3TJVA

Crystal structure of human granzyme h with a peptidyl substrate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
225
structure length
225
Chain Sequence
IIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNNIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Granzyme H
publication title Structural insights into the substrate specificity of human granzyme H: the functional roles of a novel RKR motif
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 225
sequence length 225
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tjvA02
5JDUB 1UVSH 2CJIA 4ZKOU 1IQKA 3ZVAA 4NIVA 1TB6H 3SU3A 1WQVH 1Y5AT 1SSXA 4U2WA 3UY9A 2ZIQH 1HAOH 1BB0B 2A2XH 2Z94A 1W3CA 1MBQA 3F9FA 4H42U 4UE7H 1BMAA 3GCOA 5E0JA 2O8TA 3E16B 1SHYA 5PTPA 1G36A 1O2TA 5EQQA 3SQHE 3SNDA 1D3QB 4WVPE 1EPTC 1C5WB 2IJOB 5C20A 4B2BA 3GDVA 4K1TA 3UNSA 4BXSA 1Q2WA 1C4Y2 3UPEA 1SGCA 3SNBA 1C2GA 2UWOA 4RN6A 1ELEE 1GBDA 4Y0ZE 2R9PA 3RM0H 1JIRA 1SLWB 3DA9B 3M5MA 4CRDA 1O2UA 1WAYB 1Z7KA 2YNBA 2FTMA 1PQ8A 1QJ7B 3Q77A 4BXWA 3SJKA 1TNJA 3RXIA 2Y5GA 4AYYB 3TGIE 2JKHA 2AYWA 1NM6A 1O2NA 1UJ1A 5EW2H 2CF8H 3SV9A 2WUBA 1MMJN 3C1KA 1TRMA 4FUFA 4Y8XA 1TFXA 3F1SB 1OYQA 2HNTE 3E6PH 1P01A 1U6QA 2BLQA 4ZXXH 1KLIH 1RFNA 2BVRH 1ZHPA 3GICB 3KQDA 4I8KA 5ESBA 1NESE 1O3KA 1P2QA 1DXWA 4D9RA 1LHEH 8KME2 1GCDA 1GDQA 3RXLA 1Z1IA 3SV8A 2G8TA 3MNSA 2W26A 3FZDA 3STJA 2BY8X 3KGPA 3TVJB 3DHKH 4NIYA 3SJ8A 1J8AA 3W95A 1IQGA 2BD7A 1S84A 2BMGB 3U8TH 4BAMB 1TNHA 2OBQA 2GCHG 4FU9A 3S9CA 3BIUH 1QIXB 3SGBE 1C5NH 1N6YA 2A2QH 2FOMB 3PTNA 3VGCB 3SI3H 2G81E 1THPB 5FX5A 3ODFA 3LH1A 1CBWB 1GMDF 1MTUA 2PW8H 4CRGA 1AZ8A 4WWYA 3RXMA 2J38A 5EPNA 5GWZA 4WMDA 2Q1JA 5A09A 2Q6GA 2OINA 1HAYB 1P02A 1V2WT 1ZPCA 3PM3A 1J16A 2VB0A 1H9HE 1ELGA 3M37A 1P2KA 1O2PA 4ABJA 1KIGH 4GAWA 2UUFB 1HAXB 2ZU3A 2I6QA 3WY8A 4DIHH 1C1VH 4WJG2 1FZZA 1KTSB 3ZZBA 1AE5A 2ZU2A 4I8LA 1W0ZU 1SC8U 3RXQA 3BIVH 3AAUA 1UVPA 2BVXH 3T2NA 4CRAA 6CHAC 1EB1H 3U69H 1BRCE 4MPWA 1B0EA 2FOEA 1A3BH 1W11U 1UVOA 4OS1A 1BTXA 3PTBA 5EXMA 5T6GA 1CHOG 2FTLE 5F8ZA 1BMMH 1G3BA 5EU8A 3U8RH 1GHAF 2BD3A 4X2VA 3A87A 2ODPA 1QR3E 1ARBA 4VGCC 1A0HB 2BQ7B 4UFEH 1P11E 2BZAA 1SPJA 4LZ1H 3EA8A 5JBAS 3ZZ3A 2P8OC 1OWHA 3UNQA 1FIZA 1EPTB 1QQUA 1GBLA 2PUXB 4Y7AA 2FX6A 5TJXA 5C2ZA 1HIAA 3IG6B 4KELA 4B2AA 1K22H 1OP0A 1A2CH 3PO1C 1GL0E 1P2JA 4UD9H 3P17H 2J2UA 1FMGA 3QX5H 4FUDA 1GHWH 1S5SA 1VITG 1YPEH 5AF9H 4JZDH 3MNBA 1AD8H 1FY8E 3TH3H 3BG4C 1S6FA 2WYJA 2FOAA 4R8TB 1SGPE 1GI5A 5ABWA 2CF9H 1FDPA 3FZZA 2XBVA 1AVWA 1GBFA 1QL9A 2ZTXA 3SU6A 3W94A 2V0BA 4KTSA 1ZJKA 3M5OA 1ZZZA 1EAUA 5FPSA 4OGYA 3ZYDA 4GVUA 2A45B 2SGDE 4CRBA 4K2YA 2GT7A 3PLPA 3RXGA 4D7FA 1ANBA 4X2WA 1DWEH 1A46H 4MPXA 3T28A 5DP5A 3GY6A 1G2LA 1LPKB 1NZQH 1HAVA 3DUXH 3GY8A 2H1UA 1Z8JB 2ULLA 4X2XA 3URCA 1SR5C 3NXPA 4F4OC 2GV7A 1BTUA 3VFEA 3ZVDA 5CHAC 4IBLH 3U9AH 1TQ0B 4AFUA 4X0WU 1P9SA 1TMUH 3NPSA 1E0FD 1V2NT 1AWHB 1AB9C 4IN2A 4ZHAA 1BTZA 1C1OA 4ABIA 1T4UH 3TH2H 3K2UA 4I8GA 1HBTH 1O0DH 2VWOA 3KF2A 1TPOA 2Y81A 3GCTF 4J1YA 4NZQA 1EQ9A 2AERH 1W14U 4JZ1A 1KXEA 1YCPM 1P2MA 1K1IA 3TJVA 1AUTC 1NTPA 3TGKE 3MU5A 1NRNH 1P9UA 1FPHH 3QGJA 1VGCB 3URDA 1IOEA 3TK9A 2EC9H 1FJSA 2H9TH 2IN2A 3BTEE 1O2SA 3F6UH 1E37B 3FFGA 4WXVA 1D3DB 4K8BA 2OUAA 1HDTH 1HJ9A 1DUAA 2SGEE 1OPHB 5F03A 4K69A 1F7ZA 2P94A 1OWJA 3GY3A 2R2WU 1O2WA 2O9QA 1LMWB 2FOFA 4DJZB 4O9VA 2F9BH 2UWLA 1BBRE 3MU0A 2GZ8A 1AMHA 3M7UA 1DS2E 3FANA 4ZKSU 3R3GB 1EZQA 1LQEA 4CREA 3S7KB 2VIVA 3CS7A 3GYLB 3UUZA 1MD8A 1V2RT 3BV9B 1O2OA 3U1IB 4YO9A 5CMXH 2Z9GA 3MFJA 2GVFA 2PV9B 3LDXH 1GJ5H 1O37A 3O8RA 1AO5A 3QZQA 2JETC 4X6OA 1E38B 1O3IA 2BD4A 3UWIA 2C3SA 2BXUH 1KXAA 4U01A 4AGKA 2P16A 3KQEA 1NPMA 4B71A 5C5NA 1N6XA 3PO1B 2ZTZA 1GWAA 3NUMA 5DGJA 3AAVA 1A1RA 2D8WA 3P6ZB 3TGJE 3CS0A 3UQVA 3VEQB 1GHVH 4GPGA 2ZP0H 1AFEH 1CA8B 2BTCE 2BDYA 3SU4A 3SV2H 2WINI 2WPKS 1NU9A 4XOJA 4JK5A 1MAYA 2FEQH 1RS0A 4YOIA 3UNRA 1AI8H 4ISHH 1UTQA 2PGBB 4WMFA 1PPEE 3VXFH 3DFJA 1FONA 1SLVB 2CXVA 1TRYA 3A8CA 1V6DA 1T4VH 1A3EH 5E2PA 1TRNA 4Q7ZA 5FAHA 1Z6JH 3GDUA 4O3TA 3LGWA 1V2TT 4ISOA 3QUMP 1BJUA 2FOBA 5AFZH 1C5TA 4MNVA 4NIXA 1OWKA 1GMCG 1J14A 3JZ2B 3Q76A 4INHA 3DT0H 4CR9A 1LKAA 4X8VH 2V3HH 3V12A 3A89A 2ZFRH 3HK6B 2BDGA 4OS7A 1XUIA 1GBAA 1W2KH 3MO9A 1C5SA 1DY8A 5A0CA 3SOSA 1CT4E 1LVYA 2JH0D 2TPIZ 3BG8A 1D6WA 3P92A 3MH6A 3RXKA 5C1XA 3A81A 4DT7B 2AGIX 1VJ9U 1MKXK 5HM2A 1YPJH 1DY9A 2H6MA 3U8OH 1MBMA 2BLVA 3KIDU 6LPRA 4MLFB 1O5CB 2BY7X 2ZZUH 3MO6A 4U32A 4B1TA 4TPIZ 2AGGX 3S7HB 5IYTA 2XBWA 1HRTH 1BOQA 1O3PB 2ZC9H 4IS5A 1ZGVA 4TYDA 4FUJA 3RU4E 1RIWB 2ZDVH 1DUEA 1CT0E 2PKAA 2IPHA 1W7GH 4ABGA 2SFAA 1GDUA 2ZU5A 1QCPA 2FZZA 1VCPA 2F91A 3LOXA 2WUCA 1TMTH 1P0SH 2Y5HA 1DLEA 1TBRH 1UCYK 3I29A 3EA7A 1GVKB 1AFQB 3HKJB 2JETB 2K1QA 3SUEA 2F3CE 2QC2A 2A5AA 5A0AE 3FAOA 1NRPH 2YNAA 1FIWA 1HAIH 1MCVA 1C1NA 3D62A 3ATKA 1TX6A 3A7WA 1SL3A 3MU8A 1Y3WA 1V2ST 3ITIA 2UUYA 4ISLA 1O2QA 3UR9A 1V2VT 1G9IE 1QRWA 1G2MA 2PSXA 4NWLA 3ATMA 1C1UH 3SUDA 3SORA 4WH8A 1BRAA 2WPIS 3ZZ8A 1TX7A 1GI0A 1X7AC 3A8AA 4KTCA 4Y11E 2ZTYA 3P8GA 2D2DA 1O3HA 1EAWA 3AW0A 1YLDA 3RXCA 2BM2A 4YESB 2A4RA 1V2UT 3RU4T 1TMBH 1EX3A 5L6NH 1T8LA 3TK6A 4ZKNU 1FNIA 4AZ2B 2G4UA 2BHGA 2OCVB 2GMTC 3A7TA 2ZPSA 1UO6A 2RDLA 4HFPB 1Y3YA 1Z8GA 4BTIB 1O2LA 1O2XA 5EW1H 2B5TB 2SGAA 4JYUH 1ACBE 2OC7A 3L3TA 3QZRA 1EJMA 1H8IH 2ZDKA 1CU1A 1A5IA 3E3TA 3BTME 3LU9B 1YPKH 3VXEH 4YT7H 1FY5A 1ZYOA 4R0IA 1LPZB 7GCHG 2PGQB 2H2ZA 3SU0A 3M35A 3VGCC 2BQ6B 1IQLA 1THSH 2FIRH 3P70B 2BVSH 5LPRA 3RXJA 2A31A 1CBWC 2A4GA 1J15A 1BUIA 4QT8C 5C67A 3MNCA 2QV1A 3KCGH 2O8MA 3OY6U 2RCEA 1SFIA 1YPHC 2G55A 1XXFA 2FM2A 3ESTA 2SGPE 2A1DB 1CHGA 1SMFE 1YGCH 2R2MB 1KXCA 1DM4B 5A8YA 1GMHG 3P8FA 4LZ4B 1TNIA 1GI1A 4IN1A 4ABDA 3SI4H 4XBDA 2BY9X 1O3AA 2Y80A 1SFQB 4IC6A 5LPFA 3RXTA 1O5GH 4H4FA 1MH0A 2GV6A 1LHFH 3AVZA 4TWWA 5TCCA 2QN5T 4ZHMU 3RXAA 1GDNA 1QGFA 3B8JA 1TBZH 1EZXC 3S9BA 2BB4A 2F9UA 2QAAA 3FVFB 1C4V2 2HPQH 3BEUA 3PV4A 1XKBC 4A1XA 1T8OA 2XXLA 2J4IA 1QL8A 2H5DA 5DKMA 2RA0A 3HGNA 2AIQA 1Y59T 1L1NA 3OY5U 4PROA 2FOHA 3ZVGA 2PHBA 2SGFE 3PROA 4MNXA 1P8VC 2FX4A 2G5NA 2XYAA 5C3NA 1GBTA 2YOLA 4ZKRU 4MNWA 4XBBA 1C4U2 1O2KA 3SHAH 4TPYA 4ASHA 2VIQA 4NG9H 4I31A 1HJAB 5T6FA 1ETTH 2TGDA 3RDZA 3STIA 1JXPA 2FOGA 3LGYA 3K65B 4UDWH 1OKXA 2STAE 3V0XA 1BBRK 1V2MT 1O31A 2D1JA 4O3UA 2IOTA 1GHZA 2ESTE 1P05A 1Y3VA 1YLCA 2G00A 5F6MA 2PWXA 4I33A 1AU8A 3IITA 1HJ8A 1JWTA 4DW2U 3BTTE 4XDEA 3BEFB 5A0BA 1GBCA 3Q3KA 2GMTB 4I8HA 5EGMA 4DVAU 2H9EH 1P3EA 5E2OA 3D49H 3EAJA 3MYWA 1QTFA 1V2OT 1C5UA 4AFSA 5GXPA 1ARCA 1UCYH 1OWEA 1ELDE 4Y10E 5DK1A 3ZZDA 3PWBA 1F0UA 1TBQH 1DWCH 2ZEBA 2ILNA 1FV9A 1FXYA 5AHGH 1F5LA 1KXDA 3RXBA 3ZZ6A 2XBXA 1H9LB 2UUKB 4X8UH 1OOKB 5GCHG 1TNGA 1F0RA 4Y71A 2ANWA 1ID5H 2BXTH 2P93A 1MQ6A 4GSOA 2ZCHP 4AYVB 2ZF0H 1OYTH 3TJOA 4AG1A 4AX9H 5HXFA 2GZ7A 1GJ4H 1O33A 2Z9JA 1CVWH 2RA3A 3L33A 5EQRA 5DPAA 2AH4X 3PMBB 1GJBB 1C5VA 1Z8RA 3UQOA 1Y3XA 1IQFA 2G5VA 2KAIA 1VGCC 4YOGA 2GKVE 1NRRH 2ZQ1A 4A1VA 5J4QA 3SGQE 3TLOA 3PMJA 3R0FA 1L0ZA 1UK4A 1IQNA 1RRKA 2H9HA 3T5FH 1G30B 3E91A 3MH4A 1NU7B 2ZFTA 1MZDA 1TPSA 2Z3CA 5FPYA 2P3UB 2FXRA 1YCPH 5GJ4B 2P59A 1C9TA 4BAHB 2BX3A 1C9PA 1C5LH 2FYQA 2AS9A 1WCZA 2ZHEH 4XE4A 2ZI2H 2VIPA 1NRQH 2FODA 3GISB 5DP7A 5G4BA 2VVVA 2H5CA 1S85A 1GBBA 1NFXA 1YPMH 2ZQ2A 2WPMS 4Z6AH 2VVUA 4AGJA 1H9IE 1VITH 1XM1A 1LHGH 3RXHA 2A4OA 4OS6A 1O2YA 1MZAA 2AMQA 1BMLA 3EQ0H 1C2FA 4INKA 2V6NA 1JIMA 4FUCA 2ZPRA 1HGTH 1KYNA 1HIAB 1SGTA 5A2MH 4BAKB 4ESTE 2DE8A 1C5MD 2NU1E 1QA7A 4DURA 3RXPA 3A82A 4X6PA 4BANB 2SNVA 1OX1A 1C1WH 1ESBA 1SGNE 2OBOA 1PJPA 1CSOE 1SQOA 2R0KA 2VJ1A 5DJ7A 3A85A 2ANKH 2OTVA 1TQ7B 2VH6A 2XWAA 1NN6A 1BT7A 1TAWA 4FUGA 1C5QA 1GPZA 1ZR0A 2A32A 3BSQA 3F68H 1C1SA 2G52A 2GGVB 3LKWA 1A61H 1QL7A 4AFQA 2Z9LA 2GD4B 1L1JA 3VB6A 4B2CA 5EOKA 2VH0A 5EQSA 3LPRA 3B23B 4MVNA 1HUTH 1UTLM 1WOFA 1HAVB 5I25A 1K2I1 4ZUHA 3AASA 1T32A 2QCYA 2AIPA 6GCHG 3QO6A 3UREA 1XUHA 2QXGA 4OS4A 3ZZAA 1B7XB 1NROH 1MQ5A 2ZHFH 1HAGE 3ATLA 3GOVB 3ZVEA 1UTOA 1DSUA 2ZGCA 3ZVCA 4X8SH 1FPCH 1TGBA 3TH4H 2HOBA 1E35B 2SNWA 1EASA 1V2QT 8GCHF 1NFWA 2HLCA 2BDCA 1GBHA 1P06A 1DSTA 1GJCB 2W7UA 1ZPZA 1TWXB 4IW4E 3V7TA 4WF8A 1CA0B 1SGFA 3SW2B 1L4ZA 3M3VA 2XC4A 4XFQA 1P04A 1HYLA 1O34A 3RXFA 1ZMNA 1RIWC 4ZXYH 4I8JA 3FP6E 1D3TB 1FLEE 3HPTB 1IAUA 1C2LA 4GUXA 1C2JA 3U98H 1N1LA 3KQBA 4O03A 4TWYA 1WTGH 1WTHD 1ELVA 2AGEX 3DD2H 1A4WH 3BTDE 1BTHH 4D8NA 1MD7A 2STBE 1SHHB 1TA2A 1O3MA 1BIOA 3V13A 1XMNB 1EB2A 2J95A 3A84A 1AFQC 2ZCLP 3SO3A 1WSSH 2SGQE 1F0SA 3NWUA 1C2EA 2BLWA 4K60A 2C93B 2QYIA 3BN9A 1O3OA 3ZZCA 1BMNH 1CT2E 1SOZA 2C8YB 2W3IA 3BTQE 3O8BA 3OYPA 4BOHA 2ZHDA 4ZMAH 1MAXA 1BQYA 4MPUA 3B9FH 1UTPA 1THRH 1SLUB 4CHAB 4IC5A 2TRMA 1YBWA 7GCHF 4JZIA 3HATH 3SHCH 3SV6A 1OSSA 1QJ6B 4UEHH 3TITA 5E0GA 4DGJA 2QXJA 2ZFPH 1A7SA 4GLYA 1C2MA 3H7TA 5JBTA 4UFDH 1W10U 3RMOH 2NU3E 4BTUB 1FY3A 1KLJH 1P10A 3PMHB 4H6TA 1S0RA 1RTLA 2Y7ZA 4X2YA 3RU4D 1GI4A 1NY22 1C1RA 2PKSB 4E7NA 2ALPA 3PMAB 1Q31A 1H1BA 1GJ9B 2P3TB 4UONA 5L30H 2VIWA 4OS5A 4A1TA 5DP9A 4MQAA 3NCLA 5EODA 2UUJB 3Q3XA 1O5DH 2WYGA 2OQ5A 1UK3A 1SBWA 3M3SA 1IQHA 1TONA 3T26A 3SJ9A 2BZ6H 5AFYH 2CGAA 4AG2A 2B8OH 1C5ZB 1FQ3A 1SGQE 1UK2A 1P2IA 2FS8A 2ZA5A 1CO7E 1GJ6A 4YOJA 5DP8A 3GY7A 3M7QA 5A8XA 1CQQA 1BA8B 1GJ8B 1YM0A 7ESTE 2BDHA 1DICA 2PFEA 1TOMH 5TCAA 2HVXA 1GG6C 1S82A 1LPGB 3KL6A 1H4WA 1AHTH 2Y7XA 2OC0A 2W5EA 1O3FA 1NO9H 1VR1H 1UVTH 2AMPA 2WV5A 3MO3A 4D76A 4DG4A 1F0TA 1W12U 3GDSA 2F9VA 2ZO3H 4X1QU 1EP6A 3PYHA 1G3EA 3NKKA 3MHWU 5LGOA 1PQ7A 1XVMA 1FN8A 3MNXA 4J2YB 1HAPH 2PKAB 3MU4A 2Z3EA 5ESTE 2ANMH 3ZV9A 4CH2B 3TNSA 2A7CA 2ZGXH 3O8DA 2V35A 4NA7A 4AB8A 2CHAC 3TU7H 1P57B 3RM2H 3S9AA 3ZYEA 1TGNA 2ZU1A 5T6DA 5E8EH 3RXSA 2QXHA 3K6ZA 1MUEB 1O2RA 4DY7B 1EAIA 5IDKA 3RMLH 1CGJE 2GX4A 4A6LA 3LJJA 1GCTB 1HXFH 3U1JB 1RD3B 1HJAC 3SZNA 5K7RA 1ZJDA 2PUQH 1CGHA 1E36B 3GYMA 1XXDA 2Z9KA 2NU4E 3SN8A 4E06H 5BPEA 2GCHF 1S81A 4CR5A 1A5GH 1DDJA 1C5OH 1AKSA 1V2LT 1DE7H 1OS8A 1EJNA 4K5ZA 5GCHF 3LGVA 1UVUH 1HCGA 1O30A 4FVDA 1M9UA 2VWNA 3CENA 1LCYA 2ZFFH 2ZKSA 2TGAA 2C8XB 1TALA 4D7GA 4KTUA 1QNJA 2GT8A 1Y5UT 1AY6H 4KP0A 1BHXB 4ABEA 1SG8B 1FY1A 4GHTA 3H5CB 3VB7A 3GCNA 1PPZA 2JH5D 4CBNA 4ZROA 4X1RU 2Q6FA 4ZHLU 2ZFSA 2XTTB 1O2HA 1ANDA 3PLKA 3QK1A 4CRCA 2J9NA 1XUKA 3EGKH 4YLQH 2FP7B 1KTTB 4MNYA 1PPHE 1ORFA 1JMOH 2Y5FA 4BTTB 3ZV8A 4AORA 1V3XA 1UHBB 3UTUH 1UHBA 2QGRA 3ENSB 4XSKU 4I32A 1PYTD 1AVGH 1YKTA 1YP9A 1FY4A 3LONA 3NZIA 1CHOF 2GCTB 1DPOA 4YLUA 2ZDNA 4GCHG 3E1XB 2ZDMA 3RXDA 2FMJA 1V2PT 1L1GA 1V2KT 1DANH 4NFEA 4X8TH 1Z6EA 2BDIA 2PTCE 2LPRA 4JZFH 2F83A 1G3DA 1WU1A 4OS2A 4CBOA 1SQTA 3NK8A 1L4DA 2OD3B 1GG6B 2ZHQH 5DP6A 3BTWE 2ZECA 1D6RA 1O5EH 1O32A 1D9IA 1DFPA 2BQWB 1EZSC 1GHBG 1QFKH 3KN2A 4B76A 3A7XA 3UWJH 1LO6A 1LVMA 1GI9B 4XBCA 1QA0A 2QXIA 1TGTA 1WUNH 3HKIB 4DCDA 1ZMJA 1VITF 1BZXE 1EKBB 3DFLA 8ESTE 4OGXA 2BD2A 3QTVH 1P3CA 1Y8TA 2QY0B 5EXLA 1LVBA 2TGPZ 2BX4A 1BITA 3LGIA 4Y8YA 2VWLA 4F49A 2HWLB 3VB3A 1AE8H 5JYIA 4JK6A 4Y8ZA 3LGUA 1SGYE 1SI5H 2CHAB 2VU8E 3OU0A 3AW1A 1PPFE 1QURH 4U30A 5HMAA 4RKJB 1CE5A 3IWMA 1AIXH 5AVDA 3KNXA 1T8NA 4JYVH 1UMAH 3UFAA 3P95A 5EXNA 5FXLA 4IMZA 2VVCA 3F9GA 2QA9E 4AOQA 2NU2E 6GCHF 3E90B 1GI8B 3RC5A 1O3LA 1FN6A 1MKXH 4RSPA 3LC3A 2P3FH 4BAOB 2FOCA 3T25A 2A0QB 2FESH 2QF3A 2ZFQH 2BDBA 1ZOMA 4KKDA 1VCQA 4H6SB 4FVBA 1GHXH 4MPVA 4AN7A 4THNH 5B6OA 1IQJA 1DWBH 1T31A 5DO4H 2XWBI 1TLDA 4JYTA 2A4QA 3FP8E 3RLYH 2ZPQA 2R3YA 3TNTA 9ESTA 1XUGA 2A7HA 1C2KA 2FO9A 2J94A 3PB1E 2F9PA 3ATIA 4X1SU 2ZWLH 4UFGH 1ESTA 1ZTJA 2Z3DA 1L2EA 4AB9A 2J92A 3SQEE 5LPEA 3QWCH 3BTFE 3TJUA 2VGCB 1N8OB 3T62A 5DG6A 2XC5A 2R0LA 3QLPH 1ZSLA 2O8UA 1GBIA 1MCTA 1GI2A 4FXGH 2VNTA 3RMNH 4D9QA 1T7CA 1EAXA 2QIQA 5EPYA 2FI3E 1ABIH 2BDAA 1QBNA 3ATWA 2AFQB 1Q3XA 3MH7A 3E0NB 2EI8A 3I77A 2BYAX 3GY2A 2GTBA 4Q2KA 1F5KU 3HGPA 3GY4A 1QB1A 2O8LA 5FBEA 1KLTA 2XCNA 3OX7U 1CGIE 2KAIB 2XNIA 2F9OA 1DX5M 1K1NA 2Q6DA 5L2YH 1ZGIA 1V2JT 1OWIA 3TIUA 2R3UA 1EOJA 3RXVA 1DVAH 1P2OA 4ZAEA 1AWFH 2FDAA 1HAHH 1MTNB 5F8TA 1MU6B 3LC5A 1CA0C 2BLOA 3M5LA 1VJAU 3SUFA 4X6MA 1SVPA 5LH8A 3ZVBA 4SGAE 3RXOA 2F9NA 1MTVA 2P95A 2Z6BD 4Y0YE 2JH6D 3GCHC 4Q80A 4LOYH 4ISNA 4WH6A 3KEEA 2ZU4A 3L6PA 1UCYE 2LNCA 2THFB 5JPMH 4M7GA 1K9OE 1QJ1B 2Z9IA 4YM9A 3F9EA 2A5IA 1JBUH 4INLA 4Z0KA 1QBOA 1TPPA 1W13U 2DUCA 4DIIH 2BOKA 2OQUA 4K3JA 1HLTH 3K9XB 4NWKA 1ANCA 1EJAA 1ANEA 1NRSH 2ZCKP 1SB1H 1O2GH 5HYOA 2D26C 3A86A 3KHVA 2WPHS 2FLBH 5JBCS 2VINA 3FP7E 1TNKA 3VPKA 1ELCA 4CHAC 3ELAH 1EZUC 1GMCF 4HI3A 1Y3UA 2FI5E 1XX9A 1FAXA 1E34B 2CN0H 1EPTA 2W7SA 1NFYA 1AGJA 1GJAB 1T8MA 2AMDA 4LXBH 2HGTH 1Y5BT 1TPAE 3I78A 3RXUA 3O8CA 1GI7B 1SQAA 5I46H 3S0NA 3M36A 1HNEE 1C5PA 3LIWA 1AUJA 3MOCA 5DP4A 1O5AB 1K1MA 8LPRA 1UTNA 3BTKE 2NU0E 2PKSC 3V3MA 4HZHA 2TIOA 3ZVFA 1K28D 1XVOA 1SGIB 2G4TA 3MU1A 4GHQA 3D65E 3PLBA 1P2NA 1GVZA 1GBKA 1MTWA 1PPBH 2EA3A 2XW9A 1O35A 3OSYA 4Y7BA 1RJXB 5HM9A 1LHDH 2PLXA 2J34A 1F5RA 2ZHWH 3D23A 3SU2A 1WV7H 1OWDA 3S69A 1BRUP 3BTHE 5C1UA 1TOCB 1O38A 1KXBA 5EG4A 4IMQA 2CV3A 1PQ5A 4NSYA 3SU5A 2W3KA 1ZSKA 1ZTLA 2FLRH 1HV7A 1JOUB 1HAZB 1SLXB 1GJ7B 2ZGBH 4NIWA 5GIBA 5C5OA 2WV4A 1BBRH 3SUGA 1RXPA 4JCNA 1TGSZ 2XRCA 2FPZA 1JRSA 1GI3A 1WQSA 1DXPA 1MTSA 3M3TA 1RGQA 3UIRA 1J9CH 3G01A 3ZZ5A 1B5GH 1JRTA 1K1OA 4A92A 2ASUB 1PYTC 3A8DA 1BTWA 3QDZB 1QHRB 3SJOA 2XC0A 3QTOH 5FX6A 2XCFA 1TA6A 5FHTA 3RC4A 2O8WA 3MH5A 2FWWA 2FI4E 5JB9S 3GCHB 1IQIA 2RG3A 2I6SA 3A8BA 3TJNA 3QGNB 1YYY1 1O3EA 4DOQA 1WBGB 4LK4A 1GVLA 3KQCA 1GBMA 1VZQH 2ZNKH 3RLWH 3K6YA 1NC6A 1C5RA 4CH8B 5J4SA 5K0HA 4X1NU 2BY6X 3PWCA 3E8LA 6CHAB 1AN1E 1QRZA 2GDEH 3SBKA 1W7XH 1ESAA 4UFFH 3ZZ4A 3RUOA 2HNTC 4ABFA 2A5KA 2OP9A 3M61U 1PPGE 1GCTC 1ETSH 2TGTA 1O2VA 4I7YH 1GMDG 3MWIU 4JMYA 1KXFA 1GJDB 1D3PB 4NSVA 1EOLA 1GL1A 1YPHE 2GZ9A 1NT1A 2WPLS 1TE0A 4BAQB 1QB6A 1YPGH 1UTMA 4VGCB 4WY3A 2GP9B 1EXFA 1O3NA 1BRBE 3BTGE 1QBVH 5JB8S 2ALVA 1QB9A 4A5TS 2P8OB 5F8XA 2ANYA 3M5NA 2PSYA 4NGAH 1OP8A 3A7YA 4YT6H 1C5XB 2FYRA 1B0FA 2C8WB 1P03A 1C1QA 1INCA 4Y76A 4NA8A 3RC6A 4A7IB 2B9LA 4MDSA 1DITH 1MKWK 3LJOA 1G37A 4GCHF 2ZGHA 5GPIB 1ZRBA 3SNCA 5A8ZA 9LPRA 4NA9H 1F2SE 1K1LA 3H7OA 3BG4B 4FUEA 1O3DA 1YF4A 5SGAE 1KY9A 3VB5A 2HPPH 2B0FA 2BD9A 1GMHF 5JBBS 4E05H 2ODQA 3SU1A 1PPCE 1GHAG 5GDSH 2ZGJA 2XBYA 4IGDA 5CE1A 2OC8A 3GY5A 3UOPA 4ABBA 3MI4A 3ZZ9A 1BDAA 1GHBF 3SNAA 1XUJA 1LQDB 3MMGA 5ETXA 1C5YB 1GGDC 1O3JA 2UWPA 1QRXA 4KGAA 1KSNA 1ZHRA 2C90B 4FU7A 6ESTA 2C8ZB 4NZLA 4K1EA 1AVXA 2GCTC 3P8NA 3A83A 4TY6A 2TBSA 1C2DA 1Z8IB 1EP5A 2ZG0H 4RKOB 1AZZA 1GBEA 1ZHMA 1O5BB 5L2ZH 1LDTT 2VIDA 4ABHA 2GDDA 5CHAB 2HRVA 2M5TA 1ELFA 5C1YA 5FBIA 2BD8A 2CMYA 1AB9B 2Y82A 4X6NA 2G51A 1FI8A 3VB4A 2DE9A 5FPTA 2VWMA 3SJIA 1SGRE 1K1PA 1G32B 1NS3A 5DP3A 3EA9A 1G3CA 4WXIA 1DT2A 4HGCA 1W0YH 1O3GA 3A7VA 3QN7A 1ELAA 1MU8B 4Y79A 3RXRA 4YTAA 1BJVA 2Y6TA 1BTYA 1UTKA 4K1SA 4AFZA 1FUJA 1QQ4A 1S83A 1TIOA 1TABE 1H8DH 1BTPA 1BCUH 1O2ZA 1D4PB 1DOJA 2HNTF 1GI6A 4B73A 4NCYA 1NFUA 1SOTA 1TGCA 2EEKA 3F9HA 2EI7A 7LPRA 1PQAA 2VIOA 1ABJH 1SGFG 2PTNA 1IHTH 1ZSJA 1ZPBA 1F92A 3LT3A 1YC0A 3P8OA 3OTJE 2OLGA 1S6HA 1ELTA 4ABAA 1O2MA 3GCTG 5FCRA 4YZUA 1FAKH 1LHCH 1LVOA 4ISIH 5BRRE 3RP2A 1OXGA 1O5FH 4K8YA 2BY5X 8GCHG 1LKBA 1PFXC 1RTFB 1ZTKA 1SGDE 3A80A 2C4FH 1RTKA 3SGAE 1AKSB 3JZ1B 5H4IB 2ZDLA 1ELBA 5E0HA 1TYNA 1OP2A 2OXSA 2A7JA 3N7OA 4E7RG 1YPLH 7KMEH 3SNEA 4ZH8A 1BHXF 3UR6A 3T27A 2QF0A 1O39A 1A0LA 1TNLA 4FU8A 1HXEH 3BEIB 4SGBE 3EYDA 4B74A 1P12E 1C1MA 1GHYH 1K1JA 1C1PA 1TX8A 1HFDA 4HTCH 2ZDAH 1WYKA 4TY7A 1GBJA 2FS9A 4FUBA 2VGCC 1C1TA 2AEIH 1EUFA 1HPGA 1IQEA 1J17T 1N8OC 1O3CA 3A7ZA 2V3OH 4WMEA 4MG3A 1GGDB 1O2IA 3C27B 3TPIZ 3A88A 1Z1JA 1P09A 1YCPK 2EI6A 1EATA 1O2JA 4FUIA 1SGEE 3CP7A 4Q7YA 4JZEH 1DLKB 3T29A 3EDXB 1QY6A 1W8BH 3HK3B 3LGTA 4X1PU 1ZLRA 1O36A 4O97A 1O3BA 2NWNA 4NFFA 1XKAC 5T3HA 1C2IA 4CRFA 1MKWH 1KDQB 3ODDA 3SV7A 2ODYB 1A5HA 1MTNC 1ZMLA 1ZRKA 3RXEA 1A0JA 1KDQA 4Q7XA 1Z71A 1DWDH 3LH3A 4MTBA 4BNRA 1S0QA 2WPJS 4Y6DA 4FUHA 1LTOA 3RMMH 1IQMA 3E0PB 2B7DH 1K21H 1HB0B 3MTYA 2PR3A 1UTJA 3Q00A 3ZZ7A 2BD5A 1AQ7A 1VCWA 3BF6H 5HGGA 2HALA 1C2HA 2BOHB 4B75A 1XUFA 1IHSH 3TK5A 3UOUA 2Z7FE 5FCKA 1ETRH 3EE0B 3Q3YA 2OC1A 3M7TA
chains in the Genus database with same CATH superfamily
5JDUB 1UVSH 2CJIA 4ZKOU 1IQKA 3ZVAA 4NIVA 1TB6H 5HIZA 3SU3A 1WQVH 1Y5AT 1SSXA 4U2WA 3UY9A 2ZIQH 1HAOH 1BB0B 2A2XH 2Z94A 1W3CA 1MBQA 3F9FA 4H42U 4UE7H 1BMAA 3GCOA 5E0JA 2O8TA 3E16B 1SHYA 3OEHD 5PTPA 1G36A 1O2TA 2EY4C 5EQQA 3SQHE 3SNDA 1D3QB 4WVPE 1EPTC 1C5WB 2IJOB 5C20A 4B2BA 3GDVA 2QE7D 4K1TA 3UNSA 4BXSA 1Q2WA 1C4Y2 3UPEA 1SGCA 3SNBA 1C2GA 2UWOA 4RN6A 1ELEE 1GBDA 4Y0ZE 2R9PA 3RM0H 1JIRA 1SLWB 3DA9B 3M5MA 4CRDA 1O2UA 1WAYB 1Z7KA 2KX4A 2YNBA 1COWD 2FTMA 1PQ8A 1QJ7B 3Q77A 4BXWA 3SJKA 1TNJA 3RXIA 3FN8A 2Y5GA 4AYYB 3TGIE 2JKHA 2AYWA 1NM6A 1O2NA 1UJ1A 5EW2H 2CF8H 3SV9A 2WUBA 1MMJN 3C1KA 1TRMA 4FUFA 4Y8XA 1TFXA 4RI0A 3F1SB 5GNDA 3SZEA 1OYQA 2HNTE 3E6PH 1P01A 1U6QA 2BLQA 4ZXXH 1KLIH 1RFNA 1ZHPA 2BVRH 3GICB 3KQDA 4I8KA 5ESBA 1NESE 1O3KA 1P2QA 1DXWA 4D9RA 1LHEH 8KME2 1GCDA 1GDQA 3RXLA 1Z1IA 3SV8A 2G8TA 3MNSA 2W26A 3FZDA 3STJA 2BY8X 3KGPA 3TVJB 3DHKH 4NIYA 3SJ8A 1J8AA 3W95A 1IQGA 2BD7A 1S84A 2BMGB 3U8TH 4BAMB 1TNHA 2OBQA 2GCHG 4FU9A 3S9CA 3BIUH 1QIXB 3SGBE 1C5NH 1N6YA 4RT0A 2A2QH 2FOMB 3PTNA 3VGCB 3SI3H 2F4LA 2G81E 1THPB 5FX5A 3ODFA 3LH1A 1CBWB 1GMDF 1MTUA 2PW8H 4CRGA 1AZ8A 4WWYA 3RXMA 2J38A 5EPNA 2LP6A 5GWZA 1MABB 4WMDA 2Q1JA 1E79D 5A09A 2Q6GA 2OINA 1HAYB 1P02A 1V2WT 1ZPCA 3PM3A 1J16A 2VB0A 1H9HE 1ELGA 3M37A 1P2KA 1O2PA 4ABJA 1KIGH 4GAWA 1NBME 2UUFB 1HAXB 2ZU3A 2I6QA 3WY8A 4DIHH 1C1VH 4WJG2 1FZZA 1KTSB 3ZZBA 1AE5A 2WZQA 2ZU2A 4I8LA 1W0ZU 1SC8U 3RXQA 3BIVH 3AAUA 1UVPA 2BVXH 3T2NA 4CRAA 6CHAC 1EB1H 3U69H 1BRCE 4MPWA 1B0EA 2FOEA 1A3BH 1W11U 1UVOA 4OS1A 1BTXA 3PTBA 5EXMA 5T6GA 1CHOG 2FTLE 5F8ZA 1BMMH 1G3BA 5EU8A 3U8RH 1GHAF 2BD3A 4X2VA 3A87A 1QR3E 2ODPA 1ARBA 4VGCC 1A0HB 2BQ7B 4UFEH 4P00A 1P11E 2BZAA 1SPJA 4LZ1H 3EA8A 5JBAS 3ZZ3A 2P8OC 1OWHA 3UNQA 1FIZA 1EPTB 1QQUA 1GBLA 2PUXB 4Y7AA 2FX6A 5TJXA 5C2ZA 1HIAA 3IG6B 4KELA 4B2AA 1K22H 1OP0A 1A2CH 3PO1C 1GL0E 1P2JA 4UD9H 3P17H 2J2UA 1FMGA 3QX5H 4FUDA 1GHWH 1S5SA 1VITG 1YPEH 5AF9H 4JZDH 3MNBA 1AD8H 1FY8E 3TH3H 3BG4C 1S6FA 2WYJA 2FOAA 4R8TB 1SGPE 1GI5A 5ABWA 2CF9H 1FDPA 3FZZA 2XBVA 1AVWA 1GBFA 1QL9A 2ZTXA 3SU6A 3W94A 2V0BA 4KTSA 1ZJKA 3M5OA 1ZZZA 1EAUA 5FPSA 4OGYA 3ZYDA 4GVUA 2A45B 2SGDE 4CRBA 4K2YA 2GT7A 3PLPA 3RXGA 4D7FA 1ANBA 4X2WA 1DWEH 1A46H 4MPXA 3T28A 5DP5A 3GY6A 1G2LA 1LPKB 1NZQH 1HAVA 3DUXH 3GY8A 2H1UA 1Z8JB 2ULLA 4X2XA 3URCA 1SR5C 3NXPA 4F4OC 2GV7A 1BTUA 1S6LA 3VFEA 3ZVDA 5CHAC 4IBLH 3U9AH 1TQ0B 4AFUA 4X0WU 1P9SA 1TMUH 3NPSA 1E0FD 1V2NT 1AWHB 1AB9C 4IN2A 4ZHAA 1BTZA 1C1OA 4ABIA 1T4UH 3TH2H 3K2UA 4I8GA 1HBTH 1O0DH 2VWOA 3KF2A 1TPOA 2Y81A 3GCTF 4J1YA 4NZQA 1EQ9A 2AERH 4ACBA 1W14U 4JZ1A 1KXEA 3PV2A 1YCPM 1P2MA 1K1IA 3TJVA 1AUTC 1NTPA 3TGKE 3MU5A 1W0JD 1NRNH 1P9UA 1FPHH 3QGJA 1VGCB 3URDA 1IOEA 3F0PA 3TK9A 2EC9H 1FJSA 2H9TH 2IN2A 3BTEE 1O2SA 3F6UH 1E37B 3UB0A 3FFGA 1E1QD 4M9FA 4WXVA 1D3DB 4K8BA 4TT3D 2OUAA 3DCLA 1HDTH 1HJ9A 1DUAA 2SGEE 1OPHB 5F03A 4K69A 1F7ZA 2P94A 1OWJA 3GY3A 2R2WU 1O2WA 2O9QA 1LMWB 2FOFA 4DJZB 4O9VA 2F9BH 2UWLA 1BBRE 3MU0A 2GZ8A 1AMHA 3M7UA 1DS2E 3FANA 4ZKSU 3R3GB 1EZQA 1LQEA 4CREA 4RT1A 3S7KB 2VIVA 3CS7A 3GYLB 3UUZA 1MD8A 1V2RT 2YMSC 1O2OA 3BV9B 3U1IB 4YO9A 5CMXH 2Z9GA 3MFJA 2GVFA 2PV9B 3LDXH 1GJ5H 1O37A 3O8RA 1AO5A 3QZQA 2JETC 4X6OA 1E38B 1O3IA 2BD4A 3UWIA 2C3SA 2BXUH 1EFRD 2L6OA 1KXAA 4U01A 4AGKA 2P16A 4YXWD 3KQEA 1NPMA 4B71A 5C5NA 4Q63A 1N6XA 3PO1B 2ZTZA 1GWAA 3NUMA 5DGJA 3AAVA 1A1RA 2D8WA 3P6ZB 3TGJE 3CS0A 3UQVA 3VEQB 1GHVH 4GPGA 5EJ1A 2ZP0H 1AFEH 1CA8B 2BTCE 2BDYA 3SU4A 3SV2H 2WINI 2WPKS 1NU9A 4XOJA 4JK5A 1MAYA 2FEQH 1RS0A 4YOIA 2KCAA 3UNRA 1AI8H 4ISHH 1UTQA 2PGBB 4WMFA 1PPEE 3VXFH 5T1VA 3DFJA 1FONA 1SLVB 1YY3A 2CXVA 1TRYA 3A8CA 1V6DA 1T4VH 1A3EH 5E2PA 1TRNA 4Q7ZA 5FAHA 1Z6JH 3GDUA 4O3TA 3LGWA 1V2TT 4ISOA 3QUMP 1BJUA 2FOBA 5AFZH 1C5TA 4MNVA 4NIXA 1OWKA 1GMCG 1J14A 3JZ2B 3Q76A 4INHA 3DT0H 4CR9A 1LKAA 4X8VH 2V3HH 3V12A 3A89A 2ZFRH 3HK6B 2BDGA 4OS7A 1XUIA 1GBAA 1W2KH 3MO9A 2PP6A 1C5SA 1DY8A 3W1EA 5A0CA 3SOSA 1CT4E 1LVYA 2JH0D 2TPIZ 3BG8A 1D6WA 3P92A 3MH6A 3RXKA 2KR7A 5C1XA 3A81A 4DT7B 2AGIX 1VJ9U 1MKXK 2QF4A 2F43B 5HM2A 1YPJH 2J97A 1DY9A 2H6MA 3U8OH 1MBMA 2BLVA 3KIDU 6LPRA 4MLFB 1O5CB 2BY7X 2ZZUH 3MO6A 4U32A 4B1TA 4TPIZ 2AGGX 3S7HB 4TSFD 5IYTA 2XBWA 1HRTH 1BOQA 1O3PB 2ZC9H 4IS5A 1ZGVA 4TYDA 2QF5A 4XD7D 4FUJA 3RU4E 1RIWB 2ZDVH 1DUEA 1CT0E 2PKAA 2IPHA 1W7GH 4ABGA 2SFAA 1GDUA 1H8HD 2ZU5A 1QCPA 2FZZA 1VCPA 4B6FA 2F91A 3LOXA 2WUCA 1TMTH 2YMSB 1P0SH 2Y5HA 1DLEA 1TBRH 1UCYK 3I29A 3EA7A 1GVKB 1AFQB 3HKJB 2JETB 2K1QA 3SUEA 2F3CE 2QC2A 2A5AA 5A0AE 3FAOA 1NRPH 2YNAA 1FIWA 1HAIH 1MCVA 1C1NA 3D62A 3ATKA 1TX6A 3A7WA 1SL3A 3MU8A 1Y3WA 1V2ST 3ITIA 2UUYA 4ISLA 1O2QA 3UR9A 1V2VT 1G9IE 1QRWA 1G2MA 2PSXA 4NWLA 3ATMA 1C1UH 3SUDA 3SORA 4WH8A 1BRAA 2WPIS 3ZZ8A 1TX7A 1GI0A 2CK3D 1X7AC 3OTPA 3A8AA 4KTCA 4Y11E 1BMFD 2ZTYA 3P8GA 2D2DA 1O3HA 1EAWA 3AW0A 2OK5A 1YLDA 3RXCA 2BM2A 4YESB 2A4RA 1V2UT 3RU4T 1TMBH 1EX3A 5L6NH 1T8LA 3TK6A 4ZKNU 1FNIA 4AZ2B 2G4UA 2BHGA 3EE7A 2OCVB 2GMTC 3A7TA 2ZPSA 1UO6A 2RDLA 4HFPB 1Y3YA 1Z8GA 4BTIB 1O2LA 5B6LA 1O2XA 5EW1H 2B5TB 2SGAA 4JYUH 1ACBE 2OC7A 3L3TA 3QZRA 1EJMA 1H8IH 2ZDKA 1CU1A 1A5IA 3E3TA 3BTME 3LU9B 1YPKH 3VXEH 4YT7H 1FY5A 1ZYOA 4R0IA 1LPZB 7GCHG 2PGQB 2H2ZA 3SU0A 3M35A 3VGCC 2BQ6B 1IQLA 1THSH 2FIRH 3P70B 2BVSH 5LPRA 3RXJA 2A31A 1CBWC 2A4GA 1J15A 1BUIA 4QT8C 5C67A 3MNCA 2QV1A 3KCGH 2O8MA 3OY6U 2RCEA 1SFIA 2V7QD 1YPHC 2G55A 1XXFA 2FM2A 3ESTA 2SGPE 2A1DB 1CHGA 1SMFE 1YGCH 2R2MB 1KXCA 1DM4B 5A8YA 1GMHG 3P8FA 4LZ4B 1TNIA 1GI1A 4IN1A 2KZ4A 4ABDA 3SI4H 4XBDA 2BY9X 1O3AA 2Y80A 3FO8D 1SFQB 4IC6A 5LPFA 3RXTA 1O5GH 2VBCA 4H4FA 1MH0A 2GV6A 1LHFH 3AVZA 4TWWA 5TCCA 2QN5T 2KFWA 4ZHMU 3RXAA 1GDNA 1QGFA 3B8JA 1TBZH 1EZXC 3S9BA 2BB4A 2F9UA 2QAAA 3FVFB 1C4V2 2HPQH 3BEUA 3PV4A 1XKBC 4A1XA 1T8OA 2XXLA 2J4IA 1QL8A 2H5DA 5DKMA 2RA0A 3HGNA 2AIQA 1Y59T 3OAAD 1L1NA 3OY5U 4PROA 2FOHA 3ZVGA 2PHBA 2SGFE 3PROA 4MNXA 1P8VC 2FX4A 2G5NA 2XYAA 5C3NA 1GBTA 2YOLA 4ZKRU 4MNWA 4XBBA 1C4U2 1O2KA 3PRDA 3SHAH 4TPYA 4ASHA 2VIQA 4NG9H 4I31A 1HJAB 5T6FA 1ETTH 2TGDA 3RDZA 3STIA 1JXPA 2FOGA 3LGYA 3K65B 4UDWH 1OKXA 2STAE 3V0XA 1BBRK 1V2MT 1O31A 2D1JA 4O3UA 2IOTA 1GHZA 3F2FA 2ESTE 1NBMD 1P05A 1Y3VA 1YLCA 2G00A 5F6MA 2PWXA 4I33A 1AU8A 3IITA 1HJ8A 1JWTA 4DW2U 3BTTE 4XDEA 3BEFB 5A0BA 1GBCA 3Q3KA 2GMTB 4I8HA 5EGMA 3SYJA 4DVAU 2H9EH 1P3EA 5E2OA 3D49H 3EAJA 3MYWA 1QTFA 1V2OT 1C5UA 5HIYA 4AFSA 5GXPA 1ARCA 1UCYH 1OWEA 1ELDE 4Y10E 5DK1A 3ZZDA 3PWBA 1F0UA 1TBQH 1DWCH 2ZEBA 2ILNA 1FV9A 1W0KD 1FXYA 5AHGH 1F5LA 1KXDA 3RXBA 3ZZ6A 2XBXA 1UW7A 1H9LB 2UUKB 2HVYB 4X8UH 2RFKC 1OOKB 5GCHG 1TNGA 1F0RA 4Y71A 2ANWA 1ID5H 2BXTH 2P93A 1MQ6A 4GSOA 2ZCHP 4AYVB 2ZF0H 1OYTH 3TJOA 4AG1A 4AX9H 5HXFA 3PV5A 4P02A 2GZ7A 1GJ4H 1O33A 2Z9JA 1CVWH 2RA3A 3L33A 3F0OA 5EQRA 5DPAA 2AH4X 3PMBB 1GJBB 1C5VA 1Z8RA 3UQOA 1Y3XA 1IQFA 2G5VA 2KAIA 1VGCC 3GS9A 4YOGA 2GKVE 1NRRH 2ZQ1A 4A1VA 5J4QA 3SGQE 3TLOA 3PMJA 3R0FA 1L0ZA 1UK4A 1IQNA 1RRKA 2H9HA 2JJ2D 3T5FH 1G30B 3E91A 3MH4A 1NU7B 2ZFTA 5EIYA 1MZDA 1TPSA 2Z3CA 5FPYA 2P3UB 2FXRA 1YCPH 5GJ4B 2P59A 1C9TA 4BAHB 2BX3A 1C9PA 1C5LH 2FYQA 2AS9A 1WCZA 2ZHEH 4XE4A 2ZI2H 2VIPA 1NRQH 2FODA 3GISB 5DP7A 5G4BA 2VVVA 2H5CA 1S85A 1GBBA 1NFXA 1YPMH 2ZQ2A 2WPMS 4Z6AH 2VVUA 4AGJA 1H9IE 1VITH 1XM1A 1LHGH 3RXHA 2A4OA 4OS6A 1O2YA 1MZAA 2AMQA 1BMLA 3EQ0H 5FL7D 1C2FA 4INKA 2V6NA 1JIMA 4FUCA 2ZPRA 1HGTH 1KYNA 1HIAB 1SGTA 5A2MH 4ZCNA 4BAKB 4ESTE 2DE8A 1C5MD 2NU1E 1QA7A 4DURA 3RXPA 3A82A 4X6PA 4BANB 2SNVA 1OX1A 3CNRA 1C1WH 1ESBA 1SGNE 2OBOA 1PJPA 1CSOE 1SQOA 2R0KA 2VJ1A 5DJ7A 3A85A 2ANKH 2OTVA 1TQ7B 2VH6A 2XWAA 1NN6A 5EJLA 2W6ID 1BT7A 1TAWA 4FUGA 1C5QA 1GPZA 1ZR0A 2A32A 3BSQA 3F68H 1C1SA 1WDIA 2G52A 2GGVB 3LKWA 1A61H 1QL7A 3OE7D 4AFQA 2Z9LA 2GD4B 1L1JA 3VB6A 4B2CA 5EOKA 2VH0A 5EQSA 3LPRA 3B23B 4MVNA 1HUTH 1UTLM 1WOFA 1HAVB 5I25A 1K2I1 4ZUHA 3AASA 1T32A 2QCYA 2AIPA 6GCHG 3QO6A 3UREA 1FX0B 4Q4LA 1XUHA 2QXGA 4OS4A 3ZZAA 1B7XB 1NROH 1MQ5A 2ZHFH 1HAGE 3ATLA 3GOVB 3ZVEA 1UTOA 1DSUA 2ZGCA 3ZVCA 4X8SH 1FPCH 1TGBA 3TH4H 2HOBA 1E35B 5IK2D 2SNWA 1EASA 1V2QT 8GCHF 1NFWA 2HLCA 2BDCA 1GBHA 1P06A 1DSTA 1GJCB 2W7UA 1ZPZA 1TWXB 4IW4E 3V7TA 4WF8A 1CA0B 1SGFA 3SW2B 1L4ZA 3M3VA 2XC4A 4XFQA 1P04A 1HYLA 1O34A 4F48B 3RXFA 1ZMNA 1RIWC 4ZXYH 4I8JA 3FP6E 1D3TB 1FLEE 3HPTB 1IAUA 1C2LA 2K0QA 4GUXA 3OEED 1C2JA 3U98H 1N1LA 3KQBA 4O03A 4TWYA 1WTGH 1WTHD 1ELVA 2AGEX 3DD2H 1A4WH 1QZ8A 3BTDE 1BTHH 4D8NA 1MD7A 2STBE 1SHHB 1TA2A 1O3MA 1BIOA 3V13A 1XMNB 1EB2A 2J95A 3A84A 1AFQC 2ZCLP 3SO3A 1WSSH 2J98A 2SGQE 1F0SA 3NWUA 3FKSD 1C2EA 2BLWA 4K60A 2C93B 2QYIA 3BN9A 1O3OA 3ZZCA 1BMNH 1CT2E 1SOZA 2C8YB 2W3IA 3BTQE 3O8BA 3OYPA 4BOHA 2ZHDA 4ZMAH 1MAXA 1BQYA 4MPUA 3B9FH 1UTPA 1THRH 1SLUB 4CHAB 4IC5A 2TRMA 1YBWA 7GCHF 4JZIA 3HATH 3SHCH 3SV6A 1OSSA 2JDID 1QJ6B 4UEHH 3TITA 5E0GA 4DGJA 2QXJA 2ZFPH 1A7SA 4GLYA 1C2MA 4DT4A 3H7TA 5JBTA 4UFDH 1W10U 3RMOH 2NU3E 4BTUB 1FY3A 1KLJH 1P10A 3PMHB 4H6TA 1S0RA 1K0HA 1RTLA 2Y7ZA 4X2YA 3RU4D 1GI4A 1NY22 2KM0A 1C1RA 2PKSB 4E7NA 2ALPA 3PMAB 1Q31A 1H1BA 1GJ9B 2P3TB 4UONA 5L30H 2VIWA 4OS5A 4A1TA 5DP9A 4MQAA 3NCLA 5EODA 2UUJB 3Q3XA 3F3BA 1O5DH 2WYGA 2OQ5A 1UK3A 3OFND 1SBWA 3M3SA 1IQHA 1TONA 3T26A 3SJ9A 2BZ6H 5AFYH 2CGAA 4AG2A 3ZIAD 2B8OH 1C5ZB 1FQ3A 1SGQE 1UK2A 1P2IA 1YWUA 2FS8A 2ZA5A 4I86A 1CO7E 5DN6D 1GJ6A 4YOJA 5DP8A 3GY7A 3M7QA 5A8XA 1CQQA 1BA8B 1GJ8B 1YM0A 7ESTE 2BDHA 1DICA 2PFEA 1TOMH 5TCAA 2HVXA 1GG6C 1S82A 2M2AA 1LPGB 3KL6A 1H4WA 1AHTH 2Y7XA 2OC0A 2W5EA 1O3FA 1NO9H 1VR1H 1UVTH 2AMPA 2WV5A 3MO3A 4D76A 4DG4A 1F0TA 1W12U 3GDSA 2F9VA 2ZO3H 4X1QU 1EP6A 3PYHA 1G3EA 3NKKA 2XOKD 3MHWU 5LGOA 1PQ7A 2XNDD 1XVMA 1FN8A 3MNXA 4J2YB 1HAPH 2PKAB 3MU4A 2Z3EA 5ESTE 2ANMH 3ZV9A 4CH2B 3TNSA 2A7CA 2ZGXH 3O8DA 2V35A 4NA7A 4AB8A 2CHAC 3TU7H 1P57B 3RM2H 3S9AA 1KMHB 3ZYEA 1TGNA 2ZU1A 5T6DA 5E8EH 3RXSA 2JIZD 2QXHA 3K6ZA 1MUEB 1O2RA 4DY7B 1EAIA 5IDKA 3RMLH 1CGJE 2GX4A 4A6LA 3LJJA 1GCTB 1HXFH 3U1JB 1RD3B 1HJAC 3SZNA 5K7RA 1ZJDA 2PUQH 1CGHA 1E36B 3GYMA 1XXDA 2Z9KA 2NU4E 3SN8A 4E06H 5BPEA 2GCHF 1S81A 4CR5A 1A5GH 1DDJA 1C5OH 1AKSA 1V2LT 1DE7H 1OS8A 1EJNA 4K5ZA 5GCHF 3LGVA 4XRNA 1UVUH 1HCGA 1O30A 4FVDA 1M9UA 2VWNA 3CENA 1LCYA 2ZFFH 2WPDD 2TGAA 2ZKSA 2C8XB 1TALA 4D7GA 4KTUA 1QNJA 2GT8A 1Y5UT 1AY6H 4KP0A 1BHXB 4ABEA 1SG8B 1FY1A 4GHTA 3H5CB 3VB7A 3GCNA 1PPZA 2JH5D 4CBNA 4ZROA 4X1RU 2Q6FA 4ZHLU 2ZFSA 2XTTB 1O2HA 1ANDA 3PLKA 3QK1A 4CRCA 2J9NA 1XUKA 3EGKH 4YLQH 2FP7B 5C17A 1KTTB 4MNYA 1PPHE 1ORFA 1JMOH 2Y5FA 4BTTB 3ZV8A 5KGOA 1V3XA 4AORA 1UHBB 3UTUH 1UHBA 2QGRA 3ENSB 3F2HA 4XSKU 4I32A 1PYTD 4ACAA 1AVGH 1YKTA 1YP9A 1FY4A 3LONA 3NZIA 1CHOF 2GCTB 1DPOA 4YLUA 2ZDNA 4GCHG 3E1XB 2ZDMA 3RXDA 2FMJA 1V2PT 1L1GA 1V2KT 1DANH 4NFEA 4X8TH 1Z6EA 4F55A 2BDIA 2PTCE 2LPRA 4JZFH 2F83A 1G3DA 1WU1A 4OS2A 4CBOA 1SQTA 3NK8A 1L4DA 2OD3B 1GG6B 2ZHQH 5DP6A 3BTWE 2ZECA 1D6RA 1O5EH 1O32A 1D9IA 1DFPA 2BQWB 1EZSC 1GHBG 1QFKH 3KN2A 3KYFA 4Z1MD 4B76A 3A7XA 3UWJH 1LO6A 1LVMA 1GI9B 4XBCA 1QA0A 2QXIA 1TGTA 1WUNH 3HKIB 4DCDA 5EJZA 1ZMJA 1VITF 1BZXE 1EKBB 3DFLA 8ESTE 4OGXA 2BD2A 3QTVH 1P3CA 1Y8TA 2QY0B 5EXLA 1LVBA 2TGPZ 2BX4A 2KCPA 1BITA 3LGIA 4Y8YA 2VWLA 4F49A 2HWLB 3VB3A 1AE8H 5JYIA 4JK6A 4Y8ZA 3LGUA 1SGYE 1SI5H 2CHAB 2VU8E 3OU0A 3AW1A 1PPFE 2GJGA 1QURH 4U30A 5HMAA 4RKJB 1CE5A 3IWMA 1AIXH 5AVDA 3KNXA 1T8NA 3AK5A 4JYVH 1UMAH 3UFAA 3P95A 5EXNA 5FXLA 2W6JD 4IMZA 2VVCA 2IPQX 3F9GA 2QA9E 4AOQA 2NU2E 2KCYA 6GCHF 3E90B 1GI8B 3RC5A 1O3LA 1FN6A 1MKXH 4RSPA 3LC3A 2P3FH 4BAOB 2FOCA 3T25A 2A0QB 2FESH 4FETA 2QF3A 2ZFQH 2BDBA 1ZOMA 4KKDA 1VCQA 4H6SB 4FVBA 1GHXH 4MPVA 4AN7A 4THNH 2HLDD 5B6OA 1IQJA 1DWBH 1T31A 5DO4H 2XWBI 1TLDA 4JYTA 2A4QA 5CDFE 3FP8E 3RLYH 2ZPQA 2R3YA 3TNTA 9ESTA 1XUGA 2A7HA 1C2KA 2FO9A 2J94A 3PB1E 2F9PA 3ATIA 4X1SU 2ZWLH 4UFGH 1VKYA 1ESTA 1ZTJA 2Z3DA 1L2EA 4AB9A 2J92A 3SQEE 5LPEA 3QWCH 3BTFE 3TJUA 2LELA 2VGCB 1N8OB 3T62A 5DG6A 2XC5A 2R0LA 3QLPH 1ZSLA 2O8UA 1GBIA 1MCTA 3N99A 1GI2A 4FXGH 2VNTA 3RMNH 4D9QA 1T7CA 1EAXA 1YLNA 2QIQA 5EPYA 2FI3E 1ABIH 2BDAA 1QBNA 3ATWA 3DSPA 2AFQB 1Q3XA 3MH7A 3E0NB 2EI8A 3I77A 2BYAX 3GY2A 2GTBA 4Q2KA 1F5KU 3HGPA 3GY4A 1QB1A 2O8LA 5FBEA 1KLTA 2XCNA 3OX7U 1CGIE 2KAIB 2XNIA 2F9OA 1DX5M 1K1NA 2Q6DA 5L2YH 1ZGIA 1V2JT 1OWIA 3TIUA 2R3UA 1EOJA 3RXVA 1DVAH 1P2OA 4ZAEA 2WV9A 1AWFH 2FDAA 1HAHH 1MTNB 5F8TA 1MU6B 3LC5A 1CA0C 2BLOA 3M5LA 1VJAU 3SUFA 4X6MA 1SVPA 5LH8A 3ZVBA 4SGAE 3RXOA 2F9NA 1MTVA 2P95A 2Z6BD 4Y0YE 4B6EA 2JH6D 3GCHC 4Q80A 4LOYH 4ISNA 4WH6A 3KEEA 2ZU4A 3L6PA 1UCYE 2LNCA 2IJD1 2THFB 5JPMH 4M7GA 1K9OE 1QJ1B 2Z9IA 3UAIC 4YM9A 3F9EA 2A5IA 1JBUH 4INLA 4Z0KA 1QBOA 1TPPA 1W13U 2DUCA 4DIIH 2BOKA 2AHME 2OQUA 3N7EA 4K3JA 1HLTH 3K9XB 1WXRA 5CHBA 4NWKA 1ANCA 1EJAA 1ANEA 1NRSH 2ZCKP 1SB1H 1O2GH 3F2GA 5HYOA 2D26C 3A86A 3KHVA 2WPHS 2FLBH 5JBCS 2VINA 3FP7E 1TNKA 3VPKA 1ELCA 4CHAC 3ELAH 1EZUC 1GMCF 4HI3A 1Y3UA 2FI5E 1XX9A 3H09A 1FAXA 1E34B 2CN0H 1EPTA 2K8IA 2W7SA 1NFYA 1AGJA 1GJAB 1T8MA 2AMDA 4LXBH 2HGTH 1Y5BT 1TPAE 3I78A 3RXUA 3VG8A 3O8CA 1GI7B 1SQAA 5I46H 3S0NA 3M36A 1HNEE 1C5PA 3LIWA 1AUJA 3MOCA 5DP4A 1O5AB 1K1MA 8LPRA 1UTNA 3BTKE 2NU0E 1SQRA 2PKSC 3V3MA 4HZHA 2TIOA 3DSOA 5F53A 3ZVFA 1K28D 1XVOA 1SGIB 2G4TA 3MU1A 4GHQA 3D65E 3PLBA 1P2NA 1GVZA 1GBKA 1MTWA 1PPBH 2EA3A 2XW9A 1O35A 3OSYA 4Y7BA 1RJXB 5HM9A 1LHDH 2PLXA 2J34A 1F5RA 2ZHWH 3D23A 3SU2A 1WV7H 1OWDA 3WWBA 3S69A 1BRUP 3BTHE 3KQ5A 5C1UA 1TOCB 1O38A 3NRLA 1KXBA 5EG4A 4IMQA 2CV3A 1PQ5A 4NSYA 3SU5A 2W3KA 1ZSKA 1ZTLA 2FLRH 1HV7A 1JOUB 1HAZB 1SLXB 1GJ7B 2ZGBH 4NIWA 5GIBA 5C5OA 1SKYE 2WV4A 3MQKC 1BBRH 3SUGA 1RXPA 4JCNA 1TGSZ 2XRCA 2FPZA 1JRSA 1GI3A 1WQSA 1DXPA 1MTSA 3M3TA 1RGQA 3UIRA 1J9CH 3G01A 3ZZ5A 1B5GH 1JRTA 1K1OA 4A92A 2RDEA 2ASUB 1PYTC 5KEDA 3A8DA 1BTWA 3QDZB 1QHRB 3SJOA 2WSSD 2XC0A 3QTOH 5FX6A 5KECA 2XCFA 1TA6A 5FHTA 3RC4A 3DSGA 2O8WA 3MH5A 2FWWA 2JJ1D 2FI4E 5JB9S 3GCHB 1IQIA 2RG3A 2I6SA 3A8BA 3TJNA 3QGNB 1YYY1 1O3EA 4DOQA 1WBGB 4LK4A 1GVLA 3KQCA 1GBMA 3N7DA 1VZQH 2ZNKH 3RLWH 3K6YA 1NC6A 1C5RA 4CH8B 5J4SA 5K0HA 4X1NU 2BY6X 3PWCA 3E8LA 6CHAB 1AN1E 1QRZA 2GDEH 3SBKA 1W7XH 1ESAA 4UFFH 3ZZ4A 3RUOA 2J98B 2HNTC 4ABFA 2A5KA 2OP9A 3M61U 1PPGE 1GCTC 1ETSH 2TGTA 2L74A 1O2VA 4I7YH 1GMDG 3MWIU 3PRBA 4JMYA 1KXFA 1GJDB 1D3PB 4NSVA 1EOLA 1GL1A 1YPHE 2GZ9A 1NT1A 2WPLS 1TE0A 4BAQB 1QB6A 1YPGH 1UTMA 4VGCB 4WY3A 2GP9B 1EXFA 1O3NA 1BRBE 3BTGE 1QBVH 2WHXA 5JB8S 5C0UA 2ALVA 1QB9A 4A5TS 2P8OB 5F8XA 2ANYA 3M5NA 2PSYA 4NGAH 1OP8A 5C94A 3A7YA 4YT6H 1C5XB 2FYRA 1B0FA 2C8WB 1P03A 1C1QA 1INCA 4Y76A 4NA8A 3RC6A 4A7IB 2B9LA 4MDSA 1DITH 1MKWK 3LJOA 1G37A 4GCHF 2ZGHA 5GPIB 1ZRBA 3SNCA 5A8ZA 9LPRA 4NA9H 1F2SE 4AC9A 1K1LA 3H7OA 3BG4B 4FUEA 1O3DA 1YF4A 5SGAE 1KY9A 3VB5A 2HPPH 2B0FA 2BD9A 1GMHF 5JBBS 4E05H 2ODQA 3SU1A 1PPCE 1GHAG 5GDSH 2ZGJA 2XBYA 4IGDA 5CE1A 2OC8A 3GY5A 3UOPA 4ABBA 3MI4A 3ZZ9A 1BDAA 1GHBF 3SNAA 1XUJA 1LQDB 3MMGA 5ETXA 1C5YB 1GGDC 1E1RD 1O3JA 2UWPA 1QRXA 4KGAA 1KSNA 1ZHRA 2C90B 4FU7A 6ESTA 3FOAA 2C8ZB 4NZLA 4K1EA 1AVXA 2GCTC 3P8NA 3A83A 4TY6A 2TBSA 1C2DA 1Z8IB 1EP5A 2ZG0H 4RKOB 1AZZA 1GBEA 1ZHMA 5C0TA 1O5BB 5L2ZH 1LDTT 2VIDA 4ABHA 2GDDA 5CHAB 2HRVA 2M5TA 1ELFA 5C1YA 5FBIA 2BD8A 2CMYA 1AB9B 2Y82A 4X6NA 2G51A 1FI8A 3VB4A 2DE9A 5FPTA 2V3MA 2VWMA 3SJIA 1SGRE 1K1PA 1G32B 1NS3A 5DP3A 3EA9A 1G3CA 4WXIA 1DT2A 4HGCA 1W0YH 1O3GA 3A7VA 3QN7A 1ELAA 1MU8B 4Y79A 3RXRA 4YTAA 1BJVA 2Y6TA 1BTYA 1UTKA 4K1SA 4AFZA 1FUJA 2J5UA 1QQ4A 1S83A 1TIOA 1TABE 1H8DH 1BTPA 1BCUH 1O2ZA 1D4PB 1DOJA 2HNTF 1GI6A 4B73A 4NCYA 1NFUA 1SOTA 1TGCA 2EEKA 3F9HA 2EI7A 7LPRA 1PQAA 2VIOA 1ABJH 1SGFG 2PTNA 1IHTH 1ZSJA 1ZPBA 1F92A 3LT3A 1YC0A 3P8OA 3OTJE 1H8ED 2OLGA 1S6HA 1ELTA 4ABAA 1O2MA 5DSFA 3GCTG 5FCRA 4YZUA 3U28C 1FAKH 1LHCH 1LVOA 4ISIH 5BRRE 3RP2A 1OXGA 1O5FH 4K8YA 2BY5X 8GCHG 1LKBA 4FOUC 1PFXC 1RTFB 1ZTKA 1SGDE 3A80A 2C4FH 1RTKA 3SGAE 1AKSB 4OM9A 3JZ1B 5H4IB 2ZDLA 1ELBA 5E0HA 1TYNA 1OP2A 2OXSA 2A7JA 3N7OA 4E7RG 1YPLH 7KMEH 3SNEA 4ZH8A 1BHXF 3UR6A 3T27A 2QF0A 1O39A 1A0LA 3WWFA 1TNLA 4FU8A 1HXEH 3BEIB 4SGBE 3EYDA 4B74A 3KYGA 1P12E 1C1MA 1GHYH 1K1JA 1C1PA 1TX8A 1HFDA 4HTCH 2ZDAH 1WYKA 4TY7A 1GBJA 2FS9A 4FUBA 2VGCC 1C1TA 2AEIH 1EUFA 1HPGA 1IQEA 1J17T 1N8OC 1O3CA 3A7ZA 2V3OH 4WMEA 4MG3A 1GGDB 1O2IA 3C27B 3TPIZ 3A88A 1Z1JA 1P09A 1YCPK 1OHHD 2EI6A 1EATA 1O2JA 4FUIA 1SGEE 3CP7A 4Q7YA 4JZEH 1DLKB 4HG6A 3T29A 3EDXB 1QY6A 1W8BH 3HK3B 3LGTA 4X1PU 4ASUD 1ZLRA 1O36A 4O97A 1O3BA 2NWNA 4NFFA 3WW7A 1XKAC 5T3HA 1C2IA 4CRFA 1MKWH 1KDQB 3ODDA 3SV7A 2ODYB 1A5HA 1MTNC 1ZMLA 1ZRKA 3RXEA 1A0JA 1KDQA 4Q7XA 1Z71A 1DWDH 3LH3A 2EQNA 4MTBA 4BNRA 1S0QA 2WPJS 4Y6DA 4FUHA 1LTOA 3RMMH 1IQMA 3E0PB 2B7DH 1K21H 1HB0B 3MTYA 2PR3A 1UTJA 3Q00A 3ZZ7A 2BD5A 1AQ7A 1VCWA 3BF6H 5HGGA 2HALA 2YMSD 1C2HA 5HKKD 2BOHB 4B75A 1XUFA 1IHSH 3TK5A 3UOUA 2Z7FE 5FCKA 1ETRH 3EE0B 3Q3YA 2OC1A 2KCOA 3M7TA
chains in the Genus database with same CATH topology
5JDUB 1UVSH 2CJIA 4ZKOU 1IQKA 3ZVAA 4NIVA 1TB6H 3SU3A 1WQVH 1Y5AT 1SSXA 4U2WA 3UY9A 2ZIQH 1HAOH 1BB0B 2A2XH 2Z94A 1W3CA 1MBQA 3F9FA 4H42U 4UE7H 1BMAA 3GCOA 5E0JA 2O8TA 3E16B 1SHYA 5PTPA 1G36A 1O2TA 5EQQA 3SQHE 3SNDA 1D3QB 4WVPE 1EPTC 1C5WB 2IJOB 5C20A 4B2BA 3GDVA 4K1TA 3UNSA 4BXSA 1Q2WA 1C4Y2 3UPEA 1SGCA 3SNBA 1C2GA 2UWOA 4RN6A 1ELEE 1GBDA 4Y0ZE 2R9PA 3RM0H 1JIRA 1SLWB 3DA9B 3M5MA 4CRDA 1O2UA 1WAYB 1Z7KA 2YNBA 2FTMA 1PQ8A 1QJ7B 3Q77A 4BXWA 3SJKA 1TNJA 3RXIA 2Y5GA 4AYYB 3TGIE 2JKHA 2AYWA 1NM6A 1O2NA 1UJ1A 5EW2H 2CF8H 3SV9A 2WUBA 1MMJN 3C1KA 1TRMA 4FUFA 4Y8XA 1TFXA 3F1SB 1OYQA 2HNTE 3E6PH 1P01A 1U6QA 2BLQA 4ZXXH 1KLIH 1RFNA 2BVRH 1ZHPA 3GICB 3KQDA 4I8KA 5ESBA 1NESE 1O3KA 1P2QA 1DXWA 4D9RA 1LHEH 8KME2 1GCDA 1GDQA 3RXLA 1Z1IA 3SV8A 2G8TA 3MNSA 2W26A 3FZDA 3STJA 2BY8X 3KGPA 3TVJB 3DHKH 4NIYA 3SJ8A 1J8AA 3W95A 1IQGA 2BD7A 1S84A 2BMGB 3U8TH 4BAMB 1TNHA 2OBQA 2GCHG 4FU9A 3S9CA 3BIUH 1QIXB 3SGBE 1C5NH 1N6YA 2A2QH 2FOMB 3PTNA 3VGCB 3SI3H 2G81E 1THPB 5FX5A 3ODFA 3LH1A 1CBWB 1GMDF 1MTUA 2PW8H 4CRGA 1AZ8A 4WWYA 3RXMA 2J38A 5EPNA 5GWZA 4WMDA 2Q1JA 5A09A 2Q6GA 2OINA 1HAYB 1P02A 1V2WT 1ZPCA 3PM3A 1J16A 2VB0A 1H9HE 1ELGA 3M37A 1P2KA 1O2PA 4ABJA 1KIGH 4GAWA 2UUFB 1HAXB 2ZU3A 2I6QA 3WY8A 4DIHH 1C1VH 4WJG2 1FZZA 1KTSB 3ZZBA 1AE5A 2ZU2A 4I8LA 1W0ZU 1SC8U 3RXQA 3BIVH 3AAUA 1UVPA 2BVXH 3T2NA 4CRAA 6CHAC 1EB1H 3U69H 1BRCE 4MPWA 1B0EA 2FOEA 1A3BH 1W11U 1UVOA 4OS1A 1BTXA 3PTBA 5EXMA 5T6GA 1CHOG 2FTLE 5F8ZA 1BMMH 1G3BA 5EU8A 3U8RH 1GHAF 2BD3A 4X2VA 3A87A 2ODPA 1QR3E 1ARBA 4VGCC 1A0HB 2BQ7B 4UFEH 1P11E 2BZAA 1SPJA 4LZ1H 3EA8A 5JBAS 3ZZ3A 2P8OC 1OWHA 3UNQA 1FIZA 1EPTB 1QQUA 1GBLA 2PUXB 4Y7AA 2FX6A 5TJXA 5C2ZA 1HIAA 3IG6B 4KELA 4B2AA 1K22H 1OP0A 1A2CH 3PO1C 1GL0E 1P2JA 4UD9H 3P17H 2J2UA 1FMGA 3QX5H 4FUDA 1GHWH 1S5SA 1VITG 1YPEH 5AF9H 4JZDH 3MNBA 1AD8H 1FY8E 3TH3H 3BG4C 1S6FA 2WYJA 2FOAA 4R8TB 1SGPE 1GI5A 5ABWA 2CF9H 1FDPA 3FZZA 2XBVA 1AVWA 1GBFA 1QL9A 2ZTXA 3SU6A 3W94A 2V0BA 4KTSA 1ZJKA 3M5OA 1ZZZA 1EAUA 5FPSA 4OGYA 3ZYDA 4GVUA 2A45B 2SGDE 4CRBA 4K2YA 2GT7A 3PLPA 3RXGA 4D7FA 1ANBA 4X2WA 1DWEH 1A46H 4MPXA 3T28A 5DP5A 3GY6A 1G2LA 1LPKB 1NZQH 1HAVA 3DUXH 3GY8A 2H1UA 1Z8JB 2ULLA 4X2XA 3URCA 1SR5C 3NXPA 4F4OC 2GV7A 1BTUA 3VFEA 3ZVDA 5CHAC 4IBLH 3U9AH 1TQ0B 4AFUA 4X0WU 1P9SA 1TMUH 3NPSA 1E0FD 1V2NT 1AWHB 1AB9C 4IN2A 4ZHAA 1BTZA 1C1OA 4ABIA 1T4UH 3TH2H 3K2UA 4I8GA 1HBTH 1O0DH 2VWOA 3KF2A 1TPOA 2Y81A 3GCTF 4J1YA 4NZQA 1EQ9A 2AERH 1W14U 4JZ1A 1KXEA 1YCPM 1P2MA 1K1IA 3TJVA 1AUTC 1NTPA 3TGKE 3MU5A 1NRNH 1P9UA 1FPHH 3QGJA 1VGCB 3URDA 1IOEA 3TK9A 2EC9H 1FJSA 2H9TH 2IN2A 3BTEE 1O2SA 3F6UH 1E37B 3FFGA 4WXVA 1D3DB 4K8BA 2OUAA 1HDTH 1HJ9A 1DUAA 2SGEE 1OPHB 5F03A 4K69A 1F7ZA 2P94A 1OWJA 3GY3A 2R2WU 1O2WA 2O9QA 1LMWB 2FOFA 4DJZB 4O9VA 2F9BH 2UWLA 1BBRE 3MU0A 2GZ8A 1AMHA 3M7UA 1DS2E 3FANA 4ZKSU 3R3GB 1EZQA 1LQEA 4CREA 3S7KB 2VIVA 3CS7A 3GYLB 3UUZA 1MD8A 1V2RT 3BV9B 1O2OA 3U1IB 4YO9A 5CMXH 2Z9GA 3MFJA 2GVFA 2PV9B 3LDXH 1GJ5H 1O37A 3O8RA 1AO5A 3QZQA 2JETC 4X6OA 1E38B 1O3IA 2BD4A 3UWIA 2C3SA 2BXUH 1KXAA 4U01A 4AGKA 2P16A 3KQEA 1NPMA 4B71A 5C5NA 1N6XA 3PO1B 2ZTZA 1GWAA 3NUMA 5DGJA 3AAVA 1A1RA 2D8WA 3P6ZB 3TGJE 3CS0A 3UQVA 3VEQB 1GHVH 4GPGA 2ZP0H 1AFEH 1CA8B 2BTCE 2BDYA 3SU4A 3SV2H 2WINI 2WPKS 1NU9A 4XOJA 4JK5A 1MAYA 2FEQH 1RS0A 4YOIA 3UNRA 1AI8H 4ISHH 1UTQA 2PGBB 4WMFA 1PPEE 3VXFH 3DFJA 1FONA 1SLVB 2CXVA 1TRYA 3A8CA 1V6DA 1T4VH 1A3EH 5E2PA 1TRNA 4Q7ZA 5FAHA 1Z6JH 3GDUA 4O3TA 3LGWA 1V2TT 4ISOA 3QUMP 1BJUA 2FOBA 5AFZH 1C5TA 4MNVA 4NIXA 1OWKA 1GMCG 1J14A 3JZ2B 3Q76A 4INHA 3DT0H 4CR9A 1LKAA 4X8VH 2V3HH 3V12A 3A89A 2ZFRH 3HK6B 2BDGA 4OS7A 1XUIA 1GBAA 1W2KH 3MO9A 1C5SA 1DY8A 5A0CA 3SOSA 1CT4E 1LVYA 2JH0D 2TPIZ 3BG8A 1D6WA 3P92A 3MH6A 3RXKA 5C1XA 3A81A 4DT7B 2AGIX 1VJ9U 1MKXK 5HM2A 1YPJH 1DY9A 2H6MA 3U8OH 1MBMA 2BLVA 3KIDU 6LPRA 4MLFB 1O5CB 2BY7X 2ZZUH 3MO6A 4U32A 4B1TA 4TPIZ 2AGGX 3S7HB 5IYTA 2XBWA 1HRTH 1BOQA 1O3PB 2ZC9H 4IS5A 1ZGVA 4TYDA 4FUJA 3RU4E 1RIWB 2ZDVH 1DUEA 1CT0E 2PKAA 2IPHA 1W7GH 4ABGA 2SFAA 1GDUA 2ZU5A 1QCPA 2FZZA 1VCPA 2F91A 3LOXA 2WUCA 1TMTH 1P0SH 2Y5HA 1DLEA 1TBRH 1UCYK 3I29A 3EA7A 1GVKB 1AFQB 3HKJB 2JETB 2K1QA 3SUEA 2F3CE 2QC2A 2A5AA 5A0AE 3FAOA 1NRPH 2YNAA 1FIWA 1HAIH 1MCVA 1C1NA 3D62A 3ATKA 1TX6A 3A7WA 1SL3A 3MU8A 1Y3WA 1V2ST 3ITIA 2UUYA 4ISLA 1O2QA 3UR9A 1V2VT 1G9IE 1QRWA 1G2MA 2PSXA 4NWLA 3ATMA 1C1UH 3SUDA 3SORA 4WH8A 1BRAA 2WPIS 3ZZ8A 1TX7A 1GI0A 1X7AC 3A8AA 4KTCA 4Y11E 2ZTYA 3P8GA 2D2DA 1O3HA 1EAWA 3AW0A 1YLDA 3RXCA 2BM2A 4YESB 2A4RA 1V2UT 3RU4T 1TMBH 1EX3A 5L6NH 1T8LA 3TK6A 4ZKNU 1FNIA 4AZ2B 2G4UA 2BHGA 2OCVB 2GMTC 3A7TA 2ZPSA 1UO6A 2RDLA 4HFPB 1Y3YA 1Z8GA 4BTIB 1O2LA 1O2XA 5EW1H 2B5TB 2SGAA 4JYUH 1ACBE 2OC7A 3L3TA 3QZRA 1EJMA 1H8IH 2ZDKA 1CU1A 1A5IA 3E3TA 3BTME 3LU9B 1YPKH 3VXEH 4YT7H 1FY5A 1ZYOA 4R0IA 1LPZB 7GCHG 2PGQB 2H2ZA 3SU0A 3M35A 3VGCC 2BQ6B 1IQLA 1THSH 2FIRH 3P70B 2BVSH 5LPRA 3RXJA 2A31A 1CBWC 2A4GA 1J15A 1BUIA 4QT8C 5C67A 3MNCA 2QV1A 3KCGH 2O8MA 3OY6U 2RCEA 1SFIA 1YPHC 2G55A 1XXFA 2FM2A 3ESTA 2SGPE 2A1DB 1CHGA 1SMFE 1YGCH 2R2MB 1KXCA 1DM4B 5A8YA 1GMHG 3P8FA 4LZ4B 1TNIA 1GI1A 4IN1A 4ABDA 3SI4H 4XBDA 2BY9X 1O3AA 2Y80A 1SFQB 4IC6A 5LPFA 3RXTA 1O5GH 4H4FA 1MH0A 2GV6A 1LHFH 3AVZA 4TWWA 5TCCA 2QN5T 4ZHMU 3RXAA 1GDNA 1QGFA 3B8JA 1TBZH 1EZXC 3S9BA 2BB4A 2F9UA 2QAAA 3FVFB 1C4V2 2HPQH 3BEUA 3PV4A 1XKBC 4A1XA 1T8OA 2XXLA 2J4IA 1QL8A 2H5DA 5DKMA 2RA0A 3HGNA 2AIQA 1Y59T 1L1NA 3OY5U 4PROA 2FOHA 3ZVGA 2PHBA 2SGFE 3PROA 4MNXA 1P8VC 2FX4A 2G5NA 2XYAA 5C3NA 1GBTA 2YOLA 4ZKRU 4MNWA 4XBBA 1C4U2 1O2KA 3SHAH 4TPYA 4ASHA 2VIQA 4NG9H 4I31A 1HJAB 5T6FA 1ETTH 2TGDA 3RDZA 3STIA 1JXPA 2FOGA 3LGYA 3K65B 4UDWH 1OKXA 2STAE 3V0XA 1BBRK 1V2MT 1O31A 2D1JA 4O3UA 2IOTA 1GHZA 2ESTE 1P05A 1Y3VA 1YLCA 2G00A 5F6MA 2PWXA 4I33A 1AU8A 3IITA 1HJ8A 1JWTA 4DW2U 3BTTE 4XDEA 3BEFB 5A0BA 1GBCA 3Q3KA 2GMTB 4I8HA 5EGMA 4DVAU 2H9EH 1P3EA 5E2OA 3D49H 3EAJA 3MYWA 1QTFA 1V2OT 1C5UA 4AFSA 5GXPA 1ARCA 1UCYH 1OWEA 1ELDE 4Y10E 5DK1A 3ZZDA 3PWBA 1F0UA 1TBQH 1DWCH 2ZEBA 2ILNA 1FV9A 1FXYA 5AHGH 1F5LA 1KXDA 3RXBA 3ZZ6A 2XBXA 1H9LB 2UUKB 4X8UH 1OOKB 5GCHG 1TNGA 1F0RA 4Y71A 2ANWA 1ID5H 2BXTH 2P93A 1MQ6A 4GSOA 2ZCHP 4AYVB 2ZF0H 1OYTH 3TJOA 4AG1A 4AX9H 5HXFA 2GZ7A 1GJ4H 1O33A 2Z9JA 1CVWH 2RA3A 3L33A 5EQRA 5DPAA 2AH4X 3PMBB 1GJBB 1C5VA 1Z8RA 3UQOA 1Y3XA 1IQFA 2G5VA 2KAIA 1VGCC 4YOGA 2GKVE 1NRRH 2ZQ1A 4A1VA 5J4QA 3SGQE 3TLOA 3PMJA 3R0FA 1L0ZA 1UK4A 1IQNA 1RRKA 2H9HA 3T5FH 1G30B 3E91A 3MH4A 1NU7B 2ZFTA 1MZDA 1TPSA 2Z3CA 5FPYA 2P3UB 2FXRA 1YCPH 5GJ4B 2P59A 1C9TA 4BAHB 2BX3A 1C9PA 1C5LH 2FYQA 2AS9A 1WCZA 2ZHEH 4XE4A 2ZI2H 2VIPA 1NRQH 2FODA 3GISB 5DP7A 5G4BA 2VVVA 2H5CA 1S85A 1GBBA 1NFXA 1YPMH 2ZQ2A 2WPMS 4Z6AH 2VVUA 4AGJA 1H9IE 1VITH 1XM1A 1LHGH 3RXHA 2A4OA 4OS6A 1O2YA 1MZAA 2AMQA 1BMLA 3EQ0H 1C2FA 4INKA 2V6NA 1JIMA 4FUCA 2ZPRA 1HGTH 1KYNA 1HIAB 1SGTA 5A2MH 4BAKB 4ESTE 2DE8A 1C5MD 2NU1E 1QA7A 4DURA 3RXPA 3A82A 4X6PA 4BANB 2SNVA 1OX1A 1C1WH 1ESBA 1SGNE 2OBOA 1PJPA 1CSOE 1SQOA 2R0KA 2VJ1A 5DJ7A 3A85A 2ANKH 2OTVA 1TQ7B 2VH6A 2XWAA 1NN6A 1BT7A 1TAWA 4FUGA 1C5QA 1GPZA 1ZR0A 2A32A 3BSQA 3F68H 1C1SA 2G52A 2GGVB 3LKWA 1A61H 1QL7A 4AFQA 2Z9LA 2GD4B 1L1JA 3VB6A 4B2CA 5EOKA 2VH0A 5EQSA 3LPRA 3B23B 4MVNA 1HUTH 1UTLM 1WOFA 1HAVB 5I25A 1K2I1 4ZUHA 3AASA 1T32A 2QCYA 2AIPA 6GCHG 3QO6A 3UREA 1XUHA 2QXGA 4OS4A 3ZZAA 1B7XB 1NROH 1MQ5A 2ZHFH 1HAGE 3ATLA 3GOVB 3ZVEA 1UTOA 1DSUA 2ZGCA 3ZVCA 4X8SH 1FPCH 1TGBA 3TH4H 2HOBA 1E35B 2SNWA 1EASA 1V2QT 8GCHF 1NFWA 2HLCA 2BDCA 1GBHA 1P06A 1DSTA 1GJCB 2W7UA 1ZPZA 1TWXB 4IW4E 3V7TA 4WF8A 1CA0B 1SGFA 3SW2B 1L4ZA 3M3VA 2XC4A 4XFQA 1P04A 1HYLA 1O34A 3RXFA 1ZMNA 1RIWC 4ZXYH 4I8JA 3FP6E 1D3TB 1FLEE 3HPTB 1IAUA 1C2LA 4GUXA 1C2JA 3U98H 1N1LA 3KQBA 4O03A 4TWYA 1WTGH 1WTHD 1ELVA 2AGEX 3DD2H 1A4WH 3BTDE 1BTHH 4D8NA 1MD7A 2STBE 1SHHB 1TA2A 1O3MA 1BIOA 3V13A 1XMNB 1EB2A 2J95A 3A84A 1AFQC 2ZCLP 3SO3A 1WSSH 2SGQE 1F0SA 3NWUA 1C2EA 2BLWA