AA 1ABJH 2P3TB 1UTKA 4X6OA 5E0HA 1O3DA 1EXFA 3ITIA 2IPQX 4YLQH 5ABWA 5LPFA 1FJSA 2KCOA 2KFWA 1ELBA 1XXFA 5EXMA 1E35B 5KEDA 4M7GA 3PROA 1JIRA 4ISIH 4RI0A 2KAIB 3ZVAA 1GDUA 1COWD 4MNVA 1SLXB 2AYWA 4R8TB 2GCTC 3C27B 2WPHS 2ZHQH 1DICA 3FOAA 1LHCH 1TGNA 1GBJA 4X6PA 2WPIS 2BY8X 3P92A 3RLWH 4JZDH 4YM9A 8GCHF 1RD3B 1VITH 1PFXC 1S6FA 1MBQA 4UFDH 5A09A 7KMEH 4R0IA 3LJOA 3FKSD 4DGJA 1ELFA 4GCHF 1LHGH 1MTVA 4TPIZ 1WUNH 3SHAH 4F4OC 3OE7D 2OCVB 1LCYA 2ZTXA 1Z8GA 1IQEA 2V7QD 4JZIA 2VVCA 1P3EA 3SU3A 2H5DA 1XKAC 3DSGA 1AVXA 1AY6H 2BX3A 4IS5A 2OTVA 1BJUA 2OC1A 4UDWH 3RXKA 1C1MA 3ZZAA 2QN5T 1UCYH 2SGAA 1FY5A 2O8WA 5EXNA 1P2OA 2VNTA 1P02A 2H2ZA 1V2NT 3K9XB 1GJ7B 1K1MA 3ZYDA 1SGPE 3IG6B 1CHOF 1AFEH 5GCHF 1V2OT 3F68H 3ZZ9A 4ISOA 1GVZA 4A7IB 1P57B 1E36B 5L6NH 1O2YA 1C4Y2 1QY6A 4HGCA 2W3IA 3UNQA 1FAKH 1KLJH 1TRMA 2F43B 1A0HB 3BTKE 2ZU2A 2ZCHP 1D3PB 3FZDA 3E3TA 3BF6H 3TJOA 1H1BA 1P09A 5F8ZA 1V2PT 2A1DB 4HFPB 2NU0E 3TH2H 1GBAA 3R3GB 4TPYA 2HRVA 1V2TT 1OHHD 2A0QB 3P8OA 4ZKNU 3F9HA 4X2XA 1GBMA 3GY6A 4LK4A 4WMFA 2ZQ1A 3SO3A 1YLDA 2J98A 1QHRB 3UTUH 2PKSB 3QN7A 4WMDA 2FYQA 3ZVCA 1CGJE 1TIOA 3LH3A 1ZMLA 3P6ZB 1YYY1 4GPGA 1AKSA 1ZMNA 1FIWA 1O3AA 1O34A 4MTBA 2XOKD 1GJBB 1SKYE 2VBCA 4YT6H 1O2MA 4I7YH 4ZXYH 2Y5HA 2R2WU 2AMQA 3VB3A 3LOXA 2RA3A 3VXEH 4ACAA 2GJGA 1B5GH 4NA9H 3BG4C 2SGEE 2ZDLA 3SU0A 1VR1H 2F83A 3S9BA 1H8ED 1EOJA 1TNJA 1V2QT 2BHGA 1KY9A 1XVMA 1QRZA 2RG3A 1J9CH 4O3TA 1TRNA 3ATWA 2A5IA 4NGAH 2ZU4A 4MPUA 5GPIB 1GCDA 1H8IH 6GCHF 1O2SA 5A8YA 1CHGA 3FO8D 3LIWA 3UQOA 4TSFD 3P17H 3HGNA 1LPKB 2J34A 2P8OB 2QY0B 3K6ZA 3I77A 4TWYA 5DK1A 1C5NH 5DN6D 5AFYH 1KXAA 1NFWA 1QL8A 4Y71A 3CENA 3RDZA 2GD4B 4RT0A 1TMTH 2A5KA 2Z6BD 4X1RU 4XRNA 4YLUA 1G3BA 1A0JA 1GBIA 3PV5A 2M2AA 5DKMA 3BEFB 2WZQA 3OEHD 3MWIU 3JZ1B 1GHZA 4YESB 2EEKA 2AIPA 2CJIA 2OC8A 2ZFFH 2V35A 1VCWA 3HATH 2ANWA 5DP9A 3B23B 1HB0B 1N1LA 1BRBE 2PTCE 3MHWU 1EB2A 3A7TA 3VGCC 1B0EA 4B2BA 3RXOA 3F6UH 1ZMJA 2FDAA 1O5AB 1F2SE 3SNBA 3UOUA 2ODYB 1BTHH 3BTME 2GVFA 4SGAE 1NRPH 1KXDA 1OYQA 2V3HH 1MKXK 1W7XH 1HAZB 3TK9A 4ZMAH 2O9QA 4OS7A 4DIIH 3MU4A 3A7WA 3BIVH 5ESTE 7LPRA 4UFGH 4JYVH 1T8NA 2ULLA 4Z0KA 1C2DA 5B6OA 1GMDG 2WV9A 2P94A 2ZPQA 2ZDVH 1EFRD 2ZU1A 1HCGA 1GHBG 4D7FA 1GCTC 2C8WB 1HAXB 2ZFRH 7GCHG 1QFKH 3QK1A 4K1EA 5FPTA 3I29A 1Y3XA 5GIBA 4KTUA 3UQVA 2PTNA 3EGKH 3FP7E 1A7SA 1G9IE 1N8OC 3PLBA 1YPEH 4IMZA 4ASUD 4ZCNA 1G32B 1C5PA 3SJIA 1HAVA 1MMJN 3WWBA 3LPRA 1ELTA 1IQGA 4ZKRU 1ID5H 1GHAG 2Y82A 2OP9A 3UNRA 1EPTC 1K1OA 2BD9A 2YMSB 5FCKA 3S9CA 4NIXA 2ZDMA 3QTOH 2FXRA 2VVVA 4DCDA 2AGEX 1NPMA 4BXSA 2BQ7B 4JK6A 3SGAE 1ELAA 4UEHH 1GGDC 1GG6C 1G36A 5AHGH 1V2UT 4Q2KA 3V13A 4IC5A 2VWMA 1BDAA 1BHXB 1QR3E 1ANBA 2F9NA 3PB1E 5TCCA 2B8OH 1KYNA 1S5SA 3WW7A 3R0FA 4ZAEA 5HM9A 1TQ0B 2BY9X 3SNAA 2BY6X 2HVXA 1GBKA 4ZKSU 2G52A 1HAHH 2XYAA 3GY2A 4K2YA 1MCTA 1O30A 3LGYA 4INKA 3LGUA 2OK5A 2KCAA 3GY3A 2K8IA 1UTNA 3E0NB 2AMDA 1TABE 4K3JA 1AO5A 1MKWH 4IMQA 4MNYA 1YPHE 3PO1B 5GDSH 1O2LA 1MD7A 4Q7XA 1K2I1 1GJ4H 1CGHA 1TNLA 2QXGA 2ZF0H 2CF8H 1LTOA 3BTEE 2F9UA 1ANEA 1CGIE 1RFNA 3OFND 6LPRA 1P2MA 1J15A 5J4SA 3FVFB 5JB9S 2IJOB 4X1SU 2BD2A 1B0FA 3T62A 1C5ZB 2UWOA 4GUXA 3M7TA 1H9HE 3A82A 1G3CA 5CE1A 4P02A 2G55A 3OU0A 2PKAB 1SBWA 3AW1A 1RJXB 2RDEA 1P2NA 1IQIA 2TGTA 1OS8A 4ZUHA 1OKXA 4J1YA 3TH3H 4ABEA 2TBSA 5IK2D 2KX4A 3M5MA 1CT0E 3RM2H 4DT7B 1G3EA 1TB6H 1EASA 4NG9H 1MABB 3ZZBA 4WY3A 1XX9A 1FONA 1TPSA 4Q7YA 4WWYA 1BMNH 1LHFH 2ZGBH 1XUFA 3FN8A 4AG2A 3ZZ5A 4AN7A 1F7ZA 1TX8A 1KMHB 5K7RA 1RTKA 3MNSA 5E2PA 2B7DH 4X8TH 4GSOA 4OGXA 2R9PA 1O2PA 3A88A 4I8LA 2OQ5A 1Q3XA 3HPTB 3OSYA 4Y79A 4OS2A 2BMGB 1MU6B 2TGAA 3M7UA 2A7JA 2ZC9H 4Y8ZA 2GGVB 2J94A 1V2ST 1Y5UT 2CMYA 3A80A 4NWLA 4YOIA 3MO9A 1N8OB 1ZGIA 1ZTLA 5JBAS 3P70B 4H4FA 1YLNA 1AFQC 5EQSA 1EZSC 1CA0B 5IDKA 3A8DA 1GMDF 3LU9B 1EAWA 5EOKA 1YGCH 4X2YA 4U2WA 4Y8XA 1D6WA 4CRDA 4O97A 2Y7XA 4UFFH 1GHBF 2PP6A 3RXIA 1NFXA 1JOUB 1YPJH 5LPRA 3TJUA 7GCHF 3VB7A 1KXBA 4FU8A 5CHAC 1UO6A 3GYMA 3SUFA 1TGSZ 3MH5A 2CHAB 5EG4A 3NUMA 1C4U2 4DOQA 4YZUA 4ABHA 1QL9A 4AYYB 2AERH 3BIUH 2NU1E 4AFQA 1H8HD 4AGKA 1KDQB 1GHAF 1MH0A 5GWZA 2Y5FA 3Q76A 1AQ7A 1BQYA 3W95A 1CA8B 3MYWA 1GBFA 2BVRH 2PSXA 1CO7E 1MTWA 3L3TA 1SHYA 1KXCA 3SJ9A 1GL1A 1VKYA 2BLWA 1NU7B 4AYVB 4I32A 3OY6U 5F8XA 2J38A 4CRFA 1GHWH 1C9PA 1EJAA 3P95A 2BDYA 1C5RA 3RXLA 1O2WA 1XUIA 1GPZA 3DT0H 1SGIB 1TNGA 2ZDKA 4CHAB 1ZPZA 1UTLM 1C1PA 2R0KA 3BTDE 3RMOH 2FLBH 3MFJA 2F3CE 1GHXH 4FOUC 3S7HB 1EAIA 2JH6D 1WDIA 1TOCB 1UTJA 3Q77A 1C1QA 4TWWA 4ISNA 3PWCA 3NCLA 2XTTB 2VVUA 3TITA 3T5FH 1MAYA 2QA9E 5F53A 4B1TA 1O2RA 3UUZA 5BRRE 1CU1A 3H7TA 1G2LA 4NIYA 1P8VC 2V3OH 2BD3A 1O32A 3ZZ8A 3F0PA 4ZHAA 9ESTA 2TGDA 4A92A 1LPZB 3IWMA 8KME2 1GBTA 1EZUC 1SLWB 4LOYH 5H4IB 1C2GA 1XUJA 1IHSH 1KXFA 1ZHPA 3MNXA 1AVGH 1SR5C 1GI9B 3VG8A 1C1SA 3W1EA 3ESTA 1IHTH 3HK3B 3UY9A 1WTGH 3PV4A 2THFB 1AGJA 1K1NA 2ZGJA 2VIWA 1A3EH 5F03A 3SNEA 2ZECA 1HXEH 2OUAA 3SJOA 1P2JA 1O2NA 1O5FH 2Q6FA 2BD7A 3M61U 3NPSA 2C8ZB 2G5NA 2BLVA 3MTYA 1D3QB 2A45B 2ZWLH 4DW2U 1NTPA 2PFEA 1WV7H 3ATKA 2BXUH 2UWPA 1NFYA 1HNEE 2P93A 3ENSB 4CH2B 5ETXA 1TWXB 3T29A 4MNXA 3SORA 1Y5AT 2HPPH 1UW7A 4WMEA 4O03A 1EB1H 2WYJA 2Y80A 2GP9B 1F0TA 2EY4C 1FDPA 2FWWA 1O3HA 1IQKA 1K21H 4OM9A 1YY3A 1ZSLA 1BTYA 1MQ6A 1DT2A 1AHTH 4ACBA 4CRGA 4I8JA 1S84A 2BDGA 4NA7A 4TY6A 3RXUA 1QB6A 2NWNA 3PMAB 3LGWA 4B73A 4ISHH 1SGEE 1NBMD 2VH6A 1FN8A 1DE7H 1QURH 4D9QA 2PGBB 2Y7ZA 2Z3DA 1VGCB 4BTTB 1UVOA 1ELEE 1ZLRA 2C3SA 2ZHFH 3AK5A 2HGTH 5T6FA 1GHYH 1GJ6A 1WSSH 5JB8S 3U8TH 1SLVB 2GCHG 3ZZDA 4A1VA 5K0HA 3RXAA 4F48B 1GBBA 2PKSC 3RXRA 4B2AA 1ZZZA 4AB8A 3UOPA 1SGTA 1QCPA 4XDEA 5B6LA 3EE7A 1L4DA 4DURA 1D3TB 1KTTB 1WYKA 2F9PA 3D65E 4JYUH 3QZQA 4A1XA 4AFUA 1L1JA 1OOKB 1KLTA 1MTUA 3SNCA 3QX5H 3STJA 5C0UA 3RXGA 1RTFB 2SGQE 1DLEA 4X2WA 3QUMP 1IAUA 3FAOA 3TNTA 5EGMA 1BB0B 1BA8B 2TRMA 1O2OA 1PQ7A 1UK3A 1PQAA 1C1VH 5I25A 3BTTE 1KLIH 3BTFE 3L33A 1TYNA 2XCNA 3LGVA 3A87A 1C5VA 2D2DA 4ABFA 5LH8A 1BCUH 1Y3UA 1S81A 2ZHWH 4K1SA 3SU4A 1P9UA 4MQAA 2TPIZ 3HKJB 3P8FA 3UFAA 2P8OC 4K60A 1GBEA 1PJPA 1QA0A 3UB0A 2Q6GA 1HJ8A 1XM1A 2BD5A 4FU7A 1FIZA 1T7CA 2J98B 1T8OA 2GZ8A 2FESH 2Z7FE
chains in the Genus database with same CATH topology
3RP2A 4X8VH 2VIQA 3BG8A 1FUJA 1LQEA 1FNIA 4INLA 1FMGA 3A8CA 1AKSB 1GJDB 2VIDA 4K69A 2OC0A 1LHDH 1ZTJA 2F9OA 2BDBA 1LDTT 3RXCA 4FUEA 1LVOA 1DPOA 4RSPA 2D8WA 3BTHE 4WVPE 2O8LA 2VU8E 1T32A 1O3EA 1V2JT 4ABDA 1LQDB 1V2MT 2SGPE 4UE7H 4B74A 1M9UA 4MVNA 3GY5A 5JYIA 1KSNA 3K2UA 3TGIE 2FOHA 3RM0H 1K28D 1P06A 1Z71A 3JZ2B 3MU8A 1G2MA 1O2KA 1C5LH 1YP9A 5JPMH 2ZEBA 1MTSA 1WAYB 4KKDA 1GJAB 3DFLA 3H7OA 1DANH 2P3UB 2BZAA 2JETB 2ZZUH 3OX7U 1BMAA 2H9EH 2QF0A 3NXPA 2H1UA 1WBGB 4H6SB 2Z3CA 1MKXH 3RXEA 1HBTH 1GWAA 1EJMA 4KTSA 1DWCH 8ESTE 1C5MD 4ASHA 4JCNA 4ZROA 1FY8E 2XBWA 3ZZ3A 2R2MB 1DWDH 2Y6TA 4KP0A 2R0LA 1HDTH 1KXEA 1O3MA 3SUDA 1HUTH 1SC8U 3A7VA 4FUBA 3A89A 4I8HA 4KELA 4F49A 3C1KA 4JYTA 1P3CA 1FI8A 3A81A 1QL7A 3RXSA 5FAHA 3MNCA 5L30H 4UD9H 1OWDA 1P2QA 4FUCA 1NRQH 1NC6A 1YPKH 4AGJA 1UTMA 2A32A 1UK2A 3P8GA 1NY22 2GCHF 1DFPA 1ZJDA 2BVSH 2C4FH 1TMBH 1ZTKA 1HAPH 1TMUH 1XUHA 2JH0D 5EQQA 1FQ3A 2WPJS 1BTXA 4OS4A 1SGRE 1SFQB 2JH5D 1DUAA 3U8OH 2QYIA 1HAVB 1TQ7B 2C8YB 3PO1C 2CF9H 3TH4H 2DE9A 3TLOA 5L2ZH 5C1XA 3U8RH 2PUXB 1OP2A 5F8TA 1NRNH 1IOEA 2CXVA 1LMWB 1KTSB 2FEQH 4FUGA 3SU5A 1AVWA 1PPFE 4AG1A 1MTNB 1W13U 2BB4A 1G37A 3UIRA 1IQJA 4CR5A 2BDHA 1SHHB 1S0RA 2B0FA 3DFJA 2BM2A 1MBMA 2BY7X 1BBRK 3M3TA 1EX3A 5T3HA 1CT4E 4X6NA 5FBEA 2VJ1A 3RXJA 4WH6A 4D8NA 1QGFA 1QQ4A 1WTHD 3AASA 4FUJA 3M3VA 3PYHA 1HLTH 3SU2A 1HJAB 3LC5A 4MPWA 3M36A 1O33A 1TBQH 2VH0A 1UCYK 1O2VA 5HGGA 1O3PB 4XOJA 1TRYA 1LO6A 5EW1H 1C2EA 1QRWA 1HRTH 3T27A 4O9VA 1SGQE 3P8NA 3SZNA 4BTUB 1XKBC 4BAOB 1C2KA 1A46H 2VINA 5EODA 4ABBA 1O2GH 3O8RA 1D9IA 2V0BA 2NU4E 4U01A 3RU4T 1TA2A 1E37B 4UFEH 2R3YA 1NZQH 3STIA 1NROH 3A8AA 3MO6A 2CV3A 1ARBA 2IN2A 1FPCH 1Y3WA 2XC0A 2ANYA 1ZGVA 1T8LA 2A7HA 4LXBH 4I33A 3F9EA 1P11E 2NU2E 1CA0C 1T4VH 3UNSA 4K8BA 1F5LA 1ZRBA 4XBDA 3O8CA 3ZZCA 1SG8B 4X8SH 1ACBE 2RA0A 1HIAA 2WUBA 3K65B 4NIWA 1Z1JA 3U1JB 4ABAA 4SGBE 1JMOH 1AI8H 4K8YA 1AWHB 2CHAC 2ZU5A 2PUQH 3RC4A 1LVYA 4FUFA 3SGBE 4X1NU 1PQ8A 1SSXA 3FP6E 1EZXC 1FV9A 5TJXA 4ZXXH 2FIRH 4BTIB 3CS0A 3E1XB 1C2HA 3U69H 4BOHA 3SJ8A 2A4OA 4FXGH 1OYTH 3KQDA 1Z1IA 4YT7H 5AFZH 2BXTH 1Y8TA 1HGTH 3VXFH 4YOJA 4MPXA 1ZPBA 2WV4A 1O3NA 2A4QA 2ZPRA 4ZH8A 5FBIA 3BEIB 2PR3A 1TBRH 2AEIH 3GDVA 5T6GA 4CHAC 2ANKH 1A5GH 2G4TA 1TBZH 1E34B 3GY7A 2BZ6H 2UUKB 3U9AH 4DY7B 5J4QA 2STBE 2C8XB 3ZYEA 3E8LA 3T25A 4AFZA 3BTGE 1OP8A 3EYDA 4X1PU 1DLKB 1P2KA 3MU1A 1YPHC 3HK6B 2BX4A 4TYDA 2SFAA 4Y8YA 1C1UH 2EC9H 1O2JA 4QT8C 2OQUA 1FY1A 2PWXA 1C5YB 2BD4A 3ODDA 3KGPA 1O3IA 4XFQA 2SNVA 2GMTB 1EKBB 2Z9LA 3HGPA 2LPRA 2VGCB 1RTLA 1O3GA 2ZFTA 3CP7A 3SV8A 1BRAA 3TGKE 5HYOA 1QB9A 1YPMH 4X2VA 2W5EA 4X6MA 1NFUA 3EAJA 1NS3A 2M5TA 2HWLB 3ZZ4A 3RXFA 1UVPA 1CSOE 1ETTH 2FOAA 1OXGA 3TU7H 4CREA 1W0ZU 1A3BH 3GY8A 4MPVA 1QTFA 2ZDNA 1V2WT 2OD3B 3UPEA 1CBWB 1THPB 1Z8RA 1ZYOA 4ZHLU 1P12E 1C1NA 5DP8A 3ODFA 3Q3XA 1EOLA 4Y6DA 1TX6A 1BUIA 3EQ0H 2OBQA 1LKBA 2J4IA 1XMNB 1JWTA 3QDZB 1C5TA 1TE0A 2BQ6B 2STAE 5DJ7A 3TK6A 1BTPA 2HPQH 1EATA 2BY5X 2FOEA 3KQEA 2GX4A 1WOFA 2QXJA 1FY4A 1PPZA 4X8UH 3MO3A 3SGQE 1SGYE 1GI7B 1F0SA 5TCAA 4IW4E 9LPRA 3OTJE 4JMYA 3MU5A 4ESTE 2FOGA 2EI7A 2IOTA 4OS6A 1BIOA 2FS9A 2P3FH 2VIOA 1GI5A 3ELAH 3ZVFA 3SQEE 2RCEA 2J95A 1VGCC 4AORA 2UUJB 4ABJA 1F92A 3DUXH 4XE4A 1L4ZA 4LZ1H 2D1JA 4HTCH 5DGJA 2G4UA 3EA9A 4PROA 1GMHG 3AAUA 2W26A 1DXPA 4BAMB 2PSYA 2IPHA 1TONA 1H9IE 1P01A 1TGBA 3F9GA 1O0DH 3URCA 1H4WA 3K6YA 3E91A 4TY7A 2BLQA 1OWKA 4Y0YE 1MAXA 1Y59T 4AX9H 3TVJB 4IC6A 1O31A 2FPZA 1QA7A 1YBWA 3GY4A 2TGPZ 1QBNA 3PMBB 4K5ZA 4GHTA 2I6SA 2OXSA 6CHAB 1OP0A 2AH4X 1F5RA 5GJ4B 1SFIA 5EXLA 1PQ5A 2VIPA 3SNDA 2BDCA 1G3DA 2FOFA 3KQCA 1QJ7B 3VB5A 3SU1A 2QC2A 1CQQA 1E38B 4AFSA 5DO4H 5LPEA 1UVSH 1PPBH 5FPSA 1NM6A 2WINI 2FI4E 3PMJA 3RXVA 1DSUA 2VWOA 1XUKA 5FCRA 3KL6A 1FPHH 1EPTA 1K22H 1LVMA 1T8MA 2O8TA 2OINA 2ESTE 1C5XB 4D7GA 4NSYA 3V3MA 1P10A 1THRH 2B5TB 2UUFB 3O8DA 3RXDA 1O2QA 5G4BA 2ZFSA 2ZU3A 1UHBB 1UMAH 1O3OA 1AE8H 1O3FA 3RXQA 3RXBA 2XRCA 1K1PA 2EI6A 3M37A 1EAUA 1AB9C 1GBCA 3M5NA 2PLXA 2VB0A 2Q6DA 3SV6A 2A5AA 1BTWA 5DG6A 2UUYA 1BBRE 4H6TA 2FX4A 1SOZA 3SBKA 1BZXE 2ODPA 1O2XA 3ATIA 5DP4A 4LZ4B 1E0FD 3I78A 4YO9A 1P2IA 1SQAA 5IYTA 2FI5E 4JZEH 1TA6A 4K1TA 4O3UA 2GT7A 5GXPA 3RMLH 1PPHE 2HNTC 2HALA 2QIQA 1QBOA 2JETC 2ZA5A 2ANMH 3GCHC 1U6QA 1MZDA 3SU6A 3LH1A 3MU0A 1S6HA 4Y10E 1W3CA 1LPGB 2YNBA 3ZVEA 1RIWB 1W8BH 1C5QA 3M5LA 2J9NA 1W14U 1CVWH 2WV5A 3QGNB 4RKJB 2DE8A 1O35A 4WH8A 3SUEA 1IQMA 1HFDA 3GOVB 4AOQA 1V3XA 2D26C 2FLRH 1YCPK 2QF3A 3SI4H 4BAQB 3LKWA 1O5GH 1VJ9U 1XUGA 1ZHRA 3QTVH 2ZDAH 1AWFH 1GJ5H 3BN9A 5LGOA 2O8UA 2XBYA 2FODA 2WYGA 1DS2E 3QO6A 2XCFA 3GISB 1GJ8B 3TK5A 1WQVH 3Q00A 5HXFA 2FTLE 1DITH 1VZQH 3ZV8A 4Y7BA 2AS9A 1O5BB 1DUEA 2H5CA 1V2LT 1DVAH 1O3CA 1SLUB 2H9TH 2WUCA 2OC7A 1AE5A 4RKOB 3GDUA 3ZZ6A 3FP8E 1V2KT 1MQ5A 1GMHF 4IN1A 1D3DB 2R3UA 5BPEA 1YC0A 5CMXH 3DD2H 5C67A 3A7YA 4D76A 4NZQA 1OPHB 1GHVH 3NWUA 2XW9A 1ZR0A 3MH7A 7ESTE 4BXWA 4DVAU 3IITA 1MTNC 4MNWA 1F5KU 3RXHA 1C2JA 3Q3KA 4NA8A 2PHBA 3KF2A 3GCNA 3RC5A 1SQTA 3M3SA 3SW2B 1UJ1A 2BVXH 4Y76A 2ZGCA 2XBXA 1EZQA 1ELDE 1HV7A 1C5SA 1GI0A 3QGJA 2OLGA 4AZ2B 4XSKU 2V6NA 1ORFA 1TOMH 2ZHDA 1HJAC 1GVLA 3SHCH 4BAKB 1O3KA 1SGDE 1SPJA 4OGYA 5A8XA 1O5DH 1EUFA 3LGTA 4WXIA 1AB9B 2XXLA 4MDSA 4GVUA 1PPEE 1N6XA 2QXHA 3RMNH 5C5OA 1WQSA 1FLEE 1BBRH 3LONA 2CN0H 2Z9KA 2XWBI 1JIMA 1TALA 4FUDA 5JDUB 1TLDA 5JBBS 2AFQB 1J17T 2ZI2H 1DXWA 2NU3E 5DP5A 1AUTC 3GCHB 4Q7ZA 1IQFA 1VCPA 4Y7AA 3FFGA 3MH6A 1EP6A 2GTBA 1CT2E 2BD8A 2C93B 1NRRH 4NWKA 1TX7A 1QB1A 1YPGH 1QRXA 1XXDA 1OX1A 2EA3A 1ETRH 1C4V2 5FXLA 3D62A 1BJVA 3E90B 4VGCB 4E7RG 2CGAA 2G51A 3A8BA 4FVDA 1OSSA 5DP6A 1TNIA 3M35A 2ILNA 1FZZA 1S83A 1K9OE 4YOGA 2KAIA 1UVTH 4RN6A 1HJ9A 1AIXH 1TPOA 1TNKA 3SUGA 1DY8A 3SV2H 1QJ1B 2BYAX 2PW8H 4ABIA 2XWAA 2Y81A 1T31A 3RMMH 2JKHA 1EAXA 2B9LA 2QV1A 4BNRA 3RXPA 1SGFA 3U98H 4NZLA 2Z3EA 2XC5A 1NRSH 4OS5A 3GCTG 1H8DH 1ABIH 3M5OA 1IQHA 1C5WB 2GZ7A 1O2TA 1Y5BT 3KEEA 3A83A 4JZFH 4WXVA 2ZGXH 1A4WH 1ANCA 1GBDA 5HMAA 3V12A 3HKIB 2AIQA 3D49H 4I8KA 1EJNA 1QBVH 2FMJA 1GJ9B 1P03A 1O38A 1C5UA 2SNWA 4U32A 1GI2A 1JBUH 2W7UA 3NKKA 3E0PB 3RXMA 1QNJA 1O5CB 4HI3A 1HIAB 1SGFG 2UWLA 1GDQA 1GI3A 1Z6EA 3A85A 1MUEB 1SI5H 3V7TA 3ATLA 1TAWA 3MH4A 1BRUP 1LKAA 3NK8A 5I46H 2VWLA 3SOSA 5A0BA 3WY8A 4CRCA 4ABGA 1P9SA 4XBBA 1UTQA 6ESTA 1ARCA 4X0WU 3H5CB 2GCTB 1VITG 2K1QA 1G30B 4FUIA 1PYTC 1UVUH 3TPIZ 1YCPM 4A5TS 1AD8H 2Y5GA 3BTWE 2G5VA 2GMTC 5C2ZA 1P05A 2OBOA 2P95A 2VGCC 2A4RA 2FOCA 5E8EH 1BOQA 1BMLA 3PWBA 1HXFH 2QXIA 3VB4A 2GT8A 1P0SH 1Y3YA 3KHVA 2HOBA 1T4UH 4GLYA 2G81E 1C2MA 5ESBA 2WPMS 4NCYA 1EQ9A 2ALVA 5E0JA 1FY3A 1K1LA 2VWNA 3KIDU 3AVZA 1O2ZA 2FX6A 2ZHEH 1D6RA 2ZP0H 2A31A 1GMCG 2Z9IA 3V0XA 2FOBA 3MMGA 3LJJA 2AGGX 1CBWC 1NESE 3CS7A 3L6PA 3Q3YA 3QLPH 3GYLB 1AUJA 1QIXB 2PGQB 1D4PB 3TNSA 1A0LA 3KNXA 3BSQA 3RU4D 2F9VA 1W10U 1YKTA 4I31A 3UR6A 1MCVA 1L0ZA 1ZSKA 1BT7A 2F9BH 1HAIH 4E05H 1W0YH 1GI6A 1ESAA 2FM2A 1QQUA 2ALPA 1BTUA 2FO9A 4NFFA 3SQHE 5T6DA 1AMHA 2FI3E 4I8GA 1Z8IB 3EE0B 3NZIA 1MZAA 3B9FH 1Q2WA 4ZHMU 4A1TA 4OS1A 1QJ6B 2EI8A 1K1IA 1O3BA 5L2YH 2BTCE 1SMFE 1ZOMA 1SQOA 1TGCA 3E6PH 1ZJKA 4AB9A 5PTPA 4INHA 1AU8A 2TIOA 3S7KB 2YOLA 1C1OA 4NFEA 5DPAA 1Z7KA 2ZO3H 1J16A 4B76A 1VCQA 5JBCS 3BG4B 1C9TA 1ZSJA 1SVPA 3D23A 1MD8A 4DG4A 3M7QA 1GJCB 2SGFE 3TJNA 3F9FA 3UWIA 2HLCA 3G01A 3GCTF 1DM4B 2GDEH 4IGDA 4E06H 4IBLH 1L2EA 1L1GA 2Z9JA 2GV6A 4XBCA 1ETSH 6CHAC 1Q31A 3UWJH 3T28A 3ZV9A 1J14A 3VPKA 1GBLA 4Z6AH 4UONA 4CR9A 1RXPA 3PMHB 1ZRKA 2LNCA 2G00A 3ZVDA 2RDLA 1LHEH 2ZTYA 4JK5A 3S0NA 5A0AE 1F0UA 2FZZA 3URDA 1GI1A 3A86A 3SI3H 4H42U 1A2CH 3ATMA 3W94A 3VGCB 3MOCA 3AAVA 3GICB 4KTCA 1VITF 2FP7B 1GBHA 1S85A 3EA7A 3TJVA 1P04A 1A1RA 3TIUA 3T2NA 4DJZB 2GKVE 3LDXH 2ZCLP 5A0CA 4E7NA 2QCYA 4CBOA 4WF8A 3KQBA 1C1TA 1JRTA 2WPLS 2FS8A 1GI4A 1O2IA 3U1IB 2XC4A 2ZTZA 1YF4A 3AW0A 1GCTB 2ZCKP 2ZPSA 1N6YA 2GDDA 2P16A 3PM3A 3LC3A 2F91A 3DA9B 2HNTF 1SOTA 1DY9A 3SN8A 4GHQA 3A7ZA 4