1M9UA

Crystal structure of earthworm fibrinolytic enzyme component a from eisenia fetida
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
VIGGTNASPGEFPWQLSQQRQSGSWSHSCGASLLSSTSALSASHCVDGVLPNNIRVIAGLWQQSDTSGTQTANVDSYTMHENYGAGTASYSNDIAILHLATSISLGGNIQAAVLPANNNNDYAGTTCVISGWGRTDGTNNLPDILQKSSIPVITTAQCTAAMVGVGGANIWDNHICVQDPAGNTGACNGDSGGPLNCPDGGTRVVGVTSWVVSSGLGACLPDYPSVYTRVSAYLGWIGDNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of earthworm fibrinolytic enzyme component a: revealing the structural determinants of its dual fibrinolytic activity.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Earthworm Fibrinolytic Enzyme
total genus 53
structure length 241
sequence length 241
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2002-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1m9uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1m9uA01
1QFKH 2WPIS 2TRMA 1KY9A 4I8KA 1SVPA 1SLVB 1PPHE 2BLQA 1PQAA 3K2UA 4DIIH 4Y10E 4A6LA 1Y59T 4INLA 1P06A 8KME2 2A4GA 3SNCA 1TX8A 2R9PA 2Q6DA 3UNRA 1GMDF 1YP9A 1ZJKA 4XSKU 1OSSA 5L2ZH 2QF0A 1O33A 1ESBA 2BHGA 4NIXA 2J9NA 4KP0A 3SQHE 4K8YA 1ELGA 2FPZA 1MTWA 1AUTC 3RXMA 4LZ4B 2GZ8A 4GCHF 3ZZDA 4ABGA 2A45B 1QQ4A 1HJ8A 3VB6A 2J95A 2A1DB 3ODFA 1DICA 1BJVA 4Q7YA 5DP5A 3TH2H 2VIOA 1A61H 3A7XA 1GI9B 4U30A 1UTQA 3RUOA 1EQ9A 7GCHF 1AI8H 2FIRH 3UWIA 3PMJA 4AX9H 2SGDE 3GDUA 1DOJA 3R3GB 1WV7H 4VGCC 4I33A 4Y7BA 2GVFA 4X1NU 2ZPQA 3M7TA 5B6OA 1SR5C 1K1JA 3TJNA 1GBCA 4E05H 2IOTA 1DY8A 2GCHF 1P03A 3DFJA 1O2YA 1C1SA 1TYNA 3SI4H 4YOGA 1NROH 1BBRE 1QIXB 2ZFPH 1PPGE 5T6GA 2OC8A 1FLEE 3MFJA 1QNJA 4MVNA 5A09A 1O3JA 1GMHG 3AASA 1G2MA 4UFEH 1GBKA 1GHXH 4X8TH 1SFQB 1THPB 3MMGA 5DJ7A 4K1SA 4XFQA 1GBLA 2WUCA 4AFQA 1CT2E 2FOCA 1Z6EA 3LONA 1MQ5A 2Q1JA 1FDPA 4WH8A 1LQEA 4TY7A 2ZF0H 1SLWB 3RM2H 1O3IA 4RSPA 1BMMH 2ZGBH 2F91A 2TBSA 2VVUA 4YLQH 4OS2A 1HAPH 3PB1E 2UUKB 3T5FH 2ZECA 1AZ8A 1C2KA 1HBTH 1YPKH 4NCYA 1G3BA 3AW0A 3SV2H 1O2HA 3SU1A 1QRWA 1FY1A 2RDLA 1S84A 1O3OA 4O03A 3RXFA 6GCHF 4IMQA 1HAZB 1TNJA 3PMAB 4CRDA 1KDQB 1BBRK 1QL7A 2Z6BD 1W10U 2OC7A 1BRAA 4I8GA 5K0HA 4RKJB 1TA6A 2AMQA 3SNEA 4J2YB 1OPHB 1YLDA 3T29A 2RG3A 2PKSC 1JXPA 1HAHH 3RMOH 3JZ2B 5JPMH 4NG9H 3VB7A 2G4TA 4ZKOU 1AIXH 2EI8A 3A8AA 3B9FH 3LGYA 5FPYA 1VR1H 1RD3B 1SLXB 4CR5A 3RU4D 1TABE 2FEQH 2PTNA 5C20A 1H9LB 3E90B 2HPPH 1O3HA 1SLUB 1UTNA 1SGQE 1GMCF 1DXPA 2F9PA 3MO3A 1P9UA 4CREA 5LPRA 3VEQB 1Y3YA 2F9VA 2IN2A 1LMWB 1HAIH 4YZUA 1O3EA 2VH6A 3RDZA 3SHAH 1VJAU 4CBOA 1K1OA 3BIVH 1ZHRA 3RXDA 1FY8E 2BY7X 2JH5D 2DUCA 3T2NA 3BEUA 1GBDA 1O2GH 1TGTA 4OS4A 3QN7A 1O34A 3PWCA 1XUHA 2HWLB 4I8LA 2BY8X 1BRCE 1A0JA 1N8OC 1J14A 2OC1A 2GDDA 3M36A 3PYHA 1IQHA 1A5HA 3T27A 1MH0A 1BTPA 3KIDU 1VGCB 1N8OB 3LC3A 4D9RA 3UUZA 3STJA 1PYTC 4OGXA 1K1PA 3GY7A 1O5EH 2ZTYA 3MNBA 3QTOH 3TK9A 4ZXXH 1G32B 5DG6A 1H4WA 2HRVA 2ZU2A 3LC5A 4FUHA 2QYIA 3C1KA 1O36A 1E37B 1QB6A 1PPZA 2VIDA 3TPIZ 1KLJH 6ESTA 1NN6A 1BHXF 1GJ8B 1TE0A 2W5EA 5AVDA 2FI3E 3S9BA 3OY6U 2C8WB 1QA7A 4NSYA 2H9EH 2B8OH 1V2LT 1QHRB 2PKAA 1O2MA 2ZFRH 2ZDLA 2AIQA 1G30B 1QQUA 1SGRE 2EA3A 2HOBA 3GDSA 4DY7B 2BOKA 5E2PA 1QGFA 2WYJA 2FZZA 2FI5E 4RKOB 3H7OA 2BDHA 1MBMA 4TWWA 5EOKA 1A0LA 5DK1A 1O5FH 1L1NA 3ZYEA 1HXEH 1A4WH 3RXJA 1B0FA 2AERH 1DWEH 1NU9A 1ARCA 1OWJA 2C93B 1JOUB 3QZQA 4JYTA 4A1VA 1J9CH 2BLOA 2PUXB 2B9LA 2GD4B 2A2QH 2O9QA 1Y5BT 1CA8B 3PO1C 1SQAA 1FNIA 5F03A 1UTLM 1GJDB 3RC5A 1HGTH 1D3TB 1W7XH 3VB4A 4GAWA 2XBVA 2ANWA 3D49H 2GTBA 1DANH 2ZFSA 4X6MA 2FWWA 1ZZZA 1SGPE 1FN8A 1LHCH 1KSNA 1HAYB 4CR9A 4I8JA 3UFAA 3N7OA 1XVOA 1NZQH 4MPUA 1SGDE 1RJXB 1MKXK 4U32A 3SN8A 1BDAA 1HXFH 3I78A 1DPOA 1C5YB 1TNKA 4IN2A 1GJ5H 2ZGCA 3LIWA 2H1UA 3HPTB 4ABJA 3P8FA 2BLWA 2FOMB 1UVTH 2BMGB 4DG4A 3O8BA 4J1YA 2ZTZA 3L6PA 2ZCKP 1IQKA 3C27B 1CHOF 2FTMA 1GI6A 1C5SA 3F9HA 1ZSKA 1DXWA 1BTHH 2FOAA 1LCYA 4ISOA 4FUFA 3QWCH 1HRTH 1UK2A 2ZHQH 3ZV8A 4ABAA 1GMDG 4JZFH 3ZVCA 4X0WU 2FODA 3M7QA 4R8TB 4WWYA 1W14U 2PFEA 1GHZA 3E3TA 1FIWA 3ATLA 2A32A 1BRBE 1NFYA 1GI2A 4YLUA 3RP2A 1GBEA 4LK4A 2FOEA 4GHTA 2FX6A 1TGNA 3O8RA 2LNCA 1QJ1B 1W12U 3UOUA 3SV9A 1GJ7B 1P2IA 4ABIA 3S0NA 5AHGH 4H6TA 2ASUB 1NTPA 2QGRA 3UWJH 4QT8C 2H9HA 2F9UA 1JIMA 3DA9B 1FPCH 2P94A 2OD3B 1K28D 4JZIA 5A8YA 3LOXA 5EW1H 5EGMA 4NFFA 3B23B 3MWIU 4MNWA 1ELDE 2ZDVH 4X2YA 3U98H 2XCNA 2Z9KA 3O8CA 1WTHD 1V2RT 5A8XA 2EC9H 5DP4A 2VIPA 1MTUA 5F8XA 1OWKA 2ZHFH 2ZDKA 1BRUP 5F6MA 1K1MA 1W7GH 3BEIB 4UD9H 2BX3A 5C5NA 4WMFA 2TIOA 3ELAH 4B74A 1DE7H 3M61U 3SU5A 2D8WA 3F1SB 2FS9A 4ABHA 1YPMH 1Z8IB 1W0YH 1EZQA 3SUFA 1SSXA 1KTSB 2O8MA 5C1XA 1C5ZB 2EI6A 1GMHF 2LPRA 5GPIB 3SZNA 4Y76A 3RXRA 2GCHG 4KELA 2ZO3H 1AWHB 1SGIB 2BDAA 1ZYOA 1RFNA 1AVWA 1LVBA 1YCPK 1A5IA 1GHAF 1N6XA 1WSSH 2Z7FE 1GHVH 3RXGA 1C4Y2 3PTNA 1WYKA 3IITA 2CXVA 1NFUA 2BVRH 1RIWB 3RXOA 1ZSLA 3HK3B 3SJOA 3QX5H 1AFQC 1T4VH 2JETC 2PLXA 1C9TA 1UVSH 1AU8A 1UCYK 3ZVAA 2G52A 1EASA 1BOQA 1P57B 1HNEE 3TJUA 1C5NH 1LVYA 3VFEA 1BB0B 5C3NA 3G01A 5GWZA 4GHQA 4YOIA 2GZ9A 3U1IB 3GY2A 2PSXA 1CT0E 2XTTB 4ZXYH 1OXGA 5L2YH 1C1VH 2OUAA 4Y0YE 3PMHB 1QRXA 2VWMA 5T6FA 5LPFA 3KHVA 1ZOMA 3A87A 4B75A 4ZH8A 4DURA 3U1JB 5AFYH 1AQ7A 2YNAA 4O3TA 4LXBH 4AFSA 1LVMA 3SHCH 1YC0A 2YNBA 1T8MA 8LPRA 5ABWA 2GV7A 2FLRH 1GHWH 3TH4H 2SNWA 3GYMA 3BG4C 2F9NA 1G9IE 1NRQH 3OX7U 4MNXA 4B73A 3R0FA 1BA8B 5LH8A 4HTCH 2FESH 3AAVA 3MOCA 4IC6A 1C1RA 2QV1A 3EQ0H 4DT7B 1F0SA 1GJCB 1H9IE 1MZAA 4UEHH 3P8GA 1ZRBA 2J38A 1TOMH 1ZRKA 2A7JA 4NA9H 4WF8A 6CHAB 1SL3A 2BY9X 1E36B 1KLIH 1O3KA 1CGHA 5EQQA 3SJ9A 4NZQA 3K6ZA 4K1TA 3Q00A 1L2EA 3V3MA 1GI5A 1SMFE 1SGFA 1KXEA 1IHTH 1O3LA 1LKAA 1QL8A 2J94A 2O8WA 4D8NA 2GMTB 2AFQB 1TBQH 3UNQA 1S83A 5EU8A 1FV9A 1NRPH 1YLCA 5HM9A 3F9FA 3W94A 3ZVDA 3TH3H 1SGNE 3OTJE 2RA0A 3HKJB 2BTCE 1AWFH 3MU8A 2VWOA 4E7RG 5EG4A 4AB8A 2R2WU 3EA9A 4X6PA 2ZU3A 1Q2WA 3K65B 2K1QA 1CBWC 1AZZA 2VVVA 3UIRA 1YYY1 1T8NA 1A1RA 1VGCC 1F7ZA 1XKAC 3TIUA 1MCTA 1E34B 2JKHA 1O3NA 4XE4A 3ZYDA 1FZZA 3ZZ6A 1XUIA 2ZCHP 8GCHF 1C5XB 1O5GH 2UWOA 4Y79A 1LVOA 1SGCA 1EAWA 2Y7XA 5K7RA 2NU4E 3FP8E 4ZHAA 3BTWE 5ETXA 3TNTA 2AS9A 1MQ6A 1UTKA 2BZAA 1N1LA 4FUEA 3BG8A 1OWHA 4UFDH 6LPRA 1GHYH 1C5WB 2QXHA 1O2OA 3UREA 5I46H 1TOCB 4AB9A 1Y5AT 3RXTA 1P0SH 4CH8B 2FO9A 1NRRH 2ZZUH 3RXVA 4Q2KA 1EX3A 5EQSA 1X7AC 3PLKA 1ZSJA 4TWYA 3UQVA 1ZHMA 1O2UA 3RXKA 5EW2H 3KF2A 1AVGH 4GPGA 1DSTA 3M5NA 1H9HE 4XBBA 3TK6A 1C4V2 3RMMH 4Q80A 3NWUA 2P95A 1T31A 3GDVA 4JYVH 1EZSC 1MMJN 4O3UA 5E0GA 1IQJA 4IGDA 2B5TB 4TY6A 1SGTA 1S82A 1YF4A 7KMEH 1IAUA 2XYAA 4A92A 5AF9H 3FZZA 1L1GA 2ZC9H 1HUTH 1EZXC 1O2LA 3ENSB 3ZZ7A 5GDSH 2NU1E 3V0XA 5G4BA 3S7HB 2FOBA 3RLYH 1GDQA 1KXBA 2QA9E 3LKWA 4Q7ZA 1G37A 5JBCS 1HLTH 4AORA 4MNYA 2STBE 3BTDE 3EA7A 4JZ1A 1NS3A 1MTVA 1MU8B 2GDEH 4K69A 1GDUA 3PO1B 2PSYA 3LU9B 2ESTE 2SGPE 2IJOB 3FVFB 1RGQA 2VGCB 1GBMA 3BTEE 2DE8A 1ZMJA 3RLWH 5SGAE 1V2OT 1KXCA 1V2WT 2PGBB 3OU0A 2VNTA 1P05A 1ZGIA 2A0QB 3SNDA 3TU7H 4YT7H 1IQFA 2BD5A 1CHOG 3MI4A 1EXFA 2GT7A 4JK5A 1UHBA 2FM2A 2PKSB 4X2VA 3LGVA 3RXCA 3ZZBA 1EP5A 2QXJA 1AY6H 1BTWA 1EATA 1YPLH 2WPMS 1UVUH 1A5GH 1V2NT 4LZ1H 4AZ2B 1AUJA 2WPLS 2ULLA 2GMTC 1TQ0B 2ZFTA 5F8TA 3S9AA 4I32A 1BJUA 1EAUA 2VGCC 1GHBF 1NRNH 4X1QU 2H9TH 1NT1A 3MH5A 3MO9A 3U8OH 3MNCA 4YO9A 3CS7A 1C2DA 2ZPRA 2G4UA 2ZKSA 3ATKA 4F4OC 2ZCLP 3TGIE 1HCGA 2UWLA 1IQEA 1BMAA 1CVWH 1C1WH 2KAIB 4GLYA 2A5IA 4UONA 2C8ZB 2OINA 4ISLA 1ZGVA 1Y8TA 3PLBA 4KTUA 1P3CA 3MU1A 2XC5A 2YOLA 5BPEA 1S85A 3VGCC 4ISNA 4YTAA 3SU4A 4AGJA 4OGYA 1MUEB 1T32A 2VWLA 1ANDA 4M7GA 3ZZ3A 4Y8YA 1RTKA 1AVXA 1GCDA 3AAUA 4INHA 1BTYA 3SI3H 4WVPE 4IW4E 2BD8A 3KQBA 3HGPA 1GJ9B 1LKBA 1C1UH 5DGJA 2BX4A 3GOVB 1RRKA 1Q31A 4X8VH 3RXEA 1PPCE 1WQVH 4FUCA 2P93A 4AFZA 3U8TH 1EP6A 4K5ZA 2D26C 1HJAB 2Z9JA 3RC6A 2Y7ZA 1GVZA 1AKSA 2FOGA 2WUBA 3E8LA 4HFPB 1KXDA 4AOQA 4H42U 2PV9B 2G55A 4DOQA 4FUGA 1HFDA 1K2I1 4BXSA 1J15A 2CV3A 2A2XH 4Z0KA 1A7SA 1LO6A 5GCHF 2PR3A 5FHTA 5FX5A 2ZU1A 1YM0A 2PW8H 3GY6A 1FI8A 1O3BA 1O30A 2QC2A 1TPPA 4U01A 3WY8A 4AG2A 1CGJE 1GI7B 5C5OA 1GVLA 1TRNA 2R0KA 4FVDA 1QTFA 4JK6A 1PFXC 1EB2A 2ANMH 1TNIA 3Q3KA 1GI4A 2GV6A 2A5AA 3GCHB 3I29A 3NK8A 3NXPA 2ZGXH 2SGAA 5E0HA 2CHAB 1FXYA 1ELAA 1LHDH 3NUMA 3TJOA 1YKTA 4Q7XA 3GY4A 1BTUA 1HJAC 1O2NA 1UCYH 2BYAX 1GHBG 1V2QT 3E1XB 1K22H 2ZU5A 1C1NA 2RCEA 2CJIA 1HAGE 2XC4A 3KEEA 1V6DA 4I31A 1C2MA 3QGNB 3AVZA 4K3JA 2AGIX 2WINI 1SGEE 1YCPM 3E0PB 3SJIA 1OX1A 1C5TA 4AN7A 4FU8A 3UQOA 1B0EA 4E06H 3RXLA 3VPKA 1ELBA 1GGDB 3M3VA 2ZHDA 3GCHC 1TNHA 5TCCA 3O8DA 4INKA 1H8IH 1Z6JH 1PPFE 2A5KA 1O3MA 2STAE 4K60A 3MO6A 5C2ZA 4A1TA 1Y3VA 4AYVB 3GICB 9LPRA 1ZMLA 1AMHA 1PQ7A 1TPAE 4NIYA 5TCAA 3NZIA 3P8OA 1GBBA 2ZEBA 1XX9A 5H4IB 2AH4X 1O38A 5HMAA 2ZG0H 1V3XA 2DE9A 1JRTA 2R3YA 1A3BH 1T8LA 1WBGB 3ATMA 1TBZH 2SGFE 4CRGA 5EXMA 4UFFH 1PYTD 3A8DA 2ZIQH 5FCRA 4JCNA 3SQEE 3MYWA 1T7CA 1LPGB 3A84A 3MU4A 4MNVA 1ETTH 2C8YB 2C4FH 1DITH 5E2OA 3LGIA 1GVKB 3U9AH 4YT6H 8GCHG 1EJNA 2P16A 1VCQA 2ODPA 4CRBA 2SGQE 2GT8A 1TMUH 4NWKA 4X6NA 1F5LA 3TGJE 4WY3A 4BAHB 3U69H 4CHAB 1C2GA 7ESTE 3ZV9A 3BEFB 3RU4E 3A7TA 3HATH 3Q3XA 4X1SU 5E0JA 1GI8B 2V3OH 2I6SA 3EE0B 1EPTB 1TGBA 1ZR0A 3KCGH 2WPHS 3RXBA 5AFZH 3W95A 3S9CA 2QIQA 3SW2B 1EOLA 2BY6X 1TB6H 3A88A 2CF9H 2HPQH 3SUDA 1AKSB 4UDWH 4K8BA 3UR6A 4AYYB 2UUYA 1PQ8A 3RXUA 1AD8H 4FXGH 3P6ZB 1TQ7B 2Z94A 1F92A 4WXIA 3KNXA 3MTYA 1KDQA 5A2MH 1RTFB 4WMDA 1CO7E 3ESTA 3D62A 1IQNA 1CA0C 1PJPA 2QXIA 1V2ST 2J92A 1BIOA 2TPIZ 1CBWB 1BZXE 1W2KH 2XW9A 3BV9B 5DP8A 4O97A 2W7SA 4BTTB 1C5OH 4FUBA 1XXFA 1MKWK 2BDCA 1ZHPA 1W13U 3ZZ4A 1LTOA 1LHEH 3URCA 2F9OA 3UTUH 2JETB 1WU1A 1GI1A 1T4UH 1Y3XA 2XCFA 1EZUC 3PV4A 1RIWC 1SHYA 1C5QA 3PMBB 2F9BH 3FANA 3UNSA 3LGTA 3RXPA 5FCKA 3Q3YA 1GBAA 2OBQA 1G3DA 4YM9A 2FX4A 2P3TB 2J34A 4BAKB 5JBTA 1U6QA 2GCTB 4JYUH 3T62A 1OP2A 3BIUH 4OS7A 3A81A 1B5GH 1TX6A 2TGPZ 1BITA 1BTXA 5LGOA 1C5RA 2P3UB 1HAVB 1KIGH 5EODA 3U8RH 3PROA 1C1QA 2VINA 2OXSA 3SGAE 2C90B 7LPRA 2WPKS 1A0HB 4YESB 4FU7A 1ELVA 3JZ1B 1KXAA 3GISB 1WOFA 2XWBI 2BD7A 4ISHH 4D7FA 1TMTH 2BLVA 1MD8A 2TGDA 2V6NA 1GCTC 1T8OA 3CP7A 2GCTC 1AB9C 1WCZA 1ELEE 3HGNA 3SGBE 1Z8JB 1NFWA 2AGEX 3IG6B 2QY0B 2A4QA 3LT3A 1HJ9A 4CBNA 5EXLA 2P59A 1QJ7B 3SORA 2PGQB 1Z71A 1UTJA 2FOHA 2GP9B 2ZHWH 4BANB 4WJG2 1BMLA 1ABIH 2G5VA 2TGTA 4KKDA 2PUQH 4X8SH 1HV7A 4BTUB 4DIHH 4NFEA 4I8HA 3ODDA 1MAYA 1DVAH 1FIZA 2VU8E 1NM6A 1MBQA 2P8OB 4GCHG 1L4DA 2Z3CA 5EXNA 2FTLE 1C5LH 1OOKB 1Z8RA 1PQ5A 1F5RA 2Y6TA 1ZJDA 1SG8B 1J8AA 1F5KU 4MDSA 2BDBA 2BZ6H 2D1JA 5T6DA 2C3SA 1YPJH 1D3DB 1TGCA 1C1OA 4KTSA 2FXRA 1SFIA 3ZVBA 5BRRE 5DO4H 3SV6A 2JH6D 1DLEA 2QXGA 1GJ6A 1ESAA 3L3TA 2G51A 1FAKH 2NU0E 1O39A 1NFXA 3SGQE 4ABBA 3GY8A 4B76A 4DCDA 1YPGH 4X2WA 1MZDA 2V0BA 1Z1IA 1HAVA 2B0FA 3E6PH 3VB3A 5J4SA 1ELCA 3A85A 2PWXA 2WYGA 1OYQA 1W11U 1L4ZA 3LPRA 1L1JA 2BQWB 2BY5X 1BCUH 1O5BB 2ANYA 4MPVA 3TNSA 1D6RA 1ELFA 2CF8H 3ATWA 1K1LA 1F0UA 2IPHA 3MNSA 3A7VA 1QBVH 1TALA 1FUJA 2Y81A 4A1XA 4AG1A 4CH2B 3QDZB 1V2MT 3LJJA 3STIA 2XC0A 2ODYB 5JB9S 3BTME 1ZLRA 1Y3WA 2J2UA 3GCTG 3OY5U 1MTNC 1O2QA 1XM1A 3A7WA 3I77A 4A7IB 1P01A 3A83A 3RMNH 2Y80A 4Y11E 5J4QA 5GCHG 2OTVA 1GL0E 1AFEH 5JYIA 1QY6A 2FOFA 1UHBB 1M9UA 4CRFA 3K6YA 1GL1A 5DP7A 2SGEE 3SU0A 3NPSA 3Q77A 2GGVB 1SGYE 2ZFQH 3A8CA 3ZZ5A 1VCWA 4Y8ZA 3TVJB 1ETSH 5CMXH 4Z6AH 2BDIA 3EYDA 5DP9A 4Y0ZE 3PM3A 4X8UH 2Q6GA 2ZGJA 2H2ZA 3S7KB 4ABDA 2XBWA 1BBRH 1O2ZA 1XUKA 4XDEA 5A0BA 1QL9A 1BUIA 2BD3A 3A80A 5GJ4B 3GYLB 4GVUA 2QF3A 3GY3A 1V2JT 4Y71A 5CE1A 1GI3A 3E91A 1VJ9U 2H5CA 1V2PT 3BTKE 3KL6A 3IWMA 1C2JA 1O5DH 4JZEH 2Y82A 4MPXA 1LQDB 1O5AB 1MAXA 4MG3A 4FUDA 3LDXH 4IMZA 1CU1A 5A8ZA 6CHAC 1AFQB 1TIOA 4A5TS 2HNTF 3DHKH 1S81A 3AW1A 5I25A 4VGCB 4AGKA 3LGWA 4D76A 3EAJA 1ZTLA 2FYRA 1EJAA 1O37A 2FS8A 1ZPCA 5JBBS 1P02A 2UWPA 4BXWA 1S6HA 1FPHH 3M35A 4H4FA 1GWAA 1TONA 4K1EA 3URDA 3RM0H 5PTPA 1ARBA 1O32A 1NU7B 3NCLA 1HB0B 3A82A 3FAOA 3SU3A 4XBCA 1GI0A 3SUGA 2ZGHA 1K21H 1RTLA 3RMLH 4CRAA 1XUFA 4ZHLU 4DJZB 3F9EA 3MH4A 1EUFA 4NWLA 4Y6DA 1DUEA 1P12E 4Y8XA 1DWCH 4DVAU 1ACBE 1ORFA 3PTBA 4LOYH 2BVXH 1O2PA 3LJOA 3SNBA 4IBLH 2UUJB 1S5SA 2A7HA 1BTZA 3NKKA 2NWNA 3P8NA 1LPZB 1V2UT 3OSYA 4XOJA 2A4OA 2BQ7B 2G81E 5C1UA 3ZVEA 5FPSA 1QBOA 1SQOA 1OWIA 3DT0H 4HI3A 3TITA 3MU5A 1TFXA 1A2CH 2AYWA 3PLPA 3T28A 4B2AA 1MD7A 1MU6B 1DSUA 1DT2A 1QA0A 3SBKA 1C5MD 5L6NH 1LHGH 2EEKA 1KTTB 1NC6A 3FZDA 2ZQ1A 1C1PA 1UMAH 1QBNA 4TPIZ 2VVCA 2VWNA 5DP6A 1FONA 3QGJA 3VGCB 2BVSH 3TGKE 1P2MA 5FAHA 2FLBH 1OYTH 1P11E 5EQRA 2ZWLH 1EJMA 1JWTA 1TLDA 1CHGA 1VCPA 1SOTA 1EPTA 3GCOA 4MQAA 3BSQA 5DKMA 1D6WA 1ETRH 1DS2E 1SBWA 1D9IA 5DP3A 1LDTT 1K9OE 4ZUHA 4B71A 3T25A 1C2FA 3RC4A 2VB0A 5FPTA 1FMGA 3OYPA 1HAOH 3P17H 2Z9IA 4ZMAH 3BG4B 1YPHE 2HGTH 2ZHEH 2XBYA 2BQ6B 3QTVH 4WH6A 1J17T 3DD2H 1IQLA 3E0NB 2FP7B 1NESE 1TPOA 4ISIH 5JDUB 2ALPA 5JBAS 2R3UA 2P8OC 3CENA 5C1YA 1YBWA 3VXEH 1PPEE 1TRMA 2O8UA 4YOJA 1AE8H 3HK6B 4R0IA 2OLGA 1UVPA 3FP6E 2HVXA 1MKXH 2CHAC 3MHWU 1THSH 2AEIH 3SU2A 4D7GA 2R0LA 3RXAA 4AFUA 4DGJA 1LHFH 2SFAA 1QB1A 1GBIA 1C2HA 1O2VA 4X1PU 2VH0A 5LPEA 2ZDAH 8ESTE 1FJSA 1GG6C 5CHAC 3M5MA 2OCVB 1GBJA 3E16B 2ODQA 1O5CB 1TAWA 1CE5A 2Z3EA 1AB9B 2PKAB 4UE7H 1C9PA 1QB9A 3B8JA 2G00A 1IHSH 2ZDNA 5CHAB 3ZZ9A 4BOHA 4ZAEA 2H6MA 1OS8A 1KXFA 4RN6A 1QCPA 5EPYA 2ZQ2A 1SQTA 1UO6A 4BNRA 2VIWA 1KYNA 1ANEA 3M5LA 3SJKA 1AHTH 1FAXA 4HZHA 2QN5T 1G3EA 2EI7A 3GY5A 1FQ3A 1VZQH 3BTQE 4CRCA 4ABFA 1CGIE 4MTBA 3K9XB 1BMNH 1ANCA 3SOSA 4FU9A 3RXIA 1XUJA 1UK4A 1DDJA 4ZKRU 5EPNA 2ZNKH 1G3CA 1E0FD 1TMBH 4DW2U 1XMNB 1UJ1A 1GMCG 1ELTA 2OP9A 1TBRH 4B2BA 2BD9A 4NA7A 5HXFA 1EAIA 4FUJA 1HIAB 4IC5A 4ABEA 1P2QA 3VB5A 5A0CA 2OC0A 1G2LA 4NA8A 1AE5A 1GBTA 1XXDA 1V2TT 2R2MB 4I7YH 1ABJH 3P70B 1HIAA 4HGCA 3SNAA 1MCVA 1EB1H 1O2TA 2I6QA 5FXLA 1K1NA 4U2WA 1S0QA 4ZKNU 2WPJS 1WUNH 3BTTE 2BB4A 1P04A 5L30H 1ZTKA 1ZTJA 5FX6A 1C2EA 2ZP0H 1C1TA 1V2KT 2A4RA 1JBUH 1C1MA 2OQUA 3LH1A 2FMJA 1NO9H 1OP8A 2C8XB 3P92A 1E35B 4E7NA 4NIWA 2BM2A 1F0TA 3F6UH 4PROA 1IQGA 1GJBB 1O2XA 1O2WA 2WV4A 1O2KA 4ZHMU 1CT4E 1MKWH 3A86A 3TJVA 1TNGA 3GCTF 2G8TA 2SNVA 3QUMP 1OWDA 2A31A 5T3HA 3A7YA 1SGFG 1OKXA 1H1BA 1DWBH 3D23A 1FY4A 3T26A 1C4U2 1XVMA 2Q6FA 3P95A 3TK5A 1FY3A 4BAMB 3QZRA 4IS5A 1BT7A 1IOEA 2FYQA 2W3KA 4H6SB 1VITF 1ESTA 4MLFB 4ZROA 2FI4E 3GCNA 1O3AA 3MU0A 1Y3UA 3ZZAA 3TLOA 1P10A 4B1TA 1H8DH 7GCHG 1B7XB 5HGGA 2V3HH 5DPAA 1P09A 3HKIB 3M5OA 1ZMNA 3KQCA 1GPZA 4FUIA 3DFLA 4X2XA 5A0AE 1F0RA 4XBDA 2HLCA 1HPGA 1UTMA 3EDXB 3LH3A 4SGBE 1YGCH 5C67A 1GJ4H 1BHXB 2BXUH 3QO6A 2OQ5A 3M7UA 3M3TA 1JMOH 1UCYE 2ILNA 3A7ZA 5E8EH 3SV8A 4CHAC 1D3PB 3F9GA 3ITIA 1P2NA 3QK1A 1GBFA 1C5UA 1INCA 1F2SE 1TRYA 4GSOA 2O8TA 2M5TA 1W3CA 5ESBA 2J4IA 1V2VT 1O3GA 2G5NA 1BQYA 3KQDA 1W8BH 6GCHG 1O2JA 1UVOA 3D65E 2W7UA 3VXFH 1UK3A 1D4PB 1LPKB 3MH6A 1Z7KA 1IQIA 1EPTC 1CQQA 1D3QB 4WXVA 2P3FH 1EOJA 1DM4B 1QJ6B 4JZDH 1C2IA 4F49A 4THNH 2CMYA 3CS0A 3BF6H 2AMDA 5HM2A 2XBXA 5F8ZA 1EAXA 1RS0A 2AMPA 1DUAA 5JB8S 1G36A 1UTPA 1QR3E 1SPJA 2ZDMA 3SU6A 2HNTC 4FVBA 1O31A 1TNLA 1AO5A 2Y5HA 1WAYB 1O2IA 1ZPBA 2B7DH 1GCTB 2XNIA 4JMYA 1DX5M 2VJ1A 2CGAA 4NZLA 1THRH 1O2RA 3FFGA 2GKVE 1PPBH 3LGUA 1E38B 1A3EH 1TX7A 3KQEA 5TJXA 2BDGA 1P2KA 1TA2A 2HALA 2HNTE 2WV5A 1ANBA 9ESTA 1GBHA 1RXPA 4BAQB 1IQMA 2ZFFH 1DLKB 1P2JA 1AGJA 4SGAE 1WQSA 1OWEA 2PHBA 1GDNA 2RA3A 4KGAA 4K2YA 4OS6A 1KLTA 1GG6B 1OP0A 3RXSA 1P8VC 1VITH 1N6YA 1O3CA 2ZU4A 1S0RA 1O0DH 1A46H 4GUXA 4UFGH 1MTSA 5GIBA 1QURH 1TWXB 3M37A 1W0ZU 4NSVA 1SC8U 3RXQA 3ZZ8A 1UTOA 2GX4A 2QAAA 1P3EA 2GZ7A 3L33A 1VITG 3BTGE 1O3DA 2AGGX 3S69A 1TGSZ 2OBOA 3ATIA 2CN0H 4TYDA 2Y5FA 2A7CA 1CA0B 3A8BA 3RXHA 1P9SA 1FY5A 5FBIA 4Y7AA 1SB1H 2VIQA 4IN1A 4NIVA 2F3CE 3F68H 1O2SA 3EGKH 3BTFE 2ZPSA 4TPYA 3PWBA 3BN9A 1GHAG 1C2LA 1L0ZA 2ZA5A 2NU3E 1GJAB 2F83A 1J16A 2BDYA 4X1RU 1SOZA 3MNXA 3KGPA 2PTCE 3SJ8A 3V7TA 1YPHC 2KAIA 2Z9LA 3V12A 2QCYA 1NPMA 5GXPA 3Q76A 2AIPA 1DFPA 1HAXB 5IYTA 1ZPZA 3UPEA 3UY9A 1SI5H 2FDAA 2ZTXA 1Y5UT 1JRSA 5FBEA 1YCPH 1C5VA 1ID5H 3H5CB 4WMEA 4BAOB 1GGDC 4BTIB 2UUFB 1O3FA 2V35A 1XUGA 1JIRA 3DUXH 4ASHA 1XKBC 1DWDH 3H7TA 3SV7A 1SHHB 1P2OA 5IDKA 1K1IA 2Z9GA 1Q3XA 3BTHE 3ZVFA 1Z1JA 2Z3DA 2W3IA 3UR9A 2XWAA 5HYOA 1NY22 4NGAH 2VIVA 4OS1A 2THFB 3EA8A 1NRSH 2BXTH 3UOPA 1S6FA 4OS5A 4B2CA 3M3SA 3ZVGA 3ZZCA 3KN2A 1TPSA 1DY9A 4ZKSU 2BOHB 3A89A 2H5DA 3V13A 4ESTE 2NU2E 2BD4A 3SO3A 3SUEA 4MPWA 3FP7E 1YPEH 1QRZA 1AN1E 1EKBB 1HDTH 1CSOE 5ESTE 2JH0D 2W26A 2ZI2H 4X6OA 2BD2A 2XXLA 2D2DA 3RU4T 1Z8GA 1HYLA 2ALVA 4O9VA 3MH7A 4D9QA 1WTGH 2O8LA 3QLPH 2ANKH 1C5PA 4KTCA 1MTNB 1O35A 1O3PB 2TGAA 2Y5GA 1FN6A 2XRCA
chains in the Genus database with same CATH superfamily
1QFKH 2WPIS 2TRMA 1KY9A 4I8KA 1SVPA 1SLVB 1PPHE 2BLQA 1PQAA 3K2UA 4DIIH 4Y10E 4A6LA 1Y59T 4INLA 1P06A 8KME2 2A4GA 3SNCA 1TX8A 2R9PA 2Q6DA 3UNRA 1GMDF 1YP9A 1ZJKA 4XSKU 1OSSA 5L2ZH 2QF0A 1O33A 1ESBA 2BHGA 3AK5A 4NIXA 2J9NA 4KP0A 2JJ1D 3SQHE 3PV5A 4K8YA 1ELGA 2FPZA 2EQNA 4RT0A 4B6EA 1MTWA 1AUTC 3RXMA 4LZ4B 2GZ8A 4GCHF 3ZZDA 4ABGA 2A45B 1QQ4A 3F2GA 1HJ8A 3VB6A 2J95A 2A1DB 3ODFA 1DICA 1BJVA 4Q7YA 5DP5A 3TH2H 2VIOA 1A61H 2LELA 2KX4A 3A7XA 1GI9B 4U30A 1UTQA 3RUOA 1EQ9A 7GCHF 1AI8H 2FIRH 3PRBA 3UWIA 3PMJA 4AX9H 2SGDE 3GDUA 1DOJA 2VBCA 3R3GB 1WV7H 4VGCC 4I33A 4Y7BA 2GVFA 4X1NU 2ZPQA 3M7TA 5B6OA 1SR5C 1K1JA 3TJNA 1GBCA 4AC9A 4E05H 2IOTA 1DY8A 2GCHF 1P03A 2J98B 3DFJA 1O2YA 1C1SA 2KCAA 1TYNA 3SI4H 4YOGA 1NROH 1BBRE 1QIXB 2ZFPH 1PPGE 5T6GA 2OC8A 1FLEE 3MFJA 1QNJA 4MVNA 5A09A 1O3JA 1GMHG 3AASA 3DSGA 1G2MA 4UFEH 1GBKA 1GHXH 4X8TH 1SFQB 1THPB 3MMGA 5DJ7A 4K1SA 4XFQA 1GBLA 2WUCA 4AFQA 1CT2E 2FOCA 1Z6EA 3LONA 1MQ5A 2Q1JA 1FDPA 4WH8A 1LQEA 4TY7A 2ZF0H 1SLWB 3RM2H 1O3IA 4RSPA 1BMMH 2ZGBH 2F91A 2TBSA 2VVUA 3WWBA 4YLQH 4OS2A 1HAPH 3PB1E 2UUKB 3T5FH 2ZECA 1AZ8A 1C2KA 1HBTH 1YPKH 4NCYA 1G3BA 3AW0A 3SV2H 1O2HA 3SU1A 1QRWA 1FY1A 2WPDD 2RDLA 1S84A 3F0OA 1O3OA 4O03A 4M9FA 3RXFA 6GCHF 4IMQA 1HAZB 1TNJA 3PMAB 4CRDA 1KDQB 1BBRK 1QL7A 2Z6BD 1W10U 3N99A 2OC7A 1BRAA 4XD7D 4I8GA 5K0HA 4RKJB 1TA6A 2AMQA 3SNEA 4J2YB 1OPHB 1YLDA 3T29A 2RG3A 2PKSC 1JXPA 1HAHH 3RMOH 3JZ2B 5JPMH 4NG9H 3VB7A 2G4TA 4ZKOU 1AIXH 2EI8A 3A8AA 3B9FH 3LGYA 5FPYA 1VR1H 1RD3B 1SLXB 4CR5A 3RU4D 1TABE 2FEQH 2PTNA 5C20A 1H9LB 3E90B 2HPPH 2KM0A 1O3HA 1SLUB 1UTNA 1SGQE 1GMCF 1DXPA 2F9PA 3MO3A 1P9UA 4CREA 5LPRA 3VEQB 1Y3YA 2F9VA 2IN2A 1LMWB 1HAIH 4YZUA 1O3EA 2VH6A 3RDZA 3SHAH 1VJAU 4CBOA 2AHME 1K1OA 3BIVH 1ZHRA 3RXDA 1FY8E 2BY7X 2JH5D 2DUCA 3T2NA 3BEUA 1GBDA 1O2GH 1TGTA 4OS4A 3QN7A 1O34A 1W0KD 3PWCA 1XUHA 2HWLB 4I8LA 2BY8X 1BRCE 1A0JA 1N8OC 1J14A 2OC1A 2GDDA 3KYGA 3M36A 3PYHA 1IQHA 1A5HA 2XOKD 3T27A 1MH0A 1BTPA 3KIDU 1VGCB 1N8OB 3LC3A 4D9RA 3UUZA 3STJA 1PYTC 4OGXA 1K1PA 5IK2D 3GY7A 1O5EH 2ZTYA 3MNBA 3QTOH 3TK9A 4ZXXH 1G32B 5DG6A 1H4WA 2HRVA 2ZU2A 3LC5A 4FUHA 2QYIA 3C1KA 1O36A 1E37B 1QB6A 1PPZA 2VIDA 3TPIZ 1KLJH 6ESTA 1NN6A 1BHXF 1GJ8B 1TE0A 2W5EA 5AVDA 2FI3E 3S9BA 3OY6U 2C8WB 1QA7A 4NSYA 2H9EH 2K8IA 2B8OH 2KCYA 1V2LT 1QHRB 2PKAA 1O2MA 2ZFRH 2ZDLA 2AIQA 1G30B 1QQUA 1SGRE 2EA3A 2HOBA 3GDSA 4DY7B 2BOKA 5E2PA 1QGFA 2WYJA 2FZZA 2FI5E 4RKOB 3H7OA 2BDHA 1MBMA 4TWWA 5EOKA 1A0LA 5DK1A 1O5FH 1L1NA 3ZYEA 1HXEH 1A4WH 3RXJA 1B0FA 2AERH 1DWEH 3KQ5A 1NU9A 1ARCA 1OWJA 1H8HD 2C93B 1JOUB 3QZQA 4JYTA 4A1VA 1J9CH 2BLOA 2PUXB 3FO8D 2B9LA 2GD4B 2A2QH 2O9QA 1Y5BT 1CA8B 3PO1C 1SQAA 1FNIA 5F03A 1UTLM 1GJDB 3RC5A 1HGTH 1D3TB 1W7XH 3VB4A 4GAWA 2XBVA 2ANWA 3D49H 2W6ID 2GTBA 1DANH 2ZFSA 4X6MA 2FWWA 1ZZZA 1SGPE 1FN8A 4OM9A 1LHCH 1KSNA 1HAYB 4CR9A 4I8JA 3UFAA 3N7OA 1XVOA 1NZQH 4MPUA 1SGDE 1RJXB 1MKXK 4U32A 3SN8A 1BDAA 1HXFH 3I78A 1DPOA 1C5YB 1TNKA 4IN2A 1GJ5H 2ZGCA 3FOAA 3LIWA 2H1UA 3HPTB 4ABJA 2M2AA 3P8FA 2BLWA 2FOMB 1UVTH 2BMGB 4DG4A 2J5UA 3O8BA 4J1YA 2ZTZA 3L6PA 2ZCKP 1IQKA 3C27B 1CHOF 2FTMA 1GI6A 1C5SA 3F9HA 1ZSKA 1DXWA 1BTHH 2FOAA 1LCYA 4ISOA 4FUFA 5F53A 1KMHB 3QWCH 1HRTH 1UK2A 2ZHQH 3ZV8A 4ABAA 1GMDG 4JZFH 3ZVCA 4X0WU 2FODA 5GNDA 3M7QA 4R8TB 4WWYA 1W14U 2PFEA 1GHZA 3E3TA 1FIWA 3ATLA 2A32A 1BRBE 1NFYA 1GI2A 4YLUA 3RP2A 1GBEA 4LK4A 2FOEA 4GHTA 2FX6A 1TGNA 5FL7D 3O8RA 2LNCA 1QJ1B 1W12U 3UOUA 5C94A 5DN6D 1GJ7B 3SV9A 1P2IA 4ABIA 3S0NA 5AHGH 4H6TA 2ASUB 1NTPA 3VG8A 2QGRA 3UWJH 4QT8C 2H9HA 2F9UA 1JIMA 3DA9B 1FPCH 2P94A 2OD3B 3OEHD 1K28D 4JZIA 5A8YA 3LOXA 5EW1H 5EGMA 4NFFA 2KCPA 3B23B 3MWIU 4MNWA 1ELDE 2ZDVH 4X2YA 3U98H 2XCNA 2Z9KA 3O8CA 1WTHD 2RFKC 1V2RT 5A8XA 2EC9H 5DP4A 2VIPA 1MTUA 5F8XA 1OWKA 2ZHFH 2ZDKA 1BRUP 5F6MA 1K1MA 1W7GH 3BEIB 4UD9H 2BX3A 5C5NA 1VKYA 4WMFA 2TIOA 3ELAH 2V7QD 4B74A 1DE7H 3M61U 3SU5A 3OAAD 2D8WA 3F1SB 2FS9A 4ABHA 1YPMH 1Z8IB 1W0YH 1EZQA 3SUFA 1SSXA 1KTSB 2O8MA 5C1XA 1C5ZB 2EI6A 1GMHF 2LPRA 5GPIB 3SZNA 4Y76A 3RXRA 2GCHG 4KELA 2ZO3H 1AWHB 1SGIB 2BDAA 1ZYOA 1RFNA 1AVWA 1LVBA 3DSPA 1YCPK 1A5IA 1GHAF 1N6XA 1WSSH 2Z7FE 1GHVH 3RXGA 1C4Y2 3PTNA 1WYKA 3IITA 2CXVA 1NFUA 2BVRH 1RIWB 3RXOA 1ZSLA 3HK3B 3SJOA 3QX5H 1AFQC 1T4VH 2JETC 2PLXA 3WWFA 1C9TA 1UVSH 1AU8A 1UCYK 3FN8A 3ZVAA 2G52A 1EASA 1BOQA 1P57B 1HNEE 3TJUA 1C5NH 1LVYA 3VFEA 1BB0B 5C3NA 3G01A 5GWZA 4GHQA 4YOIA 2GZ9A 3U1IB 3GY2A 2PSXA 1CT0E 2XTTB 4ZXYH 1OXGA 5L2YH 1C1VH 2OUAA 4Y0YE 3PMHB 1QRXA 2VWMA 5T6FA 5LPFA 3KHVA 1ZOMA 3A87A 4B75A 4ZH8A 4DURA 3U1JB 5AFYH 1AQ7A 2YNAA 4O3TA 4LXBH 4AFSA 1LVMA 3SHCH 1YC0A 2YNBA 1T8MA 8LPRA 5ABWA 2GV7A 2FLRH 1GHWH 3TH4H 3CNRA 2SNWA 3GYMA 3BG4C 2F9NA 1G9IE 1NRQH 3OX7U 4MNXA 4B73A 3R0FA 1BA8B 5LH8A 4HTCH 2FESH 3AAVA 3MOCA 4IC6A 1C1RA 1QZ8A 2QV1A 3EQ0H 4DT7B 1F0SA 1GJCB 1H9IE 1MZAA 4UEHH 3P8GA 1ZRBA 2J38A 1TOMH 1ZRKA 2A7JA 4NA9H 4WF8A 6CHAB 1SL3A 2QE7D 2BY9X 1E36B 1KLIH 1O3KA 1CGHA 5EQQA 3SJ9A 4NZQA 3K6ZA 4K1TA 3Q00A 1L2EA 3V3MA 1GI5A 1SMFE 1SGFA 1KXEA 1IHTH 1O3LA 3DCLA 1LKAA 1QL8A 2J94A 2O8WA 4D8NA 2GJGA 2GMTB 2AFQB 1TBQH 2HLDD 3UNQA 1S83A 5EU8A 1FV9A 1NRPH 1YLCA 5HM9A 3F9FA 3W94A 3ZVDA 3TH3H 1SGNE 3OTJE 2RA0A 3HKJB 2BTCE 1AWFH 3MU8A 2VWOA 4E7RG 5EG4A 4AB8A 2R2WU 3EA9A 2IJD1 4X6PA 5KECA 2ZU3A 1Q2WA 3K65B 2K1QA 1CBWC 1AZZA 2VVVA 3UIRA 1YYY1 1T8NA 1A1RA 1VGCC 1F7ZA 1XKAC 3TIUA 5EJLA 1MCTA 1E34B 2JKHA 1O3NA 4TSFD 4XE4A 3ZYDA 1FZZA 3ZZ6A 1XUIA 2ZCHP 8GCHF 1C5XB 1O5GH 2UWOA 4Y79A 1LVOA 1SGCA 1EAWA 2Y7XA 5K7RA 2NU4E 3FP8E 4ZHAA 3BTWE 5ETXA 3TNTA 2AS9A 1MQ6A 1UTKA 2BZAA 1N1LA 4FUEA 3BG8A 1OWHA 4UFDH 6LPRA 1GHYH 1C5WB 2QXHA 1O2OA 3UREA 5I46H 1TOCB 4AB9A 1Y5AT 3RXTA 1P0SH 4CH8B 2FO9A 1NRRH 2ZZUH 3RXVA 4Q2KA 1EX3A 5EQSA 1X7AC 3PLKA 1ZSJA 4TWYA 3UQVA 1ZHMA 1O2UA 3RXKA 5EW2H 3KF2A 1W0JD 1AVGH 4GPGA 1DSTA 3M5NA 3OTPA 1H9HE 4XBBA 3TK6A 1C4V2 3RMMH 4Q80A 3NWUA 2P95A 1T31A 3GDVA 4JYVH 1EZSC 1MMJN 4O3UA 5E0GA 1IQJA 4IGDA 2B5TB 4DT4A 4TY6A 1SGTA 1S82A 1YF4A 7KMEH 1IAUA 2XYAA 4A92A 5AF9H 3FZZA 1L1GA 2ZC9H 1HUTH 1EZXC 1O2LA 3ENSB 3ZZ7A 5GDSH 5KGOA 2NU1E 3V0XA 5G4BA 3S7HB 2FOBA 3RLYH 1GDQA 1KXBA 2QA9E 3LKWA 4Q7ZA 1G37A 5JBCS 1HLTH 4AORA 4MNYA 2STBE 3BTDE 3EA7A 4JZ1A 1NS3A 1MTVA 1MU8B 3OFND 2GDEH 4K69A 1GDUA 3PO1B 1YLNA 2PSYA 3LU9B 2ESTE 2SGPE 4HG6A 2IJOB 3FVFB 1RGQA 2VGCB 1GBMA 3BTEE 2DE8A 1ZMJA 3RLWH 5SGAE 1V2OT 1KXCA 1V2WT 2PGBB 3OU0A 1P05A 1ZGIA 2VNTA 2A0QB 3SNDA 3TU7H 4YT7H 1IQFA 2BD5A 1CHOG 3MI4A 1EXFA 2GT7A 4JK5A 5T1VA 1UHBA 2FM2A 2PKSB 3EE7A 4X2VA 3LGVA 3RXCA 3ZZBA 1EP5A 2QXJA 1AY6H 1BTWA 1EATA 1YPLH 2WPMS 1UVUH 1A5GH 1V2NT 4LZ1H 3F3BA 4AZ2B 1AUJA 2CK3D 2WPLS 2ULLA 2GMTC 1TQ0B 2ZFTA 5F8TA 3S9AA 4I32A 1BJUA 1EAUA 1WDIA 1GHBF 2VGCC 1NRNH 4X1QU 2H9TH 1NT1A 3MH5A 3MO9A 3U8OH 3MNCA 4YO9A 3CS7A 5CHBA 1C2DA 2ZPRA 2G4UA 2ZKSA 3ATKA 4F4OC 2ZCLP 3TGIE 1HCGA 2UWLA 5EJZA 1IQEA 1BMAA 1CVWH 1C1WH 2KAIB 4GLYA 2A5IA 5C0TA 4UONA 2C8ZB 2OINA 4ISLA 1ZGVA 1Y8TA 3PLBA 4KTUA 1P3CA 3MU1A 2XC5A 2YOLA 5BPEA 1S85A 3VGCC 4ISNA 4YTAA 3SU4A 4AGJA 4OGYA 1MUEB 1T32A 2VWLA 1ANDA 4M7GA 3ZZ3A 4Y8YA 1RTKA 1AVXA 1GCDA 3AAUA 4INHA 1BTYA 3SI3H 4WVPE 4IW4E 2BD8A 3KQBA 3HGPA 1GJ9B 1LKBA 1C1UH 5DGJA 4FETA 3F2FA 4Q63A 1COWD 2BX4A 3GOVB 1RRKA 1E79D 1Q31A 4X8VH 3RXEA 1PPCE 1WQVH 4FUCA 2P93A 4AFZA 3U8TH 1EP6A 4K5ZA 2D26C 1E1RD 1HJAB 2Z9JA 2KFWA 2JDID 3RC6A 2Y7ZA 1GVZA 1AKSA 2FOGA 2WUBA 3E8LA 4HFPB 1KXDA 4AOQA 4H42U 2PV9B 2G55A 3GS9A 4DOQA 4FUGA 1HFDA 1K2I1 4BXSA 1J15A 2CV3A 2A2XH 4Z0KA 1A7SA 1LO6A 5GCHF 2PR3A 5FHTA 5FX5A 2ZU1A 1YM0A 2PW8H 3GY6A 4Q4LA 1FI8A 1O3BA 1O30A 2QC2A 1TPPA 3UAIC 4U01A 3WY8A 4AG2A 1CGJE 1GI7B 5C5OA 1GVLA 1TRNA 2R0KA 4FVDA 1QTFA 4JK6A 1PFXC 1EB2A 2ANMH 1TNIA 3Q3KA 1GI4A 2GV6A 2A5AA 3GCHB 3I29A 3NK8A 3NXPA 2ZGXH 2SGAA 5E0HA 2CHAB 1FXYA 1ELAA 1LHDH 3NUMA 3TJOA 2HVYB 1YKTA 4Q7XA 3GY4A 1BTUA 1HJAC 1O2NA 1UCYH 2BYAX 1GHBG 1V2QT 3E1XB 1K22H 2ZU5A 1C1NA 2RCEA 2CJIA 1HAGE 2XC4A 3KEEA 1V6DA 4I31A 1C2MA 3QGNB 3AVZA 4K3JA 2AGIX 2WINI 1SGEE 1YCPM 2WSSD 3E0PB 3SJIA 3SZEA 1OX1A 1C5TA 4AN7A 1SKYE 4FU8A 3UQOA 1B0EA 4E06H 3RXLA 3VPKA 1ELBA 1GGDB 3M3VA 2ZHDA 3GCHC 1TNHA 5TCCA 3O8DA 4INKA 1H8IH 1Z6JH 1PPFE 2A5KA 1O3MA 2STAE 4K60A 3MO6A 5C2ZA 4A1TA 1Y3VA 4AYVB 3GICB 9LPRA 1BMFD 1ZMLA 1AMHA 1PQ7A 1TPAE 4NIYA 5TCAA 3NZIA 3P8OA 1GBBA 3KYFA 2ZEBA 1XX9A 5H4IB 2AH4X 1O38A 5HMAA 2ZG0H 1V3XA 2DE9A 1JRTA 2R3YA 1A3BH 1T8LA 1WBGB 3ATMA 1S6LA 1TBZH 2SGFE 4CRGA 5EXMA 4UFFH 1PYTD 3A8DA 2YMSB 2ZIQH 5FCRA 4JCNA 3SQEE 3MYWA 1T7CA 1LPGB 3A84A 3MU4A 4MNVA 1ETTH 2C8YB 2C4FH 1DITH 5E2OA 3LGIA 1GVKB 3U9AH 4YT6H 8GCHG 1EJNA 2P16A 1VCQA 2ODPA 4CRBA 2SGQE 2GT8A 1TMUH 4NWKA 4X6NA 1F5LA 3TGJE 4WY3A 4BAHB 3U69H 4CHAB 1C2GA 7ESTE 3ZV9A 3BEFB 3RU4E 3A7TA 3HATH 3Q3XA 4X1SU 5E0JA 1GI8B 2V3OH 2I6SA 3EE0B 1EPTB 1TGBA 1ZR0A 3KCGH 2WPHS 3RXBA 5AFZH 5B6LA 3W95A 3S9CA 2QIQA 3SW2B 1EOLA 2BY6X 1TB6H 3A88A 3F2HA 2CF9H 2HPQH 3SUDA 1AKSB 2IPQX 4UDWH 4K8BA 3UR6A 4AYYB 2UUYA 1PQ8A 3RXUA 1AD8H 4FXGH 3P6ZB 1TQ7B 2Z94A 1F92A 4WXIA 3KNXA 3MTYA 1KDQA 5A2MH 1RTFB 4WMDA 1CO7E 3ESTA 3D62A 1IQNA 1CA0C 1PJPA 2QXIA 1V2ST 2J92A 1BIOA 2TPIZ 1CBWB 1BZXE 1W2KH 2XW9A 3BV9B 5DP8A 4O97A 2W7SA 4BTTB 1C5OH 4FUBA 1XXFA 1MKWK 2BDCA 1ZHPA 1W13U 3NRLA 1LTOA 3ZZ4A 1LHEH 1UW7A 3URCA 2F9OA 3UTUH 2JETB 1WU1A 1GI1A 1T4UH 1Y3XA 2XCFA 5DSFA 1EZUC 3PV4A 1RIWC 1SHYA 1C5QA 3PMBB 2F9BH 3FANA 3UNSA 3LGTA 3RXPA 5FCKA 3Q3YA 1GBAA 2OBQA 1G3DA 1EFRD 4YM9A 1NBMD 2FX4A 2P3TB 2J34A 4BAKB 5JBTA 1U6QA 2GCTB 4JYUH 3T62A 3U28C 1OP2A 3BIUH 2JJ2D 4OS7A 3A81A 1B5GH 1TX6A 2K0QA 2TGPZ 1BITA 1BTXA 5LGOA 1C5RA 2P3UB 1HAVB 1KIGH 5EODA 3U8RH 3PROA 1C1QA 2VINA 2OXSA 2L6OA 3SGAE 2C90B 1H8ED 7LPRA 2WPKS 1A0HB 4YESB 4FU7A 1ELVA 3JZ1B 1KXAA 3GISB 1WOFA 4RT1A 2XWBI 2BD7A 5KEDA 4ISHH 4D7FA 1TMTH 2BLVA 1MD8A 2TGDA 2V6NA 1GCTC 1T8OA 3OEED 3CP7A 2GCTC 1AB9C 1WCZA 1ELEE 3HGNA 3SGBE 1Z8JB 1NFWA 2AGEX 3IG6B 2QY0B 2A4QA 3LT3A 1HJ9A 2OK5A 4CBNA 5EXLA 2P59A 1QJ7B 2KR7A 4FOUC 2PGQB 3SORA 1Z71A 1UTJA 5C0UA 2FOHA 2GP9B 2ZHWH 4BANB 4WJG2 1BMLA 1ABIH 2G5VA 2TGTA 4KKDA 2PUQH 4X8SH 1HV7A 4BTUB 4DIHH 4NFEA 4I8HA 3ODDA 1MAYA 1DVAH 1FIZA 2VU8E 1NM6A 1MBQA 2P8OB 4GCHG 1L4DA 2Z3CA 5EXNA 2FTLE 1C5LH 1OOKB 1Z8RA 1PQ5A 1F5RA 2Y6TA 1ZJDA 1SG8B 1J8AA 1F5KU 4MDSA 2BDBA 2BZ6H 2D1JA 5T6DA 2C3SA 1SQRA 1YPJH 1D3DB 1TGCA 1C1OA 4KTSA 2FXRA 1SFIA 3ZVBA 5BRRE 5DO4H 3SV6A 1OHHD 2JH6D 1DLEA 2QXGA 1GJ6A 1ESAA 3L3TA 2G51A 1FAKH 2NU0E 1O39A 1NFXA 3F0PA 3MQKC 3SGQE 4ABBA 3GY8A 4B76A 4DCDA 1YPGH 4P00A 4X2WA 1MZDA 2V0BA 1Z1IA 1HAVA 2B0FA 3E6PH 3VB3A 5J4SA 1ELCA 3A85A 2PWXA 2WYGA 1OYQA 1W11U 1L4ZA 3LPRA 1L1JA 2BQWB 2BY5X 1BCUH 1O5BB 2ANYA 4MPVA 3TNSA 1D6RA 1ELFA 2CF8H 3ATWA 3PRDA 1K1LA 1F0UA 2WHXA 2IPHA 3MNSA 3A7VA 1QBVH 1TALA 1FUJA 2Y81A 4A1XA 4AG1A 4CH2B 3QDZB 1V2MT 3LJJA 3STIA 2XC0A 2ODYB 5JB9S 3BTME 1ZLRA 1Y3WA 2J2UA 3GCTG 3OY5U 1MTNC 1O2QA 1XM1A 3A7WA 3I77A 4A7IB 1P01A 3A83A 3RMNH 2Y80A 4Y11E 5J4QA 5GCHG 2OTVA 1GL0E 1AFEH 5JYIA 1QY6A 2FOFA 1UHBB 1M9UA 4CRFA 3K6YA 1GL1A 5DP7A 2SGEE 3SU0A 3NPSA 3Q77A 2GGVB 1SGYE 2ZFQH 3A8CA 3ZZ5A 2J97A 1VCWA 3DSOA 4Y8ZA 3TVJB 2PP6A 3OE7D 1ETSH 5CMXH 4Z6AH 2BDIA 3EYDA 2YMSD 5DP9A 4Y0ZE 3PM3A 4X8UH 2Q6GA 2ZGJA 2F43B 2H2ZA 3S7KB 4ABDA 2XBWA 1BBRH 1O2ZA 1XUKA 2QF5A 4XDEA 5A0BA 4B6FA 1QL9A 1BUIA 2BD3A 3A80A 5GJ4B 3GYLB 4GVUA 2QF3A 3GY3A 1V2JT 4Y71A 5CE1A 1GI3A 3E91A 1VJ9U 2H5CA 3SYJA 1V2PT 3BTKE 3KL6A 3IWMA 1C2JA 1O5DH 4JZEH 2Y82A 4MPXA 1LQDB 1O5AB 1MAXA 4MG3A 4FUDA 3LDXH 4IMZA 1CU1A 5A8ZA 6CHAC 1AFQB 1TIOA 4A5TS 2HNTF 3DHKH 1S81A 3AW1A 5I25A 4VGCB 4AGKA 3LGWA 4D76A 3EAJA 1ZTLA 2FYRA 1EJAA 1O37A 2FS8A 1ZPCA 5HKKD 5JBBS 1P02A 2UWPA 4BXWA 1S6HA 1FPHH 3M35A 4H4FA 1GWAA 1TONA 4K1EA 3URDA 3RM0H 5PTPA 1ARBA 1O32A 1NU7B 3NCLA 1HB0B 3A82A 3FAOA 3SU3A 4XBCA 1GI0A 3SUGA 2ZGHA 1K21H 1RTLA 3RMLH 4CRAA 1XUFA 4ZHLU 4DJZB 3F9EA 4F55A 3MH4A 1EUFA 4NWLA 4Y6DA 1DUEA 2XNDD 1P12E 4Y8XA 4F48B 1DWCH 4DVAU 1ACBE 1ORFA 3PTBA 4LOYH 2BVXH 1O2PA 3LJOA 3SNBA 4IBLH 2UUJB 4ASUD 1S5SA 2A7HA 1BTZA 3NKKA 2NWNA 3P8NA 1LPZB 1V2UT 3OSYA 4XOJA 2A4OA 2BQ7B 2G81E 2WV9A 5C1UA 3ZVEA 5FPSA 1QBOA 1SQOA 1OWIA 3DT0H 4HI3A 3TITA 3MU5A 1TFXA 1A2CH 2AYWA 3PLPA 3T28A 4B2AA 1MD7A 2W6JD 1MU6B 1DSUA 1DT2A 1QA0A 3SBKA 1C5MD 5L6NH 1LHGH 2EEKA 4TT3D 1KTTB 1NC6A 3FZDA 2ZQ1A 1C1PA 1UMAH 1QBNA 4TPIZ 2VVCA 2VWNA 5DP6A 1FONA 3QGJA 3VGCB 2BVSH 3TGKE 1P2MA 5FAHA 2FLBH 1OYTH 1P11E 5EQRA 2ZWLH 1EJMA 1JWTA 1TLDA 1CHGA 1MABB 1VCPA 1SOTA 1EPTA 3GCOA 4MQAA 3BSQA 5DKMA 2KCOA 1D6WA 1ETRH 1DS2E 1SBWA 1D9IA 5DP3A 1LDTT 1K9OE 4ZUHA 4B71A 3T25A 1C2FA 3RC4A 2VB0A 5FPTA 4P02A 1FMGA 3OYPA 1HAOH 3P17H 2Z9IA 4ZMAH 3BG4B 1YPHE 2HGTH 3UB0A 2ZHEH 2XBYA 2BQ6B 2F4LA 3QTVH 4WH6A 1J17T 3DD2H 1IQLA 3E0NB 2FP7B 1NESE 1TPOA 4ISIH 5JDUB 2ALPA 5JBAS 2R3UA 2P8OC 1YY3A 3CENA 5C1YA 1WXRA 2RDEA 1YBWA 3VXEH 1PPEE 1TRMA 2O8UA 4YOJA 1AE8H 3HK6B 4R0IA 2OLGA 1UVPA 3FP6E 2HVXA 1MKXH 2CHAC 3MHWU 1THSH 2AEIH 3SU2A 4D7GA 2R0LA 3RXAA 4AFUA 4DGJA 1LHFH 2SFAA 1QB1A 1GBIA 1C2HA 1O2VA 4I86A 4X1PU 2VH0A 5LPEA 2ZDAH 8ESTE 1FJSA 1GG6C 5CHAC 3M5MA 2OCVB 1GBJA 3E16B 2ODQA 1O5CB 1TAWA 1CE5A 2Z3EA 1AB9B 2PKAB 3W1EA 4UE7H 1C9PA 1QB9A 3B8JA 2G00A 1IHSH 2ZDNA 5CHAB 4Z1MD 3ZZ9A 5HIZA 2V3MA 4BOHA 4ZAEA 2H6MA 1OS8A 1KXFA 4RN6A 1QCPA 5EPYA 2ZQ2A 1SQTA 1UO6A 4BNRA 2VIWA 1KYNA 2WZQA 1ANEA 3M5LA 3SJKA 1AHTH 4ZCNA 1FAXA 4HZHA 2QN5T 1G3EA 2EI7A 3GY5A 1FQ3A 1VZQH 3BTQE 4CRCA 4ABFA 1CGIE 4MTBA 3K9XB 1BMNH 1ANCA 3SOSA 4FU9A 3RXIA 1XUJA 1UK4A 1DDJA 4ZKRU 5EPNA 2ZNKH 1G3CA 1E0FD 1TMBH 4DW2U 1XMNB 1UJ1A 1GMCG 1ELTA 2OP9A 1TBRH 4B2BA 2BD9A 4NA7A 5HXFA 1EAIA 3N7DA 4FUJA 5EJ1A 1HIAB 4IC5A 4ABEA 1P2QA 3VB5A 5A0CA 2OC0A 1G2LA 4NA8A 1AE5A 1GBTA 1XXDA 1V2TT 2R2MB 4I7YH 1ABJH 3P70B 1HIAA 4HGCA 3SNAA 1MCVA 1EB1H 1O2TA 2I6QA 5FXLA 1K1NA 4U2WA 1S0QA 4ZKNU 2WPJS 1WUNH 3BTTE 2BB4A 1P04A 5L30H 1ZTKA 1ZTJA 5FX6A 3PV2A 1C2EA 1K0HA 2ZP0H 1C1TA 1V2KT 2A4RA 1JBUH 1C1MA 2OQUA 5HIYA 3LH1A 2FMJA 1NO9H 1OP8A 2C8XB 3P92A 1E35B 4E7NA 4NIWA 2BM2A 1F0TA 3F6UH 4PROA 1IQGA 1GJBB 1O2XA 1O2WA 2WV4A 1O2KA 4ZHMU 1CT4E 1MKWH 3A86A 3TJVA 5EIYA 1TNGA 3GCTF 2G8TA 2SNVA 3QUMP 1OWDA 2A31A 5T3HA 3A7YA 1SGFG 1OKXA 1H1BA 1DWBH 3D23A 1FY4A 3T26A 1C4U2 1XVMA 2Q6FA 3P95A 3TK5A 1FY3A 4BAMB 3QZRA 4IS5A 1BT7A 1IOEA 2FYQA 2W3KA 1NBME 1VITF 1ESTA 4H6SB 4MLFB 4ZROA 2FI4E 3GCNA 1O3AA 3MU0A 1Y3UA 4ACAA 3ZZAA 3TLOA 3FKSD 1P10A 4B1TA 1H8DH 7GCHG 1B7XB 5HGGA 2V3HH 5DPAA 1P09A 3HKIB 3M5OA 1ZMNA 3KQCA 4XRNA 1GPZA 4FUIA 3DFLA 3H09A 4X2XA 5A0AE 1F0RA 2L74A 2LP6A 4XBDA 2HLCA 1HPGA 1UTMA 3EDXB 3LH3A 4SGBE 1YGCH 5C67A 1GJ4H 1BHXB 2BXUH 3QO6A 2OQ5A 3M7UA 3M3TA 1JMOH 1UCYE 2ILNA 3A7ZA 5E8EH 3SV8A 4CHAC 1D3PB 3F9GA 3ITIA 1P2NA 3QK1A 1GBFA 1C5UA 1INCA 1F2SE 1TRYA 4GSOA 2O8TA 2M5TA 1W3CA 5ESBA 2J4IA 1V2VT 1O3GA 2G5NA 1BQYA 3KQDA 1W8BH 1YWUA 6GCHG 1O2JA 1UVOA 3D65E 2W7UA 3VXFH 1UK3A 1D4PB 1LPKB 3MH6A 1Z7KA 1IQIA 1EPTC 1CQQA 1D3QB 4WXVA 2P3FH 1EOJA 1DM4B 1QJ6B 4JZDH 1C2IA 4F49A 4THNH 2CMYA 3CS0A 3BF6H 2AMDA 5HM2A 2XBXA 5F8ZA 1EAXA 1RS0A 2AMPA 1DUAA 5JB8S 1G36A 1UTPA 1QR3E 1SPJA 2ZDMA 3SU6A 2HNTC 4FVBA 1O31A 1TNLA 1AO5A 1WAYB 2Y5HA 1O2IA 1ZPBA 2B7DH 1GCTB 2XNIA 3ZIAD 4JMYA 1DX5M 2VJ1A 2CGAA 4NZLA 1THRH 2YMSC 1O2RA 3FFGA 2GKVE 1PPBH 3LGUA 1E38B 1A3EH 1TX7A 3KQEA 5TJXA 2BDGA 1P2KA 1TA2A 2HALA 2HNTE 2WV5A 1ANBA 9ESTA 1GBHA 1RXPA 4BAQB 1IQMA 2ZFFH 1DLKB 1P2JA 1AGJA 4SGAE 1WQSA 1OWEA 2JIZD 2PHBA 1GDNA 2RA3A 4KGAA 4K2YA 4OS6A 1KLTA 1GG6B 1OP0A 3RXSA 5C17A 1P8VC 1VITH 1N6YA 1E1QD 1O3CA 2ZU4A 1S0RA 1O0DH 1A46H 4GUXA 4UFGH 1MTSA 5GIBA 1QURH 1TWXB 3M37A 1W0ZU 4NSVA 1SC8U 3RXQA 2KZ4A 3ZZ8A 1UTOA 2GX4A 2QAAA 1P3EA 2GZ7A 3L33A 1VITG 3BTGE 1O3DA 2AGGX 3S69A 1TGSZ 2OBOA 3ATIA 2CN0H 4TYDA 2Y5FA 2A7CA 1CA0B 3N7EA 3A8BA 3RXHA 1P9SA 1FY5A 5FBIA 4Y7AA 1SB1H 2VIQA 4IN1A 4NIVA 2F3CE 3F68H 1O2SA 3EGKH 3BTFE 2ZPSA 4TPYA 3PWBA 3BN9A 1GHAG 1C2LA 1L0ZA 2ZA5A 2NU3E 1GJAB 2F83A 1J16A 2BDYA 4X1RU 1SOZA 3MNXA 3KGPA 2PTCE 3SJ8A 3V7TA 1YPHC 2KAIA 2Z9LA 3V12A 2QCYA 1NPMA 5GXPA 3Q76A 2AIPA 1DFPA 1HAXB 5IYTA 1ZPZA 3UPEA 3UY9A 1SI5H 2FDAA 2ZTXA 1Y5UT 1JRSA 5FBEA 2J98A 1YCPH 1C5VA 1ID5H 3H5CB 4WMEA 4BAOB 1GGDC 4BTIB 2UUFB 1O3FA 2V35A 1XUGA 1JIRA 3DUXH 4ASHA 1XKBC 1DWDH 3H7TA 3SV7A 1SHHB 1P2OA 5IDKA 1K1IA 2Z9GA 1Q3XA 3BTHE 3ZVFA 1Z1JA 2Z3DA 2W3IA 3UR9A 2XWAA 5HYOA 4ACBA 1NY22 4NGAH 2VIVA 4OS1A 2THFB 3EA8A 1NRSH 2BXTH 3UOPA 1S6FA 4OS5A 3WW7A 4B2CA 3M3SA 3ZVGA 3ZZCA 3KN2A 1TPSA 2EY4C 1DY9A 4ZKSU 2BOHB 3A89A 2H5DA 3V13A 4ESTE 2NU2E 2BD4A 3SO3A 3SUEA 4MPWA 3FP7E 1YPEH 1QRZA 1AN1E 1EKBB 4YXWD 1HDTH 1CSOE 5ESTE 2JH0D 2W26A 4RI0A 2ZI2H 4X6OA 2BD2A 2XXLA 2D2DA 3RU4T 1Z8GA 1HYLA 2ALVA 4O9VA 3MH7A 4D9QA 1WTGH 5CDFE 2O8LA 3QLPH 2ANKH 1C5PA 4KTCA 1FX0B 1MTNB 1O35A 1O3PB 2QF4A 2TGAA 2Y5GA 1FN6A 2XRCA
chains in the Genus database with same CATH topology
1QFKH 2WPIS 2TRMA 1KY9A 4I8KA 1SVPA 1SLVB 1PPHE 2BLQA 1PQAA 3K2UA 4DIIH 4Y10E 4A6LA 1Y59T 4INLA 1P06A 8KME2 2A4GA 3SNCA 1TX8A 2R9PA 2Q6DA 3UNRA 1GMDF 1YP9A 1ZJKA 4XSKU 1OSSA 5L2ZH 2QF0A 1O33A 1ESBA 2BHGA 4NIXA 2J9NA 4KP0A 3SQHE 4K8YA 1ELGA 2FPZA 1MTWA 1AUTC 3RXMA 4LZ4B 2GZ8A 4GCHF 3ZZDA 4ABGA 2A45B 1QQ4A 1HJ8A 3VB6A 2J95A 2A1DB 3ODFA 1DICA 1BJVA 4Q7YA 5DP5A 3TH2H 2VIOA 1A61H 3A7XA 1GI9B 4U30A 1UTQA 3RUOA 1EQ9A 7GCHF 1AI8H 2FIRH 3UWIA 3PMJA 4AX9H 2SGDE 3GDUA 1DOJA 3R3GB 1WV7H 4VGCC 4I33A 4Y7BA 2GVFA 4X1NU 2ZPQA 3M7TA 5B6OA 1SR5C 1K1JA 3TJNA 1GBCA 4E05H 2IOTA 1DY8A 2GCHF 1P03A 3DFJA 1O2YA 1C1SA 1TYNA 3SI4H 4YOGA 1NROH 1BBRE 1QIXB 2ZFPH 1PPGE 5T6GA 2OC8A 1FLEE 3MFJA 1QNJA 4MVNA 5A09A 1O3JA 1GMHG 3AASA 1G2MA 4UFEH 1GBKA 1GHXH 4X8TH 1SFQB 1THPB 3MMGA 5DJ7A 4K1SA 4XFQA 1GBLA 2WUCA 4AFQA 1CT2E 2FOCA 1Z6EA 3LONA 1MQ5A 2Q1JA 1FDPA 4WH8A 1LQEA 4TY7A 2ZF0H 1SLWB 3RM2H 1O3IA 4RSPA 1BMMH 2ZGBH 2F91A 2TBSA 2VVUA 4YLQH 4OS2A 1HAPH 3PB1E 2UUKB 3T5FH 2ZECA 1AZ8A 1C2KA 1HBTH 1YPKH 4NCYA 1G3BA 3AW0A 3SV2H 1O2HA 3SU1A 1QRWA 1FY1A 2RDLA 1S84A 1O3OA 4O03A 3RXFA 6GCHF 4IMQA 1HAZB 1TNJA 3PMAB 4CRDA 1KDQB 1BBRK 1QL7A 2Z6BD 1W10U 2OC7A 1BRAA 4I8GA 5K0HA 4RKJB 1TA6A 2AMQA 3SNEA 4J2YB 1OPHB 1YLDA 3T29A 2RG3A 2PKSC 1JXPA 1HAHH 3RMOH 3JZ2B 5JPMH 4NG9H 3VB7A 2G4TA 4ZKOU 1AIXH 2EI8A 3A8AA 3B9FH 3LGYA 5FPYA 1VR1H 1RD3B 1SLXB 4CR5A 3RU4D 1TABE 2FEQH 2PTNA 5C20A 1H9LB 3E90B 2HPPH 1O3HA 1SLUB 1UTNA 1SGQE 1GMCF 1DXPA 2F9PA 3MO3A 1P9UA 4CREA 5LPRA 3VEQB 1Y3YA 2F9VA 2IN2A 1LMWB 1HAIH 4YZUA 1O3EA 2VH6A 3RDZA 3SHAH 1VJAU 4CBOA 1K1OA 3BIVH 1ZHRA 3RXDA 1FY8E 2BY7X 2JH5D 2DUCA 3T2NA 3BEUA 1GBDA 1O2GH 1TGTA 4OS4A 3QN7A 1O34A 3PWCA 1XUHA 2HWLB 4I8LA 2BY8X 1BRCE 1A0JA 1N8OC 1J14A 2OC1A 2GDDA 3M36A 3PYHA 1IQHA 1A5HA 3T27A 1MH0A 1BTPA 3KIDU 1VGCB 1N8OB 3LC3A 4D9RA 3UUZA 3STJA 1PYTC 4OGXA 1K1PA 3GY7A 1O5EH 2ZTYA 3MNBA 3QTOH 3TK9A 4ZXXH 1G32B 5DG6A 1H4WA 2HRVA 2ZU2A 3LC5A 4FUHA 2QYIA 3C1KA 1O36A 1E37B 1QB6A 1PPZA 2VIDA 3TPIZ 1KLJH 6ESTA 1NN6A 1BHXF 1GJ8B 1TE0A 2W5EA 5AVDA 2FI3E 3S9BA 3OY6U 2C8WB 1QA7A 4NSYA 2H9EH 2B8OH 1V2LT 1QHRB 2PKAA 1O2MA 2ZFRH 2ZDLA 2AIQA 1G30B 1QQUA 1SGRE 2EA3A 2HOBA 3GDSA 4DY7B 2BOKA 5E2PA 1QGFA 2WYJA 2FZZA 2FI5E 4RKOB 3H7OA 2BDHA 1MBMA 4TWWA 5EOKA 1A0LA 5DK1A 1O5FH 1L1NA 3ZYEA 1HXEH 1A4WH 3RXJA 1B0FA 2AERH 1DWEH 1NU9A 1ARCA 1OWJA 2C93B 1JOUB 3QZQA 4JYTA 4A1VA 1J9CH 2BLOA 2PUXB 2B9LA 2GD4B 2A2QH 2O9QA 1Y5BT 1CA8B 3PO1C 1SQAA 1FNIA 5F03A 1UTLM 1GJDB 3RC5A 1HGTH 1D3TB 1W7XH 3VB4A 4GAWA 2XBVA 2ANWA 3D49H 2GTBA 1DANH 2ZFSA 4X6MA 2FWWA 1ZZZA 1SGPE 1FN8A 1LHCH 1KSNA 1HAYB 4CR9A 4I8JA 3UFAA 3N7OA 1XVOA 1NZQH 4MPUA 1SGDE 1RJXB 1MKXK 4U32A 3SN8A 1BDAA 1HXFH 3I78A 1DPOA 1C5YB 1TNKA 4IN2A 1GJ5H 2ZGCA 3LIWA 2H1UA 3HPTB 4ABJA 3P8FA 2BLWA 2FOMB 1UVTH 2BMGB 4DG4A 3O8BA 4J1YA 2ZTZA 3L6PA 2ZCKP 1IQKA 3C27B 1CHOF 2FTMA 1GI6A 1C5SA 3F9HA 1ZSKA 1DXWA 1BTHH 2FOAA 1LCYA 4ISOA 4FUFA 3QWCH 1HRTH 1UK2A 2ZHQH 3ZV8A 4ABAA 1GMDG 4JZFH 3ZVCA 4X0WU 2FODA 3M7QA 4R8TB 4WWYA 1W14U 2PFEA 1GHZA 3E3TA 1FIWA 3ATLA 2A32A 1BRBE 1NFYA 1GI2A 4YLUA 3RP2A 1GBEA 4LK4A 2FOEA 4GHTA 2FX6A 1TGNA 3O8RA 2LNCA 1QJ1B 1W12U 3UOUA 3SV9A 1GJ7B 1P2IA 4ABIA 3S0NA 5AHGH 4H6TA 2ASUB 1NTPA 2QGRA 3UWJH 4QT8C 2H9HA 2F9UA 1JIMA 3DA9B 1FPCH 2P94A 2OD3B 1K28D 4JZIA 5A8YA 3LOXA 5EW1H 5EGMA 4NFFA 3B23B 3MWIU 4MNWA 1ELDE 2ZDVH 4X2YA 3U98H 2XCNA 2Z9KA 3O8CA 1WTHD 1V2RT 5A8XA 2EC9H 5DP4A 2VIPA 1MTUA 5F8XA 1OWKA 2ZHFH 2ZDKA 1BRUP 5F6MA 1K1MA 1W7GH 3BEIB 4UD9H 2BX3A 5C5NA 4WMFA 2TIOA 3ELAH 4B74A 1DE7H 3M61U 3SU5A 2D8WA 3F1SB 2FS9A 4ABHA 1YPMH 1Z8IB 1W0YH 1EZQA 3SUFA 1SSXA 1KTSB 2O8MA 5C1XA 1C5ZB 2EI6A 1GMHF 2LPRA 5GPIB 3SZNA 4Y76A 3RXRA 2GCHG 4KELA 2ZO3H 1AWHB 1SGIB 2BDAA 1ZYOA 1RFNA 1AVWA 1LVBA 1YCPK 1A5IA 1GHAF 1N6XA 1WSSH 2Z7FE 1GHVH 3RXGA 1C4Y2 3PTNA 1WYKA 3IITA 2CXVA 1NFUA 2BVRH 1RIWB 3RXOA 1ZSLA 3HK3B 3SJOA 3QX5H 1AFQC 1T4VH 2JETC 2PLXA 1C9TA 1UVSH 1AU8A 1UCYK 3ZVAA 2G52A 1EASA 1BOQA 1P57B 1HNEE 3TJUA 1C5NH 1LVYA 3VFEA 1BB0B 5C3NA 3G01A 5GWZA 4GHQA 4YOIA 2GZ9A 3U1IB 3GY2A 2PSXA 1CT0E 2XTTB 4ZXYH 1OXGA 5L2YH 1C1VH 2OUAA 4Y0YE 3PMHB 1QRXA 2VWMA 5T6FA 5LPFA 3KHVA 1ZOMA 3A87A 4B75A 4ZH8A 4DURA 3U1JB 5AFYH 1AQ7A 2YNAA 4O3TA 4LXBH 4AFSA 1LVMA 3SHCH 1YC0A 2YNBA 1T8MA 8LPRA 5ABWA 2GV7A 2FLRH 1GHWH 3TH4H 2SNWA 3GYMA 3BG4C 2F9NA 1G9IE 1NRQH 3OX7U 4MNXA 4B73A 3R0FA 1BA8B 5LH8A 4HTCH 2FESH 3AAVA 3MOCA 4IC6A 1C1RA 2QV1A 3EQ0H 4DT7B 1F0SA 1GJCB 1H9IE 1MZAA 4UEHH 3P8GA 1ZRBA 2J38A 1TOMH 1ZRKA 2A7JA 4NA9H 4WF8A 6CHAB 1SL3A 2BY9X 1E36B 1KLIH 1O3KA 1CGHA 5EQQA 3SJ9A 4NZQA 3K6ZA 4K1TA 3Q00A 1L2EA 3V3MA 1GI5A 1SMFE 1SGFA 1KXEA 1IHTH 1O3LA 1LKAA 1QL8A 2J94A 2O8WA 4D8NA 2GMTB 2AFQB 1TBQH 3UNQA 1S83A 5EU8A 1FV9A 1NRPH 1YLCA 5HM9A 3F9FA 3W94A 3ZVDA 3TH3H 1SGNE 3OTJE 2RA0A 3HKJB 2BTCE 1AWFH 3MU8A 2VWOA 4E7RG 5EG4A 4AB8A 2R2WU 3EA9A 4X6PA 2ZU3A 1Q2WA 3K65B 2K1QA 1CBWC 1AZZA 2VVVA 3UIRA 1YYY1 1T8NA 1A1RA 1VGCC 1F7ZA 1XKAC 3TIUA 1MCTA 1E34B 2JKHA 1O3NA 4XE4A 3ZYDA 1FZZA 3ZZ6A 1XUIA 2ZCHP 8GCHF 1C5XB 1O5GH 2UWOA 4Y79A 1LVOA 1SGCA 1EAWA 2Y7XA 5K7RA 2NU4E 3FP8E 4ZHAA 3BTWE 5ETXA 3TNTA 2AS9A 1MQ6A 1UTKA 2BZAA 1N1LA 4FUEA 3BG8A 1OWHA 4UFDH 6LPRA 1GHYH 1C5WB 2QXHA 1O2OA 3UREA 5I46H 1TOCB 4AB9A 1Y5AT 3RXTA 1P0SH 4CH8B 2FO9A 1NRRH 2ZZUH 3RXVA 4Q2KA 1EX3A 5EQSA 1X7AC 3PLKA 1ZSJA 4TWYA 3UQVA 1ZHMA 1O2UA 3RXKA 5EW2H 3KF2A 1AVGH 4GPGA 1DSTA 3M5NA 1H9HE 4XBBA 3TK6A 1C4V2 3RMMH 4Q80A 3NWUA 2P95A 1T31A 3GDVA 4JYVH 1EZSC 1MMJN 4O3UA 5E0GA 1IQJA 4IGDA 2B5TB 4TY6A 1SGTA 1S82A 1YF4A 7KMEH 1IAUA 2XYAA 4A92A 5AF9H 3FZZA 1L1GA 2ZC9H 1HUTH 1EZXC 1O2LA 3ENSB 3ZZ7A 5GDSH 2NU1E 3V0XA 5G4BA 3S7HB 2FOBA 3RLYH 1GDQA 1KXBA 2QA9E 3LKWA 4Q7ZA 1G37A 5JBCS 1HLTH 4AORA 4MNYA 2STBE 3BTDE 3EA7A 4JZ1A 1NS3A 1MTVA 1MU8B 2GDEH 4K69A 1GDUA 3PO1B 2PSYA 3LU9B 2ESTE 2SGPE 2IJOB 3FVFB 1RGQA 2VGCB 1GBMA 3BTEE 2DE8A 1ZMJA 3RLWH 5SGAE 1V2OT 1KXCA 1V2WT 2PGBB 3OU0A 2VNTA 1P05A 1ZGIA 2A0QB 3SNDA 3TU7H 4YT7H 1IQFA 2BD5A 1CHOG 3MI4A 1EXFA 2GT7A 4JK5A 1UHBA 2FM2A 2PKSB 4X2VA 3LGVA 3RXCA 3ZZBA 1EP5A 2QXJA 1AY6H 1BTWA 1EATA 1YPLH 2WPMS 1UVUH 1A5GH 1V2NT 4LZ1H 4AZ2B 1AUJA 2WPLS 2ULLA 2GMTC 1TQ0B 2ZFTA 5F8TA 3S9AA 4I32A 1BJUA 1EAUA 2VGCC 1GHBF 1NRNH 4X1QU 2H9TH 1NT1A 3MH5A 3MO9A 3U8OH 3MNCA 4YO9A 3CS7A 1C2DA 2ZPRA 2G4UA 2ZKSA 3ATKA 4F4OC 2ZCLP 3TGIE 1HCGA 2UWLA 1IQEA 1BMAA 1CVWH 1C1WH 2KAIB 4GLYA 2A5IA 4UONA 2C8ZB 2OINA 4ISLA 1ZGVA 1Y8TA 3PLBA 4KTUA 1P3CA 3MU1A 2XC5A 2YOLA 5BPEA 1S85A 3VGCC 4ISNA 4YTAA 3SU4A 4AGJA 4OGYA 1MUEB 1T32A 2VWLA 1ANDA 4M7GA 3ZZ3A 4Y8YA 1RTKA 1AVXA 1GCDA 3AAUA 4INHA 1BTYA 3SI3H 4WVPE 4IW4E 2BD8A 3KQBA 3HGPA 1GJ9B 1LKBA 1C1UH 5DGJA 2BX4A 3GOVB 1RRKA 1Q31A 4X8VH 3RXEA 1PPCE 1WQVH 4FUCA 2P93A 4AFZA 3U8TH 1EP6A 4K5ZA 2D26C 1HJAB 2Z9JA 3RC6A 2Y7ZA 1GVZA 1AKSA 2FOGA 2WUBA 3E8LA 4HFPB 1KXDA 4AOQA 4H42U 2PV9B 2G55A 4DOQA 4FUGA 1HFDA 1K2I1 4BXSA 1J15A 2CV3A 2A2XH 4Z0KA 1A7SA 1LO6A 5GCHF 2PR3A 5FHTA 5FX5A 2ZU1A 1YM0A 2PW8H 3GY6A 1FI8A 1O3BA 1O30A 2QC2A 1TPPA 4U01A 3WY8A 4AG2A 1CGJE 1GI7B 5C5OA 1GVLA 1TRNA 2R0KA 4FVDA 1QTFA 4JK6A 1PFXC 1EB2A 2ANMH 1TNIA 3Q3KA 1GI4A 2GV6A 2A5AA 3GCHB 3I29A 3NK8A 3NXPA 2ZGXH 2SGAA 5E0HA 2CHAB 1FXYA 1ELAA 1LHDH 3NUMA 3TJOA 1YKTA 4Q7XA 3GY4A 1BTUA 1HJAC 1O2NA 1UCYH 2BYAX 1GHBG 1V2QT 3E1XB 1K22H 2ZU5A 1C1NA 2RCEA 2CJIA 1HAGE 2XC4A 3KEEA 1V6DA 4I31A 1C2MA 3QGNB 3AVZA 4K3JA 2AGIX 2WINI 1SGEE 1YCPM 3E0PB 3SJIA 1OX1A 1C5TA 4AN7A 4FU8A 3UQOA 1B0EA 4E06H 3RXLA 3VPKA 1ELBA 1GGDB 3M3VA 2ZHDA 3GCHC 1TNHA 5TCCA 3O8DA 4INKA 1H8IH 1Z6JH 1PPFE 2A5KA 1O3MA 2STAE 4K60A 3MO6A 5C2ZA 4A1TA 1Y3VA 4AYVB 3GICB 9LPRA 1ZMLA 1AMHA 1PQ7A 1TPAE 4NIYA 5TCAA 3NZIA 3P8OA 1GBBA 2ZEBA 1XX9A 5H4IB 2AH4X 1O38A 5HMAA 2ZG0H 1V3XA 2DE9A 1JRTA 2R3YA 1A3BH 1T8LA 1WBGB 3ATMA 1TBZH 2SGFE 4CRGA 5EXMA 4UFFH 1PYTD 3A8DA 2ZIQH 5FCRA 4JCNA 3SQEE 3MYWA 1T7CA 1LPGB 3A84A 3MU4A 4MNVA 1ETTH 2C8YB 2C4FH 1DITH 5E2OA 3LGIA 1GVKB