1M9UA

Crystal structure of earthworm fibrinolytic enzyme component a from eisenia fetida
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
VIGGTNASPGEFPWQLSQQRQSGSWSHSCGASLLSSTSALSASHCVDGVLPNNIRVIAGLWQQSDTSGTQTANVDSYTMHENYGAGTASYSNDIAILHLATSISLGGNIQAAVLPANNNNDYAGTTCVISGWGRTDGTNNLPDILQKSSIPVITTAQCTAAMVGVGGANIWDNHICVQDPAGNTGACNGDSGGPLNCPDGGTRVVGVTSWVVSSGLGACLPDYPSVYTRVSAYLGWIGDNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of earthworm fibrinolytic enzyme component a: revealing the structural determinants of its dual fibrinolytic activity.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Earthworm Fibrinolytic Enzyme
total genus 53
structure length 241
sequence length 241
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2002-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1m9uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1m9uA01
1KXAA 1ZMJA 2GCTB 1O2PA 4R8TB 1K21H 4HGCA 3SHCH 4AG2A 1BIOA 2F9PA 2ILNA 2AIPA 1FY5A 3GY6A 3BV9B 3LGTA 3T28A 2FTMA 4NG9H 1UJ1A 4JMYA 3A7WA 4BXSA 1W2KH 3ODDA 2FZZA 1CBWC 1EP6A 4K1EA 3MU1A 1HJ8A 1GBCA 4AYYB 4LZ4B 2ZCKP 1GMHG 2BD7A 3KEEA 2PTNA 3ZZBA 2XCFA 1ZRBA 1GGDC 4KELA 4NA8A 1TBRH 3B23B 4ABFA 1NZQH 1W0YH 2ZPRA 1G3CA 1PJPA 1SB1H 1EAUA 1UO6A 1DUAA 3RMNH 1OX1A 2VIVA 5EXNA 1DM4B 4H4FA 2D8WA 1Z8IB 2FOGA 3L6PA 3BIUH 3P8OA 3V13A 2VWNA 1P11E 4CRAA 2ZPQA 2UWPA 1V2LT 3SO3A 1KXBA 1JIRA 3RMLH 3ZVGA 3M36A 6GCHG 3RP2A 1Z8GA 4RKOB 2ZU4A 3D65E 4I8HA 2Z6BD 3PM3A 2G55A 3Q00A 5GWZA 1WTGH 4NSYA 4X8SH 1GI7B 4UEHH 3A89A 2J2UA 1GCTC 1ANBA 3T25A 2VWMA 5FPYA 2EI7A 3ZVCA 2BVRH 1DVAH 1SBWA 2J38A 1UTMA 4ISNA 4WWYA 1YLCA 3ZZCA 3E16B 5DO4H 4GCHF 2XTTB 1AMHA 3SUEA 2AMDA 1TRMA 2NU3E 1NRNH 1IQFA 2VH6A 3Q3KA 2DE9A 1SLWB 1O2HA 2ZA5A 2OLGA 2VU8E 1QRZA 2WV4A 1FY8E 1DT2A 3NK8A 3KHVA 4K8BA 1TMTH 1PPCE 5JYIA 1O2YA 2NU1E 5J4QA 4Y0ZE 1J14A 1KDQA 1WUNH 2GTBA 1PPEE 3TGKE 1ZMLA 1UVUH 4ABBA 1A61H 2JH0D 1ELAA 1PPGE 1GI1A 3OY6U 1AB9B 1O2OA 3SU5A 2WPIS 2LNCA 4BAQB 3T29A 3FZDA 1S81A 1BITA 5I25A 1OSSA 1O3MA 3MHWU 4DT7B 1D3DB 1UVSH 2HVXA 4J2YB 2C8ZB 5CMXH 4H6TA 4ZHLU 4INKA 2D2DA 1D3PB 1H9IE 1O34A 1O2TA 1AVGH 1K1IA 4JZDH 2AH4X 2UUFB 2AGEX 2OD3B 1UHBB 3NCLA 1Y3VA 3BG8A 3RXAA 3PV4A 4X2WA 1SGFA 1HAPH 2ODPA 1E34B 1SGPE 4FUGA 2PKAA 1GI6A 5DP7A 3BTWE 1GJ7B 2QY0B 3IWMA 1RFNA 1AU8A 2GT8A 2STBE 5EQQA 1QL7A 2ZPSA 1V2JT 1WCZA 3MNBA 1QGFA 5A8YA 1OWKA 1GVKB 4YT6H 5ETXA 2FI3E 3VGCC 2A2QH 3PMBB 3MH5A 1GJDB 1DXWA 2Y7ZA 2EI6A 2G81E 1JIMA 4D9RA 4ISHH 1GHYH 2ZDMA 2PKAB 5F6MA 1HDTH 2VIQA 3MU4A 1DDJA 3L33A 1F92A 1AQ7A 4X6OA 2ZI2H 2HGTH 1FAXA 2BQ6B 1P05A 5EW1H 4ABGA 1A46H 1HJAB 3SUGA 3RU4D 4Q7YA 1IAUA 3GISB 1W10U 3SOSA 1AUJA 2NU4E 5JB9S 1FONA 1P0SH 1ESTA 4OS2A 1P2MA 2PKSB 2W26A 1OP0A 4BTUB 1DXPA 2RG3A 1TE0A 3O8RA 1ZHPA 3K2UA 2ZTZA 1CT2E 1TPAE 3RXCA 1GI4A 5FHTA 2SGEE 4WJG2 4AYVB 1HAOH 3PB1E 3GYLB 1PQAA 3U1JB 4THNH 1FPCH 3BTGE 2P59A 3SV7A 2HALA 2EI8A 4KGAA 1NT1A 5EODA 2ANWA 5A0AE 5C2ZA 4O97A 1QQ4A 5AFYH 1J15A 2SGQE 3A8BA 3M5OA 4XBDA 1O2SA 1INCA 2GCTC 4GVUA 2GVFA 2TPIZ 3OYPA 1GMCF 4I32A 1BQYA 5AFZH 1OPHB 4CH8B 3MH6A 1GBJA 1A7SA 1GI9B 3LJOA 3P95A 1WTHD 1EJMA 5E8EH 1TNHA 5JDUB 2HPPH 1CBWB 1XXDA 1YPHC 1W0ZU 1GWAA 1EATA 3RXBA 3SU3A 1S83A 4OS7A 5T6FA 4CRGA 1C1MA 1NU7B 4ZUHA 1GGDB 1CHOG 2TBSA 6CHAC 3P8FA 1CT4E 2Z9LA 3VB4A 3RXDA 5JBAS 2FTLE 3MU0A 1O5DH 2F91A 1HIAB 1TALA 1MMJN 1LPGB 2W5EA 2GV6A 1K22H 2ANKH 3S0NA 1TGBA 3NXPA 4JZIA 3RXSA 5L2YH 4MDSA 2Z94A 4DOQA 1JRSA 2FP7B 2YOLA 3SUFA 7GCHG 2NWNA 5LH8A 4ABEA 4YZUA 1RTFB 3SV8A 4A92A 4RKJB 4X6MA 3KQBA 4KKDA 2F9OA 1QBNA 2THFB 1HB0B 1UTKA 1GCTB 2B8OH 5TCCA 4FUJA 1O3FA 2Q1JA 1HAHH 5JB8S 1DWBH 2ZU2A 3EQ0H 1P09A 1GPZA 3B9FH 4KTSA 1GBLA 1B7XB 1ELFA 3A86A 3VXFH 1O5GH 1J17T 4ISOA 1KLTA 1ZSJA 1F0RA 4Z0KA 1PPHE 1HRTH 3UPEA 1Z8RA 1W14U 3SGBE 2C4FH 2G00A 2SGFE 1SHYA 1WQSA 4Y11E 4JCNA 1LHEH 3U98H 2LPRA 5DP4A 1QY6A 4BTTB 3WY8A 2ZWLH 3M7QA 4ZHMU 2UWOA 4I7YH 4A1VA 3NPSA 1DSTA 1BMMH 2G5VA 4FUEA 1P2JA 2O8WA 1GI5A 2OINA 2ZQ1A 2ZFFH 3A88A 2ZCHP 3DA9B 4MNWA 1O32A 1QJ1B 1S0RA 2ZCLP 1CA0B 3ENSB 4B2AA 1T8MA 1FIZA 1BDAA 5IYTA 1SQAA 1WYKA 1T4VH 1MU8B 2XRCA 1BBRE 1GHWH 2VIWA 2KAIA 5DG6A 1NRSH 1C5VA 2BX4A 3NZIA 4CRFA 2O8UA 4X1QU 1YBWA 1L4DA 3P92A 1E35B 2A0QB 1OWIA 2DUCA 3GY5A 1HAVA 2GV7A 2R0KA 1G30B 2P8OC 4FUBA 4ZKNU 5C5OA 4BANB 1PFXC 2Q6FA 2PGQB 3RXUA 3F6UH 4FUHA 1AFEH 1ELGA 3F9HA 1ETSH 1E0FD 1V2VT 1GI3A 2ZQ2A 2Q6GA 1W11U 2C90B 5EU8A 5ABWA 1PQ8A 1IQJA 2WV5A 4OS5A 1TA6A 3VFEA 7ESTE 1T32A 1XXFA 3A7YA 1BA8B 2OTVA 1BTHH 1NM6A 1TPSA 5K7RA 3LGYA 3F68H 3A87A 1DFPA 1C5NH 2FESH 3M7UA 2ZECA 4Q2KA 1GBEA 1ZSKA 2HNTC 3EAJA 1UTNA 2H5CA 3NUMA 1HAGE 3P70B 1ZTJA 5F8XA 1C9TA 2R3YA 1GG6B 1PPBH 2GDEH 1ZYOA 5A8ZA 5L30H 2FOCA 1AY6H 2FX6A 8GCHF 3K65B 5C1XA 4MG3A 4HTCH 5PTPA 1VCQA 3KF2A 1ANEA 3OTJE 1O30A 4NIVA 5HYOA 1YPEH 2GKVE 2QYIA 2A32A 1MKXH 1O2KA 1TYNA 1YCPM 3BTHE 4RSPA 2H9HA 3A83A 4GUXA 4NWKA 3TITA 2ZGHA 2B5TB 3ZVAA 4CHAC 2ZHDA 1BRBE 1LQEA 3SV6A 3PYHA 1A0JA 1P02A 5FPTA 2F83A 2VVVA 2HNTE 3AAUA 4NWLA 3RXKA 3GICB 3TPIZ 1ZR0A 4XSKU 2P94A 2PFEA 3MH4A 2BLWA 4Q7XA 4Y79A 2SNVA 1BMAA 1AVXA 1E37B 2ZP0H 2PGBB 3A80A 2HOBA 1C5RA 3ATKA 1AHTH 2EC9H 3ZZ8A 3M5MA 4JZ1A 2Y81A 1D6RA 5HM2A 1CHOF 2Z3DA 4I8LA 2GD4B 2FOFA 4YT7H 2ZGXH 1SFIA 3U69H 1TOCB 4TWWA 4B76A 3IITA 1O5BB 2G8TA 1P9SA 1XUGA 1WOFA 4LOYH 2PW8H 1WU1A 3Q3XA 1V2KT 1PYTC 1ELTA 1RTKA 5HXFA 1EUFA 2CHAB 1IQMA 1TBZH 3M61U 2CF8H 1YC0A 2QXGA 3UR6A 3HPTB 3TNSA 5EOKA 2KAIB 1GBMA 1SFQB 4XBCA 4A1XA 1BOQA 2C8XB 3AW1A 1MTWA 2C8WB 2BXUH 4DVAU 4GHQA 1A4WH 1RD3B 2ZDNA 1HAIH 4HZHA 2F9UA 1UTPA 2BZAA 3M5LA 3RXMA 4ZAEA 1V2OT 2OUAA 3GDVA 3PTNA 1TBQH 3UTUH 2ZFSA 5BPEA 3BTKE 1VITF 2FOMB 4CBOA 2DE8A 3SQHE 2A45B 4BAKB 1RRKA 3ZYDA 3UOUA 3P8NA 4Q7ZA 4MPUA 2B9LA 3LU9B 2ASUB 3RXLA 1P06A 4K2YA 2VH0A 3GOVB 1ACBE 2QXJA 2BX3A 1GBBA 3CP7A 1TX6A 4WY3A 3V3MA 1CA8B 4D8NA 5FX6A 2B0FA 4YM9A 1JMOH 5EW2H 1C5MD 3V7TA 3TK6A 2V3OH 3Q76A 4X1SU 3GCOA 2AS9A 1RTLA 4WH6A 1VITG 5GCHG 1CO7E 3KCGH 2TGDA 4JK6A 3BEUA 4AZ2B 1ANDA 1FI8A 1BTUA 3SUDA 3ATLA 3MO6A 4X1PU 3TJNA 1N8OC 3T2NA 2ZDVH 2AMPA 1QBVH 3S7KB 1NRPH 3PTBA 1XKAC 1C1SA 1MZAA 3TH2H 1UCYE 1YYY1 1BCUH 3LDXH 3LONA 3R0FA 2IOTA 2QC2A 1ELEE 1FAKH 1P2OA 1BUIA 1LMWB 4OS1A 2C8YB 2I6QA 2BDCA 1TOMH 3ZVFA 4MNXA 1RXPA 3SU1A 3UQVA 4VGCC 1A5IA 2BOKA 4BOHA 2AGIX 2RCEA 4DJZB 5LPEA 1P8VC 1Y3YA 1QJ7B 3RU4T 1W7XH 4Y6DA 2GCHF 6LPRA 3A84A 3O8CA 1TMBH 3RXVA 1SL3A 5LPFA 2XCNA 1QJ6B 4AB9A 1BBRK 4CR9A 3T5FH 1EASA 2FMJA 1EZSC 4X2VA 1FIWA 1KLIH 1V2ST 1T7CA 2YNAA 1F0TA 4CBNA 1HLTH 3UQOA 2UUYA 3SW2B 3P8GA 1BTYA 2Q6DA 1TRYA 1V6DA 1UVPA 4IW4E 1GJCB 2CXVA 3VB5A 2V0BA 1T8LA 1S84A 1DE7H 1OYTH 1MQ6A 1V2TT 5CHAC 2HNTF 1DPOA 2QA9E 2SNWA 2FI4E 3FP7E 2BVXH 1TQ0B 1HBTH 4K1TA 3NKKA 4CHAB 1C1UH 5LGOA 3SNCA 3UUZA 2F3CE 3HK6B 1CHGA 1CU1A 7KMEH 3ZZ3A 1YPGH 4ZH8A 3RXHA 1OOKB 3M5NA 1YCPH 2A4QA 1MCVA 2SFAA 3AASA 4JZEH 2HRVA 1DICA 1DOJA 2BY6X 4DG4A 4U32A 2FLBH 1GDNA 3SI4H 3P17H 5L2ZH 1TIOA 2FX4A 3E8LA 3F9EA 1GHXH 2AIQA 5IDKA 2OC1A 4O9VA 3SZNA 1ETTH 1Z71A 1AZZA 4YO9A 1CT0E 3HGPA 1O3CA 4K8YA 1A3EH 2BLOA 2FOHA 4XDEA 1OYQA 1C5XB 2XC5A 2PUXB 4FUFA 3H5CB 2JETC 1ZHRA 3PWCA 4CRBA 2K1QA 1MU6B 1G2LA 5ESBA 3CS0A 1Z1JA 3MNSA 4MVNA 3RMOH 1AVWA 6ESTA 3O8DA 2BDAA 1NU9A 1XUFA 5A2MH 4FVDA 1DY8A 5FCRA 2BB4A 1H8IH 2GZ9A 4OS4A 3RM0H 1O3IA 1GJBB 2ZU5A 3EA7A 1PPFE 1TNKA 1NFUA 2D1JA 3JZ2B 4X0WU 2G51A 3FZZA 1C9PA 1SOZA 1EB1H 1ZLRA 1SHHB 3BTFE 2ZDLA 1Y3XA 1CGJE 1YCPK 2TRMA 4JYUH 1S85A 4OS6A 3GCHC 3ZZAA 1TA2A 1SGNE 3LGUA 1FZZA 2PHBA 2BXTH 5A8XA 4AN7A 1SGDE 3TK5A 5F8ZA 3ZZ7A 1OS8A 3E90B 1IQLA 3UFAA 4H6SB 4QT8C 4WH8A 1IHTH 1Q2WA 1TFXA 3OU0A 4NIWA 4HFPB 1UVOA 3IG6B 4NFFA 4GLYA 1RJXB 4D7FA 2ZHEH 2ZZUH 1JRTA 3M3SA 1YF4A 1C1TA 1D6WA 1FLEE 1P3EA 3SU2A 2XYAA 1GI8B 1WQVH 2A4GA 3E3TA 2PR3A 3HK3B 4D76A 4U2WA 3LC5A 1HAYB 1DX5M 2OBOA 3ZVEA 2OXSA 1FMGA 1C2EA 3URCA 3QN7A 1PQ7A 1ELDE 1V3XA 2VWLA 1C1RA 2C3SA 1AFQB 1HAVB 1EB2A 2F9BH 7LPRA 1G3BA 1ARBA 3KNXA 1V2PT 1O2QA 1RIWB 4ABIA 4B75A 1DANH 1C5PA 2Y82A 1UHBA 3RXQA 2XBWA 1H4WA 2ZTXA 5HMAA 1HUTH 1OP8A 5A0CA 1XVMA 1D4PB 2FWWA 2WYJA 1LVYA 1KXDA 3RXEA 1GI0A 1A0HB 1YKTA 3BSQA 2BLQA 2BVSH 1FN6A 3PMJA 4WMDA 1HXEH 3D62A 1ZMNA 3ZVBA 2NU2E 3I78A 2RA0A 1TNJA 1THPB 4E05H 4ISIH 5E0GA 1V2MT 3SJ9A 2XNIA 2F9VA 3TK9A 2BDGA 4YOJA 2IJOB 1O2NA 1NROH 4INHA 4F4OC 2ZC9H 1Z6EA 1MQ5A 1PPZA 1MTVA 2VVUA 4NIXA 1EPTB 1HFDA 1A5HA 1XUJA 3ESTA 4E7NA 3UNSA 3U1IB 2AERH 4J1YA 1EAWA 2O9QA 3KN2A 5CE1A 1GJAB 1ARCA 1O2GH 2XBXA 2XXLA 1Y3WA 2WPMS 3ZZ4A 1GMDG 3M3VA 2FOBA 2AFQB 1KTSB 3S9AA 1LO6A 1P04A 2ZEBA 1DWDH 2D26C 4YOIA 3A85A 1O5EH 2A7CA 3BTDE 2FYRA 5FCKA 4KTUA 2BD5A 5DP9A 1YP9A 1H9HE 1NPMA 1X7AC 2OC8A 1QNJA 2PV9B 3TH4H 5EPYA 1OP2A 1UK4A 2ZDKA 5TCAA 1GHAG 2WPKS 1K1PA 1VGCB 2ANYA 5LPRA 5B6OA 3AAVA 3ATWA 2BDYA 2QXIA 4NFEA 1P2QA 1LDTT 1Z7KA 2OCVB 2FM2A 2ZFTA 3GYMA 1XX9A 2FODA 2BD4A 3RXIA 1ELCA 4X6NA 2P95A 3OX7U 3DT0H 3P6ZB 9LPRA 1O2RA 4Y76A 2H2ZA 2UUJB 1SGEE 1PQ5A 1O3KA 2BD8A 1H1BA 1IHSH 1QHRB 1HJAC 1V2RT 1W3CA 1O3PB 1PYTD 2WYGA 3SI3H 1P57B 2IN2A 1GHZA 4BTIB 1V2QT 2C93B 1EP5A 1EX3A 5C5NA 3RXRA 1NN6A 3PLKA 4MLFB 1QL9A 3ZZ6A 3OSYA 2ALVA 1ELBA 1H9LB 1ZTKA 2J9NA 1MZDA 3STJA 3RXOA 1P10A 2ZO3H 2H5DA 1DITH 3AW0A 1CQQA 5C20A 5EQSA 4NA9H 5DGJA 4WXVA 3SV9A 4SGBE 4MPVA 1GJ4H 1V2UT 4Y7AA 1WSSH 5E0JA 3QZRA 2R0LA 5JBBS 2A1DB 1FNIA 4NSVA 3I29A 4AX9H 4BNRA 2AYWA 2SGAA 4K60A 2A5AA 2QF0A 1WAYB 2J94A 1L0ZA 1EPTA 2FDAA 4AGJA 1DLKB 1N1LA 3F1SB 5DJ7A 1C2HA 1NO9H 2GMTB 2H1UA 2ZKSA 2H9EH 3UOPA 2QAAA 4BAMB 1RIWC 1GBIA 1DUEA 3TJOA 1K1MA 1T4UH 1AN1E 3BN9A 3SJKA 5DK1A 1GBFA 1SSXA 1BB0B 2ZHWH 2ESTE 5DPAA 4KP0A 2V35A 4FU7A 1VJ9U 3NWUA 4I33A 1GJ8B 1AKSA 1BHXF 1O3OA 1SGFG 4AFZA 2BDBA 1BJUA 1G36A 3MH7A 1ANCA 1UVTH 3CS7A 3RU4E 3A8DA 1LTOA 3A7TA 4GAWA 1BMNH 1WV7H 2J95A 1S6HA 5H4IB 1L2EA 2FO9A 4DW2U 4ISLA 3GY8A 7GCHF 5GJ4B 3PO1B 1TGTA 3SN8A 1A3BH 4ZKOU 1FPHH 1F0UA 1ZHMA 2P3UB 4IMZA 5T6DA 5DP6A 2XW9A 1VGCC 4GCHG 4XOJA 3EE0B 2A5KA 1F5KU 1GBTA 2QXHA 1ID5H 4X8VH 1IQKA 1K1LA 1F2SE 2QN5T 2XBVA 1KIGH 5HM9A 1BZXE 1SGIB 2CN0H 2HLCA 3M35A 2NU0E 4LXBH 1BTWA 3RDZA 3UIRA 1B0EA 1XKBC 1Z8JB 2CMYA 3O8BA 4I8KA 3AVZA 1SLUB 2P3TB 2Z3EA 5FAHA 1LHCH 1C5UA 3ZYEA 3LGVA 3GY3A 3SORA 5AF9H 1TX8A 1UCYK 5C3NA 1O2JA 3VB3A 2Z3CA 1KSNA 2ZGBH 2EA3A 2BD9A 1XUIA 2A7HA 2OC0A 1BBRH 4A6LA 4YTAA 3ZVDA 3MO3A 2FXRA 2H6MA 1FXYA 1ZJKA 2XC0A 1EJAA 4WVPE 3PWBA 2Z9JA 2Y5HA 4ZXXH 1ZGVA 3A7ZA 1D3TB 1T31A 4NGAH 1GVLA 6GCHF 2FS9A 5EXMA 4AGKA 3EA8A 4X8UH 5FPSA 3MYWA 1KXCA 1L1JA 3FP8E 4AFSA 4K69A 1GDQA 1C1QA 1J8AA 3LJJA 1EOJA 2J4IA 3VB7A 4DY7B 2JH5D 3MO9A 1L1NA 1Y59T 1LVOA 1G32B 1MTSA 3LH3A 3JZ1B 4IMQA 2ZHQH 1NC6A 1ZJDA 2VGCC 3A7VA 3DD2H 1EZXC 1C5ZB 1IOEA 1O2LA 4NIYA 4UDWH 1C2LA 1THRH 1LQDB 4NZLA 1K1NA 2P3FH 1TONA 4K3JA 1N6XA 1GCDA 1WBGB 1QQUA 5FXLA 1IQNA 1IQEA 5C1YA 1MH0A 3HKIB 1ZPBA 4FUDA 4IC5A 3TH3H 4ABAA 1ZTLA 2R3UA 3A82A 1C1VH 2GZ7A 1OWDA 4F49A 1DWCH 2CHAC 1VITH 3E0PB 1UMAH 1GVZA 2WUCA 1BRAA 4X6PA 3VXEH 1Y5UT 1BJVA 1F5RA 3SJIA 4ESTE 1ORFA 3Q77A 3QK1A 1C4U2 1AI8H 1S0QA 4AOQA 1C1PA 3DFLA 3SGAE 1YPLH 2R9PA 2ZU3A 1QR3E 1P2KA 2ULLA 1GHBG 1C2FA 5TJXA 4VGCB 4O3TA 3SHAH 2BZ6H 5FBEA 2HWLB 9ESTA 1GG6C 2GT7A 1O0DH 1O3EA 4I8JA 2TIOA 1SQTA 4IGDA 5E2PA 1A1RA 4YLUA 1E38B 4YLQH 2FPZA 3MU8A 1O37A 3RXGA 4AFQA 1JXPA 4B74A 1NRRH 1SGQE 1AE5A 3RC6A 1SR5C 1Q31A 4CREA 1AB9C 3ATIA 1O2WA 4MQAA 4Y8XA 2ODQA 1U6QA 3LGIA 1K28D 3SQEE 5DP3A 3ZZDA 5AVDA 2J34A 3SBKA 4O3UA 1C4V2 3VB6A 4OGXA 2ZHFH 2JH6D 1E36B 1P01A 2VJ1A 4XE4A 3D23A 1G9IE 1SG8B 5EGMA 1W13U 1ESAA 3SNBA 2AEIH 4B2CA 3QZQA 1HAZB 4H42U 3PMHB 1RS0A 4ZMAH 2J92A 2ZGCA 3W95A 3FFGA 4NA7A 2HPQH 3OY5U 1SVPA 3ODFA 4E7RG 1YPKH 1P12E 4GSOA 4E06H 2V3HH 1EXFA 3K6ZA 4UD9H 2O8TA 4A5TS 1EKBB 1THSH 3M7TA 4MNYA 3K9XB 3GCTG 5I46H 1C2JA 3T27A 3KQDA 2ZGJA 3FVFB 1LKAA 3T62A 1LVBA 1TB6H 2BY7X 2ZFRH 1XM1A 1FY4A 1GJ6A 4DIIH 1N8OB 3SU4A 1AO5A 1C2DA 1ESBA 1GMCG 2WINI 3GCNA 4IN1A 2P16A 2B7DH 2GP9B 4LZ1H 8KME2 4ABDA 1YGCH 2QCYA 1ZGIA 2A31A 4ASHA 4A7IB 5F8TA 3RM2H 2P93A 1O36A 5G4BA 3QTVH 1EAXA 1AWHB 1KTTB 2ZF0H 5EXLA 3EDXB 3EGKH 3S9CA 1C2MA 1V2NT 2BQWB 3F9FA 4FUCA 1DWEH 3U8TH 4AB8A 1HV7A 1O3DA 1C2GA 1NESE 3RLWH 2ZNKH 1MKWK 3E91A 3RXTA 2WPLS 2UWLA 3GY2A 1DSUA 1DY9A 3QX5H 4WF8A 3PMAB 1KXFA 2Y5GA 3U8RH 3VEQB 3SV2H 3LIWA 4WMEA 1P2IA 2GMTC 1AWFH 4Y7BA 2CJIA 1B5GH 4FXGH 1GL1A 3C1KA 3GY4A 4TYDA 5GCHF 1LVMA 1SGTA 2W7SA 4WXIA 1UTLM 2VIDA 4R0IA 5JPMH 1QBOA 2PWXA 1SLXB 2BTCE 1IQIA 1TPOA 1EOLA 1KLJH 1HXFH 1D3QB 2ALPA 4UFFH 1FJSA 3S9BA 1O35A 1O3GA 4RN6A 3SGQE 2OQ5A 3TU7H 1ZPZA 1ZSLA 2A5IA 1QCPA 1QA0A 3BTME 1TX7A 2QGRA 2ZFQH 4TPYA 5GPIB 2G4UA 1C2KA 1GMHF 1CVWH 1LPKB 4Y8YA 4ZHAA 3E0NB 2PTCE 1C5WB 1GHVH 1O2VA 2VVCA 3QO6A 4B2BA 3D49H 4IN2A 1GBAA 4Y71A 4NCYA 1MKWH 2Z9KA 1MD8A 1QA7A 1QTFA 1GI2A 2H9TH 3A7XA 2Z9GA 1T8NA 2VNTA 2VGCB 4X1RU 1SMFE 2ZG0H 3BIVH 1JOUB 5HGGA 4TWYA 2A4RA 2QF3A 3KIDU 4D9QA 2CV3A 1MAXA 1FN8A 3HGNA 1GJ9B 4OGYA 3GCHB 3ITIA 4IS5A 1HJ9A 1O2MA 4X8TH 1P03A 2A2XH 1LKBA 2JETB 2FI5E 4B1TA 2FEQH 3KQCA 4CRCA 1Z6JH 4X2YA 1ZPCA 4MNVA 1CSOE 3ZZ9A 2P8OB 2BDIA 5CHAB 1Q3XA 3E1XB 1EZUC 3H7OA 1LHGH 1OWEA 4IC6A 4UFGH 2ZIQH 2ZFPH 1HYLA 3EYDA 1GJ5H 2VB0A 1EAIA 4I8GA 2Y7XA 1P3CA 5F03A 4FUIA 4X2XA 4U01A 1YPHE 2VIPA 1NRQH 2G4TA 1LHFH 4AFUA 2O8LA 3B8JA 1GBHA 2SGDE 2FOAA 1BRUP 1OWHA 3M3TA 1VCPA 4TY6A 4JK5A 1QB6A 2F9NA 1S6FA 1TWXB 3V0XA 1QIXB 4Y0YE 1TGSZ 1O3LA 2BY8X 1C5TA 1XUHA 5EG4A 3LKWA 3QGJA 2ANMH 1NFYA 1AFQC 2ODYB 1O31A 3DFJA 2XC4A 1MTNB 1G2MA 1NY22 3U9AH 1TNGA 3UNRA 2RDLA 3K6YA 1QRXA 1K1OA 3RLYH 4SGAE 1D9IA 3MTYA 3TJUA 2OP9A 2PSYA 4JYTA 3W94A 1Y5AT 1VCWA 3GDSA 1QB9A 1O33A 3M37A 3N7OA 3SNEA 3BG4C 1MKXK 3BEIB 1T8OA 4ABHA 2WPHS 5GXPA 2A4OA 3SU6A 4BAHB 3RC5A 1ELVA 3R3GB 2WPJS 1YM0A 1RGQA 1Z1IA 1A0LA 4JYVH 4GHTA 1HCGA 1HNEE 3F9GA 1H8DH 3QWCH 1AD8H 1O3NA 1IQHA 3FAOA 1CA0C 4A1TA 1GDUA 5EPNA 3QGNB 1CE5A 5J4SA 3TGJE 2BQ7B 1HIAA 1W7GH 1OWJA 2R2WU 1EPTC 1LCYA 1J16A 1L4ZA 3LT3A 1A2CH 3V12A 1KY9A 3S7HB 1MCTA 3ELAH 4FU9A 1EZQA 4K1SA 4ZKSU 1ZZZA 1BTZA 3BTQE 3FANA 4FVBA 1K1JA 3SU0A 1O3AA 2AMQA 4TPIZ 3VPKA 4HI3A 3QUMP 1TPPA 3GDUA 1C5QA 1O5CB 4B71A 3BEFB 5DP5A 4O03A 2M5TA 2OBQA 3MNXA 3MI4A 2Y5FA 5E2OA 3UY9A 2BYAX 2GX4A 2BM2A 1QFKH 2BOHB 1FQ3A 5T3HA 1GBKA 1HPGA 1SQOA 2JKHA 3RXJA 1K2I1 1FUJA 2Y6TA 3RXPA 1FY3A 1F5LA 3C27B 1Y3UA 3TGIE 2R2MB 3CENA 3BF6H 1QL8A 2BY5X 1G37A 1FV9A 1GHAF 1SGCA 4ABJA 1OKXA 3MWIU 4FU8A 1UCYH 1YPMH 2QIQA 2VINA 1K9OE 3ZV9A 1O5AB 8LPRA 1EQ9A 4MPXA 3T26A 3STIA 3HKJB 1C5LH 5E0HA 3SNAA 1ZOMA 3ATMA 1O5FH 1SI5H 5T6GA 3LGWA 2FOEA 1N6YA 1BMLA 1C1NA 4BXWA 2XBYA 2PSXA 1Y5BT 2PLXA 5GDSH 2VWOA 2YNBA 1C1OA 4B73A 1JBUH 1S5SA 3TLOA 4MTBA 4Q80A 2FS8A 1TAWA 1TGNA 2VIOA 4UFDH 1TNLA 1J9CH 4KTCA 5FBIA 3FP6E 4YOGA 3TIUA 4UE7H 1GBDA 1C5OH 2QV1A 1G3EA 1AIXH 8ESTE 4MPWA 5A09A 1YLDA 4AORA 1NS3A 2A7JA 3A8CA 2BD3A 5EQRA 4PROA 1VZQH 1C5SA 1TGCA 1UTJA 3SJOA 3U8OH 2BDHA 3LC3A 3UNQA 1NTPA 1ABIH 4X1NU 2BD2A 1DS2E 4DCDA 3E6PH 5GIBA 1C1WH 4UONA 4BAOB 1BT7A 2OC7A 3GY7A 2W3IA 3A81A 4Z6AH 5K0HA 3Q3YA 1LPZB 1EJNA 3SJ8A 1W8BH 2O8MA 4M7GA 3MFJA 5C1UA 2GGVB 1A5GH 1SGRE 1UTOA 1G3DA 2AGGX 3LPRA 1KXEA 1MTUA 1P9UA 1MAYA 4Y8ZA 1QB1A 1AGJA 2GCHG 1AKSB 1F7ZA 3I77A 3TJVA 3UREA 1O39A 3SNDA 1SOTA 4AG1A 1TQ7B 1TLDA 4ZROA 2STAE 3PLBA 3MOCA 3LOXA 1ZRKA 1ETRH 2RA3A 3QDZB 1M9UA 4U30A 1P2NA 4YESB 5BRRE 3EA9A 1SLVB 5ESTE 3GCTF 5A0BA 5JBCS 3MU5A 2UUKB 1BRCE 1O38A 3PROA 2PKSC 1UK3A 1O2ZA 3RXFA 3BTEE 4GPGA 3TNTA 1AUTC 1DLEA 1ABJH 3MNCA 1MBQA 2FIRH 2Z9IA 2FLRH 1JWTA 1XMNB 5AHGH 1MUEB 1CGHA 3ZZ5A 3L3TA 2GZ8A 1NFWA 2OQUA 2TGPZ 1VJAU 8GCHG 4K5ZA 2ZTYA 3QTOH 1VR1H 2CF9H 3LH1A 2FYQA 1OXGA 1NFXA 2Y80A 3QLPH 3RMMH 1C4Y2 1LHDH 2BHGA 1BTXA 4CR5A 4UFEH 2PUQH 1O3BA 3UWJH 4D7GA 1TRNA 1B0FA 1V2WT 4IBLH 4NZQA 1XVOA 3A8AA 1QURH 3RUOA 2SGPE 1MD7A 3DUXH 3VGCB 2V6NA 5FX5A 1XUKA 3BTTE 2WUBA 2W3KA 2ZDAH 3URDA 3BG4B 1KYNA 3G01A 3DHKH 2GDDA 1UTQA 4XFQA 1UK2A 5L6NH 1F0SA 4INLA 3RC4A 3KGPA 2TGAA 4TY7A 1S82A 1MBMA 2Z7FE 3KL6A 5JBTA 1TNIA 4ZXYH 3ZV8A 1HAXB 1BHXB 3S69A 1HGTH 1O2XA 1TABE 1C2IA 2BLVA 4I31A 1SGYE 1BTPA 4ZKRU 2EEKA 1GL0E 2IPHA 2ZU1A 3PO1C 4WMFA 1GHBF 2W7UA 6CHAB 1Y8TA 3HATH 1CGIE 2G52A 1O2UA 2BMGB 1QRWA 1FDPA 4CH2B 1L1GA 1IQGA 1W12U 4Y10E 1KDQB 4CRDA 2I6SA 1SPJA 2TGTA 2XWBI 4DGJA 1YPJH 4DURA 4DIHH 3TVJB 1C5YB 3MMGA 1GMDF 3H7TA 2G5NA 1FY1A 3UWIA 5C67A 1AE8H 4XBBA 1O3JA 1O3HA 2CGAA 5DP8A 1AZ8A 1TMUH 1MTNC 1O2IA 2BY9X 5DKMA 4JZFH 3UR9A 2XWAA 4LK4A 1SC8U 3PLPA 3KQEA 5SGAE
chains in the Genus database with same CATH superfamily
1FX0B 1KXAA 1ZMJA 2GCTB 4YXWD 1O2PA 4R8TB 2LELA 1K21H 4HGCA 3SHCH 4P00A 4AG2A 1BIOA 2F9PA 2ILNA 2AIPA 1FY5A 3GY6A 3BV9B 3LGTA 3T28A 2FTMA 4NG9H 1UJ1A 4JMYA 3A7WA 2J98A 4BXSA 1W2KH 3ODDA 2FZZA 1CBWC 1EP6A 4K1EA 3MU1A 1HJ8A 1GBCA 4AYYB 4LZ4B 2ZCKP 1GMHG 2BD7A 3KEEA 2PTNA 3ZZBA 2XCFA 1ZRBA 2YMSB 1GGDC 4KELA 4NA8A 1TBRH 3B23B 4ABFA 1NZQH 1W0YH 2ZPRA 1G3CA 1PJPA 1SB1H 1EAUA 1UO6A 1DUAA 3RMNH 1OX1A 2VIVA 1YY3A 5EXNA 1DM4B 4H4FA 2D8WA 1Z8IB 2FOGA 3L6PA 3BIUH 3P8OA 1WDIA 3V13A 2IPQX 1WXRA 2VWNA 1P11E 4CRAA 2ZPQA 2UWPA 1V2LT 3SO3A 1KXBA 1JIRA 3RMLH 3ZVGA 3M36A 6GCHG 3RP2A 1Z8GA 4RKOB 2ZU4A 3D65E 4I8HA 2Z6BD 3PM3A 2G55A 3Q00A 5GWZA 1WTGH 4NSYA 4X8SH 1GI7B 4UEHH 3A89A 2J2UA 1GCTC 1ANBA 3T25A 2VWMA 5FPYA 2EI7A 3ZVCA 2BVRH 1DVAH 1SBWA 2J38A 1UTMA 4ISNA 5IK2D 4WWYA 2J5UA 1YLCA 3ZZCA 3E16B 5DO4H 4GCHF 2XTTB 3OAAD 1AMHA 3SUEA 2AMDA 1TRMA 2NU3E 1NRNH 1IQFA 2VH6A 3Q3KA 2DE9A 1SLWB 1O2HA 2ZA5A 2OLGA 2VU8E 1QRZA 2WV4A 2KCPA 1FY8E 1DT2A 3NK8A 3KHVA 4K8BA 1TMTH 1PPCE 5JYIA 1O2YA 2NU1E 5J4QA 4Y0ZE 1J14A 1KDQA 1WUNH 2GTBA 1PPEE 3TGKE 1ZMLA 2EY4C 1UVUH 4ABBA 1A61H 2JH0D 1ELAA 1PPGE 1GI1A 3OY6U 1AB9B 1O2OA 5CDFE 3SU5A 2WPIS 3WWBA 2LNCA 4BAQB 3T29A 3FZDA 1S81A 2M2AA 3VG8A 1BITA 5I25A 1OSSA 1O3MA 3MHWU 4DT7B 1D3DB 1UVSH 2HVXA 4J2YB 2C8ZB 3FN8A 5CMXH 4H6TA 4ZHLU 4INKA 2HVYB 2D2DA 1D3PB 1H9IE 1O34A 1O2TA 1AVGH 1K1IA 4JZDH 2AH4X 2UUFB 4FETA 2AGEX 2OD3B 1UHBB 3NCLA 1Y3VA 3BG8A 3RXAA 3PV4A 4X2WA 1SGFA 3FO8D 2ODPA 1HAPH 1E34B 1SGPE 4FUGA 2PKAA 3GS9A 1GI6A 4RI0A 5DP7A 3BTWE 1GJ7B 2QY0B 3IWMA 1RFNA 1AU8A 2GT8A 2STBE 5EQQA 1QL7A 2F4LA 2ZPSA 1V2JT 1WCZA 3MNBA 1QGFA 5A8YA 1OWKA 1GVKB 4YT6H 5ETXA 2FI3E 3VGCC 2A2QH 3PMBB 3MH5A 1GJDB 1DXWA 2Y7ZA 2EI6A 2G81E 1JIMA 4D9RA 4ISHH 1GHYH 2ZDMA 2PKAB 5F6MA 1HDTH 3EE7A 2VIQA 1K0HA 3MU4A 1DDJA 3L33A 1F92A 1AQ7A 4X6OA 2ZI2H 2HGTH 1FAXA 2BQ6B 1P05A 5EW1H 4ABGA 1A46H 1HJAB 3SUGA 3RU4D 4Q7YA 1IAUA 3GISB 1W10U 3SOSA 3SYJA 1AUJA 2NU4E 5GNDA 5JB9S 1FONA 1P0SH 1ESTA 4OS2A 1P2MA 2PKSB 2W26A 4TSFD 1OP0A 4BTUB 2YMSD 1DXPA 2RG3A 1TE0A 3O8RA 1ZHPA 3K2UA 2ZTZA 1CT2E 1TPAE 3RXCA 1GI4A 5FHTA 2SGEE 4WJG2 4AYVB 1HAOH 3PB1E 3GYLB 1PQAA 3U1JB 4THNH 1FPCH 3BTGE 2P59A 3SV7A 2HALA 2EI8A 3UAIC 4KGAA 1NT1A 5EODA 2ANWA 3F0OA 2KCYA 5A0AE 5C2ZA 4O97A 1QQ4A 5AFYH 1J15A 2SGQE 3A8BA 3M5OA 4XBDA 1O2SA 1INCA 2GCTC 4GVUA 4F55A 2GVFA 2TPIZ 3OYPA 1GMCF 4I32A 1BQYA 5AFZH 3FOAA 1OPHB 4CH8B 3MH6A 1GBJA 1A7SA 1GI9B 3LJOA 3P95A 5KECA 1WTHD 1EJMA 5E8EH 1TNHA 3OEED 5JDUB 2HPPH 1CBWB 1XXDA 3N7EA 1YPHC 2KCAA 1W0ZU 1GWAA 1EATA 3RXBA 3SU3A 1S83A 4OS7A 5T6FA 4CRGA 1C1MA 1NU7B 4ZUHA 1GGDB 1CHOG 2TBSA 6CHAC 3P8FA 1CT4E 2Z9LA 3VB4A 3RXDA 5JBAS 2FTLE 3MU0A 1O5DH 2F91A 1HIAB 1TALA 1MMJN 1UW7A 1LPGB 2W5EA 2GV6A 1K22H 2ANKH 3S0NA 1SKYE 1TGBA 3NXPA 4JZIA 3RXSA 5L2YH 4MDSA 2Z94A 4DOQA 1H8ED 5CHBA 1JRSA 2FP7B 2YOLA 3SUFA 7GCHG 2NWNA 5LH8A 4ABEA 4YZUA 1RTFB 3SV8A 4A92A 4RKJB 4X6MA 3KQBA 4KKDA 2F9OA 1QBNA 2THFB 1HB0B 1UTKA 1GCTB 2B8OH 5TCCA 4FUJA 1O3FA 2Q1JA 1HAHH 5JB8S 1DWBH 2ZU2A 3EQ0H 1P09A 1GPZA 3B9FH 4KTSA 1GBLA 1B7XB 1ELFA 3A86A 3VXFH 1O5GH 1J17T 4ISOA 1KLTA 1ZSJA 1F0RA 1NBMD 4Z0KA 1PPHE 1HRTH 3UPEA 1Z8RA 1W14U 3SGBE 2C4FH 2G00A 2SGFE 1SHYA 1WQSA 4Y11E 4JCNA 1LHEH 3U98H 2LPRA 5DP4A 1QY6A 4BTTB 3WY8A 2ZWLH 3M7QA 4ZHMU 2UWOA 4I7YH 4A1VA 3NPSA 1DSTA 1BMMH 2G5VA 4FUEA 5EJLA 1P2JA 2O8WA 1GI5A 2OINA 2ZQ1A 2ZFFH 3A88A 2ZCHP 3DA9B 4MNWA 1O32A 1QJ1B 1S0RA 2ZCLP 1CA0B 3ENSB 4B2AA 1T8MA 1FIZA 1BDAA 5IYTA 1SQAA 1WYKA 1T4VH 1MU8B 2XRCA 1BBRE 1GHWH 2VIWA 2KAIA 5DG6A 1NRSH 1C5VA 2BX4A 2CK3D 3NZIA 4CRFA 2O8UA 4X1QU 1YBWA 1L4DA 3P92A 4RT1A 1E35B 2A0QB 1OWIA 2DUCA 3GY5A 1HAVA 2GV7A 2R0KA 1G30B 2P8OC 4FUBA 4ZKNU 3CNRA 5C5OA 4BANB 1PFXC 2Q6FA 2PGQB 3RXUA 3F6UH 4FUHA 1AFEH 2JDID 1ELGA 3F9HA 1ETSH 1E0FD 1V2VT 1GI3A 2ZQ2A 2Q6GA 1W11U 2C90B 5EU8A 5ABWA 1PQ8A 1IQJA 2WV5A 4OS5A 1TA6A 3VFEA 7ESTE 1T32A 1XXFA 3A7YA 1BA8B 2OTVA 1BTHH 1NM6A 1TPSA 5K7RA 3LGYA 3F68H 3A87A 1DFPA 1C5NH 2FESH 3M7UA 2ZECA 4Q2KA 1GBEA 1ZSKA 2HNTC 3EAJA 1UTNA 2H5CA 3NUMA 1HAGE 3P70B 1ZTJA 5F8XA 1C9TA 2JJ2D 2R3YA 1GG6B 1PPBH 2GDEH 1ZYOA 5A8ZA 5L30H 2FOCA 1AY6H 2FX6A 8GCHF 3K65B 2KX4A 5C1XA 4MG3A 4HTCH 5PTPA 1VCQA 3KF2A 1ANEA 3OTJE 1O30A 4NIVA 5HYOA 1YPEH 2GKVE 2QYIA 2A32A 1MKXH 1O2KA 1TYNA 1YCPM 3BTHE 4RSPA 2H9HA 3A83A 4GUXA 4NWKA 3TITA 2ZGHA 2B5TB 3ZVAA 4CHAC 2ZHDA 1BRBE 1LQEA 3SV6A 3PYHA 1A0JA 1P02A 5FPTA 2F83A 2VVVA 2HNTE 3AAUA 3OFND 4NWLA 3RXKA 3GICB 3TPIZ 1ZR0A 4XSKU 2P94A 2PFEA 3MH4A 2BLWA 4Q7XA 4Y79A 2SNVA 1BMAA 1AVXA 1E37B 2ZP0H 2PGBB 3A80A 2HOBA 2QE7D 1C5RA 3ATKA 1AHTH 2EC9H 1E79D 3M5MA 4JZ1A 3ZZ8A 2Y81A 1S6LA 1D6RA 5HM2A 1CHOF 2Z3DA 4I8LA 2GD4B 2FOFA 4YT7H 2ZGXH 1SFIA 3U69H 1TOCB 4TWWA 4B76A 3IITA 3NRLA 1O5BB 2G8TA 1P9SA 1XUGA 1WOFA 4LOYH 2PW8H 1WU1A 3Q3XA 1V2KT 1PYTC 1ELTA 1RTKA 5HXFA 1EUFA 2CHAB 1IQMA 1TBZH 3M61U 2CF8H 1YC0A 2QXGA 3UR6A 3HPTB 3TNSA 5EOKA 2KAIB 1GBMA 1SFQB 4XBCA 4A1XA 1BOQA 2C8XB 3AW1A 1MTWA 2C8WB 2BXUH 4DVAU 4GHQA 1A4WH 1RD3B 2ZDNA 1HAIH 4HZHA 5B6LA 2F9UA 1UTPA 2BZAA 3M5LA 3RXMA 4ZAEA 1V2OT 2OUAA 3GDVA 3PTNA 1TBQH 3UTUH 2ZFSA 5BPEA 3BTKE 1VITF 2FOMB 4CBOA 2DE8A 3SQHE 2A45B 4BAKB 1RRKA 3ZYDA 3UOUA 3P8NA 4Q7ZA 4MPUA 2B9LA 3LU9B 2ASUB 3RXLA 1P06A 3F3BA 4K2YA 2VH0A 3GOVB 1ACBE 2QXJA 2BX3A 1GBBA 3CP7A 1TX6A 4WY3A 3V3MA 1CA8B 4D8NA 5FX6A 2B0FA 4YM9A 1JMOH 5EW2H 1C5MD 3V7TA 3TK6A 2V3OH 4XRNA 3Q76A 4X1SU 3GCOA 2AS9A 1RTLA 4WH6A 1VITG 5GCHG 1CO7E 3KCGH 2TGDA 4JK6A 3BEUA 4AZ2B 1ANDA 1FI8A 1BTUA 3SUDA 3ATLA 3MO6A 4X1PU 3TJNA 1N8OC 3T2NA 2ZDVH 2W6JD 2AMPA 1QBVH 3S7KB 1NRPH 3PTBA 1XKAC 1C1SA 1MZAA 3TH2H 1UCYE 2K8IA 1YYY1 1BCUH 3LDXH 3LONA 3R0FA 2IOTA 2QC2A 1ELEE 1FAKH 1P2OA 1BUIA 1LMWB 4OS1A 2C8YB 2I6QA 2BDCA 1TOMH 3ZVFA 4MNXA 1RXPA 3SU1A 3UQVA 4VGCC 1A5IA 2BOKA 4BOHA 2AGIX 2RCEA 4DJZB 5LPEA 1P8VC 1Y3YA 1QJ7B 3RU4T 1W7XH 4Y6DA 2GCHF 6LPRA 3A84A 3O8CA 1TMBH 3RXVA 1SL3A 5LPFA 2XCNA 1QJ6B 4AB9A 1BBRK 4CR9A 3T5FH 1EASA 2FMJA 1EZSC 4X2VA 1FIWA 1KLIH 1V2ST 1T7CA 2YNAA 1F0TA 4CBNA 1HLTH 3UQOA 2UUYA 3SW2B 3P8GA 1BTYA 2Q6DA 1TRYA 1V6DA 1UVPA 4IW4E 1GJCB 2CXVA 3VB5A 2V0BA 1T8LA 1S84A 1DE7H 1OYTH 1MQ6A 1V2TT 5CHAC 2HNTF 1DPOA 2QA9E 2SNWA 2FI4E 3FP7E 2BVXH 1TQ0B 1HBTH 4K1TA 3NKKA 4CHAB 1C1UH 5LGOA 3SNCA 3UUZA 2F3CE 3HK6B 1CHGA 1CU1A 7KMEH 3ZZ3A 1YPGH 4ZH8A 3RXHA 3KYGA 1OOKB 3M5NA 1YCPH 2JJ1D 2A4QA 1MCVA 2SFAA 3AASA 4JZEH 2HRVA 1DICA 1DOJA 2BY6X 4DG4A 4U32A 2FLBH 1GDNA 3SI4H 3P17H 5L2ZH 1TIOA 2FX4A 5FL7D 3E8LA 3F9EA 1GHXH 2RDEA 5T1VA 2AIQA 5EJZA 5IDKA 2OC1A 4O9VA 3SZNA 1ETTH 1Z71A 1AZZA 4YO9A 1CT0E 3HGPA 1O3CA 4K8YA 4OM9A 1A3EH 2BLOA 2FOHA 3F2GA 4XDEA 1OYQA 1C5XB 2XC5A 2PUXB 4FUFA 3H5CB 2JETC 1ZHRA 3FKSD 3PWCA 4CRBA 5KEDA 2K1QA 1MU6B 1G2LA 5ESBA 3CS0A 1Z1JA 3MNSA 4MVNA 3RMOH 1AVWA 6ESTA 3O8DA 2BDAA 1NU9A 1XUFA 5A2MH 4FVDA 1DY8A 5FCRA 2BB4A 1H8IH 2GZ9A 4OS4A 3RM0H 1O3IA 1GJBB 2ZU5A 3EA7A 1PPFE 1TNKA 1NFUA 2D1JA 3JZ2B 4X0WU 2G51A 3FZZA 1C9PA 1SOZA 1EB1H 1ZLRA 1SHHB 3BTFE 2ZDLA 1Y3XA 1CGJE 1YCPK 2TRMA 4JYUH 1S85A 4OS6A 1BMFD 3GCHC 3ZZAA 1TA2A 1SGNE 3LGUA 1FZZA 2PHBA 2BXTH 5A8XA 4AN7A 1SGDE 3TK5A 5F8ZA 3ZZ7A 1OS8A 3E90B 1IQLA 3UFAA 4H6SB 4QT8C 4WH8A 1IHTH 1Q2WA 1TFXA 2VBCA 3OU0A 4ACAA 4NIWA 4HFPB 1UVOA 3IG6B 4NFFA 4GLYA 5EIYA 1RJXB 4D7FA 2ZHEH 2ZZUH 1JRTA 3M3SA 2RFKC 3ZIAD 1YF4A 1C1TA 1D6WA 1FLEE 1E1QD 1P3EA 3SU2A 2XYAA 1GI8B 1WQVH 2A4GA 3E3TA 2PR3A 4ASUD 3HK3B 4D76A 4U2WA 3LC5A 1HAYB 1DX5M 2OBOA 3ZVEA 2OXSA 1FMGA 1C2EA 3URCA 3QN7A 1NBME 1PQ7A 1ELDE 1V3XA 2VWLA 1C1RA 2C3SA 1AFQB 1HAVB 1EB2A 2F9BH 7LPRA 1G3BA 1ARBA 3KNXA 1V2PT 1O2QA 1RIWB 3OTPA 4ABIA 4B75A 1DANH 1C5PA 2Y82A 1UHBA 3RXQA 2XBWA 1H4WA 2ZTXA 5HMAA 1HUTH 1OP8A 5A0CA 1XVMA 1D4PB 2FWWA 2WYJA 1LVYA 1KXDA 3RXEA 1GI0A 1A0HB 1YKTA 3BSQA 1SQRA 2BLQA 2BVSH 1FN6A 3PMJA 4WMDA 1HXEH 3D62A 1ZMNA 3ZVBA 2NU2E 3I78A 2RA0A 1TNJA 1THPB 4E05H 4ISIH 5E0GA 1V2MT 3SJ9A 2XNIA 2F9VA 3TK9A 2BDGA 4YOJA 2IJOB 1O2NA 4B6FA 1NROH 4INHA 4F4OC 2ZC9H 1Z6EA 1MQ5A 1PPZA 1MTVA 4M9FA 2VVUA 4NIXA 4RT0A 1EPTB 1HFDA 1A5HA 1XUJA 3ESTA 4E7NA 3UNSA 3U1IB 2AERH 4J1YA 1EAWA 2O9QA 4DT4A 3KN2A 5CE1A 1GJAB 2WSSD 1ARCA 1E1RD 1O2GH 2XBXA 2XXLA 1Y3WA 2WPMS 3ZZ4A 1GMDG 3M3VA 1YLNA 2FOBA 2AFQB 1KTSB 3S9AA 1LO6A 1P04A 1W0JD 2ZEBA 1DWDH 2D26C 4YOIA 3A85A 1O5EH 2A7CA 3BTDE 2FYRA 5FCKA 4KTUA 2BD5A 4P02A 5DP9A 1YP9A 1H9HE 1NPMA 1X7AC 2OC8A 3PV5A 1QNJA 2PV9B 3TH4H 5EPYA 1OP2A 1UK4A 2ZDKA 5TCAA 1GHAG 2WPKS 2KCOA 1K1PA 1VGCB 2ANYA 5LPRA 5B6OA 3AAVA 3ATWA 2BDYA 2QXIA 4NFEA 5HKKD 1P2QA 1LDTT 1Z7KA 2OCVB 2FM2A 2ZFTA 3GYMA 2XNDD 1XX9A 2FODA 2BD4A 3RXIA 1ELCA 4X6NA 2P95A 3OX7U 3DT0H 3P6ZB 9LPRA 1O2RA 4Y76A 2H2ZA 2UUJB 1SGEE 1PQ5A 1O3KA 2BD8A 1H1BA 1IHSH 1QHRB 1HJAC 1V2RT 1W3CA 3UB0A 1O3PB 1PYTD 2WYGA 3SI3H 2KZ4A 1P57B 2IN2A 1GHZA 4BTIB 1V2QT 2C93B 1EP5A 1EX3A 5C5NA 3RXRA 1NN6A 3PLKA 4MLFB 1QL9A 3ZZ6A 3OSYA 2ALVA 1ELBA 1H9LB 1ZTKA 2J9NA 1MZDA 3STJA 3RXOA 1P10A 2ZO3H 2H5DA 1DITH 3AW0A 1CQQA 5C20A 5EQSA 2L74A 3PRDA 1OHHD 4NA9H 5DGJA 4WXVA 3SV9A 4SGBE 4MPVA 1GJ4H 1V2UT 4Y7AA 1WSSH 5E0JA 3QZRA 2R0LA 5JBBS 2A1DB 1FNIA 4NSVA 3I29A 4AX9H 4BNRA 2AYWA 2SGAA 4K60A 2A5AA 2QF0A 1WAYB 2J94A 1L0ZA 1EPTA 2FDAA 4AGJA 4F48B 1DLKB 1N1LA 3F1SB 5DJ7A 1C2HA 1NO9H 2GMTB 2H1UA 2ZKSA 2H9EH 3UOPA 2QAAA 4BAMB 1RIWC 1GBIA 1DUEA 3TJOA 1K1MA 1T4UH 1AN1E 3BN9A 3SJKA 5DK1A 1GBFA 1SSXA 4FOUC 2QF5A 1BB0B 2ZHWH 2ESTE 5DPAA 4KP0A 2V35A 4FU7A 1VJ9U 3NWUA 4I33A 1GJ8B 1AKSA 1BHXF 1O3OA 1SGFG 4AFZA 2BDBA 1BJUA 1G36A 3MH7A 1ANCA 1UVTH 3CS7A 3RU4E 3A8DA 1LTOA 3A7TA 4GAWA 2WZQA 1BMNH 1WV7H 2J95A 1S6HA 5H4IB 1L2EA 2FO9A 4DW2U 4ISLA 3GY8A 7GCHF 5GJ4B 3PO1B 1TGTA 3SN8A 1A3BH 4ZKOU 1FPHH 1F0UA 1ZHMA 2P3UB 4IMZA 5T6DA 5DP6A 2XW9A 1VGCC 4GCHG 4XOJA 3EE0B 2A5KA 1F5KU 1GBTA 2QXHA 1ID5H 4X8VH 1IQKA 1K1LA 1F2SE 2QN5T 2XBVA 1KIGH 5HM9A 3AK5A 1BZXE 1SGIB 2CN0H 2HLCA 3M35A 2NU0E 4LXBH 1BTWA 3RDZA 3UIRA 1B0EA 1XKBC 1Z8JB 2CMYA 3O8BA 4I8KA 2IJD1 3AVZA 1SLUB 2P3TB 2Z3EA 5F53A 5FAHA 1LHCH 1C5UA 2HLDD 3ZYEA 3LGVA 3GY3A 3SORA 2GJGA 5DSFA 1TX8A 5AF9H 1UCYK 2F43B 5C3NA 1O2JA 3VB3A 2Z3CA 1KSNA 2ZGBH 2EA3A 2BD9A 1XUIA 2A7HA 2KM0A 2OC0A 1BBRH 4A6LA 4YTAA 3ZVDA 3MO3A 2FXRA 2H6MA 1FXYA 1ZJKA 2XC0A 1EJAA 2AHME 4WVPE 3PWBA 2Z9JA 2Y5HA 4ZXXH 1ZGVA 3A7ZA 1D3TB 1T31A 2V7QD 4NGAH 1GVLA 6GCHF 2FS9A 5EXMA 4AGKA 3EA8A 4X8UH 5FPSA 3MYWA 1KXCA 1L1JA 3FP8E 4AFSA 4K69A 1GDQA 1C1QA 1J8AA 3LJJA 1EOJA 2J4IA 3VB7A 4DY7B 2JH5D 3MO9A 1L1NA 1Y59T 1LVOA 1G32B 1MTSA 3LH3A 3JZ1B 4IMQA 2ZHQH 1NC6A 1ZJDA 2VGCC 3A7VA 3DD2H 1EZXC 1C5ZB 1IOEA 1O2LA 4NIYA 4UDWH 1C2LA 1THRH 1LQDB 4NZLA 1K1NA 2P3FH 1TONA 4K3JA 1N6XA 1GCDA 1WBGB 1QQUA 5FXLA 1IQNA 1IQEA 5C1YA 1MH0A 3HKIB 1ZPBA 4FUDA 4IC5A 3TH3H 4ABAA 1ZTLA 3F2FA 2R3UA 3A82A 1C1VH 2GZ7A 1OWDA 4F49A 1DWCH 2CHAC 1VITH 3E0PB 1UMAH 1GVZA 2WUCA 1BRAA 4I86A 4X6PA 3VXEH 4ACBA 1Y5UT 1BJVA 1F5RA 3SJIA 4ESTE 1ORFA 3Q77A 3QK1A 1C4U2 1AI8H 1S0QA 4AOQA 4HG6A 1C1PA 3DFLA 3WW7A 3SGAE 1YPLH 2R9PA 2ZU3A 1QR3E 1P2KA 3N7DA 2ULLA 1GHBG 1C2FA 5TJXA 4VGCB 4O3TA 3SHAH 2BZ6H 5FBEA 2HWLB 9ESTA 1GG6C 2GT7A 1O0DH 3N99A 1O3EA 4I8JA 2TIOA 1SQTA 4IGDA 5E2PA 1A1RA 4YLUA 1E38B 4YLQH 2FPZA 3MU8A 1O37A 5KGOA 3RXGA 4AFQA 1JXPA 4B74A 1NRRH 1SGQE 1AE5A 3RC6A 1SR5C 1Q31A 4CREA 1AB9C 3ATIA 1O2WA 2EQNA 4MQAA 4Q4LA 4Y8XA 3KQ5A 2ODQA 1U6QA 1MABB 3LGIA 1K28D 3SQEE 5DP3A 3ZZDA 5AVDA 2J34A 3SBKA 1QZ8A 4Q63A 4O3UA 1C4V2 3VB6A 4OGXA 2ZHFH 2JH6D 1E36B 1P01A 2VJ1A 4XE4A 3D23A 1G9IE 1SG8B 3OE7D 5EGMA 1W13U 1ESAA 2WPDD 3SNBA 2AEIH 4B2CA 3QZQA 1HAZB 4H42U 3PMHB 1RS0A 4ZMAH 2J92A 2ZGCA 3W95A 3FFGA 4NA7A 2HPQH 3OY5U 1SVPA 3ODFA 4E7RG 1YPKH 1P12E 4GSOA 4E06H 2PP6A 2V3HH 1EXFA 3K6ZA 4UD9H 2O8TA 4A5TS 1EKBB 2KFWA 3H09A 1THSH 3M7TA 4MNYA 3K9XB 3GCTG 5I46H 1C2JA 3T27A 3KQDA 2ZGJA 3FVFB 1LKAA 3T62A 1LVBA 1TB6H 2BY7X 2ZFRH 1XM1A 1FY4A 1GJ6A 4DIIH 1N8OB 2W6ID 3SU4A 1AO5A 1C2DA 1ESBA 1GMCG 2WINI 3GCNA 4IN1A 2P16A 2B7DH 2GP9B 4LZ1H 8KME2 4ABDA 1YGCH 2QCYA 1ZGIA 2A31A 4ASHA 4A7IB 5F8TA 3RM2H 2P93A 1O36A 5G4BA 3QTVH 4AC9A 1EAXA 1AWHB 1KTTB 2ZF0H 5EXLA 3EDXB 3EGKH 3S9CA 1C2MA 1V2NT 2BQWB 3F9FA 4FUCA 5DN6D 1DWEH 3U8TH 4AB8A 1HV7A 1O3DA 1C2GA 1NESE 3RLWH 2ZNKH 1MKWK 3E91A 3RXTA 1COWD 2WPLS 2J97A 2UWLA 3GY2A 1DSUA 1DY9A 3QX5H 2L6OA 4WF8A 3PMAB 1KXFA 4XD7D 2Y5GA 3U8RH 3MQKC 3VEQB 3SV2H 3LIWA 4WMEA 1P2IA 2GMTC 1AWFH 4Y7BA 2CJIA 1B5GH 4FXGH 1GL1A 3C1KA 3GY4A 4TYDA 5GCHF 1LVMA 1SGTA 2W7SA 4WXIA 1UTLM 2VIDA 4R0IA 5JPMH 1QBOA 2PWXA 1SLXB 2BTCE 1IQIA 1TPOA 1EOLA 1KLJH 1HXFH 1D3QB 2ALPA 4UFFH 1FJSA 3S9BA 2OK5A 1O35A 1O3GA 4RN6A 3SGQE 2OQ5A 3TU7H 1ZPZA 1ZSLA 2A5IA 1QCPA 1QA0A 3BTME 1TX7A 2QGRA 2ZFQH 4TPYA 5GPIB 2G4UA 1C2KA 1GMHF 1CVWH 1LPKB 4Y8YA 3DSGA 4ZHAA 3E0NB 2PTCE 1C5WB 1GHVH 1O2VA 2VVCA 3QO6A 4B2BA 3D49H 4IN2A 1GBAA 4Y71A 4NCYA 1MKWH 2Z9KA 1MD8A 1QA7A 1QTFA 1KMHB 1GI2A 2H9TH 3A7XA 2Z9GA 1T8NA 2VNTA 2VGCB 4X1RU 1SMFE 2ZG0H 3BIVH 1JOUB 5HGGA 4TWYA 2A4RA 2QF3A 3KIDU 4D9QA 2CV3A 1MAXA 1FN8A 3HGNA 1GJ9B 4OGYA 3DCLA 3GCHB 3ITIA 4IS5A 1HJ9A 4B6EA 1O2MA 4X8TH 1P03A 2A2XH 1LKBA 2JETB 2FI5E 4B1TA 2FEQH 3KQCA 4CRCA 1Z6JH 4X2YA 1ZPCA 4MNVA 1CSOE 3ZZ9A 2P8OB 2BDIA 5CHAB 1Q3XA 3E1XB 1EZUC 3H7OA 1LHGH 1OWEA 4IC6A 4UFGH 2ZIQH 2ZFPH 1HYLA 3EYDA 1GJ5H 2VB0A 1EAIA 4I8GA 2Y7XA 1P3CA 5F03A 4FUIA 4X2XA 4U01A 1YPHE 2VIPA 1NRQH 2G4TA 1LHFH 4AFUA 5C0TA 2O8LA 3B8JA 1GBHA 2SGDE 2FOAA 1BRUP 1OWHA 2JIZD 3M3TA 1VCPA 4TY6A 4JK5A 1QB6A 2F9NA 1S6FA 1TWXB 3V0XA 1QIXB 4Y0YE 1TGSZ 1O3LA 2BY8X 1C5TA 1XUHA 5EG4A 3LKWA 3QGJA 2ANMH 3PV2A 1NFYA 1AFQC 2ODYB 1O31A 3DFJA 1MTNB 1G2MA 1NY22 2XC4A 3PRBA 3U9AH 1TNGA 3UNRA 2RDLA 3K6YA 1QRXA 1K1OA 5C17A 3RLYH 4SGAE 1D9IA 3MTYA 3TJUA 2OP9A 2PSYA 4JYTA 1VKYA 3W94A 1Y5AT 1VCWA 3GDSA 1QB9A 1O33A 3M37A 3N7OA 3SNEA 3BG4C 1MKXK 3BEIB 1T8OA 4ABHA 2WPHS 5GXPA 2A4OA 3SU6A 4BAHB 5HIYA 3RC5A 1ELVA 3R3GB 2WPJS 1YM0A 2QF4A 1RGQA 1Z1IA 1A0LA 4JYVH 4GHTA 1HCGA 1HNEE 3F9GA 1EFRD 1H8DH 3QWCH 1AD8H 3WWFA 1O3NA 1IQHA 3FAOA 1CA0C 4A1TA 1GDUA 5EPNA 3QGNB 1CE5A 5J4SA 3TGJE 2BQ7B 1HIAA 1W7GH 1OWJA 2R2WU 1EPTC 1LCYA 1J16A 1L4ZA 3LT3A 1A2CH 3V12A 1KY9A 2K0QA 3S7HB 1MCTA 3ELAH 4FU9A 1EZQA 4K1SA 4ZKSU 1ZZZA 1BTZA 3BTQE 3FANA 4FVBA 3U28C 1K1JA 3SU0A 5C0UA 1O3AA 2AMQA 4TPIZ 3VPKA 4HI3A 3QUMP 1TPPA 3GDUA 1C5QA 1O5CB 4B71A 3BEFB 5DP5A 3KYFA 4O03A 2M5TA 2OBQA 3MNXA 3MI4A 2Y5FA 5E2OA 3UY9A 2BYAX 2GX4A 2BM2A 1QFKH 2XOKD 2BOHB 1FQ3A 5T3HA 1GBKA 1HPGA 1SQOA 2JKHA 3RXJA 1K2I1 1FUJA 2Y6TA 3RXPA 1FY3A 1F5LA 3C27B 1Y3UA 5C94A 3TGIE 2R2MB 3CENA 3BF6H 1QL8A 2BY5X 1G37A 1FV9A 1GHAF 1SGCA 4ABJA 1OKXA 3MWIU 2YMSC 4FU8A 1UCYH 1YPMH 4Z1MD 2QIQA 2VINA 1K9OE 3SZEA 3ZV9A 1O5AB 8LPRA 1EQ9A 4MPXA 3T26A 1W0KD 3STIA 3HKJB 1C5LH 5E0HA 3SNAA 1ZOMA 3ATMA 1O5FH 1SI5H 5T6GA 3LGWA 2FOEA 1N6YA 1BMLA 1C1NA 4BXWA 2XBYA 2PSXA 1Y5BT 2PLXA 5GDSH 2VWOA 2YNBA 1C1OA 4B73A 1JBUH 1S5SA 3TLOA 4MTBA 4Q80A 2FS8A 1TAWA 1TGNA 2VIOA 4UFDH 1TNLA 1J9CH 4KTCA 5FBIA 3FP6E 4YOGA 3TIUA 4UE7H 1GBDA 1C5OH 2QV1A 1G3EA 1AIXH 8ESTE 4MPWA 5A09A 1YLDA 4AORA 1NS3A 3F2HA 2A7JA 3A8CA 2BD3A 5EQRA 4PROA 1VZQH 1C5SA 1TGCA 1UTJA 3SJOA 3U8OH 2BDHA 3LC3A 3UNQA 1NTPA 1ABIH 2KR7A 2BD2A 1DS2E 4X1NU 3E6PH 5GIBA 1C1WH 4DCDA 4UONA 4BAOB 1BT7A 2OC7A 3GY7A 2W3IA 3A81A 4Z6AH 5K0HA 3Q3YA 1LPZB 1EJNA 3SJ8A 1W8BH 2O8MA 4M7GA 3MFJA 5C1UA 2GGVB 1A5GH 1SGRE 1UTOA 3OEHD 1G3DA 2AGGX 3LPRA 3DSPA 1KXEA 1MTUA 1P9UA 2LP6A 1MAYA 4Y8ZA 1QB1A 1AGJA 2GCHG 1AKSB 1F7ZA 3I77A 3TJVA 3UREA 1O39A 3SNDA 1SOTA 4AG1A 1TQ7B 1TLDA 4ZROA 2STAE 3PLBA 3MOCA 3LOXA 1ZRKA 1ETRH 2RA3A 3QDZB 5EJ1A 1M9UA 4U30A 1P2NA 4YESB 5BRRE 3EA9A 3DSOA 1SLVB 2V3MA 5ESTE 3GCTF 5A0BA 5JBCS 3MU5A 2UUKB 1BRCE 1O38A 3PROA 2PKSC 1UK3A 1O2ZA 3RXFA 3BTEE 4GPGA 3TNTA 1AUTC 1DLEA 1ABJH 3MNCA 1MBQA 2FIRH 2Z9IA 2FLRH 1JWTA 1XMNB 5AHGH 1MUEB 1CGHA 3ZZ5A 3L3TA 2GZ8A 1NFWA 1H8HD 2OQUA 2TGPZ 1VJAU 8GCHG 4K5ZA 2ZTYA 3QTOH 1VR1H 2CF9H 3LH1A 2FYQA 1OXGA 1NFXA 2Y80A 3QLPH 3RMMH 1C4Y2 1LHDH 2BHGA 1BTXA 4CR5A 4UFEH 2PUQH 1O3BA 3UWJH 4D7GA 1TRNA 1B0FA 1V2WT 4IBLH 4NZQA 1XVOA 3A8AA 1QURH 3RUOA 2SGPE 4TT3D 1MD7A 3DUXH 4ZCNA 3VGCB 2V6NA 5FX5A 3F0PA 1XUKA 3BTTE 2WUBA 2W3KA 2ZDAH 2J98B 3BG4B 1KYNA 3URDA 3G01A 1YWUA 3DHKH 2GDDA 1UTQA 4XFQA 1UK2A 5L6NH 1F0SA 4INLA 2WV9A 3RC4A 3KGPA 2TGAA 4TY7A 1S82A 1MBMA 2Z7FE 3KL6A 5JBTA 1TNIA 4ZXYH 3ZV8A 1HAXB 1BHXB 3S69A 1HGTH 1O2XA 1TABE 1C2IA 2BLVA 4I31A 3W1EA 1SGYE 1BTPA 4ZKRU 2EEKA 1GL0E 2IPHA 2ZU1A 3PO1C 4WMFA 1GHBF 2W7UA 6CHAB 1Y8TA 3HATH 1CGIE 2G52A 1O2UA 2BMGB 1QRWA 1FDPA 4CH2B 1L1GA 1IQGA 1W12U 4Y10E 1KDQB 4CRDA 2I6SA 1SPJA 2TGTA 2XWBI 5HIZA 4DGJA 1YPJH 4DURA 4DIHH 3TVJB 1C5YB 3MMGA 1GMDF 3H7TA 2G5NA 1FY1A 2WHXA 3UWIA 5C67A 1AE8H 4XBBA 1O3JA 1O3HA 2CGAA 5DP8A 1AZ8A 1TMUH 1MTNC 1O2IA 2BY9X 5DKMA 4JZFH 3UR9A 2XWAA 4LK4A 1SC8U 3PLPA 3KQEA 5SGAE
chains in the Genus database with same CATH topology
1KXAA 1ZMJA 2GCTB 1O2PA 4R8TB 1K21H 4HGCA 3SHCH 4AG2A 1BIOA 2F9PA 2ILNA 2AIPA 1FY5A 3GY6A 3BV9B 3LGTA 3T28A 2FTMA 4NG9H 1UJ1A 4JMYA 3A7WA 4BXSA 1W2KH 3ODDA 2FZZA 1CBWC 1EP6A 4K1EA 3MU1A 1HJ8A 1GBCA 4AYYB 4LZ4B 2ZCKP 1GMHG 2BD7A 3KEEA 2PTNA 3ZZBA 2XCFA 1ZRBA 1GGDC 4KELA 4NA8A 1TBRH 3B23B 4ABFA 1NZQH 1W0YH 2ZPRA 1G3CA 1PJPA 1SB1H 1EAUA 1UO6A 1DUAA 3RMNH 1OX1A 2VIVA 5EXNA 1DM4B 4H4FA 2D8WA 1Z8IB 2FOGA 3L6PA 3BIUH 3P8OA 3V13A 2VWNA 1P11E 4CRAA 2ZPQA 2UWPA 1V2LT 3SO3A 1KXBA 1JIRA 3RMLH 3ZVGA 3M36A 6GCHG 3RP2A 1Z8GA 4RKOB 2ZU4A 3D65E 4I8HA 2Z6BD 3PM3A 2G55A 3Q00A 5GWZA 1WTGH 4NSYA 4X8SH 1GI7B 4UEHH 3A89A 2J2UA 1GCTC 1ANBA 3T25A 2VWMA 5FPYA 2EI7A 3ZVCA 2BVRH 1DVAH 1SBWA 2J38A 1UTMA 4ISNA 4WWYA 1YLCA 3ZZCA 3E16B 5DO4H 4GCHF 2XTTB 1AMHA 3SUEA 2AMDA 1TRMA 2NU3E 1NRNH 1IQFA 2VH6A 3Q3KA 2DE9A 1SLWB 1O2HA 2ZA5A 2OLGA 2VU8E 1QRZA 2WV4A 1FY8E 1DT2A 3NK8A 3KHVA 4K8BA 1TMTH 1PPCE 5JYIA 1O2YA 2NU1E 5J4QA 4Y0ZE 1J14A 1KDQA 1WUNH 2GTBA 1PPEE 3TGKE 1ZMLA 1UVUH 4ABBA 1A61H 2JH0D 1ELAA 1PPGE 1GI1A 3OY6U 1AB9B 1O2OA 3SU5A 2WPIS 2LNCA 4BAQB 3T29A 3FZDA 1S81A 1BITA 5I25A 1OSSA 1O3MA 3MHWU 4DT7B 1D3DB 1UVSH 2HVXA 4J2YB 2C8ZB 5CMXH 4H6TA 4ZHLU 4INKA 2D2DA 1D3PB 1H9IE 1O34A 1O2TA 1AVGH 1K1IA 4JZDH 2AH4X 2UUFB 2AGEX 2OD3B 1UHBB 3NCLA 1Y3VA 3BG8A 3RXAA 3PV4A 4X2WA 1SGFA 1HAPH 2ODPA 1E34B 1SGPE 4FUGA 2PKAA 1GI6A 5DP7A 3BTWE 1GJ7B 2QY0B 3IWMA 1RFNA 1AU8A 2GT8A 2STBE 5EQQA 1QL7A 2ZPSA 1V2JT 1WCZA 3MNBA 1QGFA 5A8YA 1OWKA 1GVKB 4YT6H 5ETXA 2FI3E 3VGCC 2A2QH 3PMBB 3MH5A 1GJDB 1DXWA 2Y7ZA 2EI6A 2G81E 1JIMA 4D9RA 4ISHH 1GHYH 2ZDMA 2PKAB 5F6MA 1HDTH 2VIQA 3MU4A 1DDJA 3L33A 1F92A 1AQ7A 4X6OA 2ZI2H 2HGTH 1FAXA 2BQ6B 1P05A 5EW1H 4ABGA 1A46H 1HJAB 3SUGA 3RU4D 4Q7YA 1IAUA 3GISB 1W10U 3SOSA 1AUJA 2NU4E 5JB9S 1FONA 1P0SH 1ESTA 4OS2A 1P2MA 2PKSB 2W26A 1OP0A 4BTUB 1DXPA 2RG3A 1TE0A 3O8RA 1ZHPA 3K2UA 2ZTZA 1CT2E 1TPAE 3RXCA 1GI4A 5FHTA 2SGEE 4WJG2 4AYVB 1HAOH 3PB1E 3GYLB 1PQAA 3U1JB 4THNH 1FPCH 3BTGE 2P59A 3SV7A 2HALA 2EI8A 4KGAA 1NT1A 5EODA 2ANWA 5A0AE 5C2ZA 4O97A 1QQ4A 5AFYH 1J15A 2SGQE 3A8BA 3M5OA 4XBDA 1O2SA 1INCA 2GCTC 4GVUA 2GVFA 2TPIZ 3OYPA 1GMCF 4I32A 1BQYA 5AFZH 1OPHB 4CH8B 3MH6A 1GBJA 1A7SA 1GI9B 3LJOA 3P95A 1WTHD 1EJMA 5E8EH 1TNHA 5JDUB 2HPPH 1CBWB 1XXDA 1YPHC 1W0ZU 1GWAA 1EATA 3RXBA 3SU3A 1S83A 4OS7A 5T6FA 4CRGA 1C1MA 1NU7B 4ZUHA 1GGDB 1CHOG 2TBSA 6CHAC 3P8FA 1CT4E 2Z9LA 3VB4A 3RXDA 5JBAS 2FTLE 3MU0A 1O5DH 2F91A 1HIAB 1TALA 1MMJN 1LPGB 2W5EA 2GV6A 1K22H 2ANKH 3S0NA 1TGBA 3NXPA 4JZIA 3RXSA 5L2YH 4MDSA 2Z94A 4DOQA 1JRSA 2FP7B 2YOLA 3SUFA 7GCHG 2NWNA 5LH8A 4ABEA 4YZUA 1RTFB 3SV8A 4A92A 4RKJB 4X6MA 3KQBA 4KKDA 2F9OA 1QBNA 2THFB 1HB0B 1UTKA 1GCTB 2B8OH 5TCCA 4FUJA 1O3FA 2Q1JA 1HAHH 5JB8S 1DWBH 2ZU2A 3EQ0H 1P09A 1GPZA 3B9FH 4KTSA 1GBLA 1B7XB 1ELFA 3A86A 3VXFH 1O5GH 1J17T 4ISOA 1KLTA 1ZSJA 1F0RA 4Z0KA 1PPHE 1HRTH 3UPEA 1Z8RA 1W14U 3SGBE 2C4FH 2G00A 2SGFE 1SHYA 1WQSA 4Y11E 4JCNA 1LHEH 3U98H 2LPRA 5DP4A 1QY6A 4BTTB 3WY8A 2ZWLH 3M7QA 4ZHMU 2UWOA 4I7YH 4A1VA 3NPSA 1DSTA 1BMMH 2G5VA 4FUEA 1P2JA 2O8WA 1GI5A 2OINA 2ZQ1A 2ZFFH 3A88A 2ZCHP 3DA9B 4MNWA 1O32A 1QJ1B 1S0RA 2ZCLP 1CA0B 3ENSB 4B2AA 1T8MA 1FIZA 1BDAA 5IYTA 1SQAA 1WYKA 1T4VH 1MU8B 2XRCA 1BBRE 1GHWH 2VIWA 2KAIA 5DG6A 1NRSH 1C5VA 2BX4A 3NZIA 4CRFA 2O8UA 4X1QU 1YBWA 1L4DA 3P92A 1E35B 2A0QB 1OWIA 2DUCA 3GY5A 1HAVA 2GV7A 2R0KA 1G30B 2P8OC 4FUBA 4ZKNU 5C5OA 4BANB 1PFXC 2Q6FA 2PGQB 3RXUA 3F6UH 4FUHA 1AFEH 1ELGA 3F9HA 1ETSH 1E0FD 1V2VT 1GI3A 2ZQ2A 2Q6GA 1W11U 2C90B 5EU8A 5ABWA 1PQ8A 1IQJA 2WV5A 4OS5A 1TA6A 3VFEA 7ESTE 1T32A 1XXFA 3A7YA 1BA8B 2OTVA 1BTHH 1NM6A 1TPSA 5K7RA 3LGYA 3F68H 3A87A 1DFPA 1C5NH 2FESH 3M7UA 2ZECA 4Q2KA 1GBEA 1ZSKA 2HNTC 3EAJA 1UTNA 2H5CA 3NUMA 1HAGE 3P70B 1ZTJA 5F8XA 1C9TA 2R3YA 1GG6B 1PPBH 2GDEH 1ZYOA 5A8ZA 5L30H 2FOCA 1AY6H 2FX6A 8GCHF 3K65B 5C1XA 4MG3A 4HTCH 5PTPA 1VCQA 3KF2A 1ANEA 3OTJE 1O30A 4NIVA 5HYOA 1YPEH 2GKVE 2QYIA 2A32A 1MKXH 1O2KA 1TYNA 1YCPM 3BTHE 4RSPA 2H9HA 3A83A 4GUXA 4NWKA 3TITA 2ZGHA 2B5TB 3ZVAA 4CHAC 2ZHDA 1BRBE 1LQEA 3SV6A 3PYHA 1A0JA 1P02A 5FPTA 2F83A 2VVVA 2HNTE 3AAUA 4NWLA 3RXKA 3GICB 3TPIZ 1ZR0A 4XSKU 2P94A 2PFEA 3MH4A 2BLWA 4Q7XA 4Y79A 2SNVA 1BMAA 1AVXA 1E37B 2ZP0H 2PGBB 3A80A 2HOBA 1C5RA 3ATKA 1AHTH 2EC9H 3ZZ8A 3M5MA 4JZ1A 2Y81A 1D6RA 5HM2A 1CHOF 2Z3DA 4I8LA 2GD4B 2FOFA 4YT7H 2ZGXH 1SFIA 3U69H 1TOCB 4TWWA 4B76A 3IITA 1O5BB 2G8TA 1P9SA 1XUGA 1WOFA 4LOYH 2PW8H 1WU1A 3Q3XA 1V2KT 1PYTC 1ELTA 1RTKA 5HXFA 1EUFA 2CHAB 1IQMA 1TBZH 3M61U 2CF8H 1YC0A 2QXGA 3UR6A 3HPTB 3TNSA 5EOKA 2KAIB 1GBMA 1SFQB 4XBCA 4A1XA 1BOQA 2C8XB 3AW1A 1MTWA 2C8WB 2BXUH 4DVAU 4GHQA 1A4WH 1RD3B 2ZDNA 1HAIH 4HZHA 2F9UA 1UTPA 2BZAA 3M5LA 3RXMA 4ZAEA 1V2OT 2OUAA 3GDVA 3PTNA 1TBQH 3UTUH 2ZFSA 5BPEA 3BTKE 1VITF 2FOMB 4CBOA 2DE8A 3SQHE 2A45B 4BAKB 1RRKA 3ZYDA 3UOUA 3P8NA 4Q7ZA 4MPUA 2B9LA 3LU9B 2ASUB 3RXLA 1P06A 4K2YA 2VH0A 3GOVB 1ACBE 2QXJA 2BX3A 1GBBA 3CP7A 1TX6A 4WY3A 3V3MA 1CA8B 4D8NA 5FX6A 2B0FA 4YM9A 1JMOH 5EW2H 1C5MD 3V7TA 3TK6A 2V3OH 3Q76A 4X1SU 3GCOA 2AS9A 1RTLA 4WH6A 1VITG 5GCHG 1CO7E 3KCGH 2TGDA 4JK6A 3BEUA 4AZ2B 1ANDA 1FI8A 1BTUA 3SUDA 3ATLA 3MO6A 4X1PU 3TJNA 1N8OC 3T2NA 2ZDVH 2AMPA 1QBVH 3S7KB 1NRPH 3PTBA 1XKAC 1C1SA 1MZAA 3TH2H 1UCYE 1YYY1 1BCUH 3LDXH 3LONA 3R0FA 2IOTA 2QC2A 1ELEE 1FAKH 1P2OA 1BUIA 1LMWB 4OS1A 2C8YB 2I6QA 2BDCA 1TOMH 3ZVFA 4MNXA 1RXPA 3SU1A 3UQVA 4VGCC 1A5IA 2BOKA 4BOHA 2AGIX 2RCEA 4DJZB 5LPEA 1P8VC 1Y3YA 1QJ7B 3RU4T 1W7XH 4Y6DA 2GCHF 6LPRA 3A84A 3O8CA 1TMBH 3RXVA 1SL3A 5LPFA 2XCNA 1QJ6B 4AB9A 1BBRK 4CR9A 3T5FH 1EASA 2FMJA 1EZSC 4X2VA 1FIWA 1KLIH 1V2ST 1T7CA 2YNAA 1F0TA 4CBNA 1HLTH 3UQOA 2UUYA 3SW2B 3P8GA 1BTYA 2Q6DA 1TRYA 1V6DA 1UVPA 4IW4E 1GJCB 2CXVA 3VB5A 2V0BA 1T8LA 1S84A 1DE7H 1OYTH 1MQ6A 1V2TT 5CHAC 2HNTF 1DPOA 2QA9E 2SNWA 2FI4E 3FP7E 2BVXH 1TQ0B 1HBTH 4K1TA 3NKKA 4CHAB 1C1UH 5LGOA 3SNCA 3UUZA 2F3CE 3HK6B 1CHGA 1CU1A 7KMEH 3ZZ3A 1YPGH 4ZH8A 3RXHA 1OOKB 3M5NA 1YCPH 2A4QA 1MCVA 2SFAA 3AASA 4JZEH 2HRVA 1DICA 1DOJA 2BY6X 4DG4A 4U32A 2FLBH 1GDNA 3SI4H 3P17H 5L2ZH 1TIOA 2FX4A 3E8LA 3F9EA 1GHXH 2AIQA 5IDKA 2OC1A 4O9VA 3SZNA 1ETTH 1Z71A 1AZZA 4YO9A 1CT0E 3HGPA 1O3CA 4K8YA 1A3EH 2BLOA 2FOHA 4XDEA 1OYQA 1C5XB 2XC5A 2PUXB 4FUFA 3H5CB 2JETC 1ZHRA 3PWCA 4CRBA 2K1QA 1MU6B 1G2LA 5ESBA 3CS0A 1Z1JA 3MNSA 4MVNA 3RMOH 1AVWA 6ESTA 3O8DA 2BDAA 1NU9A 1XUFA 5A2MH 4FVDA 1DY8A 5FCRA 2BB4A 1H8IH 2GZ9A 4OS4A 3RM0H 1O3IA 1GJBB 2ZU5A 3EA7A 1PPFE 1TNKA 1NFUA 2D1JA 3JZ2B 4X0WU 2G51A 3FZZA 1C9PA 1SOZA 1EB1H 1ZLRA 1SHHB 3BTFE 2ZDLA 1Y3XA 1CGJE 1YCPK 2TRMA 4JYUH 1S85A 4OS6A 3GCHC 3ZZAA 1TA2A 1SGNE 3LGUA 1FZZA 2PHBA 2BXTH 5A8XA 4AN7A 1SGDE 3TK5A 5F8ZA 3ZZ7A 1OS8A 3E90B 1IQLA 3UFAA 4H6SB 4QT8C 4WH8A 1IHTH 1Q2WA 1TFXA 3OU0A 4NIWA 4HFPB 1UVOA 3IG6B 4NFFA 4GLYA 1RJXB 4D7FA 2ZHEH 2ZZUH 1JRTA 3M3SA 1YF4A 1C1TA 1D6WA 1FLEE 1P3EA 3SU2A 2XYAA 1GI8B 1WQVH 2A4GA 3E3TA 2PR3A 3HK3B 4D76A 4U2WA 3LC5A 1HAYB 1DX5M 2OBOA 3ZVEA 2OXSA 1FMGA 1C2EA 3URCA 3QN7A 1PQ7A 1ELDE 1V3XA 2VWLA 1C1RA 2C3SA 1AFQB 1HAVB 1EB2A 2F9BH 7LPRA 1G3BA 1ARBA 3KNXA 1V2PT 1O2QA 1RIWB 4ABIA 4B75A 1DANH 1C5PA 2Y82A 1UHBA 3RXQA 2XBWA 1H4WA 2ZTXA 5HMAA 1HUTH 1OP8A 5A0CA 1XVMA 1D4PB 2FWWA 2WYJA 1LVYA 1KXDA 3RXEA 1GI0A 1A0HB 1YKTA 3BSQA 2BLQA 2BVSH 1FN6A 3PMJA 4WMDA 1HXEH 3D62A 1ZMNA 3ZVBA 2NU2E 3I78A 2RA0A 1TNJA 1THPB 4E05H 4ISIH 5E0GA 1V2MT 3SJ9A 2XNIA 2F9VA 3TK9A 2BDGA 4YOJA 2IJOB 1O2NA 1NROH 4INHA 4F4OC 2ZC9H 1Z6EA 1MQ5A 1PPZA 1MTVA 2VVUA 4NIXA 1EPTB 1HFDA 1A5HA 1XUJA 3ESTA 4E7NA 3UNSA 3U1IB 2AERH 4J1YA 1EAWA 2O9QA 3KN2A 5CE1A 1GJAB 1ARCA 1O2GH 2XBXA 2XXLA 1Y3WA 2WPMS 3ZZ4A 1GMDG 3M3VA 2FOBA 2AFQB 1KTSB 3S9AA 1LO6A 1P04A 2ZEBA 1DWDH 2D26C 4YOIA 3A85A 1O5EH 2A7CA 3BTDE 2FYRA 5FCKA 4KTUA 2BD5A 5DP9A 1YP9A 1H9HE 1NPMA 1X7AC 2OC8A 1QNJA 2PV9B 3TH4H 5EPYA 1OP2A 1UK4A 2ZDKA 5TCAA 1GHAG 2WPKS 1K1PA 1VGCB 2ANYA 5LPRA 5B6OA 3AAVA 3ATWA 2BDYA 2QXIA 4NFEA 1P2QA 1LDTT 1Z7KA 2OCVB 2FM2A 2ZFTA 3GYMA