3P8FA

Crystal structure of mt-sp1 in complex with sfti-1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of catalytic domain of Matriptase in complex with Sunflower trypsin inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ST14 protein
total genus 57
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p8fA01
2WUCA 1KTSB 2WV4A 1O3IA 1XUFA 1GMDF 4UONA 3AW1A 5DP6A 1NRRH 4IN1A 5HGGA 2J9NA 4K1TA 2PV9B 5K7RA 1TNJA 3AW0A 1TPPA 4I8GA 3NPSA 5LPRA 3MU4A 1A5IA 1GWAA 2YNBA 1WAYB 1LQEA 4I32A 3STIA 3U1IB 4GUXA 5CHAB 1HAVA 1JBUH 2FOFA 1SLVB 3FZDA 1Q31A 1CHGA 2AMDA 2ZHEH 2PTNA 3V3MA 4GHQA 1ARCA 2AS9A 4NA8A 3QN7A 1SGDE 4AN7A 1BIOA 4GCHF 1XM1A 1DS2E 1BOQA 1NRPH 2FLRH 1SFQB 3SJ9A 4Q7XA 2A4RA 1MU8B 1Z71A 1PJPA 4X8UH 3LOXA 4X1QU 1MD7A 1K1NA 1UVTH 3SGBE 3SNAA 4YOIA 1TLDA 1BBRK 4CHAB 1EAUA 1XKAC 3MU0A 4FU9A 1Z6JH 2BMGB 5EXLA 3SO3A 1O2YA 1F5LA 4ABDA 4FUCA 3TIUA 2VGCC 4YOGA 2BY6X 1BRBE 4DT7B 1H1BA 3SV2H 1E37B 7ESTE 3NWUA 1MTVA 1GVZA 3SNDA 1ESAA 2OC7A 1FNIA 1MMJN 2ZO3H 3MMGA 3PWBA 5FCRA 3UIRA 2XC0A 2BY9X 1XVMA 4ISIH 2DUCA 1ID5H 1QCPA 4FU7A 3DHKH 1C1SA 2ZC9H 1S0QA 1YPMH 3A7XA 5TJXA 3OY5U 3MNXA 1BJVA 2BVXH 3P70B 3PV4A 3SV6A 3GY4A 3K6ZA 2F91A 1GJBB 2NU3E 1CO7E 1O2OA 2C4FH 5E0GA 4X8TH 2F9BH 2VIVA 1SGPE 4BNRA 3M7UA 9LPRA 2ZDLA 1UJ1A 3G01A 1H9LB 4X6MA 4X2VA 4WH6A 1KXCA 3BIVH 1BRCE 1ESTA 1PPHE 3RXIA 1LPGB 1TPOA 5A09A 1DOJA 1Z1IA 4NZLA 1S83A 4FU8A 1YBWA 3HK3B 3MFJA 1T31A 3P6ZB 2ULLA 2Y82A 4I8JA 1ETTH 4RSPA 3S9BA 2VVCA 4X6NA 2OUAA 1TA6A 3SUFA 5JB8S 4AYYB 1OXGA 1AHTH 2SFAA 1NO9H 3E16B 1TGNA 1ELBA 1YPGH 3PYHA 3K6YA 1UHBB 4CH2B 2PKSC 1SGQE 3MNSA 1C2MA 1GI1A 2PGQB 1BMLA 3I29A 5EQQA 2ZDMA 1GJCB 1KXAA 3O8BA 4BTIB 2WPKS 1O2TA 4X6OA 1LDTT 1ELAA 3RXPA 4X8SH 1N6YA 2ZDAH 2QA9E 3DT0H 4MVNA 1O31A 4AB8A 1GJ6A 1VGCC 1A46H 2H5CA 2SGAA 1GMCG 1K1MA 2RDLA 1J9CH 2BDIA 1P2JA 1KTTB 1ZHMA 1TMUH 1OWDA 4ZH8A 1CGJE 4J1YA 4X1NU 1AUTC 3BG4C 1MUEB 1C1TA 1UMAH 2Z9KA 1HPGA 3M5OA 4A1VA 2TRMA 3FAOA 2ZP0H 1BUIA 1EZUC 2AIQA 2BY5X 4AOQA 3L33A 2EEKA 1HIAB 2F9PA 1SI5H 1DUAA 1C9TA 1QL8A 1SHYA 1ANCA 1ZJDA 1NM6A 2ZZUH 3BTDE 5HMAA 3TJOA 1C5OH 1GL1A 1HAPH 1YCPH 1C2DA 5FBIA 1ELTA 2QXGA 1OS8A 1Z8GA 2R0LA 4I8HA 1Y3YA 1OX1A 1TOCB 2H6MA 4JZ1A 1AFEH 1J15A 1G2LA 2AGIX 2XW9A 3M7QA 4HTCH 5GJ4B 4SGBE 1SGYE 3TH2H 2BD9A 1C2EA 4ZHLU 4ZXXH 1QGFA 3I77A 4J2YB 4NIYA 3S9CA 2HVXA 2AGGX 3B9FH 4UFDH 5DG6A 3GCTF 5C3NA 2R0KA 3MH5A 1YPKH 5T6DA 1TNGA 3VGCC 4TYDA 3PROA 2H9HA 2WPLS 3B8JA 1S6FA 1M9UA 1PYTC 4B2AA 3ZZDA 2GP9B 2QCYA 4IW4E 1O3EA 2ZHQH 1A2CH 2ZHDA 1F92A 1HAZB 1P3CA 4ABAA 4X0WU 4I33A 3RMNH 3SJ8A 2AEIH 3V12A 1O34A 4ZMAH 4ABEA 3D49H 4Y71A 2NU2E 1A4WH 1H9HE 4ZHMU 2ZGHA 3TH3H 3MNBA 1V2PT 3F9EA 1UTQA 2J38A 1SMFE 1Z1JA 2OQ5A 3RM2H 3KHVA 1C4V2 3TJNA 1MTNC 4VGCC 4INHA 2FTLE 5CE1A 5J4SA 1C5UA 4NIVA 6CHAC 1B7XB 1V2NT 1FN6A 4FUEA 2IPHA 2FOCA 1EAXA 3LGTA 2G5NA 1PQ5A 3A8BA 3W94A 1J8AA 4NSVA 2HNTC 3GOVB 2OQUA 4INLA 1P57B 1UCYH 2BOHB 3TK6A 3CP7A 3U98H 5I46H 2HNTF 2D2DA 4XSKU 5J4QA 1OWKA 1RIWB 4MPXA 1ELGA 1TQ0B 2FOBA 5FBEA 1WV7H 1OSSA 3EA9A 1EZQA 2W7UA 2VWNA 4CRCA 4ISLA 4Y8YA 3UTUH 4MNVA 1MTNB 1TQ7B 1AKSB 1TNIA 3NUMA 3ZVEA 3O8RA 1YPHC 1NESE 1QIXB 3UOPA 3P8NA 1W7GH 5FPSA 1CE5A 2XC4A 3P8GA 3N7OA 3EDXB 5FCKA 1FY4A 4H4FA 4ZAEA 3M5LA 2STBE 1A0JA 5A8XA 4ABIA 2ZQ2A 1P01A 1TRYA 5EOKA 1WBGB 1ZGIA 1EAIA 3ZZCA 3MU1A 3MH4A 3KNXA 3ESTA 1GHXH 2Q1JA 3ZYDA 1YPJH 2Q6DA 4UEHH 1O3OA 2Z94A 3PWCA 2WUBA 3UWJH 6GCHF 1PQ7A 1UCYK 1YPHE 1EJMA 1C1NA 2KAIB 2FX6A 4QT8C 1XUGA 1QQ4A 1BT7A 1V2JT 1KXEA 1O2ZA 2FI4E 3RXBA 4D8NA 1LVMA 2GCTB 2XCFA 4DIIH 3S7KB 1C2IA 1KIGH 1E35B 2CXVA 2ZWLH 2OBQA 2P8OB 2PSXA 1ELEE 1BHXB 1E36B 4AFSA 1ANBA 4AGKA 1K28D 1QA7A 2IOTA 4E7RG 4GAWA 1AKSA 1P02A 5A2MH 3ZZ3A 1YKTA 4WVPE 2J34A 3FFGA 5T6FA 2WV5A 3TNSA 1B5GH 1IOEA 1DFPA 2G4TA 2LNCA 4IMZA 1T8LA 1V6DA 3A81A 4E06H 2GMTC 3HPTB 1W11U 2PFEA 4D7FA 1ZZZA 2FXRA 1F0TA 2NU4E 2W26A 4WMDA 2B7DH 3V13A 1O3NA 1NRNH 1NROH 1E38B 1W13U 3T26A 1TE0A 2QIQA 1KDQA 3UNQA 2THFB 3GDVA 2P3UB 3MH7A 1HJ9A 5C1YA 4ISNA 1D6RA 5C1XA 1BQYA 3RXEA 1HFDA 1XUJA 2Y6TA 1CT2E 1C1PA 3RXTA 4WY3A 4CRDA 1W2KH 2GDDA 1HAHH 1ANEA 2ZFTA 3OYPA 1P03A 1C5NH 2AIPA 3ZZ5A 1TGSZ 1WTHD 1O3GA 1O2IA 3T27A 1WUNH 2BB4A 4BOHA 3JZ2B 2FIRH 2BDBA 5FPYA 2VIWA 1O2XA 4K1SA 1WQSA 3U8TH 2OP9A 5IDKA 1K9OE 1DANH 3GCHC 3SU0A 3RLWH 2VH6A 4XOJA 2H1UA 2ZU3A 2ZIQH 2RA0A 1U6QA 3SU1A 1ZSLA 2VIQA 3WY8A 1W7XH 4GPGA 1LTOA 4MG3A 5L30H 3E6PH 1MBQA 1EJNA 5T6GA 1WYKA 3ZVDA 3MH6A 1ZPBA 1GJAB 2R3UA 3AVZA 3KN2A 3ZZBA 1FY3A 3P17H 4Y11E 1HGTH 2ANKH 1SPJA 1BTWA 1QURH 3RC4A 2CMYA 1VZQH 1DWBH 1PYTD 2XBWA 1CHOF 5E8EH 5EW2H 2FOAA 4K5ZA 1W0ZU 1PQAA 2Y7XA 1KDQB 2P8OC 1HCGA 1O2JA 3Q00A 2BZAA 1TNLA 1GJ7B 2ZTYA 1ZLRA 1O5EH 3K65B 4K8YA 1QJ1B 3UNRA 2O8WA 4JZFH 1P05A 2W3IA 1THPB 3RU4D 1DLKB 4WXIA 3VB6A 1DWEH 1SGEE 1P2QA 1A3BH 4FUDA 3ZV9A 3IG6B 1ZGVA 1NC6A 1GI5A 4FUJA 2G81E 2VWOA 3UUZA 1HDTH 1TRNA 1Y59T 1TYNA 1O3FA 1YYY1 1IQEA 1DLEA 1CVWH 2HPQH 4Q2KA 4X8VH 4A1TA 2ANYA 1RGQA 1CSOE 1TRMA 3F9GA 5SGAE 3SUDA 2FI5E 1O35A 3SU6A 2A31A 1EPTA 3RU4E 1O3BA 1OYQA 3QGNB 1YCPK 1HAYB 5EQSA 4BAMB 1F2SE 4F4OC 2Y81A 1ZPZA 1NU7B 3C1KA 5E0JA 2ODQA 1ARBA 5IYTA 2Z3DA 5EGMA 3RXKA 3SI4H 2W7SA 1LHDH 4WMEA 1FPHH 4UDWH 3SI3H 1BB0B 1N6XA 2FOHA 4H6TA 1Q2WA 2GD4B 2XWBI 1RS0A 1XVOA 3UREA 1O2MA 1GMCF 1HV7A 4ZHAA 3Q76A 1GBDA 2A7JA 3PMHB 1EATA 2UWLA 4JK5A 2RA3A 1TGTA 3Q77A 1T7CA 2ZQ1A 3RXDA 1PFXC 1ACBE 2A2XH 2WPMS 4BAQB 3E0PB 3QGJA 1O33A 3VXEH 1C1OA 4CRBA 3D62A 2CF8H 3V0XA 1D6WA 2FLBH 2ZU4A 4I7YH 1Y5BT 4YLQH 4NWKA 3KIDU 1F7ZA 3URCA 2TGDA 7LPRA 1T32A 1CBWC 3RC6A 1KLTA 4AFZA 2PUXB 1GBCA 3KEEA 1MKXK 4GLYA 1GHYH 4XFQA 2OINA 1ELCA 3A7WA 4ZKOU 4TPYA 4WH8A 2QGRA 5EPNA 4NZQA 5JPMH 3FZZA 3OU0A 1V2WT 1OWHA 2Z9IA 4X2WA 1FY5A 2OD3B 2Z3EA 1AD8H 1ELDE 3FANA 1BMNH 1DXPA 1BDAA 3KQEA 1QR3E 1TABE 8LPRA 3BEFB 1O2NA 2VH0A 1QL9A 4JYVH 3RLYH 2ASUB 1FQ3A 4Y8XA 4CR9A 1DE7H 2FPZA 1O3LA 2FP7B 4DY7B 2GZ8A 1F0SA 3PO1C 5EXMA 4AORA 3GDUA 1DDJA 1EKBB 1W12U 4K1EA 7KMEH 1BA8B 2G8TA 1NFUA 1GBBA 4ISOA 1JIRA 1SSXA 4IMQA 1EB2A 5DP9A 3TGKE 2O8UA 3LJOA 4MDSA 3VB7A 5DP3A 1IQKA 2QXHA 1IAUA 1HBTH 3A7ZA 2G55A 1A7SA 4IGDA 5DP7A 1V2LT 4FXGH 2ZPRA 3A80A 3QWCH 2FM2A 3PTNA 4Z0KA 2QV1A 1GHAG 4OS5A 4A5TS 3B23B 2RG3A 4YM9A 1GBMA 1P9SA 4CR5A 1SLUB 5E0HA 2PSYA 1AZ8A 3T2NA 3IWMA 3T29A 4RKOB 1C5VA 3LGVA 4IN2A 2A4GA 4XDEA 2ZGXH 1ZOMA 1Z8JB 1V3XA 4AGJA 1TX8A 2GT7A 1O2HA 3GY6A 5F8XA 3LPRA 1IQMA 4K2YA 4KTCA 1QRWA 1C5WB 4Y79A 4LXBH 2BXUH 4BXWA 1C1QA 1IHSH 2ZGCA 2J92A 1YGCH 4TPIZ 1NS3A 2P95A 3A7TA 1RTKA 3PTBA 1C2LA 5TCCA 1W14U 4I8KA 4OS7A 1SB1H 4Y8ZA 5EW1H 1ESBA 1PPFE 2C93B 1GI4A 1TPSA 2HGTH 1RD3B 4B76A 2ZPSA 1C5LH 2GCTC 3SGAE 3TK9A 4WJG2 4ZKRU 3RXRA 1GJ9B 1O3AA 1LQDB 2HWLB 1CT0E 1GMHG 4Y7AA 4AG1A 1OP8A 5F8ZA 1AFQB 1KXDA 1UCYE 2A5KA 1ZTJA 3ZZAA 2A7CA 2QAAA 2J2UA 1EPTC 1P04A 2V0BA 1WOFA 5TCAA 1P2KA 3SUEA 2F9UA 1JOUB 3R0FA 1LPZB 4GVUA 3A85A 2VGCB 1GI2A 5FPTA 2YNAA 4X6PA 5E2PA 5EQRA 4HZHA 1O3PB 5FHTA 2GKVE 3EE0B 2OC8A 3RXAA 2B8OH 1KLJH 2XRCA 1OYTH 3GY8A 1GCTC 4B75A 2WYGA 3EYDA 3R3GB 5HM2A 1K1LA 4BXSA 1SGFA 4FUHA 3T28A 3EGKH 2PKAA 1OOKB 2GGVB 3M7TA 2F9NA 1V2QT 1KYNA 3SGQE 3HGNA 2CHAB 1C5XB 1UK2A 4OS6A 3SNCA 1FPCH 1EPTB 3FP8E 1KXFA 1EXFA 1IQFA 4IC5A 2PUQH 2WINI 3SUGA 1ZMJA 5JBTA 1FZZA 3EAJA 2O9QA 2BY7X 4H42U 1MAYA 1L2EA 1NN6A 4ABGA 2B9LA 1SHHB 2JH5D 3M37A 2H9EH 3RXJA 2BQ6B 1DICA 4E05H 1G2MA 3P92A 2BD7A 4IS5A 2UUJB 4DJZB 3ZYEA 5T3HA 1P11E 3RXOA 4MNXA 4Q7YA 5H4IB 3A8CA 1EOJA 3ZVCA 3U69H 2FTMA 2GVFA 1TPAE 1BTZA 1GBEA 3A8AA 4RN6A 1L1GA 1ANDA 5LH8A 1GGDB 4XBCA 3P8OA 1LKBA 3SJKA 2B5TB 2ZFQH 5GPIB 3BTGE 2Z6BD 2A5IA 2QXJA 2TBSA 1JWTA 2ZFFH 3GYLB 1S84A 3VGCB 1SGFG 1V2TT 3PB1E 1EX3A 4XBBA 1V2ST 2SGFE 1RJXB 1AO5A 1EUFA 6GCHG 1AE8H 3PLKA 5DP4A 1DM4B 1SR5C 4H6SB 5E2OA 2CGAA 2YOLA 4MPUA 1LVBA 1ELVA 1TBRH 1VJAU 5DPAA 2IJOB 1TIOA 1EP5A 4LZ4B 2BX3A 1G3BA 3ZZ9A 1GL0E 3MO9A 3ZZ6A 1G37A 4O3TA 2ZU5A 2STAE 3KQDA 2ZDKA 1DY8A 4MLFB 5PTPA 1F0UA 1AQ7A 1FAKH 4JZIA 4D7GA 3E1XB 2ZGBH 4B2CA 1LKAA 2QXIA 3KGPA 1UTMA 2C8WB 2XYAA 4Y7BA 2BLQA 4KGAA 5EPYA 2VINA 1HAOH 1GBTA 1QBNA 1GVKB 1AVGH 1AY6H 3MO6A 1GVLA 3BG8A 3ZZ4A 2A32A 2WPHS 4Y76A 1J17T 2ZNKH 1P8VC 2KAIA 2VWMA 3ZVAA 1MZDA 5LPEA 4OGXA 3O8DA 2ZTZA 3TGIE 1GI7B 3U8RH 2CF9H 2FO9A 2PWXA 1G3CA 4XBDA 1C2JA 1DWCH 1UVOA 3BTME 2JETC 1NRSH 1FI8A 2ALVA 3F68H 3ZVBA 5L6NH 1OP0A 1TMBH 1E0FD 2VIPA 1O32A 1FV9A 1AB9B 1G30B 5CHAC 4BANB 1GI6A 3V7TA 4GCHG 4NGAH 2XWAA 4I31A 3ZV8A 1UK3A 1O3MA 2G5VA 1O5DH 1NT1A 2XBXA 2G51A 2BD4A 4AFQA 2ZCLP 2FI3E 3A84A 2B0FA 4LZ1H 3M35A 5GWZA 3MOCA 1TOMH 2WPJS 2ZEBA 3DFJA 3GCTG 1BBRE 1AIXH 1TMTH 4BTUB 2GCHF 1TA2A 1WCZA 2ZFPH 4TWWA 1Y8TA 1HB0B 2P59A 3HGPA 4D9QA 5A0AE 2FEQH 1DVAH 1UVPA 4JYTA 5BPEA 3E8LA 3IITA 1QHRB 4MPWA 1TONA 1VCQA 1P2OA 3SZNA 3RMMH 1C1UH 1XUHA 3TITA 4AB9A 1KSNA 1BITA 1K1JA 1AFQC 3UY9A 1C5TA 4FVDA 3SV9A 3DD2H 2BD2A 2PHBA 2Z9LA 3HATH 4GSOA 3UQVA 2G4UA 2BVSH 1O2LA 2HOBA 5GXPA 2V35A 2HLCA 1IQHA 2FOGA 4DGJA 3HK6B 3LC3A 1LVYA 3GCOA 2A0QB 1S82A 3RMLH 3BTKE 1EASA 1NTPA 1BTUA 1ZR0A 3BTTE 1GDNA 4X1PU 1SQTA 4UE7H 1GBAA 2K1QA 2FOEA 2ZKSA 5GIBA 1CA8B 1Y5UT 2FDAA 1LCYA 1FLEE 3TNTA 1FUJA 1G9IE 1XUKA 1CU1A 4JMYA 2SGDE 1C1VH 2AH4X 3ATIA 3TJUA 2VB0A 3QZRA 2ZDVH 5JBBS 3A87A 2Z9GA 2V3HH 2VNTA 1XKBC 3I78A 4KTUA 3QK1A 2FS9A 1NU9A 1BRUP 4B74A 4YO9A 2EA3A 1H8IH 1H4WA 1C5YB 1QY6A 3TVJB 4A92A 3LT3A 4ABJA 4CRAA 5A8YA 1C1WH 3VFEA 5DO4H 4K69A 2XC5A 1HYLA 4ASHA 1QA0A 1K1IA 1TBQH 2TIOA 1UK4A 1SOTA 1SGNE 1ZRBA 4A6LA 1DSTA 2ZU2A 4BTTB 3S69A 1HIAA 3SJOA 3A7VA 2AYWA 4X1SU 1RTFB 4XE4A 3VB4A 3TPIZ 3PMJA 4NCYA 1TAWA 1THRH 3EA7A 1O2PA 1LVOA 3RXSA 1C9PA 1MD8A 2VJ1A 1O2KA 1PPBH 1ZTLA 2BQ7B 1HAXB 1K2I1 3NZIA 1YLCA 3QDZB 1QTFA 2Y5FA 3ZZ7A 1UVSH 1ZMLA 1VITH 1HXEH 4D9RA 2F83A 4TY6A 2C8ZB 2DE9A 1P2MA 3CS0A 2C8YB 4MNWA 3UNSA 4DIHH 2PTCE 3LONA 5DGJA 3RU4T 3SORA 1D3QB 1ZSJA 3ODDA 3RP2A 3A7YA 2GT8A 2Q6FA 1K1PA 2Y7ZA 2Y5GA 1BBRH 9ESTA 2PW8H 5DP5A 1TX7A 3GY5A 3NCLA 4ZKSU 2GZ9A 1IQIA 1UTLM 4UFGH 1TX6A 2BXTH 5HXFA 2FYQA 3VB5A 1CA0C 3SQHE 2ZPQA 3MWIU 5BRRE 4YLUA 2BX4A 3RXMA 1IQGA 4AFUA 2ODPA 1P06A 2A5AA 1TGBA 1BCUH 3ATKA 3PLPA 5HYOA 1HAGE 1VR1H 3M5MA 2HRVA 2ZFRH 3QLPH 3RXUA 1EJAA 2BHGA 2FX4A 1ORFA 1ZPCA 3AAUA 2BLWA 3D65E 3A82A 4UD9H 4ABHA 4B73A 1DPOA 4B1TA 3EQ0H 1O3KA 3STJA 1SQAA 1B0FA 3LDXH 1LMWB 3ATLA 1V2KT 2GV7A 4A7IB 1DUEA 1ABJH 1SGIB 2O8TA 5F03A 4R8TB 1VITG 3ENSB 4MPVA 3MO3A 5EU8A 2O8LA 3PLBA 2J4IA 2XBVA 1O5GH 2P3TB 2NWNA 1TNHA 3TU7H 2A4QA 3LC5A 1CBWB 3RM0H 2D8WA 2HPPH 2EI7A 1QB6A 1O5CB 1SGCA 2ZFSA 1H8DH 3BTFE 2P93A 4DVAU 3SU4A 1W10U 4D76A 3QUMP 1JXPA 5C5NA 8GCHG 1ZHRA 3BN9A 4NIWA 1C5SA 2XTTB 3RC5A 1GI3A 1C5MD 2BQWB 3NKKA 1FY1A 1SQOA 1ZMNA 3TH4H 3GY7A 1JRTA 5CMXH 4DURA 1NFYA 1GBLA 2QN5T 3VEQB 4UFEH 1DXWA 2ZG0H 5EG4A 1QJ6B 5L2ZH 1GGDC 2FMJA 3UR9A 1GHWH 1AVWA 4SGAE 1NZQH 2VWLA 3F6UH 2I6SA 3QZQA 1RIWC 1AUJA 2FESH 1LHEH 1K21H 1AWFH 3BTHE 4BAHB 3LU9B 1AMHA 1GI9B 2ZECA 5DP8A 2SGEE 3C27B 1GBKA 1C2FA 1C2KA 3QTOH 3LH1A 4NSYA 1HUTH 5B6OA 4DOQA 2JH6D 3DA9B 1UO6A 1UTKA 2AFQB 1FN8A 1ETSH 1O5AB 1V2VT 6CHAB 1L4ZA 2ZI2H 1G32B 3VPKA 3KF2A 1MCVA 1YPEH 4IBLH 4FUGA 5AVDA 3T25A 3FP7E 1LPKB 1BHXF 1C1MA 1DT2A 1S6HA 2SNWA 1SVPA 1RXPA 2PLXA 3SHCH 3BIUH 1BMMH 1P10A 2TPIZ 4Y0YE 4WXVA 5C67A 3MNCA 4Q7ZA 2FOMB 2GTBA 2JETB 1P12E 2OC1A 1HJAC 1A3EH 1Y5AT 1SG8B 2HALA 3OSYA 1O3CA 2ZDNA 2Z9JA 1S81A 3SV8A 3TLOA 2W3KA 3MHWU 4Y0ZE 4HI3A 2ANMH 3EA8A 3RXGA 4U01A 2GDEH 1FY8E 1GI8B 1AGJA 1WQVH 3H7TA 2R3YA 1BJUA 5AF9H 1YC0A 1CA0B 2C90B 4TY7A 1ETRH 4O9VA 1B0EA 2G00A 1IQNA 2DE8A 1XMNB 1S5SA 1GBFA 1AB9C 5AFZH 1TBZH 4E7NA 1AWHB 1SL3A 5ESTE 4NFEA 2A1DB 2HNTE 2OCVB 2BY8X 2GX4A 5ETXA 3BTWE 2ZF0H 4Y6DA 5FX5A 2Q6GA 5FAHA 1P2NA 1P09A 4CRFA 1W0YH 1FAXA 2BDHA 2ESTE 5JYIA 3Q3KA 4X1RU 1FJSA 4U30A 3BV9B 2AMQA 3K9XB 1G3DA 1GHAF 1P9UA 2FWWA 1GCDA 4KKDA 5G4BA 1HRTH 2BD3A 4KTSA 1OPHB 3BF6H 3U1JB 3F1SB 1SGRE 2ZGJA 1TWXB 2ZCKP 8GCHF 4ESTE 2Y80A 3ELAH 2F3CE 3T62A 4NG9H 2LPRA 2PKSB 3ATMA 2C8XB 2VVVA 1O39A 1S85A 1Y3WA 1Z6EA 3GDSA 3PM3A 1O2VA 2XBYA 3QTVH 1FONA 1O38A 2FYRA 1O37A 1MCTA 2XXLA 3GISB 1O2RA 1ZRKA 4O3UA 4FUFA 4UFFH 1FDPA 4YOJA 1RTLA 2FS8A 7GCHF 2UWOA 1JIMA 1K1OA 3RXFA 2PR3A 3SU3A 3RXCA 1BTYA 1D3DB 3M5NA 4ZUHA 3A89A 1YCPM 4OS4A 2D1JA 2UWPA 1MQ6A 3SHAH 1V2RT 1F0RA 3BTQE 3UWIA 3OX7U 2QYIA 2NU1E 2H5DA 4KP0A 4MNYA 3RXVA 1T8NA 2OTVA 1MKXH 8ESTE 1OWIA 2ODYB 3SJIA 3SBKA 1EP6A 2TGPZ 1IQLA 1GPZA 3MI4A 3TK5A 1C5ZB 2CJIA 1ABIH 3SOSA 1LHFH 1LHGH 1GI0A 2C3SA 1Y3XA 2WYJA 4FVBA 2BLOA 1CGIE 1AE5A 1HAIH 1IQJA 1YLDA 3UOUA 2BLVA 1S0RA 3BSQA 1YF4A 1QRZA 3BG4B 5FXLA 3NXPA 1GHBG 1GHVH 4ABFA 2OC0A 3LJJA 5LGOA 4Y10E 4U32A 3PMBB 1Z8IB 1EQ9A 1UVUH 3SW2B 2V6NA 4YESB 1F5KU 1A5HA 4AYVB 3QO6A 3ITIA 5JBAS 1T4VH 1A5GH 3A86A 4WWYA 1BTPA 5GCHG 1YM0A 3F9FA 1UTNA 1D3TB 5C2ZA 1AN1E 1DWDH 3AASA 3M3VA 2WPIS 3UR6A 2IN2A 1O2QA 3RXHA 5JBCS 4INKA 1P2IA 1NRQH 1HLTH 3RXQA 4B2BA 1OKXA 8KME2 3GYMA 2RCEA 3P95A 1ZHPA 1C5PA 1Y3VA 2SGPE 1EB1H 1SLWB 4OS2A 1HXFH 5F6MA 4AG2A 2EI8A 4MTBA 1A61H 1NFXA 2SGQE 3F9HA 2P3FH 2VVUA 3RMOH 2BOKA 3MU5A 2ZA5A 1G3EA 3GY3A 3GCHB 4JZEH 1GJ5H 3HKIB 3T5FH 3LGIA 1MZAA 4LOYH 1AVXA 2JKHA 3O8CA 3E91A 2H9TH 2Y5HA 1O2UA 3RDZA 2A45B 4THNH 1LHCH 1HAVB 3HKJB 3RUOA 1MKWH 3E3TA 4U2WA 4CREA 4KELA 1L1NA 3H5CB 3BEIB 4TWYA 2R9PA 1GG6C 1UTPA 4IC6A 1QBOA 2SNVA 2BD8A 6ESTA 3MTYA 3QX5H 3SU5A 1O3HA 3FVFB 2R2MB 4ZXYH 1Q3XA 2BYAX 5A0BA 1RFNA 3MYWA 2TGTA 3LH3A 4ABBA 2QC2A 4OS1A 1OP2A 1KY9A 2NU0E 1T8MA 1O2WA 1QNJA 1CGHA 2UUKB 1NFWA 2G52A 1MTSA 2BTCE 5GCHF 2J95A 1C5QA 1PPEE 3URDA 1QL7A 2J94A 1E34B 1AI8H 6LPRA 2GZ7A 5HM9A 4YTAA 1QB9A 1QBVH 1ELFA 1C4Y2 4YT7H 2VIDA 5L2YH 5A0CA 3TGJE 3CS7A 4CHAC 1UTJA 2O8MA 2ZCHP 3UQOA 4Z6AH 3M3SA 1P3EA 1K22H 1C2GA 1UHBA 2ALPA 3A8DA 2A2QH 5C5OA 3OY6U 3SNBA 3KCGH 3CENA 2ILNA 1HNEE 1BRAA 4CRGA 3ZZ8A 4NWLA 1BTXA 2A7HA 3S0NA 1D4PB 4R0IA 3SV7A 4AX9H 1C5RA 1GBJA 1RRKA 2W5EA 4AZ2B 1QQUA 4CBOA 1KXBA 2PGBB 4HFPB 2ZHFH 2BZ6H 1MKWK 3JZ1B 1HJ8A 3LGWA 4O97A 4CH8B 1N8OB 1ZSKA 2GV6A 1BMAA 5A8ZA 3LGUA 1QFKH 3NK8A 1PPCE 1EZSC 3Q3YA 4K3JA 1V2UT 1PQ8A 1Y3UA 1G36A 2F9VA 2ANWA 3UFAA 2GMTB 3KL6A 5ABWA 4MQAA 1DX5M 5C1UA 3S9AA 3VXFH 1CT4E 1LO6A 1VITF 2CN0H 2GCHG 2FZZA 1GJ8B 3PO1B 2A4OA 2P94A 4K8BA 4DW2U 4RKJB 3E90B 1O30A 3ATWA 3M36A 2BM2A 2F9OA 4NIXA 4ZKNU 2V3OH 1O3JA 1W8BH 3U9AH 1KLIH 4ZROA 1PPZA 4NA7A 3PMAB 1WTGH 2TGAA 4FUBA 2AGEX 1GBHA 4JZDH 1VGCB 1BZXE 1TB6H 3M3TA 2EC9H 4JYUH 3VB3A 7GCHG 3DUXH 1V2MT 4F49A 4YZUA 4YT6H 3L6PA 1GHBF 1GJ4H 1O3DA 3A88A 1PPGE 1DY9A 1L0ZA 1V2OT 3KQBA 1D9IA 3U8OH 2Z7FE 4OGYA 1FMGA 1F5RA 1EZXC 1Z7KA 1WU1A 1TALA 1JRSA 4JK6A 4A1XA 1GCTB 2Z3CA 4HGCA 3ZVGA 1XXFA 1MTWA 3GICB 2VIOA 1H9IE 3A83A 3SNEA 1ZYOA 2OXSA 2CHAC 4FUIA 1WSSH 2VU8E 1GHZA 1HJAB 3L3TA 4PROA 3GCNA 2FODA 4BAOB 3LGYA 1J14A 1FIWA 1N1LA 1T4UH 2CV3A 2AMPA 5JB9S 5EXNA 2H2ZA 1YP9A 5ESBA 3KQCA 1GBIA 1C1RA 1SGTA 1T8OA 1SLXB 1TNKA 1ZTKA 2D26C 1P0SH 1A0HB 2QY0B 4JCNA 1DSUA 1SBWA 1MQ5A 3E0NB 4DG4A 1INCA 4LK4A 4WMFA 1X7AC 2BD5A 5GDSH 1GDQA 1GDUA 5F8TA 3BTEE 2BVRH 3P8FA 1XUIA 2QF0A 1MTUA 2ZU1A 1TGCA 1O0DH 1QRXA 2QF3A 1ZJKA 1UTOA 2PKAB 1GMDG 1SC8U 1CHOG 4ISHH 4CBNA 2XNIA 4BAKB 1N8OC 3LIWA 1O36A 5DKMA 2UUFB 4DCDA 1OWJA 1JMOH 3ZVFA 4X2XA 1CQQA 1GJDB 2BDCA 2BDYA 2M5TA 1J16A 4M7GA 1TFXA 1Z8RA 2XCNA 3LKWA 1A1RA 1FXYA 1SFIA 3ODFA 4B71A 5DK1A 1QB1A 3SN8A 3FP6E 5EODA 1THSH 4VGCB 3W95A 1AZZA 1QJ7B 2JH0D 2BDGA 3OTJE 5C20A 5JDUB 5LPFA 1W3CA 3S7HB 1MAXA 1O5FH 1BTHH 1SOZA 2I6QA 4K60A 1D3PB 1YPLH 5I25A 5AHGH 3M61U 1GMHF 1OWEA 5FX6A 3RXLA 1VCPA 1NPMA 3BEUA 1O2SA 2OBOA 2P16A 1EOLA 2BDAA 5DJ7A 3UPEA 5AFYH 3D23A 4NFFA 1O2GH 1VJ9U 1A0LA 3SQEE 1FIZA 4NA9H 2ZHWH 3H7OA 1MU6B 1C4U2 1O5BB 1VCWA 1AU8A 2ZTXA 3GY2A 4O03A 1MH0A 1L1JA 1XXDA 2AERH 4GHTA 2OLGA 1EAWA 4I8LA 4Q80A 3Q3XA 1GG6B 5K0HA 4WF8A 1C2HA 1IHTH 3K2UA 1XX9A 4X2YA 2R2WU 3AAVA 3MU8A 3SU2A 1L4DA 2UUYA 1DITH 1MBMA 3DFLA 3TJVA 1NY22 2EI6A
chains in the Genus database with same CATH superfamily
2WUCA 1KTSB 2WV4A 2JJ1D 1O3IA 1XUFA 1GMDF 4UONA 3AW1A 5DP6A 1NRRH 4IN1A 5HGGA 2J9NA 4K1TA 2PV9B 5K7RA 1TNJA 3AW0A 1TPPA 4I8GA 3NPSA 5LPRA 3MU4A 1A5IA 1GWAA 2YNBA 1WAYB 1LQEA 4I32A 3STIA 3U1IB 4GUXA 4OM9A 5CHAB 1HAVA 1JBUH 2FOFA 1SLVB 3FZDA 1Q31A 1CHGA 2AMDA 2ZHEH 2PTNA 3V3MA 4GHQA 1ARCA 2AS9A 4NA8A 3QN7A 1SGDE 4AN7A 1BIOA 4GCHF 1XM1A 1DS2E 1BOQA 1NRPH 2FLRH 1SFQB 3SJ9A 4Q7XA 2A4RA 1MU8B 1Z71A 1PJPA 4X8UH 3LOXA 4X1QU 1MD7A 1K1NA 1UVTH 3SGBE 3SNAA 4YOIA 4TSFD 1TLDA 1BBRK 4CHAB 1EAUA 1XKAC 3MU0A 4FU9A 1Z6JH 2BMGB 5EXLA 3SO3A 4Z1MD 1O2YA 1F5LA 4ABDA 4FUCA 3TIUA 2VGCC 4YOGA 2BY6X 1BRBE 4DT7B 1H1BA 3SV2H 1E37B 7ESTE 3NWUA 1MTVA 1GVZA 3OE7D 3SNDA 1ESAA 2OC7A 1FNIA 1MMJN 2ZO3H 3MMGA 3PWBA 5FCRA 3UIRA 2XC0A 2BY9X 1XVMA 5KEDA 4ISIH 2DUCA 1ID5H 1QCPA 4FU7A 3DHKH 1C1SA 2ZC9H 1S0QA 1YPMH 3A7XA 5TJXA 3OY5U 3MQKC 3MNXA 1BJVA 2BVXH 3P70B 3PV4A 3SV6A 2RFKC 3GY4A 5EJZA 3K6ZA 2F91A 1GJBB 2NU3E 1CO7E 1O2OA 2C4FH 4M9FA 5E0GA 4X8TH 2F9BH 2VIVA 1SGPE 4BNRA 3WW7A 3M7UA 9LPRA 2ZDLA 1UJ1A 3G01A 1H9LB 4X6MA 4X2VA 4WH6A 1KXCA 3BIVH 1BRCE 1ESTA 1PPHE 3RXIA 1LPGB 1TPOA 5A09A 2K0QA 1DOJA 1Z1IA 4NZLA 1S83A 4FU8A 1YBWA 1E1QD 3HK3B 3MFJA 1T31A 1W0JD 3P6ZB 2ULLA 2Y82A 4I8JA 2KX4A 1ETTH 4RSPA 3S9BA 2VVCA 4X6NA 2OUAA 1TA6A 3SUFA 2L6OA 5JB8S 4AYYB 1OXGA 1AHTH 2SFAA 1NO9H 3E16B 1TGNA 1ELBA 1YPGH 3PYHA 3K6YA 1UHBB 4CH2B 2PKSC 1SGQE 3MNSA 1C2MA 1GI1A 2PGQB 1BMLA 3I29A 5EQQA 2ZDMA 1GJCB 1KXAA 3O8BA 4B6EA 4BTIB 2WPKS 1O2TA 4X6OA 1LDTT 1ELAA 3RXPA 4X8SH 1N6YA 2ZDAH 2QA9E 3DT0H 4MVNA 1O31A 4AB8A 1GJ6A 1H8HD 1VGCC 1A46H 2H5CA 2SGAA 1GMCG 1K1MA 2RDLA 1J9CH 2BDIA 1P2JA 2K8IA 1KTTB 1ZHMA 1TMUH 1OWDA 4ZH8A 1NBMD 1CGJE 2KFWA 4J1YA 1AUTC 4X1NU 3BG4C 1MUEB 1C1TA 1UMAH 2Z9KA 1HPGA 3M5OA 4A1VA 2TRMA 1SQRA 3FAOA 2ZP0H 4XD7D 1BUIA 1EZUC 2AIQA 2BY5X 4AOQA 2WHXA 3L33A 2EEKA 1HIAB 2F9PA 1SI5H 1DUAA 2F4LA 1C9TA 1QL8A 1SHYA 1ANCA 1ZJDA 1NM6A 2ZZUH 3BTDE 5HMAA 3TJOA 1C5OH 1GL1A 1HAPH 1YCPH 1C2DA 5FBIA 1ELTA 2QXGA 1OS8A 1Z8GA 2R0LA 4I8HA 1Y3YA 1OX1A 1TOCB 2H6MA 5C17A 4JZ1A 1AFEH 1J15A 1G2LA 2AGIX 2XW9A 3M7QA 4HTCH 5GJ4B 4SGBE 1SGYE 3TH2H 2WPDD 2BD9A 1C2EA 4ZHLU 4ZXXH 1QGFA 3I77A 4J2YB 2KCYA 4NIYA 3S9CA 2HVXA 2AGGX 3B9FH 4UFDH 5DG6A 3GCTF 5C3NA 2R0KA 3MH5A 1YPKH 5T6DA 1TNGA 3VGCC 4TYDA 3PROA 2H9HA 2WPLS 3B8JA 1S6FA 1M9UA 1PYTC 4B2AA 3ZZDA 2GP9B 2QCYA 4IW4E 1O3EA 2ZHQH 1A2CH 2ZHDA 1F92A 1HAZB 1P3CA 4ABAA 4X0WU 4I33A 3RMNH 3SJ8A 2AEIH 3V12A 1O34A 4ZMAH 4ABEA 3D49H 4Y71A 2NU2E 1A4WH 1H9HE 4ZHMU 2ZGHA 3TH3H 3MNBA 1V2PT 3F9EA 1UTQA 2J38A 1SMFE 1Z1JA 2OQ5A 3RM2H 3KHVA 1C4V2 3TJNA 1MTNC 4VGCC 4INHA 2FTLE 5CE1A 5J4SA 1C5UA 4NIVA 6CHAC 1B7XB 1V2NT 1FN6A 4FUEA 2IPHA 2FOCA 1EAXA 3LGTA 2G5NA 1PQ5A 3A8BA 3W94A 1J8AA 4NSVA 2HNTC 5HKKD 3GOVB 2OQUA 4INLA 1P57B 1UCYH 2BOHB 3TK6A 3CP7A 3U98H 5I46H 2HNTF 2D2DA 4XSKU 5J4QA 1OWKA 1RIWB 4MPXA 1ELGA 1TQ0B 5C0TA 2FOBA 5FBEA 1WV7H 1OSSA 3EA9A 1EZQA 2W7UA 2VWNA 4CRCA 4ISLA 4Y8YA 3UTUH 4MNVA 1MTNB 1TQ7B 1AKSB 1TNIA 3NUMA 3ZVEA 3O8RA 1YPHC 1NESE 1QIXB 3UOPA 3P8NA 1W7GH 5FPSA 1CE5A 2XC4A 3P8GA 3N7OA 3EDXB 5FCKA 3FO8D 1FY4A 4H4FA 4ZAEA 3M5LA 2STBE 1A0JA 5A8XA 4ABIA 4AC9A 2ZQ2A 1P01A 2V7QD 1TRYA 5EOKA 1WBGB 1ZGIA 1EAIA 3ZZCA 3MU1A 3MH4A 3KNXA 3ESTA 4ASUD 1GHXH 2Q1JA 3ZYDA 1YPJH 2Q6DA 4UEHH 1O3OA 2Z94A 3PWCA 2WUBA 3UWJH 6GCHF 1PQ7A 1UCYK 1YPHE 1EJMA 1C1NA 4HG6A 2KAIB 2FX6A 4QT8C 1XUGA 1QQ4A 1BT7A 1V2JT 1KXEA 1O2ZA 3OEHD 2FI4E 3RXBA 4D8NA 1LVMA 2GCTB 2XCFA 1QZ8A 4DIIH 3S7KB 1C2IA 1KIGH 1E35B 2CXVA 2ZWLH 2OBQA 2P8OB 2PSXA 1ELEE 1BHXB 1E36B 3OTPA 4AFSA 1ANBA 4AGKA 1K28D 1QA7A 2IOTA 4E7RG 4GAWA 1AKSA 1P02A 5A2MH 3ZZ3A 1YKTA 4WVPE 2J34A 3FFGA 5T6FA 2WV5A 3TNSA 1B5GH 1IOEA 1DFPA 2G4TA 2LNCA 4IMZA 1T8LA 1V6DA 1YLNA 5T1VA 3SZEA 3A81A 4E06H 2GMTC 3HPTB 1W11U 2PFEA 4D7FA 1ZZZA 2FXRA 1F0TA 2NU4E 2W26A 4WMDA 2B7DH 3V13A 1O3NA 1NRNH 1NROH 1E38B 1W13U 3T26A 1TE0A 2QIQA 1KDQA 3UNQA 2THFB 3GDVA 2P3UB 3MH7A 1HJ9A 5C1YA 4ISNA 1D6RA 5C1XA 1BQYA 3RXEA 1HFDA 1XUJA 2Y6TA 1CT2E 1C1PA 3RXTA 4WY3A 4CRDA 1MABB 1W2KH 2GDDA 1HAHH 1ANEA 2ZFTA 3OYPA 1P03A 1C5NH 2AIPA 3ZZ5A 1TGSZ 1WTHD 1O3GA 1O2IA 3T27A 1WXRA 1WUNH 2BB4A 4BOHA 3JZ2B 2FIRH 2BDBA 5FPYA 2VIWA 1O2XA 4K1SA 1WQSA 3U8TH 2OP9A 5IDKA 1K9OE 1DANH 3GCHC 3SU0A 3RLWH 2VH6A 4XOJA 2H1UA 2ZU3A 2ZIQH 2RA0A 1U6QA 3SU1A 1ZSLA 2VIQA 3WY8A 1W7XH 4GPGA 1LTOA 4MG3A 5L30H 5F53A 3E6PH 1MBQA 1EJNA 5T6GA 1WYKA 3ZVDA 3MH6A 4Q63A 1ZPBA 1GJAB 2R3UA 3AVZA 3KN2A 3KQ5A 3ZZBA 1FY3A 3P17H 4Y11E 1HGTH 2ANKH 1SPJA 3F0PA 1BTWA 1QURH 4Q4LA 3RC4A 2CMYA 3UB0A 1VZQH 1DWBH 1PYTD 2XBWA 1CHOF 5E8EH 3N99A 5EW2H 2FOAA 4K5ZA 1W0ZU 1PQAA 2Y7XA 3OAAD 1KDQB 2P8OC 1HCGA 1O2JA 3U28C 3Q00A 2BZAA 1TNLA 1GJ7B 2ZTYA 1ZLRA 1O5EH 3K65B 4K8YA 1QJ1B 3UNRA 2O8WA 3EE7A 1P05A 2W3IA 1THPB 4JZFH 3RU4D 1DLKB 2W6ID 4WXIA 3VB6A 2KZ4A 1DWEH 1SGEE 1P2QA 1A3BH 4FUDA 3ZV9A 3IG6B 1ZGVA 1NC6A 1GI5A 4FUJA 2G81E 2VWOA 3UUZA 3PRDA 1HDTH 3AK5A 1TRNA 5HIZA 1Y59T 1TYNA 1O3FA 1YYY1 1IQEA 1DLEA 1CVWH 2HPQH 4Q2KA 4X8VH 4A1TA 2ANYA 1RGQA 4P02A 1CSOE 1TRMA 3F9GA 5SGAE 3SUDA 2FI5E 1O35A 3SU6A 2A31A 1EPTA 3RU4E 1O3BA 1OYQA 3QGNB 1YCPK 1HAYB 5EQSA 4BAMB 1F2SE 4F4OC 2Y81A 1ZPZA 3PRBA 1NU7B 3C1KA 4ACBA 5E0JA 2ODQA 1ARBA 5IYTA 2Z3DA 5EGMA 3RXKA 3SI4H 2W7SA 1LHDH 4WMEA 3PV2A 1FPHH 4UDWH 3SI3H 1BB0B 1N6XA 2FOHA 4H6TA 1Q2WA 2GD4B 2XWBI 1RS0A 1XVOA 3UREA 1O2MA 1GMCF 1HV7A 3N7DA 3Q76A 4ZHAA 1GBDA 2A7JA 3PMHB 1EATA 2UWLA 4JK5A 3FOAA 2RA3A 1NBME 1TGTA 3Q77A 1T7CA 2ZQ1A 2QF5A 3RXDA 1PFXC 1ACBE 2A2XH 2WPMS 4BAQB 3E0PB 3QGJA 1O33A 3VXEH 1C1OA 5CDFE 4CRBA 3D62A 2CF8H 3V0XA 1D6WA 2FLBH 2ZU4A 4I7YH 1Y5BT 4YLQH 4NWKA 3KIDU 1F7ZA 3URCA 2TGDA 1WDIA 7LPRA 1T32A 1CBWC 3RC6A 1KLTA 4AFZA 2PUXB 1GBCA 3KEEA 1MKXK 4GLYA 1GHYH 4XFQA 2OINA 1ELCA 3A7WA 4ZKOU 4TPYA 4WH8A 2QGRA 4RT0A 4NZQA 5EPNA 5JPMH 3FZZA 3OU0A 2J98A 1V2WT 1OWHA 2Z9IA 4X2WA 1FY5A 2OD3B 2Z3EA 1AD8H 1ELDE 3FANA 1BMNH 1DXPA 1BDAA 3KQEA 1QR3E 1TABE 8LPRA 3BEFB 1O2NA 2VH0A 1QL9A 4JYVH 3RLYH 2ASUB 1FQ3A 4Y8XA 4CR9A 1DE7H 2FPZA 1O3LA 2FP7B 4DY7B 2GZ8A 1F0SA 3PO1C 5EXMA 4AORA 3GDUA 1DDJA 1EKBB 1W12U 4K1EA 7KMEH 1BA8B 2G8TA 1NFUA 1GBBA 4ISOA 5EJ1A 1JIRA 1SSXA 4IMQA 1EB2A 5DP9A 3TGKE 2O8UA 2IPQX 3LJOA 4MDSA 3VB7A 5DP3A 1IQKA 5KGOA 2QXHA 1IAUA 1HBTH 3A7ZA 2G55A 1A7SA 4IGDA 5DP7A 1V2LT 4FXGH 2ZPRA 3A80A 3QWCH 2FM2A 3PTNA 4Z0KA 2QV1A 1GHAG 4OS5A 4A5TS 3B23B 2RG3A 4YM9A 1GBMA 1P9SA 4CR5A 1SLUB 5E0HA 2LELA 2PSYA 1AZ8A 3T2NA 3IWMA 3T29A 4RKOB 1C5VA 3LGVA 4IN2A 2A4GA 4XDEA 2ZGXH 1ZOMA 1Z8JB 1V3XA 4AGJA 1TX8A 2GT7A 1O2HA 3GY6A 5F8XA 2J97A 3LPRA 1IQMA 4K2YA 4KTCA 1QRWA 1C5WB 4Y79A 4LXBH 2BXUH 4BXWA 1C1QA 1IHSH 2ZGCA 2J92A 1YGCH 4TPIZ 1NS3A 2P95A 3A7TA 1RTKA 3PTBA 1C2LA 5TCCA 1W14U 4I8KA 4OS7A 1SB1H 4Y8ZA 5EW1H 1ESBA 2PP6A 1PPFE 2C93B 1GI4A 1TPSA 2HGTH 4ACAA 1RD3B 4B76A 2ZPSA 1C5LH 2GCTC 3SGAE 3TK9A 4WJG2 4ZKRU 3RXRA 5DSFA 1GJ9B 4B6FA 1O3AA 1LQDB 2HWLB 1CT0E 1GMHG 4Y7AA 4AG1A 1OP8A 5F8ZA 1AFQB 1KXDA 1UCYE 2A5KA 1ZTJA 2YMSC 3ZZAA 2A7CA 2QAAA 2J2UA 1EPTC 1P04A 2V0BA 1WOFA 5TCAA 2JDID 1P2KA 3SUEA 2F9UA 1JOUB 3R0FA 1LPZB 4GVUA 3A85A 2VGCB 1GI2A 5FPTA 2YNAA 4X6PA 5E2PA 5EQRA 2XOKD 4HZHA 1O3PB 2J5UA 5FHTA 2GKVE 3EE0B 2OC8A 3RXAA 2B8OH 1KLJH 2XRCA 1OYTH 3GY8A 1GCTC 4B75A 2WYGA 3EYDA 4P00A 3R3GB 3FKSD 5HM2A 1K1LA 4BXSA 1SGFA 1EFRD 4FUHA 3EGKH 3T28A 2PKAA 1OOKB 2GGVB 3M7TA 2F9NA 1V2QT 1KYNA 3SGQE 2KCAA 3HGNA 2CHAB 1C5XB 1UK2A 4OS6A 3SNCA 1FPCH 1EPTB 3FP8E 1KXFA 1EXFA 1IQFA 4IC5A 2PUQH 2WINI 3SUGA 5C94A 1ZMJA 5JBTA 1FZZA 3EAJA 2O9QA 2BY7X 4H42U 1MAYA 1L2EA 1NN6A 4ABGA 2B9LA 1SHHB 2JH5D 3M37A 2H9EH 3RXJA 2BQ6B 1DICA 4E05H 1G2MA 3P92A 2BD7A 4IS5A 2UUJB 4DJZB 3ZYEA 5T3HA 1P11E 3RXOA 4MNXA 4Q7YA 5H4IB 3A8CA 1EOJA 3ZVCA 2W6JD 3U69H 2FTMA 2GVFA 1TPAE 1BTZA 1GBEA 3A8AA 4RN6A 1L1GA 1ANDA 2KM0A 5LH8A 1GGDB 4XBCA 3P8OA 1LKBA 3SJKA 2B5TB 2ZFQH 2RDEA 5GPIB 3BTGE 2Z6BD 2A5IA 2QXJA 2TBSA 1JWTA 2ZFFH 3GYLB 1S84A 3VGCB 3KYGA 1SGFG 1V2TT 3PB1E 1EX3A 4XBBA 1V2ST 2SGFE 1BMFD 1RJXB 1AO5A 1EUFA 6GCHG 1AE8H 3PLKA 5DP4A 1DM4B 1SR5C 4H6SB 5E2OA 5FL7D 2CGAA 2YOLA 4MPUA 1LVBA 1ELVA 1TBRH 1VJAU 5DPAA 2IJOB 1TIOA 1EP5A 4LZ4B 2BX3A 1G3BA 3ZZ9A 1GL0E 3MO9A 3ZZ6A 1G37A 4O3TA 2ZU5A 2STAE 3KQDA 2ZDKA 1DY8A 4MLFB 5PTPA 3W1EA 1F0UA 1AQ7A 1FAKH 4JZIA 4D7GA 3E1XB 2ZGBH 4B2CA 1LKAA 2QXIA 2J98B 3KGPA 1UTMA 2C8WB 2XYAA 4Y7BA 2BLQA 4KGAA 5EPYA 2VINA 1HAOH 1GBTA 1QBNA 1GVKB 1AVGH 1AY6H 3MO6A 1GVLA 3BG8A 3ZZ4A 2A32A 2WPHS 4Y76A 1J17T 2ZNKH 1P8VC 2KAIA 2VWMA 3ZVAA 1MZDA 5LPEA 4OGXA 3O8DA 2ZTZA 3TGIE 1GI7B 3U8RH 2CF9H 2FO9A 2PWXA 1G3CA 4XBDA 1C2JA 1DWCH 1UVOA 3BTME 2JETC 1NRSH 1FI8A 2ALVA 3F68H 3ZVBA 5L6NH 1OP0A 1TMBH 1E0FD 2VIPA 1O32A 1FV9A 1AB9B 1G30B 2CK3D 5CHAC 4BANB 1GI6A 2JIZD 3V7TA 4GCHG 4NGAH 2XWAA 4I31A 3ZV8A 1UK3A 1O3MA 2G5VA 1O5DH 1NT1A 2XBXA 2G51A 2BD4A 4AFQA 2ZCLP 2FI3E 3A84A 2B0FA 4LZ1H 3M35A 5GWZA 3MOCA 1TOMH 2WPJS 2ZEBA 3DFJA 3GCTG 1BBRE 1AIXH 1TMTH 4BTUB 2GCHF 1TA2A 1WCZA 2ZFPH 4TWWA 1UW7A 1Y8TA 1HB0B 2P59A 3F2GA 3HGPA 4D9QA 5A0AE 2FEQH 1DVAH 1UVPA 4JYTA 5BPEA 3E8LA 3IITA 1QHRB 4MPWA 1TONA 1VCQA 4F48B 1P2OA 2V3MA 3SZNA 3RMMH 1C1UH 1XUHA 3TITA 4AB9A 1KSNA 1BITA 1K1JA 1AFQC 3UY9A 1C5TA 3F3BA 4FVDA 3SV9A 3DD2H 2BD2A 2PHBA 3DSGA 2HVYB 2Z9LA 3HATH 4GSOA 3UQVA 2G4UA 2BVSH 1O2LA 2JJ2D 2HOBA 5GXPA 2V35A 2HLCA 1IQHA 2FOGA 4DGJA 2XNDD 3HK6B 3LC3A 1LVYA 3GCOA 2A0QB 1S82A 3RMLH 3WWBA 3BTKE 1EASA 1NTPA 1BTUA 1ZR0A 3BTTE 1GDNA 4X1PU 1SQTA 4UE7H 1GBAA 2K1QA 2FOEA 2ZKSA 5GIBA 1CA8B 1Y5UT 2FDAA 1LCYA 1FLEE 3TNTA 1FUJA 1G9IE 1XUKA 1CU1A 4JMYA 2SGDE 1C1VH 2AH4X 3ATIA 3TJUA 2VB0A 3QZRA 2ZDVH 2IJD1 5JBBS 3A87A 2Z9GA 2V3HH 2VNTA 1XKBC 3I78A 4KTUA 3QK1A 3GS9A 2FS9A 1NU9A 1BRUP 4B74A 4YO9A 2EA3A 1H8IH 1H4WA 1C5YB 2F43B 1QY6A 3TVJB 4A92A 3LT3A 4ABJA 4CRAA 5A8YA 1C1WH 2WZQA 3VFEA 5DO4H 4K69A 2XC5A 1HYLA 4ASHA 1QA0A 1K1IA 1TBQH 3F0OA 2TIOA 1UK4A 1SOTA 1SGNE 1ZRBA 4A6LA 1DSTA 2ZU2A 4BTTB 3S69A 1HIAA 1K0HA 3SJOA 3A7VA 2AYWA 4X1SU 1RTFB 4XE4A 3VB4A 2LP6A 3TPIZ 3PMJA 4NCYA 3H09A 3WWFA 1TAWA 1THRH 3EA7A 1O2PA 1LVOA 3RXSA 1C9PA 1MD8A 2VJ1A 1O2KA 1PPBH 1ZTLA 2BQ7B 1HAXB 1K2I1 3NZIA 1YLCA 3QDZB 1QTFA 2Y5FA 3ZZ7A 1UVSH 1ZMLA 1VITH 1HXEH 4D9RA 2F83A 4TY6A 2C8ZB 2DE9A 1P2MA 3CS0A 2C8YB 4MNWA 3UNSA 4DIHH 2PTCE 3LONA 5DGJA 3RU4T 3SORA 1D3QB 1ZSJA 3ODDA 3RP2A 3A7YA 2GT8A 2Q6FA 1K1PA 2Y7ZA 4DT4A 2Y5GA 1BBRH 9ESTA 2PW8H 5DP5A 1TX7A 3GY5A 3NCLA 4ZKSU 2GZ9A 1IQIA 1UTLM 4UFGH 1TX6A 2BXTH 5HXFA 2FYQA 3VB5A 1CA0C 3SQHE 2ZPQA 3MWIU 5BRRE 4YLUA 2BX4A 3RXMA 1IQGA 4AFUA 2ODPA 1P06A 2A5AA 3DCLA 1TGBA 1BCUH 2EY4C 3ATKA 3PLPA 5HYOA 1HAGE 5KECA 1VR1H 3M5MA 2HRVA 2ZFRH 3QLPH 3NRLA 3RXUA 1EJAA 2BHGA 2FX4A 1ORFA 1ZPCA 3AAUA 2BLWA 3D65E 3A82A 4UD9H 4ABHA 4B73A 1DPOA 4B1TA 3EQ0H 1O3KA 3STJA 1SQAA 1B0FA 3LDXH 1LMWB 3DSPA 3N7EA 3ATLA 1V2KT 2GV7A 4A7IB 1DUEA 1ABJH 1SGIB 2O8TA 5F03A 4R8TB 1VITG 3ENSB 4MPVA 3MO3A 5EU8A 2O8LA 3PLBA 2J4IA 2XBVA 1O5GH 2P3TB 2NWNA 1TNHA 3TU7H 2A4QA 3LC5A 1CBWB 3RM0H 2D8WA 2HPPH 2EI7A 1QB6A 1O5CB 1SGCA 2ZFSA 1H8DH 3BTFE 2P93A 4DVAU 3SU4A 1H8ED 1W10U 4D76A 3QUMP 1JXPA 5C5NA 8GCHG 1ZHRA 1SKYE 3BN9A 3ZIAD 4NIWA 1C5SA 2XTTB 3RC5A 1GI3A 1C5MD 2BQWB 3NKKA 1FY1A 1SQOA 1ZMNA 3TH4H 3GY7A 1JRTA 5CMXH 4DURA 1NFYA 1GBLA 3FN8A 2QN5T 3VEQB 1FX0B 4UFEH 1DXWA 2ZG0H 5EG4A 1QJ6B 5L2ZH 1GGDC 2FMJA 3UR9A 1GHWH 1AVWA 4SGAE 1NZQH 2VWLA 3F6UH 2I6SA 3QZQA 1RIWC 1AUJA 2FESH 2KR7A 1LHEH 1K21H 1AWFH 3BTHE 4BAHB 3LU9B 2QE7D 1AMHA 1GI9B 2ZECA 5DP8A 2SGEE 3C27B 1GBKA 1C2FA 1C2KA 3QTOH 3LH1A 4NSYA 1HUTH 5B6OA 2QF4A 2JH6D 4DOQA 3DA9B 1UO6A 1UTKA 2AFQB 1FN8A 1ETSH 1O5AB 1V2VT 6CHAB 1L4ZA 2ZI2H 1G32B 3VPKA 3KF2A 3OFND 1MCVA 3KYFA 1YPEH 4IBLH 4FUGA 5AVDA 3T25A 3FP7E 1LPKB 1BHXF 1C1MA 1DT2A 1S6HA 2SNWA 1SVPA 1RXPA 2PLXA 3SHCH 3BIUH 1BMMH 4FOUC 1P10A 2TPIZ 4Y0YE 4WXVA 5C67A 3MNCA 4Q7ZA 2FOMB 2GTBA 2JETB 1P12E 2OC1A 1HJAC 1A3EH 1Y5AT 1SG8B 2HALA 3OSYA 1O3CA 2ZDNA 2Z9JA 1S81A 3SV8A 3TLOA 2W3KA 3MHWU 4Y0ZE 4FETA 4HI3A 2ANMH 3EA8A 3RXGA 4U01A 2GDEH 1FY8E 1GI8B 1AGJA 1WQVH 2WSSD 3H7TA 2R3YA 1BJUA 5AF9H 1YC0A 1CA0B 2C90B 4TY7A 1ETRH 4O9VA 1B0EA 2G00A 1IQNA 2DE8A 1XMNB 1S5SA 1GBFA 1AB9C 5AFZH 1TBZH 4E7NA 1AWHB 1SL3A 5ESTE 4NFEA 2A1DB 2HNTE 2OCVB 2BY8X 2GX4A 5ETXA 3BTWE 2ZF0H 4Y6DA 5FX5A 2Q6GA 5FAHA 1P2NA 1VKYA 1P09A 4XRNA 4CRFA 1W0YH 1FAXA 2BDHA 2ESTE 2WV9A 5JYIA 3Q3KA 4X1RU 1E1RD 1FJSA 4U30A 3BV9B 2AMQA 3K9XB 1G3DA 1GHAF 1P9UA 2FWWA 2YMSD 1GCDA 4KKDA 5G4BA 1HRTH 2BD3A 4KTSA 1OPHB 1YWUA 3BF6H 3U1JB 3F1SB 1SGRE 2ZGJA 1TWXB 2ZCKP 8GCHF 4ESTE 2Y80A 3ELAH 2F3CE 3T62A 4NG9H 2LPRA 2PKSB 3ATMA 2C8XB 2VVVA 1O39A 1S85A 1Y3WA 1Z6EA 3GDSA 3PM3A 3UAIC 1O2VA 2XBYA 4ZCNA 3QTVH 1FONA 1O38A 2FYRA 1O37A 1MCTA 2XXLA 3GISB 2KCPA 1O2RA 3OEED 1ZRKA 4O3UA 4FUFA 4UFFH 1FDPA 4YOJA 1RTLA 2FS8A 7GCHF 2UWOA 1JIMA 1K1OA 3RXFA 2PR3A 3SU3A 3RXCA 1BTYA 1D3DB 3M5NA 4ZUHA 3A89A 1YCPM 4OS4A 2D1JA 2UWPA 1MQ6A 3SHAH 1V2RT 1F0RA 3BTQE 3UWIA 3OX7U 2QYIA 2NU1E 1OHHD 2H5DA 4KP0A 4MNYA 3RXVA 1T8NA 2OTVA 1MKXH 8ESTE 1OWIA 2ODYB 3SJIA 3SBKA 1EP6A 2TGPZ 1IQLA 1GPZA 1YY3A 3MI4A 3TK5A 1C5ZB 2CJIA 1ABIH 3SOSA 1LHFH 1LHGH 1GI0A 2C3SA 1Y3XA 2WYJA 4FVBA 2OK5A 2BLOA 1CGIE 1AE5A 1HAIH 1IQJA 1YLDA 5EJLA 3UOUA 2BLVA 2HLDD 1S0RA 3BSQA 1YF4A 1QRZA 3BG4B 5FXLA 3NXPA 1GHBG 1GHVH 4ABFA 2OC0A 3LJJA 5LGOA 4Y10E 4U32A 3PMBB 1Z8IB 1EQ9A 1UVUH 3SW2B 2V6NA 4YESB 1F5KU 1A5HA 4AYVB 3QO6A 3ITIA 5JBAS 1T4VH 1A5GH 3A86A 2L74A 4WWYA 1BTPA 5GCHG 1YM0A 3F9FA 1UTNA 1D3TB 5C2ZA 1AN1E 1DWDH 3AASA 3M3VA 2WPIS 3UR6A 2IN2A 1O2QA 3RXHA 5JBCS 4INKA 1P2IA 1NRQH 1HLTH 3RXQA 4B2BA 1OKXA 8KME2 3GYMA 2RCEA 3P95A 1ZHPA 3PV5A 1C5PA 1Y3VA 2SGPE 1EB1H 1SLWB 4OS2A 1HXFH 5F6MA 4AG2A 2EI8A 4MTBA 1A61H 1NFXA 2SGQE 3F9HA 2P3FH 2VVUA 3RMOH 2BOKA 3MU5A 2KCOA 2ZA5A 1G3EA 3GY3A 3GCHB 4JZEH 1GJ5H 3HKIB 3T5FH 3LGIA 1MZAA 4LOYH 1AVXA 2JKHA 3O8CA 3E91A 2H9TH 2Y5HA 1O2UA 3RDZA 2A45B 4THNH 1LHCH 1HAVB 3HKJB 3RUOA 1MKWH 3E3TA 4U2WA 4CREA 4KELA 1L1NA 3H5CB 3BEIB 4TWYA 2R9PA 1GG6C 1UTPA 4IC6A 1QBOA 2SNVA 2BD8A 6ESTA 3MTYA 3QX5H 3SU5A 1O3HA 3FVFB 2R2MB 4ZXYH 1Q3XA 2BYAX 5A0BA 1RFNA 3MYWA 2TGTA 3LH3A 5CHBA 4ABBA 2QC2A 4OS1A 1OP2A 1KY9A 2NU0E 1T8MA 1O2WA 1QNJA 1CGHA 2EQNA 2UUKB 1NFWA 2G52A 1MTSA 2BTCE 5GCHF 1COWD 1C5QA 2J95A 1PPEE 3URDA 1QL7A 2M2AA 2J94A 1E34B 1AI8H 6LPRA 2GZ7A 5HM9A 4YTAA 1QB9A 1QBVH 1ELFA 1C4Y2 4YT7H 2VIDA 5L2YH 5A0CA 3TGJE 3CS7A 4RI0A 4CHAC 1UTJA 2O8MA 2ZCHP 3UQOA 4Z6AH 3M3SA 1P3EA 1K22H 1C2GA 1UHBA 2ALPA 3A8DA 2A2QH 5C5OA 3OY6U 3SNBA 3KCGH 3CENA 2ILNA 1HNEE 1BRAA 4CRGA 3ZZ8A 1W0KD 4NWLA 1BTXA 2A7HA 3S0NA 1D4PB 4R0IA 3SV7A 4AX9H 1C5RA 1GBJA 1RRKA 2W5EA 4AZ2B 1QQUA 4CBOA 1KXBA 2PGBB 4HFPB 2ZHFH 2BZ6H 1MKWK 3JZ1B 1HJ8A 3LGWA 4O97A 4CH8B 1N8OB 1ZSKA 2GV6A 1BMAA 4RT1A 5A8ZA 3LGUA 1QFKH 3NK8A 1PPCE 1EZSC 3Q3YA 4K3JA 1V2UT 1PQ8A 1Y3UA 1G36A 2F9VA 2ANWA 3UFAA 2GMTB 3KL6A 5ABWA 4MQAA 1DX5M 4F55A 5C1UA 3S9AA 3VXFH 1CT4E 1LO6A 1VITF 2CN0H 2GCHG 2FZZA 1GJ8B 3PO1B 2A4OA 2P94A 4K8BA 4DW2U 4RKJB 3E90B 1O30A 3ATWA 3M36A 2BM2A 2F9OA 4NIXA 4ZKNU 2V3OH 1O3JA 1W8BH 3U9AH 5B6LA 1KLIH 4ZROA 1PPZA 4NA7A 3PMAB 1E79D 5C0UA 1WTGH 2TGAA 4FUBA 1KMHB 2AGEX 1GBHA 3SYJA 4JZDH 1VGCB 1BZXE 1TB6H 3M3TA 2EC9H 4JYUH 3VB3A 3CNRA 7GCHG 3DUXH 1V2MT 4F49A 4YZUA 4YT6H 3L6PA 1GHBF 1GJ4H 1O3DA 3A88A 1PPGE 1DY9A 1L0ZA 1V2OT 3KQBA 1D9IA 3U8OH 2Z7FE 4OGYA 1FMGA 1F5RA 1EZXC 1Z7KA 1WU1A 1TALA 1JRSA 4JK6A 4A1XA 1GCTB 2Z3CA 4HGCA 3ZVGA 1XXFA 4TT3D 1MTWA 3GICB 2VIOA 1H9IE 3A83A 3SNEA 1ZYOA 2OXSA 2CHAC 4FUIA 1WSSH 5EIYA 2VU8E 1GHZA 1HJAB 3L3TA 4PROA 3GCNA 2FODA 4BAOB 3LGYA 1J14A 1FIWA 1N1LA 1T4UH 2CV3A 2AMPA 2VBCA 5EXNA 2H2ZA 4YXWD 1YP9A 5ESBA 5JB9S 3KQCA 1GBIA 1C1RA 1SGTA 1T8OA 1SLXB 1TNKA 1ZTKA 2D26C 1P0SH 1A0HB 2QY0B 4JCNA 1DSUA 1SBWA 1MQ5A 3E0NB 3VG8A 4DG4A 1INCA 4LK4A 4WMFA 1X7AC 2BD5A 5GDSH 1GDQA 1GDUA 5F8TA 3BTEE 2BVRH 3P8FA 1XUIA 2QF0A 1MTUA 2ZU1A 1TGCA 1O0DH 1QRXA 2QF3A 1ZJKA 1UTOA 2PKAB 1GMDG 1SC8U 1CHOG 3F2HA 4ISHH 4CBNA 2XNIA 5GNDA 1N8OC 3LIWA 4BAKB 1O36A 5DKMA 2AHME 2UUFB 4DCDA 1OWJA 1JMOH 3ZVFA 4X2XA 1CQQA 1GJDB 2BDCA 2BDYA 2M5TA 1J16A 4M7GA 1TFXA 1Z8RA 2GJGA 2XCNA 3LKWA 1A1RA 1FXYA 1SFIA 3ODFA 4B71A 5DK1A 1QB1A 3SN8A 3FP6E 5EODA 5DN6D 1THSH 4VGCB 3W95A 1AZZA 1QJ7B 2JH0D 2BDGA 3OTJE 5C20A 5JDUB 2YMSB 5LPFA 1W3CA 3S7HB 1MAXA 1O5FH 1BTHH 1SOZA 2I6QA 4K60A 1D3PB 1YPLH 5I25A 5AHGH 3M61U 1GMHF 1OWEA 5FX6A 3RXLA 1VCPA 1NPMA 3BEUA 1O2SA 2OBOA 2P16A 1EOLA 2BDAA 5DJ7A 3UPEA 5AFYH 3D23A 4NFFA 1O2GH 1VJ9U 1A0LA 3SQEE 1FIZA 4NA9H 2ZHWH 3H7OA 1MU6B 5HIYA 1C4U2 3DSOA 5IK2D 1O5BB 1VCWA 1AU8A 2ZTXA 3GY2A 4O03A 1MH0A 1L1JA 1XXDA 2AERH 4GHTA 2OLGA 1EAWA 4I8LA 4Q80A 3Q3XA 1GG6B 5K0HA 4WF8A 1C2HA 3F2FA 1IHTH 3K2UA 1XX9A 4X2YA 2R2WU 3AAVA 4I86A 3MU8A 3SU2A 1L4DA 1S6LA 2UUYA 1DITH 1MBMA 3DFLA 3TJVA 1NY22 2EI6A
chains in the Genus database with same CATH topology
2WUCA 1KTSB 2WV4A 1O3IA 1XUFA 1GMDF 4UONA 3AW1A 5DP6A 1NRRH 4IN1A 5HGGA 2J9NA 4K1TA 2PV9B 5K7RA 1TNJA 3AW0A 1TPPA 4I8GA 3NPSA 5LPRA 3MU4A 1A5IA 1GWAA 2YNBA 1WAYB 1LQEA 4I32A 3STIA 3U1IB 4GUXA 5CHAB 1HAVA 1JBUH 2FOFA 1SLVB 3FZDA 1Q31A 1CHGA 2AMDA 2ZHEH 2PTNA 3V3MA 4GHQA 1ARCA 2AS9A 4NA8A 3QN7A 1SGDE 4AN7A 1BIOA 4GCHF 1XM1A 1DS2E 1BOQA 1NRPH 2FLRH 1SFQB 3SJ9A 4Q7XA 2A4RA 1MU8B 1Z71A 1PJPA 4X8UH 3LOXA 4X1QU 1MD7A 1K1NA 1UVTH 3SGBE 3SNAA 4YOIA 1TLDA 1BBRK 4CHAB 1EAUA 1XKAC 3MU0A 4FU9A 1Z6JH 2BMGB 5EXLA 3SO3A 1O2YA 1F5LA 4ABDA 4FUCA 3TIUA 2VGCC 4YOGA 2BY6X 1BRBE 4DT7B 1H1BA 3SV2H 1E37B 7ESTE 3NWUA 1MTVA 1GVZA 3SNDA 1ESAA 2OC7A 1FNIA 1MMJN 2ZO3H 3MMGA 3PWBA 5FCRA 3UIRA 2XC0A 2BY9X 1XVMA 4ISIH 2DUCA 1ID5H 1QCPA 4FU7A 3DHKH 1C1SA 2ZC9H 1S0QA 1YPMH 3A7XA 5TJXA 3OY5U 3MNXA 1BJVA 2BVXH 3P70B 3PV4A 3SV6A 3GY4A 3K6ZA 2F91A 1GJBB 2NU3E 1CO7E 1O2OA 2C4FH 5E0GA 4X8TH 2F9BH 2VIVA 1SGPE 4BNRA 3M7UA 9LPRA 2ZDLA 1UJ1A 3G01A 1H9LB 4X6MA 4X2VA 4WH6A 1KXCA 3BIVH 1BRCE 1ESTA 1PPHE 3RXIA 1LPGB 1TPOA 5A09A 1DOJA 1Z1IA 4NZLA 1S83A 4FU8A 1YBWA 3HK3B 3MFJA 1T31A 3P6ZB 2ULLA 2Y82A 4I8JA 1ETTH 4RSPA 3S9BA 2VVCA 4X6NA 2OUAA 1TA6A 3SUFA 5JB8S 4AYYB 1OXGA 1AHTH 2SFAA 1NO9H 3E16B 1TGNA 1ELBA 1YPGH 3PYHA 3K6YA 1UHBB 4CH2B 2PKSC 1SGQE 3MNSA 1C2MA 1GI1A 2PGQB 1BMLA 3I29A 5EQQA 2ZDMA 1GJCB 1KXAA 3O8BA 4BTIB 2WPKS 1O2TA 4X6OA 1LDTT 1ELAA 3RXPA 4X8SH 1N6YA 2ZDAH 2QA9E 3DT0H 4MVNA 1O31A 4AB8A 1GJ6A 1VGCC 1A46H 2H5CA 2SGAA 1GMCG 1K1MA 2RDLA 1J9CH 2BDIA 1P2JA 1KTTB 1ZHMA 1TMUH 1OWDA 4ZH8A 1CGJE 4J1YA 4X1NU 1AUTC 3BG4C 1MUEB 1C1TA 1UMAH 2Z9KA 1HPGA 3M5OA 4A1VA 2TRMA 3FAOA 2ZP0H 1BUIA 1EZUC 2AIQA 2BY5X 4AOQA 3L33A 2EEKA 1HIAB 2F9PA 1SI5H 1DUAA 1C9TA 1QL8A 1SHYA 1ANCA 1ZJDA 1NM6A 2ZZUH 3BTDE 5HMAA 3TJOA 1C5OH 1GL1A 1HAPH 1YCPH 1C2DA 5FBIA 1ELTA 2QXGA 1OS8A 1Z8GA 2R0LA 4I8HA 1Y3YA 1OX1A 1TOCB 2H6MA 4JZ1A 1AFEH 1J15A 1G2LA 2AGIX 2XW9A 3M7QA 4HTCH 5GJ4B 4SGBE 1SGYE 3TH2H 2BD9A 1C2EA 4ZHLU 4ZXXH 1QGFA 3I77A 4J2YB 4NIYA 3S9CA 2HVXA 2AGGX 3B9FH 4UFDH 5DG6A 3GCTF 5C3NA 2R0KA 3MH5A 1YPKH 5T6DA 1TNGA 3VGCC 4TYDA 3PROA 2H9HA 2WPLS 3B8JA 1S6FA 1M9UA 1PYTC 4B2AA 3ZZDA 2GP9B 2QCYA 4IW4E 1O3EA 2ZHQH 1A2CH 2ZHDA 1F92A 1HAZB 1P3CA 4ABAA 4X0WU 4I33A 3RMNH 3SJ8A 2AEIH 3V12A 1O34A 4ZMAH 4ABEA 3D49H 4Y71A 2NU2E 1A4WH 1H9HE 4ZHMU 2ZGHA 3TH3H 3MNBA 1V2PT 3F9EA 1UTQA 2J38A 1SMFE 1Z1JA 2OQ5A 3RM2H 3KHVA 1C4V2 3TJNA 1MTNC 4VGCC 4INHA 2FTLE 5CE1A 5J4SA 1C5UA 4NIVA 6CHAC 1B7XB 1V2NT 1FN6A 4FUEA 2IPHA 2FOCA 1EAXA 3LGTA 2G5NA 1PQ5A 3A8BA 3W94A 1J8AA 4NSVA 2HNTC 3GOVB 2OQUA 4INLA 1P57B 1UCYH 2BOHB 3TK6A 3CP7A 3U98H 5I46H 2HNTF 2D2DA 4XSKU 5J4QA 1OWKA 1RIWB 4MPXA 1ELGA 1TQ0B 2FOBA 5FBEA 1WV7H 1OSSA 3EA9A 1EZQA 2W7UA 2VWNA 4CRCA 4ISLA 4Y8YA 3UTUH 4MNVA 1MTNB 1TQ7B 1AKSB 1TNIA 3NUMA 3ZVEA 3O8RA 1YPHC 1NESE 1QIXB 3UOPA 3P8NA 1W7GH 5FPSA 1CE5A 2XC4A 3P8GA 3N7OA 3EDXB 5FCKA 1FY4A 4H4FA 4ZAEA 3M5LA 2STBE 1A0JA 5A8XA 4ABIA 2ZQ2A 1P01A 1TRYA 5EOKA 1WBGB 1ZGIA 1EAIA 3ZZCA 3MU1A 3MH4A 3KNXA 3ESTA 1GHXH 2Q1JA 3ZYDA 1YPJH 2Q6DA 4UEHH 1O3OA 2Z94A 3PWCA 2WUBA 3UWJH 6GCHF 1PQ7A 1UCYK 1YPHE 1EJMA 1C1NA 2KAIB 2FX6A 4QT8C 1XUGA 1QQ4A 1BT7A 1V2JT 1KXEA 1O2ZA 2FI4E 3RXBA 4D8NA 1LVMA 2GCTB 2XCFA 4DIIH 3S7KB 1C2IA 1KIGH 1E35B 2CXVA 2ZWLH 2OBQA 2P8OB 2PSXA 1ELEE 1BHXB 1E36B 4AFSA 1ANBA 4AGKA 1K28D 1QA7A 2IOTA 4E7RG 4GAWA 1AKSA 1P02A 5A2MH 3ZZ3A 1YKTA 4WVPE 2J34A 3FFGA 5T6FA 2WV5A 3TNSA 1B5GH 1IOEA 1DFPA 2G4TA 2LNCA 4IMZA 1T8LA 1V6DA 3A81A 4E06H 2GMTC 3HPTB 1W11U 2PFEA 4D7FA 1ZZZA 2FXRA 1F0TA 2NU4E 2W26A 4WMDA 2B7DH 3V13A 1O3NA 1NRNH 1NROH 1E38B 1W13U 3T26A 1TE0A 2QIQA 1KDQA 3UNQA 2THFB 3GDVA 2P3UB 3MH7A 1HJ9A 5C1YA 4ISNA 1D6RA 5C1XA 1BQYA 3RXEA 1HFDA 1XUJA 2Y6TA 1CT2E 1C1PA 3RXTA 4WY3A 4CRDA 1W2KH 2GDDA 1HAHH 1ANEA 2ZFTA 3OYPA 1P03A 1C5NH 2AIPA 3ZZ5A 1TGSZ 1WTHD 1O3GA 1O2IA 3T27A 1WUNH 2BB4A 4BOHA 3JZ2B 2FIRH 2BDBA 5FPYA 2VIWA 1O2XA 4K1SA 1WQSA 3U8TH 2OP9A 5IDKA 1K9OE 1DANH 3GCHC 3SU0A 3RLWH 2VH6A 4XOJA 2H1UA 2ZU3A 2ZIQH 2RA0A 1U6QA 3SU1A 1ZSLA 2VIQA 3WY8A 1W7XH 4GPGA 1LTOA 4MG3A 5L30H 3E6PH 1MBQA 1EJNA 5T6GA 1WYKA 3ZVDA 3MH6A 1ZPBA 1GJAB 2R3UA 3AVZA 3KN2A 3ZZBA 1FY3A 3P17H 4Y11E 1HGTH 2ANKH 1SPJA 1BTWA 1QURH 3RC4A 2CMYA 1VZQH 1DWBH 1PYTD 2XBWA 1CHOF 5E8EH 5EW2H 2FOAA 4K5ZA 1W0ZU 1PQAA 2Y7XA 1KDQB 2P8OC 1HCGA 1O2JA 3Q00A 2BZAA 1TNLA 1GJ7B 2ZTYA 1ZLRA 1O5EH 3K65B 4K8YA 1QJ1B 3UNRA 2O8WA 4JZFH 1P05A 2W3IA 1THPB 3RU4D 1DLKB 4WXIA 3VB6A 1DWEH 1SGEE 1P2QA 1A3BH 4FUDA 3ZV9A 3IG6B 1ZGVA 1NC6A 1GI5A 4FUJA 2G81E 2VWOA 3UUZA 1HDTH 1TRNA 1Y59T 1TYNA 1O3FA 1YYY1 1IQEA 1DLEA 1CVWH 2HPQH 4Q2KA 4X8VH 4A1TA 2ANYA 1RGQA 1CSOE 1TRMA 3F9GA 5SGAE 3SUDA 2FI5E 1O35A 3SU6A 2A31A 1EPTA 3RU4E 1O3BA 1OYQA 3QGNB 1YCPK 1HAYB 5EQSA 4BAMB 1F2SE 4F4OC 2Y81A 1ZPZA 1NU7B 3C1KA 5E0JA 2ODQA 1ARBA 5IYTA 2Z3DA 5EGMA 3RXKA 3SI4H 2W7SA 1LHDH 4WMEA 1FPHH 4UDWH 3SI3H 1BB0B 1N6XA 2FOHA 4H6TA 1Q2WA 2GD4B 2XWBI 1RS0A 1XVOA 3UREA 1O2MA 1GMCF 1HV7A 4ZHAA 3Q76A 1GBDA 2A7JA 3PMHB 1EATA 2UWLA 4JK5A 2RA3A 1TGTA 3Q77A 1T7CA 2ZQ1A 3RXDA 1PFXC 1ACBE 2A2XH 2WPMS 4BAQB 3E0PB 3QGJA 1O33A 3VXEH 1C1OA 4CRBA 3D62A 2CF8H 3V0XA 1D6WA 2FLBH 2ZU4A 4I7YH 1Y5BT 4YLQH 4NWKA 3KIDU 1F7ZA 3URCA 2TGDA 7LPRA 1T32A 1CBWC 3RC6A 1KLTA 4AFZA 2PUXB 1GBCA 3KEEA 1MKXK 4GLYA 1GHYH 4XFQA 2OINA 1ELCA 3A7WA 4ZKOU 4TPYA 4WH8A 2QGRA 5EPNA 4NZQA 5JPMH 3FZZA 3OU0A 1V2WT 1OWHA 2Z9IA 4X2WA 1FY5A 2OD3B 2Z3EA 1AD8H 1ELDE 3FANA 1BMNH 1DXPA 1BDAA 3KQEA 1QR3E 1TABE 8LPRA 3BEFB 1O2NA 2VH0A 1QL9A 4JYVH 3RLYH 2ASUB 1FQ3A 4Y8XA 4CR9A 1DE7H 2FPZA 1O3LA 2FP7B 4DY7B 2GZ8A 1F0SA 3PO1C 5EXMA 4AORA 3GDUA 1DDJA 1EKBB 1W12U 4K1EA 7KMEH 1BA8B 2G8TA 1NFUA 1GBBA 4ISOA 1JIRA 1SSXA 4IMQA 1EB2A 5DP9A 3TGKE 2O8UA 3LJOA 4MDSA 3VB7A 5DP3A 1IQKA 2QXHA 1IAUA 1HBTH 3A7ZA 2G55A 1A7SA 4IGDA 5DP7A 1V2LT 4FXGH 2ZPRA 3A80A 3QWCH 2FM2A 3PTNA 4Z0KA 2QV1A 1GHAG 4OS5A 4A5TS 3B23B 2RG3A 4YM9A 1GBMA 1P9SA 4CR5A 1SLUB 5E0HA 2PSYA 1AZ8A 3T2NA 3IWMA 3T29A 4RKOB 1C5VA 3LGVA 4IN2A 2A4GA 4XDEA 2ZGXH 1ZOMA 1Z8JB 1V3XA 4AGJA 1TX8A 2GT7A 1O2HA 3GY6A 5F8XA 3LPRA 1IQMA 4K2YA 4KTCA 1QRWA 1C5WB 4Y79A 4LXBH 2BXUH 4BXWA 1C1QA 1IHSH 2ZGCA 2J92A 1YGCH 4TPIZ 1NS3A 2P95A 3A7TA 1RTKA 3PTBA 1C2LA 5TCCA 1W14U 4I8KA 4OS7A 1SB1H 4Y8ZA 5EW1H 1ESBA 1PPFE 2C93B 1GI4A 1TPSA 2HGTH 1RD3B 4B76A 2ZPSA 1C5LH 2GCTC 3SGAE 3TK9A 4WJG2 4ZKRU 3RXRA 1GJ9B 1O3AA 1LQDB 2HWLB 1CT0E 1GMHG 4Y7AA 4AG1A 1OP8A 5F8ZA 1AFQB 1KXDA 1UCYE 2A5KA 1ZTJA 3ZZAA 2A7CA 2QAAA 2J2UA 1EPTC 1P04A 2V0BA 1WOFA 5TCAA 1P2KA 3SUEA 2F9UA 1JOUB 3R0FA 1LPZB 4GVUA 3A85A 2VGCB 1GI2A 5FPTA 2YNAA 4X6PA 5E2PA 5EQRA 4HZHA 1O3PB 5FHTA 2GKVE 3EE0B 2OC8A 3RXAA 2B8OH 1KLJH 2XRCA 1OYTH 3GY8A 1GCTC 4B75A 2WYGA 3EYDA 3R3GB 5HM2A 1K1LA 4BXSA 1SGFA 4FUHA 3T28A 3EGKH 2PKAA 1OOKB 2GGVB 3M7TA 2F9NA 1V2QT 1KYNA 3SGQE 3HGNA 2CHAB 1C5XB 1UK2A 4OS6A 3SNCA 1FPCH 1EPTB 3FP8E 1KXFA 1EXFA 1IQFA 4IC5A 2PUQH 2WINI 3SUGA 1ZMJA 5JBTA 1FZZA 3EAJA 2O9QA 2BY7X 4H42U 1MAYA 1L2EA 1NN6A 4ABGA 2B9LA 1SHHB 2JH5D 3M37A 2H9EH 3RXJA 2BQ6B 1DICA 4E05H 1G2MA 3P92A 2BD7A 4IS5A 2UUJB 4DJZB 3ZYEA 5T3HA 1P11E 3RXOA 4MNXA 4Q7YA 5H4IB 3A8CA 1EOJA 3ZVCA 3U69H 2FTMA 2GVFA 1TPAE 1BTZA 1GBEA 3A8AA 4RN6A 1L1GA 1ANDA 5LH8A 1GGDB 4XBCA 3P8OA 1LKBA 3SJKA 2B5TB 2ZFQH 5GPIB 3BTGE 2Z6BD 2A5IA 2QXJA 2TBSA 1JWTA 2ZFFH 3GYLB 1S84A 3VGCB 1SGFG 1V2TT 3PB1E 1EX3A 4XBBA 1V2ST 2SGFE 1RJXB 1AO5A 1EUFA 6GCHG 1AE8H 3PLKA 5DP4A 1DM4B 1SR5C 4H6SB 5E2OA 2CGAA 2YOLA 4MPUA 1LVBA 1ELVA 1TBRH 1VJAU 5DPAA 2IJOB 1TIOA 1EP5A 4LZ4B 2BX3A 1G3BA 3ZZ9A 1GL0E 3MO9A 3ZZ6A 1G37A 4O3TA 2ZU5A 2STAE 3KQDA 2ZDKA 1DY8A 4MLFB 5PTPA 1F0UA 1AQ7A 1FAKH 4JZIA 4D7GA 3E1XB 2ZGBH 4B2CA 1LKAA 2QXIA 3KGPA 1UTMA 2C8WB 2XYAA 4Y7BA 2BLQA 4KGAA 5EPYA 2VINA 1HAOH 1GBTA 1QBNA 1GVKB 1AVGH 1AY6H 3MO6A 1GVLA 3BG8A 3ZZ4A 2A32A 2WPHS 4Y76A 1J17T 2ZNKH 1P8VC 2KAIA 2VWMA 3ZVAA 1MZDA 5LPEA 4OGXA 3O8DA 2ZTZA 3TGIE 1GI7B 3U8RH 2CF9H 2FO9A 2PWXA 1G3CA 4XBDA 1C2JA