3P8FA

Crystal structure of mt-sp1 in complex with sfti-1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of catalytic domain of Matriptase in complex with Sunflower trypsin inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ST14 protein
total genus 57
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA01
1OWJA 1W3CA 1C5NH 1EB2A 1C1OA 1O2SA 2ZQ2A 4I8KA 3W94A 3UNRA 3RXLA 1HJ9A 2A31A 5C20A 3A8DA 1SGIB 2ZECA 1UVTH 1RTFB 2CF9H 3EA9A 1OWHA 1E34B 3B23B 2JH6D 1G3EA 3ZVBA 1AD8H 1QBOA 3GOVB 2G00A 3BEIB 4THNH 3OYPA 5C1XA 3H7TA 2FX6A 2F9PA 4GVUA 1FLEE 4TWWA 3A80A 1OP8A 1ZMJA 5DPAA 5LPEA 2WUBA 5EXMA 3PO1B 2GCTB 3AVZA 2JETC 2O9QA 3SV9A 4JYUH 1TNKA 3PROA 1K2I1 4YOJA 4RN6A 2PKAB 1A46H 4GSOA 2XYAA 2Z9LA 3BTEE 1GMHG 4D7GA 3M35A 1C1SA 3A84A 4FUFA 1AWFH 1FAKH 2ALVA 4Q7XA 3ODDA 2R3YA 3RXHA 3W95A 4DT7B 1HAVA 1PQ5A 3A8CA 3STIA 4BANB 3FZZA 4I33A 1O2KA 1C5MD 1F0RA 1Z8RA 1V3XA 1AWHB 1OYQA 1N8OC 3BTKE 1SR5C 2WPHS 2P93A 2V3OH 3GISB 1LHDH 1O3DA 2W7UA 4CRGA 4D9RA 1BRAA 1NFXA 2ZHWH 1EOJA 4XSKU 5AFYH 1YPEH 3U1IB 2FLRH 3S7HB 3I78A 4Y10E 3OY5U 3FVFB 3RMMH 3MU4A 1Z6EA 1V2NT 4A1TA 2A0QB 5FPYA 3UTUH 1BDAA 3EA7A 4D8NA 1UTJA 1BTUA 2FIRH 2PKSB 1FY8E 1BBRE 2P8OB 1Z7KA 2SNVA 2A7HA 3EA8A 1ANEA 3BTHE 4IC5A 1ID5H 2Z9JA 4J1YA 3D62A 1UHBA 1UTKA 2QF3A 2VIVA 3D49H 5ESTE 7GCHG 2P3UB 2ESTE 1F2SE 4O03A 4BNRA 2FS9A 2BDHA 4KP0A 4O97A 2XC5A 1BOQA 3F9EA 3LIWA 1DICA 2BXTH 3FANA 3T26A 2BHGA 4MPVA 1Y3WA 4M7GA 1GBAA 1LKAA 1P11E 4U30A 4FUHA 5A8YA 4X8VH 2QAAA 1UTLM 3RLYH 2V6NA 4WH8A 1A61H 1RIWB 1TBQH 3P95A 4FU7A 3ZZ5A 1C4Y2 1BRBE 1TMTH 2BVSH 3MU8A 3Q3YA 4Y8YA 1XVOA 4TPIZ 1YBWA 1G30B 1O3LA 1XX9A 1EX3A 1HRTH 3KGPA 3E8LA 3L3TA 4NZQA 5HMAA 1KTSB 2CMYA 2FOEA 3RXUA 2EA3A 1V2JT 1OPHB 5LPRA 5B6OA 1GJ7B 1EAWA 1JXPA 4B71A 3TGJE 1GHAF 1FONA 1Y8TA 1UVPA 1ARCA 4IMZA 4D9QA 1MTVA 2QXGA 1MAYA 3HK6B 1RRKA 2QGRA 2P94A 1WTHD 1AHTH 4MPUA 2W5EA 1HDTH 3EGKH 4DVAU 5JDUB 1LHFH 1NRSH 2STBE 1TMUH 1DWCH 1ETRH 1ZTLA 4O3UA 4Q80A 2FM2A 1AQ7A 1PPZA 5TCAA 3DHKH 1V2WT 4HI3A 3Q3KA 1TNJA 3C27B 1TX6A 1FN6A 3MNXA 1IQHA 1XUHA 4FVBA 1KXDA 2BZAA 5K7RA 3KQEA 1L1NA 4XBCA 1V6DA 1SQOA 2JETB 4OS4A 2VGCB 5EOKA 5T6FA 1IHSH 4CBOA 4X6OA 2R2MB 1F0UA 2PKSC 1LPZB 4ZKSU 3UFAA 1LTOA 1C5PA 2PTCE 2J38A 1D3QB 1BQYA 1BTZA 6GCHG 3SGBE 3GY3A 4GUXA 1P2NA 2FMJA 2VIPA 2QXIA 2GZ7A 3K6YA 2H9EH 4WXVA 2FYQA 3GY4A 4CRDA 2EC9H 1BTWA 1P04A 1SBWA 4GAWA 4ISHH 2FI3E 2AFQB 2B0FA 3OTJE 2VWOA 2PGQB 3LC5A 3VPKA 5DP3A 1MBQA 1CT0E 4I8GA 3MO9A 4H6TA 3KL6A 1TPPA 1PQ8A 4JYTA 3MNSA 2Q6GA 3RXRA 1UK2A 5DP9A 4J2YB 1GL1A 4WMEA 3KCGH 1C1UH 1O39A 1DXPA 1NM6A 1KY9A 1GJ5H 4HZHA 4QT8C 3SUGA 1H8DH 3BIVH 2OC8A 4H42U 2HNTC 3AASA 3LU9B 1IQLA 3E3TA 1O32A 4AGKA 1WSSH 2CF8H 2H5DA 5EGMA 1K1LA 4I7YH 1DFPA 1KYNA 3TVJB 4YO9A 1SC8U 1SHHB 1QBNA 1S81A 1A0JA 3FP8E 4YOIA 4NIVA 1ANCA 2A45B 5GIBA 2BY6X 2WPKS 4BAHB 1HAIH 1TOCB 2A5AA 1AN1E 1GVLA 5AVDA 3TGKE 1G3CA 1V2TT 2C8ZB 4IW4E 4X8UH 2WPJS 1HAXB 1IQNA 1NRPH 2VH6A 7GCHF 5DK1A 2ZFSA 4O9VA 3RP2A 3ATMA 5GWZA 3AAVA 4NCYA 2F83A 4UD9H 4ZH8A 1BIOA 2XWAA 1YP9A 1RTLA 1GBBA 2ZFQH 2OD3B 2O8LA 2FTLE 1HV7A 1O3CA 1BJVA 2HNTE 4NWKA 1C2IA 2BD3A 4ZXYH 3BG4B 3NPSA 1J14A 5EODA 1WAYB 1A5HA 1KDQB 1QRXA 3B9FH 2RDLA 2Y82A 4FUEA 3E6PH 2G4TA 1GHYH 3A7ZA 3MYWA 4DIHH 3UQOA 1NFUA 1KXBA 1GBJA 2GKVE 2H1UA 3S7KB 1JBUH 1C2EA 2WUCA 3ODFA 1P2QA 2XXLA 3DFLA 3F9FA 2BXUH 1GI9B 3LGYA 1AKSB 1P09A 2CV3A 1MQ5A 1P57B 3NKKA 2TRMA 2QCYA 1G36A 1IHTH 1EZUC 1MU8B 1P3EA 1FNIA 3QUMP 1ZSKA 4TPYA 2ZU5A 4MVNA 4INKA 1Z8IB 5AFZH 1BUIA 2PTNA 1ZGIA 1QTFA 4A5TS 3A7YA 1L2EA 4AORA 1TGSZ 2FWWA 5C5OA 4R0IA 4WY3A 2JH0D 4GCHG 4YOGA 2YNBA 4BTUB 3PWBA 3LGTA 1BMMH 1GBMA 2FLBH 1W2KH 2AMQA 3RXKA 1OYTH 4B75A 2XNIA 4LK4A 4UFGH 1ZRKA 2VIWA 1S5SA 1OWEA 1GI3A 1BMLA 1QB1A 3SUEA 1DPOA 4AG1A 4AYVB 2G81E 2ZPSA 5I46H 3E91A 3MTYA 1QJ6B 4WWYA 3SW2B 1AB9B 1DM4B 1L4ZA 1P06A 2M5TA 1XXDA 4ZAEA 2BOKA 3MOCA 3BG4C 1UVUH 1EJAA 2BVRH 3V3MA 1O2HA 1O2WA 3UPEA 2JKHA 3RXIA 3MWIU 1C1TA 1YPGH 5GCHF 2BD4A 1NROH 5H4IB 1MTNB 3I29A 4DURA 1O3HA 2AGIX 2W3KA 3P6ZB 2ZTYA 4WMDA 5FX5A 2AGEX 3U98H 1DOJA 4IC6A 3M7TA 2SFAA 1C1VH 1UCYE 2AERH 4CRCA 1O3GA 1O34A 3RLWH 4AZ2B 4ABFA 4YLQH 1S83A 1FUJA 5AHGH 5T6GA 2ZCLP 4JZFH 2VWMA 4I8LA 1BITA 1CSOE 1GHBF 2VVVA 2R2WU 1CT4E 2BX4A 2VVUA 3VFEA 2GDEH 2Z94A 3RXPA 1GBEA 3ATIA 1WOFA 2ZGCA 3M61U 3EQ0H 2XTTB 2P16A 1GBTA 1GBFA 3QDZB 7ESTE 3A83A 4B2BA 1BB0B 5FCRA 2CGAA 2VJ1A 3VB4A 1WBGB 3UQVA 1RD3B 3U1JB 1C2DA 2VINA 1ZPBA 2ANMH 5LH8A 3A85A 1JIMA 1P02A 3D23A 2BQWB 1MTWA 3ZVDA 2NU0E 3A7XA 1MCVA 2GT7A 1C4U2 1TMBH 2K1QA 1ZTKA 3NUMA 2GCTC 1ELFA 5DP6A 1ORFA 2QXHA 3PMJA 1AVWA 2GCHG 1SLUB 2PGBB 2ZDLA 4F49A 1ZHMA 1G2MA 2GD4B 3TIUA 5JB8S 1TA2A 1HAYB 4OS5A 4VGCC 3URCA 1T31A 2XC4A 3F9GA 4Q7YA 1OKXA 5HGGA 3UNQA 3SGQE 5DKMA 2HALA 1GMDF 2ZDVH 1SOZA 1GJDB 2C8XB 3SQHE 6GCHF 2BDAA 1S6HA 1BHXF 1L0ZA 4B1TA 1TPAE 3M5LA 2WYGA 1GBHA 4NGAH 1K9OE 1C5LH 1KSNA 3TU7H 1GHXH 1O2VA 4JZDH 1TGTA 1OWKA 3SV7A 3ZYEA 1CHOF 3ZVCA 3D65E 1GHAG 4YT6H 4ZKOU 4NSVA 2J4IA 3VGCC 4ZHMU 2A1DB 4AOQA 5E0JA 2TBSA 4Y8XA 4A7IB 1CGJE 1NPMA 4HFPB 2UUFB 2G52A 1GBDA 1YLCA 2BY9X 1BMAA 2Y6TA 3M5MA 3GYMA 3NWUA 3SOSA 2VU8E 1FY3A 2W26A 2P8OC 4DY7B 3TGIE 2SNWA 1Y5BT 4AFQA 1P8VC 3MH6A 1VCPA 2SGDE 2ASUB 3TH4H 3QTVH 1IQKA 1T8MA 1EASA 1NFWA 1KXFA 2AMDA 2ZIQH 5GJ4B 4PROA 2GTBA 4Y8ZA 2FOMB 4K8YA 3MU0A 4Y0YE 4XOJA 1AZ8A 2A4GA 2ZGBH 1TQ0B 1DITH 1W11U 2ZWLH 1TA6A 1E35B 1K1MA 1SMFE 2UWLA 1NFYA 3MO3A 1SGDE 4ABEA 1AUJA 1PQAA 3CP7A 3MNCA 2J34A 1EAXA 2BY5X 2XBVA 5EPYA 1VCQA 3RXCA 1W0ZU 1O3IA 1NY22 2OCVB 1AY6H 1EPTC 2C8WB 3A86A 2WYJA 1FMGA 1RFNA 4DW2U 3BTTE 5DP7A 2ZU2A 3SJ8A 2IJOB 2QYIA 4I8HA 3ZZ8A 1NESE 4YT7H 3QX5H 1VITF 1ZR0A 1IOEA 2ZHQH 3F1SB 3RXOA 4D76A 3VB7A 1GVZA 4YESB 1EUFA 2FI4E 3NCLA 1MD8A 1O2PA 2A2XH 3NZIA 1UVOA 3AAUA 4U2WA 1AFEH 3TK6A 3TK5A 1HAPH 1JOUB 1QQ4A 4CHAC 5C67A 3LH3A 3PMAB 3BF6H 3RMOH 1GJ4H 8LPRA 2O8UA 1EPTB 4HTCH 1SGCA 5FHTA 2AMPA 2RA0A 3TK9A 5JB9S 1DS2E 1E38B 2GP9B 3HGNA 1SFIA 2UUYA 1V2LT 1K21H 1ZMLA 3SJOA 7KMEH 1TNLA 2H9HA 1IQGA 4U01A 3T5FH 1FXYA 2GT8A 1VCWA 2H6MA 3LT3A 1MZDA 2ANKH 2H9TH 5PTPA 4NZLA 2R0KA 3A7VA 2XC0A 3LGWA 1ZSJA 2OBQA 4LXBH 2BX3A 4ZKRU 3RXVA 3MMGA 1GI8B 1CHGA 1C5SA 1ELGA 2C90B 1MBMA 1QIXB 1T8OA 2ZKSA 5L30H 1ZSLA 4B73A 2XBWA 3UNSA 1A3BH 1XUGA 3ZVEA 3V0XA 1GHVH 1CA8B 3BTQE 4K2YA 5LGOA 1ELVA 1A2CH 1BTPA 4NSYA 1CU1A 2FODA 4IMQA 2C3SA 3GY8A 1RS0A 1ZJKA 1CT2E 5ABWA 1GVKB 1D6WA 4BOHA 5A0CA 1AI8H 1B5GH 3PV4A 3BSQA 1VR1H 4DG4A 1LQDB 2FOBA 3PMBB 1BTXA 3ZVFA 1SSXA 2C93B 3ELAH 3SGAE 1TRNA 1O3FA 4HGCA 1EQ9A 1TRMA 1ANDA 1Y5AT 1NC6A 9ESTA 1IQFA 2SGQE 2Z3EA 2VB0A 3SHCH 2QY0B 2J9NA 1FJSA 3VB5A 5J4QA 8KME2 1RGQA 1O5FH 4BTTB 3ZZ9A 3SU3A 3A82A 1O5CB 1NRNH 4JZIA 1V2RT 3SU5A 2WPLS 2QV1A 1GI5A 3SI3H 1YKTA 3PTBA 2QF0A 2ZP0H 2J2UA 4ABIA 4ABHA 3E1XB 1ZJDA 4INLA 4KELA 3UWJH 5JYIA 3M3VA 1KLTA 2BLOA 1PQ7A 1S85A 1GI4A 1E37B 2WPIS 5A2MH 4LZ4B 1TX7A 2XCNA 4K1SA 2ZO3H 2HLCA 5EPNA 2ZHEH 1XMNB 1OXGA 1EKBB 3MFJA 2AS9A 4KTCA 3U8OH 1ZGVA 2HGTH 1W14U 1J9CH 2BDIA 1SLWB 4CRAA 2SGEE 3ZZDA 2BD7A 3HKIB 4ISIH 4JMYA 3P8FA 1YM0A 3PTNA 4MLFB 1C5VA 1SGEE 2A5KA 2TGPZ 3PO1C 2WINI 2ZFPH 3SI4H 5I25A 1W13U 1NS3A 1C5TA 2PUXB 1YPMH 4X1QU 2BTCE 3PM3A 3E0NB 3ZVGA 3ZV9A 2GCHF 3TH3H 3ZZ7A 1FDPA 4WH6A 2P3FH 1UCYH 2ZTZA 4UE7H 5GXPA 1NRRH 3TLOA 2BY8X 2NU2E 3KN2A 1BTYA 1LHGH 1O3KA 2OC7A 1ESBA 2Y81A 3O8CA 2OC1A 3SUFA 1THPB 4RKJB 2FOAA 1GI1A 1UTQA 1GJCB 1ABJH 1UTOA 1ELCA 5L2YH 3FAOA 4YZUA 1K1NA 1C5OH 3FZDA 2F9NA 1O2LA 1SL3A 1W10U 2Z9GA 3U9AH 3SV8A 3O8DA 1Y3VA 4YLUA 2VWLA 1TBRH 1GMCG 1LKBA 1GWAA 1O33A 1TB6H 3SO3A 2V3HH 1SGFA 5HM2A 1G3BA 1XXFA 4OGXA 4MPWA 1CO7E 1TNIA 4ABJA 1MUEB 5TJXA 1A0HB 1LHEH 2Z3CA 1C5YB 3RXFA 1Y59T 2P59A 5IDKA 1O35A 1LVYA 3QK1A 1SGTA 3HPTB 3SORA 1DXWA 3UOPA 1QL8A 1TQ7B 2GZ8A 3EAJA 1O5AB 3SBKA 1AGJA 2BQ6B 1QRZA 1OWIA 1TONA 3BEFB 4NIXA 5DP5A 1K1JA 1T4VH 1O3BA 3A87A 1MTNC 1Y3YA 3PLBA 3ESTA 1BA8B 2ZF0H 6CHAC 1PPBH 1GDNA 1TX8A 1MD7A 3Q77A 1HGTH 2ZI2H 3A7TA 2D26C 1Z1IA 5ETXA 1KXEA 1PPFE 1GG6B 4MNXA 5C1YA 1KDQA 1F7ZA 2GX4A 1RXPA 1DY8A 1H1BA 1QA0A 1V2PT 1O3MA 2AEIH 4WMFA 1SGYE 4X1RU 4Y76A 1A3EH 1EXFA 5A09A 3SU1A 1C1RA 5SGAE 1SHYA 1SGNE 1A5IA 3E90B 4X1NU 4LZ1H 1MKXK 3VXEH 1YPKH 2F9OA 3BN9A 3P8GA 1HB0B 2C4FH 2FPZA 3UIRA 2FS8A 4NWLA 1YPHC 3K9XB 3BTGE 1OOKB 1XUKA 1K1IA 4ZUHA 4FUIA 1MMJN 2CHAC 4KKDA 3IG6B 1O0DH 4YTAA 1V2VT 3HK3B 1NTPA 6LPRA 2P95A 2D2DA 3FFGA 1TGNA 5E0HA 1XM1A 3ITIA 1GDQA 3T29A 3QZQA 3LONA 1KXAA 4XBDA 5L6NH 1W7GH 4LOYH 2IPHA 2GV6A 5DP4A 2BD9A 4K60A 1Z8JB 3E16B 1K28D 1S82A 3DT0H 3JZ2B 1MH0A 1DWEH 1FY5A 2ZA5A 2HPQH 3G01A 4CBNA 1K1OA 3MH4A 5G4BA 4FU8A 1G9IE 1INCA 3SU2A 1SQAA 2SGFE 3SQEE 1DE7H 1QNJA 4X6NA 4CRFA 2HRVA 1YPHE 3SZNA 4FU9A 3NXPA 1N1LA 1ELDE 2F9BH 2BQ7B 2XRCA 2ANWA 1FIWA 1GDUA 3RXBA 2BVXH 3HKJB 1LVBA 4AFUA 1GMCF 2F91A 1O3EA 1UHBB 3JZ1B 4I8JA 4X2XA 1YPJH 3EYDA 4I31A 3LGUA 4KTSA 1GGDB 1IAUA 1Q3XA 1P2MA 3SNEA 2UWOA 1XUIA 4OS7A 2AGGX 3R3GB 3TJOA 3V7TA 1O31A 1MTUA 4NA8A 2EI7A 2RA3A 1C2HA 2ZFTA 2RG3A 3TPIZ 4UDWH 2I6QA 2P3TB 1LPGB 3QTOH 1RTKA 2PHBA 1C2KA 2ZDKA 1GI0A 3HATH 5JBAS 2FXRA 1PPCE 3ZZ3A 1FQ3A 5HM9A 1LVOA 3ATWA 1RIWC 1O2XA 3VEQB 1AU8A 3RXEA 1DWDH 3QGNB 2DUCA 3F68H 1D3PB 1EP5A 2CN0H 5DJ7A 1CBWC 3S9AA 2D8WA 2BZ6H 2A2QH 1DVAH 2OC0A 1YCPH 2B8OH 2BD5A 3TJUA 2PKAA 2H5CA 1TRYA 2TGDA 4H4FA 1TPOA 1TWXB 4MDSA 1KTTB 1IQEA 1XVMA 1WTGH 4MNWA 1E0FD 1GI2A 3PYHA 1GCDA 1EP6A 3R0FA 3SV6A 2BDBA 1PPGE 1W0YH 1LHCH 1ZOMA 1XUFA 1IQIA 1LQEA 2BDGA 4BXSA 1AMHA 1FN8A 1HAZB 1SGRE 1Y3UA 1A4WH 3M7QA 3FP6E 1QB9A 5GCHG 3SNAA 3KF2A 1F5LA 2ZU3A 1BBRK 5GDSH 2HWLB 1O2YA 1GJBB 2ALPA 1HNEE 1P2JA 3OY6U 4I32A 3O8BA 1QURH 2A4QA 1O3NA 1P2IA 3RU4T 4JYVH 2WPMS 1HPGA 2ZHFH 3IITA 5J4SA 3HGPA 1UMAH 1ZHRA 3TNSA 1V2MT 1GGDC 3SV2H 4K1EA 2XCFA 2BOHB 4X6MA 2GMTB 1V2OT 2DE9A 1AVXA 1FAXA 1QFKH 3OU0A 1P05A 2D1JA 5F8TA 3GDUA 1ARBA 1N6YA 3U8TH 1O2GH 5DG6A 1UTMA 2XBXA 1D3DB 2VIOA 2A4RA 2WV5A 3VGCB 1PFXC 5E0GA 1C2GA 2TIOA 2R3UA 3QO6A 3K65B 2STAE 4GPGA 1C2LA 4ABDA 5EXLA 1T8NA 2G5VA 1JRTA 2ZU1A 4AYYB 1C5ZB 3GICB 4BAOB 3SHAH 1IQMA 3U8RH 1ESAA 4R8TB 3ZZ6A 1ANBA 5FCKA 2TGAA 3PLPA 2VIQA 1O2UA 1ETSH 4ISOA 1C2JA 4KTUA 2OUAA 5T3HA 2ODPA 2ZPQA 4FUBA 1OX1A 1D3TB 4NIWA 4ABGA 1C1WH 3T25A 2W7SA 2FP7B 2R9PA 5DP8A 1B0FA 1LDTT 1B7XB 1F92A 2FO9A 2DE8A 1O3JA 1AO5A 5FBIA 1C1NA 1H8IH 1O5GH 1P9SA 2BYAX 1PPEE 1WQVH 3LPRA 4H6SB 4SGBE 3SN8A 4ESTE 1SGFG 4JZ1A 1Q31A 2ZCHP 2RCEA 3M36A 2Y5HA 3RC4A 3BV9B 4UFEH 4IS5A 1LMWB 1LO6A 2CXVA 4FUJA 3A89A 1F5RA 4ZKNU 1QL7A 1BMNH 1MKWK 4O3TA 4X2WA 1GJAB 3BTFE 1A1RA 4U32A 4CHAB 1C2MA 1O2IA 4A1XA 5A8ZA 4ISLA 1AB9C 3LGIA 3S9BA 2LNCA 1UK3A 1YGCH 4Y7AA 2PSXA 1H4WA 2ZNKH 1WV7H 1X7AC 2B7DH 2AYWA 1TPSA 3BG8A 1ZHPA 4OS6A 2AH4X 1MKXH 1HIAA 3L6PA 1ZPZA 4BTIB 4X1SU 2ZDAH 1HJAB 2BLWA 1MKWH 1MQ6A 3AW0A 4JCNA 1EZQA 2Z3DA 1MU6B 1ETTH 1EZSC 4Z0KA 3SJIA 1FV9A 2TGTA 4JK6A 1V2KT 3TITA 3VB6A 3MH7A 1C9PA 1P9UA 2B9LA 2QA9E 1L4DA 3C1KA 4E7RG 3GY2A 3CS7A 2BLQA 3P70B 3M7UA 3B8JA 2FOGA 2GGVB 4ABAA 3EE0B 3KQDA 2EI8A 2ANYA 2FOHA 2ZHDA 1H9LB 2OLGA 3GCTF 4Z6AH 3BTME 4ASHA 1O2RA 4A92A 4FUDA 1HXFH 2GZ9A 1KLJH 1Z1JA 4ZXXH 1GCTB 5EQSA 3U69H 2ZGHA 1J16A 1H9HE 5HYOA 1GBIA 4XE4A 2ODYB 5FXLA 1CVWH 1P10A 5GPIB 1ELBA 1P2KA 3UOUA 1HUTH 4AN7A 4TYDA 3ZZBA 2NU1E 2AIQA 3K2UA 1P12E 3ZV8A 1TIOA 3H5CB 5FAHA 2BM2A 1TFXA 2BDCA 3GYLB 1GJ6A 3SNBA 1GG6C 3KEEA 5CHAC 3SU4A 1AKSA 3T62A 8ESTE 3ZZ4A 1QB6A 1KXCA 2VWNA 4Y6DA 1A7SA 1EAIA 3E0PB 5JBBS 3LC3A 2ZTXA 2ZEBA 3S0NA 2PV9B 1QY6A 1FPCH 4MNVA 5E8EH 1BRUP 1BTHH 2GV7A 4NIYA 3VXFH 1EZXC 2IOTA 1S84A 1HJAC 3UWIA 1T8LA 5E2OA 4AFSA 1BZXE 1NZQH 1MAXA 4ZHAA 1AUTC 4D7FA 1BHXB 3WY8A 1G37A 3GCTG 4K3JA 1O2QA 1J15A 4NFFA 1XKBC 2UUKB 3LDXH 4B2CA 5F8XA 3DUXH 1W8BH 1WUNH 5BRRE 1HIAB 5A0AE 2WV4A 4GLYA 2QIQA 4X2YA 1O3PB 3ENSB 1SVPA 4Q2KA 1GMHF 1W12U 1YLDA 1GCTC 2A5IA 3SUDA 1SQTA 1MCTA 1WYKA 3QWCH 3T28A 1EJNA 1EATA 1KLIH 3S9CA 2IN2A 3P17H 1OP0A 1ELEE 3STJA 1NN6A 4X2VA 1C5UA 1T7CA 5IYTA 1P0SH 1QBVH 4GHQA 2BB4A 2ZQ1A 4MG3A 1QJ7B 3URDA 1SGQE 3IWMA 1QJ1B 1QCPA 2PUQH 3RC5A 3RXTA 5FBEA 4IN2A 5DO4H 4CREA 3M37A 3KNXA 2HPPH 3OSYA 3KIDU 3UR9A 1VZQH 2OQ5A 4ZROA 4CRBA 1VGCB 2Z9KA 3M3SA 2ZFRH 4TY6A 3LJOA 1CE5A 3SNCA 2AIPA 1BRCE 3SU0A 3M3TA 2O8TA 3TJVA 1DDJA 5F8ZA 3PB1E 1ELTA 2Q6FA 1ZTJA 4DGJA 1A0LA 1QQUA 2QC2A 1S0QA 1SLXB 1AE8H 5C5NA 1AFQC 2PSYA 2ULLA 4INHA 5A0BA 2OQUA 1AIXH 1C1MA 3PLKA 4Q7ZA 5JPMH 1K22H 1UTPA 3RDZA 2PW8H 3RU4D 3ZVAA 1PYTC 1TOMH 1NU9A 4MNYA 3V13A 3T27A 1DANH 1NRQH 2GMTC 4MTBA 5DGJA 3V12A 2UWPA 1J17T 1HLTH 5TCCA 2ZGXH 3KHVA 4WF8A 3CS0A 5EQRA 1ZZZA 4A6LA 3A81A 4K8BA 2XBYA 1FPHH 3P92A 3DD2H 4MQAA 2ZC9H 3F9HA 1L1GA 4IBLH 3RMLH 1G3DA 3MU5A 4WJG2 1LVMA 2BD2A 1JIRA 1PJPA 4YM9A 1GI7B 2Y7ZA 4AG2A 1BCUH 3OX7U 4VGCB 1C5QA 2QN5T 1EB1H 2A32A 2EI6A 3Q3XA 4CR5A 3GCNA 1FZZA 2CJIA 3BTWE 3MNBA 3TNTA 1V2ST 1TBZH 1AZZA 1E36B 3P8NA 2V35A 2BDYA 2PWXA 1VJ9U 1O37A 4ABBA 1H9IE 1C5XB 1SLVB 1YCPK 4FXGH 8GCHG 1A5GH 4AX9H 3LKWA 5EG4A 4XFQA 1MZAA 4DJZB 1Z71A 1O30A 1ZLRA 3RXDA 1Z8GA 1DX5M 2Y5GA 4CH8B 2O8WA 1O36A 2G55A 3QZRA 1ABIH 3GY7A 4RSPA 1TE0A 5ESBA 2G4UA 1GJ8B 3UY9A 3A8BA 2SGAA 3O8RA 2R0LA 1YC0A 1F5KU 2C8YB 2VVCA 4RKOB 1K1PA 4GHTA 2F9VA 1O5DH 1BT7A 4FUCA 1N8OB 3DA9B 1WCZA 2V0BA 1WQSA 1GHWH 4E7NA 1SG8B 2XWBI 4K5ZA 2KAIB 3N7OA 4JK5A 3BEUA 2G8TA 3LJJA 5F03A 3A8AA 3RMNH 3K6ZA 2CHAB 3SJ9A 3PWCA 1W7XH 3LOXA 4BAKB 4CR9A 2VGCC 1DUAA 1P01A 3LGVA 1UJ1A 3RC6A 1B0EA 1S6FA 1MTSA 1BJUA 1D6RA 1T4UH 2OP9A 3RU4E 1UVSH 4OS1A 1WU1A 3RUOA 3ZZCA 1OP2A 2NU4E 4UFFH 1HCGA 1O38A 3VB3A 3KQBA 5E2PA 3QLPH 1DT2A 1ELAA 1QHRB 2ZPRA 3QGJA 4Y0ZE 1SOTA 1O5BB 1TYNA 4F4OC 4MPXA 4OGYA 3UUZA 4DIIH 2Z6BD 1C1PA 4BXWA 1ZPCA 3ATKA 1D9IA 1TALA 1ZRBA 1NU7B 1J8AA 1DLKB 1P2OA 4ZHLU 1TAWA 1EOLA 5EQQA 1UO6A 3ZYDA 2XW9A 3SJKA 1EJMA 3RXJA 1C4V2 4FUGA 4ISNA 5T6DA 4E05H 4XDEA 1UCYK 2OBOA 1ACBE 1HAHH 1BBRH 1HAGE 4NG9H 1FIZA 1GBKA 2VIDA 3EDXB 2BLVA 3KQCA 1C2FA 2J95A 4K69A 1O2TA 5CE1A 3I77A 4K1TA 3A7WA 5AF9H 2NU3E 4X6PA 4NFEA 4Y79A 2FTMA 1D4PB 1V2UT 3DFJA 5C2ZA 2FDAA 4UONA 4UEHH 4BAQB 2FI5E 2FOCA 1LCYA 4B76A 2GDDA 4WVPE 3F6UH 2Z7FE 4E06H 1TGBA 1AFQB 1QGFA 1GPZA 2BD8A 1CGIE 2J94A 1AE5A 2YNAA 2I6SA 4KGAA 5FPSA 2FEQH 3T2NA 4AGJA 3L33A 2A7JA 1ZMNA 2Z9IA 5EXNA 2QXJA 4NA9H 1CQQA 3NK8A 1C9TA 6CHAB 1RJXB 3GDVA 4X8TH 1OS8A 1QRWA 3RXSA 5JBTA 4FVDA 1SB1H 1O2OA 2O8MA 2BMGB 4B74A 1O2ZA 3CENA 3MO6A 2FZZA 4Y7BA 5CMXH 5F6MA 2A7CA 1N6XA 5EU8A 5EW1H 4CH2B 4JZEH 1DUEA 5FPTA 1HBTH 2PLXA 3MHWU 1TGCA 1YF4A 4UFDH 4X0WU 4IN1A 1JWTA 2FESH 2Q1JA 1AVGH 3RXQA 4X1PU 1HJ8A 2OTVA 4Y71A 1SGPE 2W3IA 3RXAA 4IGDA 1YCPM 1UTNA 3Q00A 9LPRA 5L2ZH 4AB9A 1GBCA 2Y5FA 2ZGJA 2UUJB 1Y5UT 2ZCKP 2YOLA 2Y7XA 1ESTA 3GY6A 4Y11E 7LPRA 3RXMA 1QL9A 1Q2WA 1SPJA 2F3CE 3GCOA 4SGAE 2BY7X 1JMOH 3GCHB 1DSUA 2G51A 3RXGA 1HXEH 5FX6A 1GI6A 1GBLA 1GMDG 3AW1A 4OS2A 2B5TB 1THRH 3TH2H 2VH0A 2KAIA 1G32B 1CBWB 4GCHF 3MI4A 1TABE 1DSTA 3QN7A 4A1VA 3UR6A 2EEKA 1DLEA 3Q76A 1YYY1 4AFZA 3MH5A 6ESTA 1KIGH 2HOBA 4WXIA 1O2JA 1O2MA 2G5NA 1HAVB 2ODQA 4B2AA 5C1UA 2ZDNA 5BPEA 1HYLA 1NT1A 3MU1A 1HAOH 3P8OA 3BIUH 1GJ9B 1YPLH 2Q6DA 1IQJA 3BTDE 1O3AA 2NWNA 4ZMAH 2SGPE 2FOFA 2FX4A 1GL0E 2GVFA 5C3NA 1S0RA 3GCHC 4XBBA 2ILNA 1CA0B 2FYRA 1UK4A 3S69A 1C1QA 1GHBG 2F9UA 3UREA 3M5NA 1DWBH 3LH1A 1NO9H 1P3CA 1V2QT 4DCDA 1F0SA 2OXSA 2HNTF 2ZDMA 3A88A 1PPHE 1FI8A 2HVXA 1Y3XA 2Y80A 1XUJA 4BAMB 1Z6JH 3SNDA 1EPTA 1P03A 1LPKB 1L1JA 5LPFA 1HFDA 1VITH 1FY1A 1SFQB 4X8SH 1VGCC 3H7OA 5A8XA 1SI5H 3RM2H 2THFB 3ATLA 1PYTD 3ZZAA 3TJNA 5K0HA 1F0TA 4NA7A 3SU6A 1OWDA 2VNTA 4AB8A 2PFEA 1VITG 1O5EH 1CGHA 1C5WB 3GDSA 5CHAB 3RM0H 1QA7A 1JRSA 3M5OA 2LPRA 2OINA 1U6QA 1THSH 3PMHB 5HXFA 1O2NA 1TNGA 1T32A 2J92A 1FY4A 1OSSA 2JH5D 3FP7E 4TWYA 2ZG0H 1GHZA 2PR3A 8GCHF 2ZFFH 2ZZUH 4TY7A 1TNHA 5JBCS 1EAUA 2H2ZA 2TPIZ 1O3OA 1ZYOA 1CA0C 1DY9A 4DOQA 1CHOG 5EW2H 1M9UA 3GY5A 1VJAU 2A4OA 1XKAC 1TLDA 2ZU4A 1C5RA 1G2LA 1QR3E
chains in the Genus database with same CATH superfamily
1OWJA 1W3CA 1C5NH 1EB2A 1C1OA 1O2SA 2ZQ2A 4I8KA 3W94A 3UNRA 3RXLA 1HJ9A 2A31A 5C20A 3A8DA 1SGIB 2ZECA 3F2FA 1UVTH 1RTFB 2CF9H 3EA9A 5CDFE 1OWHA 1E34B 3B23B 2JH6D 1G3EA 3ZVBA 2JJ2D 1AD8H 1QBOA 3GOVB 2G00A 3BEIB 4THNH 3OYPA 5C1XA 3H7TA 2FX6A 2F9PA 4GVUA 1FLEE 4TWWA 3A80A 4YXWD 1OP8A 1ZMJA 5DPAA 5LPEA 2WUBA 5EXMA 3PO1B 2GCTB 3AVZA 2JETC 2O9QA 3SV9A 4JYUH 1TNKA 3PROA 1K2I1 4YOJA 4RN6A 2QF4A 2PKAB 4OM9A 1A46H 4GSOA 2XYAA 2Z9LA 3BTEE 1GMHG 3OE7D 2WPDD 4D7GA 3M35A 1C1SA 3A84A 4FUFA 1AWFH 1FAKH 2ALVA 4Q7XA 3ODDA 2R3YA 3RXHA 3W95A 4RT1A 4DT7B 1HAVA 1PQ5A 3A8CA 3STIA 2WSSD 4BANB 3FZZA 4I33A 1O2KA 1C5MD 1F0RA 1Z8RA 2JIZD 1V3XA 1AWHB 1OYQA 1N8OC 3BTKE 1SR5C 3DSPA 2WPHS 2P93A 2V3OH 3GISB 1LHDH 1O3DA 2W7UA 4CRGA 4D9RA 1BRAA 1NFXA 2ZHWH 1EOJA 4XSKU 5AFYH 1YPEH 3U1IB 2FLRH 3F2HA 3I78A 3S7HB 4Y10E 3OY5U 3FVFB 3RMMH 3MU4A 1Z6EA 1V2NT 4A1TA 2A0QB 4M9FA 5FPYA 3UTUH 1BDAA 2K8IA 3EA7A 4D8NA 1UTJA 1BTUA 2FIRH 2PKSB 5C0UA 1FY8E 1BBRE 2P8OB 1Z7KA 2SNVA 2A7HA 3EA8A 1ANEA 3BTHE 4IC5A 1ID5H 2Z9JA 4J1YA 3D62A 1UHBA 1UTKA 2QF3A 2VIVA 3D49H 5ESTE 5B6LA 7GCHG 2P3UB 2ESTE 1F2SE 4O03A 4BNRA 2FS9A 2BDHA 4KP0A 4O97A 2XC5A 1BOQA 3F9EA 3LIWA 4DT4A 1DICA 2BXTH 3FANA 3T26A 2BHGA 4MPVA 1Y3WA 4M7GA 1GBAA 1LKAA 1P11E 4U30A 4FUHA 5A8YA 4X8VH 2QAAA 1UTLM 3RLYH 2V6NA 4WH8A 1A61H 5EJLA 1RIWB 1TBQH 3P95A 4FU7A 3EE7A 3ZZ5A 1C4Y2 1WXRA 1BRBE 1TMTH 2BVSH 3MU8A 3Q3YA 4Y8YA 1XVOA 4TPIZ 2RDEA 1YBWA 1G30B 1O3LA 1XX9A 1EX3A 1HRTH 3KGPA 3E8LA 3L3TA 4NZQA 5HMAA 1KTSB 2CMYA 2FOEA 3RXUA 2EA3A 1V2JT 1OPHB 5LPRA 3WWBA 5B6OA 2XOKD 1GJ7B 1EAWA 1JXPA 4B71A 3TGJE 1GHAF 1FONA 1Y8TA 1UVPA 1ARCA 4IMZA 4D9QA 1MTVA 2QXGA 1MAYA 3HK6B 1RRKA 2QGRA 2P94A 1WTHD 1AHTH 4MPUA 2W5EA 1HDTH 3EGKH 4DVAU 5JDUB 1LHFH 1NRSH 2STBE 1TMUH 1DWCH 1ETRH 1ZTLA 4O3UA 4Q80A 2FM2A 1AQ7A 1PPZA 5TCAA 3DHKH 1V2WT 4HI3A 3Q3KA 1TNJA 3C27B 1TX6A 1FN6A 4Q63A 3MNXA 1IQHA 1XUHA 4FVBA 1KXDA 2V3MA 2BZAA 5K7RA 3KQEA 1L1NA 2HLDD 4ACAA 4XBCA 1V6DA 1SQOA 2JETB 4OS4A 2VGCB 5EOKA 5T6FA 1IHSH 4CBOA 4X6OA 2R2MB 1F0UA 2PKSC 1LPZB 4ZKSU 3UFAA 1LTOA 1C5PA 2PTCE 2J38A 1D3QB 1BQYA 1BTZA 6GCHG 3SGBE 3GY3A 4GUXA 1P2NA 2FMJA 2VIPA 2QXIA 2GZ7A 3K6YA 2H9EH 4WXVA 2FYQA 2KFWA 3GY4A 4CRDA 2EC9H 1BTWA 1P04A 1SBWA 4GAWA 4ISHH 1WDIA 2FI3E 2AFQB 2B0FA 3OTJE 2VWOA 2PGQB 3LC5A 3VPKA 5DP3A 1MBQA 1CT0E 4I8GA 3MO9A 4H6TA 3KL6A 1TPPA 1PQ8A 4JYTA 3MNSA 2Q6GA 3RXRA 1UK2A 5DP9A 4J2YB 1GL1A 4WMEA 3KCGH 1C1UH 1O39A 1DXPA 1NM6A 1KY9A 1GJ5H 4HZHA 4QT8C 3SUGA 1H8DH 3BIVH 2OC8A 4H42U 2HNTC 3AASA 3LU9B 1IQLA 3E3TA 1O32A 5FL7D 4AGKA 1WSSH 2CF8H 2H5DA 5EGMA 1K1LA 4I7YH 1DFPA 1KYNA 3TVJB 4YO9A 1SC8U 1SHHB 1QBNA 1SKYE 1S81A 1A0JA 3FP8E 4YOIA 4NIVA 1ANCA 2A45B 5GIBA 2BY6X 2WPKS 4BAHB 1HAIH 1TOCB 2A5AA 1AN1E 1GVLA 5AVDA 3TGKE 1G3CA 1V2TT 2C8ZB 4IW4E 4X8UH 2WPJS 1HAXB 1IQNA 1NRPH 2VH6A 7GCHF 5DK1A 2ZFSA 4O9VA 3RP2A 3ATMA 5GWZA 3AAVA 4NCYA 2F83A 4UD9H 4ZH8A 1BIOA 2XWAA 1YP9A 1RTLA 1GBBA 2ZFQH 2OD3B 2O8LA 2FTLE 1HV7A 1O3CA 1COWD 1BJVA 2HNTE 4NWKA 1C2IA 2BD3A 4ZXYH 3BG4B 3NPSA 1J14A 5EODA 1WAYB 1A5HA 1KDQB 1QRXA 3B9FH 2RDLA 2Y82A 4FUEA 3E6PH 2G4TA 1GHYH 3A7ZA 3MYWA 4ZCNA 4DIHH 5DN6D 3UQOA 1NFUA 1KXBA 1GBJA 2GKVE 2H1UA 2JJ1D 1JBUH 3S7KB 1C2EA 3OTPA 2WUCA 3ODFA 1P2QA 2XXLA 3DFLA 3F9FA 2BXUH 1GI9B 3LGYA 1AKSB 1P09A 2CV3A 1MQ5A 1P57B 3NKKA 2TRMA 2QCYA 1G36A 1IHTH 1EZUC 1MU8B 1P3EA 1FNIA 3QUMP 1ZSKA 4TPYA 2ZU5A 4MVNA 4INKA 1Z8IB 5AFZH 1BUIA 2LP6A 2PTNA 1ZGIA 4XRNA 1QTFA 2LELA 4A5TS 3A7YA 1L2EA 2HVYB 4AORA 1TGSZ 2FWWA 5C5OA 4R0IA 4WY3A 2JH0D 4GCHG 4YOGA 2YNBA 4BTUB 3PWBA 3LGTA 1BMMH 1GBMA 2FLBH 1OHHD 1W2KH 2AMQA 3RXKA 1OYTH 3U28C 4B75A 2XNIA 4LK4A 4UFGH 1ZRKA 2VIWA 1S5SA 1OWEA 1GI3A 1BMLA 1QB1A 3SUEA 1DPOA 4AG1A 4AYVB 2AHME 2G81E 2ZPSA 5I46H 3E91A 3MTYA 1QJ6B 4WWYA 3SW2B 1AB9B 1DM4B 1L4ZA 1P06A 2M5TA 1XXDA 4ZAEA 2BOKA 3MOCA 3BG4C 4AC9A 1UVUH 1EJAA 2BVRH 3V3MA 1O2HA 1O2WA 3UPEA 2JKHA 3RXIA 3MWIU 1C1TA 1YPGH 5GCHF 2BD4A 1NROH 1YWUA 5H4IB 1YY3A 1MTNB 3I29A 4DURA 1O3HA 2AGIX 2W3KA 3P6ZB 2ZTYA 2JDID 4WMDA 5FX5A 2AGEX 3U98H 1DOJA 4IC6A 3M7TA 2SFAA 1C1VH 1UCYE 2AERH 4CRCA 1O3GA 1O34A 3RLWH 4AZ2B 4ABFA 4YLQH 1S83A 1FUJA 5AHGH 1E1RD 5T6GA 2ZCLP 4JZFH 2VWMA 4I8LA 1BITA 1CSOE 1GHBF 3N99A 2VVVA 2R2WU 2KX4A 1CT4E 2BX4A 2VVUA 3VFEA 2GDEH 2Z94A 3RXPA 1GBEA 3ATIA 1WOFA 2ZGCA 3M61U 3EQ0H 4RI0A 2XTTB 2P16A 1GBTA 1GBFA 3QDZB 7ESTE 3A83A 4B2BA 1BB0B 5FCRA 2CGAA 2VJ1A 3VB4A 1WBGB 3UQVA 1RD3B 3U1JB 1C2DA 2VINA 1ZPBA 2ANMH 5LH8A 3A85A 1JIMA 2YMSB 1P02A 3D23A 2BQWB 1MTWA 3ZVDA 2NU0E 3A7XA 1MCVA 2GT7A 1C4U2 1TMBH 2K1QA 1ZTKA 3NUMA 2GCTC 1ELFA 5DP6A 1ORFA 2QXHA 3PMJA 1AVWA 2GCHG 1SLUB 2PGBB 2ZDLA 3DCLA 4F49A 1ZHMA 1G2MA 2GD4B 3TIUA 5JB8S 1TA2A 1HAYB 4OS5A 4VGCC 3OEED 3URCA 1T31A 2XC4A 3F9GA 4Q7YA 1OKXA 5HGGA 3UNQA 3SGQE 5DKMA 2HALA 1GMDF 2ZDVH 1SOZA 1GJDB 2C8XB 3SQHE 6GCHF 2BDAA 1S6HA 1BHXF 1L0ZA 4B1TA 1TPAE 3M5LA 2WYGA 1NBME 1GBHA 4NGAH 1K9OE 1C5LH 1KSNA 3TU7H 1GHXH 1O2VA 3F2GA 4JZDH 1TGTA 1OWKA 3SV7A 3ZYEA 1CHOF 3ZVCA 3D65E 1GHAG 4YT6H 4ZKOU 4NSVA 2J4IA 3VGCC 4ZHMU 2A1DB 4AOQA 5E0JA 2TBSA 4Y8XA 4A7IB 1CGJE 1NPMA 4HFPB 2UUFB 2G52A 1GBDA 1YLCA 2BY9X 1BMAA 2Y6TA 3M5MA 5IK2D 3GYMA 3NWUA 3SOSA 2VU8E 1FY3A 2W26A 2P8OC 4DY7B 3TGIE 2SNWA 1Y5BT 4AFQA 1P8VC 3MH6A 1VCPA 2SGDE 2ASUB 3TH4H 3QTVH 1IQKA 1T8MA 1EASA 1NFWA 1KXFA 2AMDA 2ZIQH 5GJ4B 4PROA 4ASUD 2GTBA 4Y8ZA 2FOMB 4K8YA 3MU0A 4Y0YE 4XOJA 1AZ8A 4B6EA 2A4GA 3FKSD 2ZGBH 1TQ0B 1DITH 1W11U 2ZWLH 1TA6A 1E35B 1K1MA 1SMFE 2UWLA 1NFYA 3MO3A 1SGDE 4ABEA 1AUJA 1PQAA 3CP7A 3MNCA 2J34A 1EAXA 2BY5X 2XBVA 5EPYA 1VCQA 3RXCA 1W0ZU 1O3IA 1NY22 2OCVB 1AY6H 1EPTC 2C8WB 3A86A 2WYJA 1FMGA 1RFNA 4DW2U 3BTTE 5DP7A 2ZU2A 3SJ8A 2IJOB 2QYIA 4I8HA 3ZZ8A 1NESE 4YT7H 3QX5H 1VITF 1ZR0A 1IOEA 2ZHQH 3F1SB 3RXOA 2WZQA 4D76A 3VB7A 1GVZA 4YESB 1EUFA 2FI4E 3NCLA 1MD8A 1O2PA 2A2XH 3NZIA 1UVOA 3AAUA 4U2WA 1AFEH 3TK6A 3TK5A 1HAPH 1JOUB 1QQ4A 4CHAC 5C67A 3LH3A 3PMAB 3BF6H 3RMOH 1GJ4H 8LPRA 2O8UA 1EPTB 4HTCH 1SGCA 5FHTA 2AMPA 2RA0A 3TK9A 5JB9S 1DS2E 1E38B 2GP9B 3HGNA 2KCPA 1SFIA 2UUYA 1V2LT 1K21H 1ZMLA 3SJOA 7KMEH 1H8HD 1TNLA 2H9HA 3MQKC 1IQGA 4U01A 3T5FH 1FXYA 2GT8A 1VCWA 3FN8A 2H6MA 3LT3A 1MZDA 2ANKH 2H9TH 5PTPA 4NZLA 2R0KA 3A7VA 2XC0A 3LGWA 2J98A 1ZSJA 2OBQA 4LXBH 2BX3A 4ZKRU 3RXVA 3MMGA 1GI8B 1CHGA 1C5SA 1ELGA 2C90B 1MBMA 1QIXB 1T8OA 2ZKSA 5L30H 1ZSLA 4B73A 2XBWA 3UNSA 1A3BH 1XUGA 3ZVEA 3V0XA 1GHVH 1CA8B 3BTQE 4K2YA 5LGOA 1ELVA 1A2CH 1BTPA 4NSYA 1CU1A 2EY4C 2FODA 4IMQA 2C3SA 3GY8A 1RS0A 1ZJKA 1CT2E 5ABWA 1GVKB 1D6WA 4BOHA 5A0CA 1AI8H 1B5GH 3PV4A 3BSQA 1VR1H 4DG4A 1LQDB 2FOBA 2M2AA 1BTXA 3PMBB 3ZVFA 1SSXA 2C93B 3ELAH 3SGAE 1TRNA 1O3FA 4HGCA 1EQ9A 1TRMA 1ANDA 1Y5AT 1NC6A 9ESTA 1IQFA 2SGQE 2Z3EA 2VB0A 3SHCH 2QY0B 3F0PA 2J9NA 1FJSA 3VB5A 5J4QA 8KME2 1RGQA 1O5FH 4BTTB 3ZZ9A 3SU3A 5KGOA 3A82A 1O5CB 1NRNH 4JZIA 1V2RT 3SU5A 2WPLS 2QV1A 1GI5A 3SI3H 1YKTA 3PTBA 4I86A 3PV2A 2QF0A 2ZP0H 2J2UA 4ABIA 4ABHA 3E1XB 1ZJDA 2QE7D 4INLA 4KELA 3UWJH 5JYIA 3M3VA 1KLTA 2BLOA 1PQ7A 1S85A 1GI4A 1E37B 2WPIS 5A2MH 4LZ4B 1TX7A 2XCNA 4K1SA 2ZO3H 2HLCA 5EPNA 2ZHEH 1XMNB 1OXGA 1EKBB 3MFJA 2AS9A 4KTCA 3U8OH 5C94A 1ZGVA 2HGTH 1W14U 1J9CH 2BDIA 1SLWB 4CRAA 2SGEE 3ZZDA 2BD7A 3HKIB 4ISIH 3FOAA 3P8FA 4JMYA 1YM0A 2VBCA 3PTNA 4MLFB 1C5VA 1SGEE 2A5KA 2TGPZ 3PO1C 2WINI 2ZFPH 3SI4H 5I25A 1W13U 1NS3A 1C5TA 2PUXB 1YPMH 4X1QU 2BTCE 3PM3A 3E0NB 3ZVGA 3ZV9A 2GCHF 3TH3H 1W0KD 3ZZ7A 1FDPA 4WH6A 2P3FH 1UCYH 2ZTZA 4UE7H 5GXPA 1NRRH 3TLOA 2BY8X 2NU2E 3KN2A 1BTYA 1LHGH 1O3KA 2OC7A 1ESBA 2Y81A 3O8CA 2OC1A 3SUFA 1THPB 4RKJB 2FOAA 1GI1A 1UTQA 1GJCB 1ABJH 1UTOA 1ELCA 5L2YH 3FAOA 4YZUA 1K1NA 1C5OH 3FZDA 2F9NA 1O2LA 1SL3A 1W10U 2Z9GA 3U9AH 3SV8A 3O8DA 1Y3VA 4YLUA 2VWLA 1TBRH 1GMCG 1LKBA 2XNDD 1GWAA 1O33A 1TB6H 3SO3A 2V3HH 1SGFA 3KQ5A 5HM2A 1G3BA 1XXFA 4OGXA 4MPWA 1CO7E 1TNIA 4ABJA 1MUEB 5TJXA 1A0HB 1LHEH 2Z3CA 1C5YB 3RXFA 1Y59T 2P59A 5EJZA 5IDKA 1O35A 5C0TA 1LVYA 3QK1A 1SGTA 3HPTB 3SORA 1DXWA 3UOPA 1QL8A 1TQ7B 2GZ8A 3EAJA 1O5AB 3SBKA 1AGJA 2BQ6B 1QRZA 1OWIA 5CHBA 1TONA 3BEFB 4NIXA 5DP5A 1K1JA 1T4VH 1O3BA 3A87A 1Y3YA 1MTNC 3PLBA 3ESTA 1BA8B 2ZF0H 6CHAC 1PPBH 1GDNA 1TX8A 2J98B 1MD7A 3Q77A 1HGTH 2ZI2H 3A7TA 2D26C 1Z1IA 3KYFA 1KXEA 5ETXA 1PPFE 1GG6B 1EFRD 4MNXA 5C1YA 2IJD1 1KDQA 1F7ZA 2GX4A 1RXPA 1DY8A 3DSGA 1H1BA 1QA0A 1V2PT 1O3MA 2AEIH 4WMFA 1SGYE 4X1RU 4Y76A 1A3EH 2GJGA 1EXFA 5A09A 3SU1A 1C1RA 5SGAE 1SHYA 1SGNE 1A5IA 3E90B 4X1NU 4LZ1H 1MKXK 3VXEH 1YPKH 2F9OA 3BN9A 3P8GA 1HB0B 2C4FH 2FPZA 2J97A 3UIRA 2FS8A 4NWLA 1YPHC 3K9XB 3BTGE 1OOKB 1XUKA 1K1IA 2KCAA 4FUIA 4ZUHA 1MMJN 2CHAC 4KKDA 3IG6B 1O0DH 4HG6A 4YTAA 1V2VT 3HK3B 1NTPA 6LPRA 2P95A 2D2DA 3FFGA 1TGNA 2V7QD 1XM1A 3ITIA 5E0HA 1GDQA 3T29A 3QZQA 3LONA 1KXAA 3GS9A 4XBDA 5L6NH 3DSOA 1W7GH 4LOYH 2IPHA 2GV6A 5DP4A 2BD9A 4K60A 1Z8JB 3E16B 1K28D 1E1QD 1S82A 3DT0H 3JZ2B 1MH0A 1DWEH 1FY5A 2ZA5A 2HPQH 3G01A 4CBNA 3N7EA 1K1OA 3MH4A 5G4BA 4FU8A 1G9IE 1INCA 3SU2A 1SQAA 2SGFE 3SQEE 1DE7H 2W6ID 1QNJA 4X6NA 4CRFA 3PV5A 2HRVA 1YPHE 3SZNA 4FU9A 3NXPA 1N1LA 1ELDE 2F9BH 2BQ7B 2XRCA 2ANWA 1FIWA 1GDUA 3RXBA 2BVXH 3HKJB 1LVBA 4AFUA 1GMCF 1SQRA 2F91A 1O3EA 1UHBB 3JZ1B 4I8JA 4X2XA 1YPJH 3EYDA 4I31A 3LGUA 4KTSA 1GGDB 1IAUA 1Q3XA 1P2MA 3SNEA 2UWOA 1XUIA 4OS7A 2AGGX 3R3GB 3TJOA 3V7TA 1O31A 1MTUA 4NA8A 2EI7A 2RA3A 1C2HA 2ZFTA 2RG3A 3TPIZ 4UDWH 2I6QA 2P3TB 1LPGB 3QTOH 1RTKA 2PHBA 1C2KA 2ZDKA 1GI0A 3HATH 5JBAS 2FXRA 1PPCE 3ZZ3A 4B6FA 1FQ3A 5HM9A 1LVOA 3ATWA 1RIWC 1O2XA 3VEQB 1AU8A 3RXEA 1DWDH 3QGNB 2DUCA 2PP6A 3F68H 1D3PB 1KMHB 1EP5A 2CN0H 5DJ7A 1CBWC 3S9AA 2D8WA 2BZ6H 2A2QH 1DVAH 2OC0A 1YCPH 2B8OH 2BD5A 2F4LA 3TJUA 2PKAA 2H5CA 1TRYA 2TGDA 4H4FA 1TPOA 4F55A 1TWXB 4MDSA 1KTTB 1IQEA 1XVMA 1WTGH 4MNWA 1E0FD 1GI2A 3PYHA 1GCDA 1EP6A 2KR7A 3R0FA 3SV6A 2BDBA 1PPGE 1W0YH 1LHCH 1ZOMA 1XUFA 1IQIA 1LQEA 2BDGA 4BXSA 1AMHA 1FN8A 1HAZB 1SGRE 1Y3UA 1A4WH 3M7QA 3FP6E 1QB9A 3F0OA 5GCHG 3SNAA 3KF2A 1F5LA 2ZU3A 1BBRK 5GDSH 2HWLB 1O2YA 1GJBB 2ALPA 1HNEE 1P2JA 3OY6U 4I32A 3O8BA 1QURH 2A4QA 1O3NA 1P2IA 3RU4T 4JYVH 3F3BA 2WPMS 1HPGA 2ZHFH 3IITA 5J4SA 3HGPA 1UMAH 1ZHRA 3TNSA 1V2MT 1GGDC 3SV2H 4K1EA 2XCFA 2BOHB 4X6MA 2GMTB 1MABB 1V2OT 2DE9A 1AVXA 1FAXA 1QFKH 3OU0A 1P05A 3OEHD 2D1JA 5F8TA 3GDUA 1ARBA 1N6YA 3U8TH 1O2GH 5DG6A 1UTMA 2XBXA 1D3DB 2VIOA 2KCYA 2A4RA 2WV5A 3VGCB 1PFXC 1NBMD 5E0GA 1C2GA 2TIOA 2R3UA 3QO6A 3K65B 2STAE 4GPGA 1C2LA 4ABDA 5EXLA 1T8NA 2G5VA 1JRTA 2ZU1A 4AYYB 1C5ZB 2IPQX 3GICB 4BAOB 3SHAH 1IQMA 3U8RH 1ESAA 4R8TB 3ZZ6A 1ANBA 5FCKA 2TGAA 3PLPA 2VIQA 1O2UA 1ETSH 4ISOA 1C2JA 4KTUA 2OUAA 5T3HA 3SYJA 2ODPA 2ZPQA 4FUBA 1OX1A 1D3TB 4NIWA 4ABGA 1C1WH 3T25A 2W7SA 2FP7B 2R9PA 5DP8A 1B0FA 1LDTT 1B7XB 1F92A 2FO9A 2DE8A 1O3JA 1AO5A 5FBIA 1C1NA 1H8IH 1O5GH 1P9SA 2BYAX 1PPEE 1WQVH 3LPRA 4H6SB 4SGBE 3SN8A 4ESTE 1SGFG 4JZ1A 1Q31A 2ZCHP 2RCEA 3M36A 2Y5HA 3RC4A 3BV9B 4UFEH 4IS5A 1LMWB 1LO6A 2CXVA 4FUJA 3A89A 1F5RA 4ZKNU 1QL7A 1BMNH 1MKWK 4O3TA 4X2WA 1GJAB 3BTFE 1A1RA 4U32A 4CHAB 1C2MA 1O2IA 4A1XA 5A8ZA 4ISLA 1AB9C 3LGIA 3S9BA 2LNCA 1UK3A 1YGCH 3KYGA 4Y7AA 2PSXA 1H4WA 2ZNKH 1WV7H 1X7AC 2B7DH 2AYWA 1TPSA 3BG8A 1ZHPA 4OS6A 2AH4X 1MKXH 1QZ8A 3VG8A 1HIAA 3L6PA 1ZPZA 4BTIB 4X1SU 2ZDAH 1HJAB 3FO8D 2BLWA 1MKWH 1MQ6A 3AW0A 4JCNA 1EZQA 2Z3DA 1MU6B 1ETTH 1EZSC 4Z0KA 3SJIA 3UAIC 1FV9A 2TGTA 4JK6A 1V2KT 3TITA 3VB6A 3MH7A 1C9PA 1P9UA 2B9LA 2QA9E 1L4DA 3C1KA 4E7RG 3GY2A 3CS7A 2BLQA 3P70B 3M7UA 3B8JA 2FOGA 2GGVB 4ABAA 3EE0B 3KQDA 2EI8A 2ANYA 2FOHA 2ZHDA 1H9LB 2OLGA 3GCTF 4Z6AH 3BTME 4ASHA 1O2RA 4A92A 4FUDA 1HXFH 2GZ9A 1KLJH 1Z1JA 4ZXXH 1GCTB 5EQSA 3U69H 2ZGHA 1J16A 1H9HE 5HYOA 1GBIA 1UW7A 4XE4A 2ODYB 5FXLA 1CVWH 1P10A 5GPIB 3WWFA 1ELBA 1P2KA 3UOUA 1HUTH 4AN7A 4TYDA 3ZZBA 2NU1E 2AIQA 3K2UA 1P12E 3ZV8A 1TIOA 3H5CB 5FAHA 2BM2A 1TFXA 2BDCA 3GYLB 1GJ6A 3SNBA 1GG6C 3KEEA 5CHAC 3SU4A 1AKSA 3T62A 3H09A 8ESTE 3ZZ4A 1QB6A 1KXCA 2VWNA 4Y6DA 1BMFD 1A7SA 1EAIA 3E0PB 5JBBS 3LC3A 2ZTXA 2ZEBA 3S0NA 5DSFA 2PV9B 1QY6A 1FPCH 4MNVA 5E8EH 1BRUP 1BTHH 2GV7A 4NIYA 3VXFH 1EZXC 2IOTA 1S84A 1HJAC 3UWIA 1T8LA 5E2OA 4AFSA 1BZXE 1NZQH 1MAXA 4ZHAA 1AUTC 4D7FA 1BHXB 3WY8A 1G37A 3GCTG 4K3JA 1O2QA 1J15A 4NFFA 1XKBC 2UUKB 3LDXH 4B2CA 5F8XA 3DUXH 1W8BH 1WUNH 5BRRE 1HIAB 5A0AE 2WV4A 4GLYA 2QIQA 4X2YA 4RT0A 1O3PB 3ENSB 1SVPA 4Q2KA 1GMHF 1W12U 1YLDA 1GCTC 2A5IA 3SUDA 1SQTA 1MCTA 1WYKA 3QWCH 1FX0B 1EJNA 3T28A 1EATA 1KLIH 3S9CA 2IN2A 3P17H 1OP0A 1ELEE 3STJA 1NN6A 4X2VA 1C5UA 1T7CA 5IYTA 1P0SH 1QBVH 4GHQA 2BB4A 2ZQ1A 4MG3A 1QJ7B 3URDA 1SGQE 2YMSD 3IWMA 1QJ1B 2PUQH 1QCPA 3RC5A 3RXTA 5FBEA 4IN2A 5DO4H 2L74A 4CREA 3M37A 3KNXA 2HPPH 3OSYA 3KIDU 3UR9A 1VZQH 2OQ5A 4ZROA 4CRBA 1VGCB 2Z9KA 3M3SA 2ZFRH 4TY6A 4FETA 3LJOA 1CE5A 3SNCA 2AIPA 1BRCE 3SU0A 3M3TA 2O8TA 3TJVA 1DDJA 5F8ZA 5GNDA 3PB1E 3N7DA 1ELTA 2Q6FA 1ZTJA 4DGJA 1A0LA 1QQUA 2QC2A 1S0QA 1SLXB 1AE8H 5C5NA 1AFQC 2PSYA 2ULLA 4INHA 5A0BA 2QF5A 2OQUA 2OK5A 1AIXH 1C1MA 3PLKA 4Q7ZA 5JPMH 1K22H 1UTPA 3RDZA 2PW8H 3RU4D 3ZVAA 1PYTC 1TOMH 1NU9A 2YMSC 4MNYA 3V13A 4P02A 3T27A 1DANH 1NRQH 2GMTC 4MTBA 5DGJA 3V12A 2UWPA 1J17T 1HLTH 5TCCA 2ZGXH 3KHVA 4WF8A 3CS0A 5EQRA 1ZZZA 5EJ1A 5C17A 4A6LA 3A81A 4K8BA 2XBYA 1FPHH 3P92A 3DD2H 4MQAA 3CNRA 2ZC9H 4P00A 3F9HA 3UB0A 1L1GA 4IBLH 2K0QA 3RMLH 3W1EA 1G3DA 3MU5A 4WJG2 1LVMA 2BD2A 1JIRA 2WHXA 1PJPA 4YM9A 1GI7B 2Y7ZA 4AG2A 1BCUH 3OX7U 4VGCB 5HIZA 1C5QA 2QN5T 1EB1H 2A32A 2EI6A 3Q3XA 4CR5A 3GCNA 1FZZA 2CJIA 2J5UA 3BTWE 3MNBA 3TNTA 1V2ST 1TBZH 1AZZA 1E36B 4FOUC 3P8NA 2V35A 2BDYA 2PWXA 1VJ9U 1O37A 4ABBA 1H9IE 1C5XB 1SLVB 1YCPK 4FXGH 8GCHG 1A5GH 4AX9H 5KEDA 3LKWA 5EG4A 4XFQA 1MZAA 4DJZB 1Z71A 1O30A 1ZLRA 3RXDA 1Z8GA 1DX5M 2Y5GA 4CH8B 2O8WA 1O36A 2G55A 3QZRA 1ABIH 3GY7A 2WV9A 4RSPA 1TE0A 2KM0A 2RFKC 5ESBA 2G4UA 1GJ8B 3UY9A 3A8BA 2SGAA 3O8RA 1YLNA 2R0LA 1YC0A 1F5KU 2C8YB 2VVCA 4RKOB 1K1PA 4GHTA 2F9VA 1O5DH 1BT7A 4FUCA 1N8OB 3DA9B 1WCZA 2V0BA 1WQSA 1GHWH 4E7NA 1SG8B 3SZEA 2XWBI 4K5ZA 2KAIB 3N7OA 4JK5A 3BEUA 2G8TA 3LJJA 3PRDA 5F03A 3A8AA 3RMNH 2L6OA 3K6ZA 2CHAB 3SJ9A 3PWCA 1W7XH 3LOXA 4BAKB 4CR9A 2W6JD 2VGCC 1DUAA 1P01A 3LGVA 1UJ1A 3RC6A 1B0EA 1S6FA 1MTSA 1BJUA 1D6RA 1T4UH 2OP9A 3RU4E 1UVSH 4OS1A 1WU1A 3RUOA 3ZZCA 1OP2A 2NU4E 4UFFH 1HCGA 1O38A 3VB3A 3KQBA 3AK5A 5E2PA 3QLPH 1DT2A 1ELAA 1QHRB 2ZPRA 3QGJA 4Y0ZE 1SOTA 1O5BB 1TYNA 4F4OC 4MPXA 4OGYA 3UUZA 4DIIH 2Z6BD 1C1PA 4BXWA 1ZPCA 3ATKA 1D9IA 1TALA 1ZRBA 1NU7B 1J8AA 1DLKB 1P2OA 4ZHLU 5KECA 1TAWA 4XD7D 1EOLA 5EQQA 1UO6A 3ZYDA 2XW9A 3SJKA 1EJMA 3RXJA 1C4V2 4FUGA 3PRBA 4ISNA 5T6DA 4E05H 4XDEA 1UCYK 2OBOA 1ACBE 1HAHH 1BBRH 1HAGE 4NG9H 1FIZA 1GBKA 2VIDA 3EDXB 2BLVA 3KQCA 1C2FA 5HKKD 2J95A 4K69A 1O2TA 5CE1A 3I77A 4K1TA 3A7WA 5AF9H 2NU3E 4X6PA 4NFEA 4Y79A 2FTMA 1D4PB 1V2UT 3DFJA 5C2ZA 2FDAA 4UONA 1S6LA 4UEHH 4BAQB 2FI5E 2FOCA 1LCYA 4B76A 2GDDA 4WVPE 3F6UH 2Z7FE 4E06H 1TGBA 1AFQB 2KZ4A 1QGFA 1GPZA 2BD8A 1CGIE 2J94A 1AE5A 2YNAA 2I6SA 4KGAA 5FPSA 3OFND 2FEQH 3T2NA 4AGJA 3L33A 2EQNA 2A7JA 1ZMNA 2Z9IA 5EXNA 2QXJA 5T1VA 4NA9H 1CQQA 3NK8A 1C9TA 5EIYA 3WW7A 1RJXB 3GDVA 4X8TH 1OS8A 6CHAB 1QRWA 4Q4LA 4TT3D 3RXSA 5JBTA 4FVDA 1SB1H 1O2OA 2O8MA 2BMGB 4B74A 1O2ZA 3CENA 3MO6A 2FZZA 2F43B 4Y7BA 5CMXH 5F6MA 2A7CA 1N6XA 5EU8A 5EW1H 4CH2B 4JZEH 1DUEA 5FPTA 1HBTH 2PLXA 3MHWU 1TGCA 1YF4A 4UFDH 4X0WU 4IN1A 1JWTA 2FESH 2Q1JA 1AVGH 3RXQA 4X1PU 1HJ8A 2OTVA 4Y71A 1SGPE 2W3IA 3RXAA 4IGDA 1YCPM 1UTNA 3Q00A 9LPRA 5L2ZH 4AB9A 1GBCA 2Y5FA 3OAAD 2ZGJA 2UUJB 1Y5UT 2ZCKP 2YOLA 2Y7XA 1ESTA 3GY6A 4Y11E 7LPRA 3RXMA 1QL9A 1Q2WA 5HIYA 1SPJA 4TSFD 2F3CE 3GCOA 4SGAE 1E79D 2BY7X 1JMOH 3GCHB 1DSUA 2G51A 3RXGA 1HXEH 1H8ED 5FX6A 1GI6A 1GBLA 1GMDG 3AW1A 4OS2A 2B5TB 1THRH 3TH2H 2VH0A 2KAIA 1G32B 1CBWB 4GCHF 3MI4A 1TABE 1DSTA 3QN7A 4A1VA 3UR6A 1VKYA 2EEKA 1DLEA 3Q76A 1YYY1 4AFZA 3MH5A 6ESTA 1KIGH 2HOBA 4WXIA 1O2JA 1O2MA 2G5NA 1HAVB 3ZIAD 2ODQA 4B2AA 5C1UA 2ZDNA 5BPEA 1HYLA 1NT1A 3MU1A 1HAOH 3P8OA 3BIUH 1GJ9B 1YPLH 2Q6DA 1IQJA 3BTDE 1O3AA 2NWNA 4ZMAH 2SGPE 2FOFA 2FX4A 1GL0E 2GVFA 4F48B 5C3NA 1S0RA 3GCHC 4XBBA 2ILNA 5F53A 1CA0B 2FYRA 1UK4A 3S69A 1C1QA 1GHBG 2F9UA 3UREA 3M5NA 1DWBH 3LH1A 1NO9H 1P3CA 1V2QT 4DCDA 1F0SA 4Z1MD 2OXSA 2HNTF 2ZDMA 3A88A 1PPHE 1FI8A 2HVXA 1Y3XA 2Y80A 1XUJA 4BAMB 1Z6JH 3SNDA 1EPTA 1P03A 1LPKB 1L1JA 4ACBA 5LPFA 1HFDA 1VITH 1FY1A 1SFQB 3NRLA 4X8SH 1VGCC 3H7OA 5A8XA 1SI5H 3RM2H 2THFB 3ATLA 1PYTD 3ZZAA 3TJNA 5K0HA 1F0TA 4NA7A 3SU6A 1OWDA 2VNTA 4AB8A 2PFEA 1VITG 1O5EH 1CGHA 1C5WB 3GDSA 5CHAB 3RM0H 1QA7A 1W0JD 1JRSA 3M5OA 2LPRA 2OINA 1U6QA 1THSH 3PMHB 5HXFA 1O2NA 1TNGA 1T32A 2J92A 1FY4A 1OSSA 2JH5D 3FP7E 4TWYA 2ZG0H 1GHZA 2PR3A 8GCHF 2ZFFH 2ZZUH 4TY7A 1TNHA 5JBCS 1EAUA 2H2ZA 2TPIZ 2KCOA 1O3OA 1ZYOA 1CA0C 1DY9A 4DOQA 1CHOG 5EW2H 1M9UA 1K0HA 2CK3D 3GY5A 1VJAU 2A4OA 1XKAC 1TLDA 2ZU4A 1C5RA 1G2LA 1QR3E
chains in the Genus database with same CATH topology
1OWJA 1W3CA 1C5NH 1EB2A 1C1OA 1O2SA 2ZQ2A 4I8KA 3W94A 3UNRA 3RXLA 1HJ9A 2A31A 5C20A 3A8DA 1SGIB 2ZECA 1UVTH 1RTFB 2CF9H 3EA9A 1OWHA 1E34B 3B23B 2JH6D 1G3EA 3ZVBA 1AD8H 1QBOA 3GOVB 2G00A 3BEIB 4THNH 3OYPA 5C1XA 3H7TA 2FX6A 2F9PA 4GVUA 1FLEE 4TWWA 3A80A 1OP8A 1ZMJA 5DPAA 5LPEA 2WUBA 5EXMA 3PO1B 2GCTB 3AVZA 2JETC 2O9QA 3SV9A 4JYUH 1TNKA 3PROA 1K2I1 4YOJA 4RN6A 2PKAB 1A46H 4GSOA 2XYAA 2Z9LA 3BTEE 1GMHG 4D7GA 3M35A 1C1SA 3A84A 4FUFA 1AWFH 1FAKH 2ALVA 4Q7XA 3ODDA 2R3YA 3RXHA 3W95A 4DT7B 1HAVA 1PQ5A 3A8CA 3STIA 4BANB 3FZZA 4I33A 1O2KA 1C5MD 1F0RA 1Z8RA 1V3XA 1AWHB 1OYQA 1N8OC 3BTKE 1SR5C 2WPHS 2P93A 2V3OH 3GISB 1LHDH 1O3DA 2W7UA 4CRGA 4D9RA 1BRAA 1NFXA 2ZHWH 1EOJA 4XSKU 5AFYH 1YPEH 3U1IB 2FLRH 3S7HB 3I78A 4Y10E 3OY5U 3FVFB 3RMMH 3MU4A 1Z6EA 1V2NT 4A1TA 2A0QB 5FPYA 3UTUH 1BDAA 3EA7A 4D8NA 1UTJA 1BTUA 2FIRH 2PKSB 1FY8E 1BBRE 2P8OB 1Z7KA 2SNVA 2A7HA 3EA8A 1ANEA 3BTHE 4IC5A 1ID5H 2Z9JA 4J1YA 3D62A 1UHBA 1UTKA 2QF3A 2VIVA 3D49H 5ESTE 7GCHG 2P3UB 2ESTE 1F2SE 4O03A 4BNRA 2FS9A 2BDHA 4KP0A 4O97A 2XC5A 1BOQA 3F9EA 3LIWA 1DICA 2BXTH 3FANA 3T26A 2BHGA 4MPVA 1Y3WA 4M7GA 1GBAA 1LKAA 1P11E 4U30A 4FUHA 5A8YA 4X8VH 2QAAA 1UTLM 3RLYH 2V6NA 4WH8A 1A61H 1RIWB 1TBQH 3P95A 4FU7A 3ZZ5A 1C4Y2 1BRBE 1TMTH 2BVSH 3MU8A 3Q3YA 4Y8YA 1XVOA 4TPIZ 1YBWA 1G30B 1O3LA 1XX9A 1EX3A 1HRTH 3KGPA 3E8LA 3L3TA 4NZQA 5HMAA 1KTSB 2CMYA 2FOEA 3RXUA 2EA3A 1V2JT 1OPHB 5LPRA 5B6OA 1GJ7B 1EAWA 1JXPA 4B71A 3TGJE 1GHAF 1FONA 1Y8TA 1UVPA 1ARCA 4IMZA 4D9QA 1MTVA 2QXGA 1MAYA 3HK6B 1RRKA 2QGRA 2P94A 1WTHD 1AHTH 4MPUA 2W5EA 1HDTH 3EGKH 4DVAU 5JDUB 1LHFH 1NRSH 2STBE 1TMUH 1DWCH 1ETRH 1ZTLA 4O3UA 4Q80A 2FM2A 1AQ7A 1PPZA 5TCAA 3DHKH 1V2WT 4HI3A 3Q3KA 1TNJA 3C27B 1TX6A 1FN6A 3MNXA 1IQHA 1XUHA 4FVBA 1KXDA 2BZAA 5K7RA 3KQEA 1L1NA 4XBCA 1V6DA 1SQOA 2JETB 4OS4A 2VGCB 5EOKA 5T6FA 1IHSH 4CBOA 4X6OA 2R2MB 1F0UA 2PKSC 1LPZB 4ZKSU 3UFAA 1LTOA 1C5PA 2PTCE 2J38A 1D3QB 1BQYA 1BTZA 6GCHG 3SGBE 3GY3A 4GUXA 1P2NA 2FMJA 2VIPA 2QXIA 2GZ7A 3K6YA 2H9EH 4WXVA 2FYQA 3GY4A 4CRDA 2EC9H 1BTWA 1P04A 1SBWA 4GAWA 4ISHH 2FI3E 2AFQB 2B0FA 3OTJE 2VWOA 2PGQB 3LC5A 3VPKA 5DP3A 1MBQA 1CT0E 4I8GA 3MO9A 4H6TA 3KL6A 1TPPA 1PQ8A 4JYTA 3MNSA 2Q6GA 3RXRA 1UK2A 5DP9A 4J2YB 1GL1A 4WMEA 3KCGH 1C1UH 1O39A 1DXPA 1NM6A 1KY9A 1GJ5H 4HZHA 4QT8C 3SUGA 1H8DH 3BIVH 2OC8A 4H42U 2HNTC 3AASA 3LU9B 1IQLA 3E3TA 1O32A 4AGKA 1WSSH 2CF8H 2H5DA 5EGMA 1K1LA 4I7YH 1DFPA 1KYNA 3TVJB 4YO9A 1SC8U 1SHHB 1QBNA 1S81A 1A0JA 3FP8E 4YOIA 4NIVA 1ANCA 2A45B 5GIBA 2BY6X 2WPKS 4BAHB 1HAIH 1TOCB 2A5AA 1AN1E 1GVLA 5AVDA 3TGKE 1G3CA 1V2TT 2C8ZB 4IW4E 4X8UH 2WPJS 1HAXB 1IQNA 1NRPH 2VH6A 7GCHF 5DK1A 2ZFSA 4O9VA 3RP2A 3ATMA 5GWZA 3AAVA 4NCYA 2F83A 4UD9H 4ZH8A 1BIOA 2XWAA 1YP9A 1RTLA 1GBBA 2ZFQH 2OD3B 2O8LA 2FTLE 1HV7A 1O3CA 1BJVA 2HNTE 4NWKA 1C2IA 2BD3A 4ZXYH 3BG4B 3NPSA 1J14A 5EODA 1WAYB 1A5HA 1KDQB 1QRXA 3B9FH 2RDLA 2Y82A 4FUEA 3E6PH 2G4TA 1GHYH 3A7ZA 3MYWA 4DIHH 3UQOA 1NFUA 1KXBA 1GBJA 2GKVE 2H1UA 3S7KB 1JBUH 1C2EA 2WUCA 3ODFA 1P2QA 2XXLA 3DFLA 3F9FA 2BXUH 1GI9B 3LGYA 1AKSB 1P09A 2CV3A 1MQ5A 1P57B 3NKKA 2TRMA 2QCYA 1G36A 1IHTH 1EZUC 1MU8B 1P3EA 1FNIA 3QUMP 1ZSKA 4TPYA 2ZU5A 4MVNA 4INKA 1Z8IB 5AFZH 1BUIA 2PTNA 1ZGIA 1QTFA 4A5TS 3A7YA 1L2EA 4AORA 1TGSZ 2FWWA 5C5OA 4R0IA 4WY3A 2JH0D 4GCHG 4YOGA 2YNBA 4BTUB 3PWBA 3LGTA 1BMMH 1GBMA 2FLBH 1W2KH 2AMQA 3RXKA 1OYTH 4B75A 2XNIA 4LK4A 4UFGH 1ZRKA 2VIWA 1S5SA 1OWEA 1GI3A 1BMLA 1QB1A 3SUEA 1DPOA 4AG1A 4AYVB 2G81E 2ZPSA 5I46H 3E91A 3MTYA 1QJ6B 4WWYA 3SW2B 1AB9B 1DM4B 1L4ZA 1P06A 2M5TA 1XXDA 4ZAEA 2BOKA 3MOCA 3BG4C 1UVUH 1EJAA 2BVRH 3V3MA 1O2HA 1O2WA 3UPEA 2JKHA 3RXIA 3MWIU 1C1TA 1YPGH 5GCHF 2BD4A 1NROH 5H4IB 1MTNB 3I29A 4DURA 1O3HA 2AGIX 2W3KA 3P6ZB 2ZTYA 4WMDA 5FX5A 2AGEX 3U98H 1DOJA 4IC6A 3M7TA 2SFAA 1C1VH 1UCYE 2AERH 4CRCA 1O3GA 1O34A 3RLWH 4AZ2B 4ABFA 4YLQH 1S83A 1FUJA 5AHGH 5T6GA 2ZCLP 4JZFH 2VWMA 4I8LA 1BITA 1CSOE 1GHBF 2VVVA 2R2WU 1CT4E 2BX4A 2VVUA 3VFEA 2GDEH 2Z94A 3RXPA 1GBEA 3ATIA 1WOFA 2ZGCA 3M61U 3EQ0H 2XTTB 2P16A 1GBTA 1GBFA 3QDZB 7ESTE 3A83A 4B2BA 1BB0B 5FCRA 2CGAA 2VJ1A 3VB4A 1WBGB 3UQVA 1RD3B 3U1JB 1C2DA 2VINA 1ZPBA 2ANMH 5LH8A 3A85A 1JIMA 1P02A 3D23A 2BQWB 1MTWA 3ZVDA 2NU0E 3A7XA 1MCVA 2GT7A 1C4U2 1TMBH 2K1QA 1ZTKA 3NUMA 2GCTC 1ELFA 5DP6A 1ORFA 2QXHA 3PMJA 1AVWA 2GCHG 1SLUB 2PGBB 2ZDLA 4F49A 1ZHMA 1G2MA 2GD4B 3TIUA 5JB8S 1TA2A 1HAYB 4OS5A 4VGCC 3URCA 1T31A 2XC4A 3F9GA 4Q7YA 1OKXA 5HGGA 3UNQA 3SGQE 5DKMA 2HALA 1GMDF 2ZDVH 1SOZA 1GJDB 2C8XB 3SQHE 6GCHF 2BDAA 1S6HA 1BHXF 1L0ZA 4B1TA 1TPAE 3M5LA 2WYGA 1GBHA 4NGAH 1K9OE 1C5LH 1KSNA 3TU7H 1GHXH 1O2VA 4JZDH 1TGTA 1OWKA 3SV7A 3ZYEA 1CHOF 3ZVCA 3D65E 1GHAG 4YT6H 4ZKOU 4NSVA 2J4IA 3VGCC 4ZHMU 2A1DB 4AOQA 5E0JA 2TBSA 4Y8XA 4A7IB 1CGJE 1NPMA 4HFPB 2UUFB 2G52A 1GBDA 1YLCA 2BY9X 1BMAA 2Y6TA 3M5MA 3GYMA 3NWUA 3SOSA 2VU8E 1FY3A 2W26A 2P8OC 4DY7B 3TGIE 2SNWA 1Y5BT 4AFQA 1P8VC 3MH6A 1VCPA 2SGDE 2ASUB 3TH4H 3QTVH 1IQKA 1T8MA 1EASA 1NFWA 1KXFA 2AMDA 2ZIQH 5GJ4B 4PROA 2GTBA 4Y8ZA 2FOMB 4K8YA 3MU0A 4Y0YE 4XOJA 1AZ8A 2A4GA 2ZGBH 1TQ0B 1DITH 1W11U 2ZWLH 1TA6A 1E35B 1K1MA 1SMFE 2UWLA 1NFYA 3MO3A 1SGDE 4ABEA 1AUJA 1PQAA 3CP7A 3MNCA 2J34A 1EAXA 2BY5X 2XBVA 5EPYA 1VCQA 3RXCA 1W0ZU 1O3IA 1NY22 2OCVB 1AY6H 1EPTC 2C8WB 3A86A 2WYJA 1FMGA 1RFNA 4DW2U 3BTTE 5DP7A 2ZU2A 3SJ8A 2IJOB 2QYIA 4I8HA 3ZZ8A 1NESE 4YT7H 3QX5H 1VITF 1ZR0A 1IOEA 2ZHQH 3F1SB 3RXOA 4D76A 3VB7A 1GVZA 4YESB 1EUFA 2FI4E 3NCLA 1MD8A 1O2PA 2A2XH 3NZIA 1UVOA 3AAUA 4U2WA 1AFEH 3TK6A 3TK5A 1HAPH 1JOUB 1QQ4A 4CHAC 5C67A 3LH3A 3PMAB 3BF6H 3RMOH 1GJ4H 8LPRA 2O8UA 1EPTB 4HTCH 1SGCA 5FHTA 2AMPA 2RA0A 3TK9A 5JB9S 1DS2E 1E38B 2GP9B 3HGNA 1SFIA 2UUYA 1V2LT 1K21H 1ZMLA 3SJOA 7KMEH 1TNLA 2H9HA 1IQGA 4U01A 3T5FH 1FXYA 2GT8A 1VCWA 2H6MA 3LT3A 1MZDA 2ANKH 2H9TH 5PTPA 4NZLA 2R0KA 3A7VA 2XC0A 3LGWA 1ZSJA 2OBQA 4LXBH 2BX3A 4ZKRU 3RXVA 3MMGA 1GI8B 1CHGA 1C5SA 1ELGA 2C90B 1MBMA 1QIXB 1T8OA 2ZKSA 5L30H 1ZSLA 4B73A 2XBWA 3UNSA 1A3BH 1XUGA 3ZVEA 3V0XA 1GHVH 1CA8B 3BTQE 4K2YA 5LGOA 1ELVA 1A2CH 1BTPA 4NSYA 1CU1A 2FODA 4IMQA 2C3SA 3GY8A 1RS0A 1ZJKA 1CT2E 5ABWA 1GVKB 1D6WA 4BOHA 5A0CA 1AI8H 1B5GH 3PV4A 3BSQA 1VR1H 4DG4A 1LQDB 2FOBA 3PMBB 1BTXA 3ZVFA 1SSXA 2C93B 3ELAH 3SGAE 1TRNA 1O3FA 4HGCA 1EQ9A 1TRMA 1ANDA 1Y5AT 1NC6A 9ESTA 1IQFA 2SGQE 2Z3EA 2VB0A 3SHCH 2QY0B 2J9NA 1FJSA 3VB5A 5J4QA 8KME2 1RGQA 1O5FH 4BTTB 3ZZ9A 3SU3A 3A82A 1O5CB 1NRNH 4JZIA 1V2RT 3SU5A 2WPLS 2QV1A 1GI5A 3SI3H 1YKTA 3PTBA 2QF0A 2ZP0H 2J2UA 4ABIA 4ABHA 3E1XB 1ZJDA 4INLA 4KELA 3UWJH 5JYIA 3M3VA 1KLTA 2BLOA 1PQ7A 1S85A 1GI4A 1E37B 2WPIS 5A2MH 4LZ4B 1TX7A 2XCNA 4K1SA 2ZO3H 2HLCA 5EPNA 2ZHEH 1XMNB 1OXGA 1EKBB 3MFJA 2AS9A 4KTCA 3U8OH 1ZGVA 2HGTH 1W14U 1J9CH 2BDIA 1SLWB 4CRAA 2SGEE 3ZZDA 2BD7A 3HKIB 4ISIH 4JMYA 3P8FA 1YM0A 3PTNA 4MLFB 1C5VA 1SGEE 2A5KA 2TGPZ 3PO1C 2WINI 2ZFPH 3SI4H 5I25A 1W13U 1NS3A 1C5TA 2PUXB 1YPMH 4X1QU 2BTCE 3PM3A 3E0NB 3ZVGA 3ZV9A 2GCHF 3TH3H 3ZZ7A 1FDPA 4WH6A 2P3FH 1UCYH 2ZTZA 4UE7H 5GXPA 1NRRH 3TLOA 2BY8X 2NU2E 3KN2A 1BTYA 1LHGH 1O3KA 2OC7A 1ESBA 2Y81A 3O8CA 2OC1A 3SUFA 1THPB 4RKJB 2FOAA 1GI1A 1UTQA 1GJCB 1ABJH 1UTOA 1ELCA 5L2YH 3FAOA 4YZUA 1K1NA 1C5OH 3FZDA 2F9NA 1O2LA 1SL3A 1W10U 2Z9GA 3U9AH 3SV8A 3O8DA 1Y3VA 4YLUA 2VWLA 1TBRH 1GMCG 1LKBA 1GWAA 1O33A 1TB6H 3SO3A 2V3HH 1SGFA 5HM2A 1G3BA 1XXFA 4OGXA 4MPWA 1CO7E 1TNIA 4ABJA 1MUEB 5TJXA 1A0HB 1LHEH 2Z3CA 1C5YB 3RXFA 1Y59T 2P59A 5IDKA 1O35A 1LVYA 3QK1A 1SGTA 3HPTB 3SORA 1DXWA 3UOPA 1QL8A 1TQ7B 2GZ8A 3EAJA 1O5AB 3SBKA 1AGJA 2BQ6B 1QRZA 1OWIA 1TONA 3BEFB 4NIXA 5DP5A 1K1JA 1T4VH 1O3BA 3A87A 1MTNC 1Y3YA 3PLBA 3ESTA 1BA8B 2ZF0H 6CHAC 1PPBH 1GDNA 1TX8A 1MD7A 3Q77A 1HGTH 2ZI2H 3A7TA 2D26C 1Z1IA 5ETXA 1KXEA 1PPFE 1GG6B 4MNXA 5C1YA 1KDQA 1F7ZA 2GX4A 1RXPA 1DY8A 1H1BA 1QA0A 1V2PT 1O3MA 2AEIH 4WMFA 1SGYE 4X1RU 4Y76A 1A3EH 1EXFA 5A09A 3SU1A 1C1RA 5SGAE 1SHYA 1SGNE 1A5IA 3E90B 4X1NU 4LZ1H 1MKXK 3VXEH 1YPKH 2F9OA 3BN9A 3P8GA 1HB0B 2C4FH 2FPZA 3UIRA 2FS8A 4NWLA 1YPHC