3TJVA

Crystal structure of human granzyme h with a peptidyl substrate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
225
structure length
225
Chain Sequence
IIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNNIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme H
publication title Structural insights into the substrate specificity of human granzyme H: the functional roles of a novel RKR motif
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 225
sequence length 225
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjvA02
1BRAA 1DXPA 1TPOA 3LONA 3P8OA 3PMBB 3BTTE 8KME2 1K1LA 2VIVA 4WMDA 1TALA 1AU8A 1J9CH 1MAXA 3BG4B 3HATH 3MU1A 2XBXA 2VWNA 1O3AA 2AH4X 1JRTA 1UVUH 2F91A 3LDXH 3STIA 1N8OC 2GCHF 2D2DA 1GCDA 3BIVH 2VIOA 1TA6A 2ZDVH 2TIOA 1EXFA 1MQ5A 4ZHAA 1C2HA 4GHQA 2CF9H 1ZHRA 1ZSJA 1G3DA 1GCTB 1KIGH 3BTEE 3SNDA 3AAVA 2ZA5A 3SNEA 1P10A 3UIRA 3R0FA 3ZVEA 5CE1A 2BD2A 4DW2U 4WXVA 1P2JA 4DURA 3BTHE 1GDUA 4AG2A 3O8CA 2BX4A 3M5MA 4J2YB 4X1PU 1QRXA 1T8OA 1KDQB 1FY1A 2FESH 2PWXA 5F8TA 2AMQA 2ZU4A 5I25A 2PUXB 2PKAA 3U1IB 2J9NA 3RXDA 1SLWB 2HALA 3LC3A 1TNHA 5A8ZA 1O3GA 1GI8B 1P3EA 4INKA 1HAIH 1FIWA 3RXCA 3SJIA 1AVXA 2H9TH 1AE8H 3OYPA 1CBWB 1HXFH 1QY6A 4KGAA 2OC8A 2H1UA 3ZZ9A 2AGGX 1HAYB 3M7UA 1VITF 2GTBA 4ZHMU 4AORA 1UHBA 3MNSA 4XBDA 1SVPA 1K1NA 1MTWA 2VIQA 1GHBF 1O2LA 2BLWA 3SNAA 3PMJA 4BANB 3SV7A 4MPUA 5AFZH 1DITH 3GCHC 6CHAB 1Z6JH 1NU9A 5EPNA 3U9AH 3GICB 2FX6A 2VVCA 2AIQA 4AG1A 1F0TA 5E0HA 2Z3DA 5EXNA 1IAUA 3C1KA 1GI1A 5H4IB 2JKHA 1GI9B 2V6NA 5DK1A 2VH0A 1Y3UA 3SV2H 3MFJA 1TRYA 1QL7A 1XUJA 1MTVA 1GG6C 1BT7A 1FPHH 1FDPA 1RTLA 5A0CA 1QNJA 2VU8E 1FONA 1SGPE 1GJCB 1NFUA 2PTNA 3QTOH 1WQSA 2VVVA 1GMDG 1GBHA 3D62A 1BHXB 2NU3E 4ZAEA 4FUEA 2I6SA 1QGFA 1UTMA 1PPEE 1N6XA 1HJ9A 2BZAA 2GKVE 2WV5A 4Y8ZA 2A45B 2FMJA 3V7TA 4B76A 4ZUHA 4U01A 1O3CA 3R3GB 4FXGH 5LPFA 3SU4A 1C1MA 1RIWB 1TIOA 5EPYA 3SJ9A 3SV8A 1DFPA 3MU4A 1ZTJA 2XC0A 2ZU5A 4FUCA 4H42U 3N7OA 3TJUA 3RXMA 2QCYA 2C8ZB 1ETTH 1LVYA 3GY4A 1GI3A 2D1JA 3RXIA 1JMOH 2BDIA 4E05H 1ZMLA 3RM0H 1S85A 3TGJE 3DT0H 3M3TA 1O30A 2G51A 2GX4A 4OS4A 1HUTH 1O2PA 2J94A 2QGRA 3GYLB 3A80A 3F1SB 4NFEA 2O8UA 1BTYA 1E35B 3D49H 4ABHA 1DUAA 2SGAA 5ESBA 2SGQE 3LH3A 4JYTA 3PO1C 3MU5A 4ABDA 4AGKA 2C8WB 1C2EA 5T6FA 1RXPA 4NA9H 8GCHG 1GBMA 3E0PB 1DWDH 1UJ1A 5DP3A 7KMEH 1SGFG 3SUEA 2SGFE 5FPSA 1HRTH 3B9FH 2A5IA 2DUCA 1W13U 1O2YA 2OD3B 1M9UA 2F9PA 1OP2A 2A4OA 4RKJB 1V2JT 2ILNA 3BG8A 2WPJS 3RC6A 1BBRE 1CSOE 4Y8YA 1O31A 3MNXA 1H9HE 3BTFE 2OQUA 2PLXA 3GCTG 1C1WH 3M7TA 3E6PH 2BD3A 2F9BH 3K6ZA 2ZDMA 3ZZBA 1BTWA 3SI4H 1EZSC 3PROA 3RU4D 3I77A 3QZQA 3E1XB 1D3TB 2HOBA 1FXYA 1EAXA 2WPIS 2BD8A 2TGTA 1OWHA 4DGJA 1IHTH 3KQEA 1TBZH 4NFFA 4NSYA 3W94A 3EDXB 4MTBA 1CGHA 1L4ZA 1UMAH 1CT0E 4E7NA 4BNRA 2ZDAH 1YPLH 3U69H 1CGJE 4X8VH 4WY3A 1HXEH 1JWTA 2WPLS 3ESTA 1ZTKA 2BYAX 1F5LA 1GHAF 5GJ4B 1G3CA 4WH6A 1MKXK 3QO6A 1BDAA 1YYY1 5JBBS 1EPTA 1S6HA 3TNSA 2VGCC 3AW0A 1TFXA 2ZFPH 1YCPH 1N1LA 2A5AA 3UR9A 2AMPA 1MZAA 1CT4E 5LGOA 1HCGA 2BTCE 3SI3H 1SGNE 4AB8A 3A82A 4NZQA 5A0BA 2Y80A 3P17H 3TH2H 1VZQH 1Q2WA 1ZOMA 3DA9B 1HAHH 1ZJKA 4FUDA 3TLOA 1O2JA 1KTSB 1O3LA 1QR3E 3A8AA 1C1VH 1WAYB 3Q3KA 2CXVA 4JZEH 3DFJA 4NG9H 1WTGH 5FPTA 1LHCH 1ABIH 1OOKB 3UY9A 1GVKB 4A1XA 5K0HA 2UUYA 1FN6A 2R3YA 1FAXA 1F0RA 3MI4A 5JBTA 3IITA 1LKAA 1HJAC 1TONA 1GGDC 4JZ1A 1EJAA 1O2XA 1O5EH 4K2YA 1XUIA 5E0JA 1IHSH 1WUNH 2QIQA 4I33A 4Y7AA 2BD9A 2OP9A 3FAOA 1MZDA 2YNAA 4X8TH 3ZYDA 4BOHA 1QJ1B 1P06A 4TY7A 3M37A 1V6DA 1O2HA 3MO6A 4R0IA 1P2OA 3KGPA 1ELEE 2Y7ZA 3GCHB 3LPRA 4A1VA 2G4TA 1XUFA 4JCNA 4IW4E 1Y5AT 3VB7A 5FAHA 1TQ7B 2FXRA 1WU1A 2OC0A 4LZ4B 2H5CA 4VGCC 1OYTH 1V2KT 2FYRA 1A46H 2FI4E 5HGGA 1QBNA 3NWUA 4Q7YA 4IS5A 1GJ7B 1C2JA 1TX7A 2O8WA 4CRCA 3Q00A 2WPHS 1UTKA 1DX5M 1GDQA 1OWIA 2AYWA 1IQMA 2ZKSA 3M7QA 4Y8XA 2YNBA 5T6DA 1DLKB 5L2ZH 2EI8A 3AW1A 3GOVB 3OSYA 4YESB 1IQJA 1EX3A 5JDUB 1TPPA 1AY6H 1QL8A 1GI2A 4B1TA 2GCTB 2Z9IA 3GDUA 2ZDNA 2R2MB 1QHRB 4IMQA 3LT3A 5FX5A 1MTNC 1ZGVA 1UTPA 3QZRA 2Y81A 4UFEH 1O39A 4R8TB 1CGIE 1ESBA 4THNH 1PQ7A 1Z1IA 3MHWU 5AF9H 1TPAE 4CR5A 2WPKS 2WINI 4KKDA 1MKWH 4OS7A 1O2QA 1G9IE 5EG4A 4BTIB 1O2RA 3IWMA 2ALPA 2A4RA 1QCPA 3OY6U 1K1PA 1A7SA 3LGWA 3VB4A 1HDTH 1DVAH 1GHBG 2G55A 1A3BH 1C2FA 3LU9B 1L1NA 3RXFA 1GMDF 1C5SA 2WPMS 3BN9A 3T29A 3T5FH 4B2BA 1J8AA 7GCHG 5PTPA 1C9TA 1O3OA 3UUZA 3T62A 1NTPA 1SI5H 2ZTZA 3I78A 1BZXE 4I8KA 2A1DB 1C2IA 2UWOA 1YBWA 2H6MA 1O2TA 1TNGA 3SGAE 2HVXA 4UDWH 5DP9A 1HAGE 2VWOA 2UUJB 2VWMA 3BTQE 2CGAA 1ANEA 5LH8A 4X1RU 2O8MA 1DY9A 1HLTH 4WF8A 1XX9A 1T4VH 1EOJA 1V2QT 3TPIZ 5A2MH 2FPZA 1DSUA 5CHAC 3K65B 1O36A 3BTGE 1NN6A 5DP5A 1YM0A 1BRCE 2VIPA 4HFPB 2BD4A 1CT2E 1QFKH 2OBOA 2XNIA 1PJPA 1L2EA 4Z6AH 2FS9A 4FUFA 1HIAB 3E0NB 1C1PA 1DWBH 1D9IA 4ISIH 1Q3XA 2HPPH 4K1SA 3SNCA 1P09A 1TABE 4B71A 1HFDA 1EKBB 4XSKU 8GCHF 3QWCH 3TGKE 2ZPRA 1GMHF 2XRCA 4GVUA 1THSH 3GCOA 4INHA 3CS7A 3O8BA 4UFGH 3MO3A 2BD7A 1F2SE 2RA3A 4KELA 2QAAA 2HWLB 2LNCA 1FV9A 1S6FA 5EQRA 3SGBE 1PPCE 2A2QH 4AN7A 1A4WH 1V2TT 1GJDB 1LHDH 4Q2KA 1GBDA 3Q76A 3UOPA 1DWEH 2FOGA 3T2NA 1P2KA 2F9NA 3SJOA 1D3PB 2EEKA 2TGPZ 3A7WA 1VGCC 4RN6A 1FN8A 1ZPZA 3RXJA 1H4WA 1AQ7A 4IN1A 3OU0A 2FOHA 3PWCA 3L3TA 4YLQH 1P57B 1O5FH 1A0JA 1LQEA 2BXUH 2AIPA 1OS8A 2FYQA 1O2UA 2ANKH 4H4FA 2BLQA 3NCLA 5C2ZA 2WYGA 4CRGA 3VB6A 1ZPCA 2AEIH 4MNYA 1EP5A 1HNEE 3TITA 5EU8A 1TA2A 2QN5T 2ZHWH 4ASHA 2PKSB 2C90B 5CMXH 1ESAA 2R3UA 4H6TA 5FBIA 2G52A 4I8GA 1AGJA 2FDAA 4B73A 1SGYE 2OBQA 4FVBA 2G5NA 1O38A 2XCFA 1OYQA 2C4FH 3ZVBA 1BBRH 1DY8A 4ABIA 4ZHLU 2VNTA 1D6RA 1D3QB 1NPMA 1BA8B 1CO7E 1KXDA 4VGCB 3FANA 2DE8A 1W3CA 2BQ7B 5G4BA 2R0LA 4ZKRU 2GT8A 1LPKB 2B5TB 1DICA 2OTVA 3S0NA 1UCYH 1BHXF 1P2IA 1NRRH 1FAKH 1B5GH 2K1QA 3KCGH 4YO9A 4CBOA 4I8LA 2PTCE 2ZTYA 2KAIA 2GZ8A 1SLVB 3BIUH 3SV6A 4A5TS 1ZLRA 3V0XA 3AAUA 2BX3A 4AB9A 3RXEA 1QL9A 2B8OH 1FNIA 3S9CA 1A0HB 1NM6A 3TIUA 3S7KB 4TPYA 3NKKA 1ELTA 3SU3A 1VCPA 3RXBA 2HPQH 3U1JB 1QB6A 2PKAB 2XTTB 2LPRA 1IQFA 1NO9H 3SZNA 1D4PB 1MAYA 3LC5A 3K2UA 1OKXA 4D8NA 1C5WB 1A5GH 3A84A 4HTCH 1AVWA 4MQAA 4DY7B 1ARCA 1UTNA 1UHBB 1W0YH 2HRVA 1K1IA 5JBCS 2BY8X 3PLKA 1O5CB 6GCHG 2ZU2A 2ZFFH 4RSPA 3QK1A 1AKSA 4TYDA 4FU8A 3KQCA 2TRMA 4Q80A 2WUCA 5HXFA 3FZDA 2ZGJA 1TGCA 1THPB 3S69A 1C2GA 4YOJA 1BB0B 2GZ9A 2AFQB 1Z1JA 1SGQE 1F0SA 2CV3A 1O37A 1GBIA 1QTFA 1EB1H 1QJ6B 3SORA 5C1XA 3SV9A 1QB9A 1XUGA 2BHGA 2Y82A 3M61U 3PMAB 5C67A 6LPRA 2FO9A 1MBMA 1DSTA 5CHAB 4KTUA 1UVPA 2G00A 1G30B 1BTXA 1MU6B 1PYTD 1OWDA 1IQLA 4ZXYH 3OY5U 2ZU1A 7GCHF 3GY6A 1E38B 1Y8TA 2ULLA 4IC6A 1Z6EA 3M3SA 1ELBA 1P04A 2B9LA 1F5KU 5GIBA 1EP6A 3M3VA 1EATA 1ZMNA 2XBWA 2IN2A 2QF0A 1HYLA 4X2XA 4Z0KA 3SUFA 1GHVH 4MPWA 4GLYA 2GZ7A 2BLOA 1SGCA 1HPGA 3ATLA 1CE5A 1B7XB 1IQNA 4I31A 2VJ1A 2BDYA 3VXFH 4JZIA 2ZGXH 4X6PA 5GDSH 4FUGA 2HNTE 3KQBA 1HJ8A 3UNRA 4O3TA 1MQ6A 3VGCC 1SSXA 1LVBA 2A32A 4D9QA 1THRH 1HV7A 3MTYA 1XUKA 1ESTA 1VGCB 1MCVA 1LMWB 3KL6A 1BIOA 4YZUA 1GJAB 1NFXA 1ELDE 3VPKA 5C1UA 1KXCA 2BY5X 2XXLA 3E16B 3U98H 3LOXA 3H7OA 3F6UH 1W11U 3TGIE 5AHGH 2WV4A 4Y6DA 1V2UT 5FCKA 4OS1A 2A7JA 1HAOH 1IQKA 1K22H 2SFAA 1TOMH 3E3TA 5GCHF 1GBLA 5EOKA 3PTNA 1XXFA 5A8XA 4JMYA 2J34A 2FOBA 3EA7A 1ZZZA 1AFQB 1SHHB 1O3JA 1K2I1 1P9SA 3ITIA 1YPEH 1K9OE 1GMHG 3L33A 1T7CA 1YCPK 3GY2A 2QA9E 1V2LT 1S81A 2P8OB 4CH8B 1TNKA 1ZGIA 3P8GA 1K21H 5E8EH 2FODA 1P2QA 3SNBA 1A1RA 3KEEA 3A81A 1F0UA 4ZH8A 5FHTA 2FWWA 1LO6A 1ANDA 4ABBA 2ESTE 1IOEA 3T25A 2AGIX 2UWPA 3GY3A 1G3BA 1AB9C 3D23A 2UUKB 1FY3A 1DLEA 3ZVFA 1GBBA 1DWCH 2ZGCA 1AUTC 1V2OT 1ZPBA 5EQSA 1BMLA 2F9OA 1EPTB 1C5VA 4X2VA 2P95A 3T28A 4YOGA 3HGPA 1DOJA 3QX5H 4YLUA 1MMJN 3GDVA 4WMFA 5ETXA 3TH4H 3BTKE 1Z8GA 4O03A 3EYDA 6ESTA 1BQYA 4AFSA 1KLIH 2FOAA 1K28D 3HKJB 1CA0C 2BMGB 1GI7B 2PV9B 1TGSZ 2BOKA 1LHGH 2G81E 4X8SH 1W10U 4X6MA 3P8NA 1C1TA 1N8OB 4WMEA 3EE0B 3PWBA 3P6ZB 3RXOA 4DG4A 3ATWA 1A2CH 3M5OA 3RXRA 4CRAA 1KYNA 3PYHA 3E91A 1O32A 1UK3A 5EQQA 2GVFA 2I6QA 1J14A 3ZZ6A 5EXLA 3URDA 3HK6B 1P9UA 1EQ9A 2IOTA 4NIYA 4DOQA 4AGJA 1A0LA 1P2NA 2CHAC 1Z7KA 3ZV9A 2STBE 4Y10E 2OLGA 5EXMA 1UTQA 1SMFE 3SOSA 2FM2A 1KXFA 4CHAC 1SQAA 4YT6H 4CR9A 5HMAA 1HAVA 1GBTA 2ZTXA 1BMMH 4K60A 2G8TA 3KQDA 3MH4A 4DVAU 4CRFA 2FZZA 1YPKH 4Y0ZE 3RUOA 1PQ8A 4D76A 2B0FA 2OUAA 1C4U2 2H5DA 1Y5UT 4CREA 1SGRE 1MKWK 1G32B 1BCUH 2W7SA 2XCNA 1XM1A 2FOCA 6GCHF 2ASUB 1SB1H 3TK5A 1P3CA 5SGAE 3GDSA 1PQ5A 1FY4A 4U30A 2GDEH 1O3BA 3B8JA 1PPFE 3O8DA 3RXHA 5T6GA 2Z6BD 1TGTA 2ZHEH 1O2IA 3BEUA 1C5MD 1GL1A 2F3CE 1GHXH 1TMUH 4Q7ZA 1GVZA 2W5EA 1Z8IB 5J4QA 1FZZA 1B0EA 3GY8A 3A87A 3RC4A 3O8RA 4NA8A 1P05A 1C2LA 1V2MT 1GG6B 2EI7A 2VIDA 3RXLA 3SU6A 4GSOA 1NRPH 5E2PA 1AI8H 4YT7H 1UTLM 1SBWA 1H9IE 1O3FA 3RU4E 1EJMA 2A2XH 2C8XB 7ESTE 1SOTA 2V3OH 1C2KA 2OC7A 2G4UA 1TRMA 2SGDE 1JBUH 1YLDA 4UFDH 1DANH 1KLJH 5L2YH 2JH6D 4ZMAH 3RDZA 1TBRH 1Y3VA 1W7GH 1WTHD 3ZVDA 3HPTB 2FLBH 2PW8H 2Z7FE 4I8HA 4X2YA 1C5UA 3EAJA 2TBSA 1C4V2 1TNLA 4JK5A 2ALVA 2W3IA 2ZFSA 3SO3A 1UTJA 1J15A 1EAIA 2J92A 1MU8B 3A88A 2ZPSA 1O2NA 1MCTA 3VFEA 3FVFB 1AZZA 5GXPA 1GBEA 3F9HA 2FOEA 2Z9KA 1FIZA 3KIDU 3BG4C 4WH8A 4Y0YE 1SPJA 3LGIA 3UQOA 1ZR0A 3CENA 2V35A 4MPVA 1W7XH 2V3HH 3GY7A 1VR1H 1TOCB 4TWYA 3QDZB 1EAUA 3ZZ7A 2C8YB 3UNQA 4NIVA 8LPRA 1ABJH 2O9QA 1O3NA 5I46H 1L1GA 1G2LA 1L0ZA 1EB2A 4FUJA 3PO1B 4ISNA 4BXWA 5HM2A 1QA0A 1AMHA 3MYWA 1O2WA 4IMZA 2ZEBA 4AOQA 1QRZA 2H2ZA 4ABFA 1SGDE 4NZLA 5EW2H 3JZ2B 1NRNH 3LJOA 4MNWA 2XW9A 3P70B 3MNBA 4LZ1H 4DJZB 1JRSA 1O34A 3ATMA 3MO9A 4X6NA 2XC4A 3V3MA 3TH3H 3C27B 3NXPA 3ENSB 2GMTC 3DUXH 5IDKA 1PFXC 1AO5A 1C5YB 2JH5D 1L4DA 2RA0A 5DKMA 3UNSA 1ZJDA 3KN2A 4F4OC 4GPGA 2FOFA 1AHTH 1V2VT 3QN7A 2NU0E 3IG6B 4NWKA 3OX7U 3PLPA 1TGBA 2D8WA 3GY5A 1F7ZA 5E0GA 2STAE 1O2MA 1UVOA 1JIRA 2GP9B 3M36A 2TPIZ 1LVMA 4QT8C 3D65E 2ZCHP 4GCHG 4YTAA 2C3SA 1RTFB 2IJOB 3EA8A 2ZCKP 3CS0A 3MU0A 1CA0B 4Y71A 4HGCA 4BXSA 2HGTH 1EASA 1V2WT 1L1JA 1U6QA 1O2OA 2BY7X 1NC6A 2GV6A 3T27A 3ELAH 3LIWA 1W0ZU 1BBRK 1ZHMA 1AFEH 3LJJA 1S82A 2CJIA 2W7UA 5GCHG 1MD7A 2BDCA 3P92A 5TCCA 1BMNH 1TQ0B 2VGCB 1O3KA 2ZG0H 3VEQB 1C4Y2 1W14U 1FQ3A 1Y59T 2B7DH 1Z8RA 4NWLA 2WUBA 1OWEA 5A09A 2R9PA 1RFNA 3MNCA 3ZZDA 4UFFH 1D6WA 1UCYK 1XMNB 4WVPE 2CHAB 3ZVAA 1AIXH 4YOIA 2O8LA 4JZDH 2F83A 4O3UA 3ZZ8A 4CHAB 8ESTE 5IYTA 3HGNA 4OGYA 1INCA 2G5VA 1C9PA 2CMYA 3Q3XA 4H6SB 3ZZAA 5ESTE 1HJAB 1GJ9B 1GGDB 2ZHFH 1C2DA 4ZKSU 1SL3A 1DM4B 1SFQB 5EGMA 2TGAA 5JBAS 3TNTA 3B23B 4GUXA 2ZNKH 3U8RH 4ZXXH 2FOMB 1A61H 2KAIB 1P12E 3LH1A 3AASA 1D3DB 2F9VA 2JH0D 1HGTH 2HLCA 1O2VA 3F9EA 3PTBA 1MBQA 4A7IB 2ZO3H 9LPRA 1BRUP 1OX1A 1O5DH 1NZQH 1O5AB 3ATKA 3K6YA 3MH7A 1Y3WA 2P16A 4ISOA 1O2KA 1AVGH 1TWXB 4HI3A 2PGBB 1EAWA 3TVJB 5TJXA 2P3FH 3NZIA 1FUJA 1HAZB 1HAXB 3BEFB 1QIXB 2J4IA 5LPRA 2FI5E 4AZ2B 1A5IA 2Z9LA 3E8LA 1KLTA 1PYTC 3SGQE 3U8OH 1SG8B 2WYJA 1AKSB 5F6MA 1MTNB 5AFYH 1O3MA 1MTSA 2NU1E 5JYIA 1GHWH 1N6YA 3H5CB 2QXIA 2QXGA 1GJBB 4K1EA 1SC8U 4XBBA 2NWNA 2HNTF 2QV1A 2VIWA 5GWZA 2PUQH 2SNVA 1ZSKA 3KF2A 1H8DH 3BV9B 3UR6A 1WBGB 1BJVA 4UEHH 4O9VA 2Y5HA 3E90B 2UWLA 1SQOA 3FZZA 1YF4A 2ODQA 1ELVA 2EI6A 1SOZA 3Q3YA 1QQ4A 1JIMA 5F8ZA 2Z3EA 1G3EA 4DT7B 1NS3A 2ZI2H 2FEQH 1NT1A 1TNIA 1UTOA 1EZQA 2FS8A 1Z71A 5C5NA 1GBCA 3LGVA 3HK3B 2A7HA 4J1YA 3K9XB 4TWWA 2UUFB 2NU2E 3RXQA 1NROH 3MWIU 1TRNA 3A7YA 3KNXA 1KSNA 3MMGA 4CRBA 1LHFH 2BVXH 2A5KA 1SGFA 3NUMA 3A86A 1ZSLA 5JB8S 2ZHDA 4BAHB 3STJA 3FP8E 2D26C 2GMTB 4RKOB 1BTHH 1RS0A 3M5LA 1XKBC 4JZFH 1G37A 4CRDA 1O2SA 1GHZA 4KTSA 4NSVA 3ZZ4A 1TGNA 1QRWA 2ZDLA 1IQIA 2ZQ1A 2FP7B 3M5NA 4I8JA 3EA9A 1ACBE 2GGVB 2GD4B 3RXKA 4MLFB 1KDQA 2P3TB 1OWJA 1H1BA 2BLVA 1TPSA 2OXSA 1LPZB 1GI4A 1GJ6A 3TJNA 1KY9A 1O5BB 4JK6A 1YC0A 2A4GA 5JPMH 1YPHC 3VXEH 2PGQB 2A7CA 1GJ8B 5TCAA 3BTWE 4LK4A 4DIIH 1F5RA 2Y6TA 1P02A 1RTKA 5DPAA 3A89A 1GBFA 1PPHE 2QY0B 2RCEA 1MD8A 2FLRH 1YPJH 2YOLA 1O3EA 3VB5A 3G01A 1SGTA 1UVTH 2Q6GA 2P3UB 2QF3A 1B0FA 1PQAA 3FFGA 4FUIA 5L30H 5C5OA 2ZQ2A 3H7TA 1UO6A 3A7XA 4K5ZA 4DCDA 1GJ5H 5FPYA 1GI5A 1TNJA 1ZRKA 2GCTC 3QGJA 5E2OA 2ZGBH 1ARBA 5DP7A 2BY6X 3CP7A 2SGPE 1DS2E 4GCHF 4OS6A 3BSQA 1G36A 1J17T 2DE9A 5GPIB 4NGAH 2Q6DA 4B2CA 1EOLA 1GDNA 3SHAH 1FPCH 5AVDA 1IQEA 1BTUA 2PHBA 3BF6H 1SGEE 1ANCA 2A4QA 3SUGA 3NPSA 3A8CA 4XBCA 2BQ6B 3LGYA 4AX9H 2Y7XA 2A31A 2EC9H 1A3EH 3GCNA 4BTUB 1S0QA 1C1QA 3I29A 1BMAA 1XXDA 3ZVGA 1KTTB 5DP8A 4XE4A 2ZHQH 1EUFA 1ETSH 1GBKA 4NIXA 1O35A 1ELGA 4WXIA 1GWAA 5DGJA 4BAQB 3HKIB 1C1SA 3QGNB 1C1NA 4MPXA 3F9GA 4U32A 1SFIA 5JB9S 4I32A 4NCYA 3UTUH 2GV7A 3ZZ5A 4WWYA 2PSYA 1YPMH 4BAKB 4Y76A 1E37B 3UWJH 3RP2A 1QBVH 4UD9H 1SHYA 1TYNA 1ZYOA 3NK8A 1DUEA 1FI8A 1A5HA 1O2GH 1OP8A 1DXWA 4AFUA 4TPIZ 1PPZA 1C1RA 2O8TA 4JYVH 2ZCLP 4ESTE 2Q6FA 4UONA 3SQHE 3RLYH 3SHCH 3SU0A 2J95A 4MVNA 4AYYB 1HB0B 1K1JA 1GJ4H 1E34B 1BTPA 3PLBA 2J38A 2BDAA 3MU8A 3MH6A 3PMHB 1WV7H 2BVRH 5C1YA 4Q7XA 1CHOG 1T8MA 1TX6A 3RXAA 3A8BA 3QTVH 4IGDA 3RMNH 3RMOH 1UCYE 1CHGA 3L6PA 2BDGA 1HAVB 1G2MA 1O3DA 5L6NH 2Z9JA 1O3PB 4IBLH 1F92A 3M35A 5T3HA 1QQUA 3ODDA 4D7GA 4YM9A 3P8FA 4FUBA 1TMBH 1H9LB 4JYUH 4UE7H 3LGTA 1GMCG 1YP9A 1VJAU 5C20A 1KXAA 3URCA 3PM3A 2JETC 2ZZUH 1C5NH 5EODA 4Y11E 1BITA 4E06H 4A1TA 4AYVB 4I7YH 4CBNA 3RMLH 2SNWA 2VINA 1XVMA 2NU4E 1W8BH 2A0QB 1SGIB 2XBVA 2ZFRH 4MNVA 1HAPH 5FBEA 4GAWA 1ORFA 1OP0A 5BPEA 1CA8B 3A83A 1ELCA 4B74A 1AUJA 4SGBE 2XYAA 3SU1A 1MH0A 1LTOA 1NU7B 3SUDA 1C5ZB 1T31A 2F9UA 1HBTH 3ODFA 4LXBH 3RM2H 2Z3CA 2PFEA 4X1QU 3RXVA 5LPEA 2BXTH 2ZU3A 3A85A 4CH2B 1AWHB 2QC2A 1ETRH 2THFB 1RJXB 2PKSC 1C5TA 2ZP0H 3GISB 1V2RT 1BRBE 1LHEH 4A92A 1NFWA 1Y3XA 1YPHE 1ZTLA 4B2AA 1UK2A 2GDDA 4F49A 4GHTA 2TGDA 1W2KH 2Q1JA 5C3NA 2J2UA 4X1NU 1TB6H 3SU5A 2ODPA 2AGEX 4INLA 1J16A 1SR5C 1O2ZA 3SN8A 3LGUA 2BQWB 2ZFQH 3JZ1B 3F68H 1YLCA 2OC1A 1BUIA 1MKXH 1CU1A 4DIHH 4M7GA 3RXUA 4K3JA 1P8VC 3FP6E 2BB4A 2GCHG 2OCVB 2ZC9H 1T32A 4SGAE 1GHYH 1O5GH 1LQDB 1FY5A 4B75A 1CVWH 4K69A 2BZ6H 3VGCB 2H9EH 3VB3A 4AFQA 3PB1E 1LVOA 2C93B 2PSXA 4ISLA 1V3XA 4NIWA 3TJVA 1C1OA 3EQ0H 4KTCA 5HM9A 3TK9A 1RD3B 2ZFTA 1NRQH 4U2WA 5F8XA 7LPRA 2VVUA 4IC5A 1K1OA 2ZGHA 3QLPH 3W95A 4FVDA 1C2MA 4ABAA 4WJG2 1VCQA 3AVZA 5J4SA 1YGCH 2M5TA 2OINA 4OS5A 1C5QA 3DD2H 2XWBI 4D9RA 1LKBA 3PV4A 3S9AA 2P93A 1T8LA 3V13A 1BJUA 1SLUB 4X1SU 2ZECA 1C5PA 4E7RG 1VITG 4ZROA 1P11E 1JOUB 1GCTC 1S5SA 1FJSA 1RGQA 3TK6A 2SGEE 3A8DA 1PPBH 2XBYA 1V2ST 2VWLA 1E36B 1TBQH 1ZRBA 2BDHA 2R2WU 4TY6A 2CF8H 1FMGA 1GI0A 1LDTT 1QJ7B 1LPGB 3RC5A 4D7FA 2ANWA 1NFYA 1T4UH 1P03A 1TLDA 2FIRH 3UFAA 2AMDA 4XFQA 4IN2A 3P95A 3RMMH 4BTTB 1EZXC 3A7VA 1O3IA 2P94A 1UK4A 2BDBA 4ABJA 1VCWA 2VH6A 4KP0A 3ATIA 1C1UH 1QA7A 5BRRE 2BVSH 3SU2A 1GPZA 2XC5A 1W12U 2CN0H 1P01A 1H8IH 1UVSH 1CBWC 5ABWA 3ZZ3A 3LKWA 1FLEE 1NY22 3WY8A 1AB9B 1KXEA 2OQ5A 3SJKA 1BOQA 4X0WU 1P0SH 1WYKA 2V0BA 4HZHA 3ZYEA 1S84A 2W3KA 4AFZA 3F9FA 1IQGA 3RU4T 3V12A 1OWKA 2BY9X 3QUMP 4FU7A 4BAOB 1TMTH 4O97A 2PR3A 2FX4A 3ZV8A 1X7AC 1KXBA 5FX6A 4X6OA 6CHAC 1GVLA 1MUEB 3SQEE 2EA3A 3U8TH 5A8YA 5DJ7A 1NESE 1O33A 3RXSA 1QBOA 2ANMH 2FTMA 1OPHB 1K1MA 1E0FD 2ZPQA 1P2MA 2QXHA 4MNXA 1V2NT 1V2PT 4ZKOU 1LCYA 1ZMJA 1GI6A 3UWIA 2ANYA 9ESTA 1WQVH 3OTJE 4LOYH 5DO4H 3MH5A 1QURH 5DP4A 3SW2B 1JXPA 2QYIA 1WOFA 4ZKNU 2BD5A 1C5XB 4BAMB 1WCZA 2JETB 1NRSH 1AZ8A 2W26A 1HIAA 4Y79A 5K7RA 1EJNA 4X8UH 3GCTF 4K1TA 1Y3YA 3ZVCA 2Y5FA 3DFLA 3S7HB 1S83A 4OS2A 4NA7A 1IQHA 4XDEA 4XOJA 1CHOF 2AERH 3Q77A 3A7ZA 1AWFH 1WSSH 1PPGE 1RIWC 2RG3A 1GBAA 1VJ9U 2QXJA 1DDJA 1YKTA 1AD8H 3BTDE 1XVOA 1GBJA 2GT7A 3TJOA 2R0KA 3T26A 2H9HA 5DG6A 2HNTC 3UOUA 2Z9GA 1YPGH 5FXLA 1GMCF 2VB0A 5DP6A 3A7TA 1AE5A 3ZZCA 4ABGA 1C5OH 2ZWLH 3DHKH 4ABEA 2BM2A 3KHVA 4PROA 1RRKA 1FY8E 4X2WA 3RXPA 1C5RA 3EGKH 3BEIB 5A0AE 1VITH 4K8BA 5FCRA 2IPHA 2ZDKA 3UREA 1MTUA 3RLWH 5HYOA 1Z8JB 2ZF0H 1EZUC 1YCPM 1AFQC 1ELAA 3RXGA 1O0DH 1TE0A 3FP7E 1DT2A 1OXGA 5F03A 1S0RA 4Y7BA 1GL0E 3UPEA 3GYMA 4ISHH 1CQQA 1ANBA 1Y5BT 4MG3A 3MOCA 4MDSA 2P8OC 3RXTA 2ZIQH 4FU9A 4OGXA 5B6OA 1SLXB 2FI3E 2ODYB 2Z94A 3S9BA 1BTZA 1XKAC 2BOHB 3UQVA 3SBKA 1ZHPA 1GHAG 1OSSA 1ID5H 1DE7H 3SJ8A 1XUHA 1ELFA 3TU7H 2Y5GA 2AS9A 1C5LH 1DPOA 1QB1A 1AN1E 2RDLA 1Q31A 4A6LA 1EPTC 1TX8A 4FUHA 2P59A 1T8NA 2FTLE 5EW1H 4K8YA 1O3HA 1SQTA 1TAWA 3BTME 2XWAA
chains in the Genus database with same CATH superfamily
1BRAA 1DXPA 1TPOA 3LONA 3P8OA 3PMBB 3BTTE 8KME2 1K1LA 2VIVA 4WMDA 1TALA 1AU8A 1J9CH 1MAXA 3BG4B 3HATH 3MU1A 2XBXA 2VWNA 1O3AA 2AH4X 1JRTA 1UVUH 2F91A 3LDXH 3STIA 1N8OC 2GCHF 2D2DA 1GCDA 3BIVH 2VIOA 1TA6A 2ZDVH 2TIOA 1EXFA 1MQ5A 4ZHAA 1C2HA 4GHQA 2CF9H 1ZHRA 1ZSJA 1G3DA 1GCTB 1KIGH 3BTEE 3SNDA 3AAVA 2ZA5A 3SNEA 1P10A 3UIRA 3R0FA 3ZVEA 5CE1A 2BD2A 4DW2U 4WXVA 1P2JA 4DURA 3BTHE 1GDUA 4AG2A 3O8CA 2BX4A 3M5MA 4J2YB 4X1PU 1QRXA 1T8OA 1KDQB 1FY1A 2FESH 2PWXA 3F0PA 5F8TA 2AMQA 2ZU4A 5I25A 2PUXB 2PKAA 3U1IB 2J9NA 3RXDA 1SLWB 2HALA 3LC3A 1TNHA 5A8ZA 1O3GA 1GI8B 1P3EA 4INKA 1HAIH 1FIWA 3RXCA 3SJIA 1AVXA 2H9TH 1AE8H 3OYPA 1CBWB 1HXFH 1QY6A 4KGAA 2H1UA 2OC8A 3ZZ9A 2AGGX 4ACAA 1HAYB 3M7UA 1VITF 2GTBA 4ZHMU 4AORA 1UHBA 3MNSA 4XBDA 1SVPA 1K1NA 1MTWA 2VIQA 1GHBF 1O2LA 2BLWA 3SNAA 3PMJA 4BANB 3SV7A 4MPUA 5AFZH 1DITH 3GCHC 6CHAB 1Z6JH 1NU9A 4Z1MD 5EPNA 2KX4A 3U9AH 3GICB 2FX6A 2VVCA 2AIQA 4AG1A 1F0TA 5E0HA 2Z3DA 5EXNA 1IAUA 3C1KA 1GI1A 5H4IB 2JKHA 1GI9B 2V6NA 5C94A 3FOAA 5DK1A 2VH0A 1Y3UA 3SV2H 3MFJA 1TRYA 1QL7A 1XUJA 1MTVA 1GG6C 1BT7A 1FPHH 1FDPA 1E79D 1RTLA 5A0CA 1QNJA 2VU8E 1FONA 1SGPE 1GJCB 1NFUA 2PTNA 3QTOH 1WQSA 2VVVA 1GMDG 1GBHA 3D62A 1BHXB 2NU3E 4ZAEA 4FUEA 2I6SA 1QGFA 1UTMA 1PPEE 1N6XA 1HJ9A 2BZAA 2GKVE 2WV5A 4Y8ZA 2A45B 2FMJA 3V7TA 4B76A 4ZUHA 1OHHD 4U01A 1O3CA 3R3GB 4FXGH 5LPFA 3SU4A 1C1MA 1RIWB 1TIOA 5EPYA 3SJ9A 5HIZA 3SV8A 1DFPA 3MU4A 1ZTJA 2XC0A 2ZU5A 4FUCA 4H42U 3N7OA 3TJUA 3RXMA 2QCYA 3WWBA 2C8ZB 1ETTH 1LVYA 3GY4A 1GI3A 2D1JA 3RXIA 1JMOH 2BDIA 4E05H 1ZMLA 3RM0H 1S85A 3TGJE 3DT0H 3M3TA 1O30A 2G51A 2GX4A 4OS4A 1HUTH 1O2PA 2J94A 2QGRA 3GYLB 3A80A 3F1SB 4NFEA 2O8UA 3DSPA 1BTYA 2W6JD 1E35B 3D49H 4ABHA 1DUAA 2SGAA 5ESBA 2SGQE 3LH3A 4JYTA 3PO1C 3MU5A 4ABDA 4AGKA 2C8WB 1C2EA 5T6FA 1RXPA 4NA9H 8GCHG 1GBMA 3E0PB 1DWDH 1UJ1A 5DP3A 7KMEH 1SGFG 3SUEA 2SGFE 5FPSA 2OK5A 1HRTH 3B9FH 2A5IA 2DUCA 1W13U 1O2YA 2OD3B 1M9UA 2F9PA 1OP2A 2A4OA 4RKJB 1V2JT 2ILNA 3BG8A 2WPJS 3RC6A 1BBRE 1CSOE 4Y8YA 1O31A 3MNXA 1H9HE 3BTFE 2OQUA 2PLXA 3GCTG 1C1WH 3M7TA 3E6PH 2BD3A 2F9BH 3K6ZA 1BMFD 2ZDMA 3ZZBA 1BTWA 3SI4H 4DT4A 1EZSC 3PROA 3RU4D 3I77A 3QZQA 3E1XB 1D3TB 2HOBA 1FXYA 1EAXA 2WPIS 2BD8A 2TGTA 1OWHA 4DGJA 1IHTH 3KQEA 1TBZH 4NFFA 4NSYA 3W94A 3EDXB 4MTBA 1CGHA 1L4ZA 3NRLA 1UMAH 1CT0E 4E7NA 4BNRA 2ZDAH 3F0OA 1YPLH 3U69H 1CGJE 4X8VH 4WY3A 1HXEH 1JWTA 2WPLS 3ESTA 1ZTKA 2BYAX 1F5LA 1GHAF 5GJ4B 1G3CA 4WH6A 1MKXK 3QO6A 1BDAA 1YYY1 5JBBS 1EPTA 1S6HA 3TNSA 2VGCC 3AW0A 1TFXA 2ZFPH 1YCPH 1N1LA 2A5AA 3UR9A 2AMPA 1MZAA 1CT4E 5LGOA 1HCGA 2BTCE 3SI3H 1SGNE 4AB8A 3A82A 4NZQA 5A0BA 2XOKD 2Y80A 3P17H 2KFWA 3TH2H 1VZQH 1Q2WA 1ZOMA 3DA9B 1HAHH 1ZJKA 4FUDA 3TLOA 1O2JA 1KTSB 1O3LA 3H09A 1QR3E 3A8AA 1C1VH 1WAYB 2RDEA 3Q3KA 2CXVA 4JZEH 3DFJA 4NG9H 1WTGH 5FPTA 1LHCH 1ABIH 1OOKB 5EJZA 3UY9A 1GVKB 4A1XA 5K0HA 2UUYA 1FN6A 2R3YA 1FAXA 1F0RA 3MI4A 5JBTA 3IITA 1LKAA 1HJAC 1TONA 1GGDC 4JZ1A 1EJAA 1O2XA 1O5EH 3OTPA 4K2YA 1XUIA 5E0JA 1IHSH 1WUNH 2QIQA 3N7DA 4I33A 4Y7AA 2BD9A 2OP9A 3FAOA 1MZDA 2YNAA 4X8TH 3ZYDA 4BOHA 1QJ1B 1P06A 4TY7A 3M37A 1V6DA 1O2HA 3MO6A 4R0IA 1P2OA 3KGPA 1ELEE 2Y7ZA 3GCHB 3LPRA 4HG6A 2G4TA 4A1VA 1XUFA 4JCNA 4IW4E 1Y5AT 3VB7A 5FAHA 1TQ7B 2FXRA 1WU1A 2OC0A 4LZ4B 2H5CA 4VGCC 1OYTH 1V2KT 2FYRA 1A46H 2FI4E 5HGGA 4RI0A 1QBNA 3NWUA 4Q7YA 4IS5A 1GJ7B 1C2JA 1TX7A 2O8WA 4CRCA 3Q00A 2WPHS 1UTKA 1DX5M 1GDQA 1OWIA 2AYWA 1IQMA 2ZKSA 3M7QA 4Y8XA 2YNBA 5T6DA 1DLKB 5L2ZH 2EI8A 3AW1A 3GOVB 3OSYA 4YESB 1IQJA 1EX3A 5JDUB 1TPPA 1AY6H 1QL8A 1GI2A 4B1TA 2GCTB 2Z9IA 3GDUA 3PRBA 2ZDNA 2R2MB 1QHRB 4IMQA 3LT3A 5FX5A 1MTNC 1ZGVA 1UTPA 3QZRA 2Y81A 4UFEH 1O39A 4R8TB 1CGIE 1ESBA 4THNH 1PQ7A 1Z1IA 3MHWU 5AF9H 1TPAE 4CR5A 3FN8A 2WPKS 2WINI 4KKDA 1MKWH 4OS7A 1O2QA 1G9IE 5EG4A 4BTIB 1O2RA 4F55A 3IWMA 2ALPA 2A4RA 1QCPA 3OY6U 1K1PA 1A7SA 3LGWA 3VB4A 1HDTH 1DVAH 1GHBG 2G55A 1A3BH 4TT3D 1C2FA 3LU9B 1L1NA 3RXFA 1GMDF 1C5SA 2WPMS 3BN9A 3T29A 3T5FH 4B2BA 1J8AA 7GCHG 5PTPA 1C9TA 1O3OA 3UUZA 3T62A 1NTPA 1SI5H 2ZTZA 3I78A 1BZXE 4I8KA 2A1DB 1C2IA 2UWOA 1YBWA 2H6MA 1O2TA 4OM9A 1TNGA 3SGAE 2HVXA 4UDWH 5DP9A 1HAGE 2VWOA 2UUJB 2VWMA 5HIYA 3BTQE 2CGAA 1ANEA 5LH8A 4X1RU 2O8MA 5C17A 1DY9A 1HLTH 4WF8A 1XX9A 1T4VH 1EOJA 1V2QT 3TPIZ 5A2MH 2FPZA 1DSUA 5CHAC 3K65B 1O36A 3BTGE 1NN6A 1UW7A 3SYJA 5DP5A 1YM0A 1BRCE 2VIPA 4HFPB 2BD4A 1CT2E 1QFKH 2OBOA 2XNIA 1PJPA 1L2EA 4Z6AH 2FS9A 4FUFA 1HIAB 3W1EA 3E0NB 1C1PA 1DWBH 5B6LA 1D9IA 4ISIH 1YY3A 1Q3XA 2HPPH 4K1SA 3SNCA 1P09A 1TABE 4B71A 5IK2D 1HFDA 1EKBB 3PRDA 4XSKU 8GCHF 3QWCH 3TGKE 2ZPRA 1GMHF 2XRCA 4GVUA 1THSH 3GCOA 4INHA 3CS7A 3O8BA 4UFGH 3MO3A 2BD7A 1F2SE 2RA3A 4KELA 2QAAA 2HWLB 2LNCA 1FV9A 3FKSD 1S6FA 2WZQA 5EQRA 3SGBE 1PPCE 2A2QH 4AN7A 1A4WH 1V2TT 1GJDB 1LHDH 4Q2KA 1GBDA 3Q76A 3UOPA 1DWEH 2FOGA 3T2NA 2IPQX 1P2KA 2F9NA 3SJOA 1D3PB 2EEKA 2TGPZ 3A7WA 1VGCC 4RN6A 1MABB 1FN8A 1ZPZA 3RXJA 1H4WA 1AQ7A 4IN1A 3OU0A 2FOHA 4RT1A 3PWCA 3L3TA 4YLQH 1P57B 1O5FH 5DN6D 1A0JA 1LQEA 2BXUH 2AIPA 1OS8A 2FYQA 1O2UA 2ANKH 4H4FA 2BLQA 3NCLA 5C2ZA 2WYGA 4CRGA 3VB6A 1ZPCA 2AEIH 4MNYA 1EP5A 1HNEE 3N7EA 3TITA 5EU8A 1TA2A 2QN5T 2ZHWH 4ASHA 2PKSB 2C90B 5CMXH 1ESAA 2R3UA 4H6TA 5FBIA 2G52A 4I8GA 1AGJA 2FDAA 4B73A 1SGYE 2KCPA 2OBQA 4FVBA 2G5NA 1O38A 2XCFA 1OYQA 2C4FH 3ZVBA 1BBRH 1DY8A 4ABIA 3UB0A 4ZHLU 2KM0A 2VNTA 1D6RA 1D3QB 1NPMA 1BA8B 1CO7E 1KXDA 4VGCB 3FANA 2DE8A 1W3CA 2BQ7B 5G4BA 2R0LA 4ZKRU 2GT8A 1LPKB 2B5TB 2PP6A 1DICA 2OTVA 3S0NA 1UCYH 1BHXF 1P2IA 1NRRH 1FAKH 1B5GH 4ASUD 2K1QA 5DSFA 3KCGH 4YO9A 4CBOA 4I8LA 2PTCE 2ZTYA 2KAIA 2GZ8A 1SLVB 3BIUH 3SV6A 4A5TS 1ZLRA 3V0XA 3AAUA 2BX3A 4AB9A 3RXEA 1QL9A 2B8OH 1FNIA 3S9CA 1A0HB 1NM6A 3TIUA 5C0UA 3S7KB 4TPYA 3NKKA 1ELTA 3SU3A 1VCPA 3RXBA 2HPQH 2F4LA 3U1JB 1QB6A 2PKAB 2QF5A 2XTTB 1IQFA 2LPRA 1NO9H 3SZNA 1D4PB 1MAYA 3GS9A 3LC5A 3K2UA 1OKXA 4D8NA 1NBME 1C5WB 1A5GH 3A84A 4HTCH 1AVWA 2KR7A 2JJ2D 4MQAA 4DY7B 1ARCA 1UTNA 1UHBB 1W0YH 2HRVA 1K1IA 5JBCS 2BY8X 3PLKA 1O5CB 6GCHG 2ZU2A 2ZFFH 4RSPA 3QK1A 1AKSA 4TYDA 4FU8A 3KQCA 2TRMA 4Q80A 2WUCA 5HXFA 3FZDA 2ZGJA 1TGCA 1THPB 3S69A 1C2GA 4YOJA 1BB0B 2GZ9A 2F43B 2AFQB 1Z1JA 3F2FA 1SGQE 1F0SA 2CV3A 1O37A 1GBIA 1QTFA 1EB1H 1QJ6B 3SORA 5C1XA 3SV9A 1QB9A 1XUGA 2IJD1 2BHGA 2Y82A 3M61U 3PMAB 5C67A 6LPRA 2FO9A 1MBMA 1DSTA 5CHAB 4KTUA 1UVPA 2G00A 1G30B 1BTXA 1MU6B 1PYTD 1OWDA 1IQLA 4ZXYH 3OY5U 2L6OA 3U28C 2ZU1A 7GCHF 3GY6A 1E38B 1Y8TA 2ULLA 4IC6A 1Z6EA 3M3SA 1ELBA 1P04A 2B9LA 2VBCA 1F5KU 5GIBA 1EP6A 3M3VA 1EATA 1ZMNA 2XBWA 2IN2A 2QF0A 2GJGA 1HYLA 4X2XA 4Z0KA 2KCYA 3SUFA 1GHVH 4MPWA 4GLYA 2GZ7A 2BLOA 1SGCA 1HPGA 3ATLA 1CE5A 1B7XB 1IQNA 4I31A 2VJ1A 2BDYA 1KMHB 3VXFH 4JZIA 2ZGXH 4X6PA 5GDSH 4FUGA 2HNTE 3KQBA 1HJ8A 3UNRA 4O3TA 1MQ6A 3VGCC 1SSXA 5FL7D 1LVBA 2A32A 4D9QA 1THRH 1HV7A 3MTYA 1XUKA 1ESTA 1VGCB 1MCVA 1LMWB 3KL6A 1BIOA 4YZUA 1GJAB 1NFXA 1ELDE 3VPKA 5C1UA 1KXCA 2BY5X 2XXLA 3E16B 3U98H 3LOXA 3H7OA 3F6UH 1W11U 3TGIE 5AHGH 2WV4A 4Y6DA 1V2UT 5FCKA 4OS1A 2A7JA 1HAOH 1IQKA 1K22H 2SFAA 1TOMH 3E3TA 5GCHF 1GBLA 5EOKA 3PTNA 1XXFA 5A8XA 4JMYA 2J34A 2WSSD 2FOBA 3EA7A 3OAAD 1ZZZA 1AFQB 1SHHB 3UAIC 1O3JA 1K2I1 1P9SA 3ITIA 1YPEH 1K9OE 1GMHG 3L33A 1T7CA 1YCPK 3GY2A 2QA9E 1V2LT 1S81A 2P8OB 4CH8B 4ACBA 1TNKA 1ZGIA 3P8GA 1K21H 5E8EH 2FODA 1P2QA 3SNBA 1A1RA 2EY4C 3KEEA 3A81A 1F0UA 4ZH8A 5FHTA 2FWWA 1LO6A 1ANDA 4ABBA 2ESTE 1IOEA 3T25A 2AGIX 2UWPA 3GY3A 1EFRD 1G3BA 1AB9C 3D23A 2UUKB 1FY3A 1DLEA 3ZVFA 1GBBA 1DWCH 2ZGCA 1AUTC 1V2OT 1ZPBA 5EQSA 1BMLA 2F9OA 1EPTB 1C5VA 4X2VA 2P95A 3T28A 4YOGA 3HGPA 1DOJA 3QX5H 3VG8A 5EJ1A 4YLUA 1MMJN 3GDVA 4WMFA 5ETXA 3TH4H 3BTKE 1Z8GA 4O03A 3EYDA 5T1VA 6ESTA 1BQYA 4AFSA 2YMSC 1KLIH 2FOAA 1K28D 3HKJB 1CA0C 2BMGB 2J98A 1GI7B 2PV9B 1TGSZ 2BOKA 1LHGH 2G81E 3KYFA 4X8SH 1W10U 4X6MA 3P8NA 1WXRA 1C1TA 1N8OB 4WMEA 3EE0B 3PWBA 3P6ZB 3RXOA 4DG4A 3ATWA 1A2CH 3M5OA 3RXRA 4CRAA 4ZCNA 1KYNA 3PYHA 3E91A 1O32A 1UK3A 5EQQA 2GVFA 2I6QA 1J14A 3ZZ6A 5EXLA 3URDA 3HK6B 1P9UA 1EQ9A 2IOTA 4NIYA 4DOQA 4AGJA 1A0LA 1P2NA 2CHAC 1Z7KA 3ZV9A 2STBE 2WV9A 4Y10E 2OLGA 5EXMA 1UTQA 1SMFE 3SOSA 2FM2A 1KXFA 4CHAC 1SQAA 4YT6H 4CR9A 5HMAA 1HAVA 1GBTA 2ZTXA 1BMMH 4K60A 2G8TA 3KQDA 3MH4A 4DVAU 4CRFA 2FZZA 1YPKH 4Y0ZE 3RUOA 1PQ8A 4D76A 2B0FA 2OUAA 1C4U2 2H5DA 3OEED 1Y5UT 5HKKD 4CREA 1SGRE 1MKWK 1G32B 1BCUH 2W7SA 2XCNA 1XM1A 2FOCA 2YMSD 6GCHF 2ASUB 1SB1H 3TK5A 1P3CA 5SGAE 3GDSA 1PQ5A 1FY4A 4U30A 2GDEH 1O3BA 3B8JA 1PPFE 3O8DA 3RXHA 5T6GA 2Z6BD 1TGTA 2ZHEH 1O2IA 3BEUA 1C5MD 1GL1A 2F3CE 1GHXH 1TMUH 4Q7ZA 1GVZA 2W5EA 2AHME 1Z8IB 5J4QA 1FZZA 1B0EA 3GY8A 3A87A 3RC4A 3O8RA 4NA8A 1P05A 1C2LA 1V2MT 1GG6B 2EI7A 2VIDA 3RXLA 3SU6A 4GSOA 1NRPH 5E2PA 1AI8H 4YT7H 1UTLM 1SBWA 1H9IE 1O3FA 3RU4E 1EJMA 2A2XH 2C8XB 7ESTE 1SOTA 2V3OH 1C2KA 2OC7A 2G4UA 1TRMA 2SGDE 1JBUH 1YLDA 4UFDH 1DANH 1KLJH 5L2YH 2JH6D 4ZMAH 3RDZA 1TBRH 1Y3VA 1W7GH 1WTHD 3ZVDA 3HPTB 2FLBH 2PW8H 2Z7FE 4I8HA 4X2YA 1C5UA 3EAJA 2TBSA 4P00A 1C4V2 1TNLA 4JK5A 2ALVA 2W3IA 2ZFSA 3SO3A 1UTJA 1J15A 1EAIA 2J92A 1MU8B 3A88A 3F3BA 2ZPSA 1O2NA 1MCTA 3VFEA 3FVFB 1AZZA 4I86A 5GXPA 1GBEA 3F9HA 2FOEA 2Z9KA 1FIZA 3KIDU 2M2AA 3BG4C 4WH8A 4Y0YE 1SPJA 3LGIA 3UQOA 1ZR0A 3CENA 2V35A 4MPVA 1W7XH 2V3HH 3GY7A 1VR1H 1TOCB 4TWYA 3QDZB 1EAUA 3ZZ7A 2C8YB 3UNQA 4NIVA 8LPRA 1ABJH 2J97A 2O9QA 1O3NA 5I46H 1L1GA 1G2LA 1L0ZA 1EB2A 4FUJA 3PO1B 4ISNA 4BXWA 5HM2A 1QA0A 1AMHA 3MYWA 1O2WA 4IMZA 2ZEBA 4AOQA 1QRZA 2H2ZA 4B6FA 4ABFA 1SGDE 4NZLA 5EW2H 3JZ2B 1NRNH 3LJOA 4MNWA 2XW9A 3P70B 3MNBA 4LZ1H 4DJZB 1JRSA 1O34A 3ATMA 3MO9A 4X6NA 2XC4A 3V3MA 3TH3H 3WWFA 3C27B 3NXPA 3ENSB 2GMTC 3DUXH 5IDKA 1PFXC 1AO5A 1C5YB 2JH5D 1L4DA 2RA0A 5DKMA 3UNSA 1ZJDA 3PV2A 3KN2A 4F4OC 4GPGA 2W6ID 1H8ED 2FOFA 1AHTH 1V2VT 3WW7A 3QN7A 2NU0E 3IG6B 4NWKA 3OX7U 3PLPA 1TGBA 2D8WA 3GY5A 1F7ZA 5E0GA 2STAE 2K0QA 1O2MA 1UVOA 1JIRA 1FX0B 2GP9B 3M36A 2TPIZ 1LVMA 4QT8C 3D65E 2ZCHP 4GCHG 4YTAA 2C3SA 1RTFB 2IJOB 3EA8A 2ZCKP 3CS0A 3MU0A 1CA0B 4Y71A 4HGCA 4BXSA 2HGTH 1EASA 1V2WT 1L1JA 1K0HA 1U6QA 1O2OA 2BY7X 1NC6A 2GV6A 3T27A 3ELAH 3LIWA 1W0ZU 1BBRK 1ZHMA 1AFEH 3LJJA 1S82A 2CJIA 2W7UA 5GCHG 1MD7A 2BDCA 3P92A 5TCCA 1BMNH 1TQ0B 2VGCB 1O3KA 2ZG0H 5CDFE 3VEQB 5EJLA 1C4Y2 1W14U 1FQ3A 1Y59T 2B7DH 1E1QD 1Z8RA 4NWLA 2WUBA 1OWEA 5A09A 2R9PA 1RFNA 3MNCA 3ZZDA 4UFFH 1D6WA 1UCYK 3F2HA 1XMNB 4WVPE 2CHAB 3ZVAA 1AIXH 4YOIA 2O8LA 3AK5A 4JZDH 2F83A 4O3UA 3ZZ8A 4CHAB 8ESTE 5IYTA 3HGNA 4OGYA 1INCA 2G5VA 5C0TA 1C9PA 2CMYA 3Q3XA 4H6SB 3ZZAA 5ESTE 1HJAB 1GJ9B 1GGDB 2HVYB 2ZHFH 1C2DA 4ZKSU 1SL3A 2KZ4A 1DM4B 1SFQB 5EGMA 2TGAA 5JBAS 3TNTA 3B23B 4GUXA 2ZNKH 3U8RH 4ZXXH 2FOMB 1A61H 2KAIB 1P12E 3LH1A 3AASA 1D3DB 2F9VA 2JH0D 1HGTH 2HLCA 1O2VA 3F9EA 3PTBA 1MBQA 1COWD 4A7IB 2ZO3H 3DSGA 9LPRA 1BRUP 1OX1A 1O5DH 1NZQH 1O5AB 3ATKA 3K6YA 3MH7A 1Y3WA 2P16A 4ISOA 1O2KA 1AVGH 1TWXB 4HI3A 2PGBB 1EAWA 3TVJB 5TJXA 2P3FH 3NZIA 1FUJA 1HAZB 1HAXB 2JJ1D 3BEFB 1QIXB 2J4IA 5LPRA 2FI5E 4AZ2B 1A5IA 2LP6A 2Z9LA 3E8LA 1KLTA 1PYTC 2WHXA 3SGQE 1WDIA 3U8OH 1SG8B 2WYJA 1AKSB 5F6MA 1MTNB 5AFYH 1O3MA 1MTSA 2NU1E 5JYIA 1GHWH 1N6YA 3H5CB 2QXIA 2QXGA 1GJBB 4K1EA 1SC8U 4XBBA 2NWNA 2HNTF 2QV1A 2VIWA 5GWZA 2PUQH 2SNVA 1ZSKA 4AC9A 3KF2A 1H8DH 3BV9B 3UR6A 1WBGB 1BJVA 4UEHH 4O9VA 2Y5HA 3E90B 2UWLA 1SQOA 3FZZA 1YF4A 2ODQA 1ELVA 2EI6A 1SOZA 3Q3YA 1QQ4A 1JIMA 5F8ZA 2Z3EA 1G3EA 4DT7B 1NS3A 2ZI2H 2FEQH 1NT1A 1TNIA 1UTOA 1EZQA 2FS8A 1Z71A 3OFND 5C5NA 1GBCA 5KGOA 3LGVA 3HK3B 2A7HA 4J1YA 3K9XB 3SZEA 4TWWA 2UUFB 2NU2E 3RXQA 1NROH 3MWIU 1TRNA 3A7YA 3KNXA 1KSNA 3MMGA 4CRBA 4M9FA 1LHFH 2BVXH 2A5KA 1SGFA 3NUMA 3A86A 1ZSLA 5JB8S 4FOUC 2ZHDA 4BAHB 3STJA 3FP8E 2D26C 2GMTB 4RKOB 1BTHH 1RS0A 3M5LA 1XKBC 4JZFH 1G37A 3CNRA 1O2SA 4CRDA 1GHZA 4KTSA 4NSVA 3ZZ4A 1TGNA 5GNDA 1QRWA 2ZDLA 4P02A 1IQIA 2ZQ1A 2FP7B 3M5NA 4I8JA 3EA9A 1ACBE 4TSFD 2GGVB 2GD4B 3RXKA 4MLFB 1KDQA 2P3TB 1OWJA 1H1BA 2BLVA 1TPSA 2OXSA 1LPZB 1GI4A 1GJ6A 3TJNA 1KY9A 2J5UA 1O5BB 1E1RD 4JK6A 1YC0A 2A4GA 5JPMH 1YPHC 3VXEH 2PGQB 2A7CA 1GJ8B 5TCAA 3BTWE 4LK4A 4DIIH 1F5RA 2Y6TA 1P02A 1RTKA 2CK3D 5DPAA 3A89A 1GBFA 1PPHE 2QY0B 2RCEA 1MD8A 2FLRH 1YPJH 2YOLA 1O3EA 3VB5A 3G01A 1SGTA 1UVTH 2Q6GA 2P3UB 2QF3A 1B0FA 1PQAA 3FFGA 4FUIA 5L30H 5C5OA 2ZQ2A 3H7TA 1UO6A 3A7XA 4K5ZA 4DCDA 3OEHD 1GJ5H 5FPYA 1GI5A 1TNJA 1ZRKA 2GCTC 3QGJA 5E2OA 1QZ8A 2ZGBH 1ARBA 5DP7A 2BY6X 3CP7A 2SGPE 1VKYA 1DS2E 4GCHF 4OS6A 2QF4A 3BSQA 1G36A 1J17T 2DE9A 5GPIB 4NGAH 2Q6DA 4B2CA 1EOLA 1GDNA 3SHAH 5KECA 1FPCH 5AVDA 1IQEA 1BTUA 2PHBA 3BF6H 1SGEE 1ANCA 2A4QA 3SUGA 3NPSA 3A8CA 4XBCA 2BQ6B 3LGYA 4AX9H 2Y7XA 2A31A 2EC9H 1A3EH 3GCNA 4BTUB 1S0QA 1C1QA 3I29A 1BMAA 1W0KD 1XXDA 3ZVGA 1KTTB 5DP8A 4XE4A 2ZHQH 1EUFA 1ETSH 1GBKA 4NIXA 1O35A 1ELGA 4WXIA 1GWAA 5DGJA 4BAQB 3HKIB 1C1SA 3QGNB 1C1NA 2XNDD 2KCAA 3F9GA 4MPXA 4U32A 2J98B 1SFIA 5JB9S 4I32A 4NCYA 3UTUH 2GV7A 3ZZ5A 4WWYA 2PSYA 1YPMH 4BAKB 4Y76A 1E37B 3PV5A 3UWJH 3RP2A 1QBVH 4UD9H 1SHYA 1TYNA 1ZYOA 3NK8A 1DUEA 1FI8A 1A5HA 1O2GH 1OP8A 1DXWA 4AFUA 4TPIZ 1PPZA 1C1RA 2O8TA 4JYVH 2ZCLP 4Q4LA 4ESTE 2Q6FA 4UONA 3SQHE 3RLYH 3SHCH 3SU0A 3DSOA 2J95A 4MVNA 4AYYB 1HB0B 1K1JA 1GJ4H 1E34B 1BTPA 3PLBA 2J38A 2BDAA 3MU8A 3MH6A 3PMHB 1WV7H 2BVRH 5C1YA 4Q7XA 1CHOG 1T8MA 1TX6A 3RXAA 5KEDA 3A8BA 3QTVH 4IGDA 3RMNH 3RMOH 1UCYE 1CHGA 3L6PA 2BDGA 1HAVB 1G2MA 1O3DA 5L6NH 2V7QD 2Z9JA 1O3PB 4IBLH 1F92A 3M35A 2V3MA 5T3HA 1SKYE 1QQUA 3ODDA 4D7GA 4YM9A 3P8FA 4FUBA 1TMBH 1H9LB 4JYUH 4UE7H 3LGTA 1GMCG 1YP9A 1VJAU 5C20A 1KXAA 3URCA 3PM3A 2JETC 2ZZUH 2HLDD 1C5NH 5EODA 4Y11E 5F53A 1BITA 4E06H 4A1TA 4AYVB 4I7YH 2RFKC 4CBNA 3RMLH 2SNWA 2VINA 1XVMA 2NU4E 1W8BH 2JIZD 2A0QB 1SGIB 2XBVA 2ZFRH 4MNVA 1HAPH 5FBEA 4GAWA 1ORFA 1OP0A 5BPEA 1CA8B 3A83A 1ELCA 4B74A 1AUJA 4SGBE 2XYAA 3SU1A 1MH0A 1LTOA 1NU7B 3SUDA 1C5ZB 1T31A 2F9UA 1HBTH 3ODFA 4LXBH 3RM2H 2Z3CA 2PFEA 4X1QU 3RXVA 5LPEA 2BXTH 2ZU3A 3A85A 4CH2B 4B6EA 1AWHB 2QC2A 1ETRH 2THFB 1RJXB 2PKSC 1C5TA 2ZP0H 3GISB 1V2RT 1BRBE 1LHEH 4A92A 1NFWA 1Y3XA 1YPHE 1ZTLA 4B2AA 1UK2A 2GDDA 4F49A 4GHTA 2TGDA 1W2KH 2Q1JA 5C3NA 2J2UA 4X1NU 1TB6H 3SU5A 2ODPA 2AGEX 4INLA 1J16A 1SR5C 1O2ZA 3SN8A 4Q63A 3LGUA 2BQWB 2ZFQH 3JZ1B 3F68H 1YLCA 2OC1A 1BUIA 1MKXH 1CU1A 4DIHH 4M7GA 3RXUA 4K3JA 1P8VC 3FP6E 3MQKC 2BB4A 1SQRA 2GCHG 2OCVB 2ZC9H 1T32A 4SGAE 1GHYH 2QE7D 1O5GH 1LQDB 1FY5A 4B75A 1CVWH 4XRNA 4K69A 2BZ6H 3VGCB 2H9EH 4F48B 3VB3A 4AFQA 3PB1E 1LVOA 2C93B 2PSXA 4ISLA 1V3XA 4NIWA 3TJVA 1C1OA 3EQ0H 4KTCA 5HM9A 3TK9A 1RD3B 2ZFTA 1NRQH 4U2WA 5F8XA 7LPRA 2VVUA 4IC5A 1K1OA 2ZGHA 3OE7D 3QLPH 3W95A 4FVDA 1C2MA 1YLNA 4ABAA 4WJG2 1VCQA 3AVZA 3F2GA 5J4SA 1YGCH 2M5TA 2OINA 4OS5A 1C5QA 3DD2H 2XWBI 4D9RA 1LKBA 3PV4A 3S9AA 2P93A 1T8LA 3V13A 1BJUA 1SLUB 4X1SU 2ZECA 1C5PA 4E7RG 1VITG 4ZROA 1P11E 1JOUB 1GCTC 1S5SA 1FJSA 1RGQA 3TK6A 2SGEE 3A8DA 1PPBH 2XBYA 1V2ST 2L74A 1E36B 1TBQH 1ZRBA 2BDHA 2R2WU 2VWLA 4TY6A 2CF8H 1FMGA 1GI0A 1LDTT 1QJ7B 1LPGB 3RC5A 4D7FA 2ANWA 1NFYA 1T4UH 1P03A 1TLDA 2FIRH 3UFAA 2AMDA 4XFQA 4IN2A 3P95A 1H8HD 3RMMH 1EZXC 4BTTB 3A7VA 1O3IA 2P94A 1UK4A 2BDBA 4ABJA 1VCWA 2VH6A 4KP0A 3ATIA 1C1UH 1QA7A 5BRRE 2BVSH 3SU2A 1GPZA 2XC5A 1W12U 2CN0H 2K8IA 1P01A 1H8IH 2EQNA 1UVSH 1CBWC 5ABWA 3ZZ3A 3LKWA 1FLEE 1NY22 3WY8A 1AB9B 2WPDD 1KXEA 2OQ5A 3SJKA 1BOQA 4X0WU 1P0SH 1WYKA 2V0BA 2LELA 4HZHA 3ZYEA 1S84A 2W3KA 4AFZA 3F9FA 1IQGA 3RU4T 3V12A 1OWKA 2BY9X 3QUMP 4FU7A 4BAOB 1TMTH 4O97A 2PR3A 2FX4A 3ZV8A 1X7AC 1KXBA 5FX6A 4X6OA 6CHAC 1GVLA 1MUEB 1YWUA 3SQEE 2EA3A 2JDID 2YMSB 3U8TH 5A8YA 5DJ7A 1NESE 1O33A 3RXSA 1QBOA 2ANMH 2FTMA 1OPHB 1K1MA 1E0FD 2ZPQA 4FETA 1P2MA 2QXHA 4MNXA 1V2NT 1V2PT 4ZKOU 1LCYA 1ZMJA 1GI6A 3UWIA 2ANYA 9ESTA 1WQVH 3OTJE 4LOYH 5DO4H 3MH5A 1QURH 5DP4A 3SW2B 1JXPA 3N99A 2QYIA 1WOFA 4ZKNU 2BD5A 1C5XB 4BAMB 1WCZA 2JETB 1NRSH 1AZ8A 2W26A 1HIAA 4Y79A 5K7RA 1EJNA 1NBMD 4X8UH 3GCTF 4K1TA 1Y3YA 3ZVCA 2Y5FA 3DFLA 3S7HB 1S83A 4OS2A 4NA7A 1IQHA 4XDEA 4XOJA 1CHOF 2AERH 3Q77A 3A7ZA 1AWFH 1WSSH 1PPGE 1RIWC 2RG3A 1GBAA 1VJ9U 2QXJA 1DDJA 1YKTA 1AD8H 3BTDE 1XVOA 1GBJA 2GT7A 1S6LA 3TJOA 2R0KA 3T26A 2H9HA 5DG6A 2HNTC 3UOUA 2Z9GA 1W0JD 1YPGH 5FXLA 1GMCF 3KQ5A 2VB0A 5DP6A 3A7TA 1AE5A 3ZZCA 4ABGA 1C5OH 2ZWLH 3DHKH 4ABEA 2BM2A 3KHVA 4PROA 1RRKA 2KCOA 3ZIAD 1FY8E 4YXWD 4X2WA 3RXPA 1C5RA 3EGKH 3BEIB 5A0AE 1VITH 4K8BA 5FCRA 2IPHA 2ZDKA 3UREA 1MTUA 3RLWH 5HYOA 1Z8JB 2ZF0H 1EZUC 1YCPM 3DCLA 1AFQC 1ELAA 3RXGA 1O0DH 1TE0A 3FP7E 1DT2A 1OXGA 5F03A 1S0RA 4Y7BA 1GL0E 3UPEA 3GYMA 4ISHH 1CQQA 1ANBA 1Y5BT 4MG3A 5EIYA 3MOCA 4MDSA 2P8OC 3RXTA 2ZIQH 4FU9A 4OGXA 5B6OA 1SLXB 2FI3E 2ODYB 2Z94A 3S9BA 1BTZA 1XKAC 2BOHB 3KYGA 3UQVA 3SBKA 1ZHPA 1GHAG 1OSSA 1ID5H 1DE7H 3SJ8A 1XUHA 1ELFA 3TU7H 2Y5GA 2AS9A 1C5LH 1DPOA 1QB1A 1AN1E 2RDLA 1Q31A 4A6LA 4RT0A 5CHBA 4XD7D 1EPTC 1TX8A 4FUHA 2P59A 1T8NA 3FO8D 2FTLE 5EW1H 4K8YA 1O3HA 1SQTA 1TAWA 3BTME 2XWAA 3EE7A
chains in the Genus database with same CATH topology
1BRAA 1DXPA 1TPOA 3LONA 3P8OA 3PMBB 3BTTE 8KME2 1K1LA 2VIVA 4WMDA 1TALA 1AU8A 1J9CH 1MAXA 3BG4B 3HATH 3MU1A 2XBXA 2VWNA 1O3AA 2AH4X 1JRTA 1UVUH 2F91A 3LDXH 3STIA 1N8OC 2GCHF 2D2DA 1GCDA 3BIVH 2VIOA 1TA6A 2ZDVH 2TIOA 1EXFA 1MQ5A 4ZHAA 1C2HA 4GHQA 2CF9H 1ZHRA 1ZSJA 1G3DA 1GCTB 1KIGH 3BTEE 3SNDA 3AAVA 2ZA5A 3SNEA 1P10A 3UIRA 3R0FA 3ZVEA 5CE1A 2BD2A 4DW2U 4WXVA 1P2JA 4DURA 3BTHE 1GDUA 4AG2A 3O8CA 2BX4A 3M5MA 4J2YB 4X1PU 1QRXA 1T8OA 1KDQB 1FY1A 2FESH 2PWXA 5F8TA 2AMQA 2ZU4A 5I25A 2PUXB 2PKAA 3U1IB 2J9NA 3RXDA 1SLWB 2HALA 3LC3A 1TNHA 5A8ZA 1O3GA 1GI8B 1P3EA 4INKA 1HAIH 1FIWA 3RXCA 3SJIA 1AVXA 2H9TH 1AE8H 3OYPA 1CBWB 1HXFH 1QY6A 4KGAA 2OC8A 2H1UA 3ZZ9A 2AGGX 1HAYB 3M7UA 1VITF 2GTBA 4ZHMU 4AORA 1UHBA 3MNSA 4XBDA 1SVPA 1K1NA 1MTWA 2VIQA 1GHBF 1O2LA 2BLWA 3SNAA 3PMJA 4BANB 3SV7A 4MPUA 5AFZH 1DITH 3GCHC 6CHAB 1Z6JH 1NU9A 5EPNA 3U9AH 3GICB 2FX6A 2VVCA 2AIQA 4AG1A 1F0TA 5E0HA 2Z3DA 5EXNA 1IAUA 3C1KA 1GI1A 5H4IB 2JKHA 1GI9B 2V6NA 5DK1A 2VH0A 1Y3UA 3SV2H 3MFJA 1TRYA 1QL7A 1XUJA 1MTVA 1GG6C 1BT7A 1FPHH 1FDPA 1RTLA 5A0CA 1QNJA 2VU8E 1FONA 1SGPE 1GJCB 1NFUA 2PTNA 3QTOH 1WQSA 2VVVA 1GMDG 1GBHA 3D62A 1BHXB 2NU3E 4ZAEA 4FUEA 2I6SA 1QGFA 1UTMA 1PPEE 1N6XA 1HJ9A 2BZAA 2GKVE 2WV5A 4Y8ZA 2A45B 2FMJA 3V7TA 4B76A 4ZUHA 4U01A 1O3CA 3R3GB 4FXGH 5LPFA 3SU4A 1C1MA 1RIWB 1TIOA 5EPYA 3SJ9A 3SV8A 1DFPA 3MU4A 1ZTJA 2XC0A 2ZU5A 4FUCA 4H42U 3N7OA 3TJUA 3RXMA 2QCYA 2C8ZB 1ETTH 1LVYA 3GY4A 1GI3A 2D1JA 3RXIA 1JMOH 2BDIA 4E05H 1ZMLA 3RM0H 1S85A 3TGJE 3DT0H 3M3TA 1O30A 2G51A 2GX4A 4OS4A 1HUTH 1O2PA 2J94A 2QGRA 3GYLB 3A80A 3F1SB 4NFEA 2O8UA 1BTYA 1E35B 3D49H 4ABHA 1DUAA 2SGAA 5ESBA 2SGQE 3LH3A 4JYTA 3PO1C 3MU5A 4ABDA 4AGKA 2C8WB 1C2EA 5T6FA 1RXPA 4NA9H 8GCHG 1GBMA 3E0PB 1DWDH 1UJ1A 5DP3A 7KMEH 1SGFG 3SUEA 2SGFE 5FPSA 1HRTH 3B9FH 2A5IA 2DUCA 1W13U 1O2YA 2OD3B 1M9UA 2F9PA 1OP2A 2A4OA 4RKJB 1V2JT 2ILNA 3BG8A 2WPJS 3RC6A 1BBRE 1CSOE 4Y8YA 1O31A 3MNXA 1H9HE 3BTFE 2OQUA 2PLXA 3GCTG 1C1WH 3M7TA 3E6PH 2BD3A 2F9BH 3K6ZA 2ZDMA 3ZZBA 1BTWA 3SI4H 1EZSC 3PROA 3RU4D 3I77A 3QZQA 3E1XB 1D3TB 2HOBA 1FXYA 1EAXA 2WPIS 2BD8A 2TGTA 1OWHA 4DGJA 1IHTH 3KQEA 1TBZH 4NFFA 4NSYA 3W94A 3EDXB 4MTBA 1CGHA 1L4ZA 1UMAH 1CT0E 4E7NA 4BNRA 2ZDAH 1YPLH 3U69H 1CGJE 4X8VH 4WY3A 1HXEH 1JWTA 2WPLS 3ESTA 1ZTKA 2BYAX 1F5LA 1GHAF 5GJ4B 1G3CA 4WH6A 1MKXK 3QO6A 1BDAA 1YYY1 5JBBS 1EPTA 1S6HA 3TNSA 2VGCC 3AW0A 1TFXA 2ZFPH 1YCPH 1N1LA 2A5AA 3UR9A 2AMPA 1MZAA 1CT4E 5LGOA 1HCGA 2BTCE 3SI3H 1SGNE 4AB8A 3A82A 4NZQA 5A0BA 2Y80A 3P17H 3TH2H 1VZQH 1Q2WA 1ZOMA 3DA9B 1HAHH 1ZJKA 4FUDA 3TLOA 1O2JA 1KTSB 1O3LA 1QR3E 3A8AA 1C1VH 1WAYB 3Q3KA 2CXVA 4JZEH 3DFJA 4NG9H 1WTGH 5FPTA 1LHCH 1ABIH 1OOKB 3UY9A 1GVKB 4A1XA 5K0HA 2UUYA 1FN6A 2R3YA 1FAXA 1F0RA 3MI4A 5JBTA 3IITA 1LKAA 1HJAC 1TONA 1GGDC 4JZ1A 1EJAA 1O2XA 1O5EH 4K2YA 1XUIA 5E0JA 1IHSH 1WUNH 2QIQA 4I33A 4Y7AA 2BD9A 2OP9A 3FAOA 1MZDA 2YNAA 4X8TH 3ZYDA 4BOHA 1QJ1B 1P06A 4TY7A 3M37A 1V6DA 1O2HA 3MO6A 4R0IA 1P2OA 3KGPA 1ELEE 2Y7ZA 3GCHB 3LPRA 4A1VA 2G4TA 1XUFA 4JCNA 4IW4E 1Y5AT 3VB7A 5FAHA 1TQ7B 2FXRA 1WU1A 2OC0A 4LZ4B 2H5CA 4VGCC 1OYTH 1V2KT 2FYRA 1A46H 2FI4E 5HGGA 1QBNA 3NWUA 4Q7YA 4IS5A 1GJ7B 1C2JA 1TX7A 2O8WA 4CRCA 3Q00A 2WPHS 1UTKA 1DX5M 1GDQA 1OWIA 2AYWA 1IQMA 2ZKSA 3M7QA 4Y8XA 2YNBA 5T6DA 1DLKB 5L2ZH 2EI8A 3AW1A 3GOVB 3OSYA 4YESB 1IQJA 1EX3A 5JDUB 1TPPA 1AY6H 1QL8A 1GI2A 4B1TA 2GCTB 2Z9IA 3GDUA 2ZDNA 2R2MB 1QHRB 4IMQA 3LT3A 5FX5A 1MTNC 1ZGVA 1UTPA 3QZRA 2Y81A 4UFEH 1O39A 4R8TB 1CGIE 1ESBA 4THNH 1PQ7A 1Z1IA 3MHWU 5AF9H 1TPAE 4CR5A 2WPKS 2WINI 4KKDA 1MKWH 4OS7A 1O2QA 1G9IE 5EG4A 4BTIB 1O2RA 3IWMA 2ALPA 2A4RA 1QCPA 3OY6U 1K1PA 1A7SA 3LGWA 3VB4A 1HDTH 1DVAH 1GHBG 2G55A 1A3BH 1C2FA 3LU9B 1L1NA 3RXFA 1GMDF 1C5SA 2WPMS 3BN9A 3T29A 3T5FH 4B2BA 1J8AA 7GCHG 5PTPA 1C9TA 1O3OA 3UUZA 3T62A 1NTPA 1SI5H 2ZTZA 3I78A 1BZXE 4I8KA 2A1DB 1C2IA 2UWOA 1YBWA 2H6MA 1O2TA 1TNGA 3SGAE 2HVXA 4UDWH 5DP9A 1HAGE 2VWOA 2UUJB 2VWMA 3BTQE 2CGAA 1ANEA 5LH8A 4X1RU 2O8MA 1DY9A 1HLTH 4WF8A 1XX9A 1T4VH 1EOJA 1V2QT 3TPIZ 5A2MH 2FPZA 1DSUA 5CHAC 3K65B 1O36A 3BTGE 1NN6A 5DP5A 1YM0A 1BRCE 2VIPA 4HFPB 2BD4A 1CT2E 1QFKH 2OBOA 2XNIA 1PJPA 1L2EA 4Z6AH 2FS9A 4FUFA 1HIAB 3E0NB 1C1PA 1DWBH 1D9IA 4ISIH 1Q3XA 2HPPH 4K1SA 3SNCA 1P09A 1TABE 4B71A 1HFDA 1EKBB 4XSKU 8GCHF 3QWCH 3TGKE 2ZPRA 1GMHF 2XRCA 4GVUA 1THSH 3GCOA 4INHA 3CS7A 3O8BA 4UFGH 3MO3A 2BD7A 1F2SE 2RA3A 4KELA 2QAAA 2HWLB 2LNCA 1FV9A 1S6FA 5EQRA 3SGBE 1PPCE 2A2QH 4AN7A 1A4WH 1V2TT 1GJDB 1LHDH 4Q2KA 1GBDA 3Q76A 3UOPA 1DWEH 2FOGA 3T2NA 1P2KA 2F9NA 3SJOA 1D3PB 2EEKA 2TGPZ 3A7WA 1VGCC 4RN6A 1FN8A 1ZPZA 3RXJA 1H4WA 1AQ7A 4IN1A 3OU0A 2FOHA 3PWCA 3L3TA 4YLQH 1P57B 1O5FH 1A0JA 1LQEA 2BXUH 2AIPA 1OS8A 2FYQA 1O2UA 2ANKH 4H4FA 2BLQA 3NCLA 5C2ZA 2WYGA 4CRGA 3VB6A 1ZPCA 2AEIH 4MNYA 1EP5A 1HNEE 3TITA 5EU8A 1TA2A 2QN5T 2ZHWH 4ASHA 2PKSB 2C90B 5CMXH 1ESAA 2R3UA 4H6TA 5FBIA 2G52A 4I8GA 1AGJA 2FDAA 4B73A 1SGYE 2OBQA 4FVBA 2G5NA 1O38A 2XCFA 1OYQA 2C4FH 3ZVBA 1BBRH 1DY8A 4ABIA 4ZHLU 2VNTA 1D6RA 1D3QB 1NPMA 1BA8B 1CO7E 1KXDA 4VGCB 3FANA 2DE8A 1W3CA 2BQ7B 5G4BA 2R0LA 4ZKRU 2GT8A 1LPKB 2B5TB 1DICA 2OTVA 3S0NA 1UCYH 1BHXF 1P2IA 1NRRH 1FAKH 1B5GH 2K1QA 3KCGH 4YO9A 4CBOA 4I8LA 2PTCE 2ZTYA 2KAIA 2GZ8A 1SLVB 3BIUH 3SV6A 4A5TS 1ZLRA 3V0XA 3AAUA 2BX3A 4AB9A 3RXEA 1QL9A 2B8OH 1FNIA 3S9CA 1A0HB 1NM6A 3TIUA 3S7KB 4TPYA 3NKKA 1ELTA 3SU3A 1VCPA 3RXBA 2HPQH 3U1JB 1QB6A 2PKAB 2XTTB 2LPRA 1IQFA 1NO9H 3SZNA 1D4PB 1MAYA 3LC5A 3K2UA 1OKXA 4D8NA 1C5WB 1A5GH 3A84A 4HTCH 1AVWA 4MQAA 4DY7B 1ARCA 1UTNA 1UHBB 1W0YH 2HRVA 1K1IA 5JBCS 2BY8X 3PLKA 1O5CB 6GCHG 2ZU2A 2ZFFH 4RSPA 3QK1A 1AKSA 4TYDA 4FU8A 3KQCA 2TRMA 4Q80A 2WUCA 5HXFA 3FZDA 2ZGJA 1TGCA 1THPB 3S69A 1C2GA 4YOJA 1BB0B 2GZ9A 2AFQB 1Z1JA 1SGQE 1F0SA 2CV3A 1O37A 1GBIA 1QTFA 1EB1H 1QJ6B 3SORA 5C1XA 3SV9A 1QB9A 1XUGA 2BHGA 2Y82A 3M61U 3PMAB 5C67A 6LPRA 2FO9A 1MBMA 1DSTA 5CHAB 4KTUA 1UVPA 2G00A 1G30B 1BTXA 1MU6B 1PYTD 1OWDA 1IQLA 4ZXYH 3OY5U 2ZU1A 7GCHF 3GY6A 1E38B 1Y8TA 2ULLA 4IC6A 1Z6EA 3M3SA 1ELBA 1P04A 2B9LA 1F5KU 5GIBA 1EP6A 3M3VA 1EATA 1ZMNA 2XBWA 2IN2A 2QF0A 1HYLA 4X2XA 4Z0KA 3SUFA 1GHVH 4MPWA 4GLYA 2GZ7A 2BLOA 1SGCA 1HPGA 3ATLA 1CE5A 1B7XB 1IQNA 4I31A 2VJ1A 2BDYA 3VXFH 4JZIA 2ZGXH 4X6PA 5GDSH 4FUGA 2HNTE 3KQBA 1HJ8A 3UNRA 4O3TA 1MQ6A 3VGCC 1SSXA 1LVBA 2A32A 4D9QA 1THRH 1HV7A 3MTYA 1XUKA 1ESTA 1VGCB 1MCVA 1LMWB 3KL6A 1BIOA 4YZUA 1GJAB 1NFXA 1ELDE 3VPKA 5C1UA 1KXCA 2BY5X 2XXLA 3E16B 3U98H 3LOXA 3H7OA 3F6UH 1W11U 3TGIE 5AHGH 2WV4A 4Y6DA 1V2UT 5FCKA 4OS1A 2A7JA 1HAOH 1IQKA 1K22H 2SFAA 1TOMH 3E3TA 5GCHF 1GBLA 5EOKA 3PTNA 1XXFA 5A8XA 4JMYA 2J34A 2FOBA 3EA7A 1ZZZA 1AFQB 1SHHB 1O3JA 1K2I1 1P9SA 3ITIA 1YPEH 1K9OE 1GMHG 3L33A 1T7CA 1YCPK 3GY2A 2QA9E 1V2LT 1S81A 2P8OB 4CH8B 1TNKA 1ZGIA 3P8GA 1K21H 5E8EH 2FODA 1P2QA 3SNBA 1A1RA 3KEEA 3A81A 1F0UA 4ZH8A 5FHTA 2FWWA 1LO6A 1ANDA 4ABBA 2ESTE 1IOEA 3T25A 2AGIX 2UWPA 3GY3A 1G3BA 1AB9C 3D23A 2UUKB 1FY3A 1DLEA 3ZVFA 1GBBA 1DWCH 2ZGCA 1AUTC 1V2OT 1ZPBA 5EQSA 1BMLA 2F9OA 1EPTB 1C5VA 4X2VA 2P95A 3T28A 4YOGA 3HGPA 1DOJA 3QX5H 4YLUA 1MMJN 3GDVA 4WMFA 5ETXA 3TH4H 3BTKE 1Z8GA 4O03A 3EYDA 6ESTA 1BQYA 4AFSA 1KLIH 2FOAA 1K28D 3HKJB 1CA0C 2BMGB 1GI7B 2PV9B 1TGSZ 2BOKA 1LHGH 2G81E 4X8SH 1W10U 4X6MA 3P8NA 1C1TA 1N8OB 4WMEA 3EE0B 3PWBA 3P6ZB 3RXOA 4DG4A 3ATWA 1A2CH 3M5OA 3RXRA 4CRAA 1KYNA 3PYHA 3E91A 1O32A 1UK3A 5EQQA 2GVFA 2I6QA 1J14A 3ZZ6A 5EXLA 3URDA 3HK6B 1P9UA 1EQ9A 2IOTA 4NIYA 4DOQA 4AGJA 1A0LA 1P2NA 2CHAC 1Z7KA 3ZV9A 2STBE 4Y10E 2OLGA 5EXMA 1UTQA 1SMFE 3SOSA 2FM2A 1KXFA 4CHAC 1SQAA 4YT6H 4CR9A 5HMAA 1HAVA 1GBTA 2ZTXA 1BMMH 4K60A 2G8TA 3KQDA 3MH4A 4DVAU 4CRFA 2FZZA 1YPKH 4Y0ZE 3RUOA 1PQ8A 4D76A 2B0FA 2OUAA 1C4U2 2H5DA 1Y5UT 4CREA 1SGRE 1MKWK 1G32B 1BCUH 2W7SA 2XCNA 1XM1A 2FOCA 6GCHF 2ASUB 1SB1H 3TK5A 1P3CA 5SGAE 3GDSA 1PQ5A 1FY4A 4U30A 2GDEH 1O3BA 3B8JA 1PPFE 3O8DA 3RXHA 5T6GA 2Z6BD 1TGTA 2ZHEH 1O2IA 3BEUA 1C5MD 1GL1A 2F3CE 1GHXH 1TMUH 4Q7ZA 1GVZA 2W5EA 1Z8IB