1M9UA

Crystal structure of earthworm fibrinolytic enzyme component a from eisenia fetida
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
241
structure length
241
Chain Sequence
VIGGTNASPGEFPWQLSQQRQSGSWSHSCGASLLSSTSALSASHCVDGVLPNNIRVIAGLWQQSDTSGTQTANVDSYTMHENYGAGTASYSNDIAILHLATSISLGGNIQAAVLPANNNNDYAGTTCVISGWGRTDGTNNLPDILQKSSIPVITTAQCTAAMVGVGGANIWDNHICVQDPAGNTGACNGDSGGPLNCPDGGTRVVGVTSWVVSSGLGACLPDYPSVYTRVSAYLGWIGDNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Earthworm Fibrinolytic Enzyme
publication title Crystal structure of earthworm fibrinolytic enzyme component a: revealing the structural determinants of its dual fibrinolytic activity.
pubmed doi rcsb
total genus 53
structure length 241
sequence length 241
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2002-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1m9uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1m9uA01
2UWLA 1AN1E 3K9XB 1BMMH 3MNBA 2UUJB 2B7DH 2ILNA 3PWCA 4FUEA 1V2JT 2XBVA 1FY4A 1V2LT 3GYMA 4YOJA 2BLWA 1FY1A 1HAVB 1YC0A 2F9PA 3QO6A 5F6MA 1G2MA 1SQTA 1OWEA 3MNCA 3SGQE 3KCGH 4CR9A 4DW2U 2G8TA 1Y8TA 2YOLA 1O3KA 4Y79A 4O9VA 3T29A 2ZHDA 3SU3A 1ELFA 1L2EA 5DG6A 3U98H 1XKBC 1CGHA 2ZFQH 4NSYA 4FUHA 1UVPA 2CHAB 1G3DA 3M37A 1SGFA 5ESBA 4CREA 1S84A 3LONA 2TGPZ 1UTOA 2QCYA 1NU9A 4MTBA 1QFKH 4AFZA 1EXFA 1WAYB 2Z3EA 4D76A 1ESTA 2GP9B 1NRQH 1OOKB 1O3NA 4B74A 1SFIA 2ZTZA 1MTNB 2WPHS 3SO3A 4B2CA 1O2UA 2WPKS 1PPBH 1GBDA 1G36A 2BY6X 4GHTA 1GJDB 3UPEA 1D4PB 3SU5A 1DM4B 2ALPA 1VCWA 3ESTA 2P3UB 1J17T 2C4FH 2Z94A 3SU4A 1CHOF 1KDQB 1XKAC 2QAAA 2GMTB 1W3CA 1ESBA 1P2NA 2EA3A 4ISOA 1AGJA 3LC3A 4HFPB 5HXFA 1F0TA 1HJAC 1NROH 3A8BA 3O8DA 3U8TH 1TMTH 1C5YB 2BD9A 2NU0E 3GCTG 8GCHF 5C3NA 1BA8B 1A0HB 3PYHA 1AUTC 2P8OC 4UE7H 1QBVH 1D3QB 1PPCE 4I8KA 1BRCE 1Z8JB 1N6XA 1YPLH 1HGTH 1BRBE 3AW1A 2ZDMA 3RXRA 5J4SA 3FANA 5C5NA 5F8XA 1HXEH 4BTUB 3NUMA 1P0SH 1C1OA 2EC9H 2Z3DA 3GCOA 1MTSA 4CR5A 3RP2A 3ZVCA 2BVSH 1MTWA 1O2WA 2OD3B 1BTZA 4DY7B 1TNHA 3ZVGA 2PTCE 2LPRA 3A7ZA 2RDLA 3E91A 1F7ZA 2JETC 3TH3H 3LU9B 3EA9A 1JMOH 1C2EA 1UHBA 1DT2A 1TGTA 4H4FA 4K3JA 4D8NA 1C2FA 1NC6A 2Q1JA 1B0FA 1CA0B 2HRVA 1TGSZ 3QZQA 1ANBA 5GCHF 1VITH 6ESTA 7GCHG 3RXHA 1ETTH 1GVZA 5FXLA 2QA9E 2SGQE 1S5SA 4LXBH 3GY8A 3M7QA 3RXGA 4E7NA 1Y5UT 1HV7A 2ZDAH 1TE0A 3U1JB 1FPHH 1KXCA 1ZGIA 3MU1A 1C5WB 1MKXH 1ELTA 3LGIA 3EE0B 1L1GA 1GHBF 3SI4H 2C8WB 2Z9KA 2Y81A 3ITIA 1UCYK 1DVAH 3PLPA 3SNBA 4A5TS 1IQMA 1GHAF 3P6ZB 3RXVA 2J94A 4CBOA 1VZQH 4ABDA 5A8ZA 3SUEA 2AGIX 2R3YA 3SV2H 1ELGA 1E38B 2BY9X 1P03A 3RXDA 5G4BA 1V2QT 4IW4E 5AF9H 3T26A 1GHVH 2BLVA 3A81A 3KQCA 9ESTA 2XBYA 3KGPA 1SGEE 3MNSA 1A5HA 2R9PA 3U1IB 4NWLA 4OS6A 1LCYA 3QGJA 2A5IA 1C5SA 4XBBA 5JDUB 3BSQA 2H5DA 3MOCA 2FI5E 2WUCA 1K21H 1Y5AT 2CXVA 4IN2A 1RJXB 1T32A 5TCCA 1KXAA 2FDAA 2QY0B 1QCPA 2GZ7A 2GCTB 3F9HA 3RMOH 1O2XA 1W11U 4RKJB 1DDJA 1K1PA 3ZZ3A 1C1MA 3M3VA 2FP7B 2O8TA 4GUXA 1YGCH 4ISHH 2FX6A 2CHAC 4FUFA 5T6FA 3SI3H 3SW2B 4Z6AH 2ZF0H 1HRTH 4E7RG 2AGGX 3PLKA 3GOVB 1JOUB 1LHGH 5C67A 1TONA 1YLCA 1C1RA 1VGCB 1MTNC 2A5KA 2DE9A 1IQHA 1GMCG 4CRFA 4MPXA 3SORA 1UTJA 2FM2A 5JBTA 4I7YH 4DVAU 1HLTH 3LDXH 3STJA 1AVXA 1BITA 3MH7A 3MO3A 2GMTC 4XOJA 1MCVA 2FLBH 2HLCA 1XX9A 2FWWA 2VH0A 1YF4A 1C5LH 1SC8U 5FPTA 5DGJA 5JBCS 1MU6B 1CGIE 1GBMA 1GPZA 3P95A 2M5TA 1GBKA 1EP6A 3HGNA 2XBXA 1CE5A 2FLRH 1PYTC 3RC5A 5EW2H 1FMGA 5E8EH 3SU0A 1GJ6A 2AERH 3T25A 2ZCHP 4I8JA 1QA7A 2EI6A 2VIOA 4NZQA 3ZZ6A 4HI3A 4UFEH 5I46H 2ZG0H 4O3TA 1LPKB 3A7TA 1BRAA 1V2OT 3MWIU 3NK8A 5EW1H 1UVOA 1TYNA 1Z8GA 1FAKH 3S69A 2H9EH 2TIOA 4X1SU 4X0WU 3SQEE 1W8BH 1MBMA 2AYWA 3RM2H 5DKMA 4D9RA 4PROA 4ZKNU 1Y3UA 1AIXH 1CA0C 1SQAA 1P9UA 5K7RA 3MTYA 4XFQA 1DUAA 1GBCA 3KQEA 1P2IA 1DPOA 2NU4E 2Y5HA 5T6DA 2XXLA 1O2ZA 1ZGVA 1GI2A 1A4WH 3UUZA 2XCFA 4WWYA 1UK2A 2GV7A 2AS9A 2A4RA 1XM1A 2NU1E 1GVKB 1ID5H 2OBQA 1HFDA 5ABWA 1GBHA 3GCHC 2ZIQH 5DK1A 1ACBE 1B5GH 3M5OA 3LKWA 1AUJA 1PQ7A 2Y80A 2XW9A 3OX7U 4CRGA 1HAXB 4OS7A 2GD4B 3TK9A 1TNKA 1NFWA 3GY5A 1TBZH 3M5LA 4I8LA 4AYVB 2OUAA 2A1DB 1C4U2 1QNJA 4UFFH 1EAWA 4LZ4B 1O3IA 1DXWA 1GBBA 1P12E 1Y3WA 1TNJA 5FHTA 1UHBB 3M3TA 1IQNA 1M9UA 4NG9H 4GLYA 1EX3A 1QB1A 1ZPZA 2J38A 1AHTH 3PMJA 3QLPH 1PFXC 2TBSA 1C1QA 1C9TA 1O3GA 3L3TA 4NA8A 3BTQE 1S6FA 2R2WU 3P17H 2TRMA 3SBKA 1S83A 3GY2A 1V2NT 4GAWA 2GCTC 1XUGA 4DG4A 1P10A 2O8LA 4ZHAA 1OWKA 3BTTE 5LPRA 1TA6A 5A09A 5E0GA 1O39A 4NFFA 1O2IA 3PMHB 1O5FH 1NFYA 1ELEE 4Y0ZE 4H6SB 3S7HB 1S6HA 2ZU5A 1DX5M 1O3FA 1OP2A 1ZSKA 3DFLA 4JK5A 4A1XA 2XCNA 2BB4A 2ZWLH 4GCHF 2H9HA 1VGCC 5DP9A 5EGMA 1B0EA 1GMDF 4X6NA 4ABAA 1G2LA 2CGAA 1FIZA 4K60A 3ENSB 3STIA 4K5ZA 1BTHH 3UOUA 2ZP0H 1JXPA 1ABIH 2FZZA 3A80A 1TX7A 1P2JA 1GHAG 4X6MA 1O0DH 1HJ8A 4MVNA 1FPCH 1ZTLA 4MQAA 1BZXE 4JYVH 1SI5H 3SV8A 4K2YA 3V0XA 8LPRA 1V2WT 5A8XA 2C3SA 2BDAA 4IN1A 3G01A 5BRRE 5EU8A 4X1NU 1XXFA 1G32B 2BXUH 1NS3A 1P2QA 4FUCA 4INKA 3TGKE 1LPGB 4TWYA 1T8LA 1TA2A 5HGGA 5LPEA 1QY6A 5C5OA 2HNTE 1NZQH 1ETRH 3B23B 3SZNA 1V2UT 5C1YA 4CRBA 3HKJB 3RMNH 2W5EA 2CJIA 4O97A 4AN7A 2PR3A 3RXBA 4ABGA 4AFSA 2HVXA 1C5OH 2BYAX 2ODYB 4X1PU 1QL8A 3ZV8A 2GCHF 3BEFB 1BIOA 1KTTB 1E35B 1VCQA 2C8YB 1DSUA 1SHHB 1BMAA 3MH6A 2Q6DA 1QA0A 2A7HA 5EXMA 1G30B 1GBJA 3GICB 1PPGE 1GMHF 2STAE 4RSPA 3VGCB 2VVUA 1EATA 1NRNH 1O2VA 4FVBA 1AB9C 4TPYA 3GCNA 2BLOA 1F0RA 2B8OH 2ZEBA 1QBNA 2FEQH 1HJAB 1PPEE 5E2PA 2PTNA 2D8WA 3E8LA 1G9IE 2FS8A 3A83A 4GSOA 1E0FD 1HCGA 2G00A 3I77A 1QRXA 1C4V2 2ZDNA 1EAXA 1XVMA 2DUCA 4X2YA 4YZUA 1OP8A 1VR1H 4ABIA 3I29A 3RXUA 5EPNA 3HKIB 3ZYDA 2A2QH 1FN6A 2OP9A 1WUNH 4VGCC 3UNRA 4MNVA 2SGPE 3GYLB 1NESE 2H6MA 1C5RA 1ETSH 1FUJA 5JPMH 2P59A 1EOLA 1KSNA 1A46H 1IQGA 2JETB 1ESAA 4GVUA 2FOGA 4YTAA 2Z9JA 4WH6A 5ESTE 3PTBA 4O3UA 5TJXA 5A2MH 2BY8X 4MPWA 4NFEA 1HXFH 4B2BA 2HPQH 3HK3B 1SOZA 5L2YH 2BHGA 1T7CA 2IPHA 5H4IB 5PTPA 2ZCKP 3PM3A 1NY22 4UFGH 2I6SA 3GDSA 3RC6A 3PMAB 1O35A 1P9SA 2W7SA 1CT2E 1MD8A 2C8ZB 6CHAB 4X8SH 4MNXA 1NU7B 4AYYB 3SUGA 3W95A 4JMYA 2FPZA 4R8TB 5E0JA 3LPRA 3TK5A 4E06H 2A31A 2ZGCA 1IQFA 2F9BH 3UNQA 2BD2A 3CS7A 1GL0E 3HATH 1OWIA 4MLFB 4ZXXH 4YT7H 1QGFA 1W7XH 1DY9A 2Y5FA 2B5TB 4NIXA 1TPSA 1LTOA 2V6NA 4BXSA 2VIDA 1CT0E 1SGTA 1RD3B 4Y8XA 3VB5A 1Z7KA 4BOHA 1YCPM 1IHSH 3QGNB 4Y0YE 5GWZA 4HTCH 4K8YA 3Q3YA 4D7FA 1OYQA 2QGRA 1TGBA 4B73A 1P2OA 3GY3A 1C1TA 1D6WA 1MTUA 3HGPA 3MU0A 1FLEE 2TGAA 4IS5A 3SGBE 1LQDB 2QF3A 3M5MA 1NTPA 3F9EA 5GJ4B 1P8VC 2A4OA 1AD8H 2GDDA 1XUJA 1ZJDA 2ZGBH 2ZTYA 2BD8A 2XWBI 3AAVA 1Q2WA 1CU1A 1GGDB 1FIWA 2SGDE 1C5NH 4MDSA 4X2XA 1GJ5H 4FXGH 3S9BA 3FAOA 1EZXC 5AVDA 3BG4C 1GI1A 4J1YA 3ZVAA 1N8OB 1S0RA 4JZ1A 3VPKA 3VGCC 1S82A 1ZTJA 1QRWA 3MMGA 1O2PA 3RLWH 1HJ9A 4LZ1H 3RXIA 2SNWA 1HIAA 4DURA 3RC4A 3TITA 2UUYA 3SJKA 3SNAA 4AOQA 1VITG 2JKHA 1GDQA 2D26C 3SHAH 4BANB 4B75A 2AIPA 1WCZA 2P16A 1SL3A 3RLYH 4K1EA 1XUHA 2BM2A 1ZZZA 1T8OA 3A8CA 2J34A 3MO9A 1C2MA 1ZMNA 2FX4A 1Z6JH 1UVUH 5C20A 1CVWH 2XTTB 1O3CA 1LKBA 4K69A 3RXFA 2JH0D 1HB0B 3M7TA 3MU5A 3OU0A 2XBWA 3T28A 2ZFTA 3RXQA 3ZZ9A 1GJAB 4JK6A 1W13U 2VB0A 4NWKA 1TX8A 3TH4H 1EB1H 1V2PT 1IOEA 1G3BA 3EYDA 2AGEX 3I78A 2QN5T 5JB8S 1MBQA 4THNH 1P2MA 1LDTT 2ZTXA 2Z3CA 1K1IA 1TRYA 3HPTB 1ZLRA 4IBLH 2G55A 2WYGA 1IAUA 2A45B 1FAXA 5EXLA 3VB6A 1BDAA 1O3MA 1IQLA 1GJ7B 3B8JA 1LHDH 2R0LA 2FI4E 3GCHB 4OS4A 6GCHF 1WSSH 3LH3A 2ZI2H 1FY3A 2STBE 2BDHA 6CHAC 1SOTA 1HAPH 3BV9B 3UQVA 3Q3XA 2W26A 1VJAU 2Q6FA 3T5FH 3SU1A 1H8DH 3RDZA 2J2UA 1O5AB 1SGPE 1W7GH 1T8MA 4WH8A 2G5NA 1YKTA 1KXEA 3SU2A 1TOCB 5E2OA 3DT0H 3U8OH 3P8NA 1RTFB 1THSH 1MKXK 1J8AA 3UIRA 2G52A 4DGJA 2VWLA 1ANCA 3PROA 1RRKA 4X6OA 3LGUA 1Z1JA 2W3KA 1JIMA 1HAZB 2A5AA 4A6LA 5LH8A 4OGXA 2ZKSA 1T31A 2ANWA 4FU9A 3R3GB 1KYNA 1WU1A 1IQIA 1TRMA 1H9LB 2G51A 3U69H 1GCTB 1QURH 3ATLA 2FOAA 4DCDA 5DP3A 1KLTA 1BTUA 2EI8A 2FO9A 1LHEH 2XC4A 4SGBE 1F92A 2VWNA 3TU7H 2BOKA 3WY8A 1O3LA 1DXPA 1H4WA 1TB6H 3ZYEA 3RXEA 2CMYA 5EQRA 5FPYA 2BVRH 3LOXA 1AE5A 1O33A 1L4ZA 1YPMH 4ISIH 2ZU1A 3FVFB 3F6UH 3KHVA 3GDUA 2AH4X 3LT3A 1O3JA 2JH5D 1GGDC 1BJUA 1O5DH 1C9PA 1J14A 3ZZAA 4WF8A 2FTLE 2ZNKH 1HAIH 2VWMA 3BTWE 3BTEE 2VGCC 4O03A 8ESTE 1N8OC 5CMXH 1ZRBA 1YCPH 3ATMA 1XUIA 3K65B 1RS0A 1Q3XA 4R0IA 4X2VA 4YLUA 3DHKH 4B71A 5A0BA 3NKKA 1ELDE 1LHCH 2VVCA 1V2RT 4AX9H 4KELA 4UONA 2OQ5A 1MU8B 3UR6A 1KY9A 4ZKSU 4CH2B 1EASA 1BCUH 1CBWC 3IG6B 2H9TH 3B9FH 3TPIZ 1FY8E 2V3HH 2ZQ1A 1Y3VA 1EAUA 3D49H 1P06A 2P95A 1QR3E 2YNBA 3ATWA 1GI0A 4KTUA 4BTIB 2ZZUH 1YCPK 1DWDH 4U2WA 1LMWB 3SUDA 4AZ2B 1A3EH 1SLXB 4U32A 1O37A 2A7CA 4RKOB 1MD7A 2G81E 3NXPA 3E0NB 5T3HA 5L2ZH 3VB4A 2PGQB 1PQ8A 4OS1A 1O2LA 1AQ7A 2WV5A 2Z9IA 4BTTB 1T8NA 2OINA 2QIQA 2BDYA 1P2KA 3MNXA 1WBGB 4MNWA 2SFAA 1NT1A 3BEIB 3LJJA 4Y7AA 3PO1C 1ZPBA 1O2YA 2V35A 1AO5A 2ZPSA 1TFXA 1F5LA 3A87A 3OY6U 4I33A 4WMEA 2D2DA 1GI4A 1AB9B 1EPTA 4FUIA 5DP8A 3RM0H 1K2I1 2GDEH 2IJOB 1HIAB 1AWHB 2ZECA 3VEQB 1P11E 1DE7H 1LPZB 2I6QA 1EJNA 1YPKH 4FU8A 1O3HA 1U6QA 2FS9A 4Y71A 4CRAA 1BJVA 1SGFG 5ETXA 3SUFA 2SGFE 2FOMB 3V7TA 7LPRA 1CHOG 2J95A 1XUFA 2BQ7B 4WXIA 1YM0A 2Y7XA 1GBFA 1Z71A 2OLGA 4VGCB 5LPFA 1THPB 4CRCA 3KL6A 5EXNA 8GCHG 1C5PA 1SLUB 5K0HA 4FVDA 2OTVA 2WPMS 3DA9B 4BXWA 1CHGA 2PKSB 2QV1A 3PV4A 2GVFA 1HNEE 4INLA 1WQSA 1GL1A 4KTCA 3FP8E 1SHYA 1ZMLA 2WPIS 4ZKRU 3OY5U 1E34B 2PUQH 2GT8A 1TNLA 2PGBB 1GCTC 1KXBA 1EJAA 1V2MT 2PHBA 1UTLM 2QXJA 1GJCB 1AU8A 1C1NA 2F91A 2ANMH 2FODA 1UJ1A 3BTKE 2BDGA 1HUTH 5GDSH 3L6PA 3S9CA 3ZVFA 3SV6A 4ASHA 1Y3XA 5GCHG 2ZDLA 5FPSA 3IITA 3FZZA 1RGQA 4FUDA 2HOBA 3MHWU 2ANYA 3V3MA 1TIOA 3GY7A 2F83A 2W3IA 4ZROA 1OSSA 4U01A 1FI8A 1V2VT 2AMDA 3BF6H 4IMQA 1EAIA 1DWEH 1IQKA 2ZDVH 3R0FA 1K1OA 3DFJA 1D3PB 1GHBG 3QTOH 6GCHG 1EB2A 3AASA 1YBWA 1BTPA 1ELCA 3PLBA 2BD4A 5GXPA 2BD5A 4IMZA 1O5EH 2W7UA 1W0YH 3TJUA 4B2AA 4KKDA 2VIWA 1FJSA 1IQJA 1KXFA 1XMNB 2TPIZ 4YOGA 2ZHFH 5HMAA 1TNIA 1HDTH 1DWCH 1O2NA 3P70B 1ELBA 1GBIA 1O3OA 3JZ1B 2J4IA 4AORA 1L0ZA 2CN0H 2BD3A 3NCLA 1IQEA 5C1UA 3O8RA 2D1JA 3KQDA 5I25A 3PB1E 3A8DA 4ISNA 4NCYA 4NSVA 4NA7A 1Y59T 1GJ4H 3LC5A 1TX6A 2Z9GA 3SQHE 1H9HE 2Y6TA 4YLQH 4K1TA 1UTKA 2QXIA 3PTNA 1AFQB 2BY5X 1NPMA 1O36A 2OXSA 1TABE 4XBCA 1JBUH 1SSXA 3M5NA 3RUOA 2GX4A 1WV7H 2V3OH 3MI4A 4CRDA 3OSYA 2VNTA 5FAHA 1GBAA 2QXHA 2OC1A 1KTSB 1JRSA 3BG4B 7GCHF 1ZMJA 4WXVA 1EZSC 3KEEA 3S9AA 1SBWA 3QK1A 4JZIA 1S85A 3CS0A 4YO9A 4NIVA 4B76A 1TPOA 2O8UA 3ZZ5A 1O3EA 3TGIE 4TWWA 4ZH8A 2OQUA 4Q7YA 2Z7FE 4NIYA 3ZVBA 2F9OA 1D9IA 1DSTA 2VIVA 3SGAE 3OYPA 5IYTA 1AI8H 1CA8B 4DT7B 1HBTH 1A2CH 1UTQA 5FX5A 5B6OA 3RXAA 1RFNA 2GZ9A 1SLWB 5F03A 2BZAA 4Q80A 5GPIB 4YESB 1GJBB 3Q77A 3SV7A 3EQ0H 4I8HA 9LPRA 2ZFRH 4WMFA 3LH1A 2PKSC 1OKXA 4ABEA 2AFQB 1K1JA 3U9AH 4CH8B 5FCKA 1P3CA 3LGVA 2H2ZA 3A82A 4K8BA 3ZZ7A 2FXRA 2FYQA 5L30H 3EA7A 2ZQ2A 4XDEA 3MH5A 1O2TA 2WPLS 4I31A 3EAJA 2ZU2A 2CF8H 5EPYA 1EPTB 1JRTA 1XVOA 3SHCH 3UFAA 1KXDA 1GHZA 1C5UA 3UREA 5CHAB 1O3DA 2NU3E 1O34A 2H5CA 4X1RU 2Z9LA 1C5MD 1YPHC 3RXPA 2J92A 1OWDA 1S0QA 4ZMAH 3IWMA 1MQ5A 3ZZDA 2O8WA 2A4GA 1BQYA 1ELVA 2AIQA 3TNSA 5FCRA 2Y7ZA 3UTUH 1F5KU 3RXTA 3P8FA 2QXGA 4E05H 1PPZA 4DIIH 2F9NA 3O8BA 1GMCF 3ZV9A 1FDPA 4AFQA 3AVZA 4Y8YA 1MUEB 1TBQH 2CV3A 2ULLA 3VB7A 1PPHE 1O2MA 1UTNA 1GI8B 3GY4A 1TQ0B 3FFGA 1XXDA 2OC8A 5A0AE 1ZR0A 4UEHH 1C1WH 1DANH 1F2SE 1K28D 1J9CH 1D6RA 1QQ4A 2BX3A 1NRPH 3H5CB 1SB1H 2QF0A 3S0NA 1C5QA 2R2MB 1V2ST 1NN6A 1SLVB 2RCEA 1WQVH 2P3TB 2EI7A 1MTVA 3DUXH 2BY7X 1TGCA 3E16B 3LIWA 1GHYH 1O2OA 1O2GH 5FX6A 1T4UH 2ZO3H 3CP7A 3M61U 4ZAEA 2FOCA 2VINA 2BDCA 4BNRA 4XBDA 2OC7A 2PFEA 4A7IB 1GI6A 1HYLA 1QJ1B 1TALA 1WTGH 3KQBA 3UQOA 1ARCA 2H1UA 4INHA 1FZZA 3EGKH 1ZRKA 1AFQC 1DITH 3UY9A 3BEUA 1O3BA 1O2JA 5HM9A 1JIRA 1A0LA 2Q6GA 1A5GH 1O5GH 1ABJH 4K1SA 2ZGXH 1C2KA 5DJ7A 2ALVA 2VGCB 3NWUA 4Q7XA 1P01A 5E0HA 3BTFE 1UVTH 1F0SA 1P3EA 1HPGA 2VWOA 3MYWA 3KIDU 4ISLA 1SFQB 1ZHMA 1F0UA 1GI7B 3JZ2B 1C2DA 1CBWB 1SVPA 4GCHG 1BBRH 4NGAH 3GDVA 1CT4E 1GG6B 1UMAH 4ABFA 3P92A 1GMDG 4XE4A 1V2KT 2A0QB 2KAIA 2GKVE 1DOJA 1C2GA 4WVPE 1V2TT 4MPVA 4X8TH 2J9NA 4I8GA 1BMLA 1LVOA 2TGDA 2SGEE 2HALA 1GI3A 1OS8A 1QL9A 2XNIA 1MZDA 2XYAA 4JZDH 2FESH 1GI9B 1ZOMA 4Z0KA 1QJ6B 4TYDA 2BXTH 1SQOA 3SNDA 1BBRK 4Y76A 4MPUA 4IC6A 3D62A 3K6YA 1GI5A 3TJNA 2AMQA 2XWAA 2FOHA 3K6ZA 1L1JA 3TLOA 1DFPA 2HGTH 3ZZ8A 1C2JA 4ABHA 5SGAE 1UVSH 1YYY1 1UO6A 3PO1B 1PQAA 3GISB 3V12A 1O31A 3QTVH 3URCA 3VXEH 3KN2A 2BMGB 2C93B 1O38A 1TBRH 1BB0B 1QRZA 1V6DA 3RXMA 1EPTC 3AW0A 1OPHB 3SNCA 1PYTD 1QL7A 2GCHG 3NPSA 3C1KA 1O2QA 1QBOA 3RU4D 2PSYA 1Y5BT 5CHAC 1FNIA 1KLJH 2Y5GA 1LVBA 2PLXA 1UCYH 2JH6D 1C2HA 3MO6A 3EA8A 1NRRH 2F9UA 3LGWA 1GMHG 4AG2A 3RU4T 3Q76A 4LK4A 5J4QA 4KP0A 1AY6H 2HNTC 5CE1A 1CSOE 3QUMP 2SNVA 4ZUHA 1HAYB 1MMJN 1SGNE 1ZSLA 5DP4A 3RMMH 4H6TA 4ZHLU 2GGVB 3RXSA 3FP7E 3A7VA 3BN9A 1Y3YA 1AZ8A 4TPIZ 5LGOA 1AFEH 1F5RA 1BHXF 2FYRA 1PQ5A 1GJ8B 1C5ZB 3MFJA 1YPGH 2WPJS 3NZIA 3H7TA 1FV9A 1GBTA 1TLDA 2FOBA 2BOHB 3TNTA 2WUBA 1QB6A 1YPEH 3V13A 4IC5A 1C5TA 4DOQA 4BAOB 4NZLA 5EQQA 1K1LA 1GBLA 2WINI 2OBOA 3E3TA 2ZC9H 4AFUA 4LOYH 4F49A 1A61H 2CF9H 3A86A 3A88A 3BG8A 1G37A 2AEIH 3F68H 1BUIA 1CO7E 1THRH 2PUXB 1YLDA 1NRSH 3BTDE 5C2ZA 3SN8A 1AKSA 1EKBB 1QQUA 2FI3E 3M3SA 4X8UH 4DIHH 3UR9A 2ZHWH 4KTSA 4OS2A 1TGNA 1DUEA 1L1NA 4H42U 2R0KA 3CENA 2F3CE 2Z6BD 1VCPA 1H1BA 4BAKB 5C1XA 1X7AC 5HM2A 1HAHH 1GWAA 2XRCA 4JZFH 1Z8IB 4XSKU 1DY8A 1TMUH 1HAGE 1MQ6A 2BQWB 3F1SB 5F8ZA 1C1SA 3E0PB 2P94A 1LKAA 1NM6A 3PMBB 3ZZCA 5AFYH 4JYTA 4DJZB 2BX4A 1WYKA 2A2XH 1Z1IA 2ZHQH 2ASUB 1BTXA 1O5BB 2FMJA 1GHWH 2UUFB 4M7GA 4SGAE 3LGTA 1O32A 3TVJB 2LNCA 3D65E 4JZEH 1GG6C 3N7OA 2WYJA 2BQ6B 2A32A 2VH6A 2FIRH 4TY6A 1TNGA 4U30A 4FUBA 1JWTA 1OP0A 1FN8A 3C27B 7ESTE 3ZZBA 1INCA 1H9IE 3RXOA 3TIUA 2P93A 1W2KH 3AAUA 2YNAA 3BTME 3A85A 3A7XA 3TJOA 4JYUH 3UWJH 1G3EA 4AG1A 1TPAE 5IDKA 1W12U 1GHXH 1LO6A 1YPHE 5TCAA 3F9GA 2HWLB 3M7UA 3LGYA 1QIXB 1RXPA 2EEKA 1C1UH 3SNEA 1RTKA 1MAYA 3TJVA 2PKAA 2VU8E 2SGAA 5DP6A 2ZPQA 4ESTE 4KGAA 1MAXA 2A4QA 1TRNA 1N1LA 2C90B 2VIQA 3KF2A 4Q2KA 4TY7A 3ATKA 1QHRB 4AGJA 3F9FA 4UD9H 2G4TA 1ZHPA 2F9VA 3RXKA 3RXCA 4Q7ZA 1K1NA 2GZ8A 1V3XA 1O2SA 1SGQE 3URDA 4F4OC 2PV9B 1DLEA 1NFUA 1L4DA 1UTMA 3BIUH 2KAIB 1AZZA 3QZRA 1C5XB 3UNSA 1BTYA 2ZGJA 1EP5A 1QJ7B 5JBBS 1T4VH 4ABJA 1S81A 2TGTA 5DP7A 5EQSA 4X6PA 1NFXA 3Q00A 5FBEA 3K2UA 2R3UA 3GY6A 1FQ3A 5EODA 4WMDA 2PW8H 3ODFA 1FY5A 5EOKA 4D7GA 2ZCLP 3ATIA 1K9OE 2HNTF 4OGYA 1K22H 1W0ZU 2ZFFH 1SGDE 4X8VH 3KNXA 1RIWB 1TWXB 1Z6EA 1BOQA 2NWNA 4X1QU 3SJOA 1MH0A 4A1VA 1GJ9B 5DPAA 1SG8B 1O2HA 2BLQA 2G4UA 1UK4A 3ODDA 4FUGA 1A5IA 4Y6DA 1O5CB 3PWBA 1ELAA 1EOJA 3VB3A 1C2IA 1SPJA 4GHQA 4MG3A 3P8GA 1ZHRA 3UWIA 2ANKH 4CBNA 1WTHD 1HAVA 1LQEA 1PPFE 5DP5A 3T62A 1P04A 1BHXB 2IN2A 4CHAB 1EJMA 1H8IH 1C5VA 1B7XB 2Y82A 4A92A 4YOIA 3RXJA 2ZFPH 3W94A 2UWOA 2ZU4A 4AB8A 1A0JA 1AE8H 1QB9A 2DE8A 4MNYA 5T6GA 3T2NA 2IOTA 2XC5A 2XC0A 4I32A 3TH2H 4NIWA 5DO4H 2OC0A 1MZAA 1GDNA 1UK3A 4UFDH 1OWHA 4Y7BA 1G3CA 1NO9H 3FP6E 2ODPA 1GBEA 5GIBA 5JYIA 2HPPH 1LHFH 1SGIB 1N6YA 3GCTF 1VITF 3E1XB 3RMLH 3U8RH 1TOMH 4BAHB 2B9LA 1HAOH 1GDUA 3MU4A 1ZTKA 3A7WA 4HZHA 4AGKA 1MCTA 1C1PA 3D23A 4B1TA 1O2KA 2ZFSA 1TMBH 1ZJKA 3BTGE 1KDQA 1Q31A 2BD7A 2OCVB 2RA0A 4WY3A 3ELAH 1UTPA 1AKSB 2BDIA 4UDWH 2VIPA 1D3TB 3O8CA 2FOFA 4BAQB 3OTJE 3QWCH 3SOSA 3UOPA 2FTMA 2VJ1A 4FU7A 1ANDA 4YM9A 3TGJE 5L6NH 4IGDA 2ZU3A 1OYTH 2UWPA 1J16A 1BMNH 3M36A 2ODQA 4ABBA 2THFB 1GVLA 2UUKB 4RN6A 3ZVEA 8KME2 3M35A 2BTCE 4JCNA 1A7SA 1BBRE 1ARBA 2PWXA 1O3AA 1BT7A 1IHTH 1W14U 4HGCA 4AB9A 3EDXB 4QT8C 1EZUC 2BDBA 1SGYE 1ANEA 1J15A 1DS2E 3BTHE 5AHGH 2BZ6H 1BTWA 2QC2A 7KMEH 2GV6A 1OX1A 1KIGH 2V0BA 1O30A 2AMPA 1KLIH 1FXYA 1YPJH 5F8TA 2GT7A 1E37B 1MKWH 3QN7A 2QYIA 2RA3A 3A7YA 1C1VH 1EZQA 3HK6B 1ZYOA 4ZXYH 3DD2H 2ZDKA 1QTFA 2A7JA 1OWJA 1OXGA 1SGCA 3S7KB 2BVXH 4ZKOU 5FBIA 1EQ9A 1A1RA 4OS5A 6LPRA 2P8OB 1BRUP 2NU2E 1LVMA 5JBAS 2ESTE 3VXFH 4GPGA 3SJ8A 2ZPRA 4FUJA 3MH4A 1P05A 1MKWK 1P57B 2RG3A 3L33A 4WJG2 1PJPA 2PKAB 3QDZB 1AMHA 2B0FA 4YT6H 1VJ9U 1RIWC 3Q3KA 1RTLA 2WV4A 2K1QA 2C8XB 1P09A 1UCYE 1K1MA 1ZPCA 3H7OA 5HYOA 1C2LA 1DWBH 1SR5C 4J2YB 3A84A 4NA9H 3RXLA 1YP9A 3LJOA 1SGRE 1CQQA 2ZHEH 5AFZH 1TAWA 3E6PH 3SJ9A 2P3FH 1AVWA 1DICA 1D3DB 2O9QA 1C4Y2 1WOFA 4CHAC 1DLKB 4ZHMU 1A3BH 1XUKA 2ZA5A 1GCDA 5BPEA 3SJIA 1LVYA 4D9QA 3VFEA 1O2RA 1SMFE 2PSXA 3TK6A 3MU8A 1W10U 2VVVA 3ZVDA 4Y11E 3BIVH 3RU4E 3A8AA 2ZGHA 1AVGH 1AWFH 2G5VA 1ZSJA 1TQ7B 3SV9A 1O3PB 1E36B 1TPPA 1FONA 5EG4A 2GTBA 4Y8ZA 1EUFA 5A8YA 1Z8RA 1P02A 4X2WA 2FOEA 1ORFA 2O8MA 3SU6A 1CGJE 3E90B 3FZDA 4A1TA 5JB9S 3A89A 3T27A 3ZZ4A 4Y10E 5A0CA 3QX5H 3P8OA 4BAMB
chains in the Genus database with same CATH superfamily
2UWLA 1AN1E 3K9XB 1BMMH 3MNBA 2UUJB 2B7DH 2ILNA 3PWCA 4FUEA 1V2JT 2XBVA 1FY4A 1V2LT 3GYMA 4YOJA 2BLWA 1FY1A 1HAVB 1YC0A 2F9PA 3QO6A 5F6MA 1G2MA 1SQTA 1OWEA 3MNCA 3SGQE 3PRBA 3KCGH 4CR9A 4DW2U 2G8TA 1Y8TA 2YOLA 1O3KA 2KCOA 4Y79A 4O9VA 3T29A 2ZHDA 3SU3A 1ELFA 1L2EA 5DG6A 3U98H 1XKBC 1CGHA 2ZFQH 5DN6D 4NSYA 4FUHA 1UVPA 2CHAB 1G3DA 3M37A 1SGFA 5ESBA 4CREA 1S84A 3LONA 2TGPZ 1UTOA 2QCYA 1NU9A 4MTBA 1QFKH 4AFZA 1EXFA 1WAYB 2Z3EA 4D76A 1ESTA 2GP9B 1NRQH 1OOKB 1O3NA 2J97A 4B74A 1SFIA 2ZTZA 1MTNB 3SZEA 2WPHS 3SO3A 4B2CA 1O2UA 2WPKS 1PPBH 1GBDA 1G36A 2BY6X 4GHTA 1GJDB 3UPEA 1D4PB 2PP6A 3SU5A 1DM4B 2ALPA 1VCWA 3ESTA 2P3UB 1J17T 2C4FH 2Z94A 3SU4A 1CHOF 1KDQB 1XKAC 2QAAA 2GMTB 1W3CA 1ESBA 1P2NA 2EA3A 4ISOA 1AGJA 3LC3A 4HFPB 5HXFA 1F0TA 1HJAC 1NROH 2KCAA 3A8BA 3DSGA 3O8DA 3U8TH 1TMTH 1C5YB 2BD9A 2NU0E 3GCTG 5C0TA 8GCHF 5C3NA 1BA8B 1S6LA 1A0HB 3PYHA 1AUTC 2P8OC 4UE7H 1QBVH 1D3QB 1PPCE 4I8KA 1BRCE 3FO8D 1Z8JB 1N6XA 1YPLH 1HGTH 1BRBE 3AW1A 2ZDMA 3RXRA 5J4SA 3FANA 5C5NA 5F8XA 1HXEH 4BTUB 3NUMA 1P0SH 1C1OA 2EC9H 4YXWD 2Z3DA 3GCOA 3F0PA 1MTSA 4CR5A 3RP2A 3ZVCA 2BVSH 1MTWA 1O2WA 2OD3B 1BTZA 4DY7B 1TNHA 3ZVGA 2PTCE 2LPRA 3A7ZA 2RDLA 3E91A 1F7ZA 2JETC 3TH3H 3LU9B 3EA9A 1JMOH 1C2EA 1UHBA 1DT2A 1TGTA 4H4FA 4K3JA 4D8NA 1C2FA 1NC6A 2Q1JA 1B0FA 1CA0B 2HRVA 4RT0A 1TGSZ 3QZQA 1ANBA 5IK2D 5GCHF 1VITH 6ESTA 7GCHG 3RXHA 1ETTH 1GVZA 5FXLA 2QA9E 2SGQE 1S5SA 4LXBH 3GY8A 3M7QA 3RXGA 4E7NA 1Y5UT 1HV7A 2ZDAH 1TE0A 3U1JB 1FPHH 1KXCA 1ZGIA 3MU1A 1C5WB 1MKXH 1ELTA 3LGIA 3EE0B 1L1GA 1GHBF 3SI4H 2C8WB 2Z9KA 2Y81A 3ITIA 1UCYK 1DVAH 3PLPA 3SNBA 4A5TS 1IQMA 1GHAF 3P6ZB 3RXVA 2J94A 5T1VA 4CBOA 1VZQH 4ABDA 5A8ZA 3SUEA 2AGIX 2R3YA 3SV2H 1ELGA 1E38B 2BY9X 1P03A 3RXDA 5G4BA 1V2QT 4IW4E 5AF9H 3T26A 2K8IA 1GHVH 2BLVA 3A81A 3KQCA 9ESTA 2XBYA 3KGPA 1SGEE 3MNSA 1OHHD 3OEHD 1A5HA 2R9PA 3U1IB 4NWLA 4OS6A 1LCYA 3QGJA 2A5IA 1C5SA 4XBBA 5JDUB 3BSQA 2H5DA 3MOCA 2FI5E 2WUCA 1K21H 1Y5AT 2CXVA 4IN2A 1RJXB 1T32A 5TCCA 1KXAA 2FDAA 2QY0B 1QCPA 2GZ7A 2GCTB 3F9HA 3RMOH 1O2XA 2JJ2D 1W11U 4RKJB 1DDJA 1K1PA 3ZZ3A 1C1MA 3M3VA 2FP7B 2O8TA 4GUXA 1YGCH 4ISHH 2FX6A 2CHAC 4FUFA 5T6FA 3SI3H 3SW2B 4Z6AH 2ZF0H 1HRTH 4E7RG 2AGGX 3PLKA 3GOVB 1JOUB 1LHGH 5C67A 1TONA 1YLCA 2V3MA 3U28C 1C1RA 1VGCB 1MTNC 2A5KA 2DE9A 1IQHA 1GMCG 4CRFA 4MPXA 3SORA 3F2FA 1UTJA 2FM2A 5JBTA 4I7YH 4DVAU 1HLTH 3LDXH 3STJA 1AVXA 1BITA 3MH7A 3MO3A 2GMTC 4XOJA 1MCVA 2FLBH 2HLCA 1XX9A 2FWWA 2VH0A 1YF4A 1C5LH 1SC8U 5FPTA 5DGJA 5JBCS 1MU6B 1CGIE 1GBMA 1GPZA 3P95A 2M5TA 1GBKA 1EP6A 3HGNA 2XBXA 2J98A 1CE5A 2FLRH 1PYTC 3RC5A 5EW2H 1FMGA 5E8EH 3SU0A 1GJ6A 2AERH 3T25A 2ZCHP 4I8JA 1QA7A 2EI6A 2VIOA 4NZQA 3ZZ6A 3GS9A 4HI3A 4UFEH 5I46H 2ZG0H 4O3TA 1LPKB 3A7TA 1BRAA 2EY4C 1V2OT 3MWIU 3NK8A 5EW1H 1UVOA 1TYNA 1Z8GA 1FAKH 3S69A 1W0JD 2H9EH 2TIOA 4X1SU 4X0WU 3SQEE 1W8BH 1MBMA 2AYWA 3RM2H 5DKMA 3UB0A 4D9RA 4PROA 4ZKNU 1Y3UA 3N99A 1AIXH 1CA0C 1SQAA 1P9UA 5K7RA 3MTYA 4XFQA 1DUAA 1GBCA 2JDID 3KQEA 1P2IA 1DPOA 2IJD1 2NU4E 2Y5HA 5T6DA 2XXLA 1O2ZA 1ZGVA 1GI2A 3CNRA 1A4WH 3UUZA 2XCFA 4WWYA 1UK2A 2GV7A 2AS9A 2A4RA 1XM1A 2NU1E 1GVKB 1ID5H 2OBQA 1HFDA 5ABWA 1GBHA 3GCHC 2ZIQH 5DK1A 1ACBE 1B5GH 5C17A 1EFRD 3M5OA 3LKWA 1AUJA 1PQ7A 2Y80A 2XW9A 3OX7U 4CRGA 1HAXB 4OS7A 2GD4B 3TK9A 1TNKA 1NFWA 3GY5A 1TBZH 3M5LA 4I8LA 4AYVB 2OUAA 2A1DB 1C4U2 1QNJA 4UFFH 1EAWA 4LZ4B 1O3IA 2F4LA 1DXWA 1GBBA 1P12E 1Y3WA 1TNJA 5FHTA 1UHBB 3M3TA 1IQNA 1M9UA 4NG9H 4GLYA 1EX3A 1QB1A 1ZPZA 2J38A 1AHTH 3PMJA 3QLPH 1PFXC 2TBSA 1C1QA 1C9TA 1O3GA 2QE7D 3L3TA 4NA8A 3BTQE 1S6FA 2R2WU 3P17H 4OM9A 2TRMA 3SBKA 1S83A 3GY2A 1V2NT 4GAWA 2GCTC 1XUGA 4DG4A 1P10A 2O8LA 4ZHAA 1W0KD 1OWKA 3BTTE 5LPRA 1TA6A 5A09A 5E0GA 1O39A 4NFFA 4TSFD 1O2IA 3PMHB 1O5FH 1NFYA 1ELEE 4Y0ZE 4H6SB 3S7HB 1S6HA 2ZU5A 1DX5M 1O3FA 1OP2A 1ZSKA 3DFLA 4JK5A 5EJLA 4A1XA 3UAIC 2XCNA 2BB4A 2ZWLH 4GCHF 2H9HA 1VGCC 4M9FA 4F48B 5DP9A 5EGMA 1B0EA 1GMDF 4X6NA 4ABAA 1G2LA 2CGAA 4B6FA 1FIZA 4K60A 3ENSB 3STIA 4K5ZA 1BTHH 3UOUA 2ZP0H 1JXPA 1ABIH 2FZZA 3A80A 1TX7A 1P2JA 1GHAG 4X6MA 1O0DH 1HJ8A 4MVNA 1FPCH 1ZTLA 4MQAA 1BZXE 4JYVH 1SI5H 3SV8A 4K2YA 3V0XA 8LPRA 1V2WT 5A8XA 2C3SA 2BDAA 4IN1A 3G01A 5BRRE 5EU8A 4AC9A 4X1NU 1XXFA 1G32B 2BXUH 1NS3A 1P2QA 4FUCA 4INKA 3TGKE 1LPGB 4TWYA 1T8LA 1TA2A 5HGGA 5LPEA 1QY6A 5C5OA 2HNTE 1NZQH 1ETRH 2YMSD 3B23B 1V2UT 3SZNA 5C1YA 4CRBA 3HKJB 3RMNH 2W5EA 2CJIA 4O97A 4AN7A 2PR3A 3RXBA 4ABGA 4AFSA 2HVXA 1C5OH 2BYAX 2ODYB 4X1PU 2KM0A 1QL8A 3ZV8A 2GCHF 3BEFB 5KECA 1BIOA 1KTTB 1E35B 1VCQA 2C8YB 2IPQX 1DSUA 1SHHB 1BMAA 3MH6A 2Q6DA 1QA0A 2A7HA 5EXMA 1G30B 1GBJA 3GICB 1PPGE 1GMHF 2STAE 4RSPA 3VGCB 2VVUA 1EATA 1NRNH 1O2VA 4FVBA 1AB9C 4TPYA 3GCNA 2BLOA 1F0RA 2B8OH 2ZEBA 1QBNA 2FEQH 1HJAB 1PPEE 5E2PA 2PTNA 2D8WA 3E8LA 1G9IE 2FS8A 3A83A 4GSOA 1E0FD 1HCGA 2G00A 3I77A 1QRXA 1C4V2 2ZDNA 1EAXA 1XVMA 2DUCA 4X2YA 4YZUA 3OTPA 1OP8A 2J98B 1VR1H 4ABIA 3I29A 3RXUA 5EPNA 3HKIB 3ZYDA 2A2QH 1FN6A 2OP9A 1WUNH 4VGCC 3UNRA 5HIZA 4MNVA 2SGPE 3GYLB 1NESE 2H6MA 1C5RA 1ETSH 1FUJA 3DCLA 5JPMH 2P59A 3KYGA 1EOLA 1KSNA 1A46H 1IQGA 2JETB 1ESAA 4GVUA 2QF5A 2FOGA 4YTAA 2Z9JA 4WH6A 5ESTE 3PTBA 4O3UA 5TJXA 1YY3A 5A2MH 2BY8X 4MPWA 4NFEA 1HXFH 4B2BA 2HPQH 3HK3B 1SOZA 5L2YH 2BHGA 1T7CA 2IPHA 5H4IB 5PTPA 2ZCKP 3PM3A 3DSPA 1NY22 2CK3D 4UFGH 2I6SA 3GDSA 3RC6A 3PMAB 1O35A 1P9SA 2W7SA 1CT2E 1MD8A 4RI0A 2C8ZB 6CHAB 4X8SH 4MNXA 1NU7B 3PV2A 4AYYB 3SUGA 3W95A 4JMYA 2FPZA 4R8TB 5E0JA 3LPRA 3TK5A 4E06H 2A31A 2ZGCA 1IQFA 2F9BH 3UNQA 2BD2A 3CS7A 1GL0E 3HATH 1OWIA 4MLFB 4ZXXH 4YT7H 1QGFA 1W7XH 1DY9A 2Y5FA 2B5TB 4NIXA 5CDFE 1TPSA 1LTOA 2V6NA 4BXSA 2VIDA 1CT0E 1SGTA 1RD3B 2QF4A 4Y8XA 3VB5A 1Z7KA 4BOHA 1YCPM 1IHSH 3QGNB 4Y0YE 5GWZA 4HTCH 3WWFA 4K8YA 3Q3YA 4D7FA 1OYQA 2QGRA 1TGBA 4B73A 1P2OA 3GY3A 1C1TA 1D6WA 1MTUA 3HGPA 3MU0A 1FLEE 2TGAA 4IS5A 3SGBE 1LQDB 2QF3A 3M5MA 1NTPA 3F9EA 5GJ4B 1P8VC 2A4OA 1AD8H 2GDDA 1XUJA 1ZJDA 2ZGBH 2ZTYA 2BD8A 2XWBI 3AAVA 4ZCNA 1Q2WA 1CU1A 1GGDB 1FIWA 2SGDE 3PV5A 1C5NH 2F43B 4MDSA 1H8ED 4X2XA 3DSOA 1GJ5H 4FXGH 3S9BA 3FAOA 1EZXC 4XD7D 5AVDA 4B6EA 2HVYB 3BG4C 1GI1A 4J1YA 3ZVAA 1N8OB 1S0RA 4JZ1A 3VPKA 3VGCC 1S82A 1ZTJA 1QRWA 3MMGA 1O2PA 3RLWH 2WSSD 1HJ9A 4LZ1H 5F53A 3RXIA 2SNWA 1HIAA 4DURA 3RC4A 3TITA 2UUYA 3SJKA 3SNAA 4AOQA 1VITG 2JKHA 1GDQA 2D26C 3SHAH 4BANB 4B75A 2AIPA 1WCZA 2P16A 1SL3A 2WPDD 3RLYH 4K1EA 1XUHA 2BM2A 1ZZZA 1T8OA 3A8CA 2J34A 3MO9A 1C2MA 1ZMNA 2FX4A 1Z6JH 1UVUH 5C20A 1CVWH 2XTTB 1O3CA 1LKBA 4K69A 3RXFA 2JH0D 1HB0B 3M7TA 3MU5A 3OU0A 2XBWA 3T28A 2ZFTA 3RXQA 3ZZ9A 1GJAB 4JK6A 1W13U 2VB0A 4NWKA 1TX8A 3TH4H 2KFWA 1EB1H 1V2PT 1IOEA 4Q63A 1G3BA 3EYDA 2AGEX 3I78A 2QN5T 5JB8S 1MBQA 4THNH 1P2MA 1LDTT 2ZTXA 2Z3CA 1K1IA 1TRYA 3HPTB 1ZLRA 4IBLH 3WWBA 3WW7A 2G55A 2WYGA 1IAUA 2A45B 1FAXA 5EXLA 3VB6A 1BDAA 1O3MA 1IQLA 1GJ7B 3B8JA 1LHDH 2R0LA 2FI4E 3GCHB 4OS4A 6GCHF 1WSSH 3LH3A 2ZI2H 1FY3A 2STBE 2BDHA 1FX0B 6CHAC 1SOTA 1HAPH 3BV9B 3UQVA 3Q3XA 2W26A 1VJAU 2Q6FA 3T5FH 3SU1A 1H8DH 3NRLA 3RDZA 2J2UA 1O5AB 1SGPE 1W7GH 1T8MA 4WH8A 2G5NA 1YKTA 1KXEA 3SU2A 5HKKD 1TOCB 5E2OA 3DT0H 3U8OH 3P8NA 1SKYE 1RTFB 1THSH 1MKXK 1J8AA 3UIRA 2G52A 4DGJA 2VWLA 1ANCA 3PROA 1RRKA 4X6OA 3LGUA 1Z1JA 2W3KA 1JIMA 1HAZB 2A5AA 4A6LA 5LH8A 4OGXA 2ZKSA 1T31A 2ANWA 1YLNA 4FU9A 3R3GB 1KYNA 1WU1A 1IQIA 1TRMA 1H9LB 2G51A 3U69H 1GCTB 1QURH 3ATLA 4FOUC 2FOAA 4DCDA 5DP3A 1KLTA 1BTUA 2EI8A 2FO9A 1LHEH 2XC4A 4SGBE 1F92A 2VWNA 3TU7H 2BOKA 3WY8A 5EJ1A 1O3LA 5C0UA 1DXPA 1H4WA 1TB6H 5C94A 3ZYEA 3RXEA 2CMYA 5EQRA 5FPYA 2BVRH 3LOXA 1AE5A 1O33A 1L4ZA 1YPMH 4ISIH 2ZU1A 3FVFB 3F6UH 3KHVA 3GDUA 2AH4X 3LT3A 1O3JA 2JH5D 1GGDC 1BJUA 1O5DH 2RFKC 1C9PA 1J14A 3ZZAA 4WF8A 2FTLE 2ZNKH 1HAIH 2VWMA 3BTWE 3BTEE 4Z1MD 2VGCC 4O03A 8ESTE 1N8OC 5CMXH 1ZRBA 1YCPH 3ATMA 1XUIA 3K65B 1RS0A 1Q3XA 4R0IA 4X2VA 4YLUA 3DHKH 4B71A 5A0BA 3NKKA 1ELDE 1LHCH 2VVCA 1V2RT 4AX9H 4KELA 4UONA 2OQ5A 1MU8B 3UR6A 1KY9A 4ZKSU 4CH2B 1WXRA 1EASA 1BCUH 1CBWC 3IG6B 4I86A 2H9TH 4TT3D 3EE7A 3B9FH 3TPIZ 1FY8E 2V3HH 2ZQ1A 1Y3VA 1EAUA 3D49H 4F55A 1P06A 2P95A 1QR3E 2YNBA 3ATWA 1GI0A 4KTUA 3ZIAD 4BTIB 2ZZUH 1YCPK 1DWDH 4U2WA 1LMWB 3SUDA 4AZ2B 1A3EH 1SLXB 4U32A 1O37A 2A7CA 2WZQA 4RKOB 2OK5A 1MD7A 2G81E 3NXPA 3E0NB 5T3HA 5L2ZH 3VB4A 2PGQB 1PQ8A 4OS1A 4ACAA 1O2LA 1AQ7A 2WV5A 4RT1A 2Z9IA 4BTTB 1T8NA 2OINA 2QIQA 2JJ1D 2BDYA 1P2KA 3MNXA 1WBGB 4MNWA 2KR7A 2SFAA 1NT1A 3BEIB 4P00A 3LJJA 4Y7AA 3PO1C 1ZPBA 1O2YA 2V35A 1AO5A 2ZPSA 1TFXA 1F5LA 3A87A 3OY6U 4I33A 4WMEA 2D2DA 1GI4A 1AB9B 1EPTA 4FUIA 5DP8A 5B6LA 3RM0H 1K2I1 2GDEH 2IJOB 1HIAB 1AWHB 2ZECA 3VEQB 1P11E 1DE7H 1LPZB 2I6QA 1EJNA 1YPKH 4FU8A 1O3HA 1U6QA 2FS9A 4Y71A 4CRAA 1BJVA 1SGFG 5ETXA 3SUFA 2SGFE 2FOMB 3V7TA 7LPRA 2HLDD 1CHOG 2J95A 2RDEA 1XUFA 2BQ7B 4WXIA 1YM0A 2Y7XA 1GBFA 1Z71A 2OLGA 4VGCB 5LPFA 1THPB 4CRCA 3KL6A 5EXNA 8GCHG 1C5PA 1SLUB 5K0HA 4FVDA 2OTVA 2WPMS 3FKSD 3DA9B 4BXWA 1CHGA 2PKSB 2QV1A 3PV4A 2GVFA 1HNEE 4INLA 1WQSA 1GL1A 4KTCA 3FP8E 1SHYA 1ZMLA 2WPIS 4ZKRU 3OY5U 1E34B 2PUQH 2GT8A 1TNLA 2PGBB 5HIYA 1GCTC 1KXBA 1EJAA 1V2MT 2PHBA 1UTLM 1E1RD 2QXJA 1GJCB 1COWD 1AU8A 1C1NA 2F91A 2ANMH 2FODA 1UJ1A 3BTKE 2BDGA 1HUTH 5GDSH 3L6PA 3S9CA 2AHME 3ZVFA 3SV6A 2KCPA 4ASHA 1Y3XA 5GCHG 2ZDLA 5FPSA 3IITA 3FZZA 1RGQA 4FUDA 2HOBA 3MHWU 2ANYA 3V3MA 1TIOA 3GY7A 2F83A 2W3IA 3N7EA 4ZROA 1OSSA 4U01A 1FI8A 1V2VT 2AMDA 5DSFA 3BF6H 4IMQA 1EAIA 1DWEH 1IQKA 2ZDVH 3R0FA 1K1OA 3DFJA 1D3PB 1GHBG 3QTOH 6GCHG 1EB2A 3AASA 1YBWA 1BTPA 2YMSB 1ELCA 3PLBA 2BD4A 5GXPA 2BD5A 4IMZA 1O5EH 2W7UA 1W0YH 3TJUA 4B2AA 4KKDA 2VIWA 1FJSA 1IQJA 1KXFA 1XMNB 2TPIZ 4YOGA 2ZHFH 5HMAA 1TNIA 1HDTH 1DWCH 1O2NA 3OAAD 3P70B 1ELBA 1GBIA 1O3OA 3JZ1B 2J4IA 4AORA 1L0ZA 2CN0H 2BD3A 3NCLA 1IQEA 5C1UA 3O8RA 2D1JA 3KQDA 5I25A 3PB1E 3A8DA 4ISNA 4NCYA 4NSVA 4NA7A 1Y59T 1GJ4H 3LC5A 1TX6A 2Z9GA 3SQHE 1H9HE 2Y6TA 4YLQH 4K1TA 1UTKA 2QXIA 3PTNA 1AFQB 2BY5X 1NPMA 1O36A 2OXSA 1TABE 4XBCA 1JBUH 1SSXA 3M5NA 3RUOA 2GX4A 2V7QD 1WV7H 2V3OH 3MI4A 1E1QD 4CRDA 3OSYA 2VNTA 5FAHA 1GBAA 2QXHA 2OC1A 4P02A 1KTSB 1JRSA 3BG4B 3W1EA 7GCHF 1ZMJA 4WXVA 1EZSC 3KEEA 3S9AA 1SBWA 2WV9A 3QK1A 4JZIA 1S85A 3CS0A 4YO9A 4NIVA 4B76A 1TPOA 2O8UA 3ZZ5A 1KMHB 1O3EA 3TGIE 4TWWA 4ZH8A 2OQUA 4Q7YA 2Z7FE 4NIYA 3ZVBA 2F9OA 1D9IA 1DSTA 2VIVA 3SGAE 3OYPA 5IYTA 1AI8H 1CA8B 4DT7B 1HBTH 1A2CH 1UTQA 3F2GA 5FX5A 5B6OA 3RXAA 1RFNA 2GZ9A 1SLWB 5F03A 2BZAA 4Q80A 3FOAA 5GPIB 4YESB 1GJBB 3Q77A 5EJZA 3EQ0H 3OFND 4I8HA 3SV7A 9LPRA 2ZFRH 4WMFA 3LH1A 2PKSC 1OKXA 1MABB 4ABEA 2AFQB 1K1JA 3U9AH 4CH8B 5FCKA 1P3CA 3LGVA 2H2ZA 3A82A 4K8BA 3ZZ7A 2FXRA 2FYQA 5L30H 3EA7A 2ZQ2A 4XDEA 3MH5A 1O2TA 2WPLS 1E79D 4I31A 3EAJA 2ZU2A 2CF8H 5EPYA 1EPTB 1JRTA 1SQRA 1XVOA 3SHCH 3UFAA 1KXDA 1GHZA 2KZ4A 1C5UA 3UREA 5CHAB 1O3DA 2NU3E 1O34A 2H5CA 4X1RU 2Z9LA 1K0HA 1C5MD 1YPHC 3RXPA 2J92A 1OWDA 1S0QA 2L6OA 4ZMAH 3IWMA 1MQ5A 3ZZDA 2O8WA 2A4GA 1BQYA 1ELVA 2AIQA 3TNSA 5FCRA 2Y7ZA 3UTUH 1F5KU 3RXTA 3P8FA 2QXGA 4E05H 1PPZA 4DIIH 2F9NA 3O8BA 1GMCF 3ZV9A 1FDPA 4AFQA 3AVZA 4Y8YA 1MUEB 1TBQH 2CV3A 2ULLA 3VB7A 1PPHE 1O2MA 1UTNA 1GI8B 3GY4A 1TQ0B 3FFGA 1XXDA 2OC8A 5A0AE 1ZR0A 4UEHH 1C1WH 1DANH 1F2SE 1K28D 1J9CH 1D6RA 1QQ4A 2BX3A 1NRPH 3H5CB 2YMSC 1SB1H 2QF0A 3S0NA 1C5QA 2R2MB 1V2ST 1NN6A 1SLVB 2RCEA 1WQVH 2P3TB 2EI7A 1MTVA 2M2AA 3DUXH 2XOKD 2BY7X 1TGCA 3E16B 3LIWA 1GHYH 1O2OA 1O2GH 5FX6A 1T4UH 2ZO3H 3CP7A 3M61U 4ZAEA 2FOCA 2VINA 2BDCA 2K0QA 4XBDA 2OC7A 4BNRA 2PFEA 4A7IB 1GI6A 1HYLA 1QJ1B 1TALA 1WTGH 3KQBA 3UQOA 1ARCA 2H1UA 4INHA 1FZZA 3EGKH 1ZRKA 1AFQC 1DITH 3UY9A 3BEUA 1O3BA 1O2JA 5HM9A 1JIRA 1A0LA 2Q6GA 1A5GH 1O5GH 1ABJH 3OEED 4K1SA 2ZGXH 1C2KA 3KYFA 5DJ7A 2ALVA 2VGCB 2JIZD 3NWUA 4Q7XA 1P01A 5E0HA 3BTFE 3OE7D 1UVTH 1F0SA 1P3EA 1HPGA 2VWOA 3MYWA 3KIDU 1YWUA 4ISLA 1SFQB 1ZHMA 1F0UA 1GI7B 3JZ2B 1C2DA 1CBWB 1SVPA 4GCHG 1BBRH 4NGAH 3GDVA 1CT4E 1GG6B 1UMAH 4ABFA 3P92A 1GMDG 4XE4A 1V2KT 2A0QB 2KAIA 2GKVE 1DOJA 1C2GA 4WVPE 1V2TT 4MPVA 4X8TH 2J9NA 4I8GA 1BMLA 1LVOA 2TGDA 2SGEE 2HALA 1GI3A 1OS8A 1QL9A 2XNIA 1MZDA 2XYAA 4JZDH 2FESH 1GI9B 1ZOMA 4Z0KA 1QJ6B 4TYDA 2BXTH 1SQOA 3SNDA 1BBRK 4Y76A 4MPUA 4IC6A 3D62A 3K6YA 1GI5A 3TJNA 2AMQA 2XWAA 2FOHA 3K6ZA 1L1JA 3TLOA 1DFPA 1H8HD 2HGTH 3ZZ8A 1C2JA 2KCYA 4ABHA 5SGAE 1UVSH 1YYY1 1UO6A 3PO1B 1PQAA 3GISB 3V12A 1O31A 3QTVH 3URCA 3VXEH 3KN2A 3FN8A 2BMGB 2C93B 1O38A 1TBRH 1BB0B 1QRZA 1V6DA 3RXMA 1EPTC 3AW0A 1OPHB 2LP6A 3SNCA 1PYTD 1QL7A 2GCHG 4XRNA 3NPSA 3C1KA 1O2QA 1QBOA 3RU4D 2PSYA 1Y5BT 5CHAC 1FNIA 1KLJH 2Y5GA 1LVBA 2PLXA 1UCYH 3F0OA 2JH6D 1C2HA 3MO6A 3EA8A 1NRRH 2F9UA 3LGWA 1GMHG 4AG2A 3RU4T 3Q76A 4LK4A 5J4QA 4KP0A 1AY6H 2HNTC 5CE1A 1CSOE 3QUMP 2SNVA 1UW7A 4ZUHA 1HAYB 1MMJN 1SGNE 1ZSLA 5DP4A 3RMMH 4H6TA 4ZHLU 2GGVB 3RXSA 3FP7E 3A7VA 3BN9A 1Y3YA 1AZ8A 4TPIZ 5LGOA 5EIYA 1AFEH 1F5RA 1BHXF 2FYRA 1PQ5A 1GJ8B 1C5ZB 3MFJA 1YPGH 2WPJS 3NZIA 3H7TA 1FV9A 1GBTA 1TLDA 2FOBA 2BOHB 1VKYA 4Q4LA 3TNTA 2WUBA 1QB6A 1YPEH 3V13A 4IC5A 1C5TA 4DOQA 4BAOB 4NZLA 5EQQA 1K1LA 1GBLA 2WINI 5GNDA 2OBOA 3E3TA 2ZC9H 4AFUA 4LOYH 4F49A 1A61H 2CF9H 3A86A 3A88A 3BG8A 1G37A 2AEIH 3H09A 1NBME 3F68H 1BUIA 1CO7E 1THRH 2XNDD 2PUXB 3SYJA 1YLDA 1NRSH 3BTDE 5C2ZA 3SN8A 1AKSA 1EKBB 1QQUA 2FI3E 3M3SA 4X8UH 4DIHH 3UR9A 2ZHWH 4KTSA 4OS2A 1TGNA 1DUEA 1L1NA 4H42U 2R0KA 3CENA 2F3CE 2Z6BD 1VCPA 1H1BA 4BAKB 5C1XA 1X7AC 5HM2A 1HAHH 1GWAA 2XRCA 4JZFH 1Z8IB 4XSKU 1DY8A 1TMUH 1HAGE 1MQ6A 2BQWB 3F1SB 5F8ZA 1C1SA 3E0PB 2P94A 1LKAA 1NM6A 3PMBB 3ZZCA 5AFYH 4JYTA 4DJZB 2BX4A 1WYKA 2A2XH 1Z1IA 2ZHQH 2ASUB 1BTXA 1O5BB 2FMJA 1GHWH 2UUFB 4M7GA 4SGAE 3LGTA 1O32A 3TVJB 3AK5A 2LNCA 3D65E 4JZEH 1GG6C 3N7OA 2WYJA 2BQ6B 2A32A 2VH6A 2FIRH 4TY6A 1TNGA 4U30A 4FUBA 1JWTA 1OP0A 1FN8A 3C27B 7ESTE 3ZZBA 1INCA 1H9IE 3RXOA 3TIUA 4FETA 2P93A 1W2KH 3AAUA 2YNAA 3BTME 3A85A 3A7XA 3TJOA 4JYUH 3UWJH 1G3EA 4AG1A 1TPAE 5IDKA 1W12U 1GHXH 1LO6A 1YPHE 5TCAA 3F9GA 2HWLB 3M7UA 3LGYA 2LELA 1QIXB 1RXPA 2EEKA 1C1UH 2WHXA 3SNEA 1RTKA 1MAYA 3TJVA 2PKAA 2VU8E 2SGAA 4DT4A 5DP6A 2ZPQA 4ESTE 4KGAA 1MAXA 2A4QA 1TRNA 1N1LA 2C90B 2VIQA 3KF2A 4Q2KA 4TY7A 3ATKA 1QHRB 4AGJA 3F9FA 4UD9H 2G4TA 1WDIA 3N7DA 1ZHPA 2F9VA 3F2HA 3RXKA 3RXCA 4Q7ZA 1K1NA 2GZ8A 1V3XA 1O2SA 1SGQE 3URDA 4F4OC 2PV9B 1DLEA 1NFUA 1L4DA 1UTMA 3BIUH 2KAIB 1AZZA 3QZRA 1C5XB 3UNSA 1BTYA 2ZGJA 1EP5A 1BMFD 1QJ7B 5JBBS 1T4VH 4ABJA 1S81A 2TGTA 5DP7A 5EQSA 4X6PA 1NFXA 3Q00A 5FBEA 3K2UA 2R3UA 2GJGA 1FQ3A 3GY6A 5EODA 4WMDA 2PW8H 1NBMD 3ODFA 1FY5A 5EOKA 4D7GA 2ZCLP 3ATIA 1K9OE 2HNTF 4OGYA 1K22H 1W0ZU 2ZFFH 1SGDE 4X8VH 3KNXA 1RIWB 1TWXB 1Z6EA 1BOQA 2NWNA 4X1QU 3SJOA 1MH0A 4A1VA 1GJ9B 2J5UA 5DPAA 1SG8B 1O2HA 2BLQA 2G4UA 1UK4A 3ODDA 4FUGA 1A5IA 4Y6DA 1O5CB 3PWBA 1ELAA 1EOJA 3VB3A 1C2IA 1SPJA 4GHQA 4MG3A 3P8GA 1ZHRA 3UWIA 2ANKH 4CBNA 1WTHD 1HAVA 1LQEA 1PPFE 5DP5A 3T62A 1P04A 1BHXB 2IN2A 4CHAB 1EJMA 1H8IH 1C5VA 1B7XB 3PRDA 2Y82A 4A92A 4YOIA 3RXJA 2ZFPH 3W94A 2UWOA 2ZU4A 4AB8A 1A0JA 1AE8H 1QB9A 2DE8A 4MNYA 5T6GA 3T2NA 2IOTA 2XC5A 2XC0A 4I32A 3TH2H 4NIWA 5DO4H 2OC0A 1MZAA 1GDNA 1UK3A 4UFDH 1OWHA 4Y7BA 1G3CA 1NO9H 3FP6E 2ODPA 1GBEA 5GIBA 5JYIA 2HPPH 1LHFH 1SGIB 4ASUD 1N6YA 3GCTF 3KQ5A 1VITF 3E1XB 3RMLH 3U8RH 1TOMH 4BAHB 2B9LA 1HAOH 1GDUA 3MU4A 1ZTKA 3A7WA 4HZHA 4AGKA 1MCTA 1C1PA 3D23A 5CHBA 4B1TA 1O2KA 2ZFSA 1TMBH 1ZJKA 3BTGE 1KDQA 1Q31A 2BD7A 2OCVB 2RA0A 4WY3A 3ELAH 1UTPA 1AKSB 2BDIA 2KX4A 4UDWH 2VIPA 1D3TB 3O8CA 2FOFA 4BAQB 3OTJE 3QWCH 3SOSA 3UOPA 2FTMA 2VJ1A 4FU7A 1ANDA 4YM9A 3TGJE 5L6NH 4IGDA 2ZU3A 1OYTH 2UWPA 1J16A 1BMNH 3M36A 2ODQA 4ABBA 2THFB 1GVLA 2UUKB 4RN6A 3ZVEA 8KME2 3M35A 2BTCE 4JCNA 1A7SA 1BBRE 1ARBA 2PWXA 1O3AA 1BT7A 1IHTH 1W14U 2VBCA 4HGCA 5FL7D 4AB9A 3EDXB 4QT8C 1EZUC 2BDBA 1SGYE 1ANEA 1J15A 1DS2E 3BTHE 5AHGH 2BZ6H 1BTWA 2QC2A 7KMEH 2GV6A 1OX1A 1KIGH 2V0BA 1O30A 2AMPA 1KLIH 1FXYA 1YPJH 5F8TA 2GT7A 1E37B 1MKWH 3QN7A 2W6ID 3F3BA 2QYIA 2RA3A 3A7YA 1C1VH 1EZQA 3HK6B 1ZYOA 4ZXYH 3DD2H 2ZDKA 1QTFA 2A7JA 1OWJA 1OXGA 1SGCA 3S7KB 2BVXH 4ZKOU 5FBIA 1EQ9A 5KGOA 1A1RA 4OS5A 6LPRA 2P8OB 1BRUP 2NU2E 1LVMA 5JBAS 2ESTE 3VXFH 4GPGA 3SJ8A 4HG6A 2ZPRA 4FUJA 3MH4A 1P05A 1MKWK 1P57B 2RG3A 3L33A 4WJG2 1PJPA 2PKAB 3QDZB 1AMHA 2B0FA 4YT6H 1VJ9U 1RIWC 3Q3KA 1RTLA 2WV4A 2K1QA 2C8XB 1P09A 1UCYE 1K1MA 1ZPCA 3H7OA 5HYOA 1C2LA 1DWBH 1SR5C 4J2YB 3A84A 4NA9H 3RXLA 1YP9A 3LJOA 1SGRE 1CQQA 3MQKC 2ZHEH 5AFZH 1TAWA 3E6PH 3SJ9A 2P3FH 1AVWA 1DICA 2L74A 1D3DB 2O9QA 1C4Y2 1WOFA 4CHAC 1DLKB 1QZ8A 4ZHMU 1A3BH 1XUKA 2ZA5A 4ACBA 1GCDA 5BPEA 3SJIA 1LVYA 4D9QA 3VFEA 1O2RA 1SMFE 2PSXA 3TK6A 3MU8A 1W10U 2VVVA 2W6JD 3ZVDA 4Y11E 3VG8A 3BIVH 2EQNA 3RU4E 3A8AA 2ZGHA 1AVGH 1AWFH 2G5VA 1ZSJA 1TQ7B 3SV9A 1O3PB 1E36B 1TPPA 1FONA 5EG4A 2GTBA 4Y8ZA 1EUFA 5A8YA 1Z8RA 1P02A 4X2WA 2FOEA 1ORFA 2O8MA 3SU6A 1CGJE 3E90B 3FZDA 4A1TA 5JB9S 3A89A 3T27A 3ZZ4A 4Y10E 5A0CA 3QX5H 5KEDA 3P8OA 4BAMB
chains in the Genus database with same CATH topology
2UWLA 1AN1E 3K9XB 1BMMH 3MNBA 2UUJB 2B7DH 2ILNA 3PWCA 4FUEA 1V2JT 2XBVA 1FY4A 1V2LT 3GYMA 4YOJA 2BLWA 1FY1A 1HAVB 1YC0A 2F9PA 3QO6A 5F6MA 1G2MA 1SQTA 1OWEA 3MNCA 3SGQE 3KCGH 4CR9A 4DW2U 2G8TA 1Y8TA 2YOLA 1O3KA 4Y79A 4O9VA 3T29A 2ZHDA 3SU3A 1ELFA 1L2EA 5DG6A 3U98H 1XKBC 1CGHA 2ZFQH 4NSYA 4FUHA 1UVPA 2CHAB 1G3DA 3M37A 1SGFA 5ESBA 4CREA 1S84A 3LONA 2TGPZ 1UTOA 2QCYA 1NU9A 4MTBA 1QFKH 4AFZA 1EXFA 1WAYB 2Z3EA 4D76A 1ESTA 2GP9B 1NRQH 1OOKB 1O3NA 4B74A 1SFIA 2ZTZA 1MTNB 2WPHS 3SO3A 4B2CA 1O2UA 2WPKS 1PPBH 1GBDA 1G36A 2BY6X 4GHTA 1GJDB 3UPEA 1D4PB 3SU5A 1DM4B 2ALPA 1VCWA 3ESTA 2P3UB 1J17T 2C4FH 2Z94A 3SU4A 1CHOF 1KDQB 1XKAC 2QAAA 2GMTB 1W3CA 1ESBA 1P2NA 2EA3A 4ISOA 1AGJA 3LC3A 4HFPB 5HXFA 1F0TA 1HJAC 1NROH 3A8BA 3O8DA 3U8TH 1TMTH 1C5YB 2BD9A 2NU0E 3GCTG 8GCHF 5C3NA 1BA8B 1A0HB 3PYHA 1AUTC 2P8OC 4UE7H 1QBVH 1D3QB 1PPCE 4I8KA 1BRCE 1Z8JB 1N6XA 1YPLH 1HGTH 1BRBE 3AW1A 2ZDMA 3RXRA 5J4SA 3FANA 5C5NA 5F8XA 1HXEH 4BTUB 3NUMA 1P0SH 1C1OA 2EC9H 2Z3DA 3GCOA 1MTSA 4CR5A 3RP2A 3ZVCA 2BVSH 1MTWA 1O2WA 2OD3B 1BTZA 4DY7B 1TNHA 3ZVGA 2PTCE 2LPRA 3A7ZA 2RDLA 3E91A 1F7ZA 2JETC 3TH3H 3LU9B 3EA9A 1JMOH 1C2EA 1UHBA 1DT2A 1TGTA 4H4FA 4K3JA 4D8NA 1C2FA 1NC6A 2Q1JA 1B0FA 1CA0B 2HRVA 1TGSZ 3QZQA 1ANBA 5GCHF 1VITH 6ESTA 7GCHG 3RXHA 1ETTH 1GVZA 5FXLA 2QA9E 2SGQE 1S5SA 4LXBH 3GY8A 3M7QA 3RXGA 4E7NA 1Y5UT 1HV7A 2ZDAH 1TE0A 3U1JB 1FPHH 1KXCA 1ZGIA 3MU1A 1C5WB 1MKXH 1ELTA 3LGIA 3EE0B 1L1GA 1GHBF 3SI4H 2C8WB 2Z9KA 2Y81A 3ITIA 1UCYK 1DVAH 3PLPA 3SNBA 4A5TS 1IQMA 1GHAF 3P6ZB 3RXVA 2J94A 4CBOA 1VZQH 4ABDA 5A8ZA 3SUEA 2AGIX 2R3YA 3SV2H 1ELGA 1E38B 2BY9X 1P03A 3RXDA 5G4BA 1V2QT 4IW4E 5AF9H 3T26A 1GHVH 2BLVA 3A81A 3KQCA 9ESTA 2XBYA 3KGPA 1SGEE 3MNSA 1A5HA 2R9PA 3U1IB 4NWLA 4OS6A 1LCYA 3QGJA 2A5IA 1C5SA 4XBBA 5JDUB 3BSQA 2H5DA 3MOCA 2FI5E 2WUCA 1K21H 1Y5AT 2CXVA 4IN2A 1RJXB 1T32A 5TCCA 1KXAA 2FDAA 2QY0B 1QCPA 2GZ7A 2GCTB 3F9HA 3RMOH 1O2XA 1W11U 4RKJB 1DDJA 1K1PA 3ZZ3A 1C1MA 3M3VA 2FP7B 2O8TA 4GUXA 1YGCH 4ISHH 2FX6A 2CHAC 4FUFA 5T6FA 3SI3H 3SW2B 4Z6AH 2ZF0H 1HRTH 4E7RG 2AGGX 3PLKA 3GOVB 1JOUB 1LHGH 5C67A 1TONA 1YLCA 1C1RA 1VGCB 1MTNC 2A5KA 2DE9A 1IQHA 1GMCG 4CRFA 4MPXA 3SORA 1UTJA 2FM2A 5JBTA 4I7YH 4DVAU 1HLTH 3LDXH 3STJA 1AVXA 1BITA 3MH7A 3MO3A 2GMTC 4XOJA 1MCVA 2FLBH 2HLCA 1XX9A 2FWWA 2VH0A 1YF4A 1C5LH 1SC8U 5FPTA 5DGJA 5JBCS 1MU6B 1CGIE 1GBMA 1GPZA 3P95A 2M5TA 1GBKA 1EP6A 3HGNA 2XBXA 1CE5A 2FLRH 1PYTC 3RC5A 5EW2H 1FMGA 5E8EH 3SU0A 1GJ6A 2AERH 3T25A 2ZCHP 4I8JA 1QA7A 2EI6A 2VIOA 4NZQA 3ZZ6A 4HI3A 4UFEH 5I46H 2ZG0H 4O3TA 1LPKB 3A7TA 1BRAA 1V2OT 3MWIU 3NK8A 5EW1H 1UVOA 1TYNA 1Z8GA 1FAKH 3S69A 2H9EH 2TIOA 4X1SU 4X0WU 3SQEE 1W8BH 1MBMA 2AYWA 3RM2H 5DKMA 4D9RA 4PROA 4ZKNU 1Y3UA 1AIXH 1CA0C 1SQAA 1P9UA 5K7RA 3MTYA 4XFQA 1DUAA 1GBCA 3KQEA 1P2IA 1DPOA 2NU4E 2Y5HA 5T6DA 2XXLA 1O2ZA 1ZGVA 1GI2A 1A4WH 3UUZA 2XCFA 4WWYA 1UK2A 2GV7A 2AS9A 2A4RA 1XM1A 2NU1E 1GVKB 1ID5H 2OBQA 1HFDA 5ABWA 1GBHA 3GCHC 2ZIQH 5DK1A 1ACBE 1B5GH 3M5OA 3LKWA 1AUJA 1PQ7A 2Y80A 2XW9A 3OX7U 4CRGA 1HAXB 4OS7A 2GD4B 3TK9A 1TNKA 1NFWA 3GY5A 1TBZH 3M5LA 4I8LA 4AYVB 2OUAA 2A1DB 1C4U2 1QNJA 4UFFH 1EAWA 4LZ4B 1O3IA 1DXWA 1GBBA 1P12E 1Y3WA 1TNJA 5FHTA 1UHBB 3M3TA 1IQNA 1M9UA 4NG9H 4GLYA 1EX3A 1QB1A 1ZPZA 2J38A 1AHTH 3PMJA 3QLPH 1PFXC 2TBSA 1C1QA 1C9TA 1O3GA 3L3TA 4NA8A 3BTQE 1S6FA 2R2WU 3P17H 2TRMA 3SBKA 1S83A 3GY2A 1V2NT 4GAWA 2GCTC 1XUGA 4DG4A 1P10A 2O8LA 4ZHAA 1OWKA 3BTTE 5LPRA 1TA6A 5A09A 5E0GA 1O39A 4NFFA 1O2IA 3PMHB 1O5FH 1NFYA 1ELEE 4Y0ZE 4H6SB 3S7HB 1S6HA 2ZU5A 1DX5M 1O3FA 1OP2A 1ZSKA 3DFLA 4JK5A 4A1XA 2XCNA 2BB4A 2ZWLH 4GCHF 2H9HA 1VGCC 5DP9A 5EGMA 1B0EA 1GMDF 4X6NA 4ABAA 1G2LA 2CGAA 1FIZA 4K60A 3ENSB 3STIA 4K5ZA 1BTHH 3UOUA 2ZP0H 1JXPA 1ABIH 2FZZA 3A80A 1TX7A 1P2JA 1GHAG 4X6MA 1O0DH 1HJ8A 4MVNA 1FPCH 1ZTLA 4MQAA 1BZXE 4JYVH 1SI5H 3SV8A 4K2YA 3V0XA 8LPRA 1V2WT 5A8XA 2C3SA 2BDAA 4IN1A 3G01A 5BRRE 5EU8A 4X1NU 1XXFA 1G32B 2BXUH 1NS3A 1P2QA 4FUCA 4INKA 3TGKE 1LPGB 4TWYA 1T8LA 1TA2A 5HGGA 5LPEA 1QY6A 5C5OA 2HNTE 1NZQH 1ETRH 3B23B 3SZNA 1V2UT 5C1YA 4CRBA 3HKJB 3RMNH 2W5EA 2CJIA 4O97A 4AN7A 2PR3A 3RXBA 4ABGA 4AFSA 2HVXA 1C5OH 2BYAX 2ODYB 4X1PU 1QL8A 3ZV8A 2GCHF 3BEFB 1BIOA 1KTTB 1E35B 1VCQA 2C8YB 1DSUA 1SHHB 1BMAA 3MH6A 2Q6DA 1QA0A 2A7HA 5EXMA 1G30B 1GBJA 3GICB 1PPGE 1GMHF 2STAE 4RSPA 3VGCB 2VVUA 1EATA 1NRNH 1O2VA 4FVBA 1AB9C 4TPYA 3GCNA 2BLOA 1F0RA 2B8OH 2ZEBA 1QBNA 2FEQH 1HJAB 1PPEE 5E2PA 2PTNA 2D8WA 3E8LA 1G9IE 2FS8A 3A83A 4GSOA 1E0FD 1HCGA 2G00A 3I77A 1QRXA 1C4V2 2ZDNA 1EAXA 1XVMA 2DUCA 4X2YA 4YZUA 1OP8A 1VR1H 4ABIA 3I29A 3RXUA 5EPNA 3HKIB 3ZYDA 2A2QH 1FN6A 2OP9A 1WUNH 4VGCC 3UNRA 4MNVA 2SGPE 3GYLB 1NESE 2H6MA 1C5RA 1ETSH 1FUJA 5JPMH 2P59A 1EOLA 1KSNA 1A46H 1IQGA 2JETB 1ESAA 4GVUA 2FOGA 4YTAA 2Z9JA 4WH6A 5ESTE 3PTBA 4O3UA 5TJXA 5A2MH 2BY8X 4MPWA 4NFEA 1HXFH 4B2BA 2HPQH 3HK3B 1SOZA 5L2YH 2BHGA 1T7CA 2IPHA 5H4IB 5PTPA 2ZCKP 3PM3A 1NY22 4UFGH 2I6SA 3GDSA 3RC6A 3PMAB 1O35A 1P9SA 2W7SA 1CT2E 1MD8A 2C8ZB 6CHAB 4X8SH 4MNXA 1NU7B 4AYYB 3SUGA 3W95A 4JMYA 2FPZA 4R8TB 5E0JA 3LPRA 3TK5A 4E06H 2A31A 2ZGCA 1IQFA 2F9BH 3UNQA 2BD2A 3CS7A 1GL0E 3HATH 1OWIA 4MLFB 4ZXXH 4YT7H 1QGFA 1W7XH 1DY9A 2Y5FA 2B5TB 4NIXA 1TPSA 1LTOA 2V6NA 4BXSA 2VIDA 1CT0E 1SGTA 1RD3B 4Y8XA 3VB5A 1Z7KA 4BOHA 1YCPM 1IHSH 3QGNB 4Y0YE 5GWZA 4HTCH 4K8YA 3Q3YA 4D7FA 1OYQA 2QGRA 1TGBA 4B73A 1P2OA 3GY3A 1C1TA 1D6WA 1MTUA 3HGPA 3MU0A 1FLEE 2TGAA 4IS5A 3SGBE 1LQDB 2QF3A 3M5MA 1NTPA 3F9EA 5GJ4B 1P8VC 2A4OA 1AD8H 2GDDA 1XUJA 1ZJDA 2ZGBH 2ZTYA 2BD8A 2XWBI 3AAVA 1Q2WA 1CU1A 1GGDB 1FIWA 2SGDE 1C5NH 4MDSA 4X2XA 1GJ5H 4FXGH 3S9BA 3FAOA 1EZXC 5AVDA 3BG4C 1GI1A 4J1YA 3ZVAA 1N8OB 1S0RA 4JZ1A 3VPKA 3VGCC 1S82A 1ZTJA 1QRWA 3MMGA 1O2PA 3RLWH 1HJ9A 4LZ1H 3RXIA 2SNWA 1HIAA 4DURA 3RC4A 3TITA 2UUYA 3SJKA 3SNAA 4AOQA 1VITG 2JKHA 1GDQA 2D26C 3SHAH 4BANB 4B75A 2AIPA 1WCZA 2P16A 1SL3A 3RLYH 4K1EA 1XUHA 2BM2A 1ZZZA 1T8OA 3A8CA 2J34A 3MO9A 1C2MA 1ZMNA 2FX4A 1Z6JH 1UVUH 5C20A 1CVWH 2XTTB 1O3CA 1LKBA 4K69A 3RXFA 2JH0D 1HB0B 3M7TA 3MU5A 3OU0A 2XBWA 3T28A 2ZFTA 3RXQA 3ZZ9A 1GJAB 4JK6A 1W13U 2VB0A 4NWKA 1TX8A 3TH4H 1EB1H 1V2PT 1IOEA 1G3BA 3EYDA 2AGEX 3I78A 2QN5T 5JB8S 1MBQA 4THNH 1P2MA 1LDTT 2ZTXA 2Z3CA 1K1IA 1TRYA 3HPTB 1ZLRA 4IBLH 2G55A 2WYGA 1IAUA 2A45B 1FAXA 5EXLA 3VB6A 1BDAA 1O3MA 1IQLA 1GJ7B 3B8JA 1LHDH 2R0LA 2FI4E 3GCHB 4OS4A 6GCHF 1WSSH 3LH3A 2ZI2H 1FY3A 2STBE 2BDHA 6CHAC 1SOTA 1HAPH 3BV9B 3UQVA 3Q3XA 2W26A 1VJAU 2Q6FA 3T5FH 3SU1A 1H8DH 3RDZA 2J2UA 1O5AB 1SGPE 1W7GH 1T8MA 4WH8A 2G5NA 1YKTA 1KXEA 3SU2A 1TOCB 5E2OA 3DT0H 3U8OH 3P8NA 1RTFB 1THSH 1MKXK 1J8AA 3UIRA 2G52A 4DGJA 2VWLA 1ANCA 3PROA 1RRKA 4X6OA 3LGUA 1Z1JA 2W3KA 1JIMA 1HAZB 2A5AA 4A6LA 5LH8A 4OGXA 2ZKSA 1T31A 2ANWA 4FU9A 3R3GB 1KYNA 1WU1A 1IQIA 1TRMA 1H9LB 2G51A 3U69H 1GCTB 1QURH 3ATLA 2FOAA 4DCDA 5DP3A 1KLTA 1BTUA 2EI8A 2FO9A 1LHEH 2XC4A 4SGBE 1F92A 2VWNA 3TU7H 2BOKA 3WY8A 1O3LA 1DXPA 1H4WA 1TB6H 3ZYEA 3RXEA 2CMYA 5EQRA 5FPYA 2BVRH 3LOXA 1AE5A 1O33A 1L4ZA 1YPMH 4ISIH 2ZU1A 3FVFB 3F6UH 3KHVA 3GDUA 2AH4X 3LT3A 1O3JA 2JH5D 1GGDC 1BJUA 1O5DH 1C9PA 1J14A 3ZZAA 4WF8A 2FTLE 2ZNKH 1HAIH 2VWMA 3BTWE 3BTEE 2VGCC 4O03A 8ESTE 1N8OC 5CMXH 1ZRBA 1YCPH 3ATMA 1XUIA 3K65B 1RS0A 1Q3XA 4R0IA 4X2VA 4YLUA 3DHKH 4B71A 5A0BA 3NKKA 1ELDE 1LHCH 2VVCA 1V2RT 4AX9H 4KELA 4UONA 2OQ5A 1MU8B 3UR6A 1KY9A 4ZKSU 4CH2B 1EASA 1BCUH 1CBWC 3IG6B 2H9TH 3B9FH 3TPIZ 1FY8E 2V3HH 2ZQ1A 1Y3VA 1EAUA 3D49H 1P06A 2P95A 1QR3E 2YNBA 3ATWA 1GI0A 4KTUA 4BTIB 2ZZUH 1YCPK 1DWDH 4U2WA 1LMWB 3SUDA 4AZ2B 1A3EH 1SLXB 4U32A 1O37A 2A7CA 4RKOB 1MD7A 2G81E 3NXPA 3E0NB 5T3HA 5L2ZH 3VB4A 2PGQB 1PQ8A 4OS1A 1O2LA 1AQ7A 2WV5A 2Z9IA 4BTTB 1T8NA 2OINA 2QIQA 2BDYA 1P2KA 3MNXA 1WBGB 4MNWA 2SFAA 1NT1A 3BEIB 3LJJA 4Y7AA 3PO1C 1ZPBA 1O2YA 2V35A 1AO5A 2ZPSA 1TFXA 1F5LA 3A87A 3OY6U 4I33A 4WMEA 2D2DA 1GI4A 1AB9B 1EPTA 4FUIA 5DP8A 3RM0H 1K2I1 2GDEH 2IJOB 1HIAB 1AWHB 2ZECA 3VEQB 1P11E 1DE7H 1LPZB 2I6QA 1EJNA 1YPKH 4FU8A 1O3HA