3SZNA

Crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester sg75
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Crystal structures of SARS-Cov main protease complexed with a series of unsaturated esters
rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 87
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sznA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sznA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sznA02
1EOLA 3MH6A 4Y7BA 4XSKU 3NXPA 1C2MA 3T5FH 1SG8B 1IHSH 3SNAA 4CH8B 3TK5A 1WUNH 2ASUB 1GJ7B 3RM2H 3SNEA 3ZV8A 2F9UA 1TBZH 3A88A 1GBBA 1CGJE 1YC0A 4KTUA 2B0FA 1INCA 3ZVEA 2UUJB 1F2SE 2ANKH 1QCPA 1OPHB 2ZQ1A 1PQ7A 2ODYB 3UQOA 3ATMA 1E37B 4X6MA 2BD2A 3BG8A 2ZHDA 1GJAB 3O8BA 2A31A 1Q3XA 1D3DB 2XBYA 1VITF 4M7GA 1XKBC 2UUFB 1ZSLA 2PKSC 3AAVA 1P2JA 1O5GH 4TPIZ 1O3IA 2CF8H 2A7HA 5E0JA 1HAIH 1HAVA 4I8LA 3NUMA 1MZAA 5L30H 3RXRA 3BF6H 1Y3XA 1EJMA 2G4UA 4PROA 3ZYEA 2GDEH 4U01A 2G55A 3ZZDA 5I25A 2AFQB 3BTDE 4XBDA 1C5UA 1C5TA 1AUTC 4ZKSU 3MH4A 2A4RA 1DOJA 1K28D 3TLOA 3PWBA 4FUJA 5LH8A 2A45B 2P3TB 3RMNH 4YT7H 3Q3XA 4DJZB 3GCHC 8GCHF 1GG6B 1CQQA 2SGDE 1XXDA 1O3EA 2ODQA 3ZZ6A 5BPEA 1K1MA 1AQ7A 1E0FD 3RXFA 3SV9A 5HM9A 1IQLA 1ESTA 2BOKA 4AFQA 1CA0C 3HKJB 5C2ZA 5JBTA 1UHBA 1ZRBA 4KTCA 2PGBB 3MHWU 1GHWH 2PWXA 5TCCA 1ARCA 1GHVH 4XDEA 2F9VA 3LJJA 1XUFA 1ABIH 1AVGH 1AY6H 1LTOA 1ZTJA 3UUZA 1GPZA 1GBCA 1PJPA 3FP8E 3BTME 4DURA 1ELDE 3BSQA 2VWNA 4X1SU 5CMXH 1O2KA 3ESTA 1DPOA 1K9OE 2H9TH 1LKBA 3Q00A 1CT0E 1W7XH 5GJ4B 2P93A 4YZUA 1CBWB 2FZZA 2FDAA 1GBIA 4NFEA 4UFEH 3EA8A 2P94A 4JZFH 1LKAA 1MU6B 2FX6A 1J15A 1V2VT 1ZPCA 1BMLA 2XCFA 4I8HA 2C4FH 3O8DA 3U1IB 1FMGA 1Y3WA 1QQ4A 1XKAC 1WSSH 3PTNA 1EUFA 1NO9H 1TLDA 1YF4A 3MWIU 3ZZ5A 4J2YB 1ZGIA 4X8TH 4BAQB 4DY7B 1NT1A 3BIVH 2STBE 3LKWA 1K1IA 1EJAA 1FIWA 4WMDA 1QRXA 4GSOA 3T62A 3PMHB 4U32A 1X7AC 2TGPZ 1M9UA 2Y80A 2XYAA 3RXJA 3RXBA 1C1QA 1C1TA 3EAJA 1LO6A 1OWIA 4ZHMU 1MTWA 3RXPA 3PB1E 4ZHAA 3O8RA 1TNKA 3HPTB 4K60A 2FOMB 1G3BA 3TK9A 1QTFA 4X1NU 4ZAEA 3SUEA 1S81A 3RU4E 2OP9A 4LXBH 1GI1A 3VB6A 5GWZA 4AB8A 3D65E 4GVUA 2SGAA 3RMMH 3TGKE 3B9FH 3D62A 2OQUA 2ODPA 1C5OH 1CHGA 2AMDA 1HAVB 2ZZUH 4Q7XA 2Q6DA 4JYTA 2ZU5A 1T4UH 4AOQA 4NSVA 1HJ9A 4FU8A 2QN5T 5C3NA 1OOKB 1HPGA 3VXFH 3QLPH 2UUYA 1MUEB 4Q2KA 1O5AB 1K1JA 5E0GA 5C5NA 1NU9A 5DP7A 4NCYA 2GMTB 3PYHA 1HNEE 1HGTH 1K1PA 1S5SA 3SU4A 1P11E 5I46H 4D76A 1IQFA 4MVNA 1FXYA 4JMYA 3V12A 2ZGJA 1UTLM 1O2JA 3ZZBA 4TPYA 1V6DA 2HGTH 5CE1A 3KQDA 1H8IH 3BTFE 1SGFA 4WXIA 4A1VA 1G2LA 1JWTA 1ZHMA 3UWIA 4WMEA 2VVUA 1L4DA 1F7ZA 2XBWA 1CE5A 1UHBB 2BXUH 3M36A 1TAWA 4GAWA 1QRWA 4O3UA 3A84A 1NS3A 1BTPA 1G3CA 1GBTA 1LHDH 3MYWA 3P92A 2BD7A 2WV5A 1O2NA 2M5TA 3TGJE 5FPYA 1C5WB 1UTKA 3RC5A 4ABGA 2AEIH 3TITA 3A8DA 4ESTE 1XVMA 2IJOB 1BTHH 1C5VA 4ABBA 1SVPA 2WPKS 3ODFA 4Y0YE 5DJ7A 2CXVA 3VB5A 5A0AE 2J9NA 2FODA 4B1TA 2BYAX 1TFXA 1C5RA 1YKTA 3TPIZ 1PPCE 1KDQA 3L3TA 1CU1A 1UTMA 2QGRA 1O2MA 1SMFE 1LHCH 1OX1A 4DIIH 1O3MA 4IGDA 1AMHA 1W7GH 3ZZAA 1O36A 3UFAA 2ZEBA 1RS0A 3MNCA 1ELBA 1O2PA 3GCNA 2A32A 1P04A 4OS5A 3VGCB 1NRNH 1GJ9B 1QNJA 2ZP0H 2WINI 2TGTA 2PHBA 2OCVB 2BM2A 5L6NH 1GJ6A 5CHAC 3QZRA 3P8GA 4H4FA 1BIOA 4X0WU 1E36B 4NA9H 3E3TA 1C1NA 1GI4A 4X1PU 1SGTA 1NZQH 3RDZA 1Z7KA 2F9NA 3CS0A 2XNIA 4O9VA 1F5KU 1Z8GA 3HKIB 2AYWA 2F9OA 4MTBA 3MMGA 3L33A 2VIQA 4Q7YA 3ZVFA 1GI5A 2FO9A 3SZNA 2RA0A 1C1UH 1WQSA 3A7TA 3EA7A 1OP0A 2LNCA 2BD8A 1HV7A 1THRH 2C8WB 1DITH 4FVDA 2BQWB 3SV7A 2BDAA 2FOGA 1SHYA 5JBCS 2G51A 2JH6D 1GI8B 1XUGA 1ANEA 5J4QA 1AE5A 1GMDG 4ZH8A 3RC6A 3NZIA 1JBUH 5IYTA 4DGJA 5A0BA 3TIUA 4KGAA 3BTKE 2WPMS 2VH6A 1GI6A 1S0RA 3TVJB 2WUBA 3TH4H 2GTBA 2AMQA 1EAIA 1WCZA 2RCEA 3MO6A 2F9BH 1NRSH 4KKDA 4WH6A 2FMJA 1TBQH 3U1JB 2QAAA 3KQBA 1V2MT 4OGXA 2Z94A 2FP7B 1AKSA 1O35A 2XW9A 2FTMA 3T26A 3ATKA 3LC3A 1GVKB 1MD7A 1QB6A 4NFFA 4ZKNU 5A2MH 1RGQA 1QA7A 4Y8YA 1TX7A 2ZFFH 4VGCB 1YBWA 4D8NA 3PTBA 4U30A 3GY8A 3PROA 1NRPH 1CT4E 2BY7X 1T31A 2W3KA 3RMLH 2QIQA 3M5MA 1QGFA 1FIZA 2ZDAH 1YYY1 1F5LA 1MTSA 1V2WT 5EXMA 4UFGH 2OD3B 4JYVH 3EBNA 2W26A 1A61H 1UVOA 2ZCKP 4E7NA 2ILNA 4NGAH 3LGTA 4Z0KA 1NFUA 1D4PB 1DWCH 2ZQ2A 2UWOA 3PMBB 5GCHG 1LPZB 1SR5C 2VVCA 4JK5A 1DWBH 3LPRA 1GJBB 1Z1IA 1NTPA 1EATA 4X8SH 1XX9A 1UVTH 3W95A 4X2XA 6GCHG 3UREA 2D2DA 1C5NH 2XC5A 3ZZCA 2ZFRH 2QF0A 1C1MA 3NKKA 1CHOF 1GHAG 2ALPA 3KNXA 1Z6JH 1GBKA 1A2CH 2ZG0H 1BOQA 4FUCA 3RXHA 3S9AA 3KHVA 1BRAA 1QRZA 1MZDA 1O2QA 2RA3A 1TA6A 1T8MA 1G30B 2GCTB 1H4WA 1KLTA 2D26C 3VEQB 2YOLA 3BTGE 1AHTH 3MOCA 2ZTXA 2FOCA 1GMHG 2EI7A 1EJNA 1GBJA 1HBTH 1HYLA 3QZQA 3MU4A 1FPHH 3P17H 1LVOA 2J2UA 4THNH 2GZ8A 3F9GA 4E05H 2ZFTA 1UVUH 4Y71A 1TA2A 3SJIA 3STIA 1TGTA 2V6NA 2PLXA 2BX3A 5DKMA 2ZGXH 5A8XA 2OC7A 1TRNA 1P8VC 1ZYOA 5T3HA 3SJ9A 5HXFA 4AYVB 3BG4B 1GBAA 1FY5A 3SUFA 1GGDB 4F4OC 3R3GB 1C1SA 5E2PA 2A5AA 1S83A 2W5EA 2ZGBH 1UMAH 4LZ1H 4K3JA 1O3GA 1ELTA 1OYTH 2P59A 2ZHWH 3TU7H 1YCPM 5DGJA 1K1OA 1GMCG 4SGAE 3LGWA 4BAKB 1C2IA 3LGUA 1C2DA 5JBAS 1L0ZA 1AB9C 1GBDA 3ATIA 3PLPA 5T6DA 4BAMB 3K6YA 3EDXB 1PPEE 2XCNA 1WU1A 3F9EA 1C2JA 4WH8A 2AGEX 2H9HA 4CRGA 1P03A 1AKSB 3RUOA 4A1XA 2BD3A 1T7CA 1CGHA 1QL7A 2B5TB 2PKSB 1TALA 1PQ8A 2ZU3A 1D6RA 3RXTA 1N8OC 3SI3H 2PGQB 3G01A 6CHAB 2K7XA 3TJVA 1VITG 3V7TA 1ZMNA 2BTCE 4AG2A 3KCGH 2ANWA 3BEFB 1NC6A 4X8VH 1MCTA 3GY5A 1AI8H 1DFPA 4LZ4B 1Q31A 3ITIA 5GPIB 5DG6A 5DO4H 1O3HA 2O8MA 3GY4A 1IQHA 1ESAA 2G4TA 5DP5A 3QTOH 4MPXA 2A4GA 1BUIA 1F92A 1DM4B 4ZUHA 1SSXA 2HNTE 4O3TA 3B8JA 2Z9JA 1IQMA 1N1LA 3TGIE 2GD4B 3A87A 2BDBA 3SNBA 3MU5A 1O3CA 1HRTH 2VIOA 2XBVA 2QXGA 1TNHA 2C3SA 3ZVDA 3F9HA 1SLVB 5C1XA 1YCPH 3GCTF 2VH0A 4DW2U 1ETSH 2HRVA 1UTOA 5EPYA 4AB9A 8GCHG 5ESBA 1D3TB 3PO1B 1E35B 3SGAE 1FY1A 1DE7H 2XWBI 1TQ7B 1V2RT 4ABHA 1O3FA 4LK4A 1CVWH 2A4QA 1NY22 1HAPH 1A0HB 3U98H 4AGKA 2Z9LA 3GDUA 4RKJB 1O32A 2ZI2H 1O2VA 1OP8A 5JBBS 1P2KA 1A4WH 2G52A 1KLIH 1F0UA 1KXBA 2FI3E 2UWLA 3FP7E 3E0PB 1A46H 1ANBA 4HZHA 1LQEA 4INLA 3Q77A 3OX7U 3I29A 5EPNA 3ATWA 2BMGB 3V3MA 2SGPE 4CRFA 2B8OH 5F6MA 3A89A 2EC9H 1SBWA 3QO6A 3SU1A 1WYKA 1CGIE 3U69H 1WQVH 1GJ8B 1GHYH 2G5VA 2PSYA 2WYGA 1NFXA 1WTGH 1OP2A 1SGPE 1MTNB 2CJIA 2ZDMA 3EQ0H 2XBXA 1JRSA 1Y3VA 1ORFA 1WTHD 2EI8A 2OINA 1UVPA 4TWYA 2B9LA 2Z9KA 1FY4A 2CV3A 1PPBH 3TK6A 1O3LA 1LHFH 2XTTB 1TQ0B 2ZHEH 3F68H 4I8JA 1GCTC 1HXFH 3TJUA 4UEHH 4DT7B 1LCYA 3NWUA 1HIAA 1NROH 3RU4T 1AO5A 1KIGH 2Z9IA 3I77A 3A80A 3GYLB 2ZGHA 1NFYA 3T2NA 2TBSA 1S0QA 2BDGA 4CHAC 2F9PA 1O5FH 1THPB 4YLQH 1CA8B 1QIXB 1V2KT 2GVFA 5F8XA 4I7YH 4Q80A 1IQEA 4ISIH 3FZZA 2O8TA 4RN6A 2VGCB 1VJ9U 1ACBE 1BRUP 1J17T 1VZQH 2BQ7B 1VGCB 4IN2A 2P8OC 3SOSA 2LPRA 1LPGB 2Z3EA 2BY8X 2IPHA 3SUDA 1C5YB 4B74A 1TPAE 2C90B 1P01A 4FUFA 4AX9H 1AD8H 4YTAA 1FUJA 3CS7A 3CP7A 2FLBH 1AU8A 4X6NA 2FX4A 2P3FH 1O5DH 1TMUH 2VIVA 4BOHA 2Y5GA 1RIWB 1C2FA 4ZXXH 2ZU1A 4FUIA 4FUEA 3LU9B 1IQJA 1P9SA 2FYQA 4NZQA 3BIUH 1TMTH 1YPHE 1NM6A 1VCQA 4AN7A 1FY3A 4BANB 2G81E 4IS5A 1WAYB 3GDVA 1YPGH 4WF8A 2GZ7A 1TGSZ 5A09A 1SLWB 1HAGE 3A8BA 2O8LA 4NIVA 4H42U 2BLQA 2FWWA 2QXIA 2TIOA 2Z3CA 1ELFA 1Z8IB 4MG3A 1AN1E 1QB1A 1Z71A 1YCPK 1IHTH 4KP0A 5B6OA 1ZZZA 1NRQH 1SGNE 2STAE 2ANMH 2C8YB 1UJ1A 1P10A 1SPJA 3BEIB 5AFZH 1E38B 3UWJH 1DSTA 5EXLA 1OSSA 5HYOA 2W7UA 4CR9A 1XUHA 1QURH 1TNJA 1O5CB 1XM1A 2VIDA 3MH7A 3LJOA 1MTVA 3ZVGA 1GG6C 1EP6A 5H4IB 2ZPQA 3P95A 2VINA 3SO3A 2BLOA 1JMOH 3T27A 2Q6GA 3QN7A 1EB1H 3S69A 1C1WH 1G2MA 2ZDKA 2H6MA 1O3PB 1P12E 1ELGA 3M35A 4B73A 1P2OA 2PUXB 2ZHFH 1HLTH 5JYIA 2OC8A 3SUGA 1GWAA 3SV6A 1RFNA 1SGFG 1V2LT 3ZZ4A 1A5HA 3UNQA 2HALA 4NG9H 3H7TA 5JPMH 4YLUA 3TJNA 2A5IA 3A7YA 2F91A 4MPUA 1ZTKA 4IMZA 1GVLA 3EA9A 2ZIQH 2DE9A 4FUDA 4MDSA 4ABEA 3SNCA 1HIAB 2QXJA 1CBWC 2CHAB 3IG6B 5TCAA 3ENSB 1MAXA 1RJXB 2J34A 3A86A 1TONA 2Z9GA 1G36A 4BAHB 1T8NA 1MKWH 1EAXA 2UUKB 3PM3A 2ZDVH 2IN2A 4GCHF 3KF2A 2VVVA 1SQAA 2BZAA 1S6HA 4YOGA 1GJ4H 1O5EH 2PKAA 4CRDA 4B2AA 3BTQE 4WMFA 1O3NA 1GDNA 2WPHS 1CT2E 1YP9A 1EPTA 4BTUB 1C4V2 4TY7A 3RC4A 1YPLH 3S9BA 1B0FA 3S7HB 3I78A 1C2KA 3FVFB 5E0HA 4ABFA 1GJCB 3LGYA 1TRMA 2OTVA 1P0SH 1KTTB 4JCNA 1XXFA 1YPEH 1BTUA 3SJOA 1MQ6A 1TGNA 3PV4A 3U8OH 4H6TA 1MH0A 3MO9A 3O8CA 5L2YH 2VWLA 1LVMA 3GY3A 1FNIA 2ZDLA 1NU7B 4INKA 2FOHA 2ULLA 1ZHPA 5EXNA 1CO7E 4ZHLU 1QJ1B 2H2ZA 3M7QA 5C1YA 2FTLE 1HAYB 1OWHA 1ANDA 3RM0H 3RXLA 2A1DB 4IN1A 4YOJA 1ZJDA 4CH2B 3A8CA 3P8NA 3V13A 4KELA 2GT7A 1GI2A 3BTEE 1J8AA 5BRRE 2A0QB 1QA0A 3M5OA 5JDUB 2PSXA 1QBNA 1TBRH 1VITH 4UDWH 1V2QT 3FP6E 1BDAA 3UY9A 3E0NB 1C1OA 1LPKB 4Y7AA 1L2EA 1DT2A 1GI7B 2A7CA 1O31A 2GMTC 3STJA 1O2OA 4UONA 3TNSA 2Y7ZA 3ZZ8A 1ETRH 2J38A 3A7ZA 3LH1A 1GHZA 1BITA 5C20A 1TMBH 4TYDA 3MU1A 1O3KA 4NZLA 3GYMA 3KN2A 5AVDA 2AMPA 3GCOA 4ZXYH 1DVAH 5L2ZH 5FBIA 2H5CA 2KAIA 2GV7A 1G37A 5A8YA 4I31A 1O2LA 4UD9H 1Z8JB 2BD4A 4ZMAH 4XFQA 3RXQA 1IQKA 1HAXB 5ETXA 3K65B 7ESTE 2ZFSA 4K1SA 3OSYA 1ABJH 1XUIA 1W3CA 1AVXA 5EU8A 1A3EH 1ZMJA 1YGCH 2JETB 1CHOG 3SU2A 1VR1H 3SNDA 2AIQA 3IITA 5FXLA 5TJXA 5A0CA 1O3OA 6ESTA 3MU8A 2J92A 3NCLA 1NRRH 3UNRA 3OY6U 4MNYA 2HVXA 1C1PA 3GY6A 1OS8A 5F03A 7GCHG 4FXGH 5EW2H 1TGBA 2F83A 5JB8S 1EASA 1SB1H 1V2PT 1EZUC 1QQUA 3HK6B 1TNGA 1BMNH 1VCPA 1DLKB 3IWMA 1BHXB 4B75A 4BAOB 3M5LA 3BTHE 1K1LA 4SGBE 4WVPE 2PR3A 4B2CA 2GCHF 4DIHH 5AFYH 3RXUA 5EGMA 2PKAB 3M3SA 1A1RA 1DWDH 2J94A 3C1KA 1MKWK 4AFUA 4A6LA 4XOJA 1LVYA 3SV8A 1HJAB 1GL1A 1EPTB 4Y6DA 3U8RH 1MBMA 4FU9A 1N6YA 2AERH 2GZ9A 2JKHA 2BDCA 3A7WA 2ZA5A 3BTWE 1W12U 5HGGA 3RXKA 1YM0A 3H7OA 3P8OA 4NSYA 2Y5FA 1TB6H 1QL8A 2PW8H 3ZZ9A 1UTNA 1SGCA 2WV4A 3A82A 1DXPA 1BBRK 2HPPH 3HGPA 1UK2A 5LGOA 1O37A 2V3OH 2RDLA 3E16B 3A81A 1JIRA 5LPEA 4YO9A 3T25A 1TGCA 2Q6FA 1B0EA 4ZKOU 1AFQB 2QY0B 7GCHF 1BQYA 4NA7A 1O2GH 2HLCA 2VIPA 1C4Y2 2C93B 1U6QA 1O2TA 3KL6A 1TX8A 1GHXH 1FONA 3GY2A 2P3UB 1ETTH 4Z6AH 1KXEA 3LGVA 1GHBF 1SHHB 1HCGA 4CRBA 1C2LA 1ELCA 2OQ5A 3ZZ7A 1JRTA 4X8UH 2ZKSA 1OYQA 2ZWLH 3K2UA 3U9AH 4UE7H 4BXSA 3RLWH 1FPCH 1L4ZA 5K0HA 1HAHH 3K9XB 1MKXH 1RD3B 1PPGE 4NIWA 2BVXH 2SGFE 2RG3A 3OTJE 2BDHA 1F0TA 1O33A 2EA3A 2ZDNA 4DVAU 9LPRA 1SI5H 1Y59T 1C5PA 3ZV9A 1T8LA 4VGCC 5AF9H 2YNBA 1K22H 5AHGH 8KME2 3MNSA 2ZFQH 1TOCB 2ZPRA 2KAIB 1DY9A 1DY8A 3MNBA 1IQGA 2QYIA 4ISHH 3GCTG 1V2JT 4FU7A 1BZXE 3UOUA 1VCWA 4CBOA 1KXDA 1QR3E 1FN8A 1J16A 1Y5AT 2BLVA 1ELVA 1VJAU 3FFGA 5EODA 1V2TT 2ZF0H 2BXTH 1ZOMA 5C1UA 2EEKA 1O3JA 2PUQH 1RTFB 2GDDA 2BDYA 2FPZA 3B23B 5HMAA 1HFDA 1GBLA 3AASA 2OLGA 1EOJA 3RXCA 2OC0A 1OXGA 4FVBA 1BJUA 1OWKA 1G9IE 1OWDA 2V35A 3P6ZB 4Y0ZE 4Y76A 1TOMH 2G00A 3SI4H 2HPQH 1SOZA 4FUHA 1W11U 4FUBA 4HTCH 1D3QB 3FAOA 4JZ1A 3E90B 4HI3A 3TJOA 2Y82A 2SGQE 2BOHB 1B7XB 1XMNB 2FESH 2F3CE 2FOEA 4O03A 2NU1E 4I33A 3E6PH 1ZLRA 2GCTC 1O2XA 1DX5M 2BLWA 1C5MD 3TNTA 2ALVA 5EQQA 1OWJA 1P9UA 1HJ8A 1UCYK 4A7IB 2FYRA 3GCHB 1BTWA 1C5ZB 1DS2E 2GKVE 3UNSA 1Y3UA 1QJ7B 1PQ5A 1H9HE 2C8ZB 4CHAB 1C1RA 3SJKA 3HK3B 2CF9H 2I6SA 1TRYA 1A0LA 2Z6BD 2ZCHP 2THFB 1KY9A 1CA0B 3QDZB 2SNWA 4X6OA 1O2UA 2D8WA 1UK3A 1AFEH 1D3PB 3NPSA 2ZU4A 1BTZA 3ZVBA 1EZSC 3BG4C 2P8OB 9ESTA 2QCYA 1P3EA 2H9EH 3AW1A 1F0RA 3HATH 1KXFA 3RMOH 5DP8A 5IDKA 1O2ZA 3LH3A 1A5IA 3ZZ3A 4CRCA 1GBMA 2P95A 3D23A 3DHKH 1TPOA 4GHTA 1V2UT 3SGQE 2NU0E 1LHEH 4CBNA 2FEQH 4YM9A 1G32B 1Z8RA 5A8ZA 4TWWA 1ZRKA 1GI3A 2OUAA 2QC2A 2NU4E 1PYTC 1DXWA 3M61U 2B7DH 2BY6X 4ABIA 1KSNA 3PLBA 4IMQA 5DP3A 3MU0A 2P16A 4NA8A 5PTPA 3SU6A 2ZHQH 4WXVA 1BJVA 1ID5H 1P2QA 3MH5A 3VXEH 1YLDA 1ELEE 4BTIB 1O3AA 1GBHA 1WBGB 4YOIA 3FANA 3PLKA 1AGJA 5DP9A 2WPLS 1HB0B 1FLEE 2ZO3H 1MKXK 4B71A 5JB9S 2V0BA 6CHAC 2Z7FE 4AFZA 4NWLA 1D9IA 2O8WA 5FCKA 2BY5X 1YPMH 1ZPBA 3RLYH 3U8TH 1MCVA 2BVRH 1THSH 1WV7H 3MI4A 1DDJA 1EZXC 1P2NA 1A7SA 3SU5A 1DICA 1SQTA 4B76A 2JH0D 4IW4E 1YPKH 3NK8A 4YT6H 5FPTA 3QGJA 1JXPA 4AORA 1SL3A 3F9FA 5EOKA 1SFQB 2W3IA 4X1QU 4O97A 4HFPB 5F8TA 2OXSA 1RTKA 3RXGA 2ANYA 3A85A 2O9QA 4IBLH 4I32A 1O2IA 4GHQA 2XC0A 3H5CB 1RRKA 3PO1C 1V2NT 2XXLA 3EGKH 1NN6A 1DWEH 1BTXA 1ZHRA 4ZKRU 3BTTE 1O2RA 1O2YA 3L6PA 1W0ZU 4TY6A 1EKBB 3RXIA 4J1YA 1H8DH 1UVSH 3UQVA 1BA8B 1FJSA 2NU3E 2XRCA 1J9CH 1GBFA 1AWFH 3KQCA 2XWAA 2O8UA 4BNRA 3E8LA 1O3BA 2FOBA 1H9IE 1QY6A 4K1TA 5HM2A 3C27B 2XC4A 4UFFH 5G4BA 5C67A 4A5TS 4MPVA 5ESTE 3RXSA 5FHTA 1FN6A 1C5XB 1F5RA 1AUJA 3GISB 4NIYA 3A8AA 3SBKA 2H5DA 1C2GA 4IC6A 1BRBE 2ZCLP 3LONA 2GV6A 2SNVA 3V0XA 2BVSH 2IOTA 3Q76A 3M3TA 3RU4D 1MTNC 2OC1A 4R8TB 4OS4A 1Y8TA 1GCDA 6LPRA 1SLUB 2Y7XA 4WJG2 4WY3A 4GCHG 3WY8A 2VNTA 2A5KA 1RXPA 1UK4A 1O39A 1PYTD 3E1XB 2ZGCA 5LPFA 4Y8XA 1V3XA 1Y5BT 1GL0E 2FI5E 3KGPA 1CSOE 2HNTF 4BXWA 1P2MA 1NFWA 4A92A 1EAWA 4Q7ZA 1AVWA 2ZTYA 1TIOA 1EQ9A 3T29A 1GI9B 1C4U2 3SU0A 3RXOA 3DD2H 3RXMA 1GDQA 1MQ5A 2ZTZA 1T4VH 3SHCH 2W7SA 3SGBE 2UWPA 2VGCC 1SC8U 3GICB 5FPSA 3QK1A 3SQHE 3GDSA 1VGCC 1ZTLA 1Y5UT 3N7OA 1QBOA 1O34A 1GJDB 4OS2A 1YPJH 4X2WA 4I8KA 1SGYE 5EQRA 1O0DH 2VU8E 2FOFA 1KLJH 2BB4A 2QV1A 5CHAB 1ZJKA 4HGCA 2AGIX 1EB2A 3M5NA 1A5GH 1LVBA 4JZIA 4OGYA 3RXAA 1KYNA 3SV2H 1EXFA 1UTQA 1ELAA 1O2HA 1QL9A 1EAUA 2BD9A 1QJ6B 1C1VH 2FIRH 2R9PA 5F8ZA 1RIWC 1DLEA 3ATLA 7KMEH 1P06A 4MNVA 2WYJA 1TNIA 4ZROA 1IOEA 2R0KA 1A3BH 1SGDE 3UTUH 5DPAA 3M7TA 2DE8A 2ESTE 3K6ZA 1C9PA 1QFKH 3TH3H 1OKXA 2GGVB 4F49A 2LIZA 4ISLA 2R0LA 2TPIZ 2Q1JA 3RXDA 4AGJA 1RTLA 2K1QA 2TGAA 4KTSA 1C5SA 3UIRA 4XE4A 1PFXC 1TE0A 1LMWB 2TGDA 2ZPSA 3URCA 4JZDH 1BBRH 1DUEA 1NESE 1SFIA 1SOTA 3RXVA 5FX5A 1GBEA 1BCUH 2VWOA 3QGNB 1BHXF 1QHRB 1G3EA 4XBCA 4OS6A 3RP2A 3QX5H 4OS1A 3ELAH 1LDTT 4JZEH 3PWCA 2OBQA 3LGIA 3F1SB 3VFEA 5GXPA 3AAUA 1QBVH 4DCDA 2HWLB 3Q3YA 2SGEE 1FI8A 5C5OA 1FZZA 1JOUB 1TPPA 1SQOA 1BMAA 2GT8A 1SGEE 2VB0A 1S85A 1TNLA 5FBEA 5E8EH 5ABWA 3M7UA 1Q2WA 1LHGH 2AH4X 1DUAA 2Y81A 1W0YH 2Y5HA 4Y10E 3R0FA 4ISNA 4GLYA 3SW2B 4K69A 1W13U 3VB7A 1A0JA 4X1RU 1HXEH 3KEEA 2HOBA 2Y6TA 1IAUA 4ABDA 3GY7A 3LC5A 8LPRA 2ZECA 4CRAA 3UR6A 2QF3A 1HUTH 4JYUH 3SN8A 2TRMA 3DT0H 3JZ2B 3T28A 2GCHG 2R3UA 1UTPA 1K21H 4K8BA 1O38A 4K2YA 1SLXB 1W8BH 1BT7A 1C5QA 2QA9E 3CENA 1B5GH 1AIXH 2G5NA 3UR9A 1NPMA 2A4OA 2CHAC 2GP9B 2ZU2A 1MTUA 3ZVCA 2EI6A 1C9TA 3ODDA 1O2SA 3VB3A 2G8TA 4I8GA 4ABJA 1F0SA 1UO6A 4WWYA 1K2I1 3PMAB 5FCRA 3HGNA 3SQEE 4DOQA 7LPRA 5EW1H 5DP6A 8ESTE 1P57B 1W2KH 1XUKA 2FM2A 5DK1A 1G3DA 4MNWA 1ZR0A 5E2OA 3SHAH 1O30A 2BHGA 3LIWA 3E91A 1H1BA 1ZPZA 3A83A 4YESB 4GPGA 2V3HH 1ZMLA 1TWXB 3P70B 1TYNA 3UPEA 4K5ZA 3ZVAA 4D9RA 1C2EA 1GI0A 2CMYA 3W94A 3MNXA 3AW0A 2ZNKH 3UOPA 2VWMA 1TX6A 1BBRE 2AIPA 3KIDU 1GHBG 1UTJA 4ASHA 4U2WA 3KQEA 3Q3KA 4JK6A 1T8OA 1P09A 2I6QA 3DFLA 2PFEA 4X2YA 1H9LB 2HNTC 1UCYH 5EQSA 5J4SA 2D1JA 1K1NA 3VGCC 2FI4E 1GDUA 3MO3A 2ZC9H 3OYPA 4Y8ZA 1DSUA 1MAYA 5EG4A 1BRCE 1FDPA 4K1EA 3EYDA 3RXEA 1ANCA 1P02A 2WUCA 4MLFB 1L1GA 3LDXH 2A2QH 1ZGVA 1AE8H 1TPSA 3OU0A 3TH2H 5LPRA 1GVZA 1AB9B 1AZ8A 3DFJA 2PTCE 3QUMP 1W10U 2R2WU 3JZ1B 4Y11E 4QT8C 1KTSB 1XUJA 2R3YA 1HAZB 1FY8E 1MBQA 2FLRH 3MFJA 2DUCA 4INHA 3S0NA 2OBOA 4GUXA 4LOYH 4K8YA 4UFDH 1OWEA 4CREA 1GMDF 4MNXA 4E7RG 2PV9B 3BN9A 1PPHE 3DUXH 1P05A 3LT3A 1N8OB 2GX4A 1S84A 3GOVB 1KDQB 2JH5D 3P8FA 5GIBA 1S6FA 1GJ5H 3AVZA 4Y79A 3A7XA 2VJ1A 3SU3A 3LOXA 3VPKA 2JETC 2J4IA 3QWCH 5SGAE 3M3VA 2FS9A 2CN0H 5FAHA 1DANH 1P3CA 2H1UA 2AGGX 1WOFA 2AS9A 1FQ3A 4RSPA 1AWHB 5T6FA 2R2MB 4D7GA 1V2OT 2VIWA 4D7FA 1Z1JA 4BTTB 1MMJN 4NIXA 1KXCA 3S7KB 3S9CA 1AZZA 1FAXA 2BY9X 2BZ6H 1TABE 4ISOA 3QTVH 3ZYDA 2A7JA 4OS7A 1O2WA 1S82A 4A1TA 2J95A 2BD5A 4X2VA 3EE0B 5GCHF 1J14A 2ZFPH 1N6XA 3DA9B 1MU8B 4RKOB 5K7RA 1Z6EA 2CGAA 1ZSKA 1HJAC 2FXRA 1BMMH 1EPTC 1FV9A 1UCYE 3URDA 6GCHF 3SJ8A 2FOAA 1YLCA 1D6WA 1XVOA 2PTNA 3MTYA 3BV9B 1P2IA 3PMJA 2QXHA 1SGQE 1T32A 2A2XH 3VB4A 3FZDA 2YNAA 1GHAF 4XBBA 2WPIS 1HDTH 4B2BA 4AZ2B 4AYYB 1Y3YA 4DG4A 1IQIA 4CR5A 1ZSJA 3OY5U 1JIMA 1LQDB 4NWKA 4MPWA 4MQAA 1MD8A 1AFQC 1EX3A 1IQNA 1L1NA 1YPHC 1C2HA 3D49H 1GMHF 2BX4A 1GCTB 1SGIB 2C8XB 1PPZA 1PPFE 1KXAA 1O3DA 2NU2E 2WPJS 1FAKH 1HAOH 3M37A 1ARBA 1EP5A 5T6GA 1PQAA 4FUGA 3F6UH 4H6SB 4X6PA 4R0IA 1O5BB 2BDIA 1BB0B 2NWNA 2SFAA 4E06H 5DP4A 5FX6A 4D9QA 2Z3DA 4IC5A 1SGRE 2BQ6B 4AG1A 1ESBA 1C5LH 1W14U 3A7VA 3SORA 5GDSH 2FS8A 4AFSA 1E34B 1EZQA 1BTYA 1GGDC 1L1JA 1V2ST 3BEUA 1QB9A 4ABAA 1GMCF
chains in the Genus database with same CATH superfamily
1EOLA 3MH6A 4Y7BA 4XSKU 3NXPA 4AC9A 1C2MA 3T5FH 2HLDD 1SG8B 1IHSH 3SNAA 4CH8B 3TK5A 1WUNH 2ASUB 1W0JD 1GJ7B 3RM2H 3SNEA 3ZV8A 2F9UA 1TBZH 3A88A 1GBBA 1CGJE 1YC0A 4KTUA 2B0FA 1INCA 3ZVEA 2UUJB 1F2SE 2ANKH 1QCPA 1OPHB 2ZQ1A 1PQ7A 2ODYB 3UQOA 3ATMA 1E37B 4X6MA 2BD2A 3BG8A 2ZHDA 1GJAB 3O8BA 2A31A 1Q3XA 1D3DB 2XBYA 1VITF 4M7GA 1XKBC 2UUFB 1ZSLA 2PKSC 3AAVA 4OM9A 1P2JA 5T1VA 1O5GH 4TPIZ 1O3IA 2CF8H 2A7HA 5E0JA 1HAIH 1HAVA 4I8LA 3NUMA 1MZAA 5L30H 3RXRA 3BF6H 1Y3XA 1EJMA 2G4UA 4PROA 3ZYEA 2GDEH 4U01A 2G55A 3ZZDA 5I25A 2AFQB 3BTDE 4XBDA 1C5UA 1C5TA 1AUTC 4ZKSU 3MH4A 2A4RA 1DOJA 1K28D 5EJLA 3TLOA 3PWBA 4FUJA 4RT0A 5LH8A 2A45B 2P3TB 3RMNH 4YT7H 3Q3XA 4DJZB 3GCHC 8GCHF 1GG6B 1CQQA 2IPQX 2SGDE 1XXDA 1O3EA 2ODQA 3ZZ6A 5BPEA 1K1MA 1AQ7A 1E0FD 3RXFA 3SV9A 5HM9A 1IQLA 1ESTA 2BOKA 4AFQA 1CA0C 3HKJB 5C2ZA 5JBTA 1UHBA 1ZRBA 4KTCA 2PGBB 3MHWU 1GHWH 2PWXA 2K0QA 5TCCA 1ARCA 3DCLA 1GHVH 4XDEA 2F9VA 3LJJA 1XUFA 1ABIH 1AVGH 1AY6H 1LTOA 1ZTJA 3UUZA 1GPZA 1GBCA 1PJPA 3FP8E 3BTME 4DURA 1ELDE 3BSQA 2VWNA 4X1SU 5CMXH 1O2KA 3ESTA 1DPOA 1K9OE 2H9TH 1LKBA 3Q00A 2KCAA 1CT0E 1W7XH 5GJ4B 2P93A 4YZUA 1CBWB 2FZZA 2FDAA 1GBIA 4NFEA 4UFEH 3EA8A 2P94A 4JZFH 1LKAA 1MU6B 5HKKD 2FX6A 1J15A 1V2VT 1ZPCA 1BMLA 2XCFA 4I8HA 2C4FH 3O8DA 3U1IB 1FMGA 1Y3WA 1QQ4A 1XKAC 1WSSH 3PTNA 1EUFA 1NO9H 1TLDA 1YF4A 2EQNA 3MWIU 4DT4A 3ZZ5A 4J2YB 1ZGIA 4X8TH 4M9FA 4BAQB 4DY7B 1NT1A 3BIVH 2STBE 1SKYE 3LKWA 1K1IA 1EJAA 1FIWA 4WMDA 1QRXA 4GSOA 3T62A 3PMHB 4U32A 5HIZA 1X7AC 2TGPZ 1M9UA 2Y80A 2XYAA 3RXJA 3RXBA 3OEED 1C1QA 1C1TA 3EAJA 1LO6A 1OWIA 4ZHMU 1MTWA 3RXPA 3PB1E 4ZHAA 3O8RA 1TNKA 3HPTB 4K60A 2FOMB 1G3BA 3TK9A 1QTFA 4X1NU 4ZAEA 3SUEA 5C0TA 1S81A 1EFRD 3RU4E 4Z1MD 2OP9A 2WSSD 2K8IA 4LXBH 1GI1A 2YMSB 3VB6A 5GWZA 4AB8A 3D65E 4GVUA 2SGAA 3RMMH 3TGKE 3B9FH 3D62A 2OQUA 2ODPA 1C5OH 4ACBA 1CHGA 2AMDA 3N7EA 1HAVB 2ZZUH 4Q7XA 2Q6DA 4JYTA 2ZU5A 1T4UH 4AOQA 4NSVA 1HJ9A 4FU8A 2QN5T 5C3NA 1OOKB 1HPGA 3VXFH 3QLPH 2J98A 2UUYA 1MUEB 4Q2KA 1O5AB 1K1JA 5E0GA 5C5NA 1NU9A 5DP7A 4NCYA 2GMTB 3NRLA 1HNEE 3PYHA 1HGTH 1K1PA 1S5SA 5KGOA 3SU4A 1P11E 2L6OA 5I46H 4D76A 1IQFA 4MVNA 2KR7A 1FXYA 2F43B 4JMYA 3V12A 2ZGJA 1UTLM 1O2JA 3ZZBA 4TPYA 1V6DA 2HGTH 5CE1A 3KQDA 1H8IH 4TSFD 3BTFE 1SGFA 4WXIA 4A1VA 1G2LA 1JWTA 1ZHMA 3UWIA 4WMEA 2VVUA 1L4DA 1F7ZA 2XBWA 1CE5A 3FOAA 1UHBB 2BXUH 3M36A 1TAWA 4GAWA 1QRWA 4O3UA 3A84A 1NS3A 1BTPA 1G3CA 1GBTA 1LHDH 3MYWA 3P92A 2BD7A 2WV5A 1O2NA 2M5TA 3W1EA 3TGJE 5FPYA 1C5WB 1UTKA 3RC5A 5IK2D 4ABGA 2AEIH 3TITA 3A8DA 4ESTE 1XVMA 2IJOB 1BTHH 1C5VA 1FX0B 4ABBA 1SVPA 2WPKS 3ODFA 4Y0YE 3FO8D 5DJ7A 2CXVA 3VB5A 5A0AE 2J9NA 2FODA 4B1TA 2BYAX 1TFXA 1C5RA 1YKTA 3TPIZ 1PPCE 5HIYA 1KDQA 3L3TA 1CU1A 1UTMA 2QGRA 1O2MA 1SMFE 1LHCH 1OX1A 4DIIH 1O3MA 4IGDA 1AMHA 1W7GH 3ZZAA 1O36A 3UFAA 2ZEBA 1RS0A 3MNCA 1ELBA 1O2PA 3GCNA 2A32A 1P04A 4OS5A 3VGCB 1NRNH 1GJ9B 1QNJA 2ZP0H 2WINI 2TGTA 2PHBA 2OCVB 2BM2A 5L6NH 1GJ6A 5CHAC 3QZRA 3P8GA 4H4FA 1E1RD 1BIOA 4X0WU 1E36B 4NA9H 3E3TA 1C1NA 1GI4A 4X1PU 1SGTA 1NZQH 3RDZA 1Z7KA 2F9NA 3CS0A 2XNIA 4O9VA 1F5KU 4XD7D 5KECA 1Z8GA 3HKIB 2AYWA 2F9OA 4MTBA 3MMGA 3L33A 2VIQA 4Q7YA 1SQRA 1GI5A 3ZVFA 2FO9A 3SZNA 2RA0A 1C1UH 1WQSA 3A7TA 3EA7A 1OP0A 2LNCA 2BD8A 3DSPA 1HV7A 1THRH 2C8WB 1DITH 4FVDA 2BQWB 4I86A 3SV7A 2BDAA 2FOGA 1SHYA 5JBCS 3VG8A 2G51A 2JH6D 1GI8B 1XUGA 1ANEA 5J4QA 1AE5A 1GMDG 4ZH8A 3RC6A 5B6LA 3NZIA 1JBUH 5IYTA 4DGJA 5A0BA 3PV2A 3TIUA 4KGAA 3BTKE 2WPMS 2VH6A 1GI6A 1S0RA 3TVJB 2WUBA 3TH4H 2GTBA 2AMQA 1EAIA 1WCZA 2RCEA 3MO6A 2F9BH 1NRSH 4KKDA 2J98B 4WH6A 2FMJA 1TBQH 3U1JB 2QAAA 3KQBA 1V2MT 4OGXA 2Z94A 2FP7B 1AKSA 1O35A 2XW9A 2FTMA 3T26A 4B6FA 3ATKA 3LC3A 1GVKB 1MD7A 1QB6A 4NFFA 4ZKNU 5A2MH 1RGQA 1QA7A 4Y8YA 1TX7A 2ZFFH 4VGCB 1YBWA 4D8NA 3PTBA 4U30A 3GY8A 3PROA 1NRPH 1CT4E 2BY7X 1T31A 2W3KA 3RMLH 2QIQA 3M5MA 1QGFA 1FIZA 2EY4C 1YYY1 1F5LA 2ZDAH 1MTSA 1V2WT 5EXMA 2KFWA 4UFGH 2OD3B 4JYVH 3EBNA 2W26A 1A61H 1UVOA 2ZCKP 4E7NA 2ILNA 4NGAH 3LGTA 4Z0KA 1NFUA 1D4PB 1DWCH 2ZQ2A 2UWOA 3PMBB 5GCHG 1LPZB 1SR5C 2VVCA 4JK5A 1DWBH 3LPRA 1GJBB 1Z1IA 1NTPA 1EATA 4X8SH 1XX9A 1UVTH 3W95A 4X2XA 6GCHG 3UREA 2D2DA 1C5NH 2XC5A 2QF4A 2ZFRH 3ZZCA 2QF0A 3GS9A 1C1MA 3NKKA 1CHOF 1GHAG 2ALPA 3KNXA 1Z6JH 1GBKA 1A2CH 2ZG0H 1BOQA 4FUCA 3RXHA 3S9AA 3KHVA 1BRAA 2WPDD 1QRZA 1MZDA 1O2QA 2RA3A 1TA6A 1T8MA 1G30B 2GCTB 1H4WA 1KLTA 2D26C 4B6EA 3VEQB 2YOLA 3BTGE 1AHTH 3MOCA 2ZTXA 2FOCA 1GMHG 2EI7A 1EJNA 3F3BA 1GBJA 1BMFD 1HBTH 1HYLA 3QZQA 3MU4A 1FPHH 3P17H 1LVOA 2J2UA 4THNH 2GZ8A 3F9GA 4E05H 2ZFTA 1UVUH 3KYFA 4Y71A 1TA2A 3SJIA 3STIA 1TGTA 2V6NA 2PLXA 2BX3A 5DKMA 5C17A 2ZGXH 5A8XA 2OC7A 3N99A 1TRNA 1P8VC 1ZYOA 5T3HA 3SJ9A 5HXFA 4AYVB 3BG4B 1GBAA 1FY5A 3SUFA 1GGDB 4F4OC 3R3GB 1C1SA 5E2PA 2A5AA 1S83A 2W5EA 2ZGBH 1UMAH 1H8HD 4LZ1H 1E1QD 4K3JA 1O3GA 1ELTA 1OYTH 2P59A 4P00A 2ZHWH 3TU7H 1YCPM 3KYGA 5DGJA 1K1OA 1GMCG 4SGAE 3LGWA 4BAKB 1C2IA 3LGUA 2CK3D 1C2DA 5JBAS 1L0ZA 1AB9C 1GBDA 3ATIA 3PLPA 5T6DA 4BAMB 3K6YA 3EDXB 1PPEE 2XCNA 1WU1A 3F9EA 1NBME 1C2JA 4WH8A 2AGEX 2KCPA 2H9HA 4CRGA 1P03A 1AKSB 3RUOA 4A1XA 2BD3A 1T7CA 1CGHA 1QL7A 2B5TB 2PKSB 1TALA 1PQ8A 2ZU3A 1D6RA 3RXTA 1N8OC 3SI3H 2PGQB 3G01A 6CHAB 2K7XA 3TJVA 1VITG 3V7TA 1ZMNA 2BTCE 4AG2A 3KCGH 2ANWA 3BEFB 1NC6A 4X8VH 1MCTA 3ZIAD 3GY5A 1AI8H 1DFPA 4LZ4B 1Q31A 3ITIA 5GPIB 5DG6A 5DO4H 1O3HA 4F48B 2O8MA 3GY4A 1IQHA 1ESAA 2G4TA 5DP5A 3QTOH 4MPXA 2A4GA 1BUIA 1F92A 1DM4B 4ZUHA 1SSXA 2HNTE 4O3TA 3B8JA 2Z9JA 1IQMA 1N1LA 5EJ1A 3TGIE 2GD4B 3A87A 2BDBA 3SNBA 3MU5A 1O3CA 1HRTH 2VIOA 2XBVA 2QXGA 5FL7D 1TNHA 2C3SA 3ZVDA 3F9HA 1SLVB 5C1XA 1YCPH 3GCTF 2VH0A 4DW2U 1ETSH 2HRVA 1UTOA 5EPYA 4AB9A 8GCHG 5ESBA 1D3TB 3PO1B 1E35B 3SGAE 1FY1A 1DE7H 2XWBI 1TQ7B 1V2RT 4ABHA 1O3FA 4LK4A 1CVWH 3KQ5A 2A4QA 1NY22 1HAPH 1A0HB 3U98H 4AGKA 2Z9LA 3GDUA 4RKJB 5KEDA 1O32A 2ZI2H 1O2VA 1OP8A 5JBBS 1P2KA 1A4WH 2G52A 1KLIH 1F0UA 1KXBA 2FI3E 2UWLA 3FP7E 3E0PB 1A46H 1ANBA 5EIYA 4HZHA 1LQEA 4INLA 3Q77A 3OX7U 3I29A 5EPNA 3ATWA 2BMGB 3V3MA 2SGPE 4CRFA 2B8OH 5F6MA 3A89A 2EC9H 1SBWA 1QZ8A 3QO6A 3SU1A 1WYKA 2F4LA 1CGIE 3U69H 3PV5A 1WQVH 1GJ8B 1YLNA 1GHYH 2G5VA 2PSYA 2WYGA 1NFXA 1WTGH 1OP2A 1SGPE 1MTNB 2CJIA 2ZDMA 3EQ0H 2KZ4A 2XBXA 1JRSA 1Y3VA 1ORFA 1WTHD 2EI8A 2OINA 1UVPA 4TWYA 2B9LA 2Z9KA 1FY4A 2CV3A 1PPBH 3TK6A 1O3LA 1LHFH 2XTTB 1TQ0B 2ZHEH 3F68H 4I8JA 1GCTC 1HXFH 3TJUA 4UEHH 4DT7B 3PRBA 1LCYA 3NWUA 1HIAA 1NROH 3RU4T 1AO5A 1KIGH 2Z9IA 3I77A 3A80A 3GYLB 2ZGHA 1NFYA 3T2NA 2TBSA 1S0QA 2BDGA 4CHAC 2F9PA 1O5FH 1THPB 4YLQH 1CA8B 1QIXB 1V2KT 2GVFA 5F8XA 4I7YH 4Q80A 1IQEA 4ISIH 3FZZA 2O8TA 4RN6A 2VGCB 1VJ9U 1ACBE 1BRUP 1J17T 1VZQH 2BQ7B 1VGCB 4IN2A 3SZEA 2P8OC 3SOSA 2LPRA 1LPGB 2Z3EA 2BY8X 2IPHA 3SUDA 1C5YB 4B74A 2JJ2D 3UB0A 1TPAE 2C90B 1P01A 4FUFA 3OE7D 4AX9H 1AD8H 4YTAA 1FUJA 3CS7A 3CP7A 2FLBH 1AU8A 4X6NA 2FX4A 2P3FH 1O5DH 1TMUH 2VIVA 4BOHA 2Y5GA 1RIWB 1C2FA 4ZXXH 2ZU1A 2J5UA 4FUIA 4FUEA 3LU9B 1IQJA 1P9SA 2FYQA 4NZQA 3BIUH 1TMTH 1YPHE 1NM6A 1VCQA 4AN7A 1FY3A 4BANB 2G81E 4IS5A 1WAYB 3GDVA 1YPGH 4WF8A 2GZ7A 1TGSZ 5A09A 1SLWB 3U28C 1HAGE 3A8BA 2O8LA 4NIVA 4H42U 2BLQA 2FWWA 2QXIA 2TIOA 2Z3CA 1ELFA 1Z8IB 4MG3A 1AN1E 1QB1A 1Z71A 2M2AA 1YCPK 1IHTH 4KP0A 5B6OA 1ZZZA 1NRQH 1SGNE 2STAE 2ANMH 2C8YB 1UJ1A 1P10A 1SPJA 3BEIB 5AFZH 1E38B 3UWJH 1DSTA 5EXLA 1OSSA 5HYOA 2W7UA 4CR9A 1XUHA 1QURH 1TNJA 1O5CB 1XM1A 2VIDA 3MH7A 3LJOA 1MTVA 3ZVGA 1GG6C 1EP6A 5H4IB 1WDIA 2ZPQA 3P95A 2VINA 3SO3A 2BLOA 1JMOH 3T27A 2Q6GA 3QN7A 1EB1H 3S69A 1C1WH 1G2MA 2ZDKA 2H6MA 2V7QD 1O3PB 1P12E 1ELGA 1WXRA 3M35A 3H09A 4B73A 1P2OA 2PUXB 2ZHFH 1HLTH 5JYIA 2OC8A 4YXWD 3SUGA 1GWAA 3SV6A 1RFNA 1SGFG 1V2LT 3ZZ4A 1A5HA 3UNQA 2HALA 4NG9H 3H7TA 5JPMH 4YLUA 3TJNA 2A5IA 3A7YA 2F91A 4MPUA 1ZTKA 4IMZA 1GVLA 3EA9A 2ZIQH 2GJGA 2DE9A 4FUDA 4MDSA 4ABEA 3SNCA 1HIAB 2QXJA 1CBWC 2CHAB 3IG6B 5TCAA 3ENSB 1MAXA 1RJXB 2J34A 3A86A 1TONA 2Z9GA 1G36A 4BAHB 1T8NA 1MKWH 1EAXA 2UUKB 3PM3A 2ZDVH 2IN2A 4GCHF 3KF2A 2VVVA 1SQAA 2BZAA 1S6HA 4YOGA 1GJ4H 1O5EH 2PKAA 4CRDA 4B2AA 3BTQE 4WMFA 1O3NA 1GDNA 2WPHS 1CT2E 1YP9A 1EPTA 4BTUB 1C4V2 4TY7A 3RC4A 1YPLH 3S9BA 4Q63A 1B0FA 3S7HB 3I78A 1C2KA 3FVFB 5E0HA 4ABFA 1GJCB 3LGYA 2J97A 1TRMA 2OTVA 1YY3A 1P0SH 1KTTB 4JCNA 1XXFA 1YPEH 1BTUA 3SJOA 1MQ6A 1TGNA 3PV4A 3OEHD 2OK5A 3U8OH 4H6TA 1MH0A 3MO9A 3O8CA 5L2YH 2VWLA 1LVMA 3GY3A 1FNIA 2ZDLA 1NU7B 4INKA 2FOHA 2ULLA 1ZHPA 5EXNA 1CO7E 4ZHLU 1QJ1B 2H2ZA 3M7QA 5C1YA 2FTLE 1HAYB 2YMSC 1OWHA 1ANDA 3RM0H 3RXLA 2A1DB 4IN1A 4YOJA 1ZJDA 4CH2B 3A8CA 3P8NA 3V13A 4KELA 2GT7A 1GI2A 3BTEE 1J8AA 5BRRE 2A0QB 1QA0A 3FKSD 3M5OA 5JDUB 2PSXA 1QBNA 2VBCA 1TBRH 1VITH 4UDWH 1V2QT 3FP6E 1BDAA 3UY9A 3E0NB 1C1OA 1LPKB 4Y7AA 1L2EA 1DT2A 1GI7B 2A7CA 1O31A 2GMTC 3STJA 1O2OA 4UONA 3TNSA 2Y7ZA 3ZZ8A 1ETRH 2J38A 3A7ZA 3LH1A 1OHHD 1GHZA 1BITA 5C20A 1TMBH 4TYDA 3MU1A 1O3KA 4NZLA 3GYMA 3KN2A 5AVDA 2AMPA 3GCOA 4ZXYH 1DVAH 5L2ZH 5FBIA 2H5CA 2KAIA 2GV7A 1G37A 5A8YA 4I31A 1O2LA 4UD9H 1Z8JB 2BD4A 4ZMAH 4XFQA 3RXQA 1IQKA 1HAXB 5ETXA 3K65B 7ESTE 2ZFSA 4K1SA 3OSYA 1ABJH 1XUIA 1W3CA 1AVXA 5EU8A 1A3EH 1ZMJA 1YGCH 2JETB 1CHOG 3SU2A 1VR1H 3SNDA 2AIQA 3IITA 5FXLA 5TJXA 5A0CA 1O3OA 6ESTA 3MU8A 2J92A 3NCLA 1NRRH 3UNRA 3OY6U 4MNYA 2HVXA 1C1PA 3GY6A 1OS8A 5F03A 7GCHG 4FXGH 5EW2H 1TGBA 2F83A 5JB8S 1EASA 1SB1H 1V2PT 1EZUC 1QQUA 3HK6B 1TNGA 1BMNH 1VCPA 1DLKB 3IWMA 1BHXB 4B75A 4BAOB 3M5LA 3BTHE 1K1LA 4SGBE 4WVPE 2PR3A 4B2CA 2GCHF 4DIHH 1H8ED 5AFYH 3RXUA 5EGMA 2PKAB 3M3SA 1A1RA 1DWDH 2J94A 3C1KA 1MKWK 4AFUA 5C0UA 4A6LA 4XOJA 1LVYA 3SV8A 1HJAB 1GL1A 1EPTB 4Y6DA 3U8RH 1MBMA 4FU9A 1N6YA 2AERH 2XNDD 2GZ9A 2JKHA 2BDCA 3A7WA 2ZA5A 4TT3D 3BTWE 1W12U 5HGGA 3RXKA 1YM0A 3F0PA 3H7OA 3P8OA 3OAAD 2V3MA 4NSYA 1YWUA 2Y5FA 1TB6H 1QL8A 2PW8H 3ZZ9A 1UTNA 2YMSD 1SGCA 2WV4A 3A82A 5CDFE 1DXPA 1BBRK 2HPPH 3HGPA 1UK2A 5LGOA 1O37A 2V3OH 2RDLA 3E16B 3A81A 1JIRA 5LPEA 4YO9A 2IJD1 1TGCA 2Q6FA 1B0EA 3T25A 4ZKOU 4ACAA 1AFQB 2QY0B 7GCHF 1BQYA 4NA7A 1O2GH 2HLCA 2VIPA 1C4Y2 2C93B 1U6QA 1O2TA 3KL6A 1TX8A 1GHXH 1FONA 3MQKC 3GY2A 2P3UB 1ETTH 4Z6AH 1KXEA 3LGVA 1GHBF 1SHHB 1HCGA 4CRBA 1C2LA 1ELCA 2OQ5A 3ZZ7A 1JRTA 4X8UH 2ZKSA 1OYQA 2WHXA 2ZWLH 3K2UA 3U9AH 4UE7H 4BXSA 3RLWH 1FPCH 1L4ZA 5K0HA 1HAHH 3K9XB 1MKXH 1RD3B 1PPGE 4NIWA 2BVXH 2SGFE 2RG3A 3OTJE 2BDHA 1F0TA 1O33A 2EA3A 2ZDNA 4DVAU 9LPRA 1SI5H 1Y59T 1C5PA 3ZV9A 1T8LA 4VGCC 5AF9H 2YNBA 1K22H 5AHGH 8KME2 3MNSA 2ZFQH 2AHME 1TOCB 2ZPRA 2W6ID 2KAIB 1DY9A 1DY8A 3MNBA 1IQGA 2QYIA 4ISHH 5GNDA 3GCTG 1V2JT 4FU7A 1BZXE 3UOUA 1VCWA 4CBOA 1KXDA 1QR3E 1FN8A 1J16A 1Y5AT 2BLVA 1ELVA 1VJAU 3FFGA 5EODA 1V2TT 2ZF0H 2BXTH 1ZOMA 5C1UA 2EEKA 1O3JA 2PUQH 1RTFB 2GDDA 2BDYA 2FPZA 3B23B 5HMAA 1HFDA 1GBLA 3AASA 2OLGA 1EOJA 3RXCA 2OC0A 1OXGA 4FVBA 1BJUA 1OWKA 1G9IE 1OWDA 2V35A 3P6ZB 4Y0ZE 4Y76A 1TOMH 2G00A 3SI4H 2HPQH 1SOZA 4FUHA 1W11U 4FUBA 4HTCH 1D3QB 3FAOA 4JZ1A 3E90B 4HI3A 3TJOA 2Y82A 2SGQE 2BOHB 1B7XB 1XMNB 2FESH 2HVYB 2F3CE 2FOEA 4O03A 2NU1E 4I33A 2QF5A 2PP6A 3E6PH 1ZLRA 4F55A 2GCTC 1O2XA 1DX5M 2BLWA 1C5MD 3TNTA 2ALVA 5EQQA 1OWJA 1P9UA 1HJ8A 1UCYK 4HG6A 4A7IB 2FYRA 3GCHB 1BTWA 1C5ZB 1KMHB 1DS2E 2GKVE 3UNSA 1Y3UA 1QJ7B 1PQ5A 1H9HE 2C8ZB 4CHAB 1C1RA 3SJKA 4ZCNA 3HK3B 2CF9H 2I6SA 1TRYA 1A0LA 1UW7A 2Z6BD 2ZCHP 3UAIC 2THFB 1KY9A 4P02A 1CA0B 3QDZB 1VKYA 2SNWA 4X6OA 1O2UA 2D8WA 1UK3A 1AFEH 1D3PB 3NPSA 2ZU4A 1BTZA 3ZVBA 1EZSC 3BG4C 2P8OB 9ESTA 2QCYA 1P3EA 2H9EH 3AW1A 1F0RA 3HATH 1KXFA 3RMOH 5DP8A 5IDKA 1O2ZA 3LH3A 1A5IA 3ZZ3A 4CRCA 1GBMA 2P95A 3D23A 3DHKH 1TPOA 4GHTA 1V2UT 3SGQE 2NU0E 1LHEH 4CBNA 2FEQH 4YM9A 1G32B 1Z8RA 3PRDA 5A8ZA 4TWWA 1ZRKA 1GI3A 2OUAA 2QC2A 2NU4E 1PYTC 1DXWA 3M61U 2B7DH 2BY6X 4ABIA 1KSNA 3PLBA 4IMQA 5DP3A 3MU0A 2P16A 4NA8A 5PTPA 3SU6A 2ZHQH 4WXVA 1BJVA 1ID5H 1P2QA 3MH5A 3VXEH 1YLDA 1ELEE 4BTIB 1O3AA 1GBHA 3F2HA 1WBGB 4YOIA 3FANA 3PLKA 3OFND 1AGJA 5DP9A 2WPLS 1HB0B 1FLEE 2ZO3H 1MKXK 2XOKD 4B71A 5JB9S 3SYJA 2V0BA 6CHAC 2Z7FE 4AFZA 4NWLA 1D9IA 2O8WA 5FCKA 2BY5X 1YPMH 1ZPBA 3RLYH 3U8TH 1MCVA 2BVRH 1THSH 1WV7H 3MI4A 1DDJA 1EZXC 1COWD 1P2NA 1A7SA 3SU5A 1DICA 1SQTA 4B76A 2JH0D 2W6JD 4IW4E 1YPKH 3NK8A 4YT6H 5FPTA 3QGJA 1JXPA 4AORA 1SL3A 3F9FA 5EOKA 1SFQB 2W3IA 4X1QU 4O97A 4HFPB 5F8TA 2OXSA 1RTKA 3RXGA 2ANYA 3A85A 2O9QA 4IBLH 4I32A 1O2IA 4GHQA 2XC0A 3H5CB 1RRKA 3PO1C 1V2NT 2XXLA 3EGKH 1NN6A 1DWEH 1BTXA 1ZHRA 4ZKRU 2KM0A 3BTTE 1O2RA 1O2YA 3L6PA 1W0ZU 4TY6A 1EKBB 3RXIA 4J1YA 1H8DH 1UVSH 3UQVA 1BA8B 4RI0A 1K0HA 1FJSA 2NU3E 2XRCA 1J9CH 1GBFA 1AWFH 3KQCA 3CNRA 2XWAA 3OTPA 2O8UA 4BNRA 3E8LA 1O3BA 4FETA 2FOBA 1H9IE 1QY6A 4K1TA 5HM2A 3C27B 2XC4A 4UFFH 5G4BA 4ASUD 5C67A 4A5TS 4MPVA 5ESTE 3RXSA 5FHTA 1FN6A 1C5XB 2JIZD 1F5RA 1AUJA 3GISB 4NIYA 3A8AA 3SBKA 2H5DA 1C2GA 4IC6A 1BRBE 2ZCLP 3LONA 2GV6A 2SNVA 3V0XA 2BVSH 2IOTA 3Q76A 3M3TA 3RU4D 1MTNC 2OC1A 4R8TB 4OS4A 1Y8TA 1GCDA 6LPRA 1SLUB 2Y7XA 4WJG2 3WW7A 4WY3A 4GCHG 3WY8A 2VNTA 2LELA 2A5KA 1RXPA 1S6LA 1UK4A 1O39A 1PYTD 3E1XB 2ZGCA 5LPFA 4Y8XA 1V3XA 1Y5BT 1GL0E 2FI5E 3KGPA 1CSOE 2HNTF 4BXWA 1P2MA 1NFWA 4A92A 1EAWA 4Q7ZA 1AVWA 2ZTYA 1TIOA 1EQ9A 3T29A 1GI9B 1C4U2 3SU0A 3RXOA 3DD2H 3RXMA 1GDQA 1MQ5A 2ZTZA 1T4VH 3SHCH 2W7SA 3SGBE 2UWPA 2VGCC 1SC8U 3WWFA 3GICB 5FPSA 3QK1A 3SQHE 3GDSA 1VGCC 1ZTLA 1Y5UT 3N7OA 1QBOA 1O34A 1GJDB 4OS2A 1YPJH 4X2WA 4I8KA 1SGYE 5EQRA 5EJZA 1O0DH 2VU8E 2FOFA 1KLJH 2BB4A 2QV1A 5CHAB 1ZJKA 4HGCA 2AGIX 1EB2A 3M5NA 1A5GH 1LVBA 4JZIA 4OGYA 3RXAA 3F0OA 1KYNA 3SV2H 1EXFA 1UTQA 1ELAA 1O2HA 1QL9A 1EAUA 2BD9A 1QJ6B 1C1VH 2FIRH 2R9PA 5F8ZA 1RIWC 1DLEA 3ATLA 7KMEH 1P06A 1W0KD 4MNVA 2WYJA 1TNIA 4ZROA 1IOEA 2R0KA 1A3BH 1SGDE 3UTUH 5DPAA 3M7TA 2DE8A 2ESTE 3K6ZA 1C9PA 1QFKH 3TH3H 1OKXA 2GGVB 4F49A 2LIZA 3WWBA 4ISLA 2R0LA 2TPIZ 3N7DA 2Q1JA 3RXDA 4AGJA 1RTLA 2K1QA 2TGAA 4KTSA 1C5SA 3DSOA 3DSGA 3UIRA 4XE4A 5CHBA 1PFXC 1TE0A 1LMWB 2TGDA 2ZPSA 3URCA 4JZDH 1BBRH 1DUEA 1NESE 1SFIA 1SOTA 3RXVA 5FX5A 5C94A 1GBEA 2WV9A 1BCUH 2VWOA 3QGNB 1BHXF 1QHRB 2JDID 1G3EA 4XBCA 4OS6A 3RP2A 3QX5H 4OS1A 3ELAH 1LDTT 4JZEH 3PWCA 2OBQA 3LGIA 3F1SB 3F2GA 3VFEA 5GXPA 3AAUA 1QBVH 4DCDA 2HWLB 3Q3YA 2SGEE 3FN8A 1FI8A 5C5OA 1FZZA 1JOUB 1TPPA 1SQOA 1BMAA 2GT8A 1SGEE 2VB0A 1S85A 1TNLA 5FBEA 5E8EH 5ABWA 3M7UA 1Q2WA 1LHGH 2AH4X 1DUAA 2Y81A 1W0YH 2Y5HA 4Y10E 3R0FA 4ISNA 4GLYA 3SW2B 4K69A 1W13U 3VB7A 1A0JA 4X1RU 1HXEH 3KEEA 2HOBA 2Y6TA 1IAUA 4ABDA 3GY7A 3LC5A 8LPRA 2ZECA 4CRAA 2WZQA 3UR6A 2QF3A 1HUTH 4JYUH 3SN8A 2TRMA 3DT0H 3JZ2B 3T28A 2GCHG 2R3UA 1UTPA 1K21H 4K8BA 1O38A 4K2YA 5DSFA 1SLXB 1W8BH 1BT7A 1C5QA 2QA9E 3CENA 1B5GH 1AIXH 2G5NA 3UR9A 1NPMA 2A4OA 2CHAC 2GP9B 2ZU2A 1MTUA 3ZVCA 2EI6A 1C9TA 3ODDA 1O2SA 5DN6D 2LP6A 3VB3A 2KCOA 2G8TA 4I8GA 4ABJA 1F0SA 1UO6A 4WWYA 1K2I1 2KCYA 3PMAB 5FCRA 3HGNA 3SQEE 4DOQA 7LPRA 5EW1H 5DP6A 8ESTE 1P57B 1W2KH 1XUKA 2FM2A 5DK1A 1G3DA 1E79D 4MNWA 1ZR0A 5E2OA 3SHAH 1O30A 2BHGA 3LIWA 3E91A 1H1BA 1ZPZA 3A83A 4YESB 4GPGA 2V3HH 1ZMLA 1TWXB 3P70B 1TYNA 3UPEA 4K5ZA 3ZVAA 4D9RA 1C2EA 1GI0A 2CMYA 3W94A 3MNXA 3AW0A 2ZNKH 3UOPA 2VWMA 3AK5A 1TX6A 1BBRE 2AIPA 3KIDU 1GHBG 1UTJA 4ASHA 4U2WA 3KQEA 3Q3KA 4JK6A 1T8OA 1P09A 2I6QA 3DFLA 2PFEA 4X2YA 1H9LB 2HNTC 1UCYH 5EQSA 5J4SA 2D1JA 1K1NA 3VGCC 2FI4E 1GDUA 3MO3A 2ZC9H 3OYPA 4Y8ZA 1DSUA 1MAYA 5EG4A 1BRCE 1FDPA 4K1EA 3EYDA 3RXEA 1ANCA 1P02A 2WUCA 4Q4LA 4MLFB 1L1GA 3LDXH 2A2QH 1ZGVA 1AE8H 1TPSA 3OU0A 3TH2H 5LPRA 1GVZA 1AB9B 1AZ8A 3DFJA 2PTCE 2JJ1D 3QUMP 1W10U 2R2WU 3JZ1B 4Y11E 4QT8C 1KTSB 1XUJA 2R3YA 1HAZB 1FY8E 1MBQA 2FLRH 3MFJA 2RDEA 2DUCA 4INHA 3S0NA 2OBOA 4GUXA 4LOYH 4K8YA 4UFDH 1OWEA 4CREA 1GMDF 5F53A 4MNXA 4E7RG 2PV9B 3BN9A 1PPHE 3DUXH 3F2FA 1P05A 3LT3A 1N8OB 2GX4A 1S84A 3GOVB 1KDQB 2JH5D 3P8FA 5GIBA 1S6FA 1GJ5H 3AVZA 4Y79A 3A7XA 2VJ1A 3SU3A 3LOXA 3VPKA 2JETC 2J4IA 4XRNA 3QWCH 5SGAE 3M3VA 2FS9A 2CN0H 5FAHA 1DANH 1P3CA 2H1UA 2AGGX 1WOFA 2AS9A 1FQ3A 4RSPA 4FOUC 1AWHB 5T6FA 2R2MB 4D7GA 1V2OT 2VIWA 4D7FA 1NBMD 1Z1JA 4BTTB 1MMJN 4NIXA 1KXCA 3S7KB 3S9CA 1AZZA 1FAXA 2BY9X 2BZ6H 1TABE 4ISOA 3QTVH 3ZYDA 2A7JA 4OS7A 1O2WA 1S82A 4A1TA 2J95A 2BD5A 4X2VA 3EE0B 5GCHF 1J14A 2ZFPH 1N6XA 3DA9B 1MU8B 4RKOB 5K7RA 1Z6EA 2CGAA 1ZSKA 1HJAC 2FXRA 1BMMH 1EPTC 1FV9A 1UCYE 3URDA 6GCHF 3SJ8A 2FOAA 1YLCA 1D6WA 1XVOA 2PTNA 3MTYA 3BV9B 1P2IA 3PMJA 2QXHA 1SGQE 1T32A 2A2XH 3VB4A 3FZDA 2YNAA 1GHAF 4XBBA 2WPIS 1HDTH 4B2BA 4AZ2B 4AYYB 1Y3YA 4DG4A 1IQIA 4CR5A 1ZSJA 3OY5U 1JIMA 1LQDB 4NWKA 4MPWA 4MQAA 1MD8A 1AFQC 1EX3A 1IQNA 1L1NA 1YPHC 1C2HA 3D49H 1GMHF 2BX4A 1GCTB 1SGIB 4RT1A 3EE7A 2C8XB 2RFKC 1PPZA 1PPFE 1KXAA 1O3DA 2NU2E 2WPJS 1FAKH 1HAOH 3M37A 1ARBA 2L74A 1EP5A 5T6GA 1PQAA 4FUGA 3F6UH 4H6SB 4X6PA 4R0IA 1O5BB 2BDIA 1BB0B 2NWNA 2SFAA 4E06H 1MABB 5DP4A 5FX6A 4D9QA 2Z3DA 4IC5A 1SGRE 2BQ6B 4AG1A 1ESBA 1C5LH 1W14U 3A7VA 3SORA 5GDSH 2FS8A 4AFSA 1E34B 1EZQA 2QE7D 1BTYA 1GGDC 2KX4A 1L1JA 1V2ST 3BEUA 1QB9A 4ABAA 1GMCF
chains in the Genus database with same CATH topology
1EOLA 3MH6A 4Y7BA 4XSKU 3NXPA 1C2MA 3T5FH 1SG8B 1IHSH 3SNAA 4CH8B 3TK5A 1WUNH 2ASUB 1GJ7B 3RM2H 3SNEA 3ZV8A 2F9UA 1TBZH 3A88A 1GBBA 1CGJE 1YC0A 4KTUA 2B0FA 1INCA 3ZVEA 2UUJB 1F2SE 2ANKH 1QCPA 1OPHB 2ZQ1A 1PQ7A 2ODYB 3UQOA 3ATMA 1E37B 4X6MA 2BD2A 3BG8A 2ZHDA 1GJAB 3O8BA 2A31A 1Q3XA 1D3DB 2XBYA 1VITF 4M7GA 1XKBC 2UUFB 1ZSLA 2PKSC 3AAVA 1P2JA 1O5GH 4TPIZ 1O3IA 2CF8H 2A7HA 5E0JA 1HAIH 1HAVA 4I8LA 3NUMA 1MZAA 5L30H 3RXRA 3BF6H 1Y3XA 1EJMA 2G4UA 4PROA 3ZYEA 2GDEH 4U01A 2G55A 3ZZDA 5I25A 2AFQB 3BTDE 4XBDA 1C5UA 1C5TA 1AUTC 4ZKSU 3MH4A 2A4RA 1DOJA 1K28D 3TLOA 3PWBA 4FUJA 5LH8A 2A45B 2P3TB 3RMNH 4YT7H 3Q3XA 4DJZB 3GCHC 8GCHF 1GG6B 1CQQA 2SGDE 1XXDA 1O3EA 2ODQA 3ZZ6A 5BPEA 1K1MA 1AQ7A 1E0FD 3RXFA 3SV9A 5HM9A 1IQLA 1ESTA 2BOKA 4AFQA 1CA0C 3HKJB 5C2ZA 5JBTA 1UHBA 1ZRBA 4KTCA 2PGBB 3MHWU 1GHWH 2PWXA 5TCCA 1ARCA 1GHVH 4XDEA 2F9VA 3LJJA 1XUFA 1ABIH 1AVGH 1AY6H 1LTOA 1ZTJA 3UUZA 1GPZA 1GBCA 1PJPA 3FP8E 3BTME 4DURA 1ELDE 3BSQA 2VWNA 4X1SU 5CMXH 1O2KA 3ESTA 1DPOA 1K9OE 2H9TH 1LKBA 3Q00A 1CT0E 1W7XH 5GJ4B 2P93A 4YZUA 1CBWB 2FZZA 2FDAA 1GBIA 4NFEA 4UFEH 3EA8A 2P94A 4JZFH 1LKAA 1MU6B 2FX6A 1J15A 1V2VT 1ZPCA 1BMLA 2XCFA 4I8HA 2C4FH 3O8DA 3U1IB 1FMGA 1Y3WA 1QQ4A 1XKAC 1WSSH 3PTNA 1EUFA 1NO9H 1TLDA 1YF4A 3MWIU 3ZZ5A 4J2YB 1ZGIA 4X8TH 4BAQB 4DY7B 1NT1A 3BIVH 2STBE 3LKWA 1K1IA 1EJAA 1FIWA 4WMDA 1QRXA 4GSOA 3T62A 3PMHB 4U32A 1X7AC 2TGPZ 1M9UA 2Y80A 2XYAA 3RXJA 3RXBA 1C1QA 1C1TA 3EAJA 1LO6A 1OWIA 4ZHMU 1MTWA 3RXPA 3PB1E 4ZHAA 3O8RA 1TNKA 3HPTB 4K60A 2FOMB 1G3BA 3TK9A 1QTFA 4X1NU 4ZAEA 3SUEA 1S81A 3RU4E 2OP9A 4LXBH 1GI1A 3VB6A 5GWZA 4AB8A 3D65E 4GVUA 2SGAA 3RMMH 3TGKE 3B9FH 3D62A 2OQUA 2ODPA 1C5OH 1CHGA 2AMDA 1HAVB 2ZZUH 4Q7XA 2Q6DA 4JYTA 2ZU5A 1T4UH 4AOQA 4NSVA 1HJ9A 4FU8A 2QN5T 5C3NA 1OOKB 1HPGA 3VXFH 3QLPH 2UUYA 1MUEB 4Q2KA 1O5AB 1K1JA 5E0GA 5C5NA 1NU9A 5DP7A 4NCYA 2GMTB 3PYHA 1HNEE 1HGTH 1K1PA 1S5SA 3SU4A 1P11E 5I46H 4D76A 1IQFA 4MVNA 1FXYA 4JMYA 3V12A 2ZGJA 1UTLM 1O2JA 3ZZBA 4TPYA 1V6DA 2HGTH 5CE1A 3KQDA 1H8IH 3BTFE 1SGFA 4WXIA 4A1VA 1G2LA 1JWTA 1ZHMA 3UWIA 4WMEA 2VVUA 1L4DA 1F7ZA 2XBWA 1CE5A 1UHBB 2BXUH 3M36A 1TAWA 4GAWA 1QRWA 4O3UA 3A84A 1NS3A 1BTPA 1G3CA 1GBTA 1LHDH 3MYWA 3P92A 2BD7A 2WV5A 1O2NA 2M5TA 3TGJE 5FPYA 1C5WB 1UTKA 3RC5A 4ABGA 2AEIH 3TITA 3A8DA 4ESTE 1XVMA 2IJOB 1BTHH 1C5VA 4ABBA 1SVPA 2WPKS 3ODFA 4Y0YE 5DJ7A 2CXVA 3VB5A 5A0AE 2J9NA 2FODA 4B1TA 2BYAX 1TFXA 1C5RA 1YKTA 3TPIZ 1PPCE 1KDQA 3L3TA 1CU1A 1UTMA 2QGRA 1O2MA 1SMFE 1LHCH 1OX1A 4DIIH 1O3MA 4IGDA 1AMHA 1W7GH 3ZZAA 1O36A 3UFAA 2ZEBA 1RS0A 3MNCA 1ELBA 1O2PA 3GCNA 2A32A 1P04A 4OS5A 3VGCB 1NRNH 1GJ9B 1QNJA 2ZP0H 2WINI 2TGTA 2PHBA 2OCVB 2BM2A 5L6NH 1GJ6A 5CHAC 3QZRA 3P8GA 4H4FA 1BIOA 4X0WU 1E36B 4NA9H 3E3TA 1C1NA 1GI4A 4X1PU 1SGTA 1NZQH 3RDZA 1Z7KA 2F9NA 3CS0A 2XNIA 4O9VA 1F5KU 1Z8GA 3HKIB 2AYWA 2F9OA 4MTBA 3MMGA 3L33A 2VIQA 4Q7YA 3ZVFA 1GI5A 2FO9A 3SZNA 2RA0A 1C1UH 1WQSA 3A7TA 3EA7A 1OP0A 2LNCA 2BD8A 1HV7A 1THRH 2C8WB 1DITH 4FVDA 2BQWB 3SV7A 2BDAA 2FOGA 1SHYA 5JBCS 2G51A 2JH6D 1GI8B 1XUGA 1ANEA 5J4QA 1AE5A 1GMDG 4ZH8A 3RC6A 3NZIA 1JBUH 5IYTA 4DGJA 5A0BA 3TIUA 4KGAA 3BTKE 2WPMS 2VH6A 1GI6A 1S0RA 3TVJB 2WUBA 3TH4H 2GTBA 2AMQA 1EAIA 1WCZA 2RCEA 3MO6A 2F9BH 1NRSH 4KKDA 4WH6A 2FMJA 1TBQH 3U1JB 2QAAA 3KQBA 1V2MT 4OGXA 2Z94A 2FP7B 1AKSA 1O35A 2XW9A 2FTMA 3T26A 3ATKA 3LC3A 1GVKB 1MD7A 1QB6A 4NFFA 4ZKNU 5A2MH 1RGQA 1QA7A 4Y8YA 1TX7A 2ZFFH 4VGCB 1YBWA 4D8NA 3PTBA 4U30A 3GY8A 3PROA 1NRPH 1CT4E 2BY7X 1T31A 2W3KA 3RMLH 2QIQA 3M5MA 1QGFA 1FIZA 2ZDAH 1YYY1 1F5LA 1MTSA 1V2WT 5EXMA 4UFGH 2OD3B 4JYVH 3EBNA 2W26A 1A61H 1UVOA 2ZCKP 4E7NA 2ILNA 4NGAH 3LGTA 4Z0KA 1NFUA 1D4PB 1DWCH 2ZQ2A 2UWOA 3PMBB 5GCHG 1LPZB 1SR5C 2VVCA 4JK5A 1DWBH 3LPRA 1GJBB 1Z1IA 1NTPA 1EATA 4X8SH 1XX9A 1UVTH 3W95A 4X2XA 6GCHG 3UREA 2D2DA 1C5NH 2XC5A 3ZZCA 2ZFRH 2QF0A 1C1MA 3NKKA 1CHOF 1GHAG 2ALPA 3KNXA 1Z6JH 1GBKA 1A2CH 2ZG0H 1BOQA 4FUCA 3RXHA 3S9AA 3KHVA 1BRAA 1QRZA 1MZDA 1O2QA 2RA3A 1TA6A 1T8MA 1G30B 2GCTB 1H4WA 1KLTA 2D26C 3VEQB 2YOLA 3BTGE 1AHTH 3MOCA 2ZTXA 2FOCA 1GMHG 2EI7A 1EJNA 1GBJA 1HBTH 1HYLA 3QZQA 3MU4A 1FPHH 3P17H 1LVOA 2J2UA 4THNH 2GZ8A 3F9GA 4E05H 2ZFTA 1UVUH 4Y71A 1TA2A 3SJIA 3STIA 1TGTA 2V6NA 2PLXA 2BX3A 5DKMA 2ZGXH 5A8XA 2OC7A 1TRNA 1P8VC 1ZYOA 5T3HA 3SJ9A 5HXFA 4AYVB 3BG4B 1GBAA 1FY5A 3SUFA 1GGDB 4F4OC 3R3GB 1C1SA 5E2PA 2A5AA 1S83A 2W5EA 2ZGBH 1UMAH 4LZ1H 4K3JA 1O3GA 1ELTA 1OYTH 2P59A 2ZHWH 3TU7H 1YCPM 5DGJA 1K1OA 1GMCG 4SGAE 3LGWA 4BAKB 1C2IA 3LGUA 1C2DA 5JBAS 1L0ZA 1AB9C 1GBDA 3ATIA 3PLPA 5T6DA 4BAMB 3K6YA 3EDXB 1PPEE 2XCNA 1WU1A 3F9EA 1C2JA 4WH8A 2AGEX 2H9HA 4CRGA 1P03A 1AKSB 3RUOA 4A1XA 2BD3A 1T7CA 1CGHA 1QL7A 2B5TB 2PKSB 1TALA 1PQ8A 2ZU3A 1D6RA 3RXTA 1N8OC 3SI3H 2PGQB 3G01A 6CHAB 2K7XA 3TJVA 1VITG 3V7TA 1ZMNA 2BTCE 4AG2A 3KCGH 2ANWA 3BEFB 1NC6A 4X8VH 1MCTA 3GY5A 1AI8H 1DFPA 4LZ4B 1Q31A 3ITIA 5GPIB 5DG6A 5DO4H 1O3HA 2O8MA 3GY4A 1IQHA 1ESAA 2G4TA 5DP5A 3QTOH 4MPXA 2A4GA 1BUIA 1F92A 1DM4B 4ZUHA 1SSXA 2HNTE 4O3TA 3B8JA 2Z9JA 1IQMA 1N1LA 3TGIE 2GD4B 3A87A 2BDBA 3SNBA 3MU5A 1O3CA 1HRTH 2VIOA 2XBVA 2QXGA 1TNHA 2C3SA 3ZVDA 3F9HA 1SLVB 5C1XA 1YCPH 3GCTF 2VH0A 4DW2U 1ETSH 2HRVA 1UTOA 5EPYA 4AB9A 8GCHG 5ESBA 1D3TB 3PO1B 1E35B 3SGAE 1FY1A 1DE7H 2XWBI 1TQ7B 1V2RT 4ABHA 1O3FA 4LK4A 1CVWH 2A4QA 1NY22 1HAPH 1A0HB 3U98H 4AGKA 2Z9LA 3GDUA 4RKJB 1O32A 2ZI2H 1O2VA 1OP8A 5JBBS 1P2KA 1A4WH 2G52A 1KLIH 1F0UA 1KXBA 2FI3E 2UWLA 3FP7E 3E0PB 1A46H 1ANBA 4HZHA 1LQEA 4INLA 3Q77A 3OX7U 3I29A 5EPNA 3ATWA 2BMGB 3V3MA 2SGPE 4CRFA 2B8OH 5F6MA 3A89A 2EC9H 1SBWA 3QO6A 3SU1A 1WYKA 1CGIE 3U69H 1WQVH 1GJ8B 1GHYH 2G5VA 2PSYA 2WYGA 1NFXA 1WTGH 1OP2A 1SGPE 1MTNB 2CJIA 2ZDMA 3EQ0H 2XBXA 1JRSA 1Y3VA 1ORFA 1WTHD 2EI8A 2OINA 1UVPA 4TWYA 2B9LA 2Z9KA 1FY4A 2CV3A 1PPBH 3TK6A 1O3LA 1LHFH 2XTTB 1TQ0B 2ZHEH 3F68H 4I8JA 1GCTC 1HXFH 3TJUA 4UEHH 4DT7B 1LCYA 3NWUA 1HIAA 1NROH 3RU4T 1AO5A 1KIGH 2Z9IA 3I77A 3A80A 3GYLB 2ZGHA 1NFYA 3T2NA 2TBSA 1S0QA 2BDGA 4CHAC 2F9PA 1O5FH 1THPB 4YLQH 1CA8B 1QIXB 1V2KT 2GVFA 5F8XA 4I7YH 4Q80A 1IQEA 4ISIH 3FZZA 2O8TA 4RN6A 2VGCB 1VJ9U 1ACBE 1BRUP 1J17T 1VZQH 2BQ7B 1VGCB 4IN2A 2P8OC 3SOSA 2LPRA 1LPGB 2Z3EA 2BY8X 2IPHA 3SUDA 1C5YB 4B74A 1TPAE 2C90B 1P01A 4FUFA 4AX9H 1AD8H 4YTAA 1FUJA 3CS7A 3CP7A 2FLBH 1AU8A 4X6NA 2FX4A 2P3FH 1O5DH 1TMUH 2VIVA 4BOHA 2Y5GA 1RIWB 1C2FA 4ZXXH 2ZU1A 4FUIA 4FUEA 3LU9B 1IQJA 1P9SA 2FYQA 4NZQA 3BIUH 1TMTH 1YPHE 1NM6A 1VCQA 4AN7A 1FY3A 4BANB 2G81E 4IS5A 1WAYB 3GDVA 1YPGH 4WF8A 2GZ7A 1TGSZ 5A09A 1SLWB 1HAGE 3A8BA 2O8LA 4NIVA 4H42U 2BLQA 2FWWA 2QXIA 2TIOA 2Z3CA 1ELFA 1Z8IB 4MG3A 1AN1E 1QB1A 1Z71A 1YCPK 1IHTH 4KP0A 5B6OA 1ZZZA 1NRQH 1SGNE 2STAE 2ANMH 2C8YB 1UJ1A 1P10A 1SPJA 3BEIB 5AFZH 1E38B 3UWJH 1DSTA 5EXLA 1OSSA 5HYOA 2W7UA 4CR9A 1XUHA 1QURH 1TNJA 1O5CB 1XM1A 2VIDA 3MH7A 3LJOA 1MTVA 3ZVGA 1GG6C 1EP6A 5H4IB 2ZPQA 3P95A 2VINA 3SO3A 2BLOA 1JMOH 3T27A 2Q6GA 3QN7A 1EB1H 3S69A 1C1WH 1G2MA 2ZDKA 2H6MA 1O3PB 1P12E 1ELGA 3M35A 4B73A 1P2OA 2PUXB 2ZHFH 1HLTH 5JYIA 2OC8A 3SUGA 1GWAA 3SV6A 1RFNA 1SGFG 1V2LT 3ZZ4A 1A5HA 3UNQA 2HALA 4NG9H 3H7TA 5JPMH 4YLUA 3TJNA 2A5IA 3A7YA 2F91A 4MPUA 1ZTKA 4IMZA 1GVLA 3EA9A 2ZIQH 2DE9A 4FUDA 4MDSA 4ABEA 3SNCA 1HIAB 2QXJA 1CBWC 2CHAB 3IG6B 5TCAA 3ENSB 1MAXA 1RJXB 2J34A 3A86A 1TONA 2Z9GA 1G36A 4BAHB 1T8NA 1MKWH 1EAXA 2UUKB 3PM3A 2ZDVH 2IN2A 4GCHF 3KF2A 2VVVA 1SQAA 2BZAA 1S6HA 4YOGA 1GJ4H 1O5EH 2PKAA 4CRDA 4B2AA 3BTQE 4WMFA 1O3NA 1GDNA 2WPHS 1CT2E 1YP9A 1EPTA 4BTUB 1C4V2 4TY7A 3RC4A 1YPLH 3S9BA 1B0FA 3S7HB 3I78A 1C2KA 3FVFB 5E0HA 4ABFA 1GJCB 3LGYA 1TRMA 2OTVA 1P0SH 1KTTB 4JCNA 1XXFA 1YPEH 1BTUA 3SJOA 1MQ6A 1TGNA 3PV4A 3U8OH 4H6TA 1MH0A 3MO9A 3O8CA 5L2YH 2VWLA 1LVMA 3GY3A 1FNIA 2ZDLA 1NU7B 4INKA 2FOHA 2ULLA 1ZHPA 5EXNA 1CO7E 4ZHLU 1QJ1B 2H2ZA 3M7QA 5C1YA 2FTLE 1HAYB 1OWHA 1ANDA 3RM0H 3RXLA 2A1DB 4IN1A 4YOJA 1ZJDA 4CH2B 3A8CA 3P8NA 3V13A 4KELA 2GT7A 1GI2A 3BTEE 1J8AA 5BRRE 2A0QB 1QA0A 3M5OA 5JDUB 2PSXA