3TJVA

Crystal structure of human granzyme h with a peptidyl substrate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
225
structure length
225
Chain Sequence
b'IIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNNIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme H
publication title Structural insights into the substrate specificity of human granzyme H: the functional roles of a novel RKR motif
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 225
sequence length 225
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjvA02
3EAJA 2H5CA 5AHGH 2IOTA 4IN2A 1BRUP 2FIRH 4KGAA 2ZGCA 3PLKA 2VH0A 3MYWA 3LJOA 2GV7A 4DT7B 1OWIA 2TBSA 1TGBA 2ZC9H 5TJXA 1TPPA 1SPJA 3LGVA 3SOSA 3RXEA 4WY3A 2TGPZ 1AB9B 2ZDNA 2XWBI 4FXGH 3PM3A 1G3BA 1TNLA 4AFSA 4MNYA 1FY4A 1LQEA 2VGCB 4RKJB 1O3GA 1UTKA 3RXKA 1IQHA 2ZF0H 1SGIB 1DSTA 1LVYA 1ELFA 1O3CA 1Z6EA 4AX9H 3TGKE 1L1NA 5DK1A 1CBWC 1O2JA 1CHOG 1V2PT 1GJ9B 5IYTA 2BVRH 1TGTA 1HAIH 3BTEE 1C2LA 1T8NA 2ZFRH 3NPSA 3HKIB 2Z9JA 1O0DH 1GJ5H 2WYJA 1G3CA 5DPAA 3A7WA 1GJ7B 1O5AB 4VGCC 3T26A 1GMHG 4F4OC 1WUNH 1MBQA 2C3SA 2ANKH 2ZCLP 4H42U 3RXTA 1V2TT 4X1NU 1GI8B 1SQOA 1JWTA 3LPRA 1TNHA 1N1LA 4E7RG 1O2XA 1Z8JB 3ESTA 4OS5A 5C67A 2A4RA 3R3GB 4ABHA 5E0JA 4I8KA 1WOFA 3M36A 2XBWA 3BTWE 5DP6A 1FQ3A 1QL8A 1CE5A 5FXLA 1S82A 5ETXA 1MTNC 2D2DA 1ANCA 3OY5U 1EP6A 1NZQH 4LZ4B 1XX9A 2IPHA 4AYYB 1HAVA 1GG6B 2PGQB 1HAPH 5A2MH 1XMNB 2BY6X 1VGCB 1ZTKA 1YCPH 2PR3A 2O8MA 3K9XB 2AMPA 3GCHC 4GHTA 2V3OH 2ZU3A 1FY3A 1C1WH 3HATH 3V7TA 1TRMA 2R2MB 1K1PA 1TALA 3S7HB 2LNCA 2A0QB 4HFPB 2TGDA 1J15A 1GJBB 4FUIA 1KY9A 1HJAB 2ULLA 2HPQH 1SGCA 1QHRB 1DITH 3ZZ8A 3PO1B 2FZZA 4I8HA 5EQQA 3A8BA 3F9GA 1P09A 2H9TH 5I25A 1GHZA 2RG3A 1ANDA 3SORA 3QN7A 1O5BB 1RTLA 1SGNE 3PWCA 4X2VA 1A5IA 4NGAH 1QGFA 2ZP0H 1W12U 4Y7AA 4FUBA 1GBTA 2TRMA 4B73A 1PPGE 3FZDA 1K1NA 1UTLM 4JYTA 4AFUA 3NZIA 5F8ZA 3ZVDA 1BBRH 1C5RA 1DX5M 1GMCF 1ZMJA 3RU4E 1JRTA 1TBZH 1O32A 2BOKA 3SGQE 1AHTH 1KXDA 3K6YA 1THRH 2QN5T 2I6SA 1OWKA 1MTVA 2CXVA 2Y6TA 1EPTA 3SU5A 1GHXH 2XW9A 2WPMS 3LOXA 1CA0B 1H1BA 3SI4H 1P2IA 1C5VA 1YBWA 3VB5A 3VB7A 3L6PA 2FYRA 3SQHE 3I29A 1A61H 3GISB 1JBUH 1V2JT 1AE8H 1K1LA 4OGYA 4RKOB 1PPFE 1BRCE 2H2ZA 2C8ZB 5F03A 1H4WA 1SG8B 5H4IB 1EZSC 3GCNA 1B0EA 1JIRA 1O3FA 1S85A 2HNTC 1ETRH 3Q77A 3U9AH 2VVVA 2P93A 5GCHF 3B8JA 4I32A 1GBBA 2BM2A 3GYMA 1GHYH 1N6XA 4ASHA 5C3NA 1HAHH 1ZOMA 4RSPA 3RMLH 3GICB 2ESTE 3LDXH 1A5GH 3MNCA 6CHAB 2BX4A 1O2UA 1IQIA 1ZRBA 1IQGA 5EQSA 1FY8E 4CH8B 4YOJA 1W14U 5FAHA 1SBWA 1UCYK 4UFGH 1GI1A 1QRWA 1EZUC 2BDAA 2AFQB 5A0CA 5E8EH 1YPHE 3MO6A 1C2GA 1QJ1B 3A8DA 1UJ1A 3AVZA 4K2YA 3A7VA 2WUBA 1RTFB 3U1IB 4AYVB 3MO9A 1GVZA 4Y8ZA 1TGSZ 1RXPA 4ISHH 1Z71A 1C9TA 2XTTB 4NFFA 2CF8H 2GZ8A 2PWXA 2FESH 1YF4A 2PGBB 3RLWH 3ZZ7A 3E1XB 1L2EA 1IAUA 1Y3XA 2F9VA 4ZROA 1VCWA 1Y5AT 3M7UA 6GCHG 3T2NA 1LHCH 1PPCE 1K1JA 1BMAA 1RJXB 3TJNA 2Z7FE 1AFQB 1DSUA 2FMJA 1X7AC 1K28D 2XWAA 1TNGA 4X1SU 3NWUA 1AQ7A 1P03A 5DO4H 1QQUA 1O5GH 4AZ2B 2ANWA 3AAUA 4X2XA 4HGCA 3RUOA 3W94A 1S81A 4D9RA 1FY5A 1Q31A 2BOHB 1HGTH 2P8OB 3BTKE 3MMGA 3UREA 3MWIU 2W3IA 3SJOA 3FZZA 3RXHA 4KTSA 2V3HH 1V2QT 1J14A 2WINI 5A0BA 1TA6A 3KEEA 2BY8X 4JZIA 2VVUA 3TGJE 1AWHB 3SU2A 4SGBE 1MAYA 2ZG0H 3BTGE 1HAGE 2W5EA 4Y79A 4TYDA 4LZ1H 1TMBH 4O97A 1OP0A 3EQ0H 6CHAC 1DLKB 5AVDA 3U69H 1O3KA 3U1JB 1C5LH 2ZO3H 5K7RA 3WY8A 4HI3A 4JK6A 1GHVH 3EA9A 2CN0H 5ABWA 2PKSB 1O2PA 1AUJA 2GMTB 3MU8A 1TLDA 1XXDA 3S9BA 3DUXH 1DUAA 4FUFA 3RM2H 3VB3A 4DVAU 2C8XB 1DICA 3KQEA 1SVPA 3OX7U 4UFDH 3P8NA 3RU4D 3S9CA 1CHOF 4ABGA 5FBIA 5EXNA 1WV7H 1S84A 1TABE 4Y76A 5PTPA 2FS8A 1QBOA 4B74A 2H5DA 3HK6B 1EQ9A 1O5CB 3PMBB 2O8UA 2TIOA 3HKJB 1SOTA 2JH0D 1GMHF 1NRNH 1QY6A 1WSSH 4CRGA 1HAVB 1K22H 4ABBA 5JBCS 3QLPH 3MH4A 4MNXA 2FLBH 1LKAA 1N6YA 3SO3A 2G5VA 1ZSLA 1J9CH 5AFYH 4HZHA 1XUJA 1HB0B 1SL3A 2G00A 1QTFA 4ZMAH 2WUCA 3Q76A 1O39A 1TRYA 3D49H 4AOQA 4AFZA 2XBXA 1GGDC 5T6DA 1GJCB 1ZR0A 3K65B 2FP7B 2BD7A 1BZXE 2SGAA 3F68H 2GDEH 2P3TB 4BAHB 4Q7XA 3QO6A 4Y0YE 1OPHB 4ZKNU 1CO7E 1IHSH 1YM0A 1TAWA 1EJAA 1L1JA 2P94A 1SGTA 2VWLA 4INHA 3BV9B 4TWWA 4E05H 3RLYH 3F9HA 2Q6GA 2GTBA 1PYTD 2TGTA 3TIUA 1D9IA 1YPHC 3ZZBA 1Z1JA 3T62A 1IQLA 3T29A 4AG2A 4B76A 2SGFE 1KXEA 1ACBE 2BDGA 2ZU2A 4ZHLU 1QQ4A 2ZHDA 1E0FD 1V2RT 1UTMA 1H9LB 3BG8A 1TNIA 3C27B 4A1TA 1O3MA 2XBYA 3MU4A 2QAAA 1V2LT 3QTOH 3SJ9A 4NCYA 1WBGB 1DM4B 3KQDA 3TJOA 4YM9A 3TJVA 1C1PA 1EPTB 1MKXH 1ZJKA 1GHWH 4I33A 1UK4A 3CS0A 2Z9IA 2VIDA 4KP0A 3ZYEA 1FAKH 2A2QH 1Q2WA 2BDBA 3URDA 8ESTE 5LPEA 3LU9B 4A1VA 3BF6H 1KSNA 2EI8A 1LTOA 3SI3H 2FOHA 1BTPA 4PROA 3DFJA 2XXLA 1W8BH 1K1IA 2FWWA 1C4V2 4ABDA 2NU1E 3HK3B 1ZTLA 4ISIH 3E90B 1NTPA 1GHAG 1NFUA 3MH5A 3STJA 2A4OA 1XUIA 1V2MT 2QGRA 5GCHG 1W3CA 2A5IA 1ELAA 2GZ7A 2ZPSA 3PMAB 5ESBA 2J38A 2P59A 1HBTH 5EPNA 4J2YB 3BN9A 4Y10E 1P05A 5T6FA 2R3YA 3SV7A 3ZZAA 1AFEH 2WPJS 2PHBA 4E7NA 2F9OA 1BTZA 4IC6A 5HM9A 1O2QA 2ZFSA 1HIAA 3A89A 1FN6A 1CGJE 2R2WU 4K1TA 5FX6A 4XDEA 1W13U 1T8OA 1A7SA 2XCNA 2BDCA 2VWMA 2B8OH 3P8OA 4IMZA 2BD2A 2WPHS 2ZKSA 1VZQH 1DWCH 3MH7A 4UONA 1MD8A 2F3CE 5JB8S 2ZA5A 2VIQA 4ZKRU 3RP2A 4FUDA 3VB4A 1VJAU 4DJZB 1AIXH 3FANA 2Y80A 2FPZA 5C1XA 1YLDA 1O33A 3UQOA 1XUFA 4IN1A 4DY7B 1A1RA 3RMMH 2F9PA 4WMDA 2PSXA 5C1YA 1BIOA 1HNEE 4B2BA 1ZSKA 3LGWA 2JETB 1HYLA 1SLUB 1C2FA 4K3JA 1QBNA 2WYGA 2Q6FA 1DY9A 1EAUA 1KLJH 1HPGA 4GSOA 3PB1E 2QV1A 3M35A 1BBRE 4MLFB 3SU3A 1C2JA 1QR3E 1FXYA 1GBHA 3K2UA 3UWIA 2PTCE 1EX3A 4FUHA 1RFNA 2BVSH 2Z9KA 1AVXA 2UWPA 1F5KU 3QX5H 1EPTC 2BXTH 1EAWA 2VIOA 4JMYA 2GP9B 1NN6A 1MZDA 1NU9A 1C2KA 3BTFE 1C5QA 1OWDA 3LC3A 2Q1JA 3RM0H 2DE8A 1ID5H 2F9UA 6GCHF 3A88A 4FUGA 4ESTE 3SQEE 1HFDA 1GI9B 2EC9H 3LJJA 4ABJA 1MH0A 1FN8A 1TBRH 2Y81A 3ATIA 1S83A 3EE0B 3TITA 2OBOA 3SJIA 4BAOB 2IN2A 4ISLA 1C1QA 3E16B 4LOYH 1OP8A 5FCKA 4X1QU 3KHVA 3JZ2B 1PPZA 4D76A 4K60A 1HAOH 2XRCA 1P3EA 4ZH8A 2HNTF 1PQ7A 2DE9A 1P06A 2LPRA 1QIXB 2PSYA 1C5OH 2A2XH 3BG4B 1C5UA 1OWEA 2D1JA 1TQ7B 2ZHFH 1ETTH 1E37B 1NRRH 2ZECA 3STIA 5F8TA 4XBDA 2F9NA 3UNQA 1BUIA 1IQJA 1NFYA 1BJUA 1V6DA 1UVTH 1NY22 3S7KB 1MTWA 1WQSA 4KKDA 1ETSH 2XCFA 3PMHB 1O2YA 3FFGA 3TGIE 3L3TA 1FNIA 1P2KA 1OWHA 2BYAX 4UDWH 1VR1H 3GY6A 3A86A 1Q3XA 4DIIH 3TH2H 4INKA 1LPGB 3BSQA 1P2JA 2BY5X 1GBKA 3AASA 3MOCA 3LONA 2YNAA 1GL0E 2ZCKP 4A92A 3VFEA 4B2AA 4NIYA 4DURA 4Y6DA 5EW2H 2WPLS 2VIPA 3PMJA 3PLBA 3MNXA 1O2SA 3QTVH 1O5FH 2ZZUH 3RC5A 4I8LA 1FY1A 3RXVA 5A8ZA 1W10U 2ZGJA 2VVCA 1ANBA 1QA7A 2HWLB 1G37A 5E2OA 4X1PU 3GY5A 1GI7B 1DXWA 4MPUA 3OSYA 2W26A 2A5AA 1UK2A 3RXMA 5F6MA 1QRZA 1BOQA 1ZHMA 1A3EH 1D6WA 1P10A 2RDLA 3ZVFA 1Y8TA 1BMNH 1OP2A 5L30H 1GI0A 3SJKA 2ZWLH 2BD4A 3A85A 4BAMB 2H9EH 4BOHA 1GCTB 1RTKA 3QWCH 5EW1H 1GJ8B 5CHAB 3PWBA 5LH8A 3LT3A 1VCQA 1AB9C 1QL7A 2OCVB 2OD3B 1GL1A 3ZZ5A 2V0BA 2Z3CA 2VGCC 1NFXA 3DFLA 4R0IA 2FOCA 4YT6H 4JK5A 1LQDB 2YOLA 1SGEE 3A87A 5LPFA 1Y59T 1MQ6A 2NU2E 3F6UH 1KIGH 2CV3A 2XBVA 3A82A 4D8NA 1YCPM 3SUEA 2SFAA 2FS9A 2UWOA 2QXHA 3P8GA 1BCUH 1GJ6A 1DDJA 2J4IA 2G55A 3IG6B 4X6PA 1EJNA 5C5NA 1Y3YA 2BDHA 3KN2A 1GMDF 2D8WA 1O3JA 1P02A 1RIWB 2ZDKA 3V13A 4M7GA 5GDSH 3KCGH 2OINA 5FCRA 2ZFPH 3OTJE 7GCHG 1LCYA 1JRSA 4ZHAA 1K1MA 2STBE 2R9PA 1YKTA 5HYOA 1D6RA 3SGAE 4CBOA 1HIAB 1E38B 2OQUA 3VXFH 1TPOA 1Y3WA 2GX4A 4ABAA 2OQ5A 1GHAF 1GG6C 2C8WB 1SLVB 1T32A 1YGCH 3P8FA 4Q2KA 2BD3A 4A1XA 3SV9A 2GCTB 1VGCC 1MU6B 1NM6A 2ILNA 1VCPA 1ESBA 5C1UA 2AMQA 5JB9S 3A84A 1N8OB 2PKAB 1P01A 4WH6A 4UE7H 1C5PA 1HJAC 2WPKS 1PPBH 4X2YA 3RXOA 3UNSA 4FU8A 2QXGA 3JZ1B 3M7QA 3LH1A 3KL6A 3PO1C 2THFB 4ZUHA 1QNJA 1GBEA 3UR6A 1F0RA 3OYPA 4MTBA 4I8GA 1UCYH 2G5NA 2G52A 1IQKA 1FAXA 2PUXB 3E91A 2PTNA 3NCLA 1PQ5A 2ZPRA 3UUZA 4YTAA 3ZZ6A 1MKWK 1SLWB 2J94A 2GVFA 3E8LA 2Z3DA 3M61U 3PV4A 5HMAA 2NU3E 1KLTA 8GCHF 1CGHA 1Z6JH 2ZCHP 1E34B 1ZPCA 3GCTF 4H6TA 1DWDH 3I78A 1C1RA 3DT0H 1K9OE 2ZU4A 4Q80A 5DKMA 3ZZCA 3A83A 1C2IA 1S5SA 1XKBC 1HLTH 1G32B 1ELCA 1K1OA 1GBIA 3V3MA 2BD9A 1LKBA 2Z9LA 2BXUH 2H1UA 1AI8H 1CA0C 1LDTT 1K21H 1UTJA 3BTME 4ABFA 1MTUA 4CRFA 3URCA 1GDQA 2OC8A 2CHAB 1T4VH 3E6PH 1NRSH 3IITA 1F0UA 1PJPA 4X6NA 1ESTA 5C2ZA 3P17H 4K69A 5EXLA 1J8AA 2NU4E 1C5NH 1WCZA 5EU8A 4TY6A 2OP9A 4TPYA 3V12A 3KF2A 3MI4A 2OXSA 1UVPA 3BTTE 4AN7A 1FZZA 2UWLA 4BANB 5JBBS 1TIOA 1HV7A 1O5EH 1OS8A 1SFQB 4ISNA 1O3IA 2SNVA 5FX5A 4BXWA 3SU4A 3U8OH 3C1KA 3GDSA 4JZEH 4XSKU 3M5NA 2AERH 4K8YA 3UPEA 3MNSA 5EXMA 1LPZB 1BQYA 1TQ0B 2BQWB 1Z8GA 1TOMH 1C5WB 3EDXB 1OYQA 2FTMA 1XKAC 2FOMB 5DP4A 1EZQA 2SGEE 5FBEA 1BA8B 4NIXA 1GPZA 4HTCH 1DXPA 5JYIA 1O35A 1AO5A 3SV2H 3CP7A 3ENSB 1WTHD 4JYUH 4NZLA 1LVBA 4YLUA 1CU1A 1EZXC 1ORFA 5A8YA 1EB1H 3P6ZB 1C5TA 1HAZB 1ELBA 5FPYA 1AU8A 2EI7A 2KAIA 2WV5A 1UVOA 3T25A 4DGJA 1LHFH 1W0ZU 2QXJA 1O2VA 1ZMLA 2Z3EA 4U30A 4X1RU 1BTYA 1SQTA 1ZPBA 3L33A 1XUGA 1C5MD 2FYQA 2ZDLA 1AFQC 3B9FH 3RXUA 2ODYB 1EKBB 1QB6A 3QZQA 1QA0A 1TX8A 3F1SB 5L2YH 1D3PB 1A0JA 1JIMA 1BHXF 4K8BA 2Y5HA 1KTTB 1QCPA 2P8OC 3UR9A 1VJ9U 1LVMA 2SGPE 4LK4A 3SNAA 4MNVA 1ZYOA 4ABEA 5ESTE 1AKSA 3CS7A 1DY8A 4OS4A 1BMLA 3RXIA 1G2LA 4O3TA 3TH4H 3MHWU 1PYTC 4ABIA 1BTHH 4YO9A 5HM2A 1PQ8A 2H6MA 2AS9A 4JZFH 4Y11E 2ZHQH 1MMJN 1P11E 3NXPA 4ZHMU 1EXFA 3M5LA 1G9IE 2SNWA 5DG6A 4Q7YA 5CE1A 5C5OA 4UFFH 4ZAEA 1GBJA 1C2HA 2OC1A 4MPXA 3ZZ4A 5TCCA 2ZTYA 1HAXB 1TBQH 4A6LA 2QF3A 1GMDG 2OC7A 1D4PB 2PKSC 1T4UH 4IC5A 4BTUB 3M5MA 1T7CA 4U01A 2GMTC 1P3CA 1GJAB 3ATKA 1KDQB 2CJIA 1FPHH 1GI6A 1PQAA 1SR5C 5JBAS 1F0TA 3DA9B 5DGJA 3GY2A 2FM2A 4MPVA 1MKXK 1ZLRA 3RDZA 1MCVA 2PUQH 1P04A 2OUAA 1QRXA 1O34A 3ZZ9A 1GHBF 1MD7A 2C93B 2VH6A 4K1SA 2FOGA 3BTQE 5DP8A 5SGAE 2V35A 3OU0A 4YESB 2RA0A 5BRRE 1WYKA 3DD2H 2ZU5A 1YPMH 3Q3KA 3HGNA 1ARBA 4K1EA 1O2IA 1P9UA 1ZPZA 1MQ5A 3LGTA 1KXCA 1SGRE 3RMNH 3ZV8A 5TCAA 2GZ9A 4Z0KA 5HGGA 2ODPA 2UUJB 1HRTH 1P0SH 3ATMA 1ESAA 4FU9A 2STAE 3Q3YA 2G8TA 2TGAA 2BD5A 3A7XA 3EA8A 1MCTA 2G81E 1BHXB 1P12E 1H9HE 7GCHF 3GDVA 1QJ7B 1BRBE 2BTCE 3SUDA 1SHYA 1TB6H 4BAQB 2FI3E 3PYHA 1HAYB 3LH3A 1DLEA 1FONA 4AGKA 2O8WA 1ANEA 3RXAA 1HJ9A 4IS5A 4WH8A 2XC4A 3O8DA 5IDKA 2R3UA 9ESTA 3AW1A 3UIRA 5E0HA 2FI5E 1UVSH 1FJSA 4THNH 3RXFA 1TOCB 1YLCA 5E0GA 1NT1A 2J9NA 3QZRA 4TPIZ 1FUJA 5GPIB 3D23A 3RXGA 4H4FA 1UTOA 1GBCA 3R0FA 1D3QB 2PKAA 3Q3XA 1GI4A 1Z7KA 2F9BH 4GLYA 8GCHG 1CBWB 5EG4A 2OBQA 5AFZH 3GCTG 1C5SA 1EUFA 1TX7A 3TNSA 2B0FA 4WVPE 1P2OA 1HCGA 1CVWH 1O3OA 3H5CB 2VNTA 4MPWA 2AIQA 3ODFA 1O3EA 1TONA 3TJUA 5I46H 1DWBH 2BHGA 4XBCA 2VWOA 1NPMA 4VGCB 3VGCB 2I6QA 4MDSA 3RU4T 3PTBA 4XE4A 2AEIH 1IQMA 4Y8XA 3UTUH 1CGIE 1L4DA 1L0ZA 2FOFA 1SGPE 4Q7ZA 4ISOA 4X6OA 2QXIA 1LO6A 1UTPA 1C2EA 1OYTH 2K1QA 2DUCA 3A8CA 2WV4A 3RXSA 3UY9A 1O3HA 1S0RA 3RXDA 3TK9A 1NRPH 2W3KA 2EI6A 1MTNB 2M5TA 1F5LA 1V2WT 4U2WA 4GAWA 4CRDA 2GV6A 3EGKH 1BDAA 1ABIH 1P2MA 4NA8A 3QK1A 3KGPA 2P3FH 3HGPA 2A4GA 1W2KH 2D26C 2BY7X 3OY6U 1F2SE 3KQBA 4MG3A 2OC0A 4J1YA 1O31A 1YPJH 3ZZ3A 1ARCA 1GJDB 3TNTA 5JBTA 2G4TA 2NWNA 3GCHB 3GY7A 2EA3A 1MTSA 1A5HA 3SU1A 1C1MA 1PFXC 1TFXA 1TMTH 3RXBA 2PFEA 1THPB 4E06H 1TNKA 4IW4E 3LGYA 3SUGA 3ZVGA 9LPRA 3I77A 2TPIZ 2AYWA 1UK3A 2VWNA 2OTVA 2BLWA 1ZMNA 1TYNA 3M3VA 1A2CH 1YYY1 3Q00A 1SLXB 2QCYA 2HNTE 4AGJA 3SZNA 2FX4A 4GUXA 4BNRA 4AORA 2EEKA 4OS7A 4WMEA 4Y0ZE 1EJMA 1SMFE 1T31A 2A7HA 5J4SA 2BZ6H 1TE0A 2HALA 1UCYE 4FUJA 4JCNA 2A31A 3U8TH 4AB9A 1LHEH 1O2OA 3TK5A 3SUFA 1L4ZA 2FX6A 3QGJA 1VITF 2Y5FA 1XM1A 2BLVA 1V2NT 1C1NA 1FV9A 2JETC 3IWMA 3A7YA 2B7DH 4KELA 1QFKH 3D62A 5FPTA 1F92A 3RXJA 1YP9A 2KAIB 1GBMA 3G01A 4TY7A 3ZV9A 5GJ4B 1AVGH 3SNBA 1AMHA 4NWKA 4BAKB 1NFWA 4CR5A 1H8IH 4BXSA 1INCA 5EOKA 4X8VH 3MO3A 4CR9A 4F49A 2Z9GA 3M5OA 3ATLA 1MBMA 3VGCC 4X8SH 4O9VA 3RC6A 5DP9A 1GBAA 1O2GH 2ZTXA 3GDUA 3TU7H 1ELTA 3NUMA 3SHAH 3LIWA 4KTUA 1P2NA 4NIVA 1JXPA 3ELAH 2VINA 4NFEA 2C8YB 2FOBA 1ELGA 3ZVBA 1ELVA 4X8TH 5T6GA 1EB2A 4B1TA 1KTSB 1O2WA 5FHTA 2ZDMA 3RXCA 4WMFA 1DPOA 1V3XA 3A81A 1AKSB 1RD3B 1O2LA 1WQVH 1YCPK 3BEIB 1BMMH 1WU1A 2HOBA 4FUEA 3T5FH 8LPRA 5T3HA 2P3UB 3SV6A 2Z6BD 2B5TB 4RN6A 2VIWA 2ZFTA 1T8MA 4Y71A 2CMYA 1FI8A 3EYDA 3RXRA 3GY4A 3M3TA 1GJ4H 2AGIX 5JPMH 3H7OA 2A7JA 2GCHF 2AH4X 1NROH 2SGDE 3D65E 2FLRH 1OSSA 1LHGH 1AUTC 3A80A 1O2ZA 1SI5H 5DP3A 2W7UA 1XVMA 1NO9H 1GBDA 2HPPH 3LGUA 1QJ6B 4NZQA 5J4QA 1IQFA 2IJOB 2FOAA 1GDUA 3BG4C 3F9FA 1G2MA 1W7GH 1GWAA 1O3NA 4OS1A 1Z8IB 1EOJA 5EQRA 1Z1IA 3MFJA 1GHBG 1V2KT 1AGJA 2ZHEH 1G3EA 1DANH 2ZPQA 3PROA 1V2UT 1Z8RA 3KIDU 1HJ8A 3UFAA 1BBRK 3TLOA 2RA3A 1EAIA 1AE5A 2G51A 2QY0B 2UUYA 1V2OT 1C1SA 2O9QA 1KDQA 1G36A 3O8BA 1H9IE 1YPEH 1XXFA 2FOEA 1P9SA 2GT7A 2ZI2H 3UWJH 1TGCA 1C5XB 3SNEA 1GVKB 3SN8A 1O2KA 5DP5A 4CH2B 4Z6AH 1DT2A 5G4BA 2BVXH 1AN1E 1SHHB 3SJ8A 2ANYA 1SGQE 1BB0B 5DP7A 1SSXA 3SHCH 2ANMH 4IBLH 1ZGIA 2Y82A 1C1VH 2R0KA 2ALPA 3MTYA 4CHAB 6ESTA 5A0AE 1DVAH 1P8VC 1TRNA 2O8TA 4CRBA 2ZDAH 1YPLH 3SGBE 2UUFB 2NU0E 5HXFA 1WTGH 4WXIA 7ESTE 1ELDE 3KNXA 4FVDA 1O30A 1BTWA 3FVFB 1V2VT 1SOZA 4WXVA 3MU1A 1GCTC 3RMOH 1LHDH 1A46H 2HLCA 5CHAC 1C2MA 1BJVA 1TA2A 1THSH 3T27A 1IOEA 1CT0E 1JOUB 2A5KA 4GCHG 1TGNA 3FP6E 1Y5BT 1D3TB 2GKVE 4NA7A 4H6SB 1M9UA 2QF0A 3ODDA 2O8LA 4GVUA 1CA8B 3V0XA 2ZGBH 1U6QA 1EASA 1ZHRA 1FIWA 3O8RA 4D7GA 1UTNA 2W7SA 3A7ZA 4CRAA 1ELEE 1AY6H 1O5DH 2SGQE 3PTNA 1ZRKA 4A5TS 1OWJA 2CGAA 2FODA 2V6NA 1C9PA 3QDZB 4U32A 4AFQA 1B7XB 2XYAA 1G3DA 4WF8A 3UNRA 1C1UH 1FMGA 4MQAA 4OS6A 1VITH 1ZGVA 3QGNB 4UEHH 5CMXH 1MKWH 3W95A 4DOQA 1A0HB 1H8DH 3ATWA 4D9QA 3E3TA 4SGAE 3RXLA 1EATA 4LXBH 2F91A 5GWZA 1CT2E 1S6FA 4ZXYH 1CQQA 1IQNA 1GI5A 2QC2A 2VJ1A 5GIBA 1UHBA 1RIWC 1O2NA 4FUCA 2J2UA 4X2WA 5B6OA 2ZHWH 3CENA 1J16A 3E0NB 1CT4E 1UVUH 5L2ZH 1E36B 3GCOA 1FDPA 4NG9H 3BTDE 4K5ZA 2OLGA 1SC8U 4O3UA 4QT8C 3BIVH 2ODQA 1EP5A 5L6NH 2BZAA 4CHAC 2FO9A 4A7IB 1UMAH 1B5GH 1GGDB 1KYNA 1SB1H 4I31A 1OX1A 3O8CA 2GCTC 3SV8A 2BX3A 4JYVH 1UO6A 4XOJA 1O38A 4Y7BA 1YPGH 4NSYA 3SU6A 2QYIA 2GD4B 1N8OC 2B9LA 1VITG 1TNJA 1BRAA 1QL9A 2FI4E 3BIUH 2JH5D 3VEQB 4OGXA 1GBFA 4B71A 5K0HA 3GOVB 1NC6A 2HGTH 2AGGX 1BTUA 1QB9A 1QBVH 1BT7A 1CSOE 2HVXA 1DFPA 1KXFA 1XVOA 2ZQ1A 1O2TA 1L1GA 1DE7H 2FTLE 7KMEH 1TWXB 3PLPA 1ZTJA 3VB6A 2BLQA 2J95A 2GGVB 4ZKOU 1C2DA 3HPTB 4I7YH 4ZKSU 4YZUA 2AGEX 3MNBA 3SW2B 3TVJB 1NS3A 2A4QA 2BB4A 4JZDH 1DUEA 3K6ZA 1CHGA 2BLOA 1AZ8A 1TPAE 1EAXA 2ZQ2A 3E0PB 3H7TA 1Y3UA 2Y7ZA 4CREA 1SGFG 3S9AA 2CF9H 3ZVEA 4WWYA 4O03A 3ZYDA 2ZDVH 1P2QA 1T8LA 1GI3A 4NA9H 3BEFB 1W11U 1QB1A 4NSVA 2P95A 1MZAA 3P92A 2ZEBA 2ZIQH 2PW8H 4Y8YA 4AG1A 4B75A 1C1TA 1SQAA 1ZJDA 3SU0A 3ITIA 3FP7E 3T28A 2GCHG 2CHAC 2XC5A 2ZU1A 1J17T 3FP8E 3U98H 1KLIH 2ZFQH 4UD9H 2BQ6B 2AIPA 2ZTZA 3BEUA 3MU0A 4JZ1A 4YOIA 1HXFH 1C1OA 2XC0A 3S69A 3ZVAA 3TPIZ 3AW0A 3GY3A 1ZZZA 1O36A 1O3PB 1FPCH 1C4U2 5A8XA 5EPYA 2JH6D 3UQVA 4GHQA 1NESE 2HRVA 2BD8A 1F7ZA 5F8XA 1NU7B 5C20A 1KXAA 2VIVA 3N7OA 3UOUA 1D3DB 2ZFFH 3NK8A 1FLEE 1OKXA 4TWYA 5BPEA 1SGYE 1C5YB 1OOKB 3KQCA 4NWLA 4BTTB 2RCEA 4XFQA 1HXEH 1BTXA 1O3BA 4AB8A 2BDYA 5JDUB 3M37A 3ZVCA 1KXBA 3LC5A 3TH3H 3RXPA 1IHTH 4XBBA 5AF9H 1TX6A 2UUKB 1GMCG 4GPGA 4ZXXH 1RRKA 1S6HA 1JMOH 4MVNA 2GT8A 1V2ST 1HDTH 2Y7XA 2PLXA 1C5ZB 2H9HA 2QIQA 2G4UA 1S0QA 3UOPA 2FXRA 3B23B 3SBKA 5DJ7A 3ZZDA 2Z94A 1RS0A 1Y3VA 1F0SA 2VU8E 3MH6A 1K2I1 4DG4A 2C4FH 1RGQA 3RXQA 4D7FA 1O2HA 4MNWA 4X0WU 1AWFH 1PPHE 1WAYB 7LPRA 1ABJH 3NKKA 2R0LA 3S0NA 1ZSJA 2F83A 1MUEB 4UFEH 1Y5UT 2VB0A 4YOGA 2YNBA 1LPKB 6LPRA 4KTCA 1SGFA 2BY9X 5GXPA 1A4WH 1GI2A 2ASUB 1P57B 1GVLA 4X8UH 3M3SA 4DCDA 4FU7A 4IGDA 1G30B 4R8TB 2A32A 2J92A 4YT7H 2BQ7B 2QA9E 3F9EA 1SFIA 1GCDA 2P16A 2ZGXH 3GY8A 4YLQH 4FVBA 4CBNA 3TK6A 3RC4A 1A3BH 1DOJA 4X6MA 3DHKH 3SNDA 5E2PA 1EOLA 3M7TA 2A45B 3EA7A 1DS2E 1GBLA 1O3LA 1ZHPA 3MU5A 1AVWA 1YPKH 1O37A 1O3AA 1XUKA 1XUHA 3VPKA 1DWEH 1MU8B 4IMQA 3A7TA 4WJG2 3GYLB 4GCHF 2A7CA 1OXGA 4INLA 1SGDE 1BITA 1B0FA 1GDNA 1UTQA 1LMWB 5EGMA 8KME2 2J34A 2ALVA 1W7XH 1IQEA 1LVOA 2BMGB 1E35B 5LGOA 2JKHA 1UHBB 1O3DA 3BTHE 1FIZA 3A8AA 2FDAA 1A0LA 1PPEE 3FAOA 4NIWA 4B2CA 1O2MA 4DW2U 1MAXA 2PV9B 5LPRA 2FEQH 2C90B 3P95A 1HUTH 4OS2A 2XNIA 3SNCA 1O2RA 2Q6DA 3QUMP 1AD8H 1QURH 2AMDA 2ZGHA 5EODA 3LKWA 3VXEH 5FPSA 1F5RA 2GDDA 1AZZA 4BTIB 4CRCA 2BDIA 1C4Y2 2ZNKH 2A1DB 2Y5GA 3LGIA 1TMUH 5A09A 3AAVA 3P70B 3U8RH 2WPIS 1TPSA 1NRQH 1YC0A 4I8JA 4DIHH 1W0YH
chains in the Genus database with same CATH superfamily
3EAJA 2H5CA 5AHGH 2IOTA 4IN2A 1BRUP 2FIRH 4XRNA 4KGAA 2ZGCA 3PLKA 2VH0A 3MYWA 3LJOA 2GV7A 4DT7B 1OWIA 5T1VA 2TBSA 1TGBA 1BMFD 2ZC9H 5TJXA 1TPPA 1SPJA 3LGVA 3SOSA 3RXEA 4WY3A 2TGPZ 1AB9B 2ZDNA 2XWBI 4FXGH 3PM3A 1G3BA 1TNLA 3DSOA 4AFSA 4MNYA 1FY4A 1LQEA 2VGCB 4RKJB 1O3GA 1UTKA 3RXKA 1IQHA 2ZF0H 1SGIB 1DSTA 1LVYA 1ELFA 1O3CA 1Z6EA 4AX9H 3TGKE 1L1NA 1K0HA 5DK1A 1CBWC 1O2JA 1CHOG 1V2PT 1GJ9B 5IYTA 2BVRH 1TGTA 1HAIH 3PRBA 3BTEE 1C2LA 1T8NA 4F48B 2ZFRH 3NPSA 3HKIB 2Z9JA 1O0DH 1GJ5H 2WYJA 1G3CA 5DPAA 1W0KD 3A7WA 1GJ7B 1O5AB 4VGCC 3T26A 1GMHG 4F4OC 1WUNH 1MBQA 2C3SA 2ANKH 2ZCLP 4H42U 3RXTA 1V2TT 4X1NU 1GI8B 1SQOA 1JWTA 3LPRA 1TNHA 1N1LA 4E7RG 4ASUD 1O2XA 1Z8JB 3ESTA 4I86A 4OS5A 5C67A 2A4RA 3R3GB 4ABHA 5E0JA 4I8KA 1WOFA 3M36A 2XBWA 3BTWE 5DP6A 1FQ3A 1QL8A 1CE5A 5FXLA 1S82A 5ETXA 1MTNC 4XD7D 2D2DA 1ANCA 3OY5U 1EP6A 1NZQH 4LZ4B 1XX9A 2IPHA 4AYYB 3OTPA 1HAVA 1GG6B 2PGQB 1HAPH 5A2MH 1XMNB 2BY6X 1VGCB 1ZTKA 1YCPH 2PR3A 2O8MA 3K9XB 2AMPA 3GCHC 4GHTA 2V3OH 2ZU3A 1FY3A 1C1WH 3HATH 3V7TA 1TRMA 2R2MB 1K1PA 1TALA 3S7HB 2LNCA 2A0QB 2RDEA 4HFPB 2TGDA 1J15A 1GJBB 4FUIA 1KY9A 1HJAB 2HVYB 2ULLA 3KYFA 2HPQH 1SGCA 1QHRB 1DITH 3ZZ8A 3PO1B 2FZZA 4I8HA 5EQQA 3A8BA 3F9GA 1P09A 1H8HD 2H9TH 5I25A 1GHZA 2RG3A 1ANDA 3SORA 3QN7A 1O5BB 1RTLA 1SGNE 3PWCA 4X2VA 1A5IA 4NGAH 1QGFA 2ZP0H 1W12U 4Y7AA 4FUBA 1GBTA 2TRMA 4B73A 1PPGE 3FZDA 1K1NA 1UTLM 4JYTA 4AFUA 3NZIA 5F8ZA 3ZVDA 1BBRH 1C5RA 1DX5M 1GMCF 1ZMJA 3RU4E 1JRTA 1TBZH 1O32A 2BOKA 3SGQE 1AHTH 1KXDA 3K6YA 1THRH 2QN5T 2I6SA 1OWKA 1MTVA 2CXVA 2Y6TA 1EPTA 3SU5A 1GHXH 2XW9A 2WPMS 3LOXA 1CA0B 1H1BA 3SI4H 1P2IA 1C5VA 1YBWA 3VB5A 3VB7A 3L6PA 2FYRA 3FN8A 3SQHE 3I29A 1A61H 3GISB 1JBUH 1V2JT 1AE8H 4ZCNA 1K1LA 4OGYA 4RKOB 1PPFE 1BRCE 2H2ZA 2C8ZB 5F03A 1H4WA 2F4LA 1SG8B 2LP6A 5H4IB 1EZSC 3OAAD 3GCNA 1B0EA 1JIRA 1O3FA 1S85A 2HNTC 1ETRH 3Q77A 3U9AH 2VVVA 2P93A 5GCHF 3B8JA 2XOKD 4I32A 1GBBA 2BM2A 3GYMA 1GHYH 1N6XA 4ASHA 5C3NA 1HAHH 1ZOMA 4RSPA 3RMLH 3GICB 2ESTE 3LDXH 1A5GH 3MNCA 6CHAB 2BX4A 1O2UA 1IQIA 1ZRBA 1IQGA 5EQSA 1FY8E 4CH8B 4YOJA 1W14U 5FAHA 1SBWA 1UCYK 4UFGH 1GI1A 1QRWA 1EZUC 2BDAA 2AFQB 5A0CA 1QZ8A 5E8EH 1YPHE 3MO6A 5C0UA 1C2GA 1QJ1B 3A8DA 1UJ1A 3AVZA 2LELA 4K2YA 3A7VA 2WUBA 1RTFB 3NRLA 3U1IB 4AYVB 3MO9A 1GVZA 4Y8ZA 1TGSZ 1RXPA 4ISHH 1Z71A 1C9TA 2XTTB 4NFFA 3OE7D 2CF8H 2GZ8A 2PWXA 2FESH 1YF4A 2PGBB 3RLWH 3ZZ7A 3E1XB 1L2EA 1IAUA 1Y3XA 2F9VA 2JJ1D 4ZROA 1VCWA 1Y5AT 3M7UA 6GCHG 3T2NA 1LHCH 1PPCE 1K1JA 1BMAA 1RJXB 3TJNA 2Z7FE 1AFQB 1DSUA 2FMJA 1X7AC 1K28D 2XWAA 1TNGA 4X1SU 3NWUA 1AQ7A 1P03A 3DCLA 5DO4H 1QQUA 1O5GH 4AZ2B 2ANWA 3AAUA 4X2XA 4HGCA 3RUOA 3W94A 2KCPA 1S81A 4D9RA 2W6ID 1FY5A 1Q31A 2BOHB 1HGTH 2P8OB 3BTKE 3WW7A 3MMGA 3UREA 3MWIU 2W3IA 3SJOA 3FZZA 3RXHA 5C94A 4KTSA 2V3HH 1V2QT 1J14A 2WINI 5A0BA 1TA6A 2YMSC 3KEEA 2BY8X 4JZIA 2VVUA 3TGJE 1AWHB 3SU2A 4SGBE 1MAYA 2ZG0H 3BTGE 1HAGE 2W5EA 4Y79A 4TYDA 4LZ1H 1TMBH 4O97A 1OP0A 3EQ0H 6CHAC 1DLKB 5AVDA 3U69H 1O3KA 3U1JB 1C5LH 2ZO3H 5K7RA 3WY8A 4HI3A 4JK6A 3AK5A 1GHVH 3EA9A 2CN0H 5ABWA 2PKSB 1O2PA 1AUJA 1E1QD 2GMTB 3MU8A 1TLDA 1XXDA 3S9BA 3DUXH 1DUAA 3DSPA 4FUFA 3RM2H 3VB3A 4DVAU 2C8XB 1DICA 3KQEA 1SVPA 3OX7U 4UFDH 3P8NA 2WV9A 3RU4D 3S9CA 1CHOF 4ABGA 5FBIA 5EXNA 1WV7H 1S84A 1TABE 4Y76A 5PTPA 2FS8A 1QBOA 4B74A 2H5DA 3HK6B 1EQ9A 1O5CB 3PMBB 2O8UA 2WZQA 2TIOA 3HKJB 1SOTA 2JH0D 1GMHF 1NRNH 1QY6A 1WSSH 3GS9A 4CRGA 1HAVB 5F53A 1K22H 4ABBA 5JBCS 3QLPH 3MH4A 4MNXA 2FLBH 1LKAA 2V3MA 1N6YA 3SO3A 2G5VA 1ZSLA 1J9CH 5AFYH 4HZHA 1XUJA 1HB0B 1SL3A 2G00A 1QTFA 4ZMAH 2WUCA 3Q76A 3H09A 4RI0A 1O39A 1TRYA 3D49H 4AOQA 4AFZA 2XBXA 1GGDC 5T6DA 1GJCB 1ZR0A 3K65B 3OEED 2FP7B 2BD7A 1BZXE 2SGAA 3F68H 2GDEH 2P3TB 4BAHB 4Q7XA 3QO6A 4Y0YE 5IK2D 1OPHB 4ZKNU 1CO7E 1IHSH 1YM0A 1TAWA 1EJAA 1L1JA 2P94A 1SGTA 2VWLA 4INHA 3BV9B 4TWWA 4E05H 3PV5A 3RLYH 3F9HA 2Q6GA 2GTBA 1PYTD 2TGTA 3TIUA 1D9IA 1YPHC 3ZZBA 1Z1JA 3T62A 1IQLA 3T29A 4AG2A 4B76A 2SGFE 1KXEA 1ACBE 2BDGA 2ZU2A 4ZHLU 1QQ4A 2ZHDA 1E0FD 1V2RT 1UTMA 1H9LB 3BG8A 1TNIA 3C27B 4A1TA 1O3MA 3DSGA 2XBYA 3MU4A 2QAAA 1V2LT 3QTOH 3SJ9A 4NCYA 4M9FA 1WBGB 1DM4B 3KQDA 3TJOA 4YM9A 3TJVA 1C1PA 2KR7A 1EPTB 1MKXH 1ZJKA 1GHWH 1WDIA 4I33A 1UK4A 3CS0A 2Z9IA 2VIDA 4KP0A 3ZYEA 1FAKH 2A2QH 1Q2WA 2BDBA 3URDA 8ESTE 5LPEA 3LU9B 4A1VA 3BF6H 1KSNA 2EI8A 1LTOA 3SI3H 2FOHA 1BTPA 4PROA 3DFJA 2XXLA 1W8BH 1K1IA 2FWWA 1C4V2 4ABDA 2NU1E 2WSSD 1ZTLA 3HK3B 4ISIH 3E90B 1NTPA 1GHAG 1NFUA 3MH5A 3STJA 2A4OA 1XUIA 1V2MT 2QGRA 2XNDD 5GCHG 1W3CA 2A5IA 1ELAA 2GZ7A 1YY3A 2ZPSA 3PMAB 2J38A 2P59A 1HBTH 5ESBA 4J2YB 5EPNA 3BN9A 4Y10E 1P05A 5T6FA 2R3YA 3SV7A 3ZZAA 1AFEH 2WPJS 2V7QD 2PHBA 4E7NA 2F9OA 1BTZA 3OFND 4IC6A 5HM9A 1O2QA 2ZFSA 1HIAA 3A89A 1FN6A 1CGJE 2R2WU 2J97A 2GJGA 4K1TA 5FX6A 4XDEA 1W13U 1T8OA 1A7SA 2XCNA 2BDCA 2VWMA 2B8OH 3P8OA 4IMZA 2BD2A 2WPHS 1EFRD 2ZKSA 1VZQH 1DWCH 3MH7A 4UONA 1MD8A 2F3CE 5JB8S 2ZA5A 2VIQA 4ZKRU 3RP2A 4FUDA 3VB4A 3F3BA 1VJAU 4DJZB 1AIXH 3FANA 2Y80A 2FPZA 5C1XA 1YLDA 1O33A 3UQOA 1XUFA 4IN1A 4DY7B 1A1RA 3RMMH 2F9PA 4WMDA 2PSXA 5C1YA 1BIOA 1HNEE 4B2BA 1ZSKA 3LGWA 2JETB 1HYLA 1SLUB 1C2FA 4K3JA 1QBNA 2WYGA 2Q6FA 1DY9A 1EAUA 1KLJH 1HPGA 4GSOA 3PB1E 2QV1A 3M35A 1BBRE 4MLFB 1YLNA 3SU3A 3U28C 1C2JA 1QR3E 1FXYA 1GBHA 3K2UA 3UWIA 2PTCE 1EX3A 4FUHA 1RFNA 2BVSH 2Z9KA 1AVXA 2UWPA 1F5KU 3QX5H 1EPTC 5DN6D 2BXTH 1EAWA 2VIOA 4JMYA 2GP9B 1NN6A 1MZDA 1NU9A 1C2KA 3BTFE 1C5QA 1OWDA 3LC3A 2Q1JA 3RM0H 2DE8A 1ID5H 2F9UA 6GCHF 3A88A 2W6JD 4FUGA 4ESTE 3SQEE 1HFDA 1GI9B 5FL7D 2EC9H 3LJJA 4TSFD 4ABJA 1MH0A 1FN8A 1TBRH 2Y81A 3ATIA 1S83A 3EE0B 3TITA 2OBOA 3SJIA 4BAOB 2IN2A 2K0QA 4ISLA 3CNRA 1C1QA 3E16B 4LOYH 5DSFA 1OP8A 5FCKA 4X1QU 3KHVA 3JZ2B 1PPZA 4D76A 4K60A 1HAOH 2XRCA 1P3EA 4ZH8A 2HNTF 1PQ7A 2DE9A 1P06A 2LPRA 1QIXB 2PSYA 1WXRA 1C5OH 2A2XH 3BG4B 1C5UA 1OWEA 2D1JA 1TQ7B 2ZHFH 1ETTH 2KM0A 3WWFA 1E37B 1NRRH 2ZECA 3STIA 5F8TA 4XBDA 2F9NA 3UNQA 1BUIA 1IQJA 1NFYA 1BJUA 1V6DA 1UVTH 1NY22 3S7KB 1MTWA 1WQSA 4KKDA 1ETSH 2K8IA 2XCFA 1O2YA 3FFGA 3PMHB 3TGIE 3L3TA 1FNIA 1P2KA 1OWHA 2BYAX 4UDWH 1VR1H 3GY6A 3A86A 1Q3XA 4DIIH 3TH2H 4INKA 1LPGB 3BSQA 1P2JA 2BY5X 1GBKA 1NBME 3AASA 3MOCA 3LONA 2YNAA 1GL0E 2ZCKP 4A92A 3VFEA 4B2AA 3VG8A 4NIYA 4DURA 2KZ4A 4Y6DA 5EW2H 2WPLS 2VIPA 3PMJA 3PLBA 3MNXA 1O2SA 3QTVH 1O5FH 2ZZUH 3RC5A 4I8LA 1FY1A 3RXVA 5A8ZA 1W10U 2ZGJA 2VVCA 1ANBA 1QA7A 2HWLB 4ACBA 1G37A 5C17A 5E2OA 4X1PU 1MABB 3GY5A 1GI7B 1DXWA 4MPUA 3OSYA 2W26A 2A5AA 1UK2A 3RXMA 5F6MA 1QRZA 1BOQA 1ZHMA 4Z1MD 1A3EH 1D6WA 1P10A 2RDLA 3ZVFA 1Y8TA 1BMNH 1OP2A 5L30H 1GI0A 3SJKA 2ZWLH 2BD4A 3A85A 4BAMB 2H9EH 4BOHA 1GCTB 1RTKA 3QWCH 5EW1H 1GJ8B 5CHAB 3PWBA 5LH8A 3FOAA 3LT3A 1VCQA 1AB9C 1QL7A 2OCVB 2OD3B 1GL1A 3ZZ5A 2VBCA 2V0BA 2Z3CA 2VGCC 1NFXA 3DFLA 4R0IA 2FOCA 4YT6H 4JK5A 1LQDB 2PP6A 2YOLA 1SGEE 3A87A 5LPFA 1Y59T 1MQ6A 2NU2E 3F6UH 1KIGH 2CV3A 2XBVA 3A82A 4D8NA 1YCPM 3SUEA 2SFAA 2FS9A 2UWOA 2QXHA 3P8GA 1BCUH 1GJ6A 1COWD 5C0TA 1DDJA 2J4IA 2G55A 3IG6B 4X6PA 1EJNA 5C5NA 1Y3YA 2BDHA 3KN2A 1GMDF 2D8WA 1KMHB 1O3JA 1P02A 1RIWB 2ZDKA 3V13A 4M7GA 5GDSH 1FX0B 2KCOA 3KCGH 2OINA 5FCRA 2ZFPH 3OTJE 7GCHG 1LCYA 1JRSA 4ZHAA 1K1MA 2STBE 2R9PA 5EIYA 1YKTA 5HYOA 1D6RA 3SGAE 4CBOA 1HIAB 1E38B 2OQUA 3VXFH 1TPOA 1Y3WA 2GX4A 4ABAA 2OQ5A 1GHAF 1GG6C 2C8WB 1SLVB 1T32A 1YGCH 3P8FA 5CHBA 4Q2KA 2BD3A 4A1XA 3SV9A 2GCTB 1VGCC 1MU6B 1NM6A 2ILNA 1VCPA 1ESBA 5C1UA 2AMQA 3SYJA 5JB9S 3A84A 1N8OB 2PKAB 1P01A 4WH6A 4UE7H 1C5PA 1HJAC 2WPKS 1PPBH 4X2YA 3RXOA 2F43B 3UNSA 4FU8A 2QXGA 3JZ1B 3M7QA 3LH1A 3KL6A 3PO1C 2JDID 2THFB 4ZUHA 1QNJA 1GBEA 3UR6A 1F0RA 3OYPA 4MTBA 2QE7D 4I8GA 1UCYH 2G5NA 2G52A 1IQKA 1FAXA 2PUXB 3E91A 2PTNA 3NCLA 1PQ5A 2ZPRA 3UUZA 4YTAA 5EJ1A 3ZZ6A 1MKWK 1SLWB 2J94A 2GVFA 3E8LA 2Z3DA 3M61U 3PV4A 5HMAA 2NU3E 1KLTA 8GCHF 1CGHA 1Z6JH 2ZCHP 1E34B 1ZPCA 3GCTF 4H6TA 1NBMD 1DWDH 3I78A 1C1RA 3DT0H 1K9OE 2ZU4A 4Q80A 5DKMA 3ZZCA 2IJD1 3A83A 1C2IA 3W1EA 4AC9A 1S5SA 1XKBC 1HLTH 1G32B 1ELCA 1K1OA 1GBIA 3V3MA 1E1RD 2BD9A 1LKBA 2Z9LA 2BXUH 2H1UA 1AI8H 1CA0C 1LDTT 1K21H 1UTJA 2KCYA 3BTME 4ABFA 1MTUA 4CRFA 3URCA 1GDQA 2OC8A 2CHAB 1T4VH 3E6PH 1NRSH 3IITA 1F0UA 1PJPA 3N7DA 4X6NA 3UAIC 1ESTA 5C2ZA 3P17H 4K69A 5EXLA 1J8AA 2NU4E 1C5NH 1WCZA 5EU8A 4TY6A 2OP9A 4TPYA 3V12A 3KF2A 3MI4A 2OXSA 1UVPA 3BTTE 4AN7A 1FZZA 2UWLA 4BANB 5JBBS 1TIOA 1HV7A 1O5EH 1OS8A 1SFQB 4ISNA 1O3IA 2SNVA 5FX5A 4BXWA 3SU4A 3U8OH 3C1KA 3GDSA 4B6FA 4JZEH 4XSKU 3M5NA 2AERH 4K8YA 3UPEA 3MNSA 5EXMA 1LPZB 1BQYA 1TQ0B 2BQWB 1Z8GA 5KECA 1TOMH 1C5WB 3EDXB 1OYQA 2FTMA 1XKAC 2FOMB 5DP4A 1EZQA 2SGEE 5FBEA 1BA8B 4Q4LA 4NIXA 1GPZA 4HTCH 1DXPA 5JYIA 1O35A 1AO5A 3SV2H 3CP7A 3ENSB 1WTHD 4JYUH 4NZLA 1LVBA 4YLUA 1CU1A 4P00A 1EZXC 1ORFA 2WPDD 5A8YA 1EB1H 3P6ZB 1C5TA 1HAZB 1ELBA 5FPYA 1AU8A 2EI7A 2KAIA 2WV5A 1UVOA 3T25A 4DGJA 1LHFH 1W0ZU 2QXJA 1O2VA 1ZMLA 2Z3EA 4U30A 3SZEA 4X1RU 1BTYA 1SQTA 1ZPBA 3L33A 1XUGA 1C5MD 2FYQA 2ZDLA 3F2HA 1AFQC 3B9FH 4FETA 2KFWA 3RXUA 2ODYB 1EKBB 1QB6A 3QZQA 1QA0A 1TX8A 3F1SB 5L2YH 1D3PB 1A0JA 1JIMA 1BHXF 4K8BA 2Y5HA 1KTTB 3F0OA 1QCPA 1W0JD 2P8OC 3UR9A 1VJ9U 1LVMA 2SGPE 4LK4A 1H8ED 3SNAA 3KYGA 4MNVA 1ZYOA 4ABEA 5ESTE 1AKSA 3CS7A 1DY8A 4OS4A 1BMLA 3RXIA 1G2LA 4O3TA 3TH4H 3MHWU 1PYTC 4ABIA 1BTHH 4YO9A 5HM2A 1PQ8A 2H6MA 2AS9A 4JZFH 4Y11E 2ZHQH 1MMJN 1P11E 3NXPA 4ZHMU 1EXFA 3M5LA 1G9IE 2SNWA 5DG6A 4Q7YA 5CE1A 5C5OA 4UFFH 4ZAEA 1GBJA 1C2HA 2OC1A 4MPXA 3ZZ4A 5TCCA 2ZTYA 1HAXB 1TBQH 4A6LA 2QF3A 3FO8D 2CK3D 5EJZA 1GMDG 2OC7A 1D4PB 2PKSC 1T4UH 4IC5A 4BTUB 3M5MA 2EY4C 1T7CA 4U01A 2GMTC 1P3CA 1GJAB 3ATKA 1KDQB 2CJIA 1FPHH 1GI6A 1PQAA 1SR5C 5JBAS 1F0TA 3DA9B 5DGJA 3GY2A 3EE7A 2FM2A 4MPVA 1MKXK 1ZLRA 3RDZA 2J98B 1MCVA 2PUQH 1P04A 2OUAA 1QRXA 1O34A 3ZZ9A 1GHBF 1MD7A 2C93B 2VH6A 4K1SA 2FOGA 3BTQE 5DP8A 5SGAE 2V35A 3OU0A 4YESB 2RA0A 5BRRE 1WYKA 3DD2H 2ZU5A 1YPMH 3Q3KA 3HGNA 1ARBA 4K1EA 1O2IA 1P9UA 1ZPZA 1MQ5A 3LGTA 1KXCA 1SGRE 3RMNH 3ZV8A 5TCAA 2GZ9A 4Z0KA 5HGGA 2ODPA 2UUJB 1HRTH 1P0SH 3ATMA 1ESAA 4FU9A 2STAE 3Q3YA 2G8TA 2TGAA 2BD5A 5EJLA 3A7XA 3EA8A 1MCTA 2G81E 1BHXB 1P12E 1H9HE 7GCHF 3GDVA 1QJ7B 1BRBE 1SQRA 2BTCE 3SUDA 1SHYA 1TB6H 4BAQB 2FI3E 3PYHA 1HAYB 3LH3A 1DLEA 1FONA 4AGKA 2O8WA 1ANEA 5HIZA 3RXAA 1HJ9A 4IS5A 4WH8A 2XC4A 3O8DA 5IDKA 2R3UA 9ESTA 3AW1A 3UIRA 5E0HA 2FI5E 1UVSH 1FJSA 4THNH 3RXFA 1TOCB 1YLCA 5E0GA 1NT1A 2J9NA 3QZRA 4TPIZ 1FUJA 5GPIB 3D23A 3RXGA 4H4FA 1UTOA 1GBCA 3R0FA 1D3QB 2PKAA 3Q3XA 1GI4A 1Z7KA 2F9BH 4GLYA 8GCHG 1CBWB 5EG4A 2OBQA 5AFZH 2L6OA 3GCTG 1C5SA 1EUFA 1TX7A 3TNSA 2B0FA 4WVPE 1P2OA 1HCGA 1CVWH 1O3OA 3H5CB 2VNTA 4MPWA 2AIQA 3ODFA 1O3EA 1TONA 3TJUA 5I46H 1DWBH 2BHGA 4XBCA 2VWOA 1NPMA 4VGCB 3VGCB 2I6QA 4MDSA 3RU4T 3PTBA 4XE4A 2AEIH 1IQMA 4Y8XA 3UTUH 1CGIE 1L4DA 3FKSD 1L0ZA 2FOFA 1SGPE 4Q7ZA 4ISOA 4X6OA 2QXIA 1LO6A 1UTPA 1C2EA 1OYTH 2K1QA 2DUCA 3A8CA 2WV4A 3RXSA 3UY9A 1O3HA 1S6LA 1S0RA 3RXDA 3TK9A 1NRPH 2W3KA 2EI6A 1MTNB 2M5TA 1F5LA 1V2WT 4U2WA 4GAWA 4CRDA 2GV6A 3EGKH 1BDAA 1ABIH 1P2MA 4NA8A 3QK1A 3KGPA 2P3FH 3HGPA 2IPQX 2A4GA 1W2KH 2D26C 2BY7X 3OY6U 1F2SE 3KQBA 4MG3A 2OC0A 4J1YA 1O31A 1YPJH 3ZZ3A 1ARCA 1GJDB 3TNTA 5JBTA 2G4TA 2NWNA 3GCHB 3GY7A 2EA3A 1MTSA 1A5HA 1SKYE 3SU1A 1C1MA 1PFXC 1TFXA 1TMTH 3RXBA 2PFEA 3F2GA 1THPB 4E06H 1TNKA 4IW4E 3LGYA 3SUGA 3ZVGA 9LPRA 3I77A 2TPIZ 2AYWA 1UK3A 2VWNA 3ZIAD 2OTVA 2BLWA 1ZMNA 1TYNA 3M3VA 1A2CH 1YYY1 3Q00A 1SLXB 2QCYA 2HNTE 4AGJA 3SZNA 2FX4A 4GUXA 4BNRA 4AORA 2JIZD 2EEKA 4OS7A 4WMEA 4Y0ZE 1EJMA 1SMFE 1T31A 2A7HA 5J4SA 2BZ6H 1TE0A 2HALA 1UCYE 4FUJA 4JCNA 2A31A 3U8TH 4AB9A 1LHEH 1O2OA 4DT4A 3TK5A 3SUFA 1L4ZA 2FX6A 3QGJA 1VITF 2Y5FA 1XM1A 2BLVA 1V2NT 1C1NA 1FV9A 2JETC 3IWMA 3A7YA 2B7DH 4KELA 1QFKH 3D62A 5FPTA 1F92A 3RXJA 1YP9A 2KAIB 1GBMA 3G01A 4TY7A 3ZV9A 5GJ4B 1AVGH 3SNBA 1AMHA 4NWKA 4BAKB 1NFWA 4CR5A 1H8IH 4BXSA 1INCA 5EOKA 4X8VH 3MO3A 4CR9A 4F49A 2Z9GA 3M5OA 3ATLA 1MBMA 3VGCC 4X8SH 4O9VA 3RC6A 5DP9A 5HIYA 1GBAA 1O2GH 2ZTXA 3GDUA 3TU7H 1ELTA 3NUMA 3SHAH 3LIWA 5B6LA 4KTUA 1P2NA 4NIVA 1JXPA 3ELAH 2VINA 4NFEA 2C8YB 3WWBA 2FOBA 1ELGA 3ZVBA 1ELVA 4X8TH 4ACAA 5T6GA 1EB2A 4B1TA 1KTSB 1O2WA 5FHTA 2ZDMA 3RXCA 4WMFA 1DPOA 1V3XA 3A81A 1AKSB 1RD3B 1O2LA 1WQVH 1YCPK 3BEIB 1BMMH 1WU1A 2HOBA 4FUEA 3T5FH 8LPRA 5T3HA 2P3UB 3SV6A 2Z6BD 2B5TB 4RN6A 2VIWA 2ZFTA 1T8MA 4Y71A 2CMYA 1FI8A 3EYDA 3RXRA 3GY4A 4P02A 3M3TA 1GJ4H 2AGIX 5JPMH 3H7OA 2A7JA 2GCHF 2QF4A 2AH4X 1NROH 2SGDE 3D65E 2FLRH 1OSSA 1LHGH 1AUTC 4FOUC 3A80A 1O2ZA 1SI5H 5DP3A 2W7UA 1XVMA 1NO9H 1GBDA 2HPPH 3LGUA 1QJ6B 4NZQA 5J4QA 1IQFA 2L74A 1UW7A 2IJOB 2FOAA 1GDUA 3BG4C 3F9FA 1G2MA 1W7GH 1GWAA 1O3NA 4OS1A 1Z8IB 4Q63A 1EOJA 5EQRA 1Z1IA 3MFJA 1GHBG 1V2KT 1AGJA 2ZHEH 1G3EA 1DANH 2ZPQA 3PROA 1V2UT 1Z8RA 3KIDU 1HJ8A 3UFAA 1BBRK 1YWUA 3TLOA 2RA3A 1EAIA 2OK5A 1AE5A 2G51A 2QY0B 2UUYA 3N7EA 1V2OT 1C1SA 2O9QA 1KDQA 1G36A 3O8BA 1H9IE 1YPEH 1XXFA 2FOEA 1P9SA 2GT7A 2ZI2H 3UWJH 2M2AA 1TGCA 1C5XB 3SNEA 1GVKB 3SN8A 2J98A 1O2KA 5DP5A 4CH2B 4Z6AH 4OM9A 1DT2A 5G4BA 2BVXH 1AN1E 1SHHB 3SJ8A 2ANYA 1SGQE 1BB0B 5DP7A 1SSXA 3SHCH 2AHME 2ANMH 4IBLH 1ZGIA 2Y82A 1C1VH 2R0KA 2ALPA 3MTYA 4CHAB 6ESTA 5A0AE 2WHXA 1DVAH 1P8VC 1TRNA 2O8TA 4CRBA 2ZDAH 1YPLH 3SGBE 2UUFB 2NU0E 5HXFA 1WTGH 4WXIA 7ESTE 1ELDE 3KNXA 4FVDA 1O30A 1BTWA 3FVFB 1V2VT 1SOZA 4WXVA 1OHHD 3MU1A 1GCTC 3RMOH 2YMSB 1LHDH 1A46H 2HLCA 5CHAC 1C2MA 1BJVA 1TA2A 1THSH 2KCAA 3T27A 1IOEA 1CT0E 1JOUB 2A5KA 4GCHG 1TGNA 3FP6E 1Y5BT 1D3TB 2GKVE 4NA7A 4H6SB 1M9UA 2QF0A 3ODDA 2O8LA 4GVUA 1CA8B 3V0XA 2ZGBH 1U6QA 1EASA 2EQNA 1ZHRA 1FIWA 3O8RA 4D7GA 1UTNA 2W7SA 3A7ZA 4CRAA 1ELEE 1AY6H 1O5DH 2SGQE 2KX4A 1ZRKA 3PTNA 4A5TS 1OWJA 2CGAA 2FODA 2V6NA 1C9PA 3QDZB 4U32A 4AFQA 1B7XB 2XYAA 1G3DA 4WF8A 3UNRA 1C1UH 1FMGA 4MQAA 4OS6A 1VITH 1ZGVA 3QGNB 5GNDA 4UEHH 5CMXH 1MKWH 3W95A 4DOQA 1A0HB 1H8DH 3ATWA 4D9QA 3E3TA 1E79D 4SGAE 2QF5A 3RXLA 1EATA 4LXBH 2F91A 5GWZA 1CT2E 1S6FA 4ZXYH 1CQQA 1IQNA 1GI5A 2QC2A 2VJ1A 5GIBA 1UHBA 1RIWC 1O2NA 4FUCA 2J2UA 4X2WA 5B6OA 2ZHWH 3CENA 1J16A 3E0NB 3KQ5A 5KGOA 1CT4E 1UVUH 5L2ZH 1E36B 3GCOA 1FDPA 4NG9H 3BTDE 4K5ZA 2OLGA 1SC8U 4O3UA 4QT8C 3BIVH 2ODQA 1EP5A 5L6NH 2BZAA 4CHAC 2FO9A 4A7IB 1UMAH 1B5GH 1GGDB 1KYNA 1SB1H 4I31A 1OX1A 3O8CA 2GCTC 3SV8A 2BX3A 4JYVH 1UO6A 4XOJA 1O38A 4Y7BA 1YPGH 4NSYA 3SU6A 2QYIA 2GD4B 3MQKC 1N8OC 2B9LA 1VITG 1TNJA 1BRAA 1QL9A 2FI4E 3BIUH 2JH5D 3VEQB 4HG6A 1GBFA 4OGXA 4B71A 5K0HA 3GOVB 1NC6A 2HGTH 2AGGX 1BTUA 1QB9A 1VKYA 2YMSD 1QBVH 1BT7A 1CSOE 2HVXA 1DFPA 1KXFA 1XVOA 2ZQ1A 1O2TA 1L1GA 1DE7H 2FTLE 7KMEH 1TWXB 3PLPA 1ZTJA 3VB6A 2BLQA 2J95A 2GGVB 4ZKOU 1C2DA 3HPTB 4I7YH 4ZKSU 4YZUA 2AGEX 3MNBA 3SW2B 3TVJB 1NS3A 2A4QA 2BB4A 4JZDH 1DUEA 3K6ZA 1CHGA 2BLOA 1AZ8A 1TPAE 1EAXA 2ZQ2A 3E0PB 3H7TA 1Y3UA 2Y7ZA 4CREA 1SGFG 3S9AA 2RFKC 2CF9H 3ZVEA 4WWYA 4O03A 3ZYDA 2ZDVH 1P2QA 1T8LA 1GI3A 4NA9H 3BEFB 1W11U 1QB1A 4NSVA 2P95A 1MZAA 3P92A 2ZEBA 2ZIQH 2PW8H 4Y8YA 4AG1A 4B75A 1C1TA 1SQAA 1ZJDA 3SU0A 3ITIA 3FP7E 3T28A 2GCHG 2CHAC 2XC5A 2ZU1A 1J17T 3FP8E 4RT1A 1KLIH 3U98H 2ZFQH 4UD9H 2BQ6B 2AIPA 2ZTZA 3BEUA 3MU0A 4JZ1A 4YOIA 1HXFH 1C1OA 2XC0A 3S69A 3ZVAA 3TPIZ 3AW0A 3GY3A 5KEDA 1ZZZA 1O36A 1O3PB 1FPCH 3PRDA 1C4U2 5A8XA 5EPYA 2JH6D 3UQVA 4GHQA 1NESE 2HRVA 2BD8A 1F7ZA 5F8XA 1NU7B 5C20A 1KXAA 2VIVA 3N7OA 3UOUA 5CDFE 1D3DB 2ZFFH 3NK8A 1FLEE 1OKXA 4TWYA 5BPEA 1SGYE 1C5YB 1OOKB 3KQCA 4NWLA 4BTTB 2RCEA 4XFQA 1HXEH 1BTXA 1O3BA 4AB8A 2BDYA 5JDUB 3M37A 3ZVCA 3UB0A 1KXBA 3LC5A 3TH3H 3RXPA 1IHTH 4XBBA 5AF9H 1TX6A 2UUKB 1GMCG 4GPGA 4ZXXH 1RRKA 1S6HA 1JMOH 4MVNA 2GT8A 1V2ST 1HDTH 2Y7XA 2PLXA 1C5ZB 2H9HA 2QIQA 2G4UA 1S0QA 3UOPA 2FXRA 3B23B 3SBKA 5DJ7A 3ZZDA 2Z94A 1RS0A 1Y3VA 1F0SA 2VU8E 3MH6A 1K2I1 4DG4A 2C4FH 1RGQA 3RXQA 4D7FA 3F0PA 1O2HA 4MNWA 4X0WU 1AWFH 1PPHE 1WAYB 7LPRA 1ABJH 3NKKA 2R0LA 3S0NA 1ZSJA 4RT0A 2F83A 1MUEB 4UFEH 1Y5UT 2J5UA 2VB0A 4YOGA 2YNBA 1LPKB 6LPRA 4KTCA 1SGFA 2BY9X 5GXPA 1A4WH 1GI2A 2ASUB 1P57B 1GVLA 4X8UH 4TT3D 3M3SA 4DCDA 4FU7A 4IGDA 1G30B 4R8TB 4YXWD 2A32A 2J92A 4YT7H 2BQ7B 2QA9E 3F9EA 3PV2A 1SFIA 1GCDA 2P16A 2ZGXH 3OEHD 3GY8A 4YLQH 4FVBA 4CBNA 4F55A 3F2FA 3TK6A 3RC4A 1A3BH 1DOJA 4X6MA 3DHKH 3SNDA 5E2PA 1EOLA 3M7TA 2A45B 3EA7A 1DS2E 1GBLA 1O3LA 1ZHPA 3MU5A 1AVWA 1YPKH 1O37A 1O3AA 1XUKA 1XUHA 3VPKA 1DWEH 1MU8B 4IMQA 3A7TA 4WJG2 3GYLB 3N99A 4GCHF 2A7CA 1OXGA 4INLA 1SGDE 1BITA 1B0FA 1GDNA 1UTQA 1LMWB 5EGMA 8KME2 2JJ2D 2J34A 2ALVA 1W7XH 1IQEA 1LVOA 2BMGB 1E35B 5LGOA 2JKHA 5HKKD 1UHBB 1O3DA 3BTHE 1FIZA 3A8AA 2FDAA 1A0LA 1PPEE 3FAOA 4NIWA 4B2CA 1O2MA 4DW2U 1MAXA 2PV9B 5LPRA 2FEQH 2C90B 3P95A 1HUTH 4OS2A 2XNIA 3SNCA 1O2RA 2Q6DA 3QUMP 1AD8H 1QURH 2AMDA 2ZGHA 5EODA 3LKWA 3VXEH 5FPSA 4B6EA 1F5RA 2GDDA 1AZZA 4BTIB 4CRCA 2BDIA 1C4Y2 2ZNKH 2A1DB 2Y5GA 3LGIA 1TMUH 5A09A 3AAVA 3P70B 3U8RH 2HLDD 2WPIS 1TPSA 1NRQH 1YC0A 4I8JA 4DIHH 1W0YH
chains in the Genus database with same CATH topology
3EAJA 2H5CA 5AHGH 2IOTA 4IN2A 1BRUP 2FIRH 4KGAA 2ZGCA 3PLKA 2VH0A 3MYWA 3LJOA 2GV7A 4DT7B 1OWIA 2TBSA 1TGBA 2ZC9H 5TJXA 1TPPA 1SPJA 3LGVA 3SOSA 3RXEA 4WY3A 2TGPZ 1AB9B 2ZDNA 2XWBI 4FXGH 3PM3A 1G3BA 1TNLA 4AFSA 4MNYA 1FY4A 1LQEA 2VGCB 4RKJB 1O3GA 1UTKA 3RXKA 1IQHA 2ZF0H 1SGIB 1DSTA 1LVYA 1ELFA 1O3CA 1Z6EA 4AX9H 3TGKE 1L1NA 5DK1A 1CBWC 1O2JA 1CHOG 1V2PT 1GJ9B 5IYTA 2BVRH 1TGTA 1HAIH 3BTEE 1C2LA 1T8NA 2ZFRH 3NPSA 3HKIB 2Z9JA 1O0DH 1GJ5H 2WYJA 1G3CA 5DPAA 3A7WA 1GJ7B 1O5AB 4VGCC 3T26A 1GMHG 4F4OC 1WUNH 1MBQA 2C3SA 2ANKH 2ZCLP 4H42U 3RXTA 1V2TT 4X1NU 1GI8B 1SQOA 1JWTA 3LPRA 1TNHA 1N1LA 4E7RG 1O2XA 1Z8JB 3ESTA 4OS5A 5C67A 2A4RA 3R3GB 4ABHA 5E0JA 4I8KA 1WOFA 3M36A 2XBWA 3BTWE 5DP6A 1FQ3A 1QL8A 1CE5A 5FXLA 1S82A 5ETXA 1MTNC 2D2DA 1ANCA 3OY5U 1EP6A 1NZQH 4LZ4B 1XX9A 2IPHA 4AYYB 1HAVA 1GG6B 2PGQB 1HAPH 5A2MH 1XMNB 2BY6X 1VGCB 1ZTKA 1YCPH 2PR3A 2O8MA 3K9XB 2AMPA 3GCHC 4GHTA 2V3OH 2ZU3A 1FY3A 1C1WH 3HATH 3V7TA 1TRMA 2R2MB 1K1PA 1TALA 3S7HB 2LNCA 2A0QB 4HFPB 2TGDA 1J15A 1GJBB 4FUIA 1KY9A 1HJAB 2ULLA 2HPQH 1SGCA 1QHRB 1DITH 3ZZ8A 3PO1B 2FZZA 4I8HA 5EQQA 3A8BA 3F9GA 1P09A 2H9TH 5I25A 1GHZA 2RG3A 1ANDA 3SORA 3QN7A 1O5BB 1RTLA 1SGNE 3PWCA 4X2VA 1A5IA 4NGAH 1QGFA 2ZP0H 1W12U 4Y7AA 4FUBA 1GBTA 2TRMA 4B73A 1PPGE 3FZDA 1K1NA 1UTLM 4JYTA 4AFUA 3NZIA 5F8ZA 3ZVDA 1BBRH 1C5RA 1DX5M 1GMCF 1ZMJA 3RU4E 1JRTA 1TBZH 1O32A 2BOKA 3SGQE 1AHTH 1KXDA 3K6YA 1THRH 2QN5T 2I6SA 1OWKA 1MTVA 2CXVA 2Y6TA 1EPTA 3SU5A 1GHXH 2XW9A 2WPMS 3LOXA 1CA0B 1H1BA 3SI4H 1P2IA 1C5VA 1YBWA 3VB5A 3VB7A 3L6PA 2FYRA 3SQHE 3I29A 1A61H 3GISB 1JBUH 1V2JT 1AE8H 1K1LA 4OGYA 4RKOB 1PPFE 1BRCE 2H2ZA 2C8ZB 5F03A 1H4WA 1SG8B 5H4IB 1EZSC 3GCNA 1B0EA 1JIRA 1O3FA 1S85A 2HNTC 1ETRH 3Q77A 3U9AH 2VVVA 2P93A 5GCHF 3B8JA 4I32A 1GBBA 2BM2A 3GYMA 1GHYH 1N6XA 4ASHA 5C3NA 1HAHH 1ZOMA 4RSPA 3RMLH 3GICB 2ESTE 3LDXH 1A5GH 3MNCA 6CHAB 2BX4A 1O2UA 1IQIA 1ZRBA 1IQGA 5EQSA 1FY8E 4CH8B 4YOJA 1W14U 5FAHA 1SBWA 1UCYK 4UFGH 1GI1A 1QRWA 1EZUC 2BDAA 2AFQB 5A0CA 5E8EH 1YPHE 3MO6A 1C2GA 1QJ1B 3A8DA 1UJ1A 3AVZA 4K2YA 3A7VA 2WUBA 1RTFB 3U1IB 4AYVB 3MO9A 1GVZA 4Y8ZA 1TGSZ 1RXPA 4ISHH 1Z71A 1C9TA 2XTTB 4NFFA 2CF8H 2GZ8A 2PWXA 2FESH 1YF4A 2PGBB 3RLWH 3ZZ7A 3E1XB 1L2EA 1IAUA 1Y3XA 2F9VA 4ZROA 1VCWA 1Y5AT 3M7UA 6GCHG 3T2NA 1LHCH 1PPCE 1K1JA 1BMAA 1RJXB 3TJNA 2Z7FE 1AFQB 1DSUA 2FMJA 1X7AC 1K28D 2XWAA 1TNGA 4X1SU 3NWUA 1AQ7A 1P03A 5DO4H 1QQUA 1O5GH 4AZ2B 2ANWA 3AAUA 4X2XA 4HGCA 3RUOA 3W94A 1S81A 4D9RA 1FY5A 1Q31A 2BOHB 1HGTH 2P8OB 3BTKE 3MMGA 3UREA 3MWIU 2W3IA 3SJOA 3FZZA 3RXHA 4KTSA 2V3HH 1V2QT 1J14A 2WINI 5A0BA 1TA6A 3KEEA 2BY8X 4JZIA 2VVUA 3TGJE 1AWHB 3SU2A 4SGBE 1MAYA 2ZG0H 3BTGE 1HAGE 2W5EA 4Y79A 4TYDA 4LZ1H 1TMBH 4O97A 1OP0A 3EQ0H 6CHAC 1DLKB 5AVDA 3U69H 1O3KA 3U1JB 1C5LH 2ZO3H 5K7RA 3WY8A 4HI3A 4JK6A 1GHVH 3EA9A 2CN0H 5ABWA 2PKSB 1O2PA 1AUJA 2GMTB 3MU8A 1TLDA 1XXDA 3S9BA 3DUXH 1DUAA 4FUFA 3RM2H 3VB3A 4DVAU 2C8XB 1DICA 3KQEA 1SVPA 3OX7U 4UFDH 3P8NA 3RU4D 3S9CA 1CHOF 4ABGA 5FBIA 5EXNA 1WV7H 1S84A 1TABE 4Y76A 5PTPA 2FS8A 1QBOA 4B74A 2H5DA 3HK6B 1EQ9A 1O5CB 3PMBB 2O8UA 2TIOA 3HKJB 1SOTA 2JH0D 1GMHF 1NRNH 1QY6A 1WSSH 4CRGA 1HAVB 1K22H 4ABBA 5JBCS 3QLPH 3MH4A 4MNXA 2FLBH 1LKAA 1N6YA 3SO3A 2G5VA 1ZSLA 1J9CH 5AFYH 4HZHA 1XUJA 1HB0B 1SL3A 2G00A 1QTFA 4ZMAH 2WUCA 3Q76A 1O39A 1TRYA 3D49H 4AOQA 4AFZA 2XBXA 1GGDC 5T6DA 1GJCB 1ZR0A 3K65B 2FP7B 2BD7A 1BZXE 2SGAA 3F68H 2GDEH 2P3TB 4BAHB 4Q7XA 3QO6A 4Y0YE 1OPHB 4ZKNU 1CO7E 1IHSH 1YM0A 1TAWA 1EJAA 1L1JA 2P94A 1SGTA 2VWLA 4INHA 3BV9B 4TWWA 4E05H 3RLYH 3F9HA 2Q6GA 2GTBA 1PYTD 2TGTA 3TIUA 1D9IA 1YPHC 3ZZBA 1Z1JA 3T62A 1IQLA 3T29A 4AG2A 4B76A 2SGFE 1KXEA 1ACBE 2BDGA 2ZU2A 4ZHLU 1QQ4A 2ZHDA 1E0FD 1V2RT 1UTMA 1H9LB 3BG8A 1TNIA 3C27B 4A1TA 1O3MA 2XBYA 3MU4A 2QAAA 1V2LT 3QTOH 3SJ9A 4NCYA 1WBGB 1DM4B 3KQDA 3TJOA 4YM9A 3TJVA 1C1PA 1EPTB 1MKXH 1ZJKA 1GHWH 4I33A 1UK4A 3CS0A 2Z9IA 2VIDA 4KP0A 3ZYEA 1FAKH 2A2QH 1Q2WA 2BDBA 3URDA 8ESTE 5LPEA 3LU9B 4A1VA 3BF6H 1KSNA 2EI8A 1LTOA 3SI3H 2FOHA 1BTPA 4PROA 3DFJA 2XXLA 1W8BH 1K1IA 2FWWA 1C4V2 4ABDA 2NU1E 3HK3B 1ZTLA 4ISIH 3E90B 1NTPA 1GHAG 1NFUA 3MH5A 3STJA 2A4OA 1XUIA 1V2MT 2QGRA 5GCHG 1W3CA 2A5IA 1ELAA 2GZ7A 2ZPSA 3PMAB 5ESBA 2J38A 2P59A 1HBTH 5EPNA 4J2YB 3BN9A 4Y10E 1P05A 5T6FA 2R3YA 3SV7A 3ZZAA 1AFEH 2WPJS 2PHBA 4E7NA 2F9OA 1BTZA 4IC6A 5HM9A 1O2QA 2ZFSA 1HIAA 3A89A 1FN6A 1CGJE 2R2WU 4K1TA 5FX6A 4XDEA 1W13U 1T8OA 1A7SA 2XCNA 2BDCA 2VWMA 2B8OH 3P8OA 4IMZA 2BD2A 2WPHS 2ZKSA 1VZQH 1DWCH 3MH7A 4UONA 1MD8A 2F3CE 5JB8S 2ZA5A 2VIQA 4ZKRU 3RP2A 4FUDA 3VB4A 1VJAU 4DJZB 1AIXH 3FANA 2Y80A 2FPZA 5C1XA 1YLDA 1O33A 3UQOA 1XUFA 4IN1A 4DY7B 1A1RA 3RMMH 2F9PA 4WMDA 2PSXA 5C1YA 1BIOA 1HNEE 4B2BA 1ZSKA 3LGWA 2JETB 1HYLA 1SLUB 1C2FA 4K3JA 1QBNA 2WYGA 2Q6FA 1DY9A 1EAUA 1KLJH 1HPGA 4GSOA 3PB1E 2QV1A 3M35A 1BBRE 4MLFB 3SU3A 1C2JA 1QR3E 1FXYA 1GBHA 3K2UA 3UWIA 2PTCE 1EX3A 4FUHA 1RFNA 2BVSH 2Z9KA 1AVXA 2UWPA 1F5KU 3QX5H 1EPTC 2BXTH 1EAWA 2VIOA 4JMYA 2GP9B 1NN6A 1MZDA 1NU9A 1C2KA 3BTFE 1C5QA 1OWDA 3LC3A 2Q1JA 3RM0H 2DE8A 1ID5H 2F9UA 6GCHF 3A88A 4FUGA 4ESTE 3SQEE 1HFDA 1GI9B 2EC9H 3LJJA 4ABJA 1MH0A 1FN8A 1TBRH 2Y81A 3ATIA 1S83A 3EE0B 3TITA 2OBOA 3SJIA 4BAOB 2IN2A 4ISLA 1C1QA 3E16B 4LOYH 1OP8A 5FCKA 4X1QU 3KHVA 3JZ2B 1PPZA 4D76A 4K60A 1HAOH 2XRCA 1P3EA 4ZH8A 2HNTF 1PQ7A 2DE9A 1P06A 2LPRA 1QIXB 2PSYA 1C5OH 2A2XH 3BG4B 1C5UA 1OWEA 2D1JA 1TQ7B 2ZHFH 1ETTH 1E37B 1NRRH 2ZECA 3STIA 5F8TA 4XBDA 2F9NA 3UNQA 1BUIA 1IQJA 1NFYA 1BJUA 1V6DA 1UVTH 1NY22 3S7KB 1MTWA 1WQSA 4KKDA 1ETSH 2XCFA 3PMHB 1O2YA 3FFGA 3TGIE 3L3TA 1FNIA 1P2KA 1OWHA 2BYAX 4UDWH 1VR1H 3GY6A 3A86A 1Q3XA 4DIIH 3TH2H 4INKA 1LPGB 3BSQA 1P2JA 2BY5X 1GBKA 3AASA 3MOCA 3LONA 2YNAA 1GL0E 2ZCKP 4A92A 3VFEA 4B2AA 4NIYA 4DURA 4Y6DA 5EW2H 2WPLS 2VIPA 3PMJA 3PLBA 3MNXA 1O2SA 3QTVH 1O5FH 2ZZUH 3RC5A 4I8LA 1FY1A 3RXVA 5A8ZA 1W10U 2ZGJA 2VVCA 1ANBA 1QA7A 2HWLB 1G37A 5E2OA 4X1PU 3GY5A 1GI7B 1DXWA 4MPUA 3OSYA 2W26A 2A5AA 1UK2A 3RXMA 5F6MA 1QRZA 1BOQA 1ZHMA 1A3EH 1D6WA 1P10A 2RDLA 3ZVFA 1Y8TA 1BMNH 1OP2A 5L30H 1GI0A 3SJKA 2ZWLH 2BD4A 3A85A 4BAMB 2H9EH 4BOHA 1GCTB 1RTKA 3QWCH 5EW1H 1GJ8B 5CHAB 3PWBA 5LH8A 3LT3A 1VCQA 1AB9C 1QL7A 2OCVB 2OD3B 1GL1A 3ZZ5A 2V0BA 2Z3CA 2VGCC 1NFXA 3DFLA 4R0IA 2FOCA 4YT6H 4JK5A 1LQDB 2YOLA 1SGEE 3A87A 5LPFA 1Y59T 1MQ6A 2NU2E 3F6UH 1KIGH 2CV3A 2XBVA 3A82A 4D8NA 1YCPM 3SUEA 2SFAA 2FS9A 2UWOA 2QXHA 3P8GA 1BCUH 1GJ6A 1DDJA 2J4IA 2G55A 3IG6B 4X6PA 1EJNA 5C5NA 1Y3YA 2BDHA 3KN2A 1GMDF 2D8WA 1O3JA 1P02A 1RIWB 2ZDKA 3V13A 4M7GA 5GDSH 3KCGH 2OINA 5FCRA 2ZFPH 3OTJE 7GCHG 1LCYA 1JRSA 4ZHAA 1K1MA 2STBE 2R9PA 1YKTA 5HYOA 1D6RA 3SGAE 4CBOA 1HIAB 1E38B 2OQUA 3VXFH 1TPOA 1Y3WA 2GX4A 4ABAA 2OQ5A 1GHAF 1GG6C 2C8WB 1SLVB 1T32A 1YGCH 3P8FA 4Q2KA 2BD3A 4A1XA 3SV9A 2GCTB 1VGCC 1MU6B 1NM6A 2ILNA 1VCPA 1ESBA 5C1UA 2AMQA 5JB9S 3A84A 1N8OB 2PKAB 1P01A 4WH6A 4UE7H 1C5PA 1HJAC 2WPKS 1PPBH 4X2YA 3RXOA 3UNSA 4FU8A 2QXGA 3JZ1B 3M7QA 3LH1A 3KL6A 3PO1C 2THFB 4ZUHA 1QNJA 1GBEA 3UR6A 1F0RA 3OYPA 4MTBA 4I8GA 1UCYH 2G5NA 2G52A 1IQKA 1FAXA 2PUXB 3E91A 2PTNA 3NCLA 1PQ5A 2ZPRA 3UUZA 4YTAA 3ZZ6A 1MKWK 1SLWB 2J94A 2GVFA 3E8LA 2Z3DA 3M61U 3PV4A 5HMAA 2NU3E 1KLTA 8GCHF 1CGHA 1Z6JH 2ZCHP 1E34B 1ZPCA 3GCTF 4H6TA 1DWDH 3I78A 1C1RA 3DT0H 1K9OE 2ZU4A 4Q80A 5DKMA 3ZZCA 3A83A 1C2IA 1S5SA 1XKBC 1HLTH 1G32B 1ELCA 1K1OA 1GBIA 3V3MA 2BD9A 1LKBA 2Z9LA 2BXUH 2H1UA 1AI8H 1CA0C 1LDTT 1K21H 1UTJA 3BTME 4ABFA 1MTUA 4CRFA 3URCA 1GDQA 2OC8A 2CHAB 1T4VH 3E6PH 1NRSH 3IITA 1F0UA 1PJPA 4X6NA 1ESTA 5C2ZA 3P17H 4K69A 5EXLA 1J8AA 2NU4E 1C5NH 1WCZA 5EU8A 4TY6A 2OP9A 4TPYA 3V12A 3KF2A 3MI4A 2OXSA 1UVPA 3BTTE 4AN7A 1FZZA 2UWLA 4BANB 5JBBS 1TIOA 1HV7A 1O5EH 1OS8A 1SFQB 4ISNA 1O3IA 2SNVA 5FX5A 4BXWA 3SU4A 3U8OH 3C1KA 3GDSA 4JZEH 4XSKU 3M5NA 2AERH 4K8YA 3UPEA 3MNSA 5EXMA 1LPZB 1BQYA 1TQ0B 2BQWB 1Z8GA 1TOMH 1C5WB 3EDXB 1OYQA 2FTMA 1XKAC 2FOMB 5DP4A 1EZQA 2SGEE 5FBEA 1BA8B 4NIXA 1GPZA 4HTCH 1DXPA 5JYIA 1O35A 1AO5A 3SV2H 3CP7