3SZNA

Crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester sg75
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Crystal structures of SARS-Cov main protease complexed with a series of unsaturated esters
rcsb
source organism Sars coronavirus
total genus 87
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sznA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sznA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sznA02
6GCHF 4MDSA 4RKOB 1K1MA 3M5OA 1YPLH 1BTPA 1P2JA 2D2DA 2CHAC 2BB4A 3URCA 2BY7X 4B1TA 2A2XH 3A7ZA 1UTLM 1QHRB 2GV7A 3SJ8A 5JBCS 2P3FH 5DJ7A 3OX7U 5GCHF 1GJ6A 5DO4H 1SBWA 3RMMH 2FTMA 1TBQH 1TPPA 1O2KA 1T8LA 4XBBA 3SNAA 1SVPA 1GI1A 4FU7A 1GHBF 1TMBH 2C93B 4CR9A 1DLEA 3H7OA 1ZRBA 3S0NA 1DFPA 5C3NA 1C2KA 4K1EA 1O32A 2QV1A 2VWLA 3E0PB 1FJSA 4E7NA 1MQ6A 3SNCA 2BOHB 1K21H 3HKIB 1TYNA 1U6QA 1J14A 3TH4H 5C5OA 1NU9A 2ZDNA 2BY6X 1TWXB 1OYTH 3P95A 2ZFRH 2Q6GA 1SGEE 4FUFA 1MQ5A 2FTLE 5HGGA 4E06H 3FP6E 2Y7ZA 4Y7BA 1O36A 3EQ0H 1A3EH 1NRQH 2QCYA 2VWOA 2BVSH 3BTWE 3C27B 2GCTB 5AFYH 1AZZA 3ZVCA 4MPWA 4OS2A 2Z9KA 4WJG2 4K3JA 1PYTD 4K60A 5GCHG 1UTJA 2PKSC 1C5YB 1ESTA 3S7HB 5DP7A 3O8BA 4GAWA 2CN0H 1T7CA 1IAUA 2ZQ1A 2BDYA 3BEIB 3LGUA 1SGYE 1C1SA 4ISNA 1TAWA 3U8RH 1OWKA 1AUTC 2ZPRA 1BTWA 1LQDB 1J16A 4BAMB 3LC5A 1UVUH 2O8TA 2OQUA 3SV6A 1QBNA 1OWHA 5DP8A 2GZ8A 1XVOA 1WCZA 1E38B 2QC2A 4DGJA 1T8NA 1F0RA 5AHGH 1ZPBA 2P94A 1F5LA 2FX4A 3SV7A 1KTSB 3SGQE 7KMEH 4X1QU 4BTUB 1UK2A 2BD3A 2IJOB 3Q3KA 1QJ1B 5E0GA 3P8NA 3ZZAA 3SU2A 2ZDAH 2G81E 3MNBA 1EP5A 3U1JB 1HIAA 1ZJDA 2C8ZB 4ZAEA 1AVXA 1NFXA 2BD4A 1NROH 4JZDH 5FXLA 4CH2B 1QBVH 1FY5A 3DA9B 2ZFSA 1GDNA 3HKJB 3E90B 3E0NB 1S6FA 4MPUA 1EZQA 4B2CA 4AFZA 1A0JA 3C1KA 3S9BA 5A09A 1S82A 1C9PA 1FXYA 3LGTA 3UREA 1ETSH 1IQJA 1GBHA 1HJAB 1O2TA 5JB8S 3VB6A 2J94A 1UK4A 4GHQA 2C3SA 3E6PH 1B0FA 2XWBI 3KIDU 3BTEE 2ZU3A 3UNQA 1MD8A 1IQHA 1BTUA 1P3CA 2M5TA 5LPFA 1YP9A 2QYIA 1A46H 4FUBA 4KTCA 4X6NA 1DXPA 3NWUA 2BM2A 3DD2H 1JIRA 1DWBH 3CS0A 4CBOA 2TRMA 4INKA 3LT3A 2I6QA 4I31A 1YKTA 4FUHA 1VCPA 3GCTF 1Y5BT 1CT2E 3LGYA 3M7TA 4Y10E 4BTTB 1GG6C 4IMZA 4MQAA 1LHCH 3P70B 1MH0A 3W95A 2AMPA 1THRH 4Y79A 4DG4A 4TPYA 4JYVH 1BIOA 2FO9A 3B23B 1UTQA 1V2OT 2ZHDA 2GKVE 4TPIZ 3A81A 1O33A 2XBWA 2PUQH 2AGIX 2TGTA 2UUKB 2EA3A 2QF3A 2ZPSA 2VWMA 1A1RA 4TWWA 4WVPE 2FP7B 2I6SA 3F9GA 1P03A 1ELBA 3LGWA 2ZU4A 2Q6FA 3URDA 5T6GA 4NWKA 3SNEA 4I7YH 1QQ4A 1NESE 2Z6BD 4YO9A 5JBBS 3MYWA 1C1WH 3GCTG 3SV9A 3ATKA 1S5SA 1HYLA 1OWIA 5LGOA 1D3TB 1W2KH 1MBMA 2V0BA 3PO1C 1SLWB 1O35A 3SU3A 1AE5A 3RM0H 1HBTH 1F0SA 1JRSA 4A1TA 5IDKA 1M9UA 1EJMA 3GDVA 1XUJA 1UVPA 1PFXC 2OC8A 1H9IE 4Y11E 4DURA 8ESTE 2VINA 1SMFE 1INCA 2IOTA 3BF6H 3A7WA 1L1JA 5J4QA 4JMYA 4Q7XA 3TJVA 1HNEE 3A8CA 1FI8A 1CA0B 1C2FA 3LIWA 1C2DA 2BD9A 2ZFTA 4KELA 4ABGA 5L2ZH 2ILNA 1OWJA 1NC6A 1ZOMA 3RC6A 4TY6A 5C5NA 1P9UA 1RXPA 2A7HA 5E8EH 3VEQB 1PPHE 2ZKSA 2AGGX 2NU2E 3MFJA 2G5VA 4MNXA 2ZO3H 3JZ1B 1O3DA 3NKKA 1O3AA 4K5ZA 3SUGA 1LHGH 3TJOA 1P2QA 4ABJA 4HZHA 1ORFA 1P9SA 2ZHQH 3Q3YA 1Y3WA 1H9HE 5DKMA 3SJIA 1FAXA 1TFXA 1W11U 1G2LA 2G8TA 1VCQA 4Q2KA 2B0FA 1P11E 2VIQA 2Z9IA 1BTYA 1S0QA 1AE8H 2ZCKP 3BTME 4XBCA 2Z3DA 1Y5AT 2PSXA 1O2OA 1ZTLA 3NUMA 1IQKA 3PMHB 2VVCA 1TLDA 2AFQB 2HVXA 2WPMS 1QL7A 4INLA 1IHTH 1V2NT 2GX4A 2BY5X 2PSYA 1TGTA 1UCYE 2BD5A 2ZG0H 3QLPH 1LHDH 1VR1H 3KGPA 4DCDA 3SUDA 4BAHB 1C5MD 4NCYA 2DE8A 1PPEE 1EZXC 1ETRH 4UD9H 2A31A 4YT7H 4LZ1H 3ZZCA 1AFQB 2W26A 3LKWA 2DUCA 1TGSZ 1AB9B 3LC3A 3RXFA 1G3CA 2F9VA 2FXRA 3O8RA 3RMNH 1C1MA 2OTVA 1XUGA 3R3GB 2SGEE 2ANWA 1HAPH 3ZZ9A 2VIWA 2Q6DA 1GGDB 2J34A 3ZZ3A 2RG3A 5ESTE 2D26C 1D6WA 3S69A 4IC5A 2AYWA 3F1SB 1FV9A 1VGCB 4UE7H 4ZH8A 3WY8A 2HNTC 1SGQE 4XFQA 1W3CA 3TIUA 1TRNA 4A1XA 1OP8A 1G3BA 4WMFA 1JIMA 3R0FA 2QA9E 3SHAH 2B7DH 1CHOF 1ZRKA 1ZTKA 2C8XB 1V2WT 4Y7AA 1ZSKA 2AIPA 2Z3CA 4JK6A 1YCPK 4NA9H 3RXKA 4CRGA 2BLOA 1DM4B 1FIWA 1O3CA 1GVLA 1C5VA 3CS7A 2F91A 2OC0A 4X8UH 3H5CB 2H5CA 2TPIZ 1TOCB 3UR9A 2PHBA 1F0UA 5GDSH 4FU9A 1EZUC 1XM1A 4RN6A 1GBIA 1MAYA 3SI3H 1EZSC 4OS6A 3PYHA 1BBRK 1DY9A 2BX3A 2XCFA 1FDPA 3ENSB 1IQLA 1NPMA 2ANMH 1O3KA 3K6YA 4LZ4B 2AMDA 3BN9A 2VVVA 5HM9A 3PROA 4KGAA 1HDTH 4UFGH 1KYNA 1MTNB 3SV8A 4Y6DA 1XKBC 2NU3E 2VH6A 4X1SU 4JZ1A 1AI8H 1JBUH 1D6RA 3RXGA 1DWEH 3RLWH 5GXPA 5LPRA 3MTYA 1P2MA 1XUFA 1AO5A 1KY9A 3BTHE 4XDEA 2NU4E 2ODPA 1O2QA 3SUEA 2HLCA 1Y3VA 1O5DH 1RRKA 1AWFH 3KQEA 3U1IB 1ELTA 2FLRH 3H7TA 1GPZA 2Y5HA 1MTVA 3SGBE 1W12U 1TRMA 2A5IA 4UFFH 3RXCA 1SQTA 2WINI 1G9IE 2XW9A 5T6FA 4AFUA 4WH6A 1DSTA 3PMBB 7GCHF 5TCAA 3SBKA 1CU1A 3MWIU 5HM2A 4DY7B 1G30B 2ULLA 2GMTC 1MU8B 1AUJA 1MCTA 1THPB 3OSYA 4ABHA 5F8ZA 1W13U 1Z1JA 4UFDH 1LO6A 2BZ6H 1HAYB 2AIQA 2BQ7B 1O2IA 1K1IA 1LPKB 1BOQA 1C2JA 1P09A 1RTKA 4D9QA 1ABJH 2GZ9A 1GBKA 3KHVA 1NFWA 5DGJA 4K2YA 4UEHH 3BTFE 5F6MA 1HAXB 3BTGE 3M37A 1T31A 1EASA 2FDAA 3UNRA 1YF4A 1MMJN 3RM2H 4FVDA 1S83A 2GDEH 1GJ8B 4K8BA 1O3JA 2VIPA 4O3UA 4BAKB 2G4UA 2RA3A 3ZYEA 3TJNA 2FOCA 1L1NA 3UIRA 7GCHG 3STJA 1HXFH 2A7CA 3UOPA 3M5MA 1P2KA 1LDTT 3GOVB 5E0HA 3LU9B 1XX9A 3KCGH 4X2YA 1TA2A 3M5LA 3U8OH 4I32A 1FPHH 1PPBH 2EC9H 1JRTA 2SGPE 2V3OH 3TNSA 2JH0D 1OP0A 3DT0H 1SI5H 1C9TA 5FX5A 4Y0ZE 1YYY1 1BITA 1IQGA 2OC7A 1MAXA 2H9EH 1NS3A 1PPFE 2BDHA 2OLGA 1GBJA 3A88A 4Q7YA 1SQAA 2ANKH 3ZZ6A 5E0JA 1DWCH 4DT7B 1DOJA 1JXPA 1HV7A 3CP7A 2QIQA 2XC5A 4I8JA 4MNVA 4X6OA 2ZPQA 1EB1H 1DDJA 2ASUB 1O3GA 1GJ9B 2Q1JA 1GHWH 2XNIA 1EXFA 3S9CA 3PLBA 4B71A 3DFLA 1AGJA 5C67A 1J15A 1NFYA 1GMCF 2K1QA 2J38A 3ATIA 3LGIA 1O30A 1O5GH 2ODYB 5CMXH 5FAHA 1HJ8A 5EGMA 1TNKA 3MO9A 4NZLA 1QA0A 2VGCB 2PLXA 2BQ6B 2UUYA 1OPHB 4ABBA 1Z8RA 1DPOA 4IMQA 1O5BB 1PPZA 3E3TA 4R8TB 1IQNA 1C4U2 4JCNA 3T5FH 4XE4A 1EOLA 1RTLA 4OGYA 2IN2A 1ZHRA 2F9OA 2ZFPH 2GZ7A 1O2SA 1SLVB 2ZDVH 3BEFB 4YLQH 5JDUB 3ATWA 1XUKA 2OXSA 1GJAB 4A6LA 1QRXA 1W7XH 2ZQ2A 4HFPB 4AOQA 2Y7XA 4A7IB 1HGTH 2UUJB 3GY2A 1J9CH 1GMCG 4YTAA 1QL9A 2H2ZA 2BZAA 2QXIA 1P02A 5I46H 1RJXB 2Y6TA 1TPSA 1V2UT 1V2MT 5C20A 2FPZA 1EQ9A 1P8VC 4YOIA 3V13A 2WPHS 3OY6U 2R9PA 6GCHG 1XMNB 1F5RA 4AYVB 1DE7H 1W0ZU 5A0CA 1QQUA 1Z8IB 1HLTH 2UWPA 2BDBA 2CV3A 3FVFB 3ZVAA 5C2ZA 1C1RA 4JZEH 2Y5FA 2R2MB 2ZWLH 1AIXH 1SGNE 1K1PA 3UFAA 5K0HA 4U30A 3A86A 3SQEE 3U69H 5L6NH 2YOLA 3T28A 1XUHA 1O34A 1GHBG 2Z94A 5DP6A 3ELAH 2HALA 1Y59T 1LVBA 3SOSA 2HPQH 1UCYH 1YPHC 4JZFH 2ZA5A 4WWYA 4K8YA 4D8NA 1Z1IA 2F9PA 1ZSLA 4BAOB 5LPEA 2THFB 5E2PA 2BDCA 1BHXF 1E0FD 1VITH 1GBLA 1SFQB 1NY22 2PTCE 1TB6H 1WOFA 3TGKE 3TITA 3QTVH 2NU0E 2XXLA 1O2JA 2FOFA 1TPOA 1GI7B 3KQDA 2PGBB 3M61U 3BEUA 1BRAA 1C5LH 1PYTC 2A4GA 1GHAF 2Y81A 3MU1A 1BRCE 4U2WA 1OP2A 4AFQA 3SORA 2XYAA 1HIAB 3UUZA 3AW0A 1F0TA 2PR3A 4IN2A 3QWCH 2JKHA 1JWTA 1C2LA 1MKXH 1W10U 4NIVA 2H5DA 1CBWC 1ZPZA 2FM2A 1BB0B 4B73A 3SN8A 2D8WA 2FI3E 3RMLH 1DICA 2ZP0H 1UVOA 3NK8A 2GV6A 4ZROA 4MLFB 1GJDB 2PTNA 3MOCA 3W94A 1DSUA 3PTBA 2TGAA 2A5KA 3EDXB 1ACBE 5LH8A 4H6SB 3L3TA 1MTSA 1DY8A 1O31A 3LJJA 3ZZ5A 2YNBA 1C5NH 5EXNA 2A4OA 5JBAS 3QTOH 1S84A 4KKDA 1C1QA 4NWLA 1K1NA 1P57B 4FUJA 4JYTA 1DT2A 1N6YA 5C1XA 2PKAB 1HPGA 1O2VA 3RDZA 2A4QA 2Z9LA 1GBTA 2WV5A 2PKAA 2ZGBH 1GJ5H 1C5SA 2FEQH 1WQSA 1CA0C 1W0YH 4I33A 4YM9A 3PM3A 2SGAA 2BX4A 3SO3A 4WY3A 2ALPA 2ZEBA 3NCLA 1KXFA 3QDZB 4OS7A 9LPRA 1TQ7B 2ZHWH 5A0AE 4OGXA 1Y3YA 2CJIA 2FOAA 3Q76A 3RMOH 4RSPA 3GCOA 1ZHMA 3FZDA 5J4SA 3GISB 1FZZA 1GJ4H 3ATMA 1EPTC 1KTTB 3A8DA 3TNTA 3GDSA 6LPRA 1ZR0A 1O5AB 5HXFA 1SPJA 2AS9A 3PB1E 2PFEA 3RXHA 1SHHB 1GHXH 1V2KT 1MCVA 3GY4A 2J2UA 4D9RA 4MPXA 1BRUP 3A89A 1GI6A 2OC1A 1O5FH 3SZNA 1B7XB 2P8OB 4B74A 1BBRE 6CHAB 3MU4A 3G01A 1LVYA 5EXMA 4D76A 4CHAC 3SU4A 1TNLA 3TPIZ 1MTWA 1G3DA 1O5EH 1OWDA 3KEEA 1LKAA 4ZMAH 1G32B 1V2ST 3P8GA 2K7XA 5FX6A 4FXGH 1QFKH 2HNTF 1KLIH 3GY3A 4XOJA 4A1VA 2P3TB 1ZJKA 1GL0E 2RA0A 1GL1A 2VIOA 2O8UA 2BVRH 1GDUA 3E1XB 1DLKB 2DE9A 1FN8A 4X6MA 1AB9C 4CRCA 8GCHF 1P12E 3TH2H 4AX9H 1KLTA 1T8MA 2OINA 1V2VT 3I29A 4WXVA 5EG4A 1K1JA 1O2MA 1O0DH 1GGDC 2A0QB 1GJCB 2XCNA 3RXQA 1Q3XA 4AB9A 1C5WB 2B8OH 2O8MA 1VGCC 4FU8A 2ZZUH 1P0SH 3HK3B 3RLYH 3BTQE 3LPRA 4CBNA 1NO9H 2PW8H 3M35A 2J95A 3PV4A 3QUMP 3A87A 4GSOA 2BLQA 4XBDA 2A32A 1C5ZB 3S7KB 2ZDLA 1C5TA 1GG6B 3P8OA 2Z9GA 2G55A 3B8JA 4VGCB 1CA8B 2O8WA 3KNXA 4J1YA 2WYGA 1HAGE 3HK6B 1UTNA 5HYOA 1PJPA 3V0XA 1KXAA 3EA8A 2ZFFH 1SGFG 3MO6A 3PTNA 5ABWA 1GI8B 3TH3H 1H9LB 1P04A 4O9VA 8GCHG 1EOJA 2SNVA 1LHFH 4X1RU 1PQAA 2CXVA 3T27A 3CENA 1GHZA 3SJ9A 5B6OA 4GCHF 3KL6A 3MNSA 3SW2B 1V2LT 1D3DB 1ELDE 3K65B 2TGDA 5A8YA 1SGCA 3GDUA 1A5GH 1A5IA 3QZQA 3VPKA 1BQYA 1C2EA 2TBSA 3GYLB 1AN1E 1Y3XA 1SSXA 1DVAH 4AN7A 1BTHH 2C8YB 3M3VA 1XUIA 2AEIH 5F8XA 4AORA 3OU0A 2G5NA 3MH5A 2WUCA 1MTNC 5EXLA 5FPYA 2BLVA 3HPTB 2ZTYA 3ZZ7A 1JMOH 4NFEA 4MTBA 4QT8C 4X8VH 1O2UA 4CREA 1F2SE 1TGCA 2Y5GA 4PROA 2ZECA 4DW2U 1TNJA 2G4TA 1UVSH 2FOHA 1LQEA 1Y3UA 3IG6B 5SGAE 2G52A 3D49H 2Y80A 4CRDA 3LOXA 1GVZA 5DG6A 2F9NA 1T4VH 5E2OA 1SGPE 1BRBE 1V3XA 1HRTH 2LNCA 3B9FH 2KAIA 4AG2A 1QA7A 3FANA 3SJKA 5BPEA 2BXUH 4NG9H 3VGCB 1FNIA 1TALA 3BV9B 4UDWH 3RXRA 2PV9B 2XC0A 1YPJH 1GJBB 5FPTA 1NN6A 3SU5A 1YM0A 1HXEH 1BTXA 2OUAA 1IQEA 1G36A 1GVKB 5A8XA 4ZHLU 2XBXA 4Y8XA 4IW4E 2FX6A 2EI6A 3BIUH 4Q7ZA 2V6NA 1O3HA 4WMEA 1HAVB 3RXTA 1ARCA 3TK9A 1CVWH 3GCHB 9ESTA 1HAVA 1MKWK 2VNTA 3A7YA 3S9AA 1YCPM 4BAQB 3VXEH 2HRVA 3M36A 2GVFA 1XXDA 1YPKH 2CMYA 1DUAA 1O5CB 2BLWA 4UONA 4BOHA 4SGAE 3V3MA 1O2HA 2R0KA 4X2VA 1LVOA 1C5QA 1CHOG 1O3PB 4FUCA 3OY5U 2FI4E 5DP3A 4FUEA 5GPIB 3RXUA 2BD8A 4CRBA 1Y5UT 1X7AC 2OQ5A 3SGAE 1HUTH 3A83A 1O2GH 4X2WA 4A92A 1O3FA 1L4ZA 3U9AH 1TOMH 3ODFA 3A7TA 1C4V2 1KXCA 4NSVA 1KDQA 5L30H 4Y76A 2BDIA 2FOBA 1RTFB 3E8LA 1ANDA 2R3YA 1KXEA 1DX5M 1WQVH 1KXDA 1ZMNA 4ISOA 2OD3B 1L0ZA 1D4PB 4FUIA 3SHCH 5FBIA 1N8OB 2ANYA 2ZC9H 3O8CA 3RXDA 1GI9B 2G00A 3ODDA 3UR6A 5A0BA 4UFEH 2PWXA 1XKAC 1TQ0B 1GCDA 5EQRA 2FIRH 1GJ7B 5EPNA 2F9BH 1SHYA 3VB5A 2C8WB 3FP7E 2QXGA 4GLYA 3QZRA 2ZGXH 3A7VA 1OYQA 2OBOA 1GMDF 3T29A 2VJ1A 3RXSA 4A5TS 1DXWA 1RS0A 4TY7A 1XXFA 2ZGJA 1SOTA 2VGCC 4Q80A 3T2NA 1ID5H 2ZHFH 2JETB 5CE1A 1K28D 5IYTA 2A4RA 1P2OA 1BMAA 4ABFA 3MU0A 2W3IA 1PQ7A 3LH3A 2W5EA 4Z0KA 3EA9A 4I8LA 1Z8GA 1D3PB 4OS5A 3T26A 4YT6H 1VCWA 1LTOA 1B5GH 1V2TT 2FYQA 4Y0YE 1VJAU 3DHKH 2UWOA 3PLPA 1WV7H 1CQQA 5TJXA 1QNJA 4Z6AH 1O3LA 4Y71A 2V3HH 4AG1A 5AFZH 3UY9A 2C4FH 3EA7A 1VZQH 1EAUA 1A3BH 1WAYB 3SU0A 2A45B 5JYIA 3A8BA 4K1SA 1GCTB 1UTPA 1E37B 4NSYA 4ZXYH 2R0LA 3RP2A 1G3EA 1CHGA 2BD2A 1EKBB 1GI3A 1GMDG 2ZIQH 5FBEA 3BG4B 1ELCA 2P3UB 3TGIE 3F9FA 1W8BH 2UUFB 3V12A 2ZU5A 3SJOA 2D1JA 1NTPA 1XVMA 1FN6A 4F49A 1HAOH 2R3UA 4ISLA 1UJ1A 1IQMA 3VB3A 1SQOA 3RXPA 3BTKE 1F7ZA 4O03A 1FY3A 3PMAB 1QTFA 1TMTH 3RXAA 3TU7H 2PGQB 1MKXK 3RXBA 3VB4A 2GCTC 3V7TA 3EE0B 1BTZA 2FLBH 2G51A 1TX6A 2WPKS 2ZU1A 1ELEE 3A7XA 2VH0A 3RU4T 2O8LA 5PTPA 1CSOE 1IOEA 3LDXH 3AAUA 1EJNA 1BBRH 1QURH 3NPSA 3RXMA 4BTIB 3KN2A 4MPVA 4NZQA 1A2CH 3E91A 5EW1H 3GYMA 2QGRA 2STBE 2XBVA 1IQIA 1BMMH 4K69A 2OCVB 1BJVA 3UOUA 1KSNA 1OX1A 1QR3E 1IHSH 3QK1A 5T6DA 1K1OA 2GGVB 1YBWA 1FPCH 1PQ5A 1E34B 1C5PA 1YLCA 1C1VH 1NRRH 2WYJA 3FFGA 2O9QA 2FESH 3ZV9A 1QB1A 2BHGA 2EI7A 1OOKB 3A82A 1DUEA 4KTSA 1BA8B 3PWCA 1FY1A 3NZIA 1PPCE 3A85A 1BMNH 1BDAA 1CT4E 3MH6A 4Y8ZA 3MU5A 1ZTJA 4H42U 5CHAB 5DP5A 2ZTZA 2C90B 3RXIA 4M7GA 2QN5T 1SR5C 3M3TA 1T8OA 4X1PU 2XBYA 3DUXH 5EOKA 5FPSA 4KTUA 1V2JT 2NU1E 1ZLRA 4ZKSU 2A5AA 4TWYA 2ZHEH 4MVNA 1QRZA 2STAE 1EB2A 3MO3A 1NRNH 3PLKA 1GHYH 3BIVH 1MZAA 1TPAE 3K6ZA 5JB9S 1FAKH 1G37A 5JPMH 1UVTH 3ESTA 4D7GA 1S81A 2J4IA 4IGDA 1VJ9U 1HJAC 1RIWB 3GY6A 3TGJE 4ZKNU 1Q2WA 2GDDA 4BXWA 5DPAA 1SGTA 3GICB 3M7UA 3JZ2B 1O2ZA 1EATA 1Y8TA 3TK5A 1GBAA 3BTDE 1FIZA 2CGAA 4X8SH 1NM6A 1Z6JH 1TABE 3EGKH 1LPGB 3N7OA 4HI3A 1ZZZA 2FI5E 2W3KA 3IWMA 3MMGA 1SB1H 5FCRA 4OS1A 4NIYA 1BMLA 1BT7A 4ZHMU 1BCUH 1LPZB 1KXBA 1Z7KA 2BD7A 4LXBH 1EUFA 1AD8H 2WPIS 3BTTE 5GWZA 2CHAB 3MHWU 1ZGIA 5AF9H 4DIHH 5DK1A 1O3BA 4XSKU 1L4DA 1ELAA 2Z7FE 2BOKA 1AHTH 4ABIA 1AU8A 1GBDA 3K2UA 1LKBA 4O97A 1C5XB 4JZIA 5GJ4B 3GCNA 1N1LA 1ZSJA 1TGNA 1QIXB 2A2QH 1WTGH 1TIOA 3MH7A 1F5KU 1O2WA 1OKXA 2ESTE 3ITIA 4LOYH 2P8OC 1ARBA 1YC0A 1ZHPA 1C2MA 4X0WU 4Y8YA 1QJ6B 4AYYB 6CHAC 1SLXB 1W14U 3LH1A 5C1UA 1CGHA 3OYPA 3F68H 1SGRE 3SQHE 2BYAX 3FZZA 3L33A 1PQ8A 1DANH 1ESBA 2BY9X 2GD4B 1BZXE 1EAWA 1C2HA 2J9NA 5G4BA 3E16B 2FS8A 1GDQA 4WXIA 1CT0E 2P16A 4ZKOU 3ZVFA 1C1PA 2WPLS 2QAAA 5TCCA 2HNTE 1LVMA 1P01A 2FMJA 1GHAG 3KQBA 2VVUA 4ZHAA 2LPRA 2B9LA 4DOQA 2QY0B 4YLUA 1SFIA 1ESAA 1GI2A 5C1YA 5T3HA 3UNSA 1P2IA 1LHEH 3BG8A 1W7GH 3RXJA 2XTTB 2PKSB 2ZNKH 5EW2H 1TX7A 1ELGA 1C4Y2 1O3MA 2JH5D 3LONA 1BUIA 2FYRA 3F9EA 1J8AA 1AQ7A 1AMHA 1O2PA 3UPEA 5JBTA 3SNBA 4INHA 1O3EA 4F4OC 1QL8A 3ZZDA 3P17H 4U32A 1YPMH 4LK4A 1ETTH 4YZUA 3RU4E 1K2I1 1CE5A 4DJZB 5FHTA 3P6ZB 2Y82A 4VGCC 3QGNB 3QO6A 3M5NA 1PPGE 1V2PT 2V35A 2F3CE 1O3IA 1UHBB 6ESTA 1ANCA 3LGVA 3TJUA 4YOGA 1UHBA 4ABEA 5F8TA 4FVBA 3GY8A 3RXLA 5A2MH 2AH4X 1S85A 1WTHD 1YLDA 3SUFA 1O2XA 4CH8B 1O3OA 2SGDE 2VIVA 1KIGH 2OBQA 2ZGCA 1TGBA 2H9TH 2SFAA 2ZFQH 4CRFA 1AVGH 3EYDA 1WSSH 1C1TA 1CBWB 1HAHH 1AFQC 4JK5A 1V6DA 3BSQA 1FMGA 3M7QA 1C5OH 1O3NA 1MBQA 2W7UA 3Q3XA 3SNDA 1P3EA 3SU1A 2BXTH 3MU8A 1MD7A 4THNH 5GIBA 4AZ2B 1EJAA 4JYUH 1O2RA 1UMAH 1C2GA 1O2YA 3RC5A 2BDAA 1GI0A 4X1NU 4E05H 1GBCA 2AERH 3A84A 4X8TH 1C1NA 2QXJA 3AVZA 3AASA 3ZVDA 2A1DB 1SLUB 1AWHB 2ODQA 3UQOA 1UTKA 4H6TA 1MUEB 1YGCH 1WYKA 2BMGB 3KF2A 3PWBA 2XRCA 1S0RA 4O3TA 3UQVA 3TLOA 3D62A 4OS4A 3VGCC 2FOGA 3ATLA 4FUGA 2BQWB 3QX5H 5AVDA 4DVAU 1DS2E 2ZI2H 2P95A 1QCPA 1KLJH 2VIDA 4WMDA 1GI4A 3UWIA 2VU8E 2WV4A 2ZTXA 1EPTB 3T62A 1FY4A 1C1OA 1H8DH 4DIIH 1OS8A 4I8KA 1TNHA 2H9HA 7LPRA 3MH4A 1EPTA 3GCHC 4GUXA 5A8ZA 1YPEH 3TVJB 1D9IA 2LIZA 3HGNA 3UTUH 1A4WH 4ISIH 3ZVBA 1E35B 4B2AA 1TE0A 1BHXB 1EX3A 1O37A 3QN7A 2FOEA 1AZ8A 1HB0B 4R0IA 4CHAB 4CR5A 1HJ9A 1CGJE 1QGFA 1O38A 3KQCA 3TK6A 4X6PA 1G2MA 4IS5A 1Z8JB 2FWWA 3Q00A 3I77A 1A0LA 4GHTA 1WBGB 1UTMA 1A7SA 5HMAA 1TBZH 1EAXA 1FLEE 3PO1B 1P06A 3K9XB 2OP9A 5DP4A 4B76A 1B0EA 4WH8A 5F03A 4NA7A 1H1BA 1GHVH 2GTBA 1NU7B 2BY8X 7ESTE 1GBMA 4ZKRU 1AKSB 3FAOA 2ZDMA 2KAIB 4ABDA 1TNIA 3I78A 1AKSA 2EI8A 3VFEA 1ELFA 1CGIE 1H8IH 2GT7A 4RKJB 1BJUA 2Z9JA 1THSH 4SGBE 3QGJA 4GCHG 2FOMB 1FQ3A 1P10A 4AFSA 1SGDE 4AGKA 3LJOA 3U98H 4AGJA 2BTCE 3A8AA 1H4WA 3GY5A 3SV2H 1QY6A 1GBFA 1SGIB 1N8OC 2VWNA 2AGEX 3M3SA 3RXOA 2RDLA 1HAIH 1TMUH 1TA6A 3RU4D 4CRAA 2R2WU 1ELVA 3UWJH 1A61H 2TGPZ 8LPRA 1Q31A 3A80A 3PMJA 1SOZA 1O2LA 4HTCH 1ZMLA 1EP6A 3OTJE 1ZYOA 1MZDA 3STIA 3ZVEA 1EAIA 3MNXA 3GY7A 1ANBA 1DITH 2ZF0H 4KP0A 3IITA 4NIWA 2P59A 3L6PA 4MNWA 3T25A 3VXFH 2VB0A 1GI5A 1K9OE 1UK3A 3RC4A 2HWLB 2JETC 3D65E 1L1GA 5EU8A 1O39A 2SGFE 1A5HA 1DWDH 1ZPCA 2B5TB 1TRYA 2XWAA 5K7RA 1VITF 1P2NA 5L2YH 1Z71A 4IN1A 4B75A 1T4UH 2ALVA 2AMQA 5H4IB 3NXPA 1NRPH 2F9UA 3P92A 3F6UH 1OWEA 2WPJS 4MG3A 1ZMJA 1D3QB 4HGCA 1KDQB 1JOUB 1T32A 3U8TH 4BNRA 1CO7E 3EBNA 1HCGA 4GPGA 1GCTC 1AY6H 1GMHF 3HATH 1ABIH 2EEKA 4I8GA 3DFJA 3RXEA 1TNGA 1FY8E 5ESBA 3RUOA 2TIOA 1S6HA 2ZCHP 4NFFA 2SGQE 1SG8B 2GCHF 2UWLA 3BG4C 3Q77A 2IPHA 1MU6B 4NA8A 1C1UH 2HGTH 2H6MA 3ZZBA 4BXSA 2Z3EA 1AVWA 1FUJA 1AFEH 1NRSH 1TONA 4D7FA 1YPHE 2WUBA 1VITG 5FCKA 3D23A 3RXVA 1SGFA 1NT1A 4IBLH 2YNAA 2A7JA 4MNYA 2ZU2A 1OSSA 1QBOA 2PUXB 2QXHA 3AAVA 2F83A 1HFDA 1WUNH 4I8HA 1C5UA 1GMHG 1ZGVA 1C2IA 1J17T 5EQSA 4ESTE 1NFUA 4J2YB 2FZZA 1SL3A 2GCHG 2BDGA 3F9HA 1FONA 4TYDA 5ETXA 1HAZB 2HPPH 1RD3B 1L2EA 1YPGH 1K1LA 1UCYK 1SC8U 4E7RG 1TX8A 4BANB 3FP8E 1LMWB 2SNWA 1F92A 5CHAC 1NZQH 3ZZ8A 3EAJA 1WU1A 3P8FA 4GVUA 5DP9A 3O8DA 3MNCA 1GBBA 4H4FA 3MI4A 5EPYA 5BRRE 8KME2 2GP9B 1RGQA 1IQFA 2JH6D 1P05A 5EODA 3SU6A 1O2NA 1E36B 4ASHA 1YCPH 2J92A 1ANEA 4IC6A 1UO6A 1MTUA 4K1TA 2CF8H 4NIXA 2W7SA 3ZZ4A 2ZGHA 2QF0A 4U01A 1C5RA 2ZDKA 4ZUHA 4WF8A 2FS9A 3AW1A 1V2QT 2CF9H 5EQQA 4FUDA 3ZV8A 2HOBA 2FODA 2GMTB 1RIWC 1QJ7B 1A0HB 3ZYDA 1LCYA 1MKWH 1GBEA 2RCEA 2NWNA 1N6XA 4X2XA 4NGAH 3HGPA 4YESB 2ZCLP 1OXGA 1TBRH 3VB7A 4ISHH 4ABAA 1QB9A 2P93A 4AB8A 4B2BA 3SI4H 1V2RT 2H1UA 1GWAA 1K22H 1Z6EA 4YOJA 1UTOA 5I25A 4ZXXH 1QB6A 1RFNA 2BVXH 3ZVGA 2GT8A 1QRWA 2XC4A
chains in the Genus database with same CATH superfamily
6GCHF 4MDSA 2AHME 2J98B 4RKOB 1K1MA 3M5OA 1YPLH 1BTPA 1P2JA 2J98A 2D2DA 5HIYA 2CHAC 2BB4A 3URCA 2BY7X 4B1TA 2A2XH 3A7ZA 1UTLM 1QHRB 2GV7A 3SJ8A 5JBCS 2P3FH 5DJ7A 3OX7U 5GCHF 1GJ6A 5DO4H 1SBWA 3RMMH 2FTMA 1TBQH 1TPPA 1O2KA 1T8LA 4XBBA 3SNAA 1SVPA 1GI1A 4FU7A 1GHBF 1TMBH 2C93B 4CR9A 1DLEA 3H7OA 1ZRBA 3S0NA 1DFPA 5C3NA 2XNDD 1C2KA 4K1EA 1O32A 2QV1A 2VWLA 3E0PB 1FJSA 4E7NA 1MQ6A 3SNCA 2BOHB 1K21H 3HKIB 1TYNA 1U6QA 1J14A 3TH4H 5C5OA 1NU9A 2ZDNA 2BY6X 1TWXB 1OYTH 3P95A 2ZFRH 2Q6GA 1SGEE 4FUFA 1MQ5A 2FTLE 5HGGA 4E06H 3FP6E 2Y7ZA 4Y7BA 1O36A 3EQ0H 1A3EH 1NRQH 2QCYA 2VWOA 2BVSH 3BTWE 3C27B 2GCTB 5AFYH 1AZZA 3ZVCA 4MPWA 4OS2A 2Z9KA 4WJG2 4K3JA 1PYTD 4K60A 5GCHG 1UTJA 2PKSC 1C5YB 1ESTA 3S7HB 5DP7A 3O8BA 4GAWA 3EE7A 2CN0H 1T7CA 1IAUA 2ZQ1A 2BDYA 3BEIB 3LGUA 1SGYE 1C1SA 4ISNA 1TAWA 3U8RH 1OWKA 1AUTC 2ZPRA 1BTWA 1LQDB 1J16A 4BAMB 3LC5A 1UVUH 2O8TA 2OQUA 2EY4C 3SV6A 1QBNA 1OWHA 5DP8A 2GZ8A 1XVOA 1QZ8A 1WCZA 4RT1A 1E38B 2QC2A 4DGJA 1T8NA 1F0RA 5AHGH 1ZPBA 2P94A 1F5LA 2FX4A 3SV7A 1KTSB 3SGQE 7KMEH 4X1QU 4BTUB 1UK2A 2BD3A 2IJOB 3Q3KA 1QJ1B 5E0GA 3P8NA 3ZZAA 3SU2A 2ZDAH 2G81E 3MNBA 1EP5A 3U1JB 1HIAA 1ZJDA 2C8ZB 4ZAEA 1AVXA 1NFXA 2BD4A 1NROH 4JZDH 5FXLA 4CH2B 1QBVH 1FY5A 5C94A 3DA9B 2ZFSA 1GDNA 3HKJB 3E90B 3E0NB 1S6FA 4MPUA 1EZQA 4B2CA 4AFZA 1A0JA 3C1KA 3S9BA 5A09A 1S82A 1C9PA 5C17A 1FXYA 3LGTA 3UREA 1ETSH 1IQJA 1GBHA 1HJAB 1O2TA 5JB8S 3VB6A 2J94A 1UK4A 4GHQA 5FL7D 2C3SA 3E6PH 1B0FA 2XWBI 3KIDU 3BTEE 2ZU3A 3UNQA 1MD8A 1IQHA 1BTUA 1P3CA 2M5TA 5LPFA 1YP9A 2QYIA 1A46H 4FUBA 4KTCA 2K8IA 4X6NA 1DXPA 3NWUA 2BM2A 3DD2H 1JIRA 1DWBH 3CS0A 4CBOA 2TRMA 4INKA 3LT3A 2I6QA 4I31A 1YKTA 4FUHA 2L6OA 1VCPA 3GCTF 1Y5BT 1CT2E 3LGYA 3M7TA 4Y10E 4BTTB 1GG6C 4IMZA 4MQAA 1LHCH 3P70B 1MH0A 3W95A 2AMPA 1THRH 4Y79A 4DG4A 4TPYA 4JYVH 1BIOA 2FO9A 3B23B 1UTQA 1V2OT 2ZHDA 2GKVE 4TPIZ 3A81A 1O33A 2XBWA 2PUQH 2AGIX 2TGTA 2UUKB 2EA3A 2QF3A 2ZPSA 2VWMA 1A1RA 4TWWA 4WVPE 2FP7B 2I6SA 3F9GA 1P03A 1ELBA 3LGWA 2ZU4A 2Q6FA 3URDA 5T6GA 4NWKA 3SNEA 4I7YH 1QQ4A 3OEED 1NESE 2Z6BD 4ASUD 1MABB 4YO9A 5JBBS 3MYWA 1C1WH 3GCTG 3SV9A 3ATKA 1S5SA 1HYLA 1OWIA 5LGOA 1D3TB 1W2KH 1MBMA 2V0BA 3DSGA 3PO1C 1SLWB 1O35A 3SU3A 1AE5A 3RM0H 1HBTH 1F0SA 1JRSA 4A1TA 5IDKA 1M9UA 1EJMA 3GDVA 1XUJA 1UVPA 1PFXC 2OC8A 1H9IE 4Y11E 4DURA 8ESTE 2VINA 1SMFE 1INCA 2IOTA 3BF6H 3A7WA 3WW7A 1L1JA 5J4QA 4JMYA 4Q7XA 3TJVA 1HNEE 3A8CA 1FI8A 1CA0B 1C2FA 3LIWA 1C2DA 2BD9A 2ZFTA 4KELA 4ABGA 5L2ZH 2GJGA 2ILNA 3OEHD 1OWJA 1NC6A 1ZOMA 3RC6A 4TY6A 5C5NA 1P9UA 1RXPA 2A7HA 5E8EH 3VEQB 1PPHE 2ZKSA 2AGGX 2NU2E 3MFJA 2OK5A 2G5VA 4MNXA 2ZO3H 2JJ2D 3JZ1B 1O3DA 3NKKA 1O3AA 4K5ZA 3SUGA 1LHGH 3TJOA 1P2QA 4ABJA 1WDIA 4HZHA 1ORFA 2W6ID 1P9SA 2ZHQH 3Q3YA 1Y3WA 1H9HE 5DKMA 3SJIA 1FAXA 1TFXA 1W11U 1G2LA 2G8TA 1VCQA 3OTPA 5KGOA 4Q2KA 2B0FA 1P11E 2VIQA 5EIYA 2Z9IA 1BTYA 1S0QA 1AE8H 2ZCKP 3BTME 4XBCA 2Z3DA 1Y5AT 2PSXA 1O2OA 1ZTLA 3NUMA 1IQKA 3PMHB 2VVCA 1TLDA 2AFQB 2HVXA 2WPMS 1QL7A 1S6LA 1IHTH 2YMSD 4INLA 1V2NT 2GX4A 2BY5X 2PSYA 1TGTA 1UCYE 2BD5A 2ZG0H 3QLPH 1LHDH 1VR1H 3KGPA 4DCDA 3SUDA 4BAHB 1C5MD 4NCYA 2DE8A 1PPEE 1EZXC 1ETRH 4UD9H 2A31A 4YT7H 4LZ1H 3ZZCA 1AFQB 2W26A 2WPDD 3LKWA 2DUCA 2PP6A 1TGSZ 1AB9B 3LC3A 3RXFA 1G3CA 2F9VA 2FXRA 3O8RA 2KR7A 3RMNH 1C1MA 2OTVA 1XUGA 3R3GB 2SGEE 2ANWA 1HAPH 3ZZ9A 2VIWA 2Q6DA 1GGDB 2J34A 3ZZ3A 2RG3A 5ESTE 2D26C 1D6WA 3S69A 4IC5A 2AYWA 3F1SB 1FV9A 1VGCB 4UE7H 2WHXA 4ZH8A 3WY8A 2HNTC 1SGQE 4XFQA 1W3CA 2RDEA 3TIUA 1TRNA 4A1XA 1OP8A 1G3BA 3PRBA 4WMFA 1JIMA 3R0FA 2QA9E 3SHAH 2B7DH 1CHOF 1ZRKA 1ZTKA 2C8XB 1V2WT 4Y7AA 1ZSKA 2AIPA 2Z3CA 4JK6A 3FKSD 1YCPK 3PRDA 4NA9H 3RXKA 4DT4A 2J97A 4CRGA 2BLOA 1DM4B 1FIWA 1O3CA 1GVLA 1C5VA 3CS7A 2F91A 2OC0A 4X8UH 3H5CB 2H5CA 3PV2A 2TPIZ 2CK3D 1TOCB 3UR9A 2PHBA 1F0UA 5GDSH 4FU9A 1EZUC 1XM1A 4RN6A 1GBIA 1MAYA 3SI3H 1EZSC 4OS6A 3PYHA 1BBRK 1DY9A 2BX3A 2XCFA 1FDPA 3ENSB 1IQLA 1NPMA 2ANMH 1O3KA 3K6YA 4LZ4B 2AMDA 3BN9A 2VVVA 5HM9A 3PROA 4KGAA 1HDTH 1W0KD 4UFGH 1KYNA 3H09A 2KCAA 1MTNB 3SV8A 4Y6DA 1XKBC 2NU3E 2VH6A 4X1SU 4JZ1A 1AI8H 1JBUH 1D6RA 3RXGA 1DWEH 3RLWH 5GXPA 5LPRA 3MTYA 1P2MA 1XUFA 1AO5A 1KY9A 2YMSB 3BTHE 4XDEA 2NU4E 2ODPA 1O2QA 3SUEA 2HLCA 1Y3VA 1O5DH 1RRKA 1AWFH 3KQEA 3U1IB 1ELTA 2FLRH 3H7TA 1GPZA 2Y5HA 1MTVA 3SGBE 1W12U 1TRMA 2JJ1D 2A5IA 4UFFH 3RXCA 1SQTA 2WV9A 2WINI 1G9IE 2XW9A 5T6FA 4AFUA 4WH6A 1DSTA 3PMBB 7GCHF 5TCAA 3SBKA 1CU1A 3MWIU 5HM2A 4DY7B 1G30B 2ULLA 2GMTC 1YWUA 1MU8B 1AUJA 1MCTA 1THPB 3OSYA 4ABHA 5F8ZA 1W13U 1Z1JA 4UFDH 1LO6A 2BZ6H 4OM9A 1HAYB 2AIQA 2BQ7B 1O2IA 2M2AA 1K1IA 1LPKB 1BOQA 1C2JA 1P09A 1RTKA 4D9QA 1ABJH 2GZ9A 1GBKA 3KHVA 1NFWA 5DGJA 4K2YA 4UEHH 3BTFE 5F6MA 1HAXB 3BTGE 3M37A 1T31A 1EASA 2FDAA 3UNRA 1YF4A 1MMJN 3RM2H 4FVDA 1S83A 2GDEH 1GJ8B 4K8BA 1O3JA 2VIPA 4O3UA 4BAKB 2F4LA 2G4UA 2RA3A 3ZYEA 3TJNA 2FOCA 1L1NA 3UIRA 7GCHG 3STJA 1HXFH 2A7CA 3UOPA 3M5MA 1P2KA 5C0TA 1LDTT 3GOVB 5E0HA 3LU9B 1XX9A 3KCGH 4X2YA 1TA2A 3M5LA 3U8OH 4I32A 1FPHH 1PPBH 2EC9H 1JRTA 2SGPE 1SQRA 2V3OH 3TNSA 2JH0D 1OP0A 3DT0H 1SI5H 1C9TA 5FX5A 4Y0ZE 1YYY1 1BITA 1IQGA 2WZQA 2OC7A 3F3BA 1MAXA 2H9EH 1NS3A 1PPFE 2BDHA 2OLGA 1GBJA 3A88A 4Q7YA 1SQAA 2ANKH 3ZZ6A 5E0JA 1DWCH 4DT7B 1DOJA 1JXPA 1HV7A 3CP7A 2QIQA 2XC5A 4I8JA 4MNVA 4X6OA 2ZPQA 1EB1H 1DDJA 2ASUB 3DSOA 1O3GA 1GJ9B 2Q1JA 1GHWH 2XNIA 1EXFA 3S9CA 3PLBA 4B71A 3DFLA 1AGJA 5C67A 1J15A 1NFYA 2K0QA 1GMCF 4Q63A 2K1QA 2J38A 3ATIA 3LGIA 1O30A 1O5GH 2ODYB 5CMXH 5FAHA 1HJ8A 3FN8A 4YXWD 5EGMA 1TNKA 3MO9A 4NZLA 1QA0A 2VGCB 5CDFE 2PLXA 2BQ6B 2UUYA 1OPHB 4ABBA 1Z8RA 1DPOA 4IMQA 1O5BB 4M9FA 1PPZA 3E3TA 4R8TB 1IQNA 1C4U2 4JCNA 3T5FH 4XE4A 3KYFA 1EOLA 1RTLA 4OGYA 2IN2A 1ZHRA 2F9OA 2ZFPH 2GZ7A 1O2SA 1SLVB 2ZDVH 3BEFB 4YLQH 5JDUB 3ATWA 1XUKA 2KCYA 1GJAB 2OXSA 2XOKD 4A6LA 1QRXA 1W7XH 2ZQ2A 4HFPB 4AOQA 2Y7XA 4A7IB 1HGTH 2UUJB 3GY2A 1J9CH 1GMCG 4YTAA 1QL9A 2H2ZA 2BZAA 2QXIA 1P02A 5I46H 1RJXB 2Y6TA 1TPSA 1V2UT 1V2MT 5C20A 2FPZA 3PV5A 1EQ9A 4F55A 1P8VC 4YOIA 3V13A 2WPHS 3OY6U 2R9PA 6GCHG 1XMNB 1F5RA 4AYVB 1YLNA 1DE7H 1W0ZU 5A0CA 3SZEA 1QQUA 1Z8IB 1HLTH 2UWPA 2LELA 2BDBA 2CV3A 3FVFB 3ZVAA 5C2ZA 1C1RA 4JZEH 2Y5FA 2R2MB 2ZWLH 1AIXH 1SGNE 1K1PA 3UFAA 5K0HA 4U30A 3A86A 3SQEE 3U69H 5L6NH 2YOLA 3T28A 1XUHA 1O34A 1GHBG 2Z94A 5DP6A 3ELAH 2HALA 1Y59T 1LVBA 3SOSA 2HPQH 1UCYH 1YPHC 4JZFH 2ZA5A 4WWYA 4K8YA 4D8NA 1Z1IA 2F9PA 5CHBA 1ZSLA 4BAOB 5LPEA 2THFB 5E2PA 2BDCA 1BHXF 1E0FD 1VITH 1GBLA 1SFQB 1W0JD 1NY22 2PTCE 1TB6H 1WOFA 3TGKE 3TITA 2HVYB 3QTVH 2NU0E 2XXLA 1O2JA 2FOFA 1TPOA 1GI7B 3KQDA 2PGBB 3M61U 3BEUA 1BRAA 1C5LH 1PYTC 2A4GA 1GHAF 2Y81A 3MU1A 1BRCE 4U2WA 1OP2A 4AFQA 3SORA 2XYAA 1HIAB 3UUZA 3AW0A 1F0TA 2PR3A 4IN2A 3QWCH 2JKHA 1JWTA 1C2LA 1MKXH 1W10U 4NIVA 2H5DA 1CBWC 1ZPZA 2FM2A 1BB0B 4B73A 3SN8A 2D8WA 2FI3E 3RMLH 1DICA 2ZP0H 1UVOA 3NK8A 2GV6A 4ZROA 4MLFB 1GJDB 2PTNA 3MOCA 3W94A 1DSUA 3PTBA 2TGAA 2A5KA 3EDXB 1ACBE 5LH8A 4H6SB 3L3TA 1MTSA 1DY8A 1O31A 3LJJA 3ZZ5A 2YNBA 1C5NH 5EXNA 2A4OA 5JBAS 3QTOH 1S84A 4KKDA 1C1QA 4NWLA 5HKKD 1K1NA 1P57B 4FUJA 3F0OA 4JYTA 1DT2A 1N6YA 5C1XA 3SYJA 2PKAB 1HPGA 1O2VA 3RDZA 2A4QA 2Z9LA 1GBTA 2WV5A 2PKAA 2ZGBH 1GJ5H 1C5SA 2FEQH 1WQSA 1CA0C 1W0YH 4I33A 4YM9A 3PM3A 2SGAA 2BX4A 3SO3A 4WY3A 2ALPA 2ZEBA 3NCLA 1KXFA 3QDZB 4OS7A 9LPRA 1TQ7B 2ZHWH 4TSFD 5A0AE 4OGXA 1Y3YA 2CJIA 2FOAA 3Q76A 3RMOH 4RSPA 3GCOA 1ZHMA 3FZDA 5DSFA 3GISB 5J4SA 1FZZA 1GJ4H 3ATMA 1EPTC 1KTTB 3A8DA 3TNTA 3GDSA 6LPRA 1ZR0A 1O5AB 5HXFA 1SPJA 2J5UA 2AS9A 3PB1E 2PFEA 3RXHA 1SHHB 1GHXH 1V2KT 1MCVA 1H8ED 3GY4A 2J2UA 4D9RA 4MPXA 1BRUP 3A89A 1GI6A 2OC1A 1O5FH 3SZNA 1B7XB 2P8OB 4B74A 1BBRE 6CHAB 3MU4A 3FOAA 1LVYA 3G01A 5EXMA 4D76A 4CHAC 2WSSD 3SU4A 1TNLA 3TPIZ 1MTWA 2KFWA 1G3DA 1O5EH 1OWDA 3KEEA 1LKAA 2KCOA 4ZMAH 1G32B 1V2ST 3P8GA 2K7XA 5FX6A 4FXGH 1QFKH 2HNTF 1KLIH 3GY3A 4XOJA 4A1VA 2P3TB 1ZJKA 1GL0E 2RA0A 1GL1A 2VIOA 2O8UA 2BVRH 1GDUA 3E1XB 1DLKB 2DE9A 1FN8A 4X6MA 1AB9C 4CRCA 8GCHF 1P12E 3TH2H 4AX9H 1KLTA 1T8MA 2OINA 1V2VT 3I29A 4WXVA 5EG4A 1K1JA 1O2MA 3FO8D 1O0DH 1GGDC 2A0QB 1GJCB 2JIZD 2XCNA 3RXQA 1Q3XA 4AB9A 1C5WB 2B8OH 2O8MA 1VGCC 4FU8A 2ZZUH 1P0SH 3HK3B 3N7EA 3RLYH 3BTQE 3LPRA 4CBNA 3U28C 1NO9H 2PW8H 3M35A 2J95A 3PV4A 3QUMP 3A87A 4GSOA 2BLQA 4XBDA 2A32A 1C5ZB 3S7KB 2ZDLA 1C5TA 1GG6B 3P8OA 2Z9GA 2G55A 3B8JA 4VGCB 1CA8B 2O8WA 3KNXA 4J1YA 2WYGA 1HAGE 3HK6B 1UTNA 5HYOA 1PJPA 3V0XA 1KXAA 3EA8A 2ZFFH 1SGFG 3MO6A 3PTNA 5ABWA 1GI8B 3TH3H 1H9LB 1P04A 4O9VA 8GCHG 1EOJA 2SNVA 1LHFH 4X1RU 1PQAA 2CXVA 3T27A 3CENA 1GHZA 3UAIC 3SJ9A 5B6OA 4GCHF 3KL6A 3MNSA 3SW2B 1V2LT 1D3DB 1ELDE 3K65B 2TGDA 5A8YA 1SGCA 3GDUA 1A5GH 1A5IA 3QZQA 3VPKA 1BQYA 1C2EA 2TBSA 3GYLB 1AN1E 1Y3XA 1SSXA 1DVAH 4AN7A 1BTHH 2C8YB 3M3VA 1XUIA 2AEIH 5F8XA 4AORA 3OU0A 2G5NA 3MH5A 2WUCA 1MTNC 5EXLA 4Q4LA 5FPYA 2BLVA 3HPTB 2ZTYA 3ZZ7A 5EJZA 1JMOH 4NFEA 4MTBA 4QT8C 4X8VH 1O2UA 4CREA 1F2SE 1TGCA 2Y5GA 4PROA 2ZECA 4DW2U 1TNJA 2G4TA 1UVSH 2YMSC 2FOHA 1LQEA 1Y3UA 3IG6B 5SGAE 2G52A 3D49H 4HG6A 2Y80A 4CRDA 3LOXA 1GVZA 5DG6A 2F9NA 1T4VH 5E2OA 1SGPE 1BRBE 1V3XA 1HRTH 2LNCA 3B9FH 2KAIA 4AG2A 1QA7A 3FANA 3SJKA 5BPEA 2BXUH 4NG9H 1E1RD 1FNIA 1TALA 3BV9B 4UDWH 3RXRA 3VGCB 2PV9B 2XC0A 1YPJH 1GJBB 5FPTA 2HLDD 1NN6A 3SU5A 1YM0A 1HXEH 1BTXA 2OUAA 1IQEA 1G36A 1GVKB 5A8XA 4ZHLU 2XBXA 4Y8XA 4IW4E 2FX6A 2EI6A 3BIUH 4Q7ZA 2V6NA 1O3HA 4WMEA 1HAVB 3RXTA 1ARCA 3TK9A 1CVWH 3GCHB 9ESTA 1HAVA 1EFRD 1MKWK 2VNTA 3A7YA 3WWBA 3S9AA 4P02A 1YCPM 2V3MA 4BAQB 3VXEH 2HRVA 3M36A 2GVFA 1XXDA 1YPKH 2CMYA 1DUAA 1O5CB 2BLWA 4UONA 4BOHA 4SGAE 3V3MA 1O2HA 2R0KA 4X2VA 1LVOA 1C5QA 1CHOG 1O3PB 4FUCA 3OY5U 2FI4E 5DP3A 4FUEA 5GPIB 3RXUA 2BD8A 4CRBA 1Y5UT 1X7AC 2OQ5A 3SGAE 1HUTH 3A83A 1O2GH 3MQKC 4X2WA 4A92A 1O3FA 1L4ZA 3U9AH 1TOMH 3ODFA 3A7TA 1OHHD 1C4V2 1KXCA 4NSVA 1KDQA 5L30H 4Y76A 3W1EA 2BDIA 2FOBA 1RTFB 3E8LA 1ANDA 2R3YA 1KXEA 1BMFD 1DX5M 1WQVH 1KXDA 1ZMNA 4ISOA 2OD3B 1L0ZA 1D4PB 4TT3D 4FUIA 3SHCH 5FBIA 1N8OB 2ANYA 2ZC9H 3O8CA 3RXDA 1GI9B 2G00A 5DN6D 3ODDA 3UR6A 5A0BA 4UFEH 2PWXA 1XKAC 1TQ0B 1GCDA 5EQRA 2FIRH 1GJ7B 5EPNA 2F9BH 1SHYA 3VB5A 2C8WB 3FP7E 2QXGA 4GLYA 2F43B 3QZRA 2ZGXH 4B6EA 3A7VA 1OYQA 2OBOA 1GMDF 3T29A 1COWD 2VJ1A 3RXSA 4A5TS 1DXWA 1RS0A 4TY7A 1XXFA 2ZGJA 1SOTA 2VGCC 4Q80A 3T2NA 1ID5H 2ZHFH 2JETB 5GNDA 5CE1A 1K28D 5IYTA 2A4RA 1P2OA 1BMAA 4ABFA 3MU0A 2W3IA 1PQ7A 3LH3A 2W5EA 4Z0KA 3EA9A 4I8LA 1Z8GA 1D3PB 4OS5A 3T26A 4YT6H 1VCWA 1LTOA 1B5GH 1V2TT 2FYQA 4Y0YE 1VJAU 3DHKH 2UWOA 3PLPA 1WV7H 1CQQA 5TJXA 5EJ1A 1QNJA 4Z6AH 1O3LA 4Y71A 2V3HH 4AG1A 5AFZH 3UY9A 2C4FH 3EA7A 1VZQH 1EAUA 1A3BH 1WAYB 3KYGA 3SU0A 2A45B 5JYIA 3A8BA 4K1SA 1GCTB 1UTPA 1E37B 1FX0B 4NSYA 4ZXYH 2R0LA 3RP2A 1G3EA 1CHGA 5EJLA 2BD2A 1E1QD 1EKBB 1GI3A 1GMDG 2ZIQH 5FBEA 3BG4B 1ELCA 2P3UB 3TGIE 3F9FA 1W8BH 2UUFB 3V12A 2ZU5A 3SJOA 2D1JA 1NTPA 1XVMA 1FN6A 4F49A 1HAOH 2R3UA 4ISLA 4ZCNA 1UJ1A 1IQMA 3VB3A 1SQOA 3RXPA 3BTKE 1F7ZA 4O03A 1FY3A 3PMAB 1QTFA 1TMTH 3RXAA 3TU7H 2PGQB 1MKXK 3RXBA 3VB4A 2GCTC 3V7TA 3EE0B 4RT0A 1BTZA 2FLBH 2G51A 1TX6A 2WPKS 2ZU1A 1ELEE 3A7XA 2VH0A 3RU4T 2O8LA 5PTPA 1CSOE 1IOEA 4ACAA 3LDXH 3AAUA 1EJNA 1BBRH 1QURH 3NPSA 2RFKC 3RXMA 4BTIB 3KN2A 4MPVA 4NZQA 1A2CH 3E91A 5EW1H 3GYMA 2QGRA 2STBE 2XBVA 1IQIA 1BMMH 4K69A 2OCVB 1BJVA 3UOUA 1KSNA 1OX1A 1QR3E 1IHSH 3QK1A 5T6DA 1K1OA 2GGVB 2JDID 1YBWA 1FPCH 1PQ5A 1E34B 1C5PA 1YLCA 1C1VH 1NRRH 2WYJA 3FFGA 2O9QA 2FESH 2KZ4A 4RI0A 3ZV9A 1QB1A 2BHGA 2EI7A 1OOKB 3A82A 1DUEA 4KTSA 1BA8B 3PWCA 1FY1A 3NZIA 1PPCE 3A85A 1BMNH 1BDAA 1CT4E 3MH6A 4Y8ZA 3MU5A 1ZTJA 4H42U 5CHAB 5DP5A 3WWFA 2ZTZA 2C90B 3RXIA 4M7GA 2QN5T 1SR5C 3M3TA 1T8OA 2IJD1 4X1PU 2XBYA 3DUXH 5EOKA 5FPSA 4KTUA 1V2JT 5KEDA 2NU1E 1ZLRA 4ZKSU 2A5AA 4TWYA 2ZHEH 4MVNA 1QRZA 2STAE 1EB2A 3MO3A 1NRNH 3PLKA 1GHYH 3BIVH 1MZAA 1TPAE 4I86A 3K6ZA 5JB9S 1FAKH 1G37A 5JPMH 1UVTH 3ESTA 4D7GA 1S81A 2J4IA 4IGDA 1VJ9U 1HJAC 1RIWB 3GY6A 3TGJE 4ZKNU 1Q2WA 2GDDA 4BXWA 5DPAA 1SGTA 3GICB 3M7UA 3JZ2B 1O2ZA 1EATA 3CNRA 1Y8TA 3TK5A 1GBAA 3BTDE 1FIZA 2CGAA 4X8SH 1NM6A 1Z6JH 1TABE 3EGKH 1LPGB 3N7OA 4HI3A 1ZZZA 3N7DA 2FI5E 2W3KA 1K0HA 3IWMA 3MMGA 1SB1H 5FCRA 4OS1A 4NIYA 1BMLA 1BT7A 4ZHMU 1BCUH 1LPZB 4FETA 1KXBA 1Z7KA 2BD7A 4LXBH 1EUFA 1AD8H 2WPIS 3BTTE 5GWZA 2CHAB 3MHWU 1ZGIA 5AF9H 4DIHH 5DK1A 1O3BA 4XSKU 1L4DA 1ELAA 2Z7FE 2BOKA 1AHTH 3OE7D 1AU8A 4ABIA 1GBDA 3K2UA 1LKBA 4O97A 1C5XB 4JZIA 5GJ4B 3GCNA 1N1LA 1ZSJA 1TGNA 1QIXB 2A2QH 1WTGH 1TIOA 3MH7A 2QF5A 5KECA 1F5KU 1O2WA 4FOUC 1OKXA 2ESTE 3ITIA 4LOYH 2P8OC 1ARBA 1YC0A 1ZHPA 1C2MA 4X0WU 4Y8YA 1QJ6B 4AYYB 6CHAC 1SLXB 3OAAD 1E79D 1W14U 3LH1A 5C1UA 1CGHA 3F0PA 3OYPA 3F68H 1SGRE 3SQHE 2BYAX 3FZZA 4AC9A 3L33A 1PQ8A 1DANH 1ESBA 2BY9X 2GD4B 1BZXE 1EAWA 1C2HA 2J9NA 5G4BA 3E16B 2FS8A 1GDQA 4WXIA 1CT0E 2P16A 4ZKOU 3ZVFA 1C1PA 2WPLS 2QAAA 5TCCA 2HNTE 1LVMA 1P01A 2FMJA 1GHAG 3KQBA 2VVUA 4ZHAA 2LPRA 2B9LA 4DOQA 2QY0B 4YLUA 1SFIA 1ESAA 1GI2A 5C1YA 5T3HA 3UNSA 1P2IA 1LHEH 3BG8A 1W7GH 3RXJA 5C0UA 2XTTB 2PKSB 2ZNKH 5EW2H 1TX7A 1ELGA 1C4Y2 1O3MA 2JH5D 3LONA 1BUIA 2W6JD 2FYRA 2QE7D 3F9EA 1J8AA 1AQ7A 1AMHA 1O2PA 3UPEA 4F48B 5JBTA 3SNBA 4INHA 1O3EA 4F4OC 1QL8A 3ZZDA 3P17H 4U32A 1YPMH 2LP6A 4LK4A 1ETTH 4YZUA 3RU4E 1K2I1 1CE5A 5IK2D 4DJZB 5FHTA 3P6ZB 2Y82A 4VGCC 3QGNB 3QO6A 3M5NA 1PPGE 1V2PT 2V35A 2F3CE 1O3IA 1UHBB 6ESTA 1ANCA 3LGVA 3TJUA 4YOGA 1UHBA 3F2HA 5HIZA 4ABEA 5F8TA 4FVBA 3GY8A 3RXLA 5A2MH 2AH4X 1S85A 1WTHD 1YLDA 3SUFA 1O2XA 4CH8B 5T1VA 1O3OA 2SGDE 2VIVA 1KIGH 2OBQA 2ZGCA 1TGBA 2H9TH 2SFAA 2ZFQH 4CRFA 2KCPA 1AVGH 3EYDA 1WSSH 1C1TA 1CBWB 1HAHH 1AFQC 4JK5A 1V6DA 3BSQA 1VKYA 1FMGA 3M7QA 1C5OH 1O3NA 1MBQA 2W7UA 3Q3XA 3SNDA 1P3EA 3SU1A 2BXTH 3MU8A 1MD7A 3KQ5A 4THNH 5GIBA 4AZ2B 1EJAA 4JYUH 1O2RA 1UMAH 1C2GA 1O2YA 3RC5A 2BDAA 1GI0A 4X1NU 4E05H 1GBCA 2AERH 3A84A 4X8TH 1C1NA 2QXJA 3AVZA 3AASA 3ZVDA 2A1DB 1SLUB 1AWHB 2ODQA 3UQOA 1UTKA 4H6TA 1MUEB 1YGCH 3N99A 1WYKA 2BMGB 3KF2A 3PWBA 2XRCA 1S0RA 4O3TA 3UQVA 3TLOA 3D62A 4ACBA 4OS4A 3VGCC 2FOGA 3ATLA 4FUGA 2BQWB 3QX5H 5AVDA 4DVAU 1DS2E 2ZI2H 2P95A 1QCPA 1KLJH 2VIDA 4WMDA 1GI4A 3UWIA 2VU8E 2WV4A 2ZTXA 2IPQX 3OFND 1EPTB 3T62A 1FY4A 1C1OA 1H8DH 4DIIH 1OS8A 4I8KA 1TNHA 2H9HA 7LPRA 3MH4A 1EPTA 3GCHC 4GUXA 5A8ZA 1YPEH 3TVJB 1D9IA 2LIZA 3HGNA 3UTUH 1A4WH 4ISIH 3ZVBA 1E35B 1NBME 4B2AA 1TE0A 1BHXB 1EX3A 1O37A 3QN7A 2FOEA 1AZ8A 1HB0B 4R0IA 4CHAB 4CR5A 1HJ9A 1CGJE 1QGFA 1O38A 3KQCA 3TK6A 4X6PA 1G2MA 4IS5A 1Z8JB 2FWWA 3Q00A 3I77A 1A0LA 4GHTA 3DSPA 1WBGB 1UTMA 1A7SA 5HMAA 1TBZH 1EAXA 1FLEE 3PO1B 1P06A 3K9XB 2OP9A 5DP4A 4B76A 1B0EA 2QF4A 1H8HD 4WH8A 5F03A 4NA7A 1H1BA 1GHVH 2GTBA 1NU7B 2BY8X 3VG8A 7ESTE 1GBMA 4ZKRU 1AKSB 3FAOA 2ZDMA 2KAIB 4ABDA 1TNIA 3I78A 1AKSA 2EI8A 3VFEA 1ELFA 1CGIE 1H8IH 2GT7A 4RKJB 1BJUA 2Z9JA 1THSH 4SGBE 3QGJA 4GCHG 2FOMB 1FQ3A 1P10A 4AFSA 1SGDE 4AGKA 3LJOA 3U98H 4AGJA 2BTCE 3A8AA 1H4WA 3GY5A 3SV2H 1QY6A 1GBFA 1SGIB 1N8OC 2VWNA 2AGEX 3M3SA 3RXOA 2RDLA 1HAIH 1TMUH 1TA6A 3RU4D 2EQNA 4CRAA 2R2WU 1ELVA 3UWJH 1A61H 2TGPZ 8LPRA 3DCLA 1Q31A 3A80A 3PMJA 1SOZA 1O2LA 4HTCH 1ZMLA 1EP6A 3OTJE 1ZYOA 1MZDA 3STIA 3ZVEA 1EAIA 3MNXA 3GY7A 1ANBA 1DITH 2ZF0H 4KP0A 3IITA 4NIWA 2P59A 3L6PA 4MNWA 3T25A 3VXFH 2VB0A 4XRNA 1GI5A 1K9OE 1UK3A 3RC4A 2HWLB 2JETC 3D65E 1L1GA 5EU8A 1O39A 2SGFE 1A5HA 1DWDH 1ZPCA 2B5TB 1TRYA 2XWAA 5K7RA 1VITF 1P2NA 5L2YH 1Z71A 4IN1A 4B75A 1T4UH 2ALVA 2AMQA 1YY3A 5H4IB 3NXPA 1NRPH 2F9UA 3P92A 3F6UH 1OWEA 2WPJS 4MG3A 1ZMJA 1D3QB 3NRLA 4HGCA 1KDQB 1JOUB 1T32A 3U8TH 4BNRA 1CO7E 3EBNA 1HCGA 4GPGA 1GCTC 1AY6H 3GS9A 1GMHF 3HATH 1ABIH 2EEKA 4I8GA 2V7QD 3DFJA 3RXEA 1TNGA 1FY8E 5ESBA 3RUOA 2TIOA 1S6HA 2ZCHP 4NFFA 2SGQE 1SG8B 2GCHF 2UWLA 3BG4C 3Q77A 2IPHA 1MU6B 1UW7A 4NA8A 1C1UH 2HGTH 2H6MA 3ZZBA 4P00A 4BXSA 2Z3EA 1AVWA 1FUJA 1AFEH 1NRSH 1TONA 4D7FA 1YPHE 4Z1MD 2WUBA 1VITG 5FCKA 3D23A 3RXVA 1SGFA 1NT1A 4IBLH 2YNAA 2A7JA 3F2GA 4MNYA 2ZU2A 1OSSA 1QBOA 2PUXB 2QXHA 3AAVA 2F83A 2L74A 1HFDA 1NBMD 1WUNH 4I8HA 1C5UA 1GMHG 1ZGVA 1C2IA 1J17T 5EQSA 3F2FA 4ESTE 1NFUA 3UB0A 4J2YB 2FZZA 1SL3A 2GCHG 3ZIAD 2BDGA 3F9HA 1FONA 4TYDA 5ETXA 1HAZB 2HPPH 1RD3B 1L2EA 3AK5A 5B6LA 1YPGH 1K1LA 1UCYK 1SC8U 4E7RG 1TX8A 4BANB 3FP8E 1LMWB 1WXRA 1SKYE 2SNWA 1F92A 5CHAC 1NZQH 3ZZ8A 3EAJA 1WU1A 3P8FA 4GVUA 5DP9A 4XD7D 3O8DA 3MNCA 1GBBA 4H4FA 3MI4A 5EPYA 5BRRE 8KME2 2GP9B 1RGQA 1IQFA 2JH6D 1P05A 5EODA 3SU6A 1O2NA 1E36B 4ASHA 1YCPH 2J92A 1ANEA 4IC6A 2KM0A 1UO6A 1MTUA 4K1TA 2CF8H 4NIXA 2W7SA 3ZZ4A 2ZGHA 2QF0A 4U01A 1C5RA 2ZDKA 4ZUHA 4WF8A 2FS9A 3AW1A 1V2QT 2CF9H 5EQQA 4FUDA 3ZV8A 2HOBA 2FODA 2GMTB 1RIWC 1QJ7B 1A0HB 3ZYDA 1LCYA 1MKWH 1GBEA 2RCEA 2VBCA 2NWNA 1N6XA 1KMHB 4X2XA 4NGAH 3HGPA 4YESB 2ZCLP 1OXGA 1TBRH 3VB7A 4ISHH 5F53A 4ABAA 4B6FA 1QB9A 2P93A 4AB8A 4B2BA 3SI4H 1V2RT 2H1UA 1GWAA 1K22H 1Z6EA 4YOJA 1UTOA 5I25A 4ZXXH 1QB6A 2KX4A 1RFNA 2BVXH 3ZVGA 2GT8A 1QRWA 2XC4A
chains in the Genus database with same CATH topology
6GCHF 4MDSA 4RKOB 1K1MA 3M5OA 1YPLH 1BTPA 1P2JA 2D2DA 2CHAC 2BB4A 3URCA 2BY7X 4B1TA 2A2XH 3A7ZA 1UTLM 1QHRB 2GV7A 3SJ8A 5JBCS 2P3FH 5DJ7A 3OX7U 5GCHF 1GJ6A 5DO4H 1SBWA 3RMMH 2FTMA 1TBQH 1TPPA 1O2KA 1T8LA 4XBBA 3SNAA 1SVPA 1GI1A 4FU7A 1GHBF 1TMBH 2C93B 4CR9A 1DLEA 3H7OA 1ZRBA 3S0NA 1DFPA 5C3NA 1C2KA 4K1EA 1O32A 2QV1A 2VWLA 3E0PB 1FJSA 4E7NA 1MQ6A 3SNCA 2BOHB 1K21H 3HKIB 1TYNA 1U6QA 1J14A 3TH4H 5C5OA 1NU9A 2ZDNA 2BY6X 1TWXB 1OYTH 3P95A 2ZFRH 2Q6GA 1SGEE 4FUFA 1MQ5A 2FTLE 5HGGA 4E06H 3FP6E 2Y7ZA 4Y7BA 1O36A 3EQ0H 1A3EH 1NRQH 2QCYA 2VWOA 2BVSH 3BTWE 3C27B 2GCTB 5AFYH 1AZZA 3ZVCA 4MPWA 4OS2A 2Z9KA 4WJG2 4K3JA 1PYTD 4K60A 5GCHG 1UTJA 2PKSC 1C5YB 1ESTA 3S7HB 5DP7A 3O8BA 4GAWA 2CN0H 1T7CA 1IAUA 2ZQ1A 2BDYA 3BEIB 3LGUA 1SGYE 1C1SA 4ISNA 1TAWA 3U8RH 1OWKA 1AUTC 2ZPRA 1BTWA 1LQDB 1J16A 4BAMB 3LC5A 1UVUH 2O8TA 2OQUA 3SV6A 1QBNA 1OWHA 5DP8A 2GZ8A 1XVOA 1WCZA 1E38B 2QC2A 4DGJA 1T8NA 1F0RA 5AHGH 1ZPBA 2P94A 1F5LA 2FX4A 3SV7A 1KTSB 3SGQE 7KMEH 4X1QU 4BTUB 1UK2A 2BD3A 2IJOB 3Q3KA 1QJ1B 5E0GA 3P8NA 3ZZAA 3SU2A 2ZDAH 2G81E 3MNBA 1EP5A 3U1JB 1HIAA 1ZJDA 2C8ZB 4ZAEA 1AVXA 1NFXA 2BD4A 1NROH 4JZDH 5FXLA 4CH2B 1QBVH 1FY5A 3DA9B 2ZFSA 1GDNA 3HKJB 3E90B 3E0NB 1S6FA 4MPUA 1EZQA 4B2CA 4AFZA 1A0JA 3C1KA 3S9BA 5A09A 1S82A 1C9PA 1FXYA 3LGTA 3UREA 1ETSH 1IQJA 1GBHA 1HJAB 1O2TA 5JB8S 3VB6A 2J94A 1UK4A 4GHQA 2C3SA 3E6PH 1B0FA 2XWBI 3KIDU 3BTEE 2ZU3A 3UNQA 1MD8A 1IQHA 1BTUA 1P3CA 2M5TA 5LPFA 1YP9A 2QYIA 1A46H 4FUBA 4KTCA 4X6NA 1DXPA 3NWUA 2BM2A 3DD2H 1JIRA 1DWBH 3CS0A 4CBOA 2TRMA 4INKA 3LT3A 2I6QA 4I31A 1YKTA 4FUHA 1VCPA 3GCTF 1Y5BT 1CT2E 3LGYA 3M7TA 4Y10E 4BTTB 1GG6C 4IMZA 4MQAA 1LHCH 3P70B 1MH0A 3W95A 2AMPA 1THRH 4Y79A 4DG4A 4TPYA 4JYVH 1BIOA 2FO9A 3B23B 1UTQA 1V2OT 2ZHDA 2GKVE 4TPIZ 3A81A 1O33A 2XBWA 2PUQH 2AGIX 2TGTA 2UUKB 2EA3A 2QF3A 2ZPSA 2VWMA 1A1RA 4TWWA 4WVPE 2FP7B 2I6SA 3F9GA 1P03A 1ELBA 3LGWA 2ZU4A 2Q6FA 3URDA 5T6GA 4NWKA 3SNEA 4I7YH 1QQ4A 1NESE 2Z6BD 4YO9A 5JBBS 3MYWA 1C1WH 3GCTG 3SV9A 3ATKA 1S5SA 1HYLA 1OWIA 5LGOA 1D3TB 1W2KH 1MBMA 2V0BA 3PO1C 1SLWB 1O35A 3SU3A 1AE5A 3RM0H 1HBTH 1F0SA 1JRSA 4A1TA 5IDKA 1M9UA 1EJMA 3GDVA 1XUJA 1UVPA 1PFXC 2OC8A 1H9IE 4Y11E 4DURA 8ESTE 2VINA 1SMFE 1INCA 2IOTA 3BF6H 3A7WA 1L1JA 5J4QA 4JMYA 4Q7XA 3TJVA 1HNEE 3A8CA 1FI8A 1CA0B 1C2FA 3LIWA 1C2DA 2BD9A 2ZFTA 4KELA 4ABGA 5L2ZH 2ILNA 1OWJA 1NC6A 1ZOMA 3RC6A 4TY6A 5C5NA 1P9UA 1RXPA 2A7HA 5E8EH 3VEQB 1PPHE 2ZKSA 2AGGX 2NU2E 3MFJA 2G5VA 4MNXA 2ZO3H 3JZ1B 1O3DA 3NKKA 1O3AA 4K5ZA 3SUGA 1LHGH 3TJOA 1P2QA 4ABJA 4HZHA 1ORFA 1P9SA 2ZHQH 3Q3YA 1Y3WA 1H9HE 5DKMA 3SJIA 1FAXA 1TFXA 1W11U 1G2LA 2G8TA 1VCQA 4Q2KA 2B0FA 1P11E 2VIQA 2Z9IA 1BTYA 1S0QA 1AE8H 2ZCKP 3BTME 4XBCA 2Z3DA 1Y5AT 2PSXA 1O2OA 1ZTLA 3NUMA 1IQKA 3PMHB 2VVCA 1TLDA 2AFQB 2HVXA 2WPMS 1QL7A 4INLA 1IHTH 1V2NT 2GX4A 2BY5X 2PSYA 1TGTA 1UCYE 2BD5A 2ZG0H 3QLPH 1LHDH 1VR1H 3KGPA 4DCDA 3SUDA 4BAHB 1C5MD 4NCYA 2DE8A 1PPEE 1EZXC 1ETRH 4UD9H 2A31A 4YT7H 4LZ1H 3ZZCA 1AFQB 2W26A 3LKWA 2DUCA 1TGSZ 1AB9B 3LC3A 3RXFA 1G3CA 2F9VA 2FXRA 3O8RA 3RMNH 1C1MA 2OTVA 1XUGA 3R3GB 2SGEE 2ANWA 1HAPH 3ZZ9A 2VIWA 2Q6DA 1GGDB 2J34A 3ZZ3A 2RG3A 5ESTE 2D26C 1D6WA 3S69A 4IC5A 2AYWA 3F1SB 1FV9A 1VGCB 4UE7H 4ZH8A 3WY8A 2HNTC 1SGQE 4XFQA 1W3CA 3TIUA 1TRNA 4A1XA 1OP8A 1G3BA 4WMFA 1JIMA 3R0FA 2QA9E 3SHAH 2B7DH 1CHOF 1ZRKA 1ZTKA 2C8XB 1V2WT 4Y7AA 1ZSKA 2AIPA 2Z3CA 4JK6A 1YCPK 4NA9H 3RXKA 4CRGA 2BLOA 1DM4B 1FIWA 1O3CA 1GVLA 1C5VA 3CS7A 2F91A 2OC0A 4X8UH 3H5CB 2H5CA 2TPIZ 1TOCB 3UR9A 2PHBA 1F0UA 5GDSH 4FU9A 1EZUC 1XM1A 4RN6A 1GBIA 1MAYA 3SI3H 1EZSC 4OS6A 3PYHA 1BBRK 1DY9A 2BX3A 2XCFA 1FDPA 3ENSB 1IQLA 1NPMA 2ANMH 1O3KA 3K6YA 4LZ4B 2AMDA 3BN9A 2VVVA 5HM9A 3PROA 4KGAA 1HDTH 4UFGH 1KYNA 1MTNB 3SV8A 4Y6DA 1XKBC 2NU3E 2VH6A 4X1SU 4JZ1A 1AI8H 1JBUH 1D6RA 3RXGA 1DWEH 3RLWH 5GXPA 5LPRA 3MTYA 1P2MA 1XUFA 1AO5A 1KY9A 3BTHE 4XDEA 2NU4E 2ODPA 1O2QA 3SUEA 2HLCA 1Y3VA 1O5DH 1RRKA 1AWFH 3KQEA 3U1IB 1ELTA 2FLRH 3H7TA 1GPZA 2Y5HA 1MTVA 3SGBE 1W12U 1TRMA 2A5IA 4UFFH 3RXCA 1SQTA 2WINI 1G9IE 2XW9A 5T6FA 4AFUA 4WH6A 1DSTA 3PMBB 7GCHF 5TCAA 3SBKA 1CU1A 3MWIU 5HM2A 4DY7B 1G30B 2ULLA 2GMTC 1MU8B 1AUJA 1MCTA 1THPB 3OSYA 4ABHA 5F8ZA 1W13U 1Z1JA 4UFDH 1LO6A 2BZ6H 1HAYB 2AIQA 2BQ7B 1O2IA 1K1IA 1LPKB 1BOQA 1C2JA 1P09A 1RTKA 4D9QA 1ABJH 2GZ9A 1GBKA 3KHVA 1NFWA 5DGJA 4K2YA 4UEHH 3BTFE 5F6MA 1HAXB 3BTGE 3M37A 1T31A 1EASA 2FDAA 3UNRA 1YF4A 1MMJN 3RM2H 4FVDA 1S83A 2GDEH 1GJ8B 4K8BA 1O3JA 2VIPA 4O3UA 4BAKB 2G4UA 2RA3A 3ZYEA 3TJNA 2FOCA 1L1NA 3UIRA 7GCHG 3STJA 1HXFH 2A7CA 3UOPA 3M5MA 1P2KA 1LDTT 3GOVB 5E0HA 3LU9B 1XX9A 3KCGH 4X2YA 1TA2A 3M5LA 3U8OH 4I32A 1FPHH 1PPBH 2EC9H 1JRTA 2SGPE 2V3OH 3TNSA 2JH0D 1OP0A 3DT0H 1SI5H 1C9TA 5FX5A 4Y0ZE 1YYY1 1BITA 1IQGA 2OC7A 1MAXA 2H9EH 1NS3A 1PPFE 2BDHA 2OLGA 1GBJA 3A88A 4Q7YA 1SQAA 2ANKH 3ZZ6A 5E0JA 1DWCH 4DT7B 1DOJA 1JXPA 1HV7A 3CP7A 2QIQA 2XC5A 4I8JA 4MNVA 4X6OA 2ZPQA 1EB1H 1DDJA 2ASUB 1O3GA 1GJ9B 2Q1JA 1GHWH 2XNIA 1EXFA 3S9CA 3PLBA 4B71A 3DFLA 1AGJA 5C67A 1J15A 1NFYA 1GMCF 2K1QA 2J38A 3ATIA 3LGIA 1O30A 1O5GH 2ODYB 5CMXH 5FAHA 1HJ8A 5EGMA 1TNKA 3MO9A 4NZLA 1QA0A 2VGCB 2PLXA 2BQ6B 2UUYA 1OPHB 4ABBA 1Z8RA 1DPOA 4IMQA 1O5BB 1PPZA 3E3TA 4R8TB 1IQNA 1C4U2 4JCNA 3T5FH 4XE4A 1EOLA 1RTLA 4OGYA 2IN2A 1ZHRA 2F9OA 2ZFPH 2GZ7A 1O2SA 1SLVB 2ZDVH 3BEFB 4YLQH 5JDUB 3ATWA 1XUKA 2OXSA 1GJAB 4A6LA 1QRXA 1W7XH 2ZQ2A 4HFPB 4AOQA 2Y7XA 4A7IB 1HGTH 2UUJB 3GY2A 1J9CH 1GMCG 4YTAA 1QL9A 2H2ZA 2BZAA 2QXIA 1P02A 5I46H 1RJXB 2Y6TA 1TPSA 1V2UT 1V2MT 5C20A 2FPZA 1EQ9A 1P8VC 4YOIA 3V13A 2WPHS 3OY6U 2R9PA 6GCHG 1XMNB 1F5RA 4AYVB 1DE7H 1W0ZU 5A0CA 1QQUA 1Z8IB 1HLTH 2UWPA 2BDBA 2CV3A 3FVFB 3ZVAA 5C2ZA 1C1RA 4JZEH 2Y5FA 2R2MB 2ZWLH 1AIXH 1SGNE 1K1PA 3UFAA 5K0HA 4U30A 3A86A 3SQEE 3U69H 5L6NH 2YOLA 3T28A 1XUHA 1O34A 1GHBG 2Z94A 5DP6A 3ELAH 2HALA 1Y59T 1LVBA 3SOSA 2HPQH 1UCYH 1YPHC 4JZFH 2ZA5A 4WWYA 4K8YA 4D8NA 1Z1IA 2F9PA 1ZSLA 4BAOB 5LPEA 2THFB 5E2PA 2BDCA 1BHXF 1E0FD 1VITH 1GBLA 1SFQB 1NY22 2PTCE 1TB6H 1WOFA 3TGKE 3TITA 3QTVH 2NU0E 2XXLA 1O2JA 2FOFA 1TPOA 1GI7B 3KQDA 2PGBB 3M61U 3BEUA 1BRAA 1C5LH 1PYTC 2A4GA 1GHAF 2Y81A 3MU1A 1BRCE 4U2WA 1OP2A 4AFQA 3SORA 2XYAA 1HIAB 3UUZA 3AW0A 1F0TA 2PR3A 4IN2A 3QWCH 2JKHA 1JWTA 1C2LA 1MKXH 1W10U 4NIVA 2H5DA 1CBWC 1ZPZA 2FM2A 1BB0B 4B73A 3SN8A 2D8WA 2FI3E 3RMLH 1DICA 2ZP0H 1UVOA 3NK8A 2GV6A 4ZROA 4MLFB 1GJDB 2PTNA 3MOCA 3W94A 1DSUA 3PTBA 2TGAA 2A5KA 3EDXB 1ACBE 5LH8A 4H6SB 3L3TA 1MTSA 1DY8A 1O31A 3LJJA 3ZZ5A 2YNBA 1C5NH 5EXNA 2A4OA 5JBAS 3QTOH 1S84A 4KKDA 1C1QA 4NWLA 1K1NA 1P57B 4FUJA 4JYTA 1DT2A 1N6YA 5C1XA 2PKAB 1HPGA 1O2VA 3RDZA 2A4QA 2Z9LA 1GBTA 2WV5A 2PKAA 2ZGBH 1GJ5H 1C5SA 2FEQH 1WQSA 1CA0C 1W0YH 4I33A 4YM9A 3PM3A 2SGAA 2BX4A 3SO3A 4WY3A 2ALPA 2ZEBA 3NCLA 1KXFA 3QDZB 4OS7A 9LPRA 1TQ7B 2ZHWH 5A0AE 4OGXA 1Y3YA 2CJIA 2FOAA 3Q76A 3RMOH 4RSPA 3GCOA 1ZHMA 3FZDA 5J4SA 3GISB 1FZZA 1GJ4H 3ATMA 1EPTC 1KTTB 3A8DA 3TNTA 3GDSA 6LPRA 1ZR0A 1O5AB 5HXFA 1SPJA 2AS9A 3PB1E 2PFEA 3RXHA 1SHHB 1GHXH 1V2KT 1MCVA 3GY4A 2J2UA 4D9RA 4MPXA 1BRUP 3A89A 1GI6A 2OC1A 1O5FH 3SZNA 1B7XB 2P8OB 4B74A 1BBRE 6CHAB 3MU4A 3G01A 1LVYA 5EXMA 4D76A 4CHAC 3SU4A 1TNLA 3TPIZ 1MTWA 1G3DA 1O5EH 1OWDA 3KEEA 1LKAA 4ZMAH 1G32B 1V2ST 3P8GA 2K7XA 5FX6A 4FXGH 1QFKH 2HNTF 1KLIH 3GY3A 4XOJA 4A1VA 2P3TB 1ZJKA 1GL0E 2RA0A 1GL1A 2VIOA 2O8UA 2BVRH 1GDUA 3E1XB 1DLKB 2DE9A 1FN8A 4X6MA 1AB9C 4CRCA 8GCHF 1P12E 3TH2H 4AX9H 1KLTA 1T8MA 2OINA 1V2VT 3I29A 4WXVA 5EG4A 1K1JA 1O2MA 1O0DH 1GGDC 2A0QB 1GJCB 2XCNA 3RXQA 1Q3XA 4AB9A 1C5WB 2B8OH 2O8MA 1VGCC 4FU8A 2ZZUH 1P0SH 3HK3B 3RLYH 3BTQE 3LPRA 4CBNA 1NO9H 2PW8H 3M35A 2J95A 3PV4A 3QUMP 3A87A 4GSOA 2BLQA 4XBDA 2A32A 1C5ZB 3S7KB 2ZDLA 1C5TA 1GG6B 3P8OA 2Z9GA 2G55A 3B8JA 4VGCB 1CA8B 2O8WA 3KNXA 4J1YA 2WYGA 1HAGE 3HK6B 1UTNA 5HYOA 1PJPA 3V0XA 1KXAA 3EA8A 2ZFFH 1SGFG 3MO6A 3PTNA 5ABWA 1GI8B 3TH3H 1H9LB 1P04A 4O9VA 8GCHG 1EOJA 2SNVA 1LHFH 4X1RU 1PQAA 2CXVA 3T27A 3CENA 1GHZA 3SJ9A