3P8FA

Crystal structure of mt-sp1 in complex with sfti-1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ST14 protein
publication title Structure of catalytic domain of Matriptase in complex with Sunflower trypsin inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA01
1WCZA 4CRCA 1GI3A 5TJXA 2GCHF 1AFEH 1HJAB 5FBIA 1GHZA 2ZU1A 1TPPA 1TALA 3ENSB 4HGCA 1N6XA 4CREA 3BTGE 1GBLA 1HB0B 1OP8A 1OWKA 4FUDA 4F49A 7GCHG 1ID5H 1E36B 1O3MA 2BQ7B 3LC3A 1TGTA 1RTLA 4UONA 1DLEA 5FXLA 1O34A 2AFQB 3LOXA 3LKWA 5FAHA 2ZCHP 3OY6U 1O3FA 5C67A 4FUBA 4I8JA 3TH2H 2VU8E 4E7RG 1PQAA 4I7YH 1TABE 1LTOA 1L1GA 1LQEA 1Q3XA 5DP7A 3O8RA 4VGCC 2K1QA 3UREA 2VWOA 1C2KA 4ABAA 1V2WT 2PV9B 1IQEA 3F1SB 3MHWU 1L0ZA 3K65B 1UVOA 3V3MA 3VGCC 2B8OH 2ZA5A 3P95A 1CBWB 5CMXH 1YCPK 2NU2E 1O39A 2DE9A 1MTNB 1W8BH 3MH5A 3HKJB 4AB8A 2F9BH 5L30H 3A7TA 1CHOG 3GCHC 4Y76A 2Y7XA 7ESTE 5A8ZA 1Z6EA 5DG6A 5A0BA 1FLEE 5T3HA 5DP8A 1MCVA 2VH6A 1NROH 2ZFQH 4UD9H 1TGSZ 1TPSA 2ANMH 2GCTB 4TY7A 4Y79A 5EODA 2BZ6H 3BSQA 4TWWA 2Y6TA 1GJ5H 3RU4D 3ZV8A 1H9IE 1GDUA 2A0QB 2FIRH 5L2ZH 2FS8A 3KHVA 1J9CH 2H5DA 1YLCA 5BRRE 1RD3B 1P2MA 3S9BA 3SU2A 3LU9B 3DUXH 5ESTE 4Q7ZA 3SJ9A 1O2GH 5EXLA 1DY8A 2AEIH 3GISB 1BTZA 3RXTA 5BPEA 2ZQ2A 2ASUB 1P2QA 2VH0A 3MU5A 1ZZZA 1W3CA 1C1TA 2A5IA 1C5VA 2OD3B 4K3JA 1K1NA 3ZZ8A 4LZ1H 5GCHG 2HPQH 3MO9A 3PMAB 2GZ9A 2VB0A 5SGAE 4BANB 3RXVA 2SGFE 3M5LA 1CA0B 1GDQA 1C1SA 4CH2B 1J8AA 3PLPA 1DITH 2BDCA 1AVWA 1Z8RA 1A5IA 3RXEA 1A7SA 2JKHA 4B2BA 5DP5A 1L4DA 1PQ7A 2A4QA 5LH8A 4ISNA 3ZZCA 1DANH 1ARCA 4JZ1A 4MG3A 2XBYA 1HAXB 3UWJH 3SJKA 4CRBA 1QL8A 3QGNB 1F5RA 2BVXH 5FCKA 4WMFA 3H7TA 1RFNA 4R0IA 4ABJA 1SSXA 1MD8A 3RXCA 3U69H 1YPMH 2G8TA 4INHA 1IQLA 1YP9A 1EJMA 3GCTF 4ZXXH 3TVJB 1GBIA 2SNWA 1SLXB 5FCRA 3SUDA 4I8LA 4DOQA 3TNSA 1FXYA 3STIA 6GCHG 1ZMLA 3K6YA 1QBNA 1NM6A 1P0SH 2OC7A 2STAE 4ZKRU 2ZCLP 2XBXA 3PO1C 1UTQA 3VXEH 3I29A 4IBLH 3ATWA 2FS9A 3RXOA 1A46H 1BHXB 2GCHG 2Q6DA 1MKWH 5JBTA 1HPGA 4UFDH 5EXNA 1FI8A 1GBJA 4VGCB 3HK3B 2P8OC 1BT7A 3M7TA 1FPCH 3SU0A 1A5GH 1ABIH 3RXPA 1O5EH 3QN7A 1C2JA 4X2XA 3D49H 4OS4A 2HWLB 2WPLS 3MI4A 3VGCB 3GCNA 1YPHE 1UHBA 1W2KH 2Q6FA 1FNIA 2QA9E 3FZZA 1A61H 1K1PA 3IG6B 4Y71A 4AG1A 1Q31A 2QN5T 2XW9A 2AGEX 1CVWH 3A88A 1IQIA 1P2OA 1HAPH 5FX5A 5EQQA 3BEIB 4NSYA 2G51A 2BXTH 1EQ9A 4JK5A 2H9HA 1AVGH 1S0RA 1C2HA 1TONA 3KNXA 2VWMA 1YKTA 1AHTH 4A1VA 1XXFA 2RA0A 2ULLA 1NZQH 3RXJA 1SPJA 1YCPM 3TIUA 1O2XA 3A8AA 1SGFA 3MNXA 2OC0A 1PPCE 1ZSJA 3ZZ7A 2ZKSA 1FY4A 1HRTH 1O3GA 4KELA 2J9NA 3ESTA 1ZTLA 1O2YA 1O3NA 1K1IA 2BD9A 3MOCA 3PLKA 8ESTE 4Z0KA 2G4UA 1LPGB 2BDAA 1O3BA 2VIOA 1Z1IA 1BCUH 2ILNA 4DIHH 1DSTA 2VGCB 3M5NA 1P2IA 4WXVA 2BB4A 1O3OA 4Y6DA 2AMQA 3NXPA 3SGQE 1C5WB 2VIQA 2OC8A 2BD8A 3CENA 1DPOA 2J94A 4ISHH 2GD4B 3GYMA 3UR6A 1W0ZU 3MH4A 4THNH 5DK1A 3KEEA 5CHAC 1GHAG 1G37A 3NPSA 1FAXA 1GL1A 2IJOB 1MMJN 1RIWC 2TGTA 2ZTZA 5AF9H 4X8UH 1DWCH 4BAQB 2CF9H 1ESAA 1EXFA 1OWDA 4ISIH 4Y7BA 6CHAC 5B6OA 2FOMB 1C5LH 1UHBB 2F9PA 2G5VA 2FTLE 2FYRA 3PROA 4IMQA 2O8UA 1D4PB 3T26A 1ABJH 3RDZA 4H6TA 1J17T 1TPOA 3OTJE 1S6FA 4DCDA 1F0RA 1QURH 1TAWA 2ZZUH 1ELGA 3A8CA 1RTFB 2VVUA 3OSYA 4LK4A 1NESE 3QUMP 1EAIA 3RXHA 3D23A 2AIQA 3RXFA 2GT8A 3A83A 3GY5A 2WPHS 2YNAA 3ELAH 1BTPA 3FP6E 1SGCA 3SV6A 1IQJA 1MTUA 3GCOA 4CR5A 2C90B 3UNRA 1A1RA 3KF2A 4AGJA 1MKXH 4FVBA 4O3UA 1FV9A 4NWKA 2GT7A 2ESTE 1OWIA 3LIWA 1ELEE 1SQTA 1K9OE 3M5OA 3UUZA 3A86A 2A31A 2WUBA 1W0YH 3MFJA 4F4OC 3SI3H 1DXWA 1D6RA 2FPZA 3BTDE 1SQAA 2XCFA 3E91A 4A6LA 1GJ7B 3SV7A 1EZSC 1UO6A 2OXSA 1ZPZA 2FOEA 3SORA 2SGDE 1Y3YA 2G00A 2BHGA 2ZDAH 1RJXB 4IW4E 1QHRB 3GOVB 1KXEA 3GDVA 3HPTB 1V2QT 3LT3A 1TMTH 1DVAH 2BLVA 3MYWA 1JBUH 1UK2A 2ZQ1A 3T27A 3VPKA 1XXDA 1TOCB 1WQVH 3RU4E 3N7OA 3AVZA 3GCTG 1HLTH 3RXSA 4CBOA 4KTCA 1MZAA 3A89A 5EPYA 1K1OA 3UOPA 1O2PA 3TK5A 3P6ZB 2QAAA 4X6OA 2KAIA 4XBDA 3SNDA 3RXMA 4GAWA 3A85A 1TRMA 2FTMA 3HGNA 4DT7B 2A7JA 3V7TA 2JH0D 2FP7B 1O2OA 3S7KB 1HJAC 3I77A 1S85A 1BJUA 1O3IA 2BD7A 1AUJA 2HPPH 3UY9A 1ZHPA 4UDWH 4GUXA 1L4ZA 1KLTA 1BJVA 3ATKA 4DW2U 4DURA 1TGNA 3BEUA 1YCPH 2G52A 4AORA 5E0JA 3L33A 3TK9A 3QLPH 1QR3E 4BTUB 2GMTB 1AY6H 2V3HH 4A7IB 4ABGA 5A0AE 1QRXA 3UTUH 3TGIE 2BVSH 1SOZA 2XBVA 2ZGJA 1Y3UA 3ATLA 2VINA 8KME2 2VVCA 2ZEBA 3GY3A 4FUJA 1QB1A 1GMCG 1P11E 3QWCH 1ANEA 2FYQA 3STJA 1HAVA 1GI0A 3RXIA 1CBWC 1EASA 4XE4A 2ODYB 1MTNC 1UCYH 1FDPA 1QGFA 2CGAA 3M7QA 3RM0H 2JH6D 4I8KA 4AZ2B 1O2HA 1ZRKA 3LPRA 1PPZA 4UFGH 1Z71A 4X1QU 5A0CA 3B23B 1ZGIA 2PSYA 1BMLA 4TPIZ 2F91A 1JMOH 5JBBS 1GI2A 3Q00A 4KKDA 1IQKA 1KXBA 1V2OT 2GCTC 4GHQA 1LPZB 1Z7KA 1G3DA 2ZGCA 4NWLA 4NA8A 1DWBH 3T5FH 3L3TA 2KAIB 3FP7E 1LVBA 1Z8JB 2WUCA 2Y81A 1O37A 3PTNA 2CMYA 5AVDA 3RXBA 1SMFE 2R9PA 1VITF 1C1RA 1EUFA 1IAUA 3BG4B 1QRWA 2EEKA 2BQ6B 1XUJA 2OP9A 4K5ZA 1SR5C 1GBCA 3UFAA 2PR3A 1TOMH 1V2KT 1TNHA 2R2WU 3ZVDA 2UWOA 3C27B 4NA7A 1MD7A 1AB9C 1O35A 5I25A 4IC6A 4Y8YA 5CE1A 3BTEE 1ETTH 1ZPCA 2ZDLA 1OWHA 2PFEA 1P02A 1W7GH 2G5NA 1ELCA 3BTWE 1WQSA 3URDA 4B73A 1BHXF 3GDSA 1UTPA 1AZ8A 3TITA 2FZZA 2BY5X 1LVYA 2O8WA 3Q3YA 1P57B 1CA0C 1HAVB 3Q77A 1OS8A 3VFEA 4H4FA 3RU4T 1KXDA 4MQAA 1SHHB 2I6QA 1EJNA 2OC1A 1CO7E 1P8VC 6ESTA 1E34B 3ATMA 1TNJA 2G55A 3SZNA 4BXSA 8GCHF 1MTSA 4NIWA 1EZQA 1C1OA 1O3HA 1TNLA 3HGPA 3ZVBA 1PYTD 4X1PU 5E2OA 1QQ4A 6GCHF 2GV7A 1JOUB 3SJOA 1HAYB 1SG8B 5HM2A 5AHGH 1V2LT 3SGAE 1TPAE 1UTNA 1FY3A 3MNBA 1C5NH 1G2MA 1W12U 1S84A 4Q7YA 1AE5A 1GI5A 1HAZB 1MAYA 2FLRH 1EKBB 1NFYA 5J4QA 5JYIA 3D62A 4Z6AH 2Y82A 4A92A 1NT1A 1J16A 4NG9H 1O2QA 1A0JA 2ZIQH 1V6DA 1EAWA 1BOQA 1XVMA 1YBWA 3OYPA 2Q1JA 2FOCA 4MPVA 1K22H 5HGGA 1BTHH 4MNYA 4AFUA 4B76A 1GVKB 1QBVH 3M7UA 2H1UA 1ZLRA 4AFQA 4J1YA 2UUKB 1DOJA 1ZHMA 1AMHA 3E1XB 1B7XB 4X6MA 3RMOH 4HTCH 5A8YA 1AGJA 1GL0E 1V2ST 1QNJA 2W3IA 3SNAA 5GPIB 4AOQA 5FBEA 1TLDA 2C8YB 1CGIE 2IN2A 3SNEA 1T32A 1V2UT 1TX7A 2H9TH 4Y11E 4MPXA 2GGVB 5AFYH 1ZGVA 2QY0B 3LGWA 1MQ5A 4WMEA 2RDLA 1LCYA 1VCQA 1ZYOA 2UUFB 5HXFA 3U8TH 4ABDA 2Z9JA 1FZZA 1HBTH 1YPGH 2ZI2H 1ZR0A 2EA3A 1T4VH 3RC4A 2VWLA 3DD2H 1CT4E 1KYNA 2W26A 3KGPA 1AI8H 1QQUA 2GDEH 4WJG2 4Q7XA 5C5OA 1LHDH 2AGIX 3SU1A 2Y5GA 5FPYA 3ODDA 4KGAA 5T6GA 1H1BA 5HMAA 2AMPA 4D7FA 4MPWA 2R0KA 1C1WH 2XWAA 2OQ5A 3QDZB 4ABHA 1KXFA 1GDNA 1XM1A 4WH6A 2O9QA 4OS7A 3TJOA 1UK4A 1O3CA 5F8ZA 2BY8X 4NSVA 1M9UA 2ZHEH 4SGAE 1ZHRA 3QK1A 4O03A 2BQWB 1FJSA 1GHAF 2NU4E 1SGTA 4K8BA 3QZQA 1LVMA 3ODFA 4HI3A 5LPFA 1EJAA 2XC4A 2UUYA 1H8IH 4U30A 1HAHH 2F9UA 1QL9A 2ZG0H 4GVUA 4FU8A 1O36A 2VGCC 1E0FD 3SJ8A 1OYQA 3SHCH 4CR9A 1MCTA 4GCHG 1X7AC 1AB9B 2IOTA 4WWYA 1BMNH 5JB8S 2V3OH 1AZZA 4AG2A 4UEHH 4YT7H 1W7XH 3CS7A 2G81E 1FAKH 1VITG 1MBMA 3BTHE 2OBQA 1UTOA 1T4UH 1A5HA 1GBMA 1AFQB 1MQ6A 1FY8E 1ORFA 1F0UA 2C8XB 1YPHC 3VB6A 2QV1A 1CGHA 1O2VA 1XKBC 3DT0H 2NU3E 1LPKB 3U98H 3NUMA 5ABWA 1C5ZB 1ZMNA 2Q6GA 4MNXA 1NRQH 4FUHA 3GYLB 4NFEA 1LKBA 1HV7A 2EI7A 3P17H 2FESH 3QTOH 3BEFB 3LONA 3ZZ6A 1A3EH 3EE0B 1C1VH 5FX6A 1HFDA 3TJVA 1TQ7B 3U8RH 1SLVB 1IQGA 1UVPA 4DGJA 2BDIA 2W7SA 3MO6A 1IQMA 2W3KA 1QA7A 3UWIA 3MH6A 1H8DH 5TCAA 2NU0E 5FPSA 4KTSA 5G4BA 3SV8A 1GJ9B 2B7DH 1P09A 2BD4A 1NS3A 1BDAA 3KIDU 2GZ7A 3S9CA 1C5UA 2DE8A 2P93A 2Y5FA 8GCHG 2FI3E 1YPLH 1QA0A 5F8TA 1XUKA 4PROA 1AE8H 1O38A 1TQ0B 1Y5AT 4CBNA 3LJOA 1NRPH 4WH8A 1ZMJA 2WPJS 3WY8A 2HOBA 1SHYA 1QRZA 3M35A 1WTHD 1NY22 3P8FA 2UUJB 2OUAA 2PKAA 1VR1H 1P01A 3RXQA 1VCWA 2QGRA 3BTFE 3RXRA 4X8TH 2FI4E 1D3TB 2HALA 4FUGA 1OXGA 3AAVA 3ZZ3A 1UTJA 2BLWA 4RSPA 2FXRA 3QGJA 3R0FA 3VB5A 2STBE 2FEQH 3FVFB 1D9IA 3QO6A 5C5NA 3DFLA 1W13U 1D3DB 2THFB 4YESB 3GDUA 1TFXA 1C5QA 2ZHWH 4B1TA 4O97A 1C9TA 1ZJDA 1RS0A 5DO4H 1BTWA 3SU6A 2Y80A 5EOKA 4ESTE 1YM0A 1IQHA 1GMCF 1GJAB 2WV4A 2OINA 1DWEH 2Z6BD 3VB7A 1O3EA 1EAXA 1GJ8B 2A7HA 1B5GH 3RM2H 1HAOH 2LPRA 2F9NA 1FY5A 1T7CA 2ZHQH 2GMTC 3E3TA 3I78A 3W94A 1BQYA 4AN7A 3M3SA 1EOLA 1P3CA 4I32A 4Q80A 1P2JA 1L2EA 4OS5A 2F9VA 4UFFH 5EW1H 2XNIA 3FFGA 3A7XA 3SQHE 1LQDB 2J2UA 1GBDA 1TWXB 2R3UA 2GZ8A 2Z9LA 2A32A 1SBWA 2P3TB 2QXGA 3OU0A 1UVUH 3EDXB 2PKAB 1GHYH 5EG4A 4TWYA 1NFWA 1O2RA 4K1TA 2AMDA 2SNVA 4A1XA 1C2FA 3TGKE 1ANDA 1YGCH 3Q3KA 4YOJA 1NTPA 2Z94A 1FY1A 2PTNA 1F2SE 2PGBB 4ZMAH 3ZVGA 1AQ7A 1SGFG 1T8NA 2C3SA 4CHAC 2FODA 4XOJA 1SGDE 1J15A 2A4OA 1IQFA 1CGJE 4IC5A 4YOGA 1WOFA 3OY5U 1THSH 2GX4A 3LGVA 4WXIA 2EC9H 1D3PB 3RMNH 1NC6A 2TPIZ 1V2MT 5LGOA 4HFPB 3RXDA 1A3BH 3SUFA 1F5LA 3BG4C 2C93B 3S0NA 3U9AH 1C5MD 3E16B 3TLOA 1ESBA 2P94A 4NZLA 2A2XH 3ZZAA 3MWIU 4A1TA 1C2LA 4D7GA 3BIVH 1GHBF 3SHAH 3F9EA 1GVLA 3LDXH 2UWPA 5H4IB 1PQ8A 1P2KA 3HKIB 3RLYH 2BD5A 3SQEE 3T25A 1AO5A 3T62A 1G3BA 2XYAA 1ARBA 1PFXC 1FONA 1TGCA 1CT2E 1VITH 1THPB 2VIPA 1OOKB 1GBFA 5JBCS 2A5AA 1G9IE 2DUCA 3A80A 4E06H 1ACBE 1AUTC 4X1NU 3SUGA 1TYNA 1O2JA 4LOYH 4YTAA 1ZTKA 1P12E 3FP8E 1TMBH 2QIQA 2H6MA 1CE5A 2FI5E 3IITA 4AFZA 2BY9X 1QFKH 1BRAA 4O9VA 4KP0A 4XBBA 5L6NH 5IYTA 1K1LA 1RTKA 3MH7A 1EPTA 2RCEA 3NCLA 3QX5H 1L1JA 1EOJA 1GGDB 1O2IA 1LHFH 1O5AB 1J14A 3A7ZA 1Y59T 5GJ4B 2F83A 1OP2A 3RC5A 2BX4A 2WYGA 3RMMH 4Y7AA 2BOHB 3A8BA 1NO9H 2CN0H 1XVOA 1HXEH 1FN8A 1FQ3A 3SN8A 2XXLA 1BZXE 1O30A 4OS1A 4XSKU 4INLA 3QZRA 1TA2A 5J4SA 3BG8A 4ZXYH 1NU7B 5JDUB 3ATIA 1QJ6B 3A7WA 4ABEA 1TRYA 2JETB 1HYLA 1YPKH 2P3FH 1XUIA 2GVFA 4RKOB 1QCPA 2J95A 4X8VH 1O3DA 1OKXA 1C5PA 2TGDA 3O8CA 5JB9S 3M3TA 2C4FH 3M5MA 4FUEA 3SU3A 3SUEA 1GBAA 3SJIA 5E0HA 1MKWK 5C1YA 4MVNA 1V2JT 2FLBH 1PPFE 3M36A 4K2YA 2ZHFH 5EU8A 2BD2A 2XC0A 4J2YB 5E2PA 1GI8B 1F5KU 1XX9A 1TNGA 1BTXA 1TE0A 2AGGX 5F8XA 3E8LA 2A4GA 5LPEA 3LGIA 1GBTA 3SU5A 7LPRA 3Q3XA 4ABFA 1C1PA 1MU6B 3U8OH 2Z3EA 2ZU5A 3ZYEA 2QYIA 1RGQA 2OQUA 1GCTB 3VB3A 1QBOA 4Q2KA 1TBZH 2I6SA 4YO9A 1GI7B 3R3GB 2A1DB 3OX7U 4GPGA 4X2YA 4B2AA 3A7YA 3LGYA 1UK3A 1EPTB 1LVOA 1GG6B 2BOKA 3F9HA 4B2CA 3KCGH 4CHAB 1MZDA 2CXVA 2OTVA 2V6NA 4X8SH 2FOBA 1ZRBA 5EPNA 1NRNH 5ESBA 1KDQA 3TU7H 3AASA 3ZVEA 5T6DA 1TMUH 4GCHF 1DFPA 5F03A 3PMBB 1ELDE 1WAYB 4JZEH 3ZVFA 1K1JA 2VVVA 3QTVH 1FIWA 1UMAH 3EQ0H 4Y8XA 1O2UA 2TBSA 2BMGB 4ZHAA 1A0HB 1P10A 4YM9A 2EI6A 1AWFH 1NN6A 5GWZA 1SGPE 2CHAB 4NA9H 2SFAA 5PTPA 2ODPA 1EZXC 4NIXA 4ABBA 1ETSH 2QXJA 1C5SA 1AVXA 1QIXB 1SOTA 2A2QH 1BA8B 4CRGA 1JWTA 2FMJA 1YYY1 2C8ZB 2A5KA 2ZO3H 5EW2H 1A2CH 2C8WB 1MTWA 4B74A 1P06A 1P05A 1HAGE 1TA6A 4YLUA 3UNSA 4D9RA 4BAOB 2YOLA 5GDSH 1AFQC 4XFQA 1EP5A 1NFUA 1O5BB 1V2RT 5GXPA 4O3TA 2P3UB 3JZ2B 4GLYA 3RUOA 3TK6A 1WYKA 1GHBG 1HAIH 1O33A 3VXFH 8LPRA 3URCA 5DKMA 4U32A 4JZDH 1KTTB 3ZZ9A 4I8GA 1PJPA 3GY2A 4AFSA 4DG4A 4ZHLU 1K1MA 2GP9B 3NK8A 2FM2A 3P8OA 2ODQA 1ELBA 1GJDB 3PTBA 1VJAU 1HIAA 1XUHA 1SGRE 4AGKA 1ZOMA 2QXIA 5A8XA 1KDQB 2VIVA 3RMLH 1KSNA 2RA3A 3ZVAA 3PYHA 3O8DA 2GKVE 1XMNB 2H9EH 2ZGHA 4AB9A 1C4Y2 1GHVH 2VWNA 1HXFH 2O8LA 4FUFA 2QC2A 2BY6X 1MKXK 2D8WA 1C1NA 4NGAH 1SVPA 2M5TA 2EI8A 3CP7A 5TCCA 4CRDA 3EYDA 2TIOA 3K9XB 1C5RA 3FANA 2JH5D 4NIVA 3H7OA 1Y5UT 1VJ9U 1YC0A 1TBQH 3LH3A 2FOAA 3EA9A 2BDYA 4OS6A 3GY4A 1N1LA 1DX5M 4K8YA 3PMHB 2PUQH 5ETXA 4OGYA 1O3AA 5EQRA 4FU9A 2VJ1A 2H2ZA 1FPHH 2FOGA 1HJ9A 2V35A 5HYOA 2VIWA 1GBEA 1QB9A 1TB6H 4MDSA 4JYUH 1KXCA 2F3CE 3LH1A 1DICA 5K7RA 1BB0B 3O8BA 2BYAX 4BOHA 1Z6JH 4MPUA 1O2NA 1S83A 3B9FH 4NIYA 1CU1A 3A87A 4CH8B 1PPHE 2ZWLH 2ZPQA 3IWMA 1Z8GA 2B5TB 1YLDA 5E0GA 1O3KA 2ZU3A 4GSOA 1N8OC 1JXPA 3U1JB 2PUXB 4X0WU 2XC5A 2ZGXH 1MBQA 1C5YB 2CJIA 2HNTE 3KQBA 2ANYA 3V0XA 2BZAA 2ZPRA 1HIAB 1BRCE 1D6WA 1Y3XA 2Z3CA 3RXAA 2V0BA 2RG3A 3NZIA 1DWDH 1WUNH 4YLQH 3UOUA 1THRH 1KTSB 2FO9A 2PKSC 4ZKSU 4B71A 3KL6A 1C4U2 1QL7A 3F6UH 2ALPA 2J38A 1EB2A 1S81A 2AS9A 1OYTH 1GBKA 1BMMH 2ZDNA 1TIOA 1EAUA 1ANCA 1W10U 5LPRA 1O3PB 1BIOA 4MNVA 2QCYA 4MTBA 1DUAA 3UIRA 1BBRK 4ZKOU 4R8TB 1H9HE 4YT6H 4D8NA 2BVRH 1DLKB 1ELFA 1W14U 2ZECA 2GDDA 2FX6A 2OBOA 4JCNA 1UCYK 1NRRH 4UE7H 3BF6H 3H5CB 1UJ1A 3VB4A 4SGBE 1EP6A 3TPIZ 1S5SA 3TH3H 2ZP0H 3GY8A 2NWNA 4E05H 3LJJA 4X2VA 1GMHG 1HGTH 4BAKB 2J92A 3EA7A 1LHGH 1XUGA 2Z7FE 3EAJA 2PGQB 3PLBA 4WVPE 3SU4A 2ZU4A 1HNEE 1OX1A 3BTQE 1VGCC 1C5TA 1LDTT 5EGMA 3ZZ5A 3PWBA 2PWXA 1KIGH 1H9LB 4IMZA 4Y8ZA 1PPGE 1UTLM 3KQDA 5K0HA 1VZQH 2QXHA 1A0LA 3GY6A 1O3LA 2FOHA 3NWUA 1O2MA 1LHCH 2ZFSA 1O3JA 1N6YA 1D3QB 4X1RU 4IN2A 2ZC9H 3RXLA 1VCPA 4DIIH 1MAXA 4JZIA 2QF0A 4ABIA 1DE7H 3UQVA 2ZNKH 4CRAA 1P9SA 4ZUHA 2GTBA 1BTYA 4K1SA 3EGKH 4BNRA 4H42U 1ELVA 3AW1A 4AYVB 1JIRA 1PYTC 3G01A 1P3EA 4IS5A 5DPAA 1C5OH 2BD3A 1UTKA 4KTUA 1TGBA 2R0LA 1T31A 1GMDF 4AX9H 1QJ7B 1V2VT 5DP4A 3BTTE 3A81A 1BBRE 1S0QA 3CS0A 2PHBA 1G3EA 4NCYA 3VEQB 3F9GA 3RP2A 5FHTA 1TX6A 6LPRA 1XKAC 1XUFA 1WSSH 3S7HB 4E7NA 2TGPZ 1UCYE 1UVTH 1GGDC 1K28D 1C4V2 2ANWA 5C1UA 2ZFTA 2B0FA 2HRVA 3D65E 1ESTA 1GJBB 4WY3A 2XRCA 1IHTH 1GBBA 3A8DA 1V3XA 1O0DH 1S82A 1HUTH 1CQQA 2R2MB 1C1MA 2BY7X 1MTVA 3UPEA 3FAOA 2AH4X 2YNBA 1P2NA 1N8OB 4BTTB 4CRFA 4XBCA 1AWHB 2VNTA 2ZCKP 2A45B 1F0TA 3A7VA 2JETC 1SGQE 3MNSA 1NFXA 3E90B 2Y7ZA 1SFQB 4Y0YE 1AKSA 5E8EH 1T8LA 2PKSB 5DP9A 3UR9A 3GCHB 1H4WA 1QTFA 4BAHB 1IQNA 1JRSA 1SL3A 3P8GA 1MUEB 4X6PA 1YF4A 2TGAA 3ZV9A 3FZDA 1F7ZA 3B8JA 4U01A 3SNBA 1C2DA 4WF8A 9ESTA 2ZFPH 1BRUP 3E0PB 1AU8A 5T6FA 2BDBA 1SB1H 4D9QA 2W7UA 4WMDA 3ZZBA 1G30B 3DA9B 3NKKA 4YZUA 2OLGA 5DGJA 3A82A 2XCNA 1YPJH 4HZHA 1G3CA 1GCTC 5I46H 1QB6A 1PQ5A 3TJUA 1GI6A 1NPMA 2AIPA 3PWCA 1E37B 1CSOE 3RXKA 4ZAEA 1EZUC 1G36A 4U2WA 1EPTC 1GG6C 2XWBI 2BM2A 4BXWA 1C2GA 1EATA 4ZROA 2W5EA 1Y3VA 3GICB 1LMWB 1NU9A 1O5GH 3SO3A 1GBHA 2J34A 1OWEA 2FOFA 4XDEA 4I33A 3S69A 1GI1A 3LC5A 1VGCB 4NZQA 1O5FH 3MTYA 4B75A 1YPEH 1V2PT 4JK6A 1MH0A 1FUJA 1TX8A 2CHAC 2TRMA 1ZPBA 1O2ZA 4ZH8A 4DVAU 2FDAA 1G2LA 2ALVA 1AIXH 1BUIA 5JBAS 3SBKA 5FPTA 1S6HA 4TY6A 1O2KA 2HLCA 1AKSB 4X6NA 1KXAA 1FIZA 2SGPE 1E38B 1GHWH 2F9OA 2ZGBH 1W11U 3P70B 1QY6A 2XBWA 3KQEA 1UTMA 4YOIA 3HK6B 3RC6A 3M37A 1PPBH 1SGNE 4BTIB 3PV4A 1HCGA 4ZHMU 3E6PH 4NFFA 1IOEA 3GY7A 2CF8H 3BTKE 1U6QA 1C1QA 1SI5H 5JPMH 3RXGA 1L1NA 2BTCE 3V13A 3LGUA 4QT8C 1GJ6A 4ISLA 1KY9A 2BDHA 3JZ1B 2BXUH 1ZJKA 1O2WA 2WPKS 4JYTA 1GJ4H 5A2MH 2ZTXA 4UFEH 4AYYB 3BN9A 3M3VA 3MU8A 1TNIA 2D2DA 2ZFRH 3L6PA 4FUIA 2NU1E 2Y5HA 5EXMA 3UNQA 1AD8H 1ANBA 1DXPA 3V12A 3TGJE 3SW2B 2G4TA 2WINI 1ZSLA 1GJCB 3PO1B 1PPEE 2ZU2A 3KQCA 1A4WH 2SGQE 2UWLA 1LKAA 1GMDG 1CT0E 1O32A 1Y8TA 3DHKH 1C2EA 2O8TA 3ZZ4A 1O2TA 4ASHA 3SNCA 7GCHF 1GCDA 2ZDMA 4D76A 2P16A 2PW8H 1E35B 2J4IA 2P8OB 3E0NB 4FXGH 1SGIB 3K6ZA 3C1KA 2ZF0H 2ZFFH 1B0FA 1ELTA 1O2LA 4OGXA 1Z8IB 1SGYE 2P59A 3K2UA 2OCVB 3ITIA 4TYDA 2D26C 2BX3A 2IPHA 1GHXH 3TNTA 3MU1A 3PMJA 1WTGH 3LGTA 1NRSH 2AERH 4JZFH 4ZKNU 3T2NA 1CHGA 2PSXA 1TNKA 1DUEA 2O8MA 3PM3A 1BRBE 3S9AA 1C5XB 4FUCA 1DY9A 1P9UA 1SGEE 3EA8A 4INKA 1LO6A 4K60A 1JRTA 1C2IA 1JIMA 2R3YA 1P03A 4MNWA 5DP6A 1Y3WA 1CHOF 4X2WA 1AN1E 1T8OA 1O5DH 1O2SA 4FU7A 1C2MA 1UVSH 4X1SU 1ETRH 1K2I1 1BBRH 1DSUA 1SQOA 2P95A 5F6MA 2SGAA 2ZHDA 1INCA 5A09A 1KLJH 3F68H 5DJ7A 4GHTA 4JMYA 3UQOA 3ZYDA 2QF3A 2HVXA 5C3NA 2Z9IA 2PTCE 5GIBA 5IDKA 2ZTYA 2HNTF 1WBGB 4M7GA 3RXUA 1WU1A 2WV5A 2H5CA 1BTUA 3P8NA 4Y10E 1WV7H 4RN6A 2FX4A 5CHAB 3Q76A 1P04A 2Z9KA 3M61U 5L2YH 2FWWA 1RIWB 1FMGA 1EX3A 3BIUH 1GMHF 1G32B 2AYWA 4K1EA 4LXBH 3SI4H 1Z1JA 6CHAB 1Y5BT 3KN2A 4H6SB 4I31A 3TJNA 4IGDA 1BMAA 1DS2E 1BITA 1HJ8A 1GI9B 1C1UH 2SGEE 3T29A 9LPRA 2ANKH 1EB1H 2ZDKA 4I8HA 4K69A 5GCHF 5HM9A 3MMGA 2D1JA 1C9PA 2ZPSA 1O5CB 2VIDA 5C20A 1TRNA 1T8MA 1F92A 1V2NT 1SLWB 3ZVCA 1HDTH 1QJ1B 1V2TT 2BLQA 3TH4H 4JYVH 4IN1A 3BTME 2WPMS 1OSSA 1SC8U 3DFJA 1ELAA 4RKJB 3HATH 3MU4A 3T28A 4MLFB 2HGTH 3BV9B 3AW0A 5AFZH 2Z3DA 3SV2H 1GI4A 4OS2A 2WYJA 3ZZDA 1O31A 7KMEH 2ZDVH 1RRKA 1DDJA 2Z9GA 1KLIH 1ZTJA 3MU0A 5C1XA 1DT2A 3W95A 2XTTB 3PB1E 1K21H 4FVDA 1GWAA 3P92A 3RLWH 3U1IB 4BAMB 3AAUA 2HNTC 1IHSH 1OP0A 3A84A 4DY7B 1RXPA 1LHEH 1SLUB 2LNCA 1DM4B 2WPIS 3MNCA 5DP3A 1FN6A 1OPHB 3F9FA 3SOSA 2CV3A 5EQSA 1B0EA 4ISOA 1GPZA 1ZSKA 2BLOA 1CA8B 2A4RA 5C2ZA 2BDGA 1MU8B 1SFIA 3MO3A 2GV6A 1TBRH 2A7CA 4DJZB 1GVZA 4A5TS 1OWJA 4LZ4B 1Q2WA 3SV9A 3SGBE 2PLXA 4Y0ZE 4TPYA 2B9LA 1F0SA
chains in the Genus database with same CATH superfamily
1WCZA 4CRCA 1GI3A 5TJXA 2GCHF 4RT1A 1AFEH 1HJAB 5FBIA 1GHZA 2ZU1A 1TPPA 1TALA 3ENSB 4HGCA 1N6XA 4CREA 3BTGE 1GBLA 1HB0B 1OP8A 1OWKA 4FUDA 4F49A 7GCHG 1ID5H 1E36B 1O3MA 2BQ7B 3LC3A 1TGTA 1RTLA 4UONA 1DLEA 5FXLA 1O34A 2AFQB 3LOXA 3LKWA 5FAHA 2ZCHP 3OY6U 1O3FA 5C67A 4FUBA 4I8JA 3TH2H 2VU8E 4E7RG 1PQAA 4I7YH 1TABE 1LTOA 1L1GA 1LQEA 1Q3XA 5DP7A 3O8RA 4VGCC 2K1QA 3UREA 2VWOA 1C2KA 4ABAA 1V2WT 2J98B 2PV9B 1IQEA 3F1SB 3MHWU 1L0ZA 3K65B 1UVOA 3H09A 3V3MA 3VGCC 5C94A 2B8OH 2ZA5A 3P95A 1CBWB 5CMXH 1YCPK 2NU2E 1O39A 2DE9A 1MTNB 1W8BH 3MH5A 3HKJB 4AB8A 2F9BH 5L30H 5GNDA 3A7TA 1CHOG 3GCHC 4Y76A 2Y7XA 7ESTE 5A8ZA 1Z6EA 5DG6A 5A0BA 1FLEE 5T3HA 5DP8A 1MCVA 2VH6A 1NROH 2ZFQH 4UD9H 1TGSZ 1TPSA 2ANMH 2GCTB 4TY7A 4Y79A 5EODA 2BZ6H 3BSQA 4TWWA 2Y6TA 1GJ5H 3RU4D 3ZV8A 1H9IE 1GDUA 2A0QB 2FIRH 5L2ZH 2FS8A 3KHVA 1J9CH 2H5DA 2RFKC 1YLCA 5BRRE 1RD3B 1P2MA 3S9BA 3SU2A 3LU9B 3DUXH 5ESTE 4Q7ZA 5KGOA 3SJ9A 1O2GH 5EXLA 1DY8A 2AEIH 3GISB 1BTZA 1NBME 3RXTA 5BPEA 2ZQ2A 2ASUB 1P2QA 2VH0A 3MU5A 1ZZZA 1W3CA 1C1TA 2A5IA 1C5VA 2OD3B 4K3JA 1K1NA 3ZZ8A 1SQRA 4LZ1H 5GCHG 2HPQH 2J5UA 3MO9A 3PMAB 2GZ9A 2VB0A 5SGAE 4BANB 3RXVA 2SGFE 3M5LA 1CA0B 1GDQA 1C1SA 4CH2B 1J8AA 3PLPA 1DITH 3FOAA 2BDCA 1AVWA 1Z8RA 1A5IA 3RXEA 1A7SA 3OEHD 2JKHA 4B2BA 2QF5A 1L4DA 1PQ7A 5DP5A 2A4QA 5LH8A 4ISNA 4XD7D 3ZZCA 1DANH 1ARCA 4JZ1A 4MG3A 2XBYA 1HAXB 3UWJH 3SJKA 4CRBA 1QL8A 3QGNB 1F5RA 2BVXH 5FCKA 4WMFA 3H7TA 1RFNA 4R0IA 4ABJA 1SSXA 1MD8A 3RXCA 3U69H 1YPMH 2G8TA 4INHA 1IQLA 1YP9A 1EJMA 3GCTF 4ZXXH 3TVJB 1GBIA 2SNWA 1SLXB 5FCRA 3SUDA 4I8LA 4DOQA 3TNSA 1FXYA 3STIA 6GCHG 1ZMLA 3K6YA 1QBNA 1NM6A 1P0SH 2OC7A 2STAE 4ZKRU 2ZCLP 2XBXA 3PO1C 1UTQA 3VXEH 3I29A 4IBLH 3ATWA 2FS9A 3RXOA 1A46H 1BHXB 2GCHG 2Q6DA 1MKWH 5JBTA 1HPGA 4UFDH 5EXNA 1FI8A 1GBJA 4VGCB 3HK3B 2P8OC 1BT7A 3M7TA 1FPCH 3SU0A 1A5GH 2XOKD 1ABIH 3RXPA 1O5EH 3QN7A 1C2JA 4X2XA 3D49H 4OS4A 2HWLB 2WPLS 3MI4A 3VGCB 3GCNA 1YPHE 5EJLA 1UHBA 1W2KH 2Q6FA 2RDEA 1FNIA 2QA9E 3FZZA 1A61H 1K1PA 1K0HA 3IG6B 3PRBA 4Y71A 4AG1A 1Q31A 2QN5T 2XW9A 2AGEX 1CVWH 3A88A 1IQIA 1P2OA 2JDID 1HAPH 5FX5A 5EQQA 3BEIB 4NSYA 2G51A 2BXTH 1EQ9A 4JK5A 2H9HA 1AVGH 1S0RA 1C2HA 1TONA 3KNXA 5C0UA 2VWMA 1YKTA 1AHTH 4A1VA 1XXFA 2RA0A 2ULLA 1NZQH 3RXJA 1SPJA 1YCPM 3TIUA 1O2XA 3OAAD 3A8AA 1SGFA 3MNXA 2OC0A 1PPCE 1ZSJA 3ZZ7A 2ZKSA 1FY4A 1W0JD 1HRTH 1O3GA 4KELA 2J9NA 3ESTA 1ZTLA 1O2YA 1O3NA 5DSFA 1K1IA 2BD9A 3MOCA 3PLKA 8ESTE 4Z0KA 2G4UA 1LPGB 2BDAA 1O3BA 2VIOA 1Z1IA 1BCUH 2ILNA 4DIHH 1DSTA 2VGCB 3M5NA 1P2IA 4WXVA 2BB4A 1O3OA 4Y6DA 2AMQA 3NXPA 3SGQE 1C5WB 2VIQA 4AC9A 2OC8A 2BD8A 3CENA 1DPOA 2JJ1D 2J94A 4ISHH 2GD4B 3GYMA 3UR6A 1W0ZU 3MH4A 4THNH 5DK1A 3KEEA 5CHAC 1GHAG 1G37A 3NPSA 1FAXA 1GL1A 2IJOB 1MMJN 1RIWC 2TGTA 2WZQA 2ZTZA 5AF9H 4X8UH 1DWCH 4BAQB 2CF9H 1ESAA 1EXFA 1OWDA 4ISIH 4Y7BA 6CHAC 5B6OA 2FOMB 1C5LH 1UHBB 2F9PA 2G5VA 2FTLE 2FYRA 2J97A 3PROA 4IMQA 2O8UA 1D4PB 3T26A 1ABJH 3RDZA 4H6TA 1J17T 1TPOA 3OTJE 1S6FA 4DCDA 1F0RA 1QURH 1TAWA 2ZZUH 1ELGA 3A8CA 5B6LA 1RTFB 2VVUA 3OSYA 4LK4A 1NESE 3QUMP 1EAIA 3RXHA 3D23A 2AIQA 3EE7A 3RXFA 2GT8A 3A83A 3GY5A 2WPHS 2YNAA 3ELAH 1BTPA 4TT3D 3FP6E 1SGCA 3SV6A 1IQJA 1MTUA 3GCOA 4CR5A 2C90B 5KEDA 1A1RA 3KF2A 4AGJA 1MKXH 4FVBA 3UNRA 4O3UA 1FV9A 4NWKA 2GT7A 2ESTE 1OWIA 3LIWA 1ELEE 1SQTA 1K9OE 3M5OA 3UUZA 3A86A 2A31A 2WUBA 1W0YH 3MFJA 4F4OC 3SI3H 1DXWA 1D6RA 2FPZA 3BTDE 1SQAA 2XCFA 3E91A 4A6LA 1GJ7B 3SV7A 1EZSC 1UO6A 1ZPZA 2OXSA 2FOEA 3SORA 2W6JD 2SGDE 1H8ED 1Y3YA 2G00A 2BHGA 2ZDAH 1RJXB 4IW4E 1QHRB 3GOVB 1KXEA 3GDVA 3HPTB 1V2QT 3LT3A 1TMTH 1DVAH 2BLVA 3MYWA 1JBUH 1UK2A 2ZQ1A 3T27A 3VPKA 1XXDA 1TOCB 1WQVH 3RU4E 3N7OA 3AVZA 3GCTG 1HLTH 3RXSA 2IJD1 4CBOA 4KTCA 1MZAA 3A89A 5EPYA 1K1OA 3UOPA 1O2PA 3TK5A 3P6ZB 2QAAA 4X6OA 2KAIA 4XBDA 3SNDA 3RXMA 4GAWA 3A85A 1TRMA 2FTMA 3HGNA 4DT7B 2A7JA 3V7TA 2JH0D 2FP7B 1O2OA 3S7KB 1HJAC 3I77A 1S85A 1BJUA 1O3IA 2BD7A 1AUJA 2HPPH 3UY9A 1ZHPA 4UDWH 4GUXA 4F55A 1L4ZA 1KLTA 1BJVA 3ATKA 1YY3A 4DW2U 4DURA 1TGNA 3BEUA 1YCPH 2G52A 4AORA 5E0JA 3L33A 3TK9A 3QLPH 1QR3E 4BTUB 2GMTB 1AY6H 2V3HH 4A7IB 4ABGA 5A0AE 2EQNA 1QRXA 3UTUH 3TGIE 2BVSH 1SOZA 3N7DA 2XBVA 2ZGJA 5FL7D 1Y3UA 3ATLA 2VINA 8KME2 2VVCA 4ZCNA 2ZEBA 3GY3A 4FUJA 1QB1A 1GMCG 3DSGA 1P11E 3QWCH 1ANEA 2FYQA 3STJA 1HAVA 1GI0A 3RXIA 1CBWC 1EASA 4XE4A 2ODYB 1MTNC 1UCYH 1FDPA 1QGFA 2CGAA 3M7QA 3RM0H 2JH6D 4RI0A 4I8KA 4AZ2B 1O2HA 1ZRKA 3LPRA 1PPZA 4UFGH 1Z71A 4X1QU 5A0CA 3B23B 1ZGIA 2PSYA 1BMLA 4TPIZ 2F91A 1JMOH 5JBBS 1GI2A 5KECA 3Q00A 4KKDA 1IQKA 1KXBA 1V2OT 2GCTC 4GHQA 1LPZB 1Z7KA 1G3DA 2ZGCA 4NWLA 4NA8A 1DWBH 3T5FH 3L3TA 2KAIB 5EIYA 3FP7E 1LVBA 1Z8JB 2WUCA 2Y81A 1O37A 3PTNA 2CMYA 5AVDA 3RXBA 1SMFE 2R9PA 1VITF 1C1RA 1EUFA 1IAUA 3BG4B 1QRWA 2EEKA 2BQ6B 3U28C 1XUJA 2OP9A 4K5ZA 1SR5C 1GBCA 2L74A 3UFAA 2PR3A 1TOMH 1V2KT 1TNHA 2R2WU 3ZVDA 2UWOA 3C27B 4NA7A 1MD7A 1AB9C 3F3BA 1O35A 5I25A 4IC6A 4Y8YA 5CE1A 3BTEE 1ETTH 1ZPCA 2ZDLA 1OWHA 2PFEA 1P02A 1W7GH 2G5NA 1ELCA 3BTWE 1WQSA 2KCYA 3URDA 4B73A 1BHXF 3GDSA 1UTPA 1AZ8A 3TITA 2FZZA 2BY5X 1LVYA 2O8WA 3Q3YA 1P57B 1CA0C 1HAVB 3Q77A 1OS8A 3VFEA 4H4FA 3RU4T 4B6FA 1KXDA 4MQAA 1SHHB 2I6QA 1EJNA 2OC1A 1CO7E 1P8VC 6ESTA 1E34B 3ATMA 1TNJA 2G55A 3SZNA 4BXSA 8GCHF 1MTSA 4NIWA 1EZQA 1C1OA 1O3HA 1TNLA 3HGPA 3ZVBA 1PYTD 4X1PU 5E2OA 1QQ4A 6GCHF 2GV7A 1JOUB 3SJOA 1HAYB 3CNRA 1SG8B 5HM2A 5AHGH 1V2LT 3SGAE 1TPAE 1UTNA 1FY3A 3MNBA 1C5NH 1G2MA 1W12U 1S84A 2XNDD 4Q7YA 1AE5A 1GI5A 1HAZB 1MAYA 2FLRH 1EKBB 1NFYA 5J4QA 5JYIA 3D62A 4Z6AH 2Y82A 4A92A 1NT1A 1J16A 3KYGA 1SKYE 1O2QA 4NG9H 1A0JA 2ZIQH 1V6DA 1EAWA 1BOQA 1XVMA 1YBWA 4ACBA 3OYPA 2Q1JA 2FOCA 4MPVA 1K22H 5HGGA 1BTHH 4MNYA 4AFUA 4B76A 1GVKB 1QBVH 3M7UA 2H1UA 1ZLRA 4AFQA 4J1YA 2UUKB 1DOJA 1ZHMA 1AMHA 3E1XB 1B7XB 4X6MA 3RMOH 2CK3D 4HTCH 5A8YA 1AGJA 1GL0E 1V2ST 1QNJA 2W3IA 3SNAA 5GPIB 4AOQA 5FBEA 1TLDA 2C8YB 1CGIE 2IN2A 3SNEA 1T32A 1V2UT 1TX7A 2H9TH 4Y11E 4MPXA 2GGVB 5AFYH 1ZGVA 1UW7A 2QY0B 3LGWA 1MQ5A 4WMEA 2RDLA 1LCYA 1VCQA 1ZYOA 2UUFB 5HXFA 3U8TH 4ABDA 2Z9JA 1FZZA 1HBTH 1YPGH 2GJGA 2ZI2H 1ZR0A 2EA3A 1T4VH 3RC4A 2VWLA 3DD2H 1CT4E 1KYNA 2W26A 3KGPA 1AI8H 1QQUA 2GDEH 4WJG2 4Q7XA 5C5OA 1LHDH 2AGIX 3SU1A 2Y5GA 5FPYA 3ODDA 4KGAA 5T6GA 1H1BA 5HMAA 2AMPA 4D7FA 4MPWA 2R0KA 1C1WH 2XWAA 2OQ5A 3QDZB 4ABHA 1KXFA 1GDNA 1XM1A 4WH6A 2O9QA 4OS7A 3TJOA 1UK4A 1O3CA 5F8ZA 2BY8X 2YMSB 4NSVA 1M9UA 2ZHEH 4SGAE 1ZHRA 3QK1A 4O03A 2BQWB 1FJSA 1GHAF 2NU4E 1SGTA 4K8BA 3QZQA 1LVMA 3ODFA 4HI3A 5LPFA 1EJAA 2XC4A 2UUYA 1H8IH 4U30A 1HAHH 2F9UA 1QL9A 2ZG0H 4GVUA 4FU8A 3F2HA 1O36A 2VGCC 1E0FD 3SJ8A 1OYQA 3SHCH 4CR9A 1MCTA 4GCHG 1X7AC 1AB9B 2IOTA 4WWYA 1BMNH 5JB8S 2KM0A 2V3OH 1AZZA 4AG2A 4UEHH 4YT7H 1W7XH 3CS7A 2G81E 1FAKH 1VITG 2QF4A 1MBMA 3BTHE 2OBQA 1UTOA 1T4UH 1A5HA 1GBMA 1AFQB 1MQ6A 1FY8E 4F48B 1ORFA 1F0UA 2C8XB 1YPHC 3VB6A 1E1QD 2QV1A 1CGHA 1O2VA 1XKBC 3DT0H 2NU3E 1LPKB 3U98H 3NUMA 5ABWA 1C5ZB 1ZMNA 2Q6GA 4MNXA 1NRQH 4FUHA 3GYLB 4NFEA 1LKBA 1HV7A 2EI7A 3P17H 2FESH 3QTOH 3BEFB 3LONA 3ZZ6A 1A3EH 3EE0B 1C1VH 5FX6A 1HFDA 3TJVA 1TQ7B 3U8RH 1SLVB 1IQGA 1UVPA 4DGJA 2BDIA 3OTPA 2W7SA 3MO6A 5C17A 1IQMA 2W3KA 1QA7A 3UWIA 3MH6A 1H8DH 5TCAA 2NU0E 5FPSA 4KTSA 2LP6A 5G4BA 3SV8A 1GJ9B 2B7DH 1P09A 2BD4A 3UB0A 1NS3A 1BDAA 3KIDU 5HIYA 2GZ7A 3S9CA 1C5UA 2DE8A 2P93A 2Y5FA 8GCHG 2FI3E 1YPLH 1QA0A 5F8TA 1XUKA 4PROA 1AE8H 1O38A 1TQ0B 1Y5AT 4CBNA 3LJOA 1NRPH 4WH8A 1ZMJA 3F2FA 2WPJS 3WY8A 2HOBA 1SHYA 1QRZA 3FN8A 3M35A 1WTHD 1NY22 3P8FA 2UUJB 2JJ2D 2OUAA 2PKAA 1VR1H 1P01A 3RXQA 4FOUC 1VCWA 2QGRA 3BTFE 3RXRA 4TSFD 4X8TH 2FI4E 1D3TB 2HALA 4FUGA 1OXGA 3AAVA 3ZZ3A 1UTJA 2BLWA 4RSPA 2FXRA 3QGJA 3R0FA 3VB5A 2STBE 2FEQH 3FVFB 1D9IA 3QO6A 5C5NA 3DFLA 1W13U 1D3DB 2THFB 4YESB 3GDUA 1TFXA 1C5QA 2ZHWH 4B1TA 4O97A 1C9TA 1ZJDA 1RS0A 5DO4H 1BTWA 3SU6A 2Y80A 5EOKA 4ESTE 1YM0A 1IQHA 1GMCF 1GJAB 2WV4A 2OINA 1DWEH 4M9FA 2Z6BD 3VB7A 1O3EA 1EAXA 1GJ8B 2A7HA 1B5GH 1H8HD 3RM2H 3AK5A 1HAOH 2LPRA 2F9NA 1FY5A 1T7CA 2ZHQH 2GMTC 3E3TA 3I78A 3W94A 1BQYA 4AN7A 3M3SA 1EOLA 1P3CA 3GS9A 4I32A 4Q80A 1P2JA 1L2EA 2WSSD 4OS5A 2F9VA 4UFFH 5EW1H 2XNIA 3FFGA 3A7XA 3SQHE 1LQDB 2J2UA 3KYFA 3N7EA 1GBDA 1TWXB 2R3UA 2GZ8A 2Z9LA 5CHBA 2A32A 2YMSD 5IK2D 1SBWA 2P3TB 2QXGA 3OU0A 1UVUH 3EDXB 2PKAB 1GHYH 5EG4A 4TWYA 1NFWA 1O2RA 4K1TA 2AMDA 2SNVA 4A1XA 1C2FA 3TGKE 1ANDA 1YGCH 3Q3KA 4YOJA 1NTPA 2Z94A 1FY1A 2PTNA 1F2SE 2PGBB 4ZMAH 3ZVGA 1AQ7A 1SGFG 1T8NA 2C3SA 4CHAC 2FODA 4XOJA 1SGDE 1J15A 2A4OA 1IQFA 1CGJE 4IC5A 4YOGA 1WOFA 3OY5U 1THSH 2GX4A 3LGVA 4WXIA 2EC9H 1D3PB 3RMNH 1NC6A 2TPIZ 1V2MT 5EJZA 5LGOA 4HFPB 3RXDA 1A3BH 3SUFA 1F5LA 1KMHB 3BG4C 2C93B 3S0NA 3SYJA 3U9AH 1C5MD 3E16B 3TLOA 4Q4LA 1ESBA 2P94A 4NZLA 2A2XH 3OFND 3MWIU 3ZZAA 4A1TA 1C2LA 4D7GA 3BIVH 1GHBF 3SHAH 1OHHD 3F9EA 1GVLA 3LDXH 2UWPA 5H4IB 1PQ8A 1P2KA 3HKIB 3RLYH 2BD5A 3SQEE 3T25A 1AO5A 3T62A 1G3BA 2XYAA 1ARBA 1PFXC 1FONA 1TGCA 1CT2E 1VITH 1THPB 2VIPA 1OOKB 1GBFA 5JBCS 2A5AA 5DN6D 1G9IE 2DUCA 3A80A 4E06H 1ACBE 1AUTC 4X1NU 3SUGA 1TYNA 1O2JA 4LOYH 4YTAA 1ZTKA 1P12E 3FP8E 1TMBH 2QIQA 2H6MA 1CE5A 2FI5E 3IITA 4AFZA 2BY9X 1QFKH 1BRAA 4O9VA 4KP0A 4XBBA 5L6NH 5IYTA 1K1LA 1RTKA 3MH7A 1EFRD 1EPTA 2RCEA 3NCLA 3QX5H 1L1JA 1EOJA 1GGDB 1O2IA 1LHFH 1O5AB 1J14A 3A7ZA 1Y59T 5GJ4B 2F83A 1OP2A 3RC5A 2BX4A 2WYGA 5C0TA 3RMMH 4Y7AA 2BOHB 3A8BA 1NO9H 2CN0H 1XVOA 1HXEH 1FN8A 1FQ3A 3SN8A 2XXLA 1BZXE 1O30A 4OS1A 4XSKU 4INLA 3QZRA 1TA2A 5J4SA 3BG8A 4ZXYH 2LELA 1NU7B 5JDUB 3ATIA 1QJ6B 3A7WA 4ABEA 1TRYA 2JETB 1HYLA 1YPKH 2P3FH 1XUIA 2GVFA 4RKOB 1QCPA 2K0QA 2J95A 4X8VH 3PV2A 1O3DA 3W1EA 1OKXA 1C5PA 2TGDA 3O8CA 5JB9S 3KQ5A 3M3TA 2C4FH 3M5MA 4FUEA 4HG6A 3SU3A 1GBAA 3SUEA 3SJIA 5E0HA 1MKWK 5C1YA 4MVNA 1V2JT 2FLBH 1PPFE 3M36A 4K2YA 1S6LA 2ZHFH 5EU8A 2BD2A 2XC0A 4J2YB 5E2PA 1GI8B 1F5KU 1XX9A 1TNGA 1BTXA 1TE0A 2AGGX 5F8XA 3E8LA 2A4GA 5LPEA 3LGIA 1GBTA 3SU5A 7LPRA 3Q3XA 4ABFA 1C1PA 5T1VA 1MU6B 3U8OH 2Z3EA 2ZU5A 3ZYEA 2QYIA 1RGQA 2OQUA 1GCTB 3VB3A 1QBOA 4Q2KA 1TBZH 2I6SA 4YO9A 1GI7B 3R3GB 2A1DB 3OX7U 4GPGA 4X2YA 4B2AA 3A7YA 3LGYA 1UK3A 1EPTB 1LVOA 1GG6B 2BOKA 3F9HA 4B2CA 1WDIA 3KCGH 4CHAB 1MZDA 2CXVA 2OTVA 2V6NA 4X8SH 2FOBA 1ZRBA 5EPNA 1NRNH 5ESBA 1KDQA 3TU7H 3AASA 3ZVEA 5T6DA 1TMUH 4GCHF 1DFPA 5F03A 3PMBB 1ELDE 1WAYB 4JZEH 2YMSC 3ZVFA 1K1JA 3UAIC 2VVVA 3QTVH 1FIWA 1UMAH 3EQ0H 4Y8XA 3F0PA 1O2UA 2TBSA 2BMGB 4ZHAA 2EY4C 1A0HB 1P10A 4YM9A 2EI6A 1AWFH 1NN6A 5GWZA 1SGPE 2CHAB 4NA9H 2SFAA 5PTPA 2ODPA 1EZXC 4NIXA 4ABBA 1ETSH 2QXJA 1C5SA 1AVXA 1QIXB 5HIZA 1SOTA 3NRLA 1WXRA 2A2QH 1BA8B 4CRGA 1JWTA 2FMJA 1YYY1 2C8ZB 2A5KA 2ZO3H 5EW2H 1A2CH 2C8WB 1MTWA 4B74A 1P06A 1P05A 1HAGE 1TA6A 4YLUA 3DCLA 3UNSA 4BAOB 4D9RA 2YOLA 5GDSH 1AFQC 4XFQA 1EP5A 1NFUA 1O5BB 1V2RT 5GXPA 4O3TA 2P3UB 3JZ2B 4GLYA 3RUOA 3TK6A 1WYKA 1GHBG 1HAIH 3FKSD 1O33A 3VXFH 8LPRA 3URCA 5DKMA 4U32A 4JZDH 1KTTB 3ZZ9A 4I8GA 2KCOA 1PJPA 3GY2A 3SZEA 4AFSA 4DG4A 4ZHLU 1K1MA 2GP9B 3NK8A 2FM2A 3P8OA 2ODQA 1ELBA 1GJDB 3PTBA 1VJAU 1HIAA 1XUHA 1SGRE 4AGKA 1ZOMA 2QXIA 5A8XA 1KDQB 2VIVA 3RMLH 1KSNA 2RA3A 3ZVAA 3PYHA 3O8DA 2GKVE 1XMNB 2H9EH 2ZGHA 4AB9A 1C4Y2 1GHVH 2F4LA 2VWNA 1HXFH 2O8LA 4FUFA 2QC2A 2BY6X 1MKXK 2D8WA 1C1NA 4NGAH 1SVPA 2M5TA 2EI8A 3CP7A 5TCCA 4CRDA 3EYDA 2TIOA 3K9XB 3MQKC 1C5RA 2IPQX 3FANA 2JH5D 4NIVA 3H7OA 1Y5UT 1VJ9U 1YC0A 1TBQH 3LH3A 2FOAA 3EA9A 2BDYA 4OS6A 3GY4A 1N1LA 1DX5M 4K8YA 3PMHB 5HKKD 2PUQH 5ETXA 4OGYA 1O3AA 5EQRA 4FU9A 3OEED 2VJ1A 2H2ZA 1FPHH 2FOGA 1HJ9A 5F53A 2V35A 4I86A 5HYOA 2VIWA 1GBEA 2AHME 1QB9A 1TB6H 4MDSA 4JYUH 1KXCA 2F3CE 3LH1A 1DICA 5K7RA 1BB0B 4FETA 3O8BA 2BYAX 4BOHA 1Z6JH 4MPUA 1O2NA 1S83A 3B9FH 4NIYA 1CU1A 3A87A 4CH8B 1PPHE 2ZWLH 2ZPQA 3IWMA 1Z8GA 2B5TB 3OE7D 1YLDA 5E0GA 1O3KA 2ZU3A 4GSOA 1N8OC 1JXPA 3U1JB 2PUXB 4X0WU 2XC5A 2ZGXH 1MBQA 1C5YB 2CJIA 2HNTE 3KQBA 2ANYA 3V0XA 2BZAA 2ZPRA 1HIAB 1BRCE 1D6WA 1Y3XA 2Z3CA 3RXAA 2V0BA 2RG3A 3NZIA 1DWDH 1WUNH 4YLQH 3UOUA 1THRH 1KTSB 2FO9A 2PKSC 4ZKSU 4B71A 3KL6A 1C4U2 1QL7A 3F6UH 2KFWA 2ALPA 2J38A 1EB2A 1S81A 2AS9A 1OYTH 1GBKA 1BMMH 2ZDNA 1TIOA 1EAUA 1ANCA 1W10U 5LPRA 1O3PB 1BIOA 1E1RD 4MNVA 2QCYA 3FO8D 2V7QD 1DUAA 4MTBA 3UIRA 1BBRK 4ZKOU 4R8TB 1H9HE 4YT6H 4D8NA 2BVRH 2L6OA 1DLKB 1ELFA 1W14U 2ZECA 2GDDA 2FX6A 2OBOA 4JCNA 1UCYK 1NRRH 4UE7H 3BF6H 3WW7A 3H5CB 1UJ1A 3VB4A 4SGBE 1EP6A 3TPIZ 1S5SA 3TH3H 2ZP0H 3GY8A 2NWNA 4E05H 3LJJA 4X2VA 1GMHG 1HGTH 4BAKB 2J92A 3EA7A 4Z1MD 1LHGH 2JIZD 1XUGA 2Z7FE 3EAJA 2PGQB 3PLBA 3VG8A 4WVPE 3SU4A 2ZU4A 1HNEE 1OX1A 3BTQE 1VGCC 1C5TA 1LDTT 5EGMA 3ZZ5A 2HLDD 3PWBA 2PWXA 1KIGH 1H9LB 4IMZA 4Y8ZA 1PPGE 1UTLM 3KQDA 5K0HA 1VZQH 2QXHA 1A0LA 3GY6A 1YWUA 1O3LA 2FOHA 3NWUA 1O2MA 1LHCH 2ZFSA 1O3JA 1N6YA 1D3QB 4X1RU 4IN2A 2ZC9H 3RXLA 1VCPA 4DIIH 1MAXA 4JZIA 2QF0A 4ABIA 1DE7H 3UQVA 2ZNKH 4CRAA 1P9SA 4ZUHA 2GTBA 1BTYA 4K1SA 3EGKH 4BNRA 4H42U 1ELVA 3AW1A 4AYVB 1JIRA 1PYTC 1FX0B 3G01A 5EJ1A 1P3EA 4IS5A 5DPAA 1C5OH 2BD3A 1UTKA 4KTUA 1TGBA 2R0LA 1T31A 1GMDF 4AX9H 1QJ7B 1V2VT 5DP4A 3BTTE 3A81A 1BBRE 1S0QA 3CS0A 1W0KD 2PHBA 1G3EA 4NCYA 3VEQB 3F9GA 3RP2A 5FHTA 1TX6A 6LPRA 1XKAC 1XUFA 1WSSH 3S7HB 4E7NA 2TGPZ 1UCYE 1UVTH 1GGDC 3WWFA 1K28D 1C4V2 2ANWA 5C1UA 2ZFTA 2B0FA 2HRVA 3D65E 1ESTA 1GJBB 4WY3A 2XRCA 1IHTH 1GBBA 3A8DA 1V3XA 1O0DH 1S82A 1HUTH 1CQQA 2VBCA 2R2MB 1C1MA 2BY7X 1MTVA 1BMFD 3UPEA 3FAOA 2V3MA 2AH4X 2YNBA 1P2NA 1N8OB 4BTTB 4CRFA 2F43B 4XBCA 1AWHB 2VNTA 2ZCKP 2A45B 1F0TA 3A7VA 2JETC 1SGQE 3MNSA 1NFXA 3E90B 2Y7ZA 1SFQB 4Y0YE 1AKSA 5E8EH 1T8LA 2PKSB 5DP9A 3UR9A 3GCHB 1H4WA 1QTFA 4BAHB 1IQNA 1JRSA 1SL3A 3P8GA 1MUEB 4X6PA 1YF4A 2TGAA 3ZV9A 3FZDA 1F7ZA 3B8JA 4U01A 3SNBA 1C2DA 4DT4A 4WF8A 9ESTA 2ZFPH 1BRUP 3E0PB 1AU8A 5T6FA 2HVYB 2BDBA 1SB1H 4D9QA 2W7UA 4WMDA 3ZZBA 1G30B 3DA9B 3NKKA 4YZUA 2OLGA 5DGJA 3A82A 2XCNA 1YPJH 4HZHA 1G3CA 1GCTC 5I46H 1QB6A 1PQ5A 3TJUA 1COWD 1GI6A 1NPMA 2AIPA 3PWCA 1E37B 1CSOE 3RXKA 4ZAEA 1EZUC 1G36A 4U2WA 1EPTC 1GG6C 2XWBI 2BM2A 4BXWA 1C2GA 1EATA 1YLNA 4ZROA 2W5EA 1Y3VA 3GICB 1LMWB 1NU9A 1O5GH 3SO3A 1GBHA 2J34A 1OWEA 2FOFA 4XDEA 4I33A 2WV9A 3S69A 1GI1A 1VKYA 3LC5A 1VGCB 4NZQA 1O5FH 3MTYA 4B75A 1QZ8A 1YPEH 1V2PT 4JK6A 1MH0A 1FUJA 1TX8A 2OK5A 2CHAC 2TRMA 1ZPBA 1O2ZA 4ZH8A 4DVAU 2M2AA 2FDAA 2KCAA 1G2LA 2ALVA 1AIXH 2W6ID 1BUIA 5JBAS 3SBKA 5FPTA 1S6HA 4TY6A 1O2KA 2HLCA 3N99A 1AKSB 4X6NA 1KXAA 1FIZA 2SGPE 1E38B 1GHWH 2F9OA 2ZGBH 4OM9A 5CDFE 1W11U 3P70B 1QY6A 2XBWA 3KQEA 1UTMA 4YOIA 3HK6B 3RC6A 3M37A 1PPBH 1SGNE 4BTIB 3PV4A 1HCGA 4ZHMU 3E6PH 4NFFA 1IOEA 3GY7A 2CF8H 3BTKE 2KR7A 1U6QA 1MABB 1C1QA 1SI5H 5JPMH 3RXGA 1L1NA 2BTCE 3V13A 3LGUA 4QT8C 1GJ6A 4ISLA 1KY9A 2BDHA 3JZ1B 2BXUH 1ZJKA 1O2WA 2WPKS 4JYTA 1GJ4H 5A2MH 2ZTXA 4UFEH 4AYYB 3BN9A 3M3VA 3MU8A 1TNIA 2D2DA 2ZFRH 3L6PA 4FUIA 2NU1E 2Y5HA 5EXMA 3UNQA 1AD8H 1ANBA 1DXPA 3V12A 3TGJE 3SW2B 3F2GA 2G4TA 2WINI 1ZSLA 1GJCB 3PO1B 1PPEE 2ZU2A 3KQCA 1A4WH 3DSOA 2SGQE 2UWLA 1LKAA 1GMDG 1CT0E 1O32A 1Y8TA 3DHKH 1C2EA 2O8TA 4XRNA 3ZZ4A 1O2TA 4ASHA 3PRDA 3SNCA 1GCDA 2ZDMA 7GCHF 4RT0A 4D76A 2P16A 2PW8H 1E35B 2J4IA 2P8OB 1NBMD 3E0NB 4FXGH 3DSPA 1SGIB 3K6ZA 3C1KA 2ZF0H 2ZFFH 1B0FA 1ELTA 1O2LA 4OGXA 1Z8IB 1SGYE 2P59A 3K2UA 2OCVB 3ITIA 4ASUD 4B6EA 4TYDA 2D26C 2BX3A 2KZ4A 2IPHA 1GHXH 3TNTA 3MU1A 4Q63A 3PMJA 1WTGH 3LGTA 1NRSH 2WPDD 2AERH 4JZFH 4ZKNU 4YXWD 3T2NA 1CHGA 2PSXA 1TNKA 1DUEA 2O8MA 3PM3A 2PP6A 1BRBE 3S9AA 1C5XB 4FUCA 1DY9A 1P9UA 1SGEE 3EA8A 4INKA 1LO6A 4K60A 1JRTA 1C2IA 1JIMA 2R3YA 1P03A 4MNWA 5DP6A 1Y3WA 1CHOF 4X2WA 1AN1E 1T8OA 1O5DH 1O2SA 4FU7A 1C2MA 1UVSH 4X1SU 1ETRH 1K2I1 1BBRH 1DSUA 1SQOA 2P95A 5F6MA 3PV5A 2SGAA 2ZHDA 1INCA 2K8IA 5A09A 1KLJH 3F68H 5DJ7A 4GHTA 4JMYA 3UQOA 3ZYDA 2QF3A 2HVXA 5C3NA 2Z9IA 2PTCE 5GIBA 5IDKA 2ZTYA 4P02A 2HNTF 1WBGB 4M7GA 1E79D 3RXUA 1WU1A 2WV5A 2KX4A 2H5CA 1BTUA 3P8NA 4Y10E 1WV7H 4RN6A 2FX4A 5CHAB 3Q76A 1P04A 2Z9KA 3M61U 5L2YH 2FWWA 4P00A 1RIWB 1FMGA 1EX3A 3BIUH 4ACAA 1GMHF 1G32B 2AYWA 4K1EA 4LXBH 3SI4H 1Z1JA 6CHAB 1Y5BT 3KN2A 4H6SB 4I31A 3TJNA 2QE7D 4IGDA 1BMAA 1DS2E 1BITA 1HJ8A 1GI9B 1C1UH 2SGEE 3T29A 9LPRA 2ANKH 1EB1H 2ZDKA 4I8HA 4K69A 5GCHF 5HM9A 3MMGA 2D1JA 1C9PA 2ZPSA 1O5CB 2VIDA 5C20A 1TRNA 1T8MA 1F92A 1V2NT 1SLWB 3ZVCA 1HDTH 1QJ1B 1V2TT 2KCPA 2BLQA 3TH4H 4JYVH 4IN1A 3BTME 2WPMS 1OSSA 1SC8U 3DFJA 1ELAA 4RKJB 3HATH 3MU4A 3T28A 4MLFB 2HGTH 3BV9B 3AW0A 5AFZH 2WHXA 2Z3DA 3SV2H 1GI4A 4OS2A 2WYJA 3ZZDA 1O31A 7KMEH 2ZDVH 1RRKA 1DDJA 2Z9GA 1KLIH 1ZTJA 3MU0A 5C1XA 1DT2A 2J98A 3W95A 2XTTB 3PB1E 1K21H 4FVDA 1GWAA 3P92A 3RLWH 3U1IB 4BAMB 3AAUA 2HNTC 1IHSH 1OP0A 3A84A 4DY7B 3ZIAD 1RXPA 1LHEH 1SLUB 2LNCA 1DM4B 2WPIS 3MNCA 5DP3A 1FN6A 1OPHB 3F9FA 3SOSA 2CV3A 5EQSA 1B0EA 4ISOA 1GPZA 1ZSKA 2BLOA 1CA8B 2A4RA 5C2ZA 2BDGA 1MU8B 1SFIA 3MO3A 2GV6A 3F0OA 1TBRH 2A7CA 4DJZB 1GVZA 4A5TS 1OWJA 4LZ4B 1Q2WA 3SV9A 3SGBE 2PLXA 3WWBA 4Y0ZE 4TPYA 2B9LA 1F0SA
chains in the Genus database with same CATH topology
1WCZA 4CRCA 1GI3A 5TJXA 2GCHF 1AFEH 1HJAB 5FBIA 1GHZA 2ZU1A 1TPPA 1TALA 3ENSB 4HGCA 1N6XA 4CREA 3BTGE 1GBLA 1HB0B 1OP8A 1OWKA 4FUDA 4F49A 7GCHG 1ID5H 1E36B 1O3MA 2BQ7B 3LC3A 1TGTA 1RTLA 4UONA 1DLEA 5FXLA 1O34A 2AFQB 3LOXA 3LKWA 5FAHA 2ZCHP 3OY6U 1O3FA 5C67A 4FUBA 4I8JA 3TH2H 2VU8E 4E7RG 1PQAA 4I7YH 1TABE 1LTOA 1L1GA 1LQEA 1Q3XA 5DP7A 3O8RA 4VGCC 2K1QA 3UREA 2VWOA 1C2KA 4ABAA 1V2WT 2PV9B 1IQEA 3F1SB 3MHWU 1L0ZA 3K65B 1UVOA 3V3MA 3VGCC 2B8OH 2ZA5A 3P95A 1CBWB 5CMXH 1YCPK 2NU2E 1O39A 2DE9A 1MTNB 1W8BH 3MH5A 3HKJB 4AB8A 2F9BH 5L30H 3A7TA 1CHOG 3GCHC 4Y76A 2Y7XA 7ESTE 5A8ZA 1Z6EA 5DG6A 5A0BA 1FLEE 5T3HA 5DP8A 1MCVA 2VH6A 1NROH 2ZFQH 4UD9H 1TGSZ 1TPSA 2ANMH 2GCTB 4TY7A 4Y79A 5EODA 2BZ6H 3BSQA 4TWWA 2Y6TA 1GJ5H 3RU4D 3ZV8A 1H9IE 1GDUA 2A0QB 2FIRH 5L2ZH 2FS8A 3KHVA 1J9CH 2H5DA 1YLCA 5BRRE 1RD3B 1P2MA 3S9BA 3SU2A 3LU9B 3DUXH 5ESTE 4Q7ZA 3SJ9A 1O2GH 5EXLA 1DY8A 2AEIH 3GISB 1BTZA 3RXTA 5BPEA 2ZQ2A 2ASUB 1P2QA 2VH0A 3MU5A 1ZZZA 1W3CA 1C1TA 2A5IA 1C5VA 2OD3B 4K3JA 1K1NA 3ZZ8A 4LZ1H 5GCHG 2HPQH 3MO9A 3PMAB 2GZ9A 2VB0A 5SGAE 4BANB 3RXVA 2SGFE 3M5LA 1CA0B 1GDQA 1C1SA 4CH2B 1J8AA 3PLPA 1DITH 2BDCA 1AVWA 1Z8RA 1A5IA 3RXEA 1A7SA 2JKHA 4B2BA 5DP5A 1L4DA 1PQ7A 2A4QA 5LH8A 4ISNA 3ZZCA 1DANH 1ARCA 4JZ1A 4MG3A 2XBYA 1HAXB 3UWJH 3SJKA 4CRBA 1QL8A 3QGNB 1F5RA 2BVXH 5FCKA 4WMFA 3H7TA 1RFNA 4R0IA 4ABJA 1SSXA 1MD8A 3RXCA 3U69H 1YPMH 2G8TA 4INHA 1IQLA 1YP9A 1EJMA 3GCTF 4ZXXH 3TVJB 1GBIA 2SNWA 1SLXB 5FCRA 3SUDA 4I8LA 4DOQA 3TNSA 1FXYA 3STIA 6GCHG 1ZMLA 3K6YA 1QBNA 1NM6A 1P0SH 2OC7A 2STAE 4ZKRU 2ZCLP 2XBXA 3PO1C 1UTQA 3VXEH 3I29A 4IBLH 3ATWA 2FS9A 3RXOA 1A46H 1BHXB 2GCHG 2Q6DA 1MKWH 5JBTA 1HPGA 4UFDH 5EXNA 1FI8A 1GBJA 4VGCB 3HK3B 2P8OC 1BT7A 3M7TA 1FPCH 3SU0A 1A5GH 1ABIH 3RXPA 1O5EH 3QN7A 1C2JA 4X2XA 3D49H 4OS4A 2HWLB 2WPLS 3MI4A 3VGCB 3GCNA 1YPHE 1UHBA 1W2KH 2Q6FA 1FNIA 2QA9E 3FZZA 1A61H 1K1PA 3IG6B 4Y71A 4AG1A 1Q31A 2QN5T 2XW9A 2AGEX 1CVWH 3A88A 1IQIA 1P2OA 1HAPH 5FX5A 5EQQA 3BEIB 4NSYA 2G51A 2BXTH 1EQ9A 4JK5A 2H9HA 1AVGH 1S0RA 1C2HA 1TONA 3KNXA 2VWMA 1YKTA 1AHTH 4A1VA 1XXFA 2RA0A 2ULLA 1NZQH 3RXJA 1SPJA 1YCPM 3TIUA 1O2XA 3A8AA 1SGFA 3MNXA 2OC0A 1PPCE 1ZSJA 3ZZ7A 2ZKSA 1FY4A 1HRTH 1O3GA 4KELA 2J9NA 3ESTA 1ZTLA 1O2YA 1O3NA 1K1IA 2BD9A 3MOCA 3PLKA 8ESTE 4Z0KA 2G4UA 1LPGB 2BDAA 1O3BA 2VIOA 1Z1IA 1BCUH 2ILNA 4DIHH 1DSTA 2VGCB 3M5NA 1P2IA 4WXVA 2BB4A 1O3OA 4Y6DA 2AMQA 3NXPA 3SGQE 1C5WB 2VIQA 2OC8A 2BD8A 3CENA 1DPOA 2J94A 4ISHH 2GD4B 3GYMA 3UR6A 1W0ZU 3MH4A 4THNH 5DK1A 3KEEA 5CHAC 1GHAG 1G37A 3NPSA 1FAXA 1GL1A 2IJOB 1MMJN 1RIWC 2TGTA 2ZTZA 5AF9H 4X8UH 1DWCH 4BAQB 2CF9H 1ESAA 1EXFA 1OWDA 4ISIH 4Y7BA 6CHAC 5B6OA 2FOMB 1C5LH 1UHBB 2F9PA 2G5VA 2FTLE 2FYRA 3PROA 4IMQA 2O8UA 1D4PB 3T26A 1ABJH 3RDZA 4H6TA 1J17T 1TPOA 3OTJE 1S6FA 4DCDA 1F0RA 1QURH 1TAWA 2ZZUH 1ELGA 3A8CA 1RTFB 2VVUA 3OSYA 4LK4A 1NESE 3QUMP 1EAIA 3RXHA 3D23A 2AIQA 3RXFA 2GT8A 3A83A 3GY5A 2WPHS 2YNAA 3ELAH 1BTPA 3FP6E 1SGCA 3SV6A 1IQJA 1MTUA 3GCOA 4CR5A 2C90B 3UNRA 1A1RA 3KF2A 4AGJA 1MKXH 4FVBA 4O3UA 1FV9A 4NWKA 2GT7A 2ESTE 1OWIA 3LIWA 1ELEE 1SQTA 1K9OE 3M5OA 3UUZA 3A86A 2A31A 2WUBA 1W0YH 3MFJA 4F4OC 3SI3H 1DXWA 1D6RA 2FPZA 3BTDE 1SQAA 2XCFA 3E91A 4A6LA 1GJ7B 3SV7A 1EZSC 1UO6A 2OXSA 1ZPZA 2FOEA 3SORA 2SGDE 1Y3YA 2G00A 2BHGA 2ZDAH 1RJXB 4IW4E 1QHRB 3GOVB 1KXEA 3GDVA 3HPTB 1V2QT 3LT3A 1TMTH 1DVAH 2BLVA 3MYWA 1JBUH 1UK2A 2ZQ1A 3T27A 3VPKA 1XXDA 1TOCB 1WQVH 3RU4E 3N7OA 3AVZA 3GCTG 1HLTH 3RXSA 4CBOA 4KTCA 1MZAA 3A89A 5EPYA 1K1OA 3UOPA 1O2PA 3TK5A 3P6ZB 2QAAA 4X6OA 2KAIA 4XBDA 3SNDA 3RXMA 4GAWA 3A85A 1TRMA 2FTMA 3HGNA 4DT7B 2A7JA 3V7TA 2JH0D 2FP7B 1O2OA 3S7KB 1HJAC 3I77A 1S85A 1BJUA 1O3IA 2BD7A 1AUJA 2HPPH 3UY9A 1ZHPA 4UDWH 4GUXA 1L4ZA 1KLTA 1BJVA 3ATKA 4DW2U 4DURA 1TGNA 3BEUA 1YCPH 2G52A 4AORA 5E0JA 3L33A 3TK9A 3QLPH 1QR3E 4BTUB 2GMTB 1AY6H 2V3HH 4A7IB 4ABGA 5A0AE 1QRXA 3UTUH 3TGIE 2BVSH 1SOZA 2XBVA 2ZGJA 1Y3UA 3ATLA 2VINA 8KME2 2VVCA 2ZEBA 3GY3A 4FUJA 1QB1A 1GMCG 1P11E 3QWCH 1ANEA 2FYQA 3STJA 1HAVA 1GI0A 3RXIA 1CBWC 1EASA 4XE4A 2ODYB 1MTNC 1UCYH 1FDPA 1QGFA 2CGAA 3M7QA 3RM0H 2JH6D 4I8KA 4AZ2B 1O2HA 1ZRKA 3LPRA 1PPZA 4UFGH 1Z71A 4X1QU 5A0CA 3B23B 1ZGIA 2PSYA 1BMLA 4TPIZ 2F91A 1JMOH 5JBBS 1GI2A 3Q00A 4KKDA 1IQKA 1KXBA 1V2OT 2GCTC 4GHQA 1LPZB 1Z7KA 1G3DA 2ZGCA 4NWLA 4NA8A 1DWBH 3T5FH 3L3TA 2KAIB 3FP7E 1LVBA 1Z8JB 2WUCA 2Y81A 1O37A 3PTNA 2CMYA 5AVDA 3RXBA 1SMFE 2R9PA 1VITF 1C1RA 1EUFA 1IAUA 3BG4B 1QRWA 2EEKA 2BQ6B 1XUJA 2OP9A 4K5ZA 1SR5C 1GBCA 3UFAA 2PR3A 1TOMH 1V2KT 1TNHA 2R2WU 3ZVDA 2UWOA 3C27B 4NA7A 1MD7A 1AB9C 1O35A 5I25A 4IC6A 4Y8YA 5CE1A 3BTEE 1ETTH 1ZPCA 2ZDLA 1OWHA 2PFEA 1P02A 1W7GH 2G5NA 1ELCA 3BTWE 1WQSA 3URDA 4B73A 1BHXF 3GDSA 1UTPA 1AZ8A 3TITA 2FZZA 2BY5X 1LVYA 2O8WA 3Q3YA 1P57B 1CA0C 1HAVB 3Q77A 1OS8A 3VFEA 4H4FA 3RU4T 1KXDA 4MQAA 1SHHB 2I6QA 1EJNA 2OC1A 1CO7E 1P8VC 6ESTA 1E34B 3ATMA 1TNJA 2G55A 3SZNA 4BXSA 8GCHF 1MTSA 4NIWA 1EZQA 1C1OA 1O3HA 1TNLA 3HGPA 3ZVBA 1PYTD 4X1PU 5E2OA 1QQ4A 6GCHF 2GV7A 1JOUB 3SJOA 1HAYB 1SG8B 5HM2A 5AHGH 1V2LT 3SGAE 1TPAE 1UTNA 1FY3A 3MNBA 1C5NH 1G2MA 1W12U 1S84A 4Q7YA 1AE5A 1GI5A 1HAZB 1MAYA 2FLRH 1EKBB 1NFYA 5J4QA 5JYIA 3D62A 4Z6AH 2Y82A 4A92A 1NT1A 1J16A 4NG9H 1O2QA 1A0JA 2ZIQH 1V6DA 1EAWA 1BOQA 1XVMA 1YBWA 3OYPA 2Q1JA 2FOCA 4MPVA 1K22H 5HGGA 1BTHH 4MNYA 4AFUA 4B76A 1GVKB 1QBVH 3M7UA 2H1UA 1ZLRA 4AFQA 4J1YA 2UUKB 1DOJA 1ZHMA 1AMHA 3E1XB 1B7XB 4X6MA 3RMOH 4HTCH 5A8YA 1AGJA 1GL0E 1V2ST 1QNJA 2W3IA 3SNAA 5GPIB 4AOQA 5FBEA 1TLDA 2C8YB 1CGIE 2IN2A 3SNEA 1T32A 1V2UT 1TX7A 2H9TH 4Y11E 4MPXA 2GGVB 5AFYH 1ZGVA 2QY0B 3LGWA 1MQ5A 4WMEA 2RDLA 1LCYA 1VCQA 1ZYOA 2UUFB 5HXFA 3U8TH 4ABDA 2Z9JA 1FZZA 1HBTH 1YPGH 2ZI2H 1ZR0A 2EA3A 1T4VH 3RC4A 2VWLA 3DD2H 1CT4E 1KYNA 2W26A 3KGPA 1AI8H 1QQUA 2GDEH 4WJG2 4Q7XA 5C5OA 1LHDH 2AGIX 3SU1A 2Y5GA 5FPYA 3ODDA 4KGAA 5T6GA 1H1BA 5HMAA 2AMPA 4D7FA 4MPWA 2R0KA 1C1WH 2XWAA 2OQ5A 3QDZB 4ABHA 1KXFA 1GDNA 1XM1A 4WH6A 2O9QA 4OS7A 3TJOA 1UK4A 1O3CA 5F8ZA 2BY8X 4NSVA 1M9UA 2ZHEH 4SGAE 1ZHRA 3QK1A 4O03A 2BQWB 1FJSA 1GHAF 2NU4E 1SGTA 4K8BA 3QZQA 1LVMA 3ODFA 4HI3A 5LPFA 1EJAA 2XC4A 2UUYA 1H8IH 4U30A 1HAHH 2F9UA 1QL9A 2ZG0H 4GVUA 4FU8A 1O36A 2VGCC 1E0FD 3SJ8A 1OYQA 3SHCH 4CR9A 1MCTA 4GCHG 1X7AC 1AB9B 2IOTA 4WWYA 1BMNH 5JB8S 2V3OH 1AZZA 4AG2A 4UEHH 4YT7H 1W7XH 3CS7A 2G81E 1FAKH 1VITG 1MBMA 3BTHE 2OBQA 1UTOA 1T4UH 1A5HA 1GBMA 1AFQB 1MQ6A 1FY8E 1ORFA 1F0UA 2C8XB 1YPHC 3VB6A 2QV1A 1CGHA 1O2VA 1XKBC 3DT0H 2NU3E 1LPKB 3U98H 3NUMA 5ABWA 1C5ZB 1ZMNA 2Q6GA 4MNXA 1NRQH 4FUHA 3GYLB 4NFEA 1LKBA 1HV7A 2EI7A 3P17H 2FESH 3QTOH 3BEFB 3LONA 3ZZ6A 1A3EH 3EE0B 1C1VH 5FX6A 1HFDA 3TJVA 1TQ7B 3U8RH 1SLVB 1IQGA 1UVPA 4DGJA 2BDIA 2W7SA 3MO6A 1IQMA 2W3KA 1QA7A 3UWIA 3MH6A 1H8DH 5TCAA 2NU0E 5FPSA 4KTSA 5G4BA 3SV8A 1GJ9B 2B7DH 1P09A 2BD4A 1NS3A 1BDAA 3KIDU 2GZ7A 3S9CA 1C5UA 2DE8A 2P93A 2Y5FA 8GCHG 2FI3E 1YPLH 1QA0A 5F8TA 1XUKA 4PROA 1AE8H 1O38A 1TQ0B 1Y5AT 4CBNA 3LJOA 1NRPH 4WH8A 1ZMJA 2WPJS 3WY8A 2HOBA 1SHYA 1QRZA 3M35A 1WTHD 1NY22 3P8FA 2UUJB 2OUAA 2PKAA 1VR1H 1P01A 3RXQA 1VCWA 2QGRA 3BTFE 3RXRA 4X8TH 2FI4E 1D3TB 2HALA 4FUGA 1OXGA 3AAVA 3ZZ3A 1UTJA 2BLWA 4RSPA 2FXRA 3QGJA 3R0FA 3VB5A 2STBE 2FEQH 3FVFB 1D9IA 3QO6A 5C5NA 3DFLA 1W13U 1D3DB 2THFB 4YESB 3GDUA 1TFXA 1C5QA 2ZHWH 4B1TA 4O97A 1C9TA 1ZJDA 1RS0A 5DO4H 1BTWA 3SU6A 2Y80A 5EOKA 4ESTE 1YM0A 1IQHA 1GMCF 1GJAB 2WV4A 2OINA 1DWEH 2Z6BD 3VB7A 1O3EA 1EAXA 1GJ8B 2A7HA 1B5GH 3RM2H 1HAOH 2LPRA 2F9NA 1FY5A 1T7CA 2ZHQH 2GMTC 3E3TA 3I78A 3W94A 1BQYA 4AN7A 3M3SA 1EOLA 1P3CA 4I32A 4Q80A 1P2JA 1L2EA 4OS5A 2F9VA 4UFFH 5EW1H 2XNIA 3FFGA 3A7XA 3SQHE 1LQDB 2J2UA 1GBDA 1TWXB 2R3UA 2GZ8A 2Z9LA 2A32A 1SBWA 2P3TB 2QXGA 3OU0A 1UVUH 3EDXB 2PKAB 1GHYH 5EG4A 4TWYA 1NFWA 1O2RA 4K1TA 2AMDA 2SNVA 4A1XA 1C2FA 3TGKE 1ANDA 1YGCH 3Q3KA 4YOJA 1NTPA 2Z94A 1FY1A 2PTNA 1F2SE 2PGBB 4ZMAH 3ZVGA 1AQ7A 1SGFG 1T8NA 2C3SA 4CHAC 2FODA 4XOJA 1SGDE 1J15A 2A4OA 1IQFA 1CGJE 4IC5A 4YOGA 1WOFA 3OY5U 1THSH