3P8FA

Crystal structure of mt-sp1 in complex with sfti-1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
b'VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ST14 protein
publication title Structure of catalytic domain of Matriptase in complex with Sunflower trypsin inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA01
2J34A 3RC6A 4MVNA 1FDPA 5B6OA 3RUOA 7GCHF 1TGBA 1C5OH 1ZPCA 2V3HH 3K9XB 1KDQA 3I29A 3QLPH 3G01A 4I8LA 1TX8A 2FS8A 4K1SA 1K1PA 2AMQA 3VPKA 2A5IA 2PW8H 1VGCB 4JYVH 2ZTZA 1SGEE 2ZTYA 1BZXE 1YPHE 1VJAU 3D49H 1ESAA 2M5TA 4ISNA 1C4V2 4E7RG 1VITH 1K9OE 1F5RA 3ZVDA 1CGJE 1MKWH 2FOCA 3KQCA 5DJ7A 1CT4E 1FPCH 1HAPH 3MO9A 1DPOA 2ZHDA 4QT8C 3A7YA 1EB2A 1Z7KA 1BMMH 5HXFA 4X8SH 5C1UA 4X1PU 3A82A 1NPMA 1GBIA 1UCYH 3NUMA 1KLJH 2FYRA 1DITH 2ANMH 1ZPBA 4AFQA 5AFYH 1GBAA 1YCPK 2STAE 2A4GA 2OCVB 3PLKA 5CMXH 1UK3A 1S0QA 3T2NA 4TWYA 3QTOH 3LGIA 2ZZUH 2PR3A 3RMMH 1KXCA 4Y76A 4AX9H 3RXJA 2RA0A 1NU7B 2IJOB 3JZ2B 1AZZA 1VITF 2FLBH 2P3FH 1V2TT 4IS5A 1QA0A 1XUKA 1SOZA 1T8MA 2A5AA 1ESBA 1BMAA 3RU4T 3IWMA 1G3BA 4GUXA 1FAKH 1GHXH 2ALPA 5TCCA 3F9FA 1E37B 1CO7E 1H9HE 1ZRKA 1TWXB 4O3UA 5C20A 3QDZB 1F0UA 1CQQA 4BANB 4CBOA 1X7AC 4BAMB 3UY9A 1Y5UT 7KMEH 1XVOA 2A0QB 3RXOA 1D3QB 4MPUA 1NC6A 2AS9A 1DVAH 3O8DA 2GCTB 3PMHB 3HATH 2PV9B 2G4UA 2CMYA 4BNRA 3CS0A 2GX4A 3EA9A 4NSYA 2Z3EA 1EATA 1GL0E 4Y7AA 2CHAC 4DW2U 1HAVA 1A0LA 1VCWA 4ESTE 4J2YB 2ZPQA 4X0WU 1FONA 1WUNH 2G4TA 5E0GA 4KGAA 1P09A 4KTUA 1ZJKA 3GCHC 1WSSH 1OSSA 1PPBH 1TGTA 5AHGH 1QQUA 1TOCB 2VGCB 3SGBE 2XBXA 8LPRA 4JZEH 1G3EA 3VXFH 1YKTA 1GHVH 2FTMA 4KP0A 1DUEA 1GHWH 2XRCA 2JH0D 3AVZA 3UNRA 4A7IB 1Q2WA 1O2TA 1SL3A 1LCYA 4I8KA 3SGAE 3UOPA 1F5LA 1XVMA 4Y8YA 3SU4A 4LOYH 4TPYA 1GJ8B 1D3TB 1LPZB 1YPMH 1FN8A 4FU7A 1DOJA 1O2KA 1FAXA 5A09A 3GDSA 1QQ4A 1O0DH 2RG3A 1GBLA 1C5TA 1O3IA 4AORA 3GY6A 2GMTB 5DP3A 1UTMA 2A45B 3RXKA 4K5ZA 3KHVA 1Y3WA 4OS1A 1FIWA 2HNTF 1GJ4H 2V3OH 3O8CA 2PWXA 4NIYA 2BLQA 2BD7A 1AUJA 3EE0B 1BTHH 3A7ZA 1P02A 3KQBA 1FI8A 1TBRH 2G81E 1HDTH 1Y59T 4DGJA 3TGIE 2UWOA 1EOLA 3T62A 1P05A 2SGDE 4YOJA 2O8TA 2PTNA 1OXGA 3PLPA 1EPTB 6GCHG 2BDHA 1H1BA 2F9VA 1EQ9A 1GDNA 2Y5HA 5LH8A 3SORA 5J4SA 1PQAA 4IC6A 1P2KA 4OS2A 1D6RA 1P3CA 3NZIA 1S81A 3FZDA 3KF2A 1HFDA 4VGCC 2TGDA 1QNJA 1ANEA 2BD5A 1TALA 1OWEA 3VFEA 1KTTB 1ZPZA 3MI4A 3RP2A 2TBSA 2HOBA 3RXBA 1Z8JB 1O2OA 2JH5D 5A8YA 4X1SU 5GJ4B 3M5MA 2PKSB 3IITA 1QTFA 3MFJA 4BAHB 2GDEH 1CVWH 2DUCA 3ZVCA 4AG1A 1VJ9U 2CGAA 1OWDA 2XNIA 1A2CH 1F5KU 2WPIS 3H7TA 3UQOA 1MTSA 2A31A 3E6PH 3TGJE 3SUGA 2BVRH 2OC7A 3RXRA 5GCHF 2AYWA 2STBE 1XXDA 1BITA 1WOFA 1G2LA 5DK1A 3UR6A 4OS5A 1YLDA 1GI3A 8ESTE 1TPPA 2H6MA 1T4VH 7LPRA 2Z6BD 1ARBA 3GY2A 3QN7A 1ZJDA 2AGEX 4INLA 3GY3A 1PYTC 1L1NA 4Y11E 3U69H 2A7JA 5FX5A 4ZXYH 4UEHH 1YPHC 3TJVA 5FAHA 1CA0C 1Q3XA 1RXPA 1N8OC 2ZU1A 3RXQA 3SU3A 1EX3A 4I31A 1AWFH 4XBBA 2ZHWH 1ELTA 1TQ7B 1UO6A 1ZTJA 1MTUA 5HM9A 6ESTA 3V0XA 1O38A 2Q6DA 4CRGA 2J38A 3Q00A 3BG4B 4NCYA 1BRAA 3RXPA 3QWCH 1P10A 2GZ8A 3C27B 2OTVA 1TPSA 1W3CA 3RDZA 2W7SA 2OXSA 4XFQA 1F0SA 3IG6B 3LC3A 1MQ5A 4X6MA 1BT7A 1T4UH 1GL1A 1K1NA 4H4FA 1B0EA 2VH6A 1GHBG 3ATMA 3MYWA 2JH6D 2HVXA 1HIAB 5JPMH 1EP6A 1GBKA 1HXFH 2BQWB 4JMYA 4INHA 1V2OT 2PLXA 4SGAE 2VU8E 2GP9B 3LOXA 1L1JA 3ZZ8A 5LPRA 3EDXB 1F2SE 4WF8A 1LHDH 3MMGA 4DT7B 4JK5A 2IPHA 1HJ9A 2ZECA 2G55A 1HNEE 3BSQA 3TIUA 1HLTH 4MQAA 1B0FA 3SV9A 3SO3A 1D3PB 1JIRA 1OKXA 1IQHA 1D6WA 2ZP0H 3D65E 1QIXB 3UWJH 1TRYA 3ATLA 1QR3E 1ZYOA 2C8XB 2P94A 2BY6X 3SU2A 1UTNA 4A92A 2J9NA 1O5AB 1O3DA 1ZSLA 2XCNA 3LJOA 1O36A 1P12E 1IQEA 4FUJA 1QURH 3FP8E 1ANCA 3S9CA 5EW1H 3VGCB 3MU5A 1RS0A 1QL9A 3MU4A 1O5GH 4OS7A 4B74A 4XBDA 4NIXA 4DY7B 1WV7H 2ANYA 3P70B 1BBRH 3GCTF 6CHAC 3QZRA 1HAZB 1SBWA 2FO9A 5F8TA 2OC8A 4DCDA 2BVSH 3R0FA 5EQSA 3A87A 4AYVB 4E06H 3KQDA 1V2RT 3SJKA 1SGPE 3BEFB 1MTWA 1UK2A 2VIOA 2NU4E 5AF9H 5ESBA 1O2GH 3ZZ6A 3SU1A 2VIPA 4MTBA 1ZRBA 5FHTA 4UONA 8KME2 1UJ1A 1W7GH 2GVFA 1PPHE 3W94A 4B2CA 1EZQA 1N6YA 1NFXA 2G52A 3MU8A 1J15A 3ZVFA 5FCRA 1XKAC 4JK6A 5GPIB 4YESB 3NPSA 1NRNH 3RMNH 1SGNE 3B23B 1W11U 4XBCA 5HGGA 1TRMA 2XBVA 3KQEA 2BX4A 1JOUB 3GYMA 1O3BA 1V2JT 2G51A 2VIDA 1P57B 3WY8A 3RXSA 2GZ7A 3BEIB 1RGQA 1C2HA 2PUQH 3LJJA 1LO6A 2OINA 1IHSH 3ZZ4A 4AZ2B 4IN2A 1ZR0A 2D8WA 1XMNB 4I8GA 1KLTA 4I7YH 1MTNC 3GCNA 1D9IA 1KYNA 2OC0A 4NSVA 3T5FH 5IDKA 4H42U 1W12U 2VJ1A 4Y10E 4DURA 2RDLA 4AFSA 1FUJA 2QXHA 1O2HA 1A1RA 1RTKA 1BTXA 5DKMA 1ABJH 1XUFA 1MAYA 4BXSA 1SR5C 4LXBH 3U1IB 3ZVEA 1AB9C 1YC0A 3PMBB 3PWCA 2BZ6H 3ZZ3A 4RKJB 3ZVAA 3BTKE 3FVFB 5TCAA 3ZV8A 2D26C 2F9NA 1C5RA 4AFZA 9ESTA 1O5BB 1T8OA 4KTSA 4JCNA 1Z1IA 1TB6H 3E3TA 3FAOA 2DE9A 3PO1C 1YYY1 4WJG2 4ZKSU 1C5WB 4A1TA 2PUXB 4MNVA 1DE7H 1DXPA 4UFGH 4ZUHA 4GCHG 1O3NA 1OWHA 1SMFE 1DXWA 2Z3DA 3RXAA 3RXUA 2YOLA 2H1UA 4ABDA 2FP7B 1SGYE 1TA6A 2ZHEH 1SGQE 2ZGCA 1NO9H 2GV6A 2WUCA 1JBUH 1WQSA 3SOSA 1O2UA 3EYDA 3KN2A 1GJDB 2BY5X 2AGGX 2O8UA 3E1XB 3OX7U 4ZKRU 3SQEE 3ZYEA 1O2YA 2SNVA 3RU4E 5CHAB 2WPJS 4JZ1A 1AVWA 2VIQA 4ZROA 3S69A 2UUYA 1B5GH 1S82A 1D4PB 5ABWA 2GV7A 3SJOA 1ID5H 1C5YB 1K2I1 3E8LA 2FDAA 3UR9A 1C5ZB 4GVUA 4CR9A 4X1RU 1T32A 3ITIA 4HTCH 1O3PB 1TOMH 1QRZA 1OP8A 1KDQB 1GDQA 4DIIH 1FV9A 3K65B 2H9HA 4K8BA 3DFJA 3STIA 3MH5A 5A2MH 1O3HA 1N8OB 4AB9A 3PMAB 4Y71A 2P8OC 4ABIA 1C2KA 3BTWE 1T7CA 1TNLA 2Y6TA 2CV3A 2PSXA 1KXBA 1O5DH 1QCPA 1G2MA 3DT0H 2A4OA 4ISLA 2XWBI 4WWYA 1SHHB 2H9EH 2ZA5A 3GY5A 3JZ1B 2ZDMA 1FQ3A 1DFPA 2C4FH 4CR5A 1O2PA 2VB0A 1LPKB 4Q7XA 1AQ7A 2J92A 1JRSA 3A7XA 4OS6A 2A4QA 2THFB 5DP6A 2QF3A 2QN5T 1AFEH 2ZDNA 4I8HA 3K6YA 1UTLM 4K8YA 1FIZA 1P06A 1TYNA 1L2EA 4INKA 1O34A 1O2JA 2Q6FA 2BDAA 1P2MA 2ZFFH 4MPXA 3Q76A 3AAUA 2RA3A 2BDCA 1FZZA 1P2QA 4X8UH 4U32A 1O2NA 1ZHRA 1NY22 5EQRA 2QXGA 2F3CE 1V2WT 2Z7FE 3L3TA 1AFQC 1DDJA 1ZMLA 3F9GA 3UPEA 4GLYA 4CRBA 2GCHG 2SFAA 1GJ7B 3E91A 3H5CB 4DJZB 4Y0ZE 2VWLA 2C90B 5EXNA 2AIQA 2ZFPH 2OUAA 2ALVA 1RIWC 4NFEA 1CGHA 2QAAA 4BTTB 3STJA 4NGAH 1GBHA 2XW9A 2FMJA 1HAIH 2GZ9A 2R0KA 1UHBB 1XUJA 2SNWA 1PPEE 4MNWA 2Q6GA 3TJNA 2PHBA 3M7QA 2ZWLH 5T3HA 1HRTH 1JWTA 1YPEH 4X1NU 3SNEA 1H8IH 5EPYA 1J9CH 4TY6A 5FPTA 4D7FA 2FI5E 3BIUH 1O2VA 1O2LA 1TNHA 2Y82A 3E0NB 3PMJA 1UTPA 2CF9H 1ANBA 5FX6A 4B73A 1V2UT 5CE1A 1O3MA 4K3JA 3RXVA 3AW0A 5EU8A 3LGTA 3MNBA 1JMOH 4ZKNU 1TMBH 1HAVB 1NRPH 2ZQ1A 1FJSA 3MHWU 4DIHH 1CT2E 1BOQA 1L4ZA 3MO3A 3Q3KA 3PYHA 2B7DH 2NU3E 5AFZH 4CHAC 3SUEA 1UHBA 3VB4A 1Y3XA 3F9HA 3SNDA 2AGIX 2XTTB 3SN8A 2I6SA 1UTJA 2BHGA 1UVPA 2BY7X 3F9EA 2SGAA 2K1QA 4M7GA 1AIXH 3O8BA 1GCTC 2AMDA 1S6HA 1EAUA 2I6QA 3DA9B 2FXRA 5GDSH 3PROA 1EB1H 3AW1A 4GHQA 3ZZDA 3LU9B 4B2BA 1CE5A 2FOHA 1SSXA 2QGRA 2BTCE 4WMEA 3LKWA 3TK9A 1BJUA 2GT7A 5E0HA 1C2MA 3S9AA 3V7TA 5TJXA 3A80A 1IQLA 2ZQ2A 2ZU4A 1UK4A 2G5VA 1DSTA 4UFDH 1XXFA 1YBWA 1HB0B 3ZVGA 1J17T 3HGPA 1S84A 3RM2H 1C5MD 2OBOA 1A7SA 4D76A 3UFAA 2ASUB 3F6UH 3RXHA 3VB7A 3K2UA 5E0JA 5DP4A 1CT0E 1TGCA 1EAXA 1BHXF 1ELCA 2F9OA 1ETTH 1MU8B 2DE8A 1JIMA 1MUEB 3GICB 1MKWK 2FI3E 1GG6B 3SHAH 3UUZA 1P2NA 3QO6A 2SGFE 3NK8A 4AG2A 3SQHE 5T6DA 2PSYA 2Y5FA 3PB1E 2F9UA 2D1JA 3I78A 3NKKA 3PWBA 4AYYB 1MKXH 1P2IA 1GI5A 1S83A 2D2DA 4MNXA 2ZCKP 4E05H 3URDA 4CH2B 1UCYK 1O3CA 2BLVA 3EA8A 2WYJA 1GI8B 1MBQA 2ZU2A 4IMZA 1LQDB 1BTUA 4MLFB 1NU9A 2LPRA 5JBAS 2FOMB 1IQIA 3SI3H 5ETXA 2R2MB 1UTKA 2BD2A 3M36A 1WQVH 3O8RA 3TK6A 2EEKA 1AU8A 4K2YA 1KXFA 1W7XH 1SQAA 3VB3A 3P8NA 4FUGA 2IN2A 1A0HB 1JXPA 1TIOA 1EZUC 1IQKA 1CHOF 1HV7A 3TVJB 1YLCA 1NFYA 4SGBE 1HJAB 3SV6A 3EQ0H 2BQ7B 3OY5U 4NIVA 1QBNA 1EAWA 5F6MA 2WINI 3FANA 1YPGH 2BDBA 1ZOMA 4FUEA 5DGJA 1EP5A 3BN9A 3UIRA 1EXFA 3SJ9A 1GWAA 2BY9X 1SGCA 4NFFA 3B8JA 5C1XA 1KXAA 1IOEA 5EQQA 1ZHPA 1SQOA 1LHCH 1DANH 3GDVA 1M9UA 3HPTB 4YT7H 1HAGE 1QJ1B 3MU0A 1ACBE 3TH2H 1XUIA 3A8DA 2VIVA 5BRRE 3UQVA 2HPQH 2BD8A 4CRCA 3HK3B 3M37A 1P9SA 5C67A 1DM4B 2J2UA 1SI5H 1SLUB 3P17H 1OPHB 2FOBA 1P2OA 3OYPA 4WMFA 2WV4A 2ZEBA 1PPZA 2BD4A 2Y7ZA 1QL7A 3RXEA 2BB4A 1UVTH 2W7UA 1GJBB 2ZTXA 1A3BH 1D3DB 3HKIB 1GMDG 3CENA 1RJXB 1H4WA 1GGDC 4ISIH 1CSOE 1YPLH 1AWHB 2F83A 1NROH 2ZG0H 2ZIQH 4CREA 4D8NA 1RD3B 4I32A 2ZC9H 2GCHF 2H2ZA 3KCGH 2FIRH 1TNJA 1H8DH 1EZXC 1O31A 1PQ5A 1K21H 2CJIA 2QA9E 3B9FH 1BMNH 4K1EA 4X2WA 4X6PA 4AFUA 2XXLA 3A89A 4FVBA 1O30A 1C2LA 3RXDA 1SFIA 1UVOA 4O97A 1TFXA 1G9IE 3HGNA 4BAKB 1C1OA 4U2WA 1P3EA 4AGKA 2FWWA 2J4IA 1GBBA 5DO4H 3EAJA 1TPAE 1IHTH 3S7KB 1W14U 3SV7A 3A7WA 1O2XA 2V0BA 4B75A 5C2ZA 1OYQA 2AEIH 3BTQE 5A8XA 4DVAU 1HGTH 1TPOA 1GMHG 2O8LA 1LHEH 1GBJA 3FZZA 1E34B 2EI6A 1P8VC 1BRBE 2UWLA 2EI7A 3SI4H 1C2IA 4WH6A 1V2LT 3U1JB 1O2WA 1YPKH 2ZCLP 3V12A 1OYTH 2R2WU 1Y5AT 1U6QA 2UUKB 5F8XA 4YOIA 1RTLA 1LKBA 1W10U 1Z8GA 1TNGA 3LT3A 1W0YH 3T28A 1SGRE 1NRSH 1SGDE 5EODA 1O3AA 1IAUA 5EXMA 1QBVH 2G5NA 2GKVE 2Z9LA 2QXJA 1KXDA 2W3IA 1ELGA 1MD7A 5I46H 3RXGA 1BUIA 1BHXB 3M7UA 3ZZ9A 2ZO3H 3PTBA 1H9IE 3KGPA 5F03A 1LVBA 4WY3A 2UUFB 1HJ8A 2BXTH 1S6FA 1H9LB 1Z8IB 3GDUA 2VVVA 1NT1A 1XKBC 2A2XH 3Q77A 1EAIA 3A8BA 2ESTE 2R0LA 3LGWA 1AE8H 5JBBS 2KAIA 2OD3B 1OWJA 1UVUH 2O9QA 3RC4A 1NM6A 2JKHA 1PYTD 4ABGA 1UCYE 3D62A 3M3VA 1ELBA 1DLEA 2FLRH 3GISB 5L2ZH 1KXEA 4GAWA 4OGYA 1F92A 1SVPA 4NA7A 1A0JA 2CHAB 3LH1A 2BYAX 2QXIA 3SUFA 3ZV9A 1IQJA 1FXYA 1PJPA 1Z6JH 2OQUA 3SJ8A 3LGUA 1GI1A 3BIVH 1N6XA 1KSNA 3M5NA 1K22H 4B1TA 3GCHB 1Y3YA 2C93B 3KNXA 3LPRA 3MOCA 1RFNA 3RMOH 9LPRA 1O39A 2O8WA 3QX5H 1Q31A 4MPWA 4A1VA 3P95A 1LVYA 1WYKA 3QTVH 1ABIH 2VINA 1C2EA 4THNH 1AVGH 2EI8A 1THPB 4ZHLU 1S5SA 1MZAA 2ILNA 1DLKB 4JZFH 1P03A 4IC5A 1YGCH 1C5LH 1QL8A 2BDIA 3F68H 3SNCA 1Y3UA 1ZTKA 3SNBA 4GPGA 3TK5A 1QBOA 4OGXA 3U98H 3UTUH 3BTEE 4Y79A 3T25A 4DOQA 1IQMA 1A3EH 5K0HA 4BXWA 2HGTH 1C1PA 4FUIA 1V2VT 1GDUA 3RXTA 2GCTC 3AASA 1V2PT 2BD9A 1TGSZ 2BD3A 2ODQA 3BTFE 6GCHF 3BG8A 1O2RA 1AGJA 3KL6A 5T6GA 4TWWA 1GI6A 1V2NT 2VWNA 2FS9A 1IQNA 1AHTH 1INCA 1L0ZA 1TAWA 3ENSB 1GHAG 3ELAH 2QC2A 1G30B 2YNBA 4CRDA 1NRRH 1GBCA 3U8TH 1ZSJA 4X6OA 3ZZBA 2A1DB 4LK4A 3MO6A 2VGCC 2HNTE 2WPMS 3CP7A 1MQ6A 4FU9A 1SLWB 1HBTH 2VH0A 5GWZA 2PGBB 1VR1H 2ZGBH 1A61H 3OU0A 1C5PA 2FEQH 3MH6A 4AOQA 1T31A 3GY4A 5JBTA 5JDUB 1AD8H 3D23A 3PM3A 4J1YA 4IBLH 3SBKA 5J4QA 1TABE 4VGCB 4AGJA 4Y7BA 1GMDF 4O9VA 1BBRK 5C5NA 5LGOA 5FBEA 4LZ4B 2FPZA 3NWUA 4BTIB 4IMQA 1C9TA 3L33A 4GHTA 2GMTC 1K1OA 1O5FH 2TRMA 3P6ZB 4ZHAA 2Z9GA 3BV9B 1MH0A 1AY6H 1B7XB 1MTVA 3RMLH 1GPZA 2QV1A 2TIOA 5FPYA 2F9BH 3LGVA 1TX6A 1YCPH 1EJNA 1EOJA 2BMGB 1G36A 2P16A 1OX1A 3N7OA 1SLVB 3U9AH 1CA0B 2FOFA 3MH4A 1EPTC 1GHBF 1ZMNA 2B8OH 1BRCE 1V2KT 1AKSA 3OTJE 4A1XA 1O2ZA 2OLGA 3P8FA 1GMHF 4JYTA 2F91A 2XBYA 3SV8A 1GJ5H 2ZF0H 2ZCHP 1ELVA 1WTGH 1LHGH 4YO9A 4GSOA 4FVDA 2QYIA 5EXLA 8GCHG 1GBDA 1KLIH 1P04A 4YOGA 1ZSKA 2ZKSA 5IYTA 2ZDLA 2H9TH 2A7CA 2NU1E 4CRAA 4NZLA 1O33A 3TLOA 4Q7YA 2B5TB 1WCZA 1GCDA 2WPLS 1KTSB 2PKSC 2PTCE 1DT2A 4TPIZ 3TNSA 1ORFA 4KTCA 1TBZH 3PV4A 1PQ8A 3E16B 2H5CA 3URCA 2ZPRA 2AERH 5PTPA 4MNYA 3TH4H 5C1YA 2VVCA 1E0FD 3SU0A 1YP9A 3VXEH 1PPFE 4NWLA 2Z9KA 1MAXA 3GY8A 1XM1A 1C2FA 2XC5A 2FODA 4JYUH 3TJUA 3HKJB 4CRFA 2B9LA 1O3LA 1SGIB 1GBEA 5G4BA 2VWOA 1LDTT 1THRH 1MD8A 1TA2A 1LMWB 4XOJA 4X2YA 3TU7H 2BQ6B 1ETRH 1HCGA 2HRVA 3ESTA 4CH8B 1QA7A 1N1LA 3T26A 1ARCA 5GCHG 2BOHB 3DD2H 5I25A 3LIWA 1C1WH 4FUFA 4ZXXH 3MWIU 3ATWA 2JETC 1Z6EA 1NESE 1BDAA 3A84A 3BG4C 2BLOA 3QZQA 2B0FA 1NFUA 4A5TS 1C1MA 3RM0H 2IOTA 1IQFA 2Y81A 1GI0A 2WUBA 3SJIA 3ZYDA 3QUMP 3SW2B 1SB1H 3S0NA 1MCTA 6CHAB 1WBGB 4NIWA 3LDXH 4IGDA 1G3DA 2G8TA 5E2PA 2C8WB 4D9QA 1DWCH 1OWKA 2H5DA 3A88A 4ZMAH 2WPKS 5DP9A 3UREA 2ZFRH 5C5OA 4X1QU 4ABBA 1TGNA 4X8VH 3A81A 2UWPA 3BF6H 4MG3A 4WXIA 2FX4A 1S85A 1DS2E 2WPHS 3QGNB 4MDSA 4NA9H 1O37A 2BZAA 1T8LA 5HM2A 4IN1A 1K1LA 1BTPA 1O5CB 3SHCH 3S7HB 2ZGXH 1AMHA 1C4U2 4PROA 4UDWH 3HK6B 4H6SB 1RRKA 3EA7A 1A5GH 3GOVB 3ZVBA 4UFEH 1YCPM 2YNAA 1G32B 1LHFH 1Z1JA 2TGPZ 3VGCC 1AVXA 4NG9H 3SUDA 1GHAF 2TGTA 2ZFSA 1QGFA 3PLBA 1PPCE 5EOKA 3VB5A 2ZPSA 4ASHA 1DUAA 1QB1A 1GVKB 2ZDAH 1C5NH 2GD4B 1TMTH 3MNSA 5A0BA 1ELDE 1MTNB 1BBRE 2ZI2H 1KIGH 2ZGHA 2A5KA 1QJ6B 1HPGA 1C5QA 4WMDA 3M61U 3P8OA 4LZ1H 1C1VH 2ZHQH 1C5SA 2Z94A 1O3FA 1ANDA 1C1NA 1AI8H 1BB0B 1BTZA 1AE5A 3MNXA 3RXIA 3V13A 4GCHF 4FUDA 1AB9B 3MNCA 4FUHA 1OWIA 3TH3H 3TJOA 2ZU3A 2HNTC 1WU1A 1FY8E 1A5IA 4I8JA 2GDDA 1LPGB 1ZGVA 3GCTG 2SGQE 5A0CA 4B2AA 1NN6A 1O3GA 3E90B 1W8BH 3DFLA 1ZLRA 1FN6A 2R3YA 3A7VA 2Z3CA 1SPJA 4I33A 2NWNA 2GGVB 4AB8A 6LPRA 1FNIA 3PO1B 5FCKA 3U8OH 2VNTA 1QB9A 3A86A 2ZDVH 4BAQB 2ODYB 1CA8B 1NS3A 4Y8XA 4B76A 3ZZ7A 3BTTE 1V3XA 3QGJA 3Q3XA 3RLWH 1T8NA 1DWBH 4X2VA 4F4OC 2HALA 3UNQA 1G37A 3F1SB 3BTME 5L6NH 2BXUH 2C8YB 1QB6A 1GBTA 1C2JA 1LVMA 4BTUB 5K7RA 3U8RH 5EG4A 1EUFA 2AH4X 2Z9IA 1CGIE 1L1GA 1K1IA 1AUTC 1K1MA 2QY0B 1OP2A 1ZMJA 4Q80A 1LTOA 2HWLB 5L2YH 4X2XA 1GBMA 1Z8RA 5JYIA 3H7OA 2LNCA 4HGCA 2R3UA 2ZFQH 8GCHF 4ISOA 1ELAA 1XUHA 5A0AE 4X8TH 4ABFA 2CF8H 1XX9A 1HAXB 5HMAA 1C9PA 4YLQH 1Y8TA 3A83A 1GI2A 4Y6DA 2P8OB 3RXLA 1ZZZA 4JZIA 1BJVA 1NFWA 4D9RA 2ZU5A 5DP8A 1FPHH 2P59A 5JB8S 1TONA 1LQEA 4A6LA 1O2MA 1TLDA 2AIPA 2P3UB 2J94A 4KELA 1UTOA 1F7ZA 5FBIA 1TBQH 1K1JA 1WTHD 1HXEH 1THSH 4BAOB 4KKDA 1MBMA 1O2IA 2O8MA 1C1SA 4X6NA 4Y8ZA 1SOTA 4NZQA 4D7GA 3BTHE 3SU6A 3T29A 2OQ5A 3MU1A 3M5LA 5CHAC 1F0TA 3RXFA 1W2KH 4RN6A 1VCQA 1SC8U 1LVOA 1GI9B 5H4IB 1EPTA 5DPAA 2WYGA 1TNIA 1SG8B 4R0IA 3L6PA 4BOHA 3P8GA 1O2SA 4AN7A 1KY9A 4FXGH 1MKXK 1ETSH 1DY8A 1XUGA 4ABHA 2FOAA 2FYQA 1C2GA 5E2OA 2BY8X 4NWKA 1MCVA 1LKAA 1ZTLA 3ZZCA 1HAYB 1QHRB 3ODFA 1CHGA 1AFQB 1PFXC 3LONA 2A2QH 2ZFTA 4NA8A 3GY7A 2FOEA 1ZGIA 3KIDU 3BTDE 1P2JA 4Z6AH 1UMAH 3DHKH 3RU4D 4YLUA 1RIWB 1HYLA 1C5VA 4ISHH 2ANWA 1NRQH 2JETB 2XWAA 1CBWC 1GVZA 3A7TA 3UWIA 3FP6E 5JBCS 2SGPE 2XCFA 2PFEA 3ZZAA 4UD9H 2A7HA 3RXCA 2OBQA 5DP5A 1QJ7B 1C1RA 1O2QA 1VZQH 2Z9JA 1SLXB 4HI3A 3OY6U 4FUBA 4XDEA 2W3KA 1C5XB 2BDYA 4B71A 2KAIB 3RXMA 2RCEA 1MU6B 3TNTA 4O3TA 2FTLE 3E0PB 5GXPA 1VGCC 2TPIZ 2NU2E 4K1TA 1C2DA 2HPPH 4OS4A 1GHZA 2OC1A 1P11E 1GMCG 3M3TA 1QRXA 3ATIA 3QK1A 3C1KA 4HFPB 1CU1A 3T27A 2Q1JA 1A5HA 1EZSC 1FY5A 2W5EA 4CHAB 1SGFA 2UUJB 7GCHG 3CS7A 2BX3A 1J16A 1MZDA 1O3KA 2XBWA 3LGYA 1W13U 1BRUP 5LPFA 3VB6A 1K28D 4WH8A 1GCTB 1O3JA 1HIAA 5GIBA 2BLWA 3UNSA 5LPEA 1AZ8A 5FPSA 5A8ZA 2A4RA 1ESTA 4UFFH 3A8CA 3GYLB 4WVPE 1YPJH 2CXVA 4U01A 4XSKU 3NCLA 1FY3A 1E38B 2GT8A 3SZNA 1G3CA 1ELFA 2ZHFH 1SGTA 3SU5A 4MPVA 1OP0A 4IW4E 2FI4E 2PKAB 2Y80A 2V6NA 1J14A 4FUCA 1EKBB 5DG6A 2QCYA 1TX7A 3BEUA 2ZGJA 1UVSH 2Y5GA 4XE4A 5FXLA 2EC9H 2EA3A 3S9BA 1V2QT 1NTPA 4Q7ZA 1C1TA 3TITA 4RSPA 3V3MA 3ODDA 3TGKE 5F8ZA 5EW2H 4U30A 5T6FA 1Y3VA 2R9PA 4UE7H 4YZUA 1DWEH 2ZDKA 1BTYA 2FM2A 2XC0A 1O3EA 1HAHH 2V35A 2WV5A 2BDGA 2BOKA 1TRNA 1HUTH 4K69A 1SQTA 1FY4A 1GJ6A 5C3NA 4JZDH 1EASA 1VITG 2FZZA 2AMPA 2C8ZB 4R8TB 5E8EH 5SGAE 2PKAA 1QRWA 1C4Y2 4ABAA 1TQ0B 2J95A 1SGFG 1DX5M 1O5EH 1QFKH 1ZHMA 3SNAA 4ABJA 3BTGE 1A4WH 1GJAB 2Y7XA 4ZKOU 4O03A 1BCUH 1PPGE 1J8AA 2OP9A 1V2MT 4RKOB 4ZH8A 4DG4A 2XC4A 2A32A 1A46H 4K60A 1NZQH 7ESTE 3R3GB 1O32A 3ATKA 1E35B 1TMUH 4FU8A 2QIQA 4H6TA 1OS8A 3M5OA 2SGEE 3NXPA 4CBNA 3PTNA 3M35A 3A8AA 3P92A 3K6ZA 1GG6C 3M3SA 1P0SH 2GTBA 3RC5A 3TPIZ 1RTFB 5JB9S 1UTQA 2F9PA 2XYAA 4F49A 5L30H 4WXVA 2ODPA 1EJMA 1BA8B 1C1UH 4E7NA 1BQYA 1Y5BT 2FX6A 2P3TB 1YF4A 2NU0E 1E36B 1V2ST 2PGQB 3M7TA 1AKSB 5HYOA 1GBFA 3OSYA 1SHYA 4Q2KA 1OOKB 3SGQE 1ELEE 3RLYH 3LC5A 1P9UA 1JRTA 1IQGA 1P01A 1W0ZU 1F0RA 3SV2H 3LH3A 1SFQB 1L4DA 2FOGA 1GVLA 1BTWA 1O35A 3AAVA 3A85A 4ZHMU 2TGAA 4HZHA 2ULLA 1GGDB 4YTAA 2VIWA 5DP7A 1HJAC 2BVXH 1S0RA 2HLCA 1BMLA 1GI4A 2VVUA 1V6DA 1GJ9B 3ZZ5A 3MTYA 1QY6A 5EPNA 3VEQB 4Y0YE 1GHYH 5EGMA 1EJAA 2ANKH 5BPEA 1AN1E 3FP7E 1C1QA 1FY1A 3W95A 3FFGA 4ABEA 1FLEE 2G00A 2C3SA 3DUXH 2BM2A 1CHOG 3MH7A 1TNKA 4TY7A 2CN0H 2FESH 3KEEA 1GI7B 2QF0A 1DICA 1FMGA 2W26A 4Z0KA 4ZAEA 1AO5A 1PQ7A 1VCPA 1C5UA 1DWDH 1WAYB 2ZNKH 1BIOA 4YT6H 2VWMA 2P93A 1GJCB 2AFQB 5ESTE 1TE0A 2P95A 3GCOA 1CBWB 1O3OA 1HAOH 3Q3YA 5AVDA 1MMJN 1YM0A 4YM9A 4TYDA 3UOUA 1GMCF 1DY9A 1Z71A 3I77A 3EGKH 1DSUA
chains in the Genus database with same CATH superfamily
2J34A 3RC6A 4MVNA 1FDPA 5B6OA 3RUOA 7GCHF 1TGBA 1C5OH 1ZPCA 2V3HH 3K9XB 1KDQA 3I29A 3QLPH 3G01A 4I8LA 1TX8A 2FS8A 4K1SA 1K1PA 2AMQA 3VPKA 2V3MA 2A5IA 5KEDA 2PW8H 1VGCB 1YLNA 4JYVH 2ZTZA 1SGEE 2ZTYA 1BZXE 1YPHE 1VJAU 3D49H 1ESAA 2M5TA 4ISNA 1C4V2 1W0JD 4E7RG 1VITH 1K9OE 1F5RA 3ZVDA 1CGJE 1MKWH 2FOCA 3KQCA 5DJ7A 1CT4E 1FPCH 1HAPH 3MO9A 1DPOA 2ZHDA 4QT8C 3A7YA 1EB2A 1Z7KA 1BMMH 5HXFA 4X8SH 5C1UA 4X1PU 3A82A 1NPMA 1GBIA 1UCYH 3NUMA 1KLJH 2FYRA 1DITH 2ANMH 1ZPBA 4AFQA 3UAIC 5AFYH 1GBAA 1YCPK 2STAE 2A4GA 2OCVB 2VBCA 3PLKA 5CMXH 1UK3A 1S0QA 3T2NA 4TWYA 5EJZA 3QTOH 3LGIA 2ZZUH 2PR3A 3RMMH 1KXCA 4Y76A 4AX9H 2M2AA 3RXJA 2RA0A 1NU7B 2IJOB 3JZ2B 1AZZA 1VITF 2FLBH 2P3FH 1V2TT 4IS5A 1QA0A 1XUKA 1SOZA 1T8MA 3FOAA 2A5AA 1ESBA 1BMAA 3RU4T 3F2GA 3IWMA 1G3BA 4GUXA 1FAKH 1GHXH 2ALPA 5TCCA 3F9FA 1E37B 1CO7E 1H9HE 1ZRKA 1TWXB 4O3UA 5C20A 2KX4A 3QDZB 1F0UA 1CQQA 3PV2A 4BANB 4CBOA 1X7AC 4BAMB 3UY9A 1Y5UT 7KMEH 1XVOA 2A0QB 3RXOA 1D3QB 4MPUA 2W6JD 1NC6A 2AS9A 1DVAH 3O8DA 2GCTB 3VG8A 3PMHB 3HATH 2PV9B 2G4UA 2CMYA 4BNRA 3CS0A 1KMHB 2GX4A 3EA9A 4NSYA 2Z3EA 1EATA 4P00A 1GL0E 4Y7AA 2CHAC 4DW2U 1HAVA 1A0LA 1VCWA 4ESTE 4J2YB 2ZPQA 4X0WU 1FONA 1WUNH 2G4TA 2YMSB 5E0GA 4KGAA 1P09A 4KTUA 1ZJKA 3GCHC 1WSSH 1OSSA 1PPBH 1TGTA 5AHGH 1QQUA 1TOCB 2VGCB 3SGBE 2XBXA 8LPRA 4JZEH 1G3EA 3VXFH 1YKTA 1GHVH 2FTMA 4KP0A 1DUEA 1GHWH 2XRCA 2JH0D 3AVZA 2L74A 3UNRA 4A7IB 1Q2WA 1O2TA 1SL3A 1LCYA 4I8KA 3SGAE 3UOPA 1F5LA 1XVMA 2EQNA 4Y8YA 3SU4A 4LOYH 4TPYA 1GJ8B 1D3TB 1LPZB 1YPMH 1FN8A 4FU7A 1DOJA 1O2KA 1FAXA 5A09A 3GDSA 1QQ4A 1O0DH 2RG3A 1GBLA 1C5TA 1H8HD 1O3IA 4AORA 3GY6A 1E79D 2GMTB 5DP3A 1UTMA 2A45B 1COWD 3RXKA 4K5ZA 2IPQX 3KHVA 1Y3WA 4OS1A 1FIWA 2HNTF 1GJ4H 2V3OH 3O8CA 2PWXA 4NIYA 2BLQA 2BD7A 1AUJA 3EE0B 1BTHH 3A7ZA 1P02A 2RDEA 3KQBA 1FI8A 1TBRH 2G81E 1HDTH 1Y59T 4DGJA 3TGIE 2UWOA 1EOLA 3T62A 1P05A 2SGDE 4YOJA 2O8TA 2PTNA 1OXGA 3PLPA 1EPTB 6GCHG 2BDHA 1H1BA 2F9VA 1EQ9A 1GDNA 2Y5HA 5LH8A 3SORA 5J4SA 1PQAA 4IC6A 1P2KA 4OS2A 1D6RA 1P3CA 3NZIA 1S81A 3FZDA 3KF2A 1HFDA 3GS9A 4Q63A 4VGCC 2TGDA 1QNJA 1ANEA 2BD5A 1TALA 1OWEA 3VFEA 1KTTB 1ZPZA 3MI4A 3RP2A 2TBSA 2HOBA 3RXBA 1Z8JB 1O2OA 2JH5D 5A8YA 4X1SU 5GJ4B 3M5MA 2PKSB 3IITA 3FO8D 1QTFA 3MFJA 4BAHB 2GDEH 1CVWH 2DUCA 3ZVCA 4AG1A 1VJ9U 2CGAA 1OWDA 2XNIA 1A2CH 1F5KU 2WPIS 3H7TA 3UQOA 1MTSA 2A31A 3E6PH 3TGJE 3SUGA 2BVRH 2OC7A 3RXRA 5GCHF 2AYWA 2STBE 1XXDA 1BITA 1WOFA 1G2LA 5DK1A 3UR6A 4OS5A 1YLDA 1GI3A 8ESTE 1TPPA 2H6MA 1T4VH 3F0OA 7LPRA 2Z6BD 1ARBA 3GY2A 3QN7A 1ZJDA 2AGEX 4INLA 3GY3A 1PYTC 3FN8A 1L1NA 2JIZD 4Y11E 2WZQA 5HIZA 3U69H 2A7JA 5FX5A 4ZXYH 4UEHH 1YPHC 3TJVA 5FAHA 1CA0C 1Q3XA 1RXPA 1N8OC 2ZU1A 3RXQA 3SU3A 1EX3A 4I31A 1AWFH 4XBBA 2ZHWH 1ELTA 1TQ7B 1UO6A 1WDIA 1ZTJA 1MTUA 5HM9A 6ESTA 3V0XA 1O38A 2Q6DA 4CRGA 2J38A 3Q00A 3BG4B 4NCYA 1BRAA 3RXPA 3QWCH 1P10A 2GZ8A 3C27B 2OTVA 1TPSA 1W3CA 3RDZA 4ACBA 2W7SA 2OXSA 4XFQA 4YXWD 1F0SA 3IG6B 3LC3A 1MQ5A 4X6MA 1BT7A 1T4UH 1GL1A 1K1NA 4H4FA 1B0EA 2HVYB 2VH6A 1GHBG 3ATMA 3MYWA 2JH6D 2HVXA 1HIAB 5JPMH 1EP6A 4RI0A 1GBKA 3FKSD 1HXFH 2BQWB 4JMYA 4INHA 1V2OT 2PLXA 4SGAE 2VU8E 2GP9B 3LOXA 1L1JA 3ZZ8A 5LPRA 3EDXB 1F2SE 4WF8A 1LHDH 3MMGA 4DT7B 4JK5A 2IPHA 1HJ9A 2ZECA 2G55A 1HNEE 3BSQA 3TIUA 1HLTH 4MQAA 1B0FA 3SV9A 3SO3A 1D3PB 1JIRA 1OKXA 1IQHA 1D6WA 2ZP0H 3D65E 1QIXB 3UWJH 1TRYA 3ATLA 1QR3E 1ZYOA 2C8XB 2P94A 2BY6X 3SU2A 1UTNA 4A92A 2J9NA 1O5AB 1O3DA 1ZSLA 2XCNA 3LJOA 4M9FA 1O36A 1SKYE 1P12E 1IQEA 4FUJA 1QURH 3FP8E 1ANCA 3S9CA 5EW1H 3VGCB 3MU5A 3OEHD 1RS0A 1QL9A 3MU4A 1O5GH 4B6FA 4OS7A 4B74A 4XBDA 4NIXA 4DY7B 1WV7H 3AK5A 2ANYA 3P70B 1BBRH 3GCTF 6CHAC 3QZRA 1HAZB 1SBWA 2FO9A 5F8TA 2OC8A 4DCDA 2BVSH 3R0FA 5EQSA 3A87A 4AYVB 3SZEA 4E06H 3KQDA 1V2RT 3SJKA 1SGPE 3BEFB 1MTWA 1UK2A 2VIOA 2NU4E 5AF9H 2CK3D 5ESBA 1O2GH 3ZZ6A 3SU1A 2VIPA 4MTBA 1ZRBA 5FHTA 4UONA 8KME2 1UJ1A 1W7GH 2GVFA 1PPHE 3W94A 4B2CA 1EZQA 1N6YA 1NFXA 2G52A 3MU8A 1J15A 3ZVFA 5FCRA 1XKAC 4JK6A 5GPIB 4YESB 3NPSA 1NRNH 3RMNH 1SGNE 3B23B 1W11U 4XBCA 5HGGA 1TRMA 2XBVA 3KQEA 2BX4A 1JOUB 3GYMA 1O3BA 1V2JT 2G51A 2VIDA 1P57B 3WY8A 3RXSA 2GZ7A 3BEIB 1RGQA 1C2HA 2PUQH 3LJJA 1LO6A 2OINA 1IHSH 3ZZ4A 4AZ2B 4IN2A 5KGOA 1ZR0A 2D8WA 1XMNB 4I8GA 1KLTA 4I7YH 1MTNC 3GCNA 1D9IA 1KYNA 2OC0A 4NSVA 3T5FH 5IDKA 4H42U 1W12U 1NBMD 2VJ1A 4Y10E 4DURA 4RT0A 2RDLA 4AFSA 1FUJA 2QXHA 1O2HA 1A1RA 1RTKA 1BTXA 5DKMA 1ABJH 1XUFA 1MAYA 4BXSA 1SR5C 4LXBH 3U1IB 3ZVEA 3DCLA 1AB9C 1YC0A 3PMBB 3PWCA 2BZ6H 3ZZ3A 4RKJB 3ZVAA 3BTKE 2V7QD 3FVFB 5TCAA 3ZV8A 2D26C 2F9NA 1C5RA 4AFZA 9ESTA 1O5BB 1T8OA 4KTSA 4JCNA 5FL7D 1Z1IA 1TB6H 3E3TA 3FAOA 2DE9A 3PO1C 1YYY1 4WJG2 4ZKSU 1C5WB 4A1TA 2PUXB 4MNVA 1DE7H 1DXPA 4UFGH 4ZUHA 4RT1A 4GCHG 1O3NA 1OWHA 1SMFE 1DXWA 2Z3DA 3RXAA 3RXUA 2YOLA 2H1UA 4ABDA 2FP7B 1SGYE 1TA6A 2ZHEH 1SGQE 2ZGCA 1NO9H 2GV6A 2WUCA 1JBUH 1WQSA 3SOSA 1O2UA 3EYDA 3KN2A 1GJDB 2BY5X 2AGGX 2WHXA 2O8UA 3E1XB 3OX7U 4ZKRU 3SQEE 3ZYEA 1O2YA 2KCYA 3N7DA 2SNVA 3RU4E 3F0PA 5CHAB 2WPJS 4JZ1A 1AVWA 1EFRD 2VIQA 4ZROA 3S69A 4B6EA 2UUYA 1B5GH 1S82A 1D4PB 5ABWA 2GV7A 3SJOA 1ID5H 1C5YB 1K2I1 2AHME 4OM9A 2KCOA 3E8LA 2FDAA 5HIYA 3UR9A 1C5ZB 4GVUA 4CR9A 4X1RU 1T32A 3ITIA 4HTCH 1O3PB 1TOMH 1QRZA 1OP8A 1KDQB 1GDQA 4DIIH 1FV9A 3K65B 2H9HA 4K8BA 3DFJA 5C17A 3STIA 3MH5A 5A2MH 1O3HA 1N8OB 4AB9A 3PMAB 4Y71A 2P8OC 4ABIA 1C2KA 3BTWE 1T7CA 1TNLA 2Y6TA 2CV3A 2PSXA 1KXBA 1O5DH 1QCPA 1G2MA 3DT0H 2A4OA 4ISLA 2XWBI 4WWYA 1SHHB 2H9EH 2ZA5A 3GY5A 3JZ1B 2ZDMA 1FQ3A 1DFPA 2C4FH 4CR5A 1O2PA 2VB0A 1LPKB 4Q7XA 1AQ7A 2J92A 1JRSA 3A7XA 4OS6A 2A4QA 2THFB 5DP6A 2LELA 2QF3A 2QN5T 1AFEH 2ZDNA 4I8HA 3K6YA 1UTLM 4K8YA 1FIZA 1P06A 1TYNA 1L2EA 4INKA 1O34A 1O2JA 2Q6FA 2BDAA 1P2MA 2ZFFH 4MPXA 3Q76A 4TSFD 3AAUA 2RA3A 2BDCA 1FZZA 1P2QA 4X8UH 4U32A 2WPDD 1O2NA 1ZHRA 1NY22 5EQRA 2QXGA 2F3CE 3W1EA 1V2WT 2Z7FE 3L3TA 1AFQC 1DDJA 1ZMLA 3F9GA 3UPEA 4GLYA 4CRBA 2GCHG 2SFAA 1GJ7B 3E91A 3H5CB 4DJZB 4Y0ZE 2VWLA 2C90B 5EXNA 2AIQA 2ZFPH 2OUAA 2ALVA 1RIWC 4NFEA 1CGHA 2QAAA 4BTTB 3STJA 4NGAH 1GBHA 2XW9A 2FMJA 1HAIH 2GZ9A 2R0KA 1UHBB 1XUJA 2SNWA 1PPEE 4MNWA 2Q6GA 3TJNA 2PHBA 3M7QA 2ZWLH 5T3HA 1HRTH 1JWTA 1YPEH 4X1NU 3SNEA 1H8IH 5EPYA 5C0TA 1J9CH 4TY6A 5FPTA 4D7FA 2FI5E 3BIUH 1O2VA 1O2LA 1TNHA 2Y82A 3E0NB 2J98A 3PMJA 1UTPA 2CF9H 1ANBA 5FX6A 4B73A 1V2UT 5CE1A 1O3MA 4K3JA 3RXVA 3AW0A 5EU8A 3LGTA 3MNBA 1JMOH 4ZKNU 1TMBH 2OK5A 1HAVB 1NRPH 2ZQ1A 1FJSA 3MHWU 4DIHH 1CT2E 1BOQA 1L4ZA 3MO3A 3Q3KA 3PYHA 2B7DH 2NU3E 5AFZH 4CHAC 3SUEA 1UHBA 3VB4A 1Y3XA 3F9HA 3SNDA 2AGIX 2XTTB 3SN8A 2I6SA 1UTJA 2BHGA 1UVPA 2BY7X 3F9EA 2SGAA 2K1QA 4M7GA 1AIXH 3O8BA 1GCTC 2AMDA 1S6HA 1EAUA 2F4LA 2I6QA 3DA9B 2FXRA 3DSGA 5GDSH 3PROA 1EB1H 3AW1A 4GHQA 3ZZDA 3LU9B 4B2BA 1CE5A 2FOHA 1SSXA 2QGRA 2BTCE 4WMEA 3LKWA 3TK9A 1BJUA 2GT7A 3CNRA 5E0HA 1C2MA 3S9AA 3V7TA 5TJXA 3A80A 1IQLA 2ZQ2A 2ZU4A 1UK4A 2G5VA 1DSTA 4UFDH 1XXFA 1YBWA 1HB0B 3ZVGA 3KYGA 1J17T 3HGPA 1S84A 3RM2H 1C5MD 1A7SA 2OBOA 4D76A 3UFAA 2ASUB 3F6UH 3RXHA 3VB7A 3K2UA 5E0JA 5DP4A 1CT0E 1TGCA 1EAXA 1BHXF 1ELCA 1MABB 1ETTH 2F9OA 3MQKC 1MU8B 2DE8A 1JIMA 1MUEB 3GICB 1MKWK 2FI3E 1GG6B 3SHAH 3UUZA 1P2NA 3QO6A 2SGFE 3NK8A 4F55A 4AG2A 3SQHE 5T6DA 2PSYA 2Y5FA 3PB1E 2F9UA 2D1JA 3I78A 3NKKA 3PWBA 4AYYB 1MKXH 1P2IA 1GI5A 1S83A 2D2DA 4MNXA 2ZCKP 4E05H 3URDA 4CH2B 1UCYK 1O3CA 2BLVA 3EA8A 2WYJA 1GI8B 1MBQA 2ZU2A 4IMZA 1LQDB 1BTUA 4MLFB 1NU9A 2LPRA 5JBAS 2FOMB 1IQIA 3SI3H 5ETXA 2R2MB 1UTKA 2BD2A 3M36A 1WQVH 3O8RA 3TK6A 2EEKA 1AU8A 4K2YA 1KXFA 1W7XH 1SQAA 3VB3A 3P8NA 4FUGA 2IN2A 1A0HB 2JDID 1JXPA 1TIOA 1EZUC 1IQKA 1CHOF 1HV7A 3TVJB 1YLCA 1NFYA 4SGBE 1HJAB 3SV6A 3EQ0H 2BQ7B 3OY5U 4NIVA 1QBNA 2J97A 1EAWA 5F6MA 2WINI 3FANA 1YPGH 2BDBA 1ZOMA 5C94A 4FUEA 5DGJA 1EP5A 3BN9A 3UIRA 1EXFA 3SJ9A 1GWAA 2BY9X 1SGCA 4NFFA 3B8JA 5C1XA 1KXAA 1IOEA 5EQQA 1W0KD 1ZHPA 1SQOA 1LHCH 1DANH 3GDVA 1M9UA 3HPTB 4YT7H 1HAGE 1QJ1B 3MU0A 1ACBE 3TH2H 1XUIA 3A8DA 2VIVA 5BRRE 3UQVA 2HPQH 2BD8A 4CRCA 3HK3B 3M37A 1P9SA 5C67A 1DM4B 2J2UA 2XOKD 1SI5H 1SLUB 3P17H 1OPHB 2FOBA 1P2OA 3OYPA 4WMFA 2QE7D 2WV4A 2ZEBA 1PPZA 2BD4A 2Y7ZA 1QL7A 3RXEA 2BB4A 1UVTH 2W7UA 1GJBB 2ZTXA 4ZCNA 1A3BH 1D3DB 3HKIB 1GMDG 3CENA 1RJXB 1H4WA 1GGDC 4ISIH 4Z1MD 1CSOE 1YPLH 1AWHB 2F83A 1NROH 2ZG0H 2ZIQH 4CREA 4D8NA 1RD3B 4I32A 2ZC9H 2GCHF 2H2ZA 3KCGH 2FIRH 3PRBA 1TNJA 1H8DH 1EZXC 1O31A 1PQ5A 1K21H 2CJIA 2QA9E 3B9FH 1BMNH 4K1EA 4X2WA 4X6PA 4AFUA 2XXLA 3A89A 4FVBA 1O30A 1C2LA 3RXDA 1SFIA 1UVOA 5C0UA 4O97A 1TFXA 1G9IE 3HGNA 4BAKB 1C1OA 4U2WA 1P3EA 4AGKA 2FWWA 2J4IA 1GBBA 5DO4H 3EAJA 1TPAE 1IHTH 3S7KB 1W14U 3SV7A 3A7WA 1O2XA 2V0BA 4B75A 5C2ZA 1K0HA 1OYQA 2AEIH 3BTQE 5A8XA 4DVAU 1HGTH 1TPOA 1GMHG 2O8LA 1LHEH 5DN6D 1GBJA 1UW7A 3FZZA 1E34B 2EI6A 1P8VC 1BRBE 3N7EA 2UWLA 2EI7A 3SI4H 1C2IA 4WH6A 1V2LT 3U1JB 1O2WA 1YPKH 5B6LA 2ZCLP 3V12A 1YY3A 1OYTH 2R2WU 1Y5AT 1U6QA 2UUKB 5F8XA 5F53A 4YOIA 1RTLA 1LKBA 1W10U 1Z8GA 1TNGA 3LT3A 1W0YH 3T28A 1SGRE 1NRSH 1SGDE 5EODA 5DSFA 1O3AA 1IAUA 5EXMA 1QBVH 2G5NA 2GKVE 2Z9LA 2QXJA 1KXDA 2W3IA 1ELGA 1MD7A 5I46H 3RXGA 1BUIA 1BHXB 3M7UA 3ZZ9A 3PRDA 2ZO3H 3PTBA 1H9IE 3KGPA 5F03A 1LVBA 2JJ2D 4WY3A 3DSPA 2UUFB 1HJ8A 2BXTH 1S6FA 2WV9A 1H9LB 1Z8IB 3GDUA 2VVVA 1NT1A 1XKBC 2A2XH 3Q77A 1EAIA 3A8BA 2ESTE 2R0LA 3LGWA 1AE8H 5JBBS 2KAIA 2OD3B 1OWJA 1UVUH 2O9QA 3RC4A 1NM6A 4DT4A 2JKHA 1PYTD 4ABGA 1UCYE 3D62A 3M3VA 1ELBA 1DLEA 2FLRH 3GISB 2KFWA 5L2ZH 1KXEA 4GAWA 4OGYA 1F92A 1SVPA 4NA7A 1A0JA 2CHAB 3LH1A 2BYAX 2QXIA 4Q4LA 3SUFA 3ZV9A 1IQJA 1FXYA 1PJPA 1Z6JH 2OQUA 3SJ8A 3LGUA 1GI1A 3BIVH 1N6XA 1KSNA 3M5NA 1K22H 4B1TA 3GCHB 1Y3YA 2C93B 3KNXA 3LPRA 3MOCA 1RFNA 3RMOH 9LPRA 1O39A 2O8WA 3QX5H 1Q31A 4MPWA 4A1VA 3P95A 1LVYA 3WWBA 1WYKA 3QTVH 1ABIH 2VINA 1C2EA 4THNH 3WW7A 1AVGH 2EI8A 1THPB 4ZHLU 1S5SA 1MZAA 2ILNA 1DLKB 4JZFH 1P03A 4IC5A 1YGCH 1C5LH 2LP6A 1QL8A 2BDIA 3F68H 3SNCA 1Y3UA 1ZTKA 3SNBA 4GPGA 3TK5A 1QBOA 4OGXA 3U98H 3UTUH 3BTEE 4Y79A 3T25A 4DOQA 1IQMA 1A3EH 5K0HA 4BXWA 2HGTH 1C1PA 4FUIA 1V2VT 1GDUA 3RXTA 2GCTC 3AASA 1V2PT 2BD9A 4XD7D 1TGSZ 2BD3A 2ODQA 3BTFE 6GCHF 2RFKC 3BG8A 1O2RA 1AGJA 3KL6A 5T6GA 4TWWA 1GI6A 1V2NT 2VWNA 2FS9A 1IQNA 1AHTH 1INCA 1L0ZA 1TAWA 3ENSB 1GHAG 3ELAH 2QC2A 2YMSC 1G30B 2YNBA 4CRDA 1NRRH 1GBCA 3U8TH 1ZSJA 4X6OA 3ZZBA 2A1DB 2L6OA 4LK4A 3MO6A 2VGCC 2HNTE 2WPMS 3CP7A 1MQ6A 4FU9A 1SLWB 1HBTH 2VH0A 5GWZA 2PGBB 1VR1H 2ZGBH 1A61H 3OU0A 1C5PA 2FEQH 3MH6A 4AOQA 1T31A 3GY4A 5JBTA 5JDUB 1AD8H 3D23A 3PM3A 4J1YA 4IBLH 3SBKA 5J4QA 1TABE 4VGCB 4AGJA 4Y7BA 1GMDF 4O9VA 1BBRK 5C5NA 2XNDD 5LGOA 5FBEA 4LZ4B 3PV5A 2FPZA 3NWUA 4BTIB 4IMQA 1C9TA 3L33A 4GHTA 2GMTC 1K1OA 1O5FH 2TRMA 3OAAD 3P6ZB 4ZHAA 2Z9GA 3BV9B 1MH0A 1AY6H 1B7XB 1MTVA 3RMLH 1GPZA 2QV1A 2TIOA 2W6ID 5FPYA 2F9BH 3LGVA 1TX6A 1YCPH 1EJNA 1EOJA 2BMGB 1G36A 2P16A 1OX1A 3N7OA 1SLVB 3U9AH 1CA0B 2FOFA 3MH4A 1EPTC 1GHBF 1ZMNA 2F43B 3OTPA 2B8OH 1BRCE 1V2KT 1AKSA 3OTJE 4A1XA 1O2ZA 2OLGA 3P8FA 1GMHF 4JYTA 2F91A 2XBYA 3SV8A 1GJ5H 2ZF0H 2ZCHP 1ELVA 1WTGH 1LHGH 4YO9A 4GSOA 2QF4A 4FVDA 2QYIA 5EXLA 8GCHG 1GBDA 1KLIH 1P04A 4YOGA 1ZSKA 2ZKSA 5IYTA 2ZDLA 3NRLA 2H9TH 2A7CA 2NU1E 4CRAA 4NZLA 1O33A 3TLOA 4Q7YA 2B5TB 1WCZA 1GCDA 2WPLS 1KTSB 2PKSC 2PTCE 1DT2A 4TPIZ 3WWFA 5HKKD 3TNSA 1ORFA 2KR7A 4KTCA 1TBZH 3PV4A 1PQ8A 3E16B 2H5CA 3URCA 2ZPRA 2AERH 5PTPA 4MNYA 3TH4H 5C1YA 2VVCA 1E0FD 3SU0A 1YP9A 3VXEH 1PPFE 4NWLA 2Z9KA 1MAXA 3GY8A 1XM1A 1C2FA 2XC5A 2FODA 4JYUH 3TJUA 3HKJB 4CRFA 2B9LA 1O3LA 1SGIB 1GBEA 5G4BA 2VWOA 1LDTT 1THRH 1MD8A 2J98B 1TA2A 1LMWB 4XOJA 4X2YA 3TU7H 2BQ6B 1ETRH 1HCGA 2EY4C 2HRVA 3ESTA 4CH8B 1QA7A 1N1LA 4AC9A 3T26A 1ARCA 5GCHG 2BOHB 3DD2H 5GNDA 5I25A 3LIWA 1C1WH 4FUFA 4ZXXH 3MWIU 3ATWA 3ZIAD 2JETC 1Z6EA 1NESE 1BDAA 3A84A 1E1QD 3BG4C 2BLOA 3QZQA 2B0FA 1NFUA 4A5TS 1C1MA 3RM0H 2IOTA 1IQFA 2Y81A 1GI0A 2WUBA 3UB0A 3SJIA 3ZYDA 3QUMP 3SW2B 1SB1H 3S0NA 1MCTA 6CHAB 1WBGB 4NIWA 3LDXH 4IGDA 1G3DA 2G8TA 5E2PA 2C8WB 4D9QA 1DWCH 1OWKA 2H5DA 3A88A 4ZMAH 2WPKS 5DP9A 3UREA 2ZFRH 5C5OA 4X1QU 4ABBA 1TGNA 4X8VH 3A81A 2UWPA 3BF6H 4MG3A 4WXIA 3OE7D 2FX4A 1S85A 1DS2E 2WPHS 3QGNB 4MDSA 4P02A 4NA9H 1O37A 2BZAA 1T8LA 5HM2A 4IN1A 1K1LA 1BTPA 1O5CB 3SHCH 1NBME 3S7HB 2ZGXH 1AMHA 1C4U2 4PROA 4UDWH 3HK6B 4H6SB 1RRKA 3EA7A 1A5GH 3GOVB 3ZVBA 4UFEH 1YCPM 2YNAA 1G32B 1LHFH 1Z1JA 2TGPZ 3VGCC 1AVXA 4NG9H 3SUDA 1GHAF 2TGTA 2ZFSA 1QGFA 3PLBA 1PPCE 5EOKA 3VB5A 2ZPSA 4ASHA 1DUAA 1QB1A 1GVKB 2ZDAH 1C5NH 2GD4B 1TMTH 3MNSA 5A0BA 1ELDE 1MTNB 1BBRE 2ZI2H 1KIGH 2JJ1D 2ZGHA 2A5KA 1QJ6B 1HPGA 1C5QA 4WMDA 3M61U 3P8OA 1WXRA 4LZ1H 1C1VH 2ZHQH 1C5SA 2Z94A 1O3FA 1ANDA 1C1NA 1AI8H 1BB0B 1BTZA 1AE5A 3MNXA 3RXIA 3OFND 3V13A 4GCHF 4FUDA 1AB9B 3MNCA 4FUHA 1OWIA 3TH3H 3TJOA 2ZU3A 2HNTC 1WU1A 1FY8E 1A5IA 4I8JA 2GDDA 1LPGB 1ZGVA 3GCTG 2SGQE 5A0CA 4B2AA 1NN6A 1O3GA 3E90B 3F2FA 1W8BH 3DFLA 3U28C 5EJ1A 1ZLRA 1FN6A 2R3YA 3A7VA 2Z3CA 1SPJA 4I33A 2NWNA 2GGVB 4AB8A 6LPRA 1FNIA 3PO1B 5FCKA 3U8OH 2VNTA 1QB9A 3A86A 2ZDVH 4BAQB 2ODYB 1CA8B 1NS3A 4FOUC 4Y8XA 4B76A 3ZZ7A 3BTTE 1V3XA 3QGJA 3Q3XA 3RLWH 1T8NA 4TT3D 1DWBH 4X2VA 4F4OC 2HALA 5CHBA 3UNQA 1G37A 3F1SB 3BTME 5L6NH 2BXUH 2C8YB 1QB6A 1GBTA 1C2JA 1LVMA 4BTUB 5K7RA 3U8RH 5EG4A 1EUFA 2AH4X 2Z9IA 1CGIE 1L1GA 1K1IA 1AUTC 1K1MA 4I86A 2QY0B 1OP2A 1ZMJA 4Q80A 1LTOA 2HWLB 5L2YH 4X2XA 1GBMA 1Z8RA 5JYIA 3H7OA 2LNCA 4HGCA 2R3UA 2ZFQH 8GCHF 4ISOA 1ELAA 1XUHA 5A0AE 2K0QA 4X8TH 4ABFA 2CF8H 1XX9A 1HAXB 5HMAA 1C9PA 4YLQH 1Y8TA 3A83A 1GI2A 4Y6DA 2P8OB 3RXLA 1ZZZA 4JZIA 1BJVA 1NFWA 4D9RA 2ZU5A 5DP8A 4ACAA 3KYFA 1FPHH 2P59A 1YWUA 5JB8S 1TONA 1LQEA 4A6LA 1O2MA 1FX0B 1TLDA 2AIPA 2P3UB 2J94A 4KELA 1UTOA 1F7ZA 1BMFD 5FBIA 1TBQH 1K1JA 1WTHD 1HXEH 1THSH 4BAOB 4KKDA 1MBMA 1O2IA 2O8MA 2KCAA 1C1SA 4X6NA 4Y8ZA 1SOTA 4NZQA 4D7GA 3BTHE 3SU6A 3T29A 2OQ5A 3MU1A 3M5LA 5CHAC 1F0TA 3RXFA 1W2KH 2KZ4A 4RN6A 1VCQA 1SC8U 1LVOA 1GI9B 5H4IB 1EPTA 5DPAA 2WYGA 1TNIA 1SG8B 4R0IA 3L6PA 4BOHA 3P8GA 1O2SA 4AN7A 1KY9A 4FXGH 1MKXK 1ETSH 1DY8A 1XUGA 4ABHA 2FOAA 2FYQA 5CDFE 1C2GA 5E2OA 2BY8X 4NWKA 1MCVA 1LKAA 1ZTLA 3ZZCA 1HAYB 1QHRB 3ODFA 1CHGA 1AFQB 1VKYA 1PFXC 1SQRA 3LONA 2A2QH 2ZFTA 4NA8A 4XRNA 3GY7A 2FOEA 1ZGIA 3KIDU 3BTDE 1P2JA 4Z6AH 1UMAH 3DHKH 3RU4D 4YLUA 1RIWB 1HYLA 2K8IA 1C5VA 4ISHH 2ANWA 1NRQH 2JETB 2XWAA 1CBWC 1GVZA 1E1RD 3A7TA 3UWIA 3FP6E 5JBCS 2SGPE 2XCFA 2PFEA 3ZZAA 4UD9H 2A7HA 3RXCA 2OBQA 5DP5A 1QJ7B 1C1RA 1O2QA 1VZQH 2Z9JA 1SLXB 4HI3A 3OY6U 4FUBA 4XDEA 2W3KA 1C5XB 2BDYA 4B71A 2KAIB 3RXMA 2RCEA 1MU6B 4FETA 3TNTA 4O3TA 2FTLE 3E0PB 5GXPA 1VGCC 2TPIZ 2NU2E 5T1VA 4K1TA 1C2DA 2HPPH 4OS4A 1GHZA 2OC1A 1P11E 1GMCG 3M3TA 1QRXA 3ATIA 3QK1A 3C1KA 4HFPB 1CU1A 3T27A 2Q1JA 1A5HA 1EZSC 1FY5A 2W5EA 2KM0A 4CHAB 1SGFA 2UUJB 7GCHG 3CS7A 2BX3A 1J16A 1MZDA 1O3KA 2XBWA 2QF5A 3LGYA 1W13U 1BRUP 5LPFA 3VB6A 1K28D 4WH8A 1GCTB 1O3JA 1HIAA 5GIBA 2BLWA 2KCPA 3UNSA 5LPEA 1AZ8A 5FPSA 5A8ZA 2A4RA 1ESTA 4UFFH 3A8CA 3GYLB 4WVPE 1YPJH 2CXVA 4U01A 4XSKU 3NCLA 1FY3A 5EJLA 2HLDD 1E38B 2GT8A 3SZNA 1G3CA 1QZ8A 1ELFA 2ZHFH 1SGTA 3SU5A 4MPVA 1OP0A 3KQ5A 2FI4E 4IW4E 4F48B 2PKAB 2Y80A 2V6NA 1J14A 4FUCA 1EKBB 5DG6A 2QCYA 1TX7A 3BEUA 2ZGJA 1UVSH 2Y5GA 4XE4A 5FXLA 2EC9H 2EA3A 1S6LA 3S9BA 1V2QT 1NTPA 4Q7ZA 1C1TA 3TITA 4RSPA 3V3MA 3ODDA 3TGKE 5F8ZA 5EW2H 4U30A 5T6FA 1Y3VA 2R9PA 4UE7H 4YZUA 1DWEH 2ZDKA 1BTYA 2FM2A 2J5UA 1O3EA 2XC0A 1HAHH 2V35A 2WV5A 2BDGA 2BOKA 1TRNA 1HUTH 4K69A 1SQTA 1FY4A 1H8ED 1GJ6A 5C3NA 4JZDH 1EASA 1VITG 2FZZA 2AMPA 2C8ZB 4R8TB 5E8EH 5SGAE 2PKAA 1QRWA 1C4Y2 2WSSD 4ABAA 1TQ0B 2J95A 1SGFG 1DX5M 1O5EH 1QFKH 1ZHMA 3SNAA 4ABJA 3BTGE 1A4WH 1GJAB 2Y7XA 4ZKOU 3H09A 4HG6A 5IK2D 4O03A 1BCUH 1PPGE 2IJD1 1J8AA 2OP9A 1V2MT 4RKOB 4ZH8A 4DG4A 2XC4A 2A32A 1A46H 4K60A 1NZQH 7ESTE 3R3GB 1O32A 3ATKA 1E35B 1TMUH 4FU8A 2QIQA 4H6TA 1OS8A 3N99A 3M5OA 2SGEE 3NXPA 4CBNA 3PTNA 3M35A 3A8AA 3P92A 3K6ZA 1GG6C 3M3SA 1P0SH 2GTBA 3RC5A 3TPIZ 1RTFB 5JB9S 1UTQA 2F9PA 2XYAA 4F49A 5EIYA 5L30H 4WXVA 3SYJA 2ODPA 1EJMA 1BA8B 1C1UH 4E7NA 1BQYA 1Y5BT 2FX6A 2P3TB 1YF4A 2NU0E 1E36B 1V2ST 2PGQB 3M7TA 1AKSB 3F3BA 5HYOA 1GBFA 3OSYA 1SHYA 4Q2KA 1OOKB 3SGQE 1ELEE 3RLYH 3LC5A 1P9UA 1JRTA 1IQGA 1P01A 1W0ZU 1F0RA 3SV2H 3LH3A 1SFQB 1L4DA 2FOGA 1GVLA 1BTWA 1O35A 3AAVA 3A85A 4ZHMU 2TGAA 4HZHA 2ULLA 1GGDB 4YTAA 2VIWA 5DP7A 1HJAC 2BVXH 1S0RA 2HLCA 1BMLA 1GI4A 2VVUA 3DSOA 1V6DA 1GJ9B 3ZZ5A 5KECA 3MTYA 1QY6A 5EPNA 3VEQB 4Y0YE 1GHYH 5EGMA 1EJAA 2ANKH 5BPEA 1AN1E 3FP7E 1C1QA 1FY1A 3W95A 3FFGA 4ABEA 1FLEE 2G00A 2C3SA 3DUXH 2BM2A 1CHOG 2PP6A 3MH7A 1TNKA 4TY7A 2CN0H 2FESH 3EE7A 3KEEA 1GI7B 2QF0A 1DICA 1FMGA 3OEED 2W26A 2GJGA 4ZAEA 4Z0KA 1AO5A 1PQ7A 1VCPA 1C5UA 1DWDH 1WAYB 2YMSD 2ZNKH 1BIOA 4YT6H 2VWMA 3F2HA 2P93A 1GJCB 2AFQB 5ESTE 1TE0A 2P95A 3GCOA 1CBWB 1O3OA 1HAOH 3Q3YA 1OHHD 5AVDA 4ASUD 1MMJN 1YM0A 4YM9A 4TYDA 3UOUA 1GMCF 1DY9A 1Z71A 3I77A 3EGKH 1DSUA
chains in the Genus database with same CATH topology
2J34A 3RC6A 4MVNA 1FDPA 5B6OA 3RUOA 7GCHF 1TGBA 1C5OH 1ZPCA 2V3HH 3K9XB 1KDQA 3I29A 3QLPH 3G01A 4I8LA 1TX8A 2FS8A 4K1SA 1K1PA 2AMQA 3VPKA 2A5IA 2PW8H 1VGCB 4JYVH 2ZTZA 1SGEE 2ZTYA 1BZXE 1YPHE 1VJAU 3D49H 1ESAA 2M5TA 4ISNA 1C4V2 4E7RG 1VITH 1K9OE 1F5RA 3ZVDA 1CGJE 1MKWH 2FOCA 3KQCA 5DJ7A 1CT4E 1FPCH 1HAPH 3MO9A 1DPOA 2ZHDA 4QT8C 3A7YA 1EB2A 1Z7KA 1BMMH 5HXFA 4X8SH 5C1UA 4X1PU 3A82A 1NPMA 1GBIA 1UCYH 3NUMA 1KLJH 2FYRA 1DITH 2ANMH 1ZPBA 4AFQA 5AFYH 1GBAA 1YCPK 2STAE 2A4GA 2OCVB 3PLKA 5CMXH 1UK3A 1S0QA 3T2NA 4TWYA 3QTOH 3LGIA 2ZZUH 2PR3A 3RMMH 1KXCA 4Y76A 4AX9H 3RXJA 2RA0A 1NU7B 2IJOB 3JZ2B 1AZZA 1VITF 2FLBH 2P3FH 1V2TT 4IS5A 1QA0A 1XUKA 1SOZA 1T8MA 2A5AA 1ESBA 1BMAA 3RU4T 3IWMA 1G3BA 4GUXA 1FAKH 1GHXH 2ALPA 5TCCA 3F9FA 1E37B 1CO7E 1H9HE 1ZRKA 1TWXB 4O3UA 5C20A 3QDZB 1F0UA 1CQQA 4BANB 4CBOA 1X7AC 4BAMB 3UY9A 1Y5UT 7KMEH 1XVOA 2A0QB 3RXOA 1D3QB 4MPUA 1NC6A 2AS9A 1DVAH 3O8DA 2GCTB 3PMHB 3HATH 2PV9B 2G4UA 2CMYA 4BNRA 3CS0A 2GX4A 3EA9A 4NSYA 2Z3EA 1EATA 1GL0E 4Y7AA 2CHAC 4DW2U 1HAVA 1A0LA 1VCWA 4ESTE 4J2YB 2ZPQA 4X0WU 1FONA 1WUNH 2G4TA 5E0GA 4KGAA 1P09A 4KTUA 1ZJKA 3GCHC 1WSSH 1OSSA 1PPBH 1TGTA 5AHGH 1QQUA 1TOCB 2VGCB 3SGBE 2XBXA 8LPRA 4JZEH 1G3EA 3VXFH 1YKTA 1GHVH 2FTMA 4KP0A 1DUEA 1GHWH 2XRCA 2JH0D 3AVZA 3UNRA 4A7IB 1Q2WA 1O2TA 1SL3A 1LCYA 4I8KA 3SGAE 3UOPA 1F5LA 1XVMA 4Y8YA 3SU4A 4LOYH 4TPYA 1GJ8B 1D3TB 1LPZB 1YPMH 1FN8A 4FU7A 1DOJA 1O2KA 1FAXA 5A09A 3GDSA 1QQ4A 1O0DH 2RG3A 1GBLA 1C5TA 1O3IA 4AORA 3GY6A 2GMTB 5DP3A 1UTMA 2A45B 3RXKA 4K5ZA 3KHVA 1Y3WA 4OS1A 1FIWA 2HNTF 1GJ4H 2V3OH 3O8CA 2PWXA 4NIYA 2BLQA 2BD7A 1AUJA 3EE0B 1BTHH 3A7ZA 1P02A 3KQBA 1FI8A 1TBRH 2G81E 1HDTH 1Y59T 4DGJA 3TGIE 2UWOA 1EOLA 3T62A 1P05A 2SGDE 4YOJA 2O8TA 2PTNA 1OXGA 3PLPA 1EPTB 6GCHG 2BDHA 1H1BA 2F9VA 1EQ9A 1GDNA 2Y5HA 5LH8A 3SORA 5J4SA 1PQAA 4IC6A 1P2KA 4OS2A 1D6RA 1P3CA 3NZIA 1S81A 3FZDA 3KF2A 1HFDA 4VGCC 2TGDA 1QNJA 1ANEA 2BD5A 1TALA 1OWEA 3VFEA 1KTTB 1ZPZA 3MI4A 3RP2A 2TBSA 2HOBA 3RXBA 1Z8JB 1O2OA 2JH5D 5A8YA 4X1SU 5GJ4B 3M5MA 2PKSB 3IITA 1QTFA 3MFJA 4BAHB 2GDEH 1CVWH 2DUCA 3ZVCA 4AG1A 1VJ9U 2CGAA 1OWDA 2XNIA 1A2CH 1F5KU 2WPIS 3H7TA 3UQOA 1MTSA 2A31A 3E6PH 3TGJE 3SUGA 2BVRH 2OC7A 3RXRA 5GCHF 2AYWA 2STBE 1XXDA 1BITA 1WOFA 1G2LA 5DK1A 3UR6A 4OS5A 1YLDA 1GI3A 8ESTE 1TPPA 2H6MA 1T4VH 7LPRA 2Z6BD 1ARBA 3GY2A 3QN7A 1ZJDA 2AGEX 4INLA 3GY3A 1PYTC 1L1NA 4Y11E 3U69H 2A7JA 5FX5A 4ZXYH 4UEHH 1YPHC 3TJVA 5FAHA 1CA0C 1Q3XA 1RXPA 1N8OC 2ZU1A 3RXQA 3SU3A 1EX3A 4I31A 1AWFH 4XBBA 2ZHWH 1ELTA 1TQ7B 1UO6A 1ZTJA 1MTUA 5HM9A 6ESTA 3V0XA 1O38A 2Q6DA 4CRGA 2J38A 3Q00A 3BG4B 4NCYA 1BRAA 3RXPA 3QWCH 1P10A 2GZ8A 3C27B 2OTVA 1TPSA 1W3CA 3RDZA 2W7SA 2OXSA 4XFQA 1F0SA 3IG6B 3LC3A 1MQ5A 4X6MA 1BT7A 1T4UH 1GL1A 1K1NA 4H4FA 1B0EA 2VH6A 1GHBG 3ATMA 3MYWA 2JH6D 2HVXA 1HIAB 5JPMH 1EP6A 1GBKA 1HXFH 2BQWB 4JMYA 4INHA 1V2OT 2PLXA 4SGAE 2VU8E 2GP9B 3LOXA 1L1JA 3ZZ8A 5LPRA 3EDXB 1F2SE 4WF8A 1LHDH 3MMGA 4DT7B 4JK5A 2IPHA 1HJ9A 2ZECA 2G55A 1HNEE 3BSQA 3TIUA 1HLTH 4MQAA 1B0FA 3SV9A 3SO3A 1D3PB 1JIRA 1OKXA 1IQHA 1D6WA 2ZP0H 3D65E 1QIXB 3UWJH 1TRYA 3ATLA 1QR3E 1ZYOA 2C8XB 2P94A 2BY6X 3SU2A 1UTNA 4A92A 2J9NA 1O5AB 1O3DA 1ZSLA 2XCNA 3LJOA 1O36A 1P12E 1IQEA 4FUJA 1QURH 3FP8E 1ANCA 3S9CA 5EW1H 3VGCB 3MU5A 1RS0A 1QL9A 3MU4A 1O5GH 4OS7A 4B74A 4XBDA 4NIXA 4DY7B 1WV7H 2ANYA 3P70B 1BBRH 3GCTF 6CHAC 3QZRA 1HAZB 1SBWA 2FO9A 5F8TA 2OC8A 4DCDA 2BVSH 3R0FA 5EQSA 3A87A 4AYVB 4E06H 3KQDA 1V2RT 3SJKA 1SGPE 3BEFB 1MTWA 1UK2A 2VIOA 2NU4E 5AF9H 5ESBA 1O2GH 3ZZ6A 3SU1A 2VIPA 4MTBA 1ZRBA 5FHTA 4UONA 8KME2 1UJ1A 1W7GH 2GVFA 1PPHE 3W94A 4B2CA 1EZQA 1N6YA 1NFXA 2G52A 3MU8A 1J15A 3ZVFA 5FCRA 1XKAC 4JK6A 5GPIB 4YESB 3NPSA 1NRNH 3RMNH 1SGNE 3B23B 1W11U 4XBCA 5HGGA 1TRMA 2XBVA 3KQEA 2BX4A 1JOUB 3GYMA 1O3BA 1V2JT 2G51A 2VIDA 1P57B 3WY8A 3RXSA 2GZ7A 3BEIB 1RGQA 1C2HA 2PUQH 3LJJA 1LO6A 2OINA 1IHSH 3ZZ4A 4AZ2B 4IN2A 1ZR0A 2D8WA 1XMNB 4I8GA 1KLTA 4I7YH 1MTNC 3GCNA 1D9IA 1KYNA 2OC0A 4NSVA 3T5FH 5IDKA 4H42U 1W12U 2VJ1A 4Y10E 4DURA 2RDLA 4AFSA 1FUJA 2QXHA 1O2HA 1A1RA 1RTKA 1BTXA 5DKMA 1ABJH 1XUFA 1MAYA 4BXSA 1SR5C 4LXBH 3U1IB 3ZVEA 1AB9C 1YC0A 3PMBB 3PWCA 2BZ6H 3ZZ3A 4RKJB 3ZVAA 3BTKE 3FVFB 5TCAA 3ZV8A 2D26C 2F9NA 1C5RA 4AFZA 9ESTA 1O5BB 1T8OA 4KTSA 4JCNA 1Z1IA 1TB6H 3E3TA 3FAOA 2DE9A 3PO1C 1YYY1 4WJG2 4ZKSU 1C5WB 4A1TA 2PUXB 4MNVA 1DE7H 1DXPA 4UFGH 4ZUHA 4GCHG 1O3NA 1OWHA 1SMFE 1DXWA 2Z3DA 3RXAA 3RXUA 2YOLA 2H1UA 4ABDA 2FP7B 1SGYE 1TA6A 2ZHEH 1SGQE 2ZGCA 1NO9H 2GV6A 2WUCA 1JBUH 1WQSA 3SOSA 1O2UA 3EYDA 3KN2A 1GJDB 2BY5X 2AGGX 2O8UA 3E1XB 3OX7U 4ZKRU 3SQEE 3ZYEA 1O2YA 2SNVA 3RU4E 5CHAB 2WPJS 4JZ1A 1AVWA 2VIQA 4ZROA 3S69A 2UUYA 1B5GH 1S82A 1D4PB 5ABWA 2GV7A 3SJOA 1ID5H 1C5YB 1K2I1 3E8LA 2FDAA 3UR9A 1C5ZB 4GVUA 4CR9A 4X1RU 1T32A 3ITIA 4HTCH 1O3PB 1TOMH 1QRZA 1OP8A 1KDQB 1GDQA 4DIIH 1FV9A 3K65B 2H9HA 4K8BA 3DFJA 3STIA 3MH5A 5A2MH 1O3HA 1N8OB 4AB9A 3PMAB 4Y71A 2P8OC 4ABIA 1C2KA 3BTWE 1T7CA 1TNLA 2Y6TA 2CV3A 2PSXA 1KXBA 1O5DH 1QCPA 1G2MA 3DT0H 2A4OA 4ISLA 2XWBI 4WWYA 1SHHB 2H9EH 2ZA5A 3GY5A 3JZ1B 2ZDMA 1FQ3A 1DFPA 2C4FH 4CR5A 1O2PA 2VB0A 1LPKB 4Q7XA 1AQ7A 2J92A 1JRSA 3A7XA 4OS6A 2A4QA 2THFB 5DP6A 2QF3A 2QN5T 1AFEH 2ZDNA 4I8HA 3K6YA 1UTLM 4K8YA 1FIZA 1P06A 1TYNA 1L2EA 4INKA 1O34A 1O2JA 2Q6FA 2BDAA 1P2MA 2ZFFH 4MPXA 3Q76A 3AAUA 2RA3A 2BDCA 1FZZA 1P2QA 4X8UH 4U32A 1O2NA 1ZHRA 1NY22 5EQRA 2QXGA 2F3CE 1V2WT 2Z7FE 3L3TA 1AFQC 1DDJA 1ZMLA 3F9GA 3UPEA 4GLYA 4CRBA 2GCHG 2SFAA 1GJ7B 3E91A 3H5CB 4DJZB 4Y0ZE 2VWLA 2C90B 5EXNA 2AIQA 2ZFPH 2OUAA 2ALVA 1RIWC 4NFEA 1CGHA 2QAAA 4BTTB 3STJA 4NGAH 1GBHA 2XW9A 2FMJA 1HAIH 2GZ9A 2R0KA 1UHBB 1XUJA 2SNWA 1PPEE 4MNWA 2Q6GA 3TJNA 2PHBA 3M7QA 2ZWLH 5T3HA 1HRTH 1JWTA 1YPEH 4X1NU 3SNEA 1H8IH 5EPYA 1J9CH 4TY6A 5FPTA 4D7FA 2FI5E 3BIUH 1O2VA 1O2LA 1TNHA 2Y82A 3E0NB 3PMJA 1UTPA 2CF9H 1ANBA 5FX6A 4B73A 1V2UT 5CE1A 1O3MA 4K3JA 3RXVA 3AW0A 5EU8A 3LGTA 3MNBA 1JMOH 4ZKNU 1TMBH 1HAVB 1NRPH 2ZQ1A 1FJSA 3MHWU 4DIHH 1CT2E 1BOQA 1L4ZA 3MO3A 3Q3KA 3PYHA 2B7DH 2NU3E 5AFZH 4CHAC 3SUEA 1UHBA 3VB4A 1Y3XA 3F9HA 3SNDA 2AGIX 2XTTB 3SN8A 2I6SA 1UTJA 2BHGA 1UVPA 2BY7X 3F9EA 2SGAA 2K1QA 4M7GA 1AIXH 3O8BA 1GCTC 2AMDA 1S6HA 1EAUA 2I6QA 3DA9B 2FXRA 5GDSH 3PROA 1EB1H 3AW1A 4GHQA 3ZZDA 3LU9B 4B2BA 1CE5A 2FOHA 1SSXA 2QGRA 2BTCE 4WMEA 3LKWA 3TK9A 1BJUA 2GT7A 5E0HA 1C2MA 3S9AA 3V7TA 5TJXA 3A80A 1IQLA 2ZQ2A 2ZU4A 1UK4A 2G5VA 1DSTA 4UFDH 1XXFA 1YBWA 1HB0B 3ZVGA 1J17T 3HGPA 1S84A 3RM2H 1C5MD 2OBOA 1A7SA 4D76A 3UFAA 2ASUB 3F6UH 3RXHA 3VB7A 3K2UA 5E0JA 5DP4A 1CT0E 1TGCA 1EAXA 1BHXF 1ELCA 2F9OA 1ETTH 1MU8B 2DE8A 1JIMA 1MUEB 3GICB 1MKWK 2FI3E 1GG6B 3SHAH 3UUZA 1P2NA 3QO6A 2SGFE 3NK8A 4AG2A 3SQHE 5T6DA 2PSYA 2Y5FA 3PB1E 2F9UA 2D1JA 3I78A 3NKKA 3PWBA 4AYYB 1MKXH 1P2IA 1GI5A 1S83A 2D2DA 4MNXA 2ZCKP 4E05H 3URDA 4CH2B 1UCYK 1O3CA 2BLVA 3EA8A 2WYJA 1GI8B 1MBQA 2ZU2A 4IMZA 1LQDB 1BTUA 4MLFB 1NU9A 2LPRA 5JBAS 2FOMB 1IQIA 3SI3H 5ETXA 2R2MB 1UTKA 2BD2A 3M36A 1WQVH 3O8RA 3TK6A 2EEKA 1AU8A 4K2YA 1KXFA 1W7XH 1SQAA 3VB3A 3P8NA 4FUGA 2IN2A 1A0HB 1JXPA 1TIOA 1EZUC 1IQKA 1CHOF 1HV7A 3TVJB 1YLCA 1NFYA 4SGBE 1HJAB 3SV6A 3EQ0H 2BQ7B 3OY5U 4NIVA 1QBNA 1EAWA 5F6MA 2WINI 3FANA 1YPGH 2BDBA 1ZOMA 4FUEA 5DGJA 1EP5A 3BN9A 3UIRA 1EXFA 3SJ9A 1GWAA 2BY9X 1SGCA 4NFFA 3B8JA 5C1XA 1KXAA 1IOEA 5EQQA 1ZHPA 1SQOA 1LHCH 1DANH 3GDVA 1M9UA 3HPTB 4YT7H 1HAGE 1QJ1B 3MU0A 1ACBE 3TH2H 1XUIA 3A8DA 2VIVA 5BRRE 3UQVA 2HPQH 2BD8A 4CRCA 3HK3B 3M37A 1P9SA 5C67A 1DM4B 2J2UA 1SI5H 1SLUB 3P17H 1OPHB 2FOBA 1P2OA 3OYPA 4WMFA 2WV4A 2ZEBA 1PPZA 2BD4A 2Y7ZA 1QL7A 3RXEA 2BB4A 1UVTH 2W7UA 1GJBB 2ZTXA 1A3BH 1D3DB 3HKIB 1GMDG 3CENA 1RJXB 1H4WA 1GGDC 4ISIH 1CSOE 1YPLH 1AWHB 2F83A 1NROH 2ZG0H 2ZIQH 4CREA 4D8NA 1RD3B 4I32A 2ZC9H 2GCHF 2H2ZA 3KCGH 2FIRH 1TNJA 1H8DH 1EZXC 1O31A 1PQ5A 1K21H 2CJIA 2QA9E 3B9FH 1BMNH 4K1EA 4X2WA 4X6PA 4AFUA 2XXLA 3A89A 4FVBA 1O30A 1C2LA 3RXDA 1SFIA 1UVOA 4O97A 1TFXA 1G9IE 3HGNA 4BAKB 1C1OA 4U2WA 1P3EA 4AGKA 2FWWA