3P8FA

Crystal structure of mt-sp1 in complex with sfti-1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ST14 protein
publication title Structure of catalytic domain of Matriptase in complex with Sunflower trypsin inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA01
3Q3XA 1L2EA 3LGYA 1NESE 1UVPA 3NK8A 3VPKA 1YPKH 1SI5H 1F0RA 8KME2 3PO1B 1UHBA 3QO6A 4I7YH 2FIRH 3NCLA 2A2QH 1T7CA 1S6FA 9ESTA 3LC3A 2FOFA 1VJ9U 1SLUB 1UCYE 1TOMH 2BVSH 2UWOA 2ZDKA 3A7YA 1QL9A 1GDUA 1GHVH 5C1XA 4PROA 1QQUA 3I77A 4ZHAA 4Q80A 1GHBG 3RLYH 1TPOA 1MQ6A 1C1NA 4ISHH 5GPIB 4ZHLU 3SV6A 2Y81A 1BB0B 2AIQA 1RXPA 1GBBA 2TGPZ 4JK6A 1YLCA 3P6ZB 3B23B 5FPSA 1GJDB 1N1LA 3RDZA 3SU4A 4VGCC 1FN6A 2Y5FA 3MNBA 5A8YA 1HIAA 1DM4B 1C1SA 3UUZA 4UDWH 3RU4E 1P9UA 3TLOA 1GI0A 2O8WA 1P01A 2GT7A 2AH4X 2AGIX 4CHAB 3SV7A 2SGPE 1P2KA 3UWIA 2H1UA 2GMTC 3PO1C 4GLYA 4U30A 3ZVBA 1ZMJA 4O97A 5ESBA 1BMMH 3PTNA 1HAXB 2F9VA 1WOFA 3LIWA 1SMFE 2OC0A 3UTUH 4X6OA 1O2JA 2JH0D 4KP0A 2ZZUH 4M7GA 2ZU1A 1DWDH 2PKAB 1RFNA 1F5LA 2VINA 1CT4E 3BV9B 1LHGH 1HAHH 5DKMA 2FXRA 1V2TT 4UFEH 3RMNH 1JMOH 1GVKB 2BLWA 5DP3A 4KTUA 3GOVB 1EAXA 4DJZB 4Y7BA 1Z8JB 3Q77A 1V2LT 4ISOA 1A3EH 3IG6B 1SGQE 1PPZA 1X7AC 3UOUA 3VXFH 1W11U 4B76A 3PWBA 1SGFG 1Y5UT 1A0HB 2B7DH 2UUJB 2WPLS 3K6ZA 4A1XA 1RD3B 1Z7KA 1QCPA 2TBSA 5TCAA 1AN1E 1YPHC 4CHAC 1K1JA 3URCA 3ATMA 1P05A 3M7QA 3N7OA 3SI3H 4X8TH 5FCKA 2FS8A 3TGIE 4GCHF 1GDQA 4FUHA 4O03A 5F8TA 1ELTA 3MH7A 2VIPA 2WV4A 3QK1A 1VITF 3AAVA 1ZTKA 1C1OA 2ZPSA 1QRWA 1DX5M 1GBLA 1MD8A 2Q6DA 2YNBA 2D26C 1ESTA 1NM6A 1G30B 1QRZA 1UTKA 2M5TA 2ZDVH 4GVUA 4XBBA 4AB9A 1V2ST 4OGXA 1QJ6B 4UFGH 1QJ7B 1YGCH 2A7HA 1FPCH 3E8LA 1UCYH 1TNJA 3LGUA 5TJXA 4JZDH 3A87A 4RN6A 1XUHA 2H2ZA 1F0SA 4DG4A 3GCNA 1RIWB 4X2WA 5K7RA 3FP7E 1O5CB 2BZAA 4CRDA 1P3CA 1CGIE 1O3PB 1V2MT 1HRTH 5C1YA 1GI8B 1DE7H 3A7VA 5DP4A 1C2JA 1EP6A 1GI9B 1UTMA 1C2DA 4BAOB 2SGFE 1GBFA 3STJA 4A7IB 3FFGA 1HB0B 1DOJA 3EGKH 2Q6GA 1Y3WA 1AWHB 1EAWA 3KCGH 5SGAE 3LH3A 3MO9A 5J4SA 1CT2E 2GZ9A 3EAJA 3RXCA 2A2XH 1F5RA 1JXPA 1FUJA 3D62A 2XBYA 3JZ1B 1O3JA 5C5OA 4MG3A 2O8UA 3QX5H 3GICB 1KDQB 1GHWH 2RDLA 3KQCA 1GJBB 2WYGA 2F9UA 1HAVB 1A7SA 1O3IA 1AI8H 4WMDA 2FOBA 3I29A 1RIWC 2G4TA 1XVOA 3A7WA 2VWNA 3MO6A 3V7TA 4CRAA 4A1VA 4X1PU 1D3PB 3S0NA 4YLUA 2ZCKP 1KLIH 3QDZB 1ZHPA 3TVJB 3D65E 2J34A 2ODYB 1P2MA 2OLGA 3UNRA 1YCPK 4U32A 4X8VH 1ELBA 1D3QB 1DS2E 4AOQA 5PTPA 1ABJH 2NU0E 1O2WA 1O3MA 3TH2H 1TGBA 2D2DA 4TYDA 1W0ZU 2BVRH 1V2NT 4YT6H 3LDXH 8ESTE 4AFUA 1WQVH 2HRVA 3SBKA 2HVXA 1O31A 2PSYA 1EB1H 2C90B 4H4FA 3RMMH 1EJAA 5FAHA 1A4WH 1SGDE 2FESH 3MH4A 3DD2H 4H6SB 4NSVA 1BTWA 2PWXA 4NA7A 1O2HA 1BOQA 5DO4H 1J15A 3RC6A 1ELAA 5A0AE 1GCTC 4NIXA 1XKBC 3EQ0H 1WBGB 3QUMP 3T25A 4UFFH 4X6PA 1C1QA 2GX4A 3LGVA 1E36B 1A0LA 1XX9A 1GHZA 2WPKS 1A46H 4WVPE 5ETXA 1MD7A 2NU2E 2R9PA 2O9QA 1XUGA 4XSKU 3TGKE 2A45B 4U2WA 1HFDA 3ZZ5A 3BTME 3VB3A 2VNTA 1OKXA 1OOKB 1ZRBA 2B8OH 3PLPA 3RU4T 1O2IA 2FOMB 4OS7A 1QBOA 1P3EA 1G3EA 1JBUH 3M37A 1S81A 1BJVA 2ZU5A 4R0IA 4I8GA 2AEIH 4D9QA 4FVBA 3SJOA 1G36A 1RRKA 1O2GH 1CE5A 2BZ6H 3M3SA 1B0FA 1C5TA 1LVOA 1TNLA 3LGWA 2Y80A 1TA6A 3PWCA 3MH6A 2CF8H 1CT0E 3UQVA 1O2TA 2BY6X 3MOCA 2H5CA 4FXGH 1P2OA 2AERH 1KYNA 1INCA 1EPTB 1SG8B 2A32A 2ZDAH 4AGJA 3U8RH 3P70B 4ZHMU 1BRCE 2SFAA 1K1PA 4Q7ZA 4ZUHA 5I25A 1RJXB 3LJJA 2BDGA 2JH5D 4HGCA 1TBZH 2C8YB 3OYPA 3EA9A 5JBBS 2P3TB 1O37A 2WPIS 4WMFA 2WV5A 3ATKA 2D1JA 3SV9A 5EPYA 1FY4A 1FMGA 5EXNA 1E37B 1ANDA 1SLXB 3VGCC 1CHOF 1DUAA 1N6XA 2A4RA 1L1GA 3PTBA 4KTCA 2TPIZ 4ABBA 1EAIA 1E35B 1ELEE 1P2IA 4B1TA 4F49A 4DY7B 1S0RA 1YC0A 1UHBB 1V2JT 1KXEA 4ZKNU 3QZQA 5E0GA 4B71A 1GBIA 4CRBA 1NROH 1UTLM 1ZYOA 2IJOB 3ESTA 3RM2H 1SGRE 2PHBA 1UVSH 1DSTA 1ELCA 1AZ8A 3DT0H 4FUIA 1O0DH 5HYOA 2ZHWH 4R8TB 1ELGA 1EPTC 2A7CA 1PFXC 1DPOA 3PB1E 2Y6TA 1ACBE 2DE8A 4BTUB 1ABIH 2VWOA 4BAKB 1PPGE 1UTQA 2ZPRA 4X6MA 1A3BH 1W0YH 1SPJA 2AMPA 4NWLA 2ZF0H 2ZTYA 1YPJH 1BRAA 1YLDA 4FUFA 4FU9A 1HIAB 1BA8B 4GCHG 1EQ9A 1JIRA 2BY9X 1UVTH 1VITG 1O3LA 2SNWA 4XOJA 1KDQA 4I8LA 1IQKA 3B8JA 3TPIZ 3F68H 1BT7A 4RSPA 4D76A 1TMBH 5L6NH 1JOUB 1LPZB 1PQAA 1NTPA 1FY1A 5GIBA 1NN6A 1F0UA 3A89A 4I8KA 1ZTJA 4Q7XA 3RXSA 1ELDE 1FY8E 3RXUA 3SU2A 2BLOA 1GHYH 2P3FH 2BQ6B 4AG1A 2AYWA 2OINA 2BY5X 2VU8E 2VB0A 2ULLA 1C5ZB 3ZV8A 4B2CA 2THFB 2VH6A 1TPPA 1ZPCA 1TMTH 3MI4A 3P8OA 4Y10E 1HJ8A 3SZNA 2P3UB 3K65B 2GV7A 1PPBH 1C2EA 1DVAH 3AW1A 1ANBA 1KLTA 1V2UT 2BXUH 1T4VH 1YBWA 1BIOA 2C8ZB 2CF9H 5A0BA 2QV1A 4YO9A 3G01A 2G8TA 5GWZA 5JBAS 1P06A 1Y3YA 4IS5A 1TRNA 2K1QA 3DHKH 4D8NA 1A2CH 3M3TA 4O3TA 3EA7A 1A5HA 1Y59T 1Z8RA 1NO9H 2BD5A 1O2XA 1GJCB 4E7RG 5AFZH 3RC4A 1FIWA 1XXFA 5GXPA 3OX7U 5EQRA 1TWXB 3S7KB 2RCEA 3BEUA 1FDPA 4HI3A 3SQHE 2WPJS 1FZZA 2OC7A 3MO3A 2A0QB 4XBDA 1P57B 1OS8A 1TQ0B 2Y82A 2O8TA 3RXQA 4B2AA 2Q6FA 1D3TB 1SGPE 1ZHMA 5A2MH 5EW2H 2HNTE 5FBIA 2SNVA 1DY8A 1ELVA 4NA9H 2BOKA 1GI2A 3NPSA 4I8JA 1UVUH 1SR5C 2BXTH 4LK4A 4Q2KA 4RKOB 3MWIU 1AZZA 3DUXH 4FUEA 4GPGA 2FEQH 1NFXA 2F9NA 1EX3A 3SHCH 4OS6A 5CMXH 2BX4A 1LKAA 1O3CA 2J2UA 1TAWA 4X1QU 3O8RA 1C5SA 1BTUA 4WJG2 3GY2A 5LPRA 2FI3E 2ODQA 3R3GB 1KXCA 4D7FA 1TALA 5T3HA 3AAUA 1FQ3A 2OQ5A 2ZHFH 1TNKA 1DICA 1TBRH 3T26A 1EOJA 3GY3A 3RMOH 2STAE 4D9RA 1MBQA 1NU7B 1AO5A 1BZXE 1G2MA 1L4ZA 5EU8A 1FY5A 2O8LA 2VVUA 4CRCA 3SGQE 1ZHRA 2P8OB 1OYTH 2QA9E 3PLKA 2AGGX 4CR9A 2QXJA 1F0TA 3TITA 1MUEB 1VGCB 1K1NA 1GMCF 2GGVB 4AFZA 2ZFPH 1T31A 1H1BA 2AIPA 1GBAA 3V12A 3F9FA 1O2YA 2G51A 1UTOA 1AVGH 1XUJA 1ZJDA 3S9CA 1WUNH 2GMTB 1P10A 1CGJE 2UWLA 3V13A 5EXLA 3BTHE 1ZSLA 1O3KA 2B0FA 2CGAA 2V3OH 1PYTC 4E05H 1D3DB 3TK5A 2FTLE 1V6DA 1SB1H 3OTJE 2OC1A 3A83A 2GV6A 4K60A 3SV2H 3LGIA 1QNJA 1DANH 2V6NA 1K22H 3K2UA 4Y8XA 3A81A 3TJOA 4JZIA 1E34B 2GDEH 4UONA 2P8OC 1LQDB 5C2ZA 4ZKRU 1AD8H 2RA3A 2ZC9H 2H6MA 1MCTA 2D8WA 2QN5T 4NZLA 1C9TA 2VJ1A 1VGCC 4E06H 1IHTH 2P94A 5LPFA 3CS7A 1Y3XA 1C2IA 1DITH 2FLBH 1FJSA 1N8OC 3SU1A 1EZXC 7LPRA 1WAYB 3KEEA 1BTPA 2TGDA 4X8UH 2J9NA 4X1RU 7GCHF 1AUTC 1SOTA 1IQHA 4K1EA 1ZLRA 1CHOG 1RS0A 3RXFA 4WY3A 4K69A 1NC6A 5EG4A 1BRBE 2HGTH 4WXIA 4IN2A 2VH0A 1QR3E 1W8BH 1D4PB 1PQ7A 2CN0H 1S83A 3KGPA 4ZKSU 3IWMA 1HJ9A 4Y8YA 4AFQA 1ZJKA 1AIXH 4ZROA 1GBHA 3UWJH 2CV3A 1WCZA 1GI5A 5LPEA 3KQEA 3SJKA 4UEHH 2Z9KA 3SU0A 3A8DA 1W13U 2HOBA 1O3BA 3I78A 4FUJA 1HPGA 1O30A 3BTDE 1WQSA 4GSOA 3A8CA 1MMJN 1D6WA 1K1IA 3M7TA 4B73A 4ABAA 3BTWE 1L4DA 1LO6A 1L1JA 2ZGJA 3LOXA 4AYVB 3P95A 3ZVFA 3P8FA 3KL6A 1F92A 1GJ6A 2ZTZA 1CVWH 1H9LB 4JZ1A 3ELAH 5E0JA 4BAMB 3BF6H 2ZO3H 2BQWB 5AVDA 1FPHH 1G32B 1GWAA 1P8VC 1GG6B 1GL0E 1NS3A 3NWUA 3SJ8A 4AORA 5L2ZH 1SGIB 2ILNA 2G5NA 3DA9B 3Q3YA 4IMQA 3TH4H 1K9OE 5FBEA 3PMHB 2BDBA 1CBWB 4FUCA 2W5EA 2ZDNA 1QB9A 1UTJA 2FM2A 2A5IA 1DWBH 8GCHF 2TRMA 1C9PA 2A5AA 1BJUA 2FS9A 4X6NA 3TGJE 4Q7YA 3RXPA 2UUYA 5TCCA 2ESTE 1EOLA 1EJMA 1O5FH 1OX1A 1NFYA 1NPMA 4AB8A 4DIIH 2FOHA 1TONA 1ZRKA 1NRRH 4OGYA 1DWCH 2BX3A 3V3MA 1V2WT 1P09A 3BN9A 5E2PA 2R0LA 1G3CA 1NRNH 2NU1E 3KHVA 3S7HB 2Q1JA 2XWBI 5DP8A 1O38A 3UPEA 3NUMA 2LNCA 1FONA 1TFXA 3C1KA 1VZQH 1GDNA 1C1MA 7KMEH 4WH6A 3FVFB 1EB2A 1EZUC 3HK6B 1ELFA 1WV7H 1GG6C 1TYNA 1MH0A 2Z3CA 1CBWC 1DXWA 1BITA 3UNSA 3QLPH 4KGAA 4K5ZA 1V2RT 2WPMS 4XBCA 5I46H 3QGNB 1Z8GA 2Z94A 2B5TB 3EE0B 3M7UA 1TB6H 3LGTA 2Y7ZA 3U8TH 2F9BH 2ANKH 1BTYA 3QZRA 2CXVA 4B75A 3M61U 4K1TA 1MZAA 1AFQB 1G3BA 1HCGA 1GCTB 3ATLA 2GCTC 1BTXA 3SO3A 1ZPZA 3RLWH 5HM9A 1Z8IB 1QJ1B 2Z9JA 1O2QA 2VIVA 2QGRA 1OSSA 3S9AA 1F5KU 1MTNC 4BTTB 3U1IB 5JBCS 2FOCA 3OU0A 1LHEH 3CP7A 2FTMA 3NXPA 4MLFB 3K9XB 1FNIA 1W14U 2XC0A 3EDXB 2OXSA 4BNRA 2WYJA 3V0XA 4HTCH 1LHDH 4NGAH 1UTNA 1MTUA 1KXDA 1O2NA 1YPLH 3P17H 1JIMA 1HGTH 3BTQE 2BDYA 4KTSA 5DGJA 5HGGA 3KF2A 3ODDA 2ZQ2A 5JB9S 4Y76A 1O3FA 1DDJA 1O5BB 3OSYA 1HBTH 1SC8U 4BXWA 3EA8A 3A85A 2JETB 2A1DB 1ZSJA 1DWEH 1BMNH 4AYYB 1LVYA 4Y11E 3SJ9A 1O3OA 1P9SA 5F8ZA 3UQOA 2FOEA 2J94A 5EQQA 3F9HA 1NRSH 1AFQC 4O9VA 2A4OA 2WUBA 1FLEE 2RA0A 4GUXA 4YTAA 1S0QA 2FOAA 1W7GH 3U8OH 1ID5H 1O39A 2GP9B 1GMCG 1GMDF 4MNYA 1BQYA 1FN8A 3GCHB 3SNEA 2NWNA 2PKSB 4FUBA 2PSXA 4SGBE 1FY3A 1O5DH 3GY6A 1GI3A 1C2GA 1IAUA 3VGCB 4YM9A 1QHRB 3M5OA 1ZMNA 3MU8A 4IMZA 4X8SH 1IQLA 2AFQB 1L1NA 1GI7B 1J17T 1T8OA 2ZGHA 1KTTB 1HXEH 2ZP0H 2BD8A 4GHQA 1IQJA 1QQ4A 3H7TA 1EKBB 3C27B 2JETC 3ZVCA 1VCQA 4NCYA 1VR1H 3VXEH 3TJVA 3RXOA 3L3TA 4X2VA 1ZPBA 2BTCE 2C4FH 4ZMAH 1A0JA 2B9LA 4F4OC 2PTCE 2AGEX 4Y79A 1AU8A 2GD4B 1K1LA 4TY6A 1HYLA 1TE0A 3NKKA 5B6OA 3BTTE 1KXBA 1TQ7B 4ISLA 1CQQA 4ABEA 1IQFA 1BTHH 2EC9H 1YP9A 2J4IA 3ZV9A 2UUFB 2BY8X 1MTWA 5C1UA 1OYQA 1O3HA 2XCNA 1NRPH 1DLEA 3U9AH 5LH8A 1KIGH 4UFDH 2QF0A 1GMHF 5FCRA 3GCHC 4JZEH 2A4GA 1LDTT 2G81E 1J8AA 3U98H 4MPXA 3SQEE 4ABHA 2PKSC 4JK5A 3RUOA 2XBXA 3T5FH 1C4Y2 2CHAB 1O3AA 2LPRA 3TNTA 2UWPA 7GCHG 3SGBE 2QC2A 3RC5A 4FU7A 4ABIA 4LZ1H 4MVNA 4ISNA 1ZR0A 3F9GA 3GISB 1C4V2 2OD3B 2HALA 3BG4B 2R3YA 3RXGA 1OP2A 3A7ZA 2P93A 3AW0A 1XKAC 1W3CA 4X2XA 4XDEA 4TWYA 3BTFE 4A5TS 3HGPA 1HNEE 3IITA 4SGAE 2ZECA 3T62A 2A7JA 2XBWA 2YOLA 4ABJA 4K3JA 4Z6AH 2STBE 1FAXA 5A0CA 1FI8A 3UY9A 2ZPQA 3T29A 2Y5GA 3TH3H 1AVXA 1H9IE 1O2OA 3SNAA 3URDA 1QB1A 1O2LA 2XBVA 1IHSH 1MAXA 1OWHA 3RXLA 3U69H 1O2SA 3A82A 2ZQ1A 2AMQA 5HM2A 3KIDU 3E90B 2FODA 1HAPH 2SGEE 1WTHD 1C5YB 1GJ9B 5EW1H 2CHAC 2PV9B 2V3HH 2BM2A 1EJNA 1NFUA 3FP6E 4THNH 4MNWA 1T4UH 3JZ2B 3RXKA 1QA0A 2QXHA 8GCHG 1GVZA 1KXFA 1AGJA 4Y0ZE 2XC4A 1GI1A 3BG4C 3KNXA 1Z1JA 4NFEA 3SORA 4OS2A 1XUIA 1BCUH 2IN2A 1GJ8B 1B5GH 3MU1A 3BTEE 2ZHEH 3GCOA 1AMHA 2EI8A 1TA2A 1QGFA 2XWAA 1Q3XA 1GBTA 3FP8E 2F9OA 3GY4A 3O8BA 4U01A 1O5GH 1C2FA 1W2KH 4AFSA 1VITH 4MNXA 1WYKA 2FX4A 2QYIA 1LVBA 1C5RA 6LPRA 2VIDA 1HAIH 1GJ5H 1HAOH 1GI6A 1C1PA 2BDHA 3FANA 5F03A 2VIQA 1FXYA 1EZSC 3LONA 3ZVEA 1AHTH 1UK3A 1S85A 1THPB 2SGDE 2QY0B 3SUGA 3E3TA 5C67A 1RTKA 3UNQA 4MPWA 1HXFH 3GDVA 1DSUA 1AB9B 4FVDA 2AS9A 2BVXH 4HZHA 3M35A 4FUDA 1ANEA 1TIOA 2H5DA 1BMLA 3SV8A 4DW2U 1J14A 4DVAU 1AWFH 2XNIA 3QGJA 2P16A 3MNSA 1S84A 1C1VH 3ZVDA 1UVOA 1GI4A 2BDIA 3UR6A 1ETSH 1JWTA 3BTKE 1WSSH 4MDSA 1KXAA 2C3SA 2ZTXA 1O32A 4WMEA 5A8ZA 4FUGA 2H9TH 1QTFA 3ZZBA 1F2SE 1UK2A 1AFEH 1C5UA 3SU6A 1C5LH 2UUKB 1VCWA 4BANB 3BIVH 4ZKOU 1QBVH 5JYIA 2WUCA 2I6QA 3HK3B 5FXLA 2G52A 1K2I1 1G37A 1HJAC 3AASA 3HPTB 3QWCH 5E8EH 3SU5A 2Z9LA 1SGYE 5HMAA 5AF9H 1TRMA 4CH2B 4IN1A 1SGTA 3BEIB 3TK9A 4IW4E 4AZ2B 5JDUB 2ZWLH 5JBTA 2BD4A 1B0EA 5BRRE 2PR3A 1NRQH 3DFJA 1CSOE 2FOGA 1TX6A 1BMAA 1C5OH 1T8NA 1O3GA 2ZFQH 1AB9C 3QTVH 1OXGA 1C2MA 1TPSA 1OWIA 1TBQH 1C1UH 2W3KA 2FPZA 4ZXXH 3L6PA 6CHAB 5EGMA 3PM3A 2R2WU 1DUEA 2WINI 1GJAB 1TGNA 3VB4A 1C5VA 2NU4E 3U1JB 1O2UA 1SHHB 2CMYA 4K1SA 1LMWB 1TGTA 1PPEE 1Y5BT 4KKDA 1QBNA 1GHXH 1TNGA 1PPCE 1OP8A 1GMDG 1PQ8A 4QT8C 3T27A 5CE1A 3PMAB 1THSH 1YPMH 2SGAA 2AMDA 4K8BA 2OQUA 5DP7A 1N8OB 2FYRA 1W7XH 3A86A 2BLVA 1QL8A 3FAOA 3SI4H 1FAKH 1LVMA 1Z71A 2ZFSA 5C3NA 1O2PA 2V35A 4AG2A 1MBMA 3L33A 1C5QA 1GCDA 1BTZA 2FP7B 2ZFFH 3Q00A 4YOJA 3F1SB 3SNDA 1SGCA 1PQ5A 1WTGH 1IQIA 1O3DA 1IOEA 3PMJA 3GDSA 1BHXF 3BEFB 1O34A 3SHAH 4WF8A 3F6UH 2OC8A 2FI4E 1A5GH 2OP9A 3LH1A 3ZZDA 1YM0A 1Q31A 3E0NB 1FIZA 4NZQA 5G4BA 1PPHE 1LPKB 2ZU3A 1K21H 2Z3EA 3SN8A 1TLDA 2BB4A 3GY5A 3MH5A 2ZG0H 4BAQB 4IC6A 3LT3A 2SGQE 3ZZ9A 6CHAC 1RTFB 1U6QA 4K2YA 1AKSA 1THRH 3GY8A 2PUXB 4BAHB 1EASA 1BRUP 3SOSA 2FZZA 4ZAEA 2FX6A 3R0FA 4DT7B 2ZKSA 1T8MA 5EOKA 1CA0C 3P92A 2BYAX 2PTNA 2OCVB 4I8HA 1JRSA 1GMHG 1DY9A 5C20A 5DK1A 3RU4D 1GPZA 1GBMA 2FO9A 2ZNKH 3Q76A 1A61H 5FPTA 3TIUA 3ZYEA 4UE7H 3BG8A 3A84A 1GJ7B 1D6RA 1LKBA 4INLA 1G9IE 2R0KA 1GVLA 2XW9A 3D49H 1O3NA 3RM0H 2PUQH 4B74A 3H5CB 1ETTH 2P59A 3RXAA 1GHAF 4JYUH 1C5PA 2G55A 4DGJA 2F83A 3MNCA 5T6GA 1BBRE 2DUCA 5EPNA 1T8LA 4DURA 2HPPH 1IQMA 2O8MA 2ASUB 1O2ZA 3MHWU 1O35A 2XXLA 1YPEH 5A8XA 3T28A 3ZZ3A 1DT2A 2TIOA 1LQEA 3VFEA 2GCHF 5IYTA 2H9EH 1C5XB 4AN7A 1CHGA 4J2YB 4UD9H 1KY9A 2VWMA 3RXTA 1XUKA 1GL1A 3SNBA 1SHYA 3RXHA 1Q2WA 1YCPM 5L30H 4Y71A 4YLQH 1CU1A 2G5VA 3LU9B 2OBOA 4ABGA 1EXFA 3KN2A 1D9IA 4I32A 4X1NU 3MMGA 4CBNA 4E7NA 5FX6A 1K1MA 3T2NA 1Y3UA 5AFYH 2QXIA 1PJPA 1O5AB 1NFWA 4AX9H 2VWLA 3HATH 1NZQH 4CR5A 1HAZB 1O2VA 3GY7A 4OS5A 1SQOA 2NU3E 1C2HA 1ZGIA 1M9UA 2PLXA 1H9HE 1QA7A 1EATA 4NIVA 1LHFH 1AY6H 3A7TA 1WU1A 3B9FH 2BDAA 2Z7FE 2FMJA 1C5NH 2GCTB 1B7XB 3LC5A 1ZSKA 1ZZZA 1YKTA 4WH8A 2GTBA 2J95A 3ZVGA 2BD7A 4TPYA 3CENA 1MQ5A 3QN7A 3VEQB 3ZYDA 5EQSA 3SU3A 1MTNB 4YZUA 2HWLB 1BDAA 2F9PA 2ZI2H 1C5WB 2XC5A 1LCYA 2PW8H 3GCTF 4ASHA 1W10U 6GCHF 1ARCA 2ZIQH 1L0ZA 1HV7A 4NFFA 1SFIA 3D23A 4JYVH 3UIRA 3UREA 2ANYA 1TABE 5FX5A 4ABFA 4FU8A 5E0HA 4H6TA 1TNIA 4I33A 2HNTC 3ENSB 5FPYA 4CBOA 3MFJA 2IOTA 4IGDA 3RXRA 4Y6DA 1Y3VA 4J1YA 3E91A 4BTIB 3SUDA 1QL7A 2PFEA 4ESTE 1UMAH 3P8GA 1HLTH 2QAAA 5DJ7A 1P12E 3O8DA 4OS4A 3WY8A 1QB6A 2F91A 3UOPA 4ISIH 1V2OT 1V2KT 5ESTE 4MTBA 5J4QA 3E1XB 2XTTB 2KAIA 1H8IH 1YF4A 1BBRH 2VIWA 3GDUA 3QTOH 5GDSH 4ZXYH 1MKWH 2ZHDA 3HKJB 2W7SA 1GBKA 1TX8A 1GBEA 1E38B 3TJUA 3SUEA 1IQGA 3CS0A 1IQNA 1SBWA 1OWEA 1UJ1A 1AQ7A 1QY6A 4LZ4B 7ESTE 2A5KA 3A8AA 2PGBB 1JRTA 1V3XA 1SSXA 1C2KA 1ESBA 1QURH 8LPRA 1SVPA 4YOIA 3W95A 2GDDA 2ZCLP 4TPIZ 3MNXA 1AUJA 1ZGVA 1EZQA 3MU0A 4XFQA 1F7ZA 2A4QA 3LPRA 2BD2A 5AHGH 2GZ8A 1MKXK 2ZU4A 3M5MA 1UTPA 1V2QT 5DP6A 1GBDA 4IBLH 5DPAA 5GCHF 3RP2A 3A7XA 4DOQA 2TGAA 4NIWA 1OP0A 2BLQA 2FWWA 4XE4A 2Y7XA 2Z9IA 1XXDA 1P2QA 1EUFA 2HPQH 2WPHS 4NWKA 1QIXB 1CO7E 1O5EH 3SW2B 3MU4A 1S5SA 1O2RA 2VVVA 3AVZA 3RMLH 2ZEBA 3LKWA 1ESAA 2BD3A 5E2OA 5FHTA 3RXJA 4H42U 3GYMA 1SQTA 1GGDB 2EI6A 3OY5U 1TGCA 4CRFA 4INHA 1GBCA 5DP5A 2DE9A 2C8WB 4GHTA 2OBQA 4BOHA 5CHAB 4MQAA 6ESTA 1O2KA 4Y8ZA 3DFLA 3SJIA 1DFPA 2G4UA 2ANMH 1G3DA 1LPGB 3E6PH 2PKAA 1KTSB 2Z6BD 3ZZ8A 4TWWA 3EYDA 1MZDA 1SQAA 5GJ4B 2Z9GA 3BTGE 1ZOMA 5T6DA 3MU5A 4WWYA 1DLKB 1GHBF 4BXSA 3TK6A 1QRXA 4AGKA 2R3UA 1Y5AT 1SL3A 5HXFA 1BUIA 1TRYA 3SGAE 1SLVB 1PYTD 2ZFTA 1T32A 5EXMA 3M5NA 3W94A 5JB8S 1TGSZ 2HNTF 1SFQB 2J92A 3H7OA 1FV9A 3UFAA 2VIOA 3PYHA 1ETRH 3A80A 1AE5A 1GGDC 1BHXB 4A1TA 2ZGCA 2YNAA 1H4WA 1Z6JH 3A8BA 5CHAC 4X2YA 1GHAG 1P02A 1QFKH 4NG9H 4K8YA 2CJIA 1UO6A 1TX7A 4MPVA 1P11E 3ZZCA 1ZTLA 1ORFA 3PLBA 1ARBA 2XRCA 1VCPA 1A1RA 2GCHG 2ALVA 1TMUH 1DXPA 5K0HA 2ZHQH 3S9BA 2FDAA 3STIA 1K1OA 1SOZA 5EODA 2EA3A 4Z0KA 3UR9A 2GT8A 2EEKA 1G2LA 1MTVA 1AKSB 3ZZ7A 2G00A 1CA8B 1O3EA 2ZA5A 2ZDLA 1XMNB 4MNVA 4NSYA 1SGFA 1V2VT 2QXGA 1MTSA 2ZGXH 2ZU2A 9LPRA 3ODFA 5JPMH 3NZIA 3VB6A 2BDCA 1S82A 2ODPA 3BIUH 4A6LA 3O8CA 1P2JA 2ZFRH 1RTLA 1EAUA 1K28D 2J38A 4X0WU 4ZH8A 1XM1A 2TGTA 1P03A 1KLJH 5A09A 4NA8A 3TNSA 4DCDA 1PPFE 1Z1IA 1ZMLA 3ATIA 3RXIA 1HAGE 4TY7A 4YOGA 1H8DH 1LHCH 2F3CE 3M36A 5ABWA 2C8XB 2GKVE 2P95A 3ZZAA 3MYWA 4KELA 2BQ7B 1OWKA 2R2MB 2FYQA 4ABDA 2ZCHP 1IQEA 3PMBB 1UCYK 1A5IA 2XYAA 4JMYA 1HAVA 1Y8TA 3GCTG 5DP9A 1TNHA 1C1WH 6GCHG 3VB5A 1VJAU 1HJAB 3RXBA 2JKHA 3MTYA 3BSQA 2OUAA 1HUTH 4JYTA 3KQBA 4WXVA 4I31A 3E16B 4RKJB 1EP5A 1YPHE 2PGQB 3OY6U 4JZFH 1TPAE 2FI5E 3SUFA 2I6SA 4CH8B 1KSNA 5BPEA 2BD9A 3S69A 4LOYH 5F6MA 3F9EA 1AVWA 1HDTH 3HGNA 1XUFA 1OPHB 2ZDMA 5T6FA 3PV4A 2ZGBH 2IPHA 1AE8H 4O3UA 3E0PB 1J9CH 2W3IA 4HFPB 5L2YH 2Z3DA 1BBRK 1O36A 1MKWK 3SNCA 2VGCB 4CRGA 5LGOA 3P8NA 2A31A 2XCFA 3ZZ6A 3KQDA 3M5LA 1MAYA 1HAYB 1RGQA 4MPUA 2VVCA 2BMGB 3VB7A 3ITIA 3Q3KA 2Y5HA 1NY22 5DG6A 3FZDA 2QCYA 1E0FD 1SGEE 5F8XA 4NIYA 2OTVA 3HKIB 4YESB 1J16A 1NU9A 5H4IB 1Z6EA 4Y0YE 3RXDA 1MU6B 2BOHB 1OWJA 2ANWA 4X1SU 4DIHH 1V2PT 1W12U 1MCVA 1O2MA 2QF3A 1C4U2 1GBJA 3LJOA 1C1TA 1XVMA 1C2LA 2GVFA 2H9HA 4YT7H 1P2NA 2RG3A 2QIQA 2BY7X 1P04A 1YYY1 1YCPH 5C5NA 2V0BA 4IC5A 1MU8B 3ATWA 1GJ4H 5GCHG 2BHGA 3M3VA 1CA0B 3A88A 3ZVAA 1MKXH 2VGCC 3RXEA 1EPTA 1TOCB 3ZZ4A 2W26A 3TJNA 5IDKA 1C1RA 1YPGH 4JCNA 3K6YA 1CGHA 1ANCA 1P0SH 1O33A 1SGNE 3RXVA 4GAWA 4LXBH 2EI7A 2KAIB 1SLWB 1NT1A 1OWDA 1UK4A 3FZZA 2ALPA 4Y7AA 3GYLB 4OS1A 2GZ7A 2FLRH 4VGCB 4CREA 4B2BA 4D7GA 2JH6D 1LTOA 2W7UA 1S6HA 3PROA 2C93B 1N6YA 1C5MD 4A92A 2HLCA 4INKA 3TU7H 3RXMA
chains in the Genus database with same CATH superfamily
3Q3XA 1L2EA 3LGYA 1NESE 1UVPA 3NK8A 3VPKA 1YPKH 1SI5H 1F0RA 8KME2 3PO1B 1UHBA 3QO6A 4I7YH 2FIRH 5KGOA 3NCLA 2A2QH 1T7CA 1S6FA 9ESTA 3LC3A 2FOFA 1VJ9U 1SLUB 1UCYE 1OHHD 1TOMH 2BVSH 2UWOA 2ZDKA 3A7YA 1QL9A 1GDUA 1GHVH 5C1XA 4PROA 1QQUA 3I77A 4ZHAA 4Q80A 1GHBG 3RLYH 1TPOA 1MQ6A 1C1NA 4ISHH 5GPIB 4ZHLU 3SV6A 2Y81A 1BB0B 2AIQA 1RXPA 1GBBA 2TGPZ 4JK6A 1YLCA 3P6ZB 3B23B 5FPSA 1GJDB 1N1LA 3PRDA 3RDZA 3SU4A 4VGCC 1FN6A 2Y5FA 3MNBA 5A8YA 1HIAA 1DM4B 1C1SA 3UUZA 4UDWH 3RU4E 1P9UA 3TLOA 1GI0A 2O8WA 1P01A 2GT7A 2AH4X 2AGIX 4CHAB 3SV7A 2SGPE 1P2KA 3UWIA 2H1UA 2GMTC 3PO1C 4GLYA 4U30A 3ZVBA 1ZMJA 4O97A 5ESBA 1BMMH 3PTNA 1HAXB 2F9VA 1WOFA 3LIWA 1SMFE 2OC0A 3UTUH 4X6OA 1O2JA 2JH0D 3F2GA 4KP0A 2ZZUH 4M7GA 2ZU1A 1DWDH 2PKAB 1RFNA 1F5LA 2VINA 1CT4E 3BV9B 1LHGH 1HAHH 5DKMA 2FXRA 1V2TT 4UFEH 3RMNH 1JMOH 1GVKB 2BLWA 5DP3A 4KTUA 3GOVB 1EAXA 4DJZB 4Y7BA 1Z8JB 3Q77A 1V2LT 4ISOA 1A3EH 3IG6B 1SGQE 1PPZA 1X7AC 3UOUA 3VXFH 1W11U 4B76A 3PWBA 1SGFG 1Y5UT 1A0HB 2B7DH 2UUJB 2WPLS 3K6ZA 4A1XA 1RD3B 1Z7KA 1QCPA 2TBSA 5TCAA 1AN1E 1YPHC 4CHAC 1K1JA 2EQNA 3URCA 3ATMA 3KYFA 1P05A 3M7QA 3N7OA 3SI3H 4X8TH 5FCKA 5IK2D 4XRNA 2FS8A 3TGIE 4GCHF 1GDQA 4FUHA 4O03A 5F8TA 1ELTA 3MH7A 2VIPA 2WV4A 3QK1A 1VITF 3AAVA 1ZTKA 1C1OA 2ZPSA 5B6LA 1QRWA 1DX5M 1GBLA 1MD8A 2Q6DA 2KM0A 2YNBA 2D26C 1ESTA 1NM6A 1G30B 1QRZA 1UTKA 2M5TA 2ZDVH 4GVUA 4XBBA 4AB9A 1V2ST 4OGXA 1QJ6B 4UFGH 2LP6A 1QJ7B 1YGCH 2A7HA 1FPCH 3E8LA 1UCYH 1TNJA 3LGUA 5TJXA 4JZDH 3A87A 2PP6A 4RN6A 1XUHA 2H2ZA 1F0SA 4DG4A 3GCNA 1RIWB 4X2WA 5K7RA 5HIZA 3FP7E 1O5CB 2BZAA 4CRDA 1P3CA 1CGIE 1O3PB 1V2MT 1HRTH 5C1YA 1GI8B 1DE7H 3A7VA 5DP4A 1C2JA 1EP6A 1GI9B 1UTMA 1C2DA 4BAOB 2SGFE 1GBFA 3STJA 4A7IB 3FFGA 1HB0B 1DOJA 3EGKH 2Q6GA 1Y3WA 5F53A 1AWHB 1EAWA 5T1VA 3KCGH 5SGAE 3LH3A 3MO9A 5J4SA 1CT2E 2GZ9A 3EAJA 3RXCA 2A2XH 1F5RA 1JXPA 1FUJA 3D62A 1SQRA 2XBYA 3JZ1B 1O3JA 2JJ1D 5C5OA 4MG3A 2O8UA 3QX5H 3GICB 1KDQB 1GHWH 2RDLA 3KQCA 1GJBB 2WYGA 2F9UA 1HAVB 1A7SA 1O3IA 1AI8H 4WMDA 2FOBA 3I29A 1RIWC 2G4TA 1XVOA 3A7WA 2VWNA 3MO6A 3V7TA 4CRAA 4A1VA 2JJ2D 4X1PU 1D3PB 3S0NA 4YLUA 2ZCKP 1KLIH 3QDZB 1ZHPA 3TVJB 3D65E 2J34A 2ODYB 1P2MA 2OLGA 3UNRA 1YCPK 4U32A 4X8VH 1ELBA 1D3QB 1DS2E 4AOQA 5PTPA 1ABJH 2NU0E 1O2WA 1O3MA 3TH2H 1TGBA 1W0JD 2D2DA 4TYDA 1W0ZU 2BVRH 1V2NT 4YT6H 3LDXH 8ESTE 4AFUA 1WQVH 2HRVA 3SBKA 2HVXA 1O31A 2PSYA 1EB1H 2C90B 1UW7A 4H4FA 3RMMH 1EJAA 5FAHA 1A4WH 1SGDE 2FESH 3MH4A 3DD2H 4H6SB 4NSVA 1BTWA 2PWXA 4NA7A 1O2HA 1BOQA 5DO4H 1J15A 3RC6A 1ELAA 5A0AE 1GCTC 4NIXA 1XKBC 3EQ0H 1WBGB 3QUMP 3T25A 4UFFH 4X6PA 1C1QA 2GX4A 3LGVA 1E36B 1A0LA 1XX9A 1GHZA 2WPKS 1A46H 4WVPE 5ETXA 1MD7A 2NU2E 2R9PA 1XUGA 2O9QA 4XSKU 3TGKE 2A45B 4U2WA 1HFDA 3ZZ5A 3BTME 3VB3A 2VNTA 1OKXA 1OOKB 1ZRBA 2B8OH 3PLPA 3KYGA 3RU4T 1O2IA 2FOMB 4OS7A 1QBOA 1P3EA 1G3EA 1JBUH 3M37A 1S81A 1BJVA 2ZU5A 4R0IA 4I8GA 2AEIH 4Q63A 4D9QA 4FVBA 3SJOA 1G36A 1RRKA 1O2GH 1CE5A 2BZ6H 3M3SA 1B0FA 1C5TA 1LVOA 1TNLA 3LGWA 2Y80A 1TA6A 3PWCA 3MH6A 2CF8H 1CT0E 3UQVA 1O2TA 3PV5A 2BY6X 3MOCA 2H5CA 2KR7A 4Z1MD 4FXGH 1P2OA 2AERH 5CHBA 1KYNA 3PRBA 1INCA 1EPTB 1SG8B 2A32A 2ZDAH 4AGJA 3U8RH 4TT3D 3P70B 4ZHMU 1BRCE 2SFAA 1K1PA 4Q7ZA 4ZUHA 5I25A 1RJXB 3LJJA 4M9FA 2BDGA 2JH5D 4HGCA 1TBZH 2C8YB 3OYPA 3EA9A 5JBBS 2P3TB 1O37A 2WPIS 4WMFA 2WV5A 3ATKA 2D1JA 3SV9A 5EPYA 1FY4A 1FMGA 5EXNA 4ZCNA 1E37B 1ANDA 1SLXB 3VGCC 1CHOF 1DUAA 1N6XA 1NBMD 2A4RA 1L1GA 3PTBA 4KTCA 2TPIZ 4ABBA 1EAIA 1E35B 1ELEE 4ACAA 1P2IA 4B1TA 4F49A 4DY7B 1S0RA 1YC0A 1UHBB 1V2JT 1KXEA 4ZKNU 3QZQA 5E0GA 4B71A 1GBIA 4CRBA 1NROH 1UTLM 1ZYOA 2IJOB 3ESTA 3RM2H 1SGRE 2PHBA 1UVSH 1DSTA 1ELCA 1AZ8A 3DT0H 4FUIA 1O0DH 5HYOA 2ZHWH 4R8TB 1ELGA 1EPTC 5C0UA 2A7CA 2RFKC 1PFXC 1DPOA 3PB1E 2Y6TA 1ACBE 2DE8A 4BTUB 1ABIH 2VWOA 4BAKB 1PPGE 1UTQA 2ZPRA 4X6MA 1A3BH 1W0YH 1SPJA 2AMPA 4NWLA 2ZF0H 2ZTYA 1YPJH 1BRAA 1YLDA 4FUFA 4FU9A 1HIAB 1BA8B 4GCHG 1EQ9A 1JIRA 2BY9X 1UVTH 1VITG 1O3LA 2SNWA 3F0OA 4XOJA 1KDQA 4I8LA 1IQKA 3B8JA 3TPIZ 1MABB 3F68H 1BT7A 4RSPA 4D76A 1TMBH 5L6NH 1JOUB 1LPZB 1PQAA 1NTPA 1FY1A 5GIBA 1NN6A 1F0UA 3A89A 4I8KA 1ZTJA 4Q7XA 3RXSA 1ELDE 1FY8E 3RXUA 3SU2A 2BLOA 1GHYH 3WWFA 2P3FH 2BQ6B 4AG1A 2AYWA 2OINA 2BY5X 2VU8E 2VB0A 2ULLA 1C5ZB 3ZV8A 4B2CA 3FKSD 2THFB 2VH6A 2QF4A 1TPPA 1ZPCA 1TMTH 3MI4A 3P8OA 4Y10E 1HJ8A 5C17A 3SZNA 2P3UB 3K65B 2GV7A 1PPBH 1C2EA 1DVAH 3AW1A 1ANBA 1KLTA 1V2UT 2BXUH 1T4VH 1S6LA 1YBWA 1BIOA 2C8ZB 2CF9H 5A0BA 2QV1A 4YO9A 3G01A 2G8TA 5GWZA 5JBAS 1P06A 1Y3YA 4IS5A 1TRNA 2K1QA 3DHKH 4D8NA 1A2CH 3M3TA 4O3TA 3EA7A 1A5HA 1Y59T 1Z8RA 1NO9H 2BD5A 1O2XA 1GJCB 4E7RG 5AFZH 3RC4A 1FIWA 1XXFA 3UB0A 5GXPA 3OX7U 5EQRA 1TWXB 3S7KB 1YWUA 2RCEA 3BEUA 1FDPA 4HI3A 3SQHE 2WPJS 1FZZA 2OC7A 3MO3A 2A0QB 4XBDA 1H8HD 1P57B 1OS8A 1TQ0B 2Y82A 2O8TA 3RXQA 4B2AA 2Q6FA 1D3TB 1SGPE 1ZHMA 5A2MH 5EW2H 2HNTE 5FBIA 2SNVA 1DY8A 1ELVA 4NA9H 2BOKA 1GI2A 3NPSA 4I8JA 1UVUH 1SR5C 2BXTH 4LK4A 4Q2KA 4RKOB 3MWIU 1AZZA 3DUXH 4FUEA 4GPGA 2FEQH 1NFXA 2F9NA 1EX3A 3SHCH 4OS6A 5CMXH 2BX4A 1LKAA 1O3CA 5DN6D 2J2UA 1TAWA 4X1QU 3O8RA 1C5SA 1BTUA 4WJG2 3GY2A 5LPRA 2FI3E 2ODQA 3R3GB 1KXCA 4D7FA 1TALA 5T3HA 3AAUA 1FQ3A 2OQ5A 5C94A 2ZHFH 1TNKA 1DICA 1TBRH 5GNDA 3T26A 1EOJA 3GY3A 4TSFD 3RMOH 2STAE 4D9RA 1MBQA 1NU7B 1AO5A 1BZXE 1G2MA 1L4ZA 5EU8A 1FY5A 2O8LA 2VVUA 4CRCA 3SGQE 3OE7D 1ZHRA 2P8OB 1OYTH 2QA9E 3PLKA 1BMFD 4OM9A 2AGGX 4CR9A 2GJGA 2QXJA 1F0TA 3TITA 1MUEB 1VGCB 1K1NA 4F55A 1GMCF 2GGVB 4AFZA 3F3BA 2ZFPH 1T31A 1H1BA 2AIPA 1GBAA 3V12A 3F9FA 2XOKD 1O2YA 2G51A 1UTOA 1AVGH 1XUJA 1ZJDA 3S9CA 1WUNH 3DSPA 2QF5A 4FETA 2GMTB 1P10A 1QZ8A 1CGJE 2UWLA 3V13A 5EXLA 3BTHE 1ZSLA 1O3KA 2B0FA 2CGAA 2V3OH 1PYTC 4E05H 1D3DB 3TK5A 2FTLE 1V6DA 1SB1H 3OTJE 2OC1A 3A83A 2GV6A 4K60A 3SV2H 3LGIA 1QNJA 1DANH 2V6NA 1K22H 3K2UA 4Y8XA 3A81A 3TJOA 4JZIA 1E34B 2GDEH 4UONA 2P8OC 1LQDB 5C2ZA 4ZKRU 1AD8H 2RA3A 2ZC9H 2H6MA 1MCTA 2D8WA 2QN5T 4NZLA 1C9TA 2VJ1A 1VGCC 4E06H 1IHTH 2P94A 2RDEA 5LPFA 3CS7A 1Y3XA 1C2IA 1DITH 2EY4C 2FLBH 1FJSA 1N8OC 1E1RD 3SU1A 1EZXC 7LPRA 1WAYB 3KEEA 1BTPA 2TGDA 4X8UH 2J9NA 4X1RU 7GCHF 1AUTC 2J5UA 1SOTA 1IQHA 4K1EA 1ZLRA 1CHOG 1RS0A 3RXFA 4WY3A 4K69A 1NC6A 5EG4A 1BRBE 2HGTH 4WXIA 3PV2A 4IN2A 2VH0A 1QR3E 1W8BH 1D4PB 1PQ7A 2CN0H 1S83A 3KGPA 4ZKSU 3IWMA 1HJ9A 4Y8YA 4AFQA 1ZJKA 1AIXH 4ZROA 1GBHA 3UWJH 2CV3A 1WCZA 1GI5A 5LPEA 3KQEA 3SJKA 4UEHH 2Z9KA 3SU0A 3A8DA 1W13U 2HOBA 1O3BA 3I78A 4FUJA 2KCYA 1HPGA 1O30A 3BTDE 1WQSA 4GSOA 3A8CA 1MMJN 1D6WA 1K1IA 3M7TA 4B73A 4ABAA 3BTWE 1L4DA 1LO6A 1L1JA 2ZGJA 3LOXA 4AYVB 3P95A 3ZVFA 3P8FA 3KL6A 1F92A 1GJ6A 1WDIA 2ZTZA 1CVWH 1H9LB 4JZ1A 3ELAH 5E0JA 4BAMB 3BF6H 2ZO3H 2BQWB 5AVDA 1FPHH 1G32B 1GWAA 1P8VC 1GG6B 1GL0E 1NS3A 3NWUA 3SJ8A 4AC9A 4AORA 5L2ZH 1SGIB 2ILNA 2G5NA 3DA9B 3Q3YA 4IMQA 3TH4H 1K9OE 5FBEA 3PMHB 2BDBA 1CBWB 4FUCA 2W5EA 2ZDNA 1QB9A 1UTJA 2FM2A 2A5IA 1DWBH 8GCHF 2TRMA 1C9PA 2A5AA 1BJUA 2FS9A 4X6NA 3TGJE 4Q7YA 3RXPA 2UUYA 5TCCA 2ESTE 1EOLA 1EJMA 1O5FH 1OX1A 1K0HA 1NFYA 1NPMA 4AB8A 4DIIH 2FOHA 1TONA 1ZRKA 1NRRH 4OGYA 1DWCH 2BX3A 3V3MA 1V2WT 1P09A 3BN9A 4XD7D 5E2PA 2R0LA 1G3CA 1NRNH 2NU1E 3KHVA 3S7HB 2Q1JA 2XWBI 5DP8A 1O38A 3UPEA 3NUMA 2LNCA 1FONA 1TFXA 3C1KA 1VZQH 1GDNA 1C1MA 7KMEH 4WH6A 1COWD 1EB2A 1EZUC 3FN8A 3FVFB 3HK6B 1ELFA 1WV7H 1GG6C 1TYNA 1MH0A 2Z3CA 5EJLA 5EJ1A 1CBWC 1DXWA 1BITA 3UNSA 3QLPH 4KGAA 4K5ZA 3EE7A 1V2RT 2WPMS 4XBCA 5I46H 3QGNB 1Z8GA 2Z94A 2B5TB 3EE0B 3M7UA 1TB6H 3LGTA 2Y7ZA 3U8TH 2F9BH 2ANKH 1BTYA 3QZRA 2CXVA 4B75A 3M61U 4RT0A 4K1TA 1MZAA 1AFQB 1G3BA 1HCGA 1GCTB 3ATLA 2GCTC 1BTXA 3SO3A 1ZPZA 3RLWH 5HM9A 1Z8IB 1QJ1B 2Z9JA 1O2QA 2VIVA 2QGRA 1OSSA 3S9AA 1F5KU 1MTNC 3SZEA 3U1IB 4BTTB 5JBCS 2FOCA 3OU0A 1LHEH 3CP7A 2FTMA 3NXPA 4MLFB 3K9XB 1FNIA 1W14U 2XC0A 3EDXB 2OXSA 4BNRA 2WYJA 3V0XA 4HTCH 1LHDH 4NGAH 1UTNA 1MTUA 1KXDA 1O2NA 1YPLH 3P17H 1JIMA 1HGTH 3BTQE 2BDYA 4KTSA 5DGJA 5HGGA 3KF2A 3ODDA 2ZQ2A 5JB9S 4Y76A 1O3FA 1DDJA 4FOUC 1O5BB 3OSYA 1HBTH 1SC8U 4BXWA 3EA8A 3A85A 3DSOA 2JETB 2A1DB 1ZSJA 1DWEH 1BMNH 4AYYB 1LVYA 2KFWA 4Y11E 3SJ9A 1O3OA 1P9SA 5F8ZA 3UQOA 2FOEA 2J94A 5EQQA 3F9HA 1NRSH 1AFQC 2WZQA 2A4OA 4O9VA 2WUBA 1FLEE 2RA0A 4GUXA 4F48B 4YTAA 1S0QA 2FOAA 1W7GH 3U8OH 1ID5H 1O39A 2GP9B 1GMCG 1GMDF 4MNYA 1BQYA 1FN8A 3GCHB 3SNEA 2NWNA 2CK3D 2PKSB 4FUBA 2PSXA 4SGBE 1FY3A 1O5DH 3GY6A 1SKYE 1GI3A 1C2GA 1IAUA 3VGCB 4YM9A 1QHRB 3M5OA 1ZMNA 3MU8A 4IMZA 4X8SH 1IQLA 2AFQB 1L1NA 1GI7B 1J17T 1T8OA 2ZGHA 1KTTB 1HXEH 2YMSB 2ZP0H 2BD8A 4GHQA 1IQJA 1QQ4A 2K8IA 3H7TA 2WV9A 1EKBB 3C27B 2JETC 3ZVCA 1VCQA 4NCYA 1VR1H 3VXEH 3TJVA 3RXOA 3L3TA 4X2VA 1ZPBA 2BTCE 2C4FH 4ZMAH 1A0JA 2B9LA 4F4OC 2PTCE 2AGEX 4Y79A 1AU8A 2GD4B 1K1LA 4TY6A 1HYLA 2M2AA 1TE0A 2KCOA 3NKKA 5B6OA 3BTTE 1KXBA 1TQ7B 4ISLA 1CQQA 4ABEA 1IQFA 1BTHH 2EC9H 1YP9A 2J4IA 3ZV9A 2UUFB 2BY8X 1MTWA 5C1UA 1OYQA 1O3HA 2XCNA 1NRPH 1DLEA 3U9AH 5LH8A 1KIGH 4UFDH 2QF0A 1GMHF 5FCRA 3GCHC 4JZEH 2A4GA 1LDTT 3AK5A 2G81E 1J8AA 3U98H 4MPXA 3SQEE 4ABHA 2PKSC 4JK5A 3RUOA 2XBXA 3T5FH 1C4Y2 2CHAB 1O3AA 2LPRA 3TNTA 2UWPA 7GCHG 3SGBE 2QC2A 3RC5A 4FU7A 4ABIA 4LZ1H 4MVNA 4ISNA 1ZR0A 3F9GA 3GISB 1C4V2 2OD3B 2HALA 3BG4B 2R3YA 3RXGA 1OP2A 3A7ZA 5KEDA 2P93A 2YMSC 3AW0A 1XKAC 1W3CA 4X2XA 4XDEA 4TWYA 3BTFE 4A5TS 3HGPA 1HNEE 3IITA 4SGAE 2ZECA 3T62A 2A7JA 2XBWA 2YOLA 4I86A 1NBME 4ABJA 4K3JA 4Z6AH 2STBE 1FAXA 5A0CA 1FI8A 3UY9A 2ZPQA 3T29A 2Y5GA 3TH3H 1AVXA 3MQKC 1H9IE 1O2OA 3SNAA 3URDA 1QB1A 1O2LA 2XBVA 1IHSH 1MAXA 1OWHA 3RXLA 3U69H 1O2SA 3A82A 2ZQ1A 3N7EA 2AMQA 5HM2A 3KIDU 3E90B 2FODA 1HAPH 2SGEE 1WTHD 1C5YB 1GJ9B 5EW1H 2CHAC 2PV9B 2V3HH 2BM2A 1EJNA 1NFUA 3FP6E 4THNH 4MNWA 1T4UH 2VBCA 3JZ2B 3RXKA 1QA0A 2QXHA 8GCHG 1GVZA 1KXFA 4P00A 1AGJA 4Y0ZE 2XC4A 1GI1A 3BG4C 4Q4LA 3KNXA 1Z1JA 1EFRD 4NFEA 3SORA 4OS2A 1XUIA 1BCUH 2IN2A 1GJ8B 1B5GH 3MU1A 3BTEE 2ZHEH 3GCOA 1YLNA 1AMHA 2EI8A 1TA2A 4RT1A 1QGFA 2XWAA 1Q3XA 1GBTA 3FP8E 2F9OA 3GY4A 3OFND 3O8BA 4U01A 1O5GH 1C2FA 1W2KH 4AFSA 1VITH 4MNXA 3DSGA 1WYKA 2FX4A 2QYIA 1YY3A 1LVBA 1C5RA 6LPRA 2VIDA 1HAIH 1GJ5H 3CNRA 1HAOH 1GI6A 1C1PA 2BDHA 2XNDD 3FANA 5F03A 2VIQA 1FXYA 1EZSC 3LONA 3ZVEA 1AHTH 1UK3A 1S85A 1THPB 2SGDE 2QY0B 3SUGA 3E3TA 5C67A 1RTKA 3H09A 3UNQA 4MPWA 1HXFH 3GDVA 1DSUA 1AB9B 4FVDA 2AS9A 2BVXH 4HZHA 3M35A 4FUDA 1ANEA 1TIOA 2H5DA 1BMLA 3SV8A 4DW2U 1J14A 4DVAU 1AWFH 2XNIA 3QGJA 2P16A 3MNSA 1S84A 1C1VH 3ZVDA 1UVOA 1GI4A 2BDIA 3UR6A 1ETSH 1JWTA 3BTKE 1WSSH 4MDSA 1KXAA 2C3SA 2ZTXA 1O32A 4WMEA 5A8ZA 4FUGA 2H9TH 1QTFA 3ZZBA 1F2SE 1UK2A 2LELA 1AFEH 1C5UA 5HKKD 3SU6A 1C5LH 2UUKB 1VCWA 4BANB 3BIVH 4ZKOU 1QBVH 5JYIA 2WUCA 2I6QA 3HK3B 2HLDD 5FXLA 2G52A 1K2I1 1G37A 4DT4A 1HJAC 3AASA 3HPTB 3QWCH 5E8EH 3SU5A 2Z9LA 1SGYE 5HMAA 5AF9H 1TRMA 4CH2B 4IN1A 1SGTA 3BEIB 3TK9A 4IW4E 4AZ2B 5JDUB 2ZWLH 5JBTA 2BD4A 1B0EA 5BRRE 2PR3A 1NRQH 3DFJA 1CSOE 2FOGA 1TX6A 1BMAA 1C5OH 1T8NA 1O3GA 2ZFQH 1AB9C 1VKYA 1OXGA 3QTVH 1C2MA 1TPSA 1OWIA 1TBQH 2IPQX 2KCPA 1C1UH 2W3KA 2FPZA 4ZXXH 3L6PA 6CHAB 5EGMA 3PM3A 2R2WU 1DUEA 2WINI 1GJAB 1TGNA 3VB4A 4B6FA 1C5VA 2NU4E 3U1JB 1O2UA 1SHHB 2CMYA 4K1SA 1LMWB 1TGTA 1PPEE 1Y5BT 4KKDA 1QBNA 1GHXH 1TNGA 1PPCE 1OP8A 1GMDG 1PQ8A 4QT8C 3T27A 5CE1A 3PMAB 1THSH 1YPMH 2SGAA 2AMDA 4K8BA 2OQUA 5DP7A 3F2FA 1N8OB 2FYRA 1W7XH 3A86A 2BLVA 1QL8A 3FAOA 3OTPA 1FAKH 3SI4H 1LVMA 1Z71A 2ZFSA 5C3NA 2KZ4A 1O2PA 5CDFE 2V35A 4AG2A 1MBMA 3L33A 1C5QA 1GCDA 1BTZA 2FP7B 2ZFFH 3Q00A 4YOJA 3F1SB 3SNDA 1SGCA 1PQ5A 1WTGH 1IQIA 1O3DA 1IOEA 3PMJA 3GDSA 1BHXF 3BEFB 1O34A 3SHAH 4WF8A 3F6UH 2OC8A 2FI4E 1A5GH 2OP9A 3LH1A 3ZZDA 1YM0A 1Q31A 3E0NB 1FIZA 4NZQA 5G4BA 1PPHE 1LPKB 2ZU3A 1K21H 2Z3EA 3SN8A 1TLDA 2BB4A 3GY5A 3MH5A 1W0KD 2ZG0H 3WW7A 4BAQB 4IC6A 3LT3A 2SGQE 3ZZ9A 6CHAC 1RTFB 1U6QA 4K2YA 1AKSA 1THRH 3GY8A 1KMHB 2PUXB 4BAHB 1EASA 1BRUP 3SOSA 2FZZA 4ZAEA 2FX6A 3R0FA 4DT7B 2ZKSA 1T8MA 5EOKA 1CA0C 3P92A 2BYAX 2PTNA 2OCVB 4I8HA 1JRSA 1GMHG 1DY9A 5C20A 5DK1A 3WWBA 3RU4D 1GPZA 1GBMA 2FO9A 2ZNKH 3Q76A 1A61H 5FPTA 3NRLA 3TIUA 3ZYEA 4UE7H 3BG8A 3A84A 1GJ7B 1D6RA 1LKBA 4INLA 4B6EA 1G9IE 2R0KA 1GVLA 2XW9A 3D49H 1O3NA 3RM0H 2PUQH 4B74A 3H5CB 1ETTH 2P59A 3OEHD 3RXAA 1GHAF 4JYUH 1C5PA 2G55A 4DGJA 2F83A 3MNCA 5T6GA 1BBRE 2DUCA 5EPNA 1T8LA 2W6ID 4DURA 2HPPH 1IQMA 2O8MA 2ASUB 1H8ED 1O2ZA 3MHWU 1O35A 2XXLA 1YPEH 5A8XA 3T28A 3ZZ3A 1DT2A 2TIOA 1LQEA 3VFEA 2GCHF 5IYTA 2H9EH 1C5XB 1E1QD 4AN7A 1CHGA 4J2YB 4UD9H 1KY9A 2VWMA 2KCAA 3RXTA 1XUKA 1GL1A 3SNBA 1SHYA 3RXHA 1Q2WA 1YCPM 2AHME 5L30H 4Y71A 4YLQH 1CU1A 2G5VA 3LU9B 2OBOA 4ABGA 4ACBA 1EXFA 2YMSD 3KN2A 1D9IA 4I32A 4X1NU 3MMGA 4CBNA 4E7NA 5FX6A 1K1MA 3T2NA 1Y3UA 5AFYH 2QXIA 1PJPA 1O5AB 1NFWA 4AX9H 2VWLA 3HATH 1NZQH 4CR5A 1HAZB 1O2VA 3GY7A 4OS5A 1SQOA 2NU3E 1C2HA 1ZGIA 1M9UA 2PLXA 1H9HE 1QA7A 1EATA 4NIVA 1LHFH 1AY6H 3A7TA 1WU1A 3B9FH 2BDAA 2Z7FE 2FMJA 1C5NH 2GCTB 1B7XB 3LC5A 1ZSKA 4P02A 1ZZZA 1YKTA 4WH8A 5DSFA 2GTBA 2J95A 3ZVGA 2BD7A 4TPYA 3CENA 1MQ5A 3QN7A 3VEQB 3ZYDA 5EQSA 3SU3A 1MTNB 4YZUA 2HWLB 1BDAA 2F9PA 2ZI2H 1C5WB 2XC5A 1LCYA 2PW8H 3GCTF 4ASHA 2W6JD 1W10U 6GCHF 1ARCA 2ZIQH 1L0ZA 1HV7A 4NFFA 1SFIA 3D23A 4JYVH 3UIRA 3UREA 2ANYA 1TABE 5FX5A 4ABFA 4FU8A 5E0HA 4H6TA 1TNIA 4I33A 2HNTC 3ENSB 5FL7D 5FPYA 5HIYA 3KQ5A 4CBOA 3MFJA 2IOTA 4IGDA 3RXRA 4Y6DA 1Y3VA 4J1YA 2WHXA 3E91A 4BTIB 3SUDA 1QL7A 2PFEA 4RI0A 4ESTE 1UMAH 3P8GA 1HLTH 2QAAA 5DJ7A 1P12E 3O8DA 4OS4A 3WY8A 1QB6A 2F91A 3UOPA 4ISIH 1V2OT 1V2KT 2WPDD 5ESTE 4MTBA 5J4QA 3E1XB 2XTTB 2KAIA 1H8IH 2HVYB 1YF4A 1BBRH 2VIWA 3GDUA 3QTOH 5GDSH 5EJZA 4ZXYH 1MKWH 2ZHDA 3HKJB 2W7SA 1GBKA 1TX8A 1GBEA 1E38B 3TJUA 3SUEA 1IQGA 3CS0A 1IQNA 1SBWA 1OWEA 1UJ1A 1AQ7A 1QY6A 4LZ4B 7ESTE 2A5KA 3A8AA 2PGBB 1JRTA 1V3XA 1SSXA 1C2KA 1ESBA 2F43B 1QURH 8LPRA 1SVPA 4YOIA 3W95A 2GDDA 2ZCLP 4TPIZ 3MNXA 1AUJA 3GS9A 1ZGVA 1EZQA 3MU0A 4XFQA 1F7ZA 2A4QA 3LPRA 4HG6A 2BD2A 5AHGH 2GZ8A 1MKXK 2ZU4A 3N99A 5EIYA 3M5MA 2L6OA 1UTPA 1V2QT 5DP6A 1GBDA 4IBLH 5DPAA 5GCHF 3RP2A 3A7XA 4DOQA 2TGAA 4NIWA 1OP0A 2BLQA 2FWWA 4XE4A 2Y7XA 2Z9IA 1XXDA 1P2QA 1EUFA 2HPQH 2WPHS 4NWKA 1QIXB 1CO7E 1O5EH 3SW2B 3MU4A 5KECA 1S5SA 1O2RA 2VVVA 3AVZA 3RMLH 2ZEBA 3LKWA 1ESAA 2BD3A 5E2OA 5FHTA 3RXJA 4H42U 3GYMA 1SQTA 1GGDB 2EI6A 3OY5U 1TGCA 4CRFA 4INHA 1GBCA 5DP5A 2DE9A 2C8WB 4GHTA 2OBQA 4BOHA 5CHAB 4MQAA 6ESTA 1O2KA 4Y8ZA 3DFLA 3SJIA 1DFPA 2G4UA 2JDID 2ANMH 1G3DA 1LPGB 3E6PH 2PKAA 1KTSB 2Z6BD 3ZZ8A 4TWWA 3EYDA 2IJD1 1MZDA 1SQAA 5GJ4B 2Z9GA 3BTGE 1ZOMA 5T6DA 3MU5A 4WWYA 1DLKB 1GHBF 4BXSA 3TK6A 1QRXA 3OAAD 4AGKA 2R3UA 1Y5AT 1SL3A 5HXFA 1BUIA 2JIZD 1TRYA 3SGAE 1SLVB 1PYTD 2V3MA 1T32A 2ZFTA 5EXMA 3M5NA 3W94A 5JB8S 1TGSZ 2HNTF 1SFQB 2J92A 3H7OA 1FV9A 3UFAA 2KX4A 2VIOA 1ETRH 3PYHA 3A80A 1AE5A 1GGDC 1BHXB 3DCLA 4A1TA 2ZGCA 2YNAA 1H4WA 2K0QA 1Z6JH 2L74A 3A8BA 5CHAC 2J98B 4X2YA 1GHAG 1P02A 1QFKH 4NG9H 3FOAA 4K8YA 2CJIA 1UO6A 1TX7A 4MPVA 1P11E 3ZZCA 3F2HA 1ZTLA 1ORFA 3PLBA 1ARBA 2XRCA 1VCPA 2OK5A 1A1RA 2GCHG 2ALVA 1TMUH 1DXPA 5K0HA 2ZHQH 3S9BA 2FDAA 3STIA 1K1OA 1SOZA 5EODA 2EA3A 4Z0KA 3UR9A 2GT8A 2EEKA 1G2LA 1E79D 1AKSB 1MTVA 3ZZ7A 2G00A 1CA8B 1O3EA 2ZA5A 2ZDLA 1XMNB 4MNVA 3N7DA 4NSYA 1SGFA 1V2VT 2QXGA 1MTSA 2ZGXH 2ZU2A 3W1EA 9LPRA 3ODFA 5JPMH 3NZIA 3VB6A 2BDCA 1S82A 2ODPA 3BIUH 4A6LA 3O8CA 1P2JA 2ZFRH 1RTLA 1EAUA 1FX0B 1K28D 2J38A 2V7QD 4X0WU 4ZH8A 1XM1A 2TGTA 1P03A 1KLJH 5A09A 4NA8A 3TNSA 4DCDA 1PPFE 1Z1IA 1ZMLA 3ATIA 3RXIA 1HAGE 4TY7A 4YOGA 1H8DH 1LHCH 2F3CE 3M36A 5ABWA 2C8XB 2GKVE 2P95A 3ZZAA 3MYWA 4KELA 2BQ7B 1OWKA 2R2MB 2FYQA 4ABDA 2F4LA 2ZCHP 1IQEA 3PMBB 3F0PA 1UCYK 1A5IA 2XYAA 4JMYA 1HAVA 1Y8TA 3GCTG 5DP9A 1TNHA 3OEED 1C1WH 6GCHG 3VB5A 1VJAU 1HJAB 3U28C 3RXBA 2JKHA 3MTYA 3BSQA 2OUAA 1HUTH 4JYTA 3KQBA 4WXVA 4I31A 3E16B 4RKJB 1EP5A 1YPHE 2PGQB 3OY6U 4JZFH 1TPAE 2FI5E 3SUFA 2I6SA 4CH8B 1KSNA 5BPEA 2BD9A 3S69A 4LOYH 5F6MA 3F9EA 1AVWA 1HDTH 3HGNA 1XUFA 1OPHB 2ZDMA 5T6FA 3PV4A 2ZGBH 2IPHA 1AE8H 4O3UA 3E0PB 1J9CH 2W3IA 4HFPB 5L2YH 2Z3DA 3UAIC 1BBRK 1O36A 1WXRA 1MKWK 3SNCA 2VGCB 4CRGA 5LGOA 3P8NA 2A31A 2XCFA 3ZZ6A 3KQDA 3M5LA 1MAYA 1HAYB 4YXWD 1RGQA 4MPUA 2VVCA 2BMGB 3VB7A 3ITIA 3Q3KA 2Y5HA 1NY22 5DG6A 3FZDA 2QCYA 1E0FD 1SGEE 5F8XA 4ASUD 4NIYA 2OTVA 5C0TA 3HKIB 4YESB 1J16A 1NU9A 5H4IB 1Z6EA 4Y0YE 3RXDA 2J97A 1MU6B 2BOHB 1OWJA 2ANWA 4X1SU 4DIHH 1V2PT 1W12U 1MCVA 1O2MA 2QF3A 1C4U2 1GBJA 3LJOA 1C1TA 1XVMA 1C2LA 2GVFA 2H9HA 4YT7H 1P2NA 2RG3A 2WSSD 2QIQA 2BY7X 1P04A 1YYY1 1YCPH 5C5NA 2V0BA 3FO8D 4IC5A 1MU8B 3ATWA 1GJ4H 5GCHG 2BHGA 3M3VA 1CA0B 3A88A 3ZVAA 1MKXH 2VGCC 3ZIAD 3RXEA 3SYJA 1EPTA 1TOCB 3VG8A 3ZZ4A 2W26A 3TJNA 5IDKA 1C1RA 1YPGH 4JCNA 3K6YA 1CGHA 1ANCA 1P0SH 1O33A 1SGNE 3RXVA 4GAWA 4LXBH 2EI7A 2KAIB 2QE7D 1SLWB 1NT1A 1OWDA 1UK4A 3FZZA 2ALPA 4Y7AA 3GYLB 4OS1A 2GZ7A 2FLRH 4VGCB 4CREA 2J98A 4B2BA 4D7GA 2JH6D 1LTOA 2W7UA 1S6HA 3PROA 2C93B 1N6YA 1C5MD 4A92A 2HLCA 4INKA 3TU7H 3RXMA
chains in the Genus database with same CATH topology
3Q3XA 1L2EA 3LGYA 1NESE 1UVPA 3NK8A 3VPKA 1YPKH 1SI5H 1F0RA 8KME2 3PO1B 1UHBA 3QO6A 4I7YH 2FIRH 3NCLA 2A2QH 1T7CA 1S6FA 9ESTA 3LC3A 2FOFA 1VJ9U 1SLUB 1UCYE 1TOMH 2BVSH 2UWOA 2ZDKA 3A7YA 1QL9A 1GDUA 1GHVH 5C1XA 4PROA 1QQUA 3I77A 4ZHAA 4Q80A 1GHBG 3RLYH 1TPOA 1MQ6A 1C1NA 4ISHH 5GPIB 4ZHLU 3SV6A 2Y81A 1BB0B 2AIQA 1RXPA 1GBBA 2TGPZ 4JK6A 1YLCA 3P6ZB 3B23B 5FPSA 1GJDB 1N1LA 3RDZA 3SU4A 4VGCC 1FN6A 2Y5FA 3MNBA 5A8YA 1HIAA 1DM4B 1C1SA 3UUZA 4UDWH 3RU4E 1P9UA 3TLOA 1GI0A 2O8WA 1P01A 2GT7A 2AH4X 2AGIX 4CHAB 3SV7A 2SGPE 1P2KA 3UWIA 2H1UA 2GMTC 3PO1C 4GLYA 4U30A 3ZVBA 1ZMJA 4O97A 5ESBA 1BMMH 3PTNA 1HAXB 2F9VA 1WOFA 3LIWA 1SMFE 2OC0A 3UTUH 4X6OA 1O2JA 2JH0D 4KP0A 2ZZUH 4M7GA 2ZU1A 1DWDH 2PKAB 1RFNA 1F5LA 2VINA 1CT4E 3BV9B 1LHGH 1HAHH 5DKMA 2FXRA 1V2TT 4UFEH 3RMNH 1JMOH 1GVKB 2BLWA 5DP3A 4KTUA 3GOVB 1EAXA 4DJZB 4Y7BA 1Z8JB 3Q77A 1V2LT 4ISOA 1A3EH 3IG6B 1SGQE 1PPZA 1X7AC 3UOUA 3VXFH 1W11U 4B76A 3PWBA 1SGFG 1Y5UT 1A0HB 2B7DH 2UUJB 2WPLS 3K6ZA 4A1XA 1RD3B 1Z7KA 1QCPA 2TBSA 5TCAA 1AN1E 1YPHC 4CHAC 1K1JA 3URCA 3ATMA 1P05A 3M7QA 3N7OA 3SI3H 4X8TH 5FCKA 2FS8A 3TGIE 4GCHF 1GDQA 4FUHA 4O03A 5F8TA 1ELTA 3MH7A 2VIPA 2WV4A 3QK1A 1VITF 3AAVA 1ZTKA 1C1OA 2ZPSA 1QRWA 1DX5M 1GBLA 1MD8A 2Q6DA 2YNBA 2D26C 1ESTA 1NM6A 1G30B 1QRZA 1UTKA 2M5TA 2ZDVH 4GVUA 4XBBA 4AB9A 1V2ST 4OGXA 1QJ6B 4UFGH 1QJ7B 1YGCH 2A7HA 1FPCH 3E8LA 1UCYH 1TNJA 3LGUA 5TJXA 4JZDH 3A87A 4RN6A 1XUHA 2H2ZA 1F0SA 4DG4A 3GCNA 1RIWB 4X2WA 5K7RA 3FP7E 1O5CB 2BZAA 4CRDA 1P3CA 1CGIE 1O3PB 1V2MT 1HRTH 5C1YA 1GI8B 1DE7H 3A7VA 5DP4A 1C2JA 1EP6A 1GI9B 1UTMA 1C2DA 4BAOB 2SGFE 1GBFA 3STJA 4A7IB 3FFGA 1HB0B 1DOJA 3EGKH 2Q6GA 1Y3WA 1AWHB 1EAWA 3KCGH 5SGAE 3LH3A 3MO9A 5J4SA 1CT2E 2GZ9A 3EAJA 3RXCA 2A2XH 1F5RA 1JXPA 1FUJA 3D62A 2XBYA 3JZ1B 1O3JA 5C5OA 4MG3A 2O8UA 3QX5H 3GICB 1KDQB 1GHWH 2RDLA 3KQCA 1GJBB 2WYGA 2F9UA 1HAVB 1A7SA 1O3IA 1AI8H 4WMDA 2FOBA 3I29A 1RIWC 2G4TA 1XVOA 3A7WA 2VWNA 3MO6A 3V7TA 4CRAA 4A1VA 4X1PU 1D3PB 3S0NA 4YLUA 2ZCKP 1KLIH 3QDZB 1ZHPA 3TVJB 3D65E 2J34A 2ODYB 1P2MA 2OLGA 3UNRA 1YCPK 4U32A 4X8VH 1ELBA 1D3QB 1DS2E 4AOQA 5PTPA 1ABJH 2NU0E 1O2WA 1O3MA 3TH2H 1TGBA 2D2DA 4TYDA 1W0ZU 2BVRH 1V2NT 4YT6H 3LDXH 8ESTE 4AFUA 1WQVH 2HRVA 3SBKA 2HVXA 1O31A 2PSYA 1EB1H 2C90B 4H4FA 3RMMH 1EJAA 5FAHA 1A4WH 1SGDE 2FESH 3MH4A 3DD2H 4H6SB 4NSVA 1BTWA 2PWXA 4NA7A 1O2HA 1BOQA 5DO4H 1J15A 3RC6A 1ELAA 5A0AE 1GCTC 4NIXA 1XKBC 3EQ0H 1WBGB 3QUMP 3T25A 4UFFH 4X6PA 1C1QA 2GX4A 3LGVA 1E36B 1A0LA 1XX9A 1GHZA 2WPKS 1A46H 4WVPE 5ETXA 1MD7A 2NU2E 2R9PA 2O9QA 1XUGA 4XSKU 3TGKE 2A45B 4U2WA 1HFDA 3ZZ5A 3BTME 3VB3A 2VNTA 1OKXA 1OOKB 1ZRBA 2B8OH 3PLPA 3RU4T 1O2IA 2FOMB 4OS7A 1QBOA 1P3EA 1G3EA 1JBUH 3M37A 1S81A 1BJVA 2ZU5A 4R0IA 4I8GA 2AEIH 4D9QA 4FVBA 3SJOA 1G36A 1RRKA 1O2GH 1CE5A 2BZ6H 3M3SA 1B0FA 1C5TA 1LVOA 1TNLA 3LGWA 2Y80A 1TA6A 3PWCA 3MH6A 2CF8H 1CT0E 3UQVA 1O2TA 2BY6X 3MOCA 2H5CA 4FXGH 1P2OA 2AERH 1KYNA 1INCA 1EPTB 1SG8B 2A32A 2ZDAH 4AGJA 3U8RH 3P70B 4ZHMU 1BRCE 2SFAA 1K1PA 4Q7ZA 4ZUHA 5I25A 1RJXB 3LJJA 2BDGA 2JH5D 4HGCA 1TBZH 2C8YB 3OYPA 3EA9A 5JBBS 2P3TB 1O37A 2WPIS 4WMFA 2WV5A 3ATKA 2D1JA 3SV9A 5EPYA 1FY4A 1FMGA 5EXNA 1E37B 1ANDA 1SLXB 3VGCC 1CHOF 1DUAA 1N6XA 2A4RA 1L1GA 3PTBA 4KTCA 2TPIZ 4ABBA 1EAIA 1E35B 1ELEE 1P2IA 4B1TA 4F49A 4DY7B 1S0RA 1YC0A 1UHBB 1V2JT 1KXEA 4ZKNU 3QZQA 5E0GA 4B71A 1GBIA 4CRBA 1NROH 1UTLM 1ZYOA 2IJOB 3ESTA 3RM2H 1SGRE 2PHBA 1UVSH 1DSTA 1ELCA 1AZ8A 3DT0H 4FUIA 1O0DH 5HYOA 2ZHWH 4R8TB 1ELGA 1EPTC 2A7CA 1PFXC 1DPOA 3PB1E 2Y6TA 1ACBE 2DE8A 4BTUB 1ABIH 2VWOA 4BAKB 1PPGE 1UTQA 2ZPRA 4X6MA 1A3BH 1W0YH 1SPJA 2AMPA 4NWLA 2ZF0H 2ZTYA 1YPJH 1BRAA 1YLDA 4FUFA 4FU9A 1HIAB 1BA8B 4GCHG 1EQ9A 1JIRA 2BY9X 1UVTH 1VITG 1O3LA 2SNWA 4XOJA 1KDQA 4I8LA 1IQKA 3B8JA 3TPIZ 3F68H 1BT7A 4RSPA 4D76A 1TMBH 5L6NH 1JOUB 1LPZB 1PQAA 1NTPA 1FY1A 5GIBA 1NN6A 1F0UA 3A89A 4I8KA 1ZTJA 4Q7XA 3RXSA 1ELDE 1FY8E 3RXUA 3SU2A 2BLOA 1GHYH 2P3FH 2BQ6B 4AG1A 2AYWA 2OINA 2BY5X 2VU8E 2VB0A 2ULLA 1C5ZB 3ZV8A 4B2CA 2THFB 2VH6A 1TPPA 1ZPCA 1TMTH 3MI4A 3P8OA 4Y10E 1HJ8A 3SZNA 2P3UB 3K65B 2GV7A 1PPBH 1C2EA 1DVAH 3AW1A 1ANBA 1KLTA 1V2UT 2BXUH 1T4VH 1YBWA 1BIOA 2C8ZB 2CF9H 5A0BA 2QV1A 4YO9A 3G01A 2G8TA 5GWZA 5JBAS 1P06A 1Y3YA 4IS5A 1TRNA 2K1QA 3DHKH 4D8NA 1A2CH 3M3TA 4O3TA 3EA7A 1A5HA 1Y59T 1Z8RA 1NO9H 2BD5A 1O2XA 1GJCB 4E7RG 5AFZH 3RC4A 1FIWA 1XXFA 5GXPA 3OX7U 5EQRA 1TWXB 3S7KB 2RCEA 3BEUA 1FDPA 4HI3A 3SQHE 2WPJS 1FZZA 2OC7A 3MO3A 2A0QB 4XBDA 1P57B 1OS8A 1TQ0B 2Y82A 2O8TA 3RXQA 4B2AA 2Q6FA 1D3TB 1SGPE 1ZHMA 5A2MH 5EW2H 2HNTE 5FBIA 2SNVA 1DY8A 1ELVA 4NA9H 2BOKA 1GI2A 3NPSA 4I8JA 1UVUH 1SR5C 2BXTH 4LK4A 4Q2KA 4RKOB 3MWIU 1AZZA 3DUXH 4FUEA 4GPGA 2FEQH 1NFXA 2F9NA 1EX3A 3SHCH 4OS6A 5CMXH 2BX4A 1LKAA 1O3CA 2J2UA 1TAWA 4X1QU 3O8RA 1C5SA 1BTUA 4WJG2 3GY2A 5LPRA 2FI3E 2ODQA 3R3GB 1KXCA 4D7FA 1TALA 5T3HA 3AAUA 1FQ3A 2OQ5A 2ZHFH 1TNKA 1DICA 1TBRH 3T26A 1EOJA 3GY3A 3RMOH 2STAE 4D9RA 1MBQA 1NU7B 1AO5A 1BZXE 1G2MA 1L4ZA 5EU8A 1FY5A 2O8LA 2VVUA 4CRCA 3SGQE 1ZHRA 2P8OB 1OYTH 2QA9E 3PLKA 2AGGX 4CR9A 2QXJA 1F0TA 3TITA 1MUEB 1VGCB 1K1NA 1GMCF 2GGVB 4AFZA 2ZFPH 1T31A 1H1BA 2AIPA 1GBAA 3V12A 3F9FA 1O2YA 2G51A 1UTOA 1AVGH 1XUJA 1ZJDA 3S9CA 1WUNH 2GMTB 1P10A 1CGJE 2UWLA 3V13A 5EXLA 3BTHE 1ZSLA 1O3KA 2B0FA 2CGAA 2V3OH 1PYTC 4E05H 1D3DB 3TK5A 2FTLE 1V6DA 1SB1H 3OTJE 2OC1A 3A83A 2GV6A 4K60A 3SV2H 3LGIA 1QNJA 1DANH 2V6NA 1K22H 3K2UA 4Y8XA 3A81A 3TJOA 4JZIA 1E34B 2GDEH 4UONA 2P8OC 1LQDB 5C2ZA 4ZKRU 1AD8H 2RA3A 2ZC9H 2H6MA 1MCTA 2D8WA 2QN5T 4NZLA 1C9TA 2VJ1A 1VGCC 4E06H 1IHTH 2P94A 5LPFA 3CS7A 1Y3XA 1C2IA 1DITH 2FLBH 1FJSA 1N8OC 3SU1A 1EZXC 7LPRA 1WAYB 3KEEA 1BTPA 2TGDA 4X8UH 2J9NA 4X1RU 7GCHF 1AUTC 1SOTA 1IQHA 4K1EA 1ZLRA 1CHOG 1RS0A 3RXFA 4WY3A 4K69A 1NC6A 5EG4A 1BRBE 2HGTH 4WXIA 4IN2A 2VH0A 1QR3E 1W8BH 1D4PB 1PQ7A 2CN0H 1S83A 3KGPA 4ZKSU 3IWMA 1HJ9A 4Y8YA 4AFQA 1ZJKA 1AIXH 4ZROA 1GBHA 3UWJH 2CV3A 1WCZA 1GI5A 5LPEA 3KQEA 3SJKA 4UEHH 2Z9KA 3SU0A 3A8DA 1W13U 2HOBA 1O3BA 3I78A 4FUJA 1HPGA 1O30A 3BTDE 1WQSA 4GSOA 3A8CA 1MMJN 1D6WA 1K1IA 3M7TA 4B73A 4ABAA 3BTWE 1L4DA 1LO6A 1L1JA 2ZGJA 3LOXA 4AYVB 3P95A 3ZVFA 3P8FA 3KL6A 1F92A 1GJ6A 2ZTZA 1CVWH 1H9LB 4JZ1A 3ELAH 5E0JA 4BAMB 3BF6H 2ZO3H 2BQWB 5AVDA 1FPHH 1G32B 1GWAA 1P8VC 1GG6B 1GL0E 1NS3A 3NWUA 3SJ8A 4AORA 5L2ZH 1SGIB 2ILNA 2G5NA 3DA9B 3Q3YA 4IMQA 3TH4H 1K9OE 5FBEA 3PMHB 2BDBA 1CBWB 4FUCA 2W5EA 2ZDNA 1QB9A 1UTJA 2FM2A 2A5IA 1DWBH 8GCHF 2TRMA 1C9PA 2A5AA 1BJUA 2FS9A 4X6NA 3TGJE 4Q7YA 3RXPA 2UUYA 5TCCA 2ESTE 1EOLA 1EJMA 1O5FH 1OX1A 1NFYA 1NPMA 4AB8A 4DIIH 2FOHA 1TONA 1ZRKA 1NRRH 4OGYA 1DWCH 2BX3A 3V3MA 1V2WT 1P09A 3BN9A 5E2PA 2R0LA 1G3CA 1NRNH 2NU1E 3KHVA 3S7HB 2Q1JA 2XWBI 5DP8A 1O38A 3UPEA 3NUMA 2LNCA 1FONA 1TFXA 3C1KA 1VZQH 1GDNA 1C1MA 7KMEH 4WH6A 3FVFB 1EB2A 1EZUC 3HK6B 1ELFA 1WV7H 1GG6C 1TYNA 1MH0A 2Z3CA 1CBWC 1DXWA 1BITA 3UNSA 3QLPH 4KGAA 4K5ZA 1V2RT 2WPMS 4XBCA 5I46H 3QGNB 1Z8GA 2Z94A 2B5TB 3EE0B 3M7UA 1TB6H 3LGTA 2Y7ZA 3U8TH 2F9BH 2ANKH 1BTYA 3QZRA 2CXVA 4B75A 3M61U 4K1TA 1MZAA 1AFQB 1G3BA 1HCGA 1GCTB 3ATLA 2GCTC 1BTXA 3SO3A 1ZPZA 3RLWH 5HM9A 1Z8IB 1QJ1B 2Z9JA 1O2QA 2VIVA 2QGRA 1OSSA 3S9AA 1F5KU 1MTNC 4BTTB 3U1IB 5JBCS 2FOCA 3OU0A 1LHEH 3CP7A 2FTMA 3NXPA 4MLFB 3K9XB 1FNIA 1W14U 2XC0A 3EDXB 2OXSA 4BNRA 2WYJA 3V0XA 4HTCH 1LHDH 4NGAH 1UTNA 1MTUA 1KXDA 1O2NA 1YPLH 3P17H 1JIMA 1HGTH 3BTQE 2BDYA 4KTSA 5DGJA 5HGGA 3KF2A 3ODDA 2ZQ2A 5JB9S 4Y76A 1O3FA 1DDJA 1O5BB 3OSYA 1HBTH 1SC8U 4BXWA 3EA8A 3A85A 2JETB 2A1DB 1ZSJA 1DWEH 1BMNH 4AYYB 1LVYA 4Y11E 3SJ9A 1O3OA 1P9SA 5F8ZA 3UQOA 2FOEA 2J94A 5EQQA 3F9HA 1NRSH 1AFQC 4O9VA 2A4OA 2WUBA 1FLEE 2RA0A 4GUXA 4YTAA 1S0QA 2FOAA 1W7GH 3U8OH 1ID5H 1O39A 2GP9B 1GMCG 1GMDF 4MNYA 1BQYA 1FN8A 3GCHB 3SNEA 2NWNA 2PKSB 4FUBA 2PSXA 4SGBE 1FY3A 1O5DH 3GY6A 1GI3A 1C2GA 1IAUA 3VGCB 4YM9A 1QHRB 3M5OA 1ZMNA 3MU8A 4IMZA 4X8SH 1IQLA 2AFQB 1L1NA 1GI7B 1J17T 1T8OA 2ZGHA 1KTTB 1HXEH 2ZP0H 2BD8A 4GHQA 1IQJA 1QQ4A 3H7TA 1EKBB 3C27B 2JETC 3