3V13A

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 61
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v13A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v13A02
1P9SA 2A4OA 1O3LA 3RC4A 2G52A 1V2JT 3M3VA 3BTEE 4UD9H 1T4VH 2QYIA 3LDXH 4NFFA 2PFEA 3TIUA 1BMNH 4F4OC 6GCHF 1HBTH 1ANEA 2G55A 4YZUA 1HAVA 3ZVAA 4AZ2B 4VGCB 1O2UA 5JYIA 1GDUA 5DP8A 3LPRA 4DVAU 2Z9IA 3MH7A 3A81A 1HGTH 1XUIA 2PGQB 3U1JB 2PW8H 3M5LA 1VITH 1HXFH 3KCGH 3PM3A 5L6NH 3N7OA 2ZDLA 4IS5A 2HGTH 5DP5A 1VCQA 1OXGA 1LQEA 2XC5A 1O2JA 1ELAA 2ZU3A 3TJVA 3KNXA 1L1NA 3BG4C 1O38A 3S9CA 2IN2A 1IQNA 1IQJA 1MAYA 3QK1A 2BY9X 4B71A 2GDEH 1C5TA 2ZDKA 5FCKA 2G4TA 4TPYA 4XBBA 1B7XB 1TNLA 1MD8A 2PSYA 1OWHA 2WYJA 3RXLA 1TYNA 4BAOB 1DSTA 1SGFA 1VJAU 1KXCA 4CHAB 2J4IA 2BVXH 3SUGA 3PWBA 3SUFA 1A0JA 5LGOA 1RRKA 3ZYDA 1LPKB 1QHRB 3LJJA 1DOJA 3GOVB 4AN7A 2CGAA 1QURH 1HLTH 2ANWA 1OOKB 4WJG2 1GI4A 3UWIA 4ZKRU 3MNCA 1BIOA 4ABAA 1SHYA 2Z6BD 3RXEA 4X1SU 3SI3H 1RTLA 3MNXA 4Q7ZA 1V2RT 1A3BH 1O32A 2OCVB 4ZXXH 2AMPA 1ETSH 3VXEH 1C5ZB 1XMNB 3F9EA 5G4BA 1O31A 1DX5M 1Y3VA 1K1JA 2OC8A 2P3UB 3ATLA 3ZV9A 1WTGH 1XKAC 2BYAX 1BTZA 1LQDB 5T6FA 1SGNE 5FBIA 5F8TA 1AFQC 1O3DA 3K6YA 2ILNA 3BIVH 3AAVA 1AHTH 3BV9B 1GJDB 4FUDA 2UWPA 4B2BA 4YESB 4ZHAA 1LHFH 1IQLA 2B8OH 2BD2A 3S69A 3SW2B 4ABJA 2JH5D 1IAUA 2ZTYA 1IQHA 4AOQA 1AZ8A 1DWBH 1GCDA 3C1KA 3GY2A 3SV6A 2FIRH 3ZYEA 4IC5A 1CVWH 3AW0A 3PMBB 1EOLA 3D23A 3SHCH 4CR5A 2SFAA 1A46H 4MVNA 1O3AA 3RXOA 4WH6A 1CGHA 4HFPB 2W26A 1HRTH 2CV3A 2GZ8A 2GD4B 2P3FH 2C4FH 2VIPA 5EG4A 3UQOA 4UFEH 3SNEA 1WAYB 4X8UH 1NFWA 4BOHA 2FOMB 3VB3A 4U01A 1W0ZU 1QJ1B 2BQ6B 2JETB 2C8YB 3BTQE 4TWWA 1O3MA 3SJ9A 1KLJH 1J17T 2SGPE 1JBUH 4LXBH 4DW2U 1KLTA 2ZCLP 1G3BA 1KYNA 3HK3B 1PFXC 3VB6A 1C1QA 1G3EA 3A8DA 4FVBA 5LPRA 3QWCH 1EAUA 2SGDE 3D62A 1G32B 1LHCH 1CA0C 1WBGB 3UTUH 1CGJE 4NSYA 1G36A 1RTFB 1GL1A 1QTFA 1O3BA 3JZ1B 2BY7X 7GCHF 3RXTA 2Q6FA 4ZH8A 2AIPA 3P17H 1ELCA 1FN6A 1QCPA 1GBDA 3RP2A 2CMYA 3CP7A 1W3CA 3VPKA 1TRMA 1SMFE 2HALA 5I25A 1JRTA 3EA9A 1XXDA 4ZROA 2VVCA 1T4UH 4CRAA 1EPTA 2J9NA 2ZFTA 3E90B 4AB9A 3U9AH 1YYY1 5HM2A 5F03A 5TCAA 2ZU1A 1F0UA 2ZKSA 1TONA 3DA9B 5GPIB 1IOEA 2AEIH 5LPFA 1Z71A 1Y3UA 3SHAH 1EASA 4TPIZ 1RJXB 5GDSH 1MD7A 3P8FA 4HI3A 2OBQA 1QA0A 2Q1JA 4WMFA 1ZRBA 1KXBA 2FOEA 1UVTH 4MNWA 2Q6GA 1KIGH 5C67A 3A7WA 3QX5H 1SGFG 1SLVB 3QZRA 2Y6TA 1UMAH 2TRMA 1P3CA 1TPPA 2F9OA 1DM4B 5EXMA 1HDTH 1MBQA 5JB8S 1DS2E 2FOAA 2PV9B 3FAOA 1K21H 3MO6A 1P2KA 1GHWH 3K2UA 4Y8XA 4QT8C 1YBWA 3L6PA 1FMGA 1HAYB 9ESTA 1GMDG 2F3CE 3SO3A 5DO4H 2F9BH 1UCYE 5E0HA 2ZF0H 1ANDA 4I8JA 1MBMA 3KEEA 3DFJA 1YPKH 3O8RA 3FZZA 4Y11E 3R3GB 4CRDA 3Q3XA 2TGPZ 1P05A 3DD2H 1C5PA 1PPZA 2GV7A 2CF9H 1DLEA 3MHWU 1MKWH 4DGJA 3RUOA 3TITA 5EQSA 4OGYA 1C5LH 1XXFA 4X1RU 4I8HA 2BVRH 1ZSJA 5A2MH 4K69A 1QB1A 1V2TT 3A8CA 1PYTD 4ABGA 4CHAC 3UIRA 3F1SB 2G5NA 4I8GA 2O8TA 2ZFRH 3BF6H 3MYWA 2RA3A 1NT1A 2ANYA 2Z3DA 3I29A 1FY5A 1AY6H 2HPPH 1F92A 1FV9A 2YNAA 3AAUA 3UOPA 1O3HA 1C4U2 1THPB 3ELAH 1MKWK 4B2AA 5TJXA 2QV1A 1XVMA 1OWKA 3SU0A 1GVZA 5HM9A 1C1UH 3RC6A 4NSVA 1L2EA 4WH8A 1QQUA 1TLDA 2QXIA 1DLKB 1O2RA 4OS1A 1SHHB 1VITF 3RMLH 1ARBA 2K1QA 2EI8A 2Q6DA 3T29A 3U1IB 1VZQH 2ALPA 1S83A 1OWIA 4D9QA 2IOTA 1SOZA 3GCTF 1O5FH 1S6HA 1TIOA 3A8BA 7LPRA 2HNTC 3CS7A 2FOCA 4ESTE 2WINI 1BBRH 1C2LA 4UE7H 1E35B 1XUFA 1E34B 1O3GA 1GBTA 1KDQB 4LZ1H 1PYTC 3U8OH 1KDQA 1CT2E 4AGKA 2VB0A 3NZIA 4IBLH 1GL0E 1ZHRA 2QIQA 1BRCE 2AERH 1GGDB 2OQ5A 3O8CA 6GCHG 1TB6H 1BMAA 1NRPH 2Z9LA 1LVBA 3ATKA 1UTLM 2BDAA 3TH4H 3UR9A 5E2PA 4H4FA 1XM1A 1DY9A 4KTSA 2HPQH 2ZHQH 2PSXA 1UO6A 1P2MA 2BD3A 5LH8A 3A7YA 3BEUA 5A0BA 2FEQH 3M61U 5HMAA 4X0WU 1TNHA 4B75A 1K1NA 3TNTA 2P8OB 1C5MD 1D3TB 3HK6B 1SQTA 3HKIB 2JETC 5I46H 2WPMS 2BD9A 2ZQ1A 2BQWB 1ACBE 1O2IA 2BDGA 2QC2A 3KQDA 1G9IE 3RXJA 1F5KU 3E0NB 1C1RA 1F0TA 1SL3A 3O8BA 2ODQA 4NFEA 1IHSH 5DKMA 4INKA 4BAHB 5ESBA 3LJOA 1PPGE 4CH8B 2DE8A 1P57B 3LC3A 4X2VA 2PTNA 4R8TB 3S7HB 2VGCB 3MU1A 3P8NA 2VH0A 1AKSB 2FO9A 2ZGCA 1NS3A 1CSOE 1AKSA 1GJ4H 1O3KA 2R3UA 2ZGBH 4LOYH 5B6OA 4LK4A 4JYTA 1O37A 4IC6A 2HVXA 3FVFB 1V2MT 2BZ6H 2BLQA 3UNQA 1O33A 5CHAC 4ZKNU 2VVVA 3ZZ9A 4D7FA 3UPEA 1C5VA 2TPIZ 1BOQA 1LVMA 4FVDA 2WUCA 2TBSA 1W10U 2BOHB 4JZIA 1AUJA 1K22H 1HJAB 3W94A 1ESAA 1O5BB 4B74A 2ULLA 2BXUH 1C5UA 1GCTC 1Y3WA 2FLBH 4GAWA 4K5ZA 1V2QT 3PLKA 1CBWC 4I8KA 1JWTA 3U8TH 3GDSA 1GBJA 2C90B 3MU5A 3M37A 4E7NA 1E0FD 2Z9JA 2FPZA 1RGQA 1P2OA 2VU8E 1SGDE 4D8NA 3T62A 2B5TB 5TCCA 3CS0A 1S0QA 1FQ3A 1QRWA 4MNXA 1HFDA 1QL9A 4FUBA 5EW1H 2VIDA 3SU5A 2D2DA 5FBEA 4YTAA 2BDBA 2WPIS 4ISHH 4ISNA 1K9OE 1WOFA 2GX4A 3NUMA 1YP9A 1BTWA 4NCYA 1TPOA 1P8VC 1YPLH 3A88A 3RLWH 1BTHH 1S5SA 1UVOA 3SV9A 3NXPA 4X2YA 4JZDH 1GJ7B 1S85A 3LGVA 3UOUA 1TQ0B 3KQEA 2EI6A 3SV8A 3S9AA 1S0RA 4DIIH 1EUFA 1O34A 2J94A 1ZRKA 1OYTH 1PQ8A 1Y5BT 2DE9A 2QXHA 1N8OB 2CN0H 2AYWA 1ZTJA 5HGGA 2W7UA 3LGUA 1HAOH 5JDUB 3DHKH 4MNVA 2Z3CA 4K1EA 1BMMH 4GCHG 1DITH 2GDDA 3F9HA 1TPSA 1SFQB 5DP9A 3KF2A 3BTDE 3GCHC 2SGAA 1OWJA 1FZZA 5DPAA 3V0XA 5JBAS 1TWXB 3BTGE 1GJ8B 1BTXA 3PLPA 4XBDA 3SQEE 4ABFA 1MAXA 1PPBH 3SV7A 4FUHA 2R2MB 1GG6B 3M35A 2ASUB 1O2QA 4H6SB 7GCHG 4SGAE 4NZLA 3D65E 2FZZA 1AWHB 1SGPE 1AVWA 1O2VA 4AX9H 4R0IA 1TE0A 5ABWA 1HAIH 3EA7A 1T8MA 3DUXH 4K8YA 1HAVB 1P2JA 2OQUA 4I32A 3ZZCA 4XBCA 1C2EA 2BX3A 1P04A 1TOMH 4Y76A 3RC5A 2OP9A 2J38A 1GBMA 4ZMAH 1YCPM 5H4IB 1FY4A 1ZMLA 2ZFPH 1OPHB 4JMYA 4O3UA 4NIYA 2F91A 2J92A 4OGXA 2B0FA 2PTCE 3PB1E 4DURA 1QL8A 3BSQA 2H6MA 4RSPA 3PTBA 5BPEA 3ZV8A 3SU6A 1DWCH 4AG2A 3M5MA 1GHXH 2J34A 1TGTA 2C8WB 2FOBA 3Q3KA 1HAGE 4IN2A 2ZTZA 1C1WH 2D26C 1K1IA 3TJNA 2ZU5A 1XUKA 1UTMA 2ZP0H 5K7RA 1FXYA 1GBCA 1O2WA 2HOBA 4FUCA 2FYQA 1A5GH 3GICB 3MO3A 5FCRA 2Y5FA 2RG3A 2A4RA 1BT7A 3SGQE 2XCFA 1TGCA 1TBRH 1SGEE 2EEKA 4H42U 3V3MA 1P3EA 4WY3A 1CHOF 2VJ1A 1NTPA 1C5RA 2V35A 2ZGXH 1THRH 1Z7KA 3HGNA 2QGRA 2SGFE 4A7IB 4AFQA 4BAKB 3SNAA 1H9HE 1QBNA 1EAWA 4MG3A 2FX6A 2D8WA 3EGKH 3STIA 2GZ9A 2P8OC 2QF3A 2P3TB 3KL6A 3F6UH 1G2MA 6CHAB 1EZXC 1YM0A 1MTNB 3TGKE 5A8ZA 1GBHA 2YOLA 2WPLS 1UTPA 1ZOMA 3VB4A 3SORA 6LPRA 2ANKH 3F68H 4GPGA 4U2WA 2SNWA 1SR5C 3AW1A 1SB1H 5FPSA 3E8LA 1UK4A 2GVFA 4ZKOU 1DVAH 3PMHB 4XSKU 3MH4A 4FUFA 2EA3A 1SOTA 1NZQH 1ZZZA 1O3NA 2BDCA 3GY7A 4MPVA 1DDJA 1W0YH 5AFZH 3V13A 3VFEA 2WPKS 1GJAB 1LHGH 1NRRH 1K1MA 2VIVA 1P2IA 1O2SA 4BAQB 1ZYOA 3GYLB 2PGBB 4O3TA 2ZHFH 2WYGA 1QGFA 2ZCKP 4NIVA 1S6FA 1KY9A 1UVPA 1EQ9A 3ZZ7A 3TGIE 1GHAF 5AFYH 3M5OA 2ZCHP 2AH4X 1DY8A 5GCHF 1NESE 3B8JA 8GCHG 3BG8A 1H8IH 1BTYA 2NU1E 1ZHMA 3GCTG 2CJIA 1ELFA 4YOIA 3Q77A 1FPCH 3LH3A 2Y7ZA 2V0BA 3SNDA 1GI7B 2FTMA 3M36A 1A3EH 2H9HA 2C8XB 5FXLA 2H2ZA 2WV4A 1NRQH 1GI9B 1J16A 2XWAA 3VEQB 1TAWA 4FUEA 3T27A 3MTYA 5E2OA 8KME2 3QTOH 1TNGA 3GY3A 1D6RA 1DUAA 1F5RA 1C5NH 1GI8B 5L30H 1AU8A 1QRXA 3SJ8A 2QXGA 3P92A 1H4WA 3UREA 4B2CA 1C4Y2 2VWOA 5EXLA 4ISLA 1TBZH 2H9TH 1C5OH 1DWDH 3SU1A 2H1UA 1C5YB 4YO9A 2Z7FE 1W2KH 1BB0B 5FX5A 2BB4A 1UTOA 1O35A 1O5CB 3PV4A 2Z9GA 4DG4A 2BD4A 3E0PB 4B1TA 3SOSA 3S0NA 2W3IA 1A5HA 1ABJH 2TIOA 2ZC9H 3A83A 1QRZA 3QO6A 3A7ZA 1EPTB 1NFYA 2UUKB 3HGPA 5DJ7A 1VJ9U 4MPUA 2FOGA 2ZDVH 3GY5A 4WWYA 4A5TS 5JPMH 1MZDA 1ZTLA 8ESTE 3RMNH 8LPRA 2BZAA 1D3QB 2P93A 2ZECA 2VVUA 5EU8A 3E1XB 3VXFH 2W3KA 3KQBA 3P8GA 1IHTH 2Y81A 2F9NA 2ZI2H 4K8BA 1SPJA 1TX7A 1BMLA 1C9PA 4ABBA 1L4ZA 5EW2H 2G8TA 3UUZA 4O9VA 2XBYA 3ENSB 1TMUH 1GG6C 5AHGH 4XFQA 1KXFA 4X1NU 1GMHG 4X6MA 1QB9A 2LPRA 4BXWA 3A8AA 4ABDA 1SG8B 5DP4A 1GJ6A 2IJOB 1XX9A 2A45B 3A82A 1Y8TA 5C1XA 1C1NA 5EGMA 3B9FH 3UY9A 4YLUA 1PPCE 4VGCC 3SN8A 1J14A 3RU4T 3ZVFA 5J4QA 1Z6EA 2ZEBA 3MH6A 1NFUA 1K1LA 2ZPQA 1SGRE 5C1UA 3RXIA 4UEHH 3UNSA 1ZSKA 1J9CH 3RXGA 3BTFE 1BRUP 1ZR0A 5BRRE 1AO5A 3GY8A 1Z6JH 5C2ZA 5JBCS 1RTKA 1P12E 1P9UA 2WV5A 1P10A 1GHVH 3F9GA 1YPHC 3EQ0H 3PO1B 5J4SA 1BJVA 3LONA 1C1SA 1A2CH 4Q80A 5DP6A 3M7UA 1GBKA 1INCA 1GBAA 4UFGH 1C2GA 2AGGX 1G30B 5FHTA 1BHXF 1W7GH 4I8LA 1AD8H 2ZZUH 1GI6A 3NCLA 1YF4A 1V2UT 4TYDA 1ANBA 3RXCA 1ABIH 3GDVA 4KGAA 1RIWB 4BXSA 1P03A 3A87A 1A0LA 3QLPH 4OS6A 1HPGA 3PLBA 1ELDE 2PKSB 5A0CA 2NWNA 1W7XH 1O5DH 2SGEE 1P06A 1LVOA 1HV7A 2GZ7A 4MQAA 1SSXA 4YOJA 3T5FH 1BITA 3TGJE 3GY4A 2OC1A 3GY6A 3VGCB 1LHDH 1TFXA 4SGBE 1BCUH 1TRNA 1P2NA 3HATH 4BTUB 1MKXH 3PYHA 2OD3B 1V2NT 1ZGVA 1EAIA 2BLVA 1Z8JB 2GP9B 1BRAA 2A2QH 2FMJA 1HAPH 1JOUB 2BY6X 1PJPA 3OX7U 4YOGA 4CRGA 1GMCG 4MNYA 2A31A 1A61H 1SGQE 2ZDNA 1N6XA 4Y8ZA 1WQSA 1OP2A 2PKAB 1QFKH 3GYMA 1NPMA 2BTCE 1LVYA 1N6YA 1D6WA 3IWMA 2PKAA 2B7DH 2R3YA 3M3TA 4WXIA 5EODA 1AE5A 1CA8B 2TGTA 2BLWA 3TK6A 1TGNA 1ZJDA 1GBLA 1G2LA 2EC9H 1Y3XA 3MH5A 9LPRA 2AMDA 1VR1H 4D9RA 1NO9H 1UVSH 3BTTE 3F9FA 1FY1A 1BDAA 4ABIA 1HYLA 4THNH 3E6PH 2VNTA 3QN7A 1HAXB 3A7XA 1DSUA 2STBE 1BBRK 3BG4B 4UDWH 2BD5A 1OP0A 4DT7B 2ALVA 4RKJB 3FP7E 1C2FA 1FI8A 4BNRA 2A2XH 1LHEH 2AGEX 2XW9A 3RU4E 2Z9KA 3ZZBA 1O5EH 2AIQA 2OBOA 1C2JA 1TABE 2PHBA 1W8BH 1FY3A 3LOXA 4NA7A 1ZMJA 1YGCH 4IMZA 3TLOA 1AWFH 3TK9A 1C4V2 1RD3B 2LNCA 1T32A 4AYYB 5A09A 2FOFA 3ZZ5A 1SBWA 3MU4A 1C5XB 1PQ7A 3SU2A 2F9VA 1X7AC 2THFB 2YNBA 1G3DA 2JH6D 5DGJA 2GCTB 2NU3E 1SFIA 1Z1JA 4X6NA 1O2GH 4WMEA 4X8VH 2ZG0H 1UK3A 1L0ZA 3OY6U 1O3PB 4FUIA 1ID5H 1MQ5A 3A7TA 2XXLA 1CHOG 5FPTA 3MU8A 1HNEE 2NU2E 4A1VA 2P94A 1FY8E 1C2KA 1B5GH 3QZQA 4CH2B 2ZQ2A 4K2YA 1EJMA 4YT7H 1Z1IA 2O8WA 2XBWA 1HIAB 4D76A 1O3IA 1EPTC 4ZHLU 1HIAA 3ATMA 3TNSA 2ODPA 2ESTE 1RS0A 4X1PU 1SLWB 1LO6A 3U69H 4ASHA 1LCYA 1HXEH 2A4GA 1ZLRA 2UUJB 3VB5A 3RXMA 1GHBF 1P09A 4K60A 2FTLE 4I31A 2ZPSA 2ZPRA 1O2MA 1T8OA 2Y7XA 1BA8B 3JZ2B 4U30A 4B76A 1E37B 4AG1A 1WTHD 1IQGA 3RM0H 1GVKB 1MTWA 5GIBA 1BTPA 2I6QA 4Y7AA 2H5CA 3V12A 1S81A 2OLGA 1TNIA 4CRFA 3C27B 1CGIE 1CE5A 1S84A 1EB2A 3RMOH 4U32A 5ESTE 3RXKA 2W5EA 3A80A 1VCPA 1O39A 1GI2A 3B23B 2PLXA 1D3PB 1GBEA 4YLQH 1SGIB 1GHAG 4ZXYH 2Y5GA 4X6PA 2FI5E 1XKBC 2J95A 2A4QA 2GV6A 2HNTF 1DICA 2R9PA 4JK5A 1ELGA 2GT7A 4A1XA 4HTCH 3RXAA 1Q2WA 1L4DA 1JIRA 2ZHDA 4NG9H 1MTUA 2GTBA 4DJZB 2G00A 1YLDA 1ZGIA 1CA0B 3MO9A 2RDLA 1NFXA 1AGJA 1S82A 2BD8A 4ZAEA 1TX6A 1V2OT 3PO1C 1IQKA 3D49H 1RFNA 4JZEH 1Y5AT 3A7VA 3BTWE 1O5GH 5HXFA 1ZJKA 3TH3H 1C1TA 1O2XA 4XE4A 3M7TA 2FXRA 5EQQA 1QBVH 1T8NA 5T6DA 4DY7B 4X2XA 1RIWC 3E16B 3EE0B 3Q76A 3TK5A 1GJBB 2VH6A 5ETXA 3UNRA 1YLCA 1OS8A 1D3DB 2PKSC 1HJ9A 1EAXA 4TY7A 4AGJA 5AF9H 1YPMH 2ZA5A 1GDNA 3BEIB 2F9PA 3STJA 3PWCA 2UUYA 1C2IA 1GJCB 1BZXE 3SUEA 2RCEA 4X8TH 1O2ZA 4E05H 2FS8A 3KN2A 3RXHA 1DXPA 3SNBA 3A89A 5F8ZA 2Y5HA 3QUMP 2BLOA 2BY8X 3NK8A 2B9LA 4HGCA 1VCWA 3Q00A 1KSNA 3T28A 3T2NA 5F8XA 3BTHE 3KIDU 3S7KB 4E7RG 2M5TA 3TU7H 4XOJA 4Z6AH 4NWLA 2BDYA 3TH2H 1ZMNA 5IYTA 1EATA 4E06H 1O2KA 2WPJS 1HUTH 4K1TA 1MUEB 2R0LA 1O0DH 2AGIX 3E91A 1W14U 4BANB 1GVLA 2EI7A 1TX8A 1PPEE 3L33A 1V2PT 1TGSZ 3FP8E 4JZ1A 3ZVEA 1YC0A 5HYOA 4JYVH 2A32A 2A0QB 1UJ1A 2GCHF 4A1TA 1SLUB 2FOHA 1K1PA 1ARCA 5JBBS 2FODA 1KLIH 4NGAH 3CENA 2AMQA 2A5KA 1ZPBA 1NRNH 1GGDC 1PQAA 2W7SA 4NWKA 4A6LA 1AVGH 5FPYA 3URDA 2ZGHA 1TNJA 3K65B 3MNSA 1THSH 3ODDA 1JIMA 2CF8H 4K3JA 1MTSA 1NU9A 4X8SH 2R2WU 5L2YH 3SQHE 3RXSA 1ANCA 1A4WH 4AFZA 3EDXB 2XC0A 3BN9A 1QY6A 4NZQA 1YKTA 2JKHA 4MTBA 2GMTB 2ZDMA 1GJ9B 5F6MA 2BD7A 1FAKH 1JRSA 1GHZA 3MWIU 1UTKA 4ZHMU 1GI0A 2C93B 4WVPE 1AMHA 3LGYA 3HPTB 3NPSA 1CT0E 1YPEH 4GSOA 4AB8A 1EKBB 1SC8U 1YPGH 2BDHA 1DT2A 4OS7A 3RXVA 2GCTC 3LGTA 1BJUA 5FAHA 3URCA 1TALA 1W11U 1SGCA 2SNVA 3RXDA 4LZ4B 1P2QA 1O36A 1FAXA 1WUNH 3VB7A 2VGCC 1XUJA 4CBNA 4Q2KA 1Y59T 3GDUA 3ESTA 1O3JA 1HCGA 2XWBI 4BAMB 1E38B 3FFGA 3MFJA 1AIXH 2Y80A 3LIWA 1UTNA 5JBTA 2BMGB 3SJOA 1AB9B 1P11E 1NROH 3PMJA 4JYUH 1DUEA 3L3TA 1AVXA 2BXTH 2FDAA 4IMQA 1A5IA 1AUTC 4JZFH 1OSSA 2VIOA 4Y6DA 5LPEA 1EJAA 4Y0YE 1FUJA 1VITG 2GKVE 4ZUHA 4AFUA 1VGCB 1ESBA 2V3HH 1WYKA 1LMWB 1CT4E 1QBOA 3I77A 3H5CB 1FJSA 3W95A 3KHVA 2RA0A 1QNJA 5C5OA 3U8RH 4WXVA 3ZZ6A 1HJAC 4Q7YA 1V2WT 3FANA 1UTQA 2TGDA 5EQRA 1LDTT 5JB9S 1TMBH 4FU7A 3A86A 2A7HA 3WY8A 1GBBA 2XRCA 5IDKA 2A7CA 4ISOA 4OS5A 2KAIB 2FWWA 4JCNA 1C1PA 3RXFA 1DXWA 3MU0A 3TVJB 1WU1A 2KAIA 1TNKA 1ELEE 2VWLA 4Y10E 1FONA 1WV7H 1DE7H 1LTOA 2H5DA 1HAZB 2ODYB 5DP3A 2XC4A 1NRSH 1QA7A 2WUBA 2BOKA 4GCHF 4Y7BA 5EOKA 1BUIA 2PUQH 4XDEA 3SJKA 3ZZ3A 1WCZA 1YPHE 4B73A 2G5VA 3KGPA 1FLEE 1TGBA 3ATWA 2SGQE 4KTCA 4H6TA 5A8XA 3SI4H 1N8OC 1SVPA 1DPOA 2BM2A 1EZQA 1ZTKA 4GHTA 2XBVA 2QN5T 2OTVA 4Z0KA 1MZAA 2R0KA 3UR6A 3P6ZB 2IPHA 1CU1A 1O2NA 2XTTB 1Z8GA 3EYDA 1QJ6B 3ZZDA 3BTKE 1T8LA 5CHAB 2FI4E 2A1DB 2QY0B 3LC5A 4FXGH 3ATIA 3KQCA 2QAAA 1ETRH 3ODFA 3QGJA 4FUJA 3ZZ4A 1TMTH 4CBOA 3OU0A 2BVSH 1Y3YA 1D4PB 1UCYH 5FX6A 1V2ST 1FIWA 2A5AA 3BEFB 2F83A 4WF8A 4Y8YA 3SU4A 5K0HA 3RXRA 1LKAA 1WSSH 1C1VH 1GPZA 1IQIA 1P0SH 2VWNA 4OS2A 3K9XB 3U98H 1GCTB 1CO7E 1F5LA 4MPXA 1CBWB 1OP8A 1YCPH 1A7SA 4MDSA 3GISB 2OC0A 3TJUA 3M3SA 5C20A 2CXVA 5C5NA 5DK1A 1J15A 2QXJA 1DANH 1N1LA 2HNTE 4Y0ZE 1AI8H 5E8EH 2AS9A 1V3XA 2ZFFH 4Y79A 1UCYK 1B0EA 4FU8A 3SNCA 1OYQA 1GHBG 1O30A 3EAJA 1ORFA 3E3TA 2NU0E 1V2LT 2C8ZB 2UWLA 5EXNA 3QTVH 3T25A 1Q3XA 1SI5H 3MI4A 3DT0H 1YCPK 1CHGA 4KP0A 5PTPA 5E0GA 1MH0A 1HAHH 3SU3A 3FZDA 1J8AA 2CHAB 3UFAA 5EPYA 1TRYA 4TY6A 4J2YB 1DWEH 3BIUH 1OKXA 2O9QA 5GJ4B 4AFSA 3SBKA 3QDZB 4ABEA 1HJ8A 4YT6H 3SGBE 3EA8A 1IQMA 2BX4A 1PPFE 1PQ5A 3V7TA 3M7QA 3ZVGA 2HRVA 4O03A 3GCHB 1KTTB 2FP7B 2AFQB 1OX1A 2I6SA 2FESH 1DFPA 4I33A 5SGAE 1XUGA 1LKBA 3GCOA 2GT8A 4FUGA 1TOCB 1QB6A 1EP6A 1KXDA 2QCYA 3R0FA 2GMTC 5DG6A 3AASA 5C1YA 2BDIA 6CHAC 1MTNC 1ESTA 4X6OA 2QF0A 1C1OA 1XUHA 1FPHH 1O3CA 1O2OA 1C5WB 4OS4A 2P95A 4TWYA 2BQ7B 2PR3A 4D7GA 4A92A 1H1BA 1A0HB 7KMEH 1F0SA 2C3SA 4INHA 4DCDA 1O2YA 1Q31A 1AZZA 5A8YA 3NWUA 7ESTE 3H7OA 1EOJA 1MKXK 8GCHF 4MLFB 3P70B 2VIWA 4X1QU 3G01A 1FDPA 1O5AB 1H9LB 1SGYE 1TQ7B 2G4UA 4CR9A 2OINA 1D9IA 1GI5A 1C2DA 3PTNA 1Z8IB 3QGNB 2A7JA 2VINA 3IITA 1ELTA 1JMOH 1AB9C 4WMDA 1O3OA 1BRBE 2OC7A 1IQFA 2FLRH 2ZU4A 1CQQA 4PROA 1GBFA 2F9UA 1EZSC 4J1YA 1QIXB 4JK6A 3SGAE 2ZTXA 1KXEA 3H7TA 1O2TA 4YM9A 1GI1A 1VGCC 1SGTA 2ZGJA 4F49A 3MMGA 1O3EA 2FYRA 1C9TA 2H9EH 1TA6A 3MOCA 4AORA 1W13U 2UUFB 3RXUA 3AVZA 4NA9H 1SQOA 4CREA 4UONA 2V3OH 1NY22 1ZPCA 2QA9E 1C1MA 4DIHH 1B0FA 1QL7A 2HWLB 2FX4A 2XCNA 1TPAE 3RDZA 3S9BA 1MQ6A 3OTJE 1UHBB 1BBRE 2STAE 2GCHG 4MPWA 1H8DH 1UHBA 4UFFH 1EP5A 1L1JA 3SV2H 4RKOB 2ZO3H 4K1SA 4BTTB 5CE1A 5C3NA 4ISIH 1MCVA 3LH1A 3O8DA 2A5IA 1A1RA 1F0RA 2NU4E 3BTME 1ETTH 3PMAB 1UVUH 4IGDA 3PROA 4NIXA 3LGIA 1O2HA 1OWDA 3OSYA 4CRCA 5CMXH 1SQAA 1OWEA 3ZVDA 1V6DA 3UQVA 1C5SA 1WQVH 2FM2A 1BQYA 5GXPA 4KKDA 2O8MA 2FS9A 3RU4D 3NKKA 1EXFA 1SLXB 2J2UA 4BTIB 2D1JA 4RN6A 3LKWA 1V2KT 1AFQB 1FN8A 1NN6A 4GLYA 3RM2H 2Z3EA 1AN1E 1GMHF 2XYAA 1AQ7A 2BY5X 3OY5U 1IQEA 2ZU2A 3RXPA 3Q3YA 2Y82A 1BHXB 4HZHA 3SJIA 4GHQA 5L2ZH 2GGVB 4GVUA 1XVOA 3A84A 1C2MA 2ZHEH 1O3FA 1ZSLA 3IG6B 2HLCA 1G37A 4O97A 4Q7XA 1PPHE 2JH0D 2VWMA 5A0AE 3K6ZA 3M5NA 3RMMH 4I7YH 1GMDF 2P59A 1YPJH 1C2HA 1G3CA 1T31A 2V6NA 1P01A 1EX3A 4CRBA 3TJOA 1U6QA 1MU6B 4NIWA 4FU9A 3ITIA 2O8UA 4IW4E 1AFEH 2ZDAH 2ZWLH 5T3HA 6ESTA 1LPZB 1NM6A 2OXSA 3TPIZ 3SUDA 1FNIA 1H9IE 3I78A 5GCHG 4X2WA 3RXBA 2ZHWH 2O8LA 1M9UA 4UFDH 4AYVB 4NA8A 1O2LA 1ZHPA 1FIZA 1AE8H 1QR3E 2OUAA 1NU7B 2PWXA 4IN1A 3LT3A 2ZFSA 3ZZ8A 3ZZAA 2TGAA 1EZUC 3RXQA 1EJNA 1F2SE 3A85A 2ZFQH 1QQ4A 2UWOA 4GUXA 1GDQA 2WPHS 1TBQH 2VIQA 1F7ZA 1K1OA 1P02A 2XNIA 1MCTA 1QJ7B 3DFLA 3LU9B 3RLYH 1O2PA 1Y5UT 5GWZA 2CHAC 1T7CA 2DUCA 3SZNA 1Z8RA 1L1GA 3HKJB 1MU8B 1NC6A 2PUXB 1KTSB 2XBXA 1ELVA 1KXAA 2Z94A 1RXPA 4KELA 3GCNA 5EPNA 3T26A 3UWJH 1W12U 1UK2A 5AVDA 3ZVCA 1K28D 4DOQA 1UTJA 1GHYH 1EB1H 1C5QA 3FP6E 1ELBA 1GI3A 2P16A 1MMJN 1HB0B 2G51A 1BTUA 1TA2A 1JXPA 4ABHA 5E0JA 4ZKSU 1GMCF 2FI3E 1E36B 3LGWA 4M7GA 2ANMH 2G81E 4INLA 3VGCC 2ZIQH 2BHGA 3OYPA 5DP7A 1LPGB 3P95A 3MNBA 1K2I1 4KTUA 1MTVA 1GBIA 1V2VT 3ZVBA 1GWAA 1GJ5H 4Y71A 1ZPZA 3P8OA 5T6GA 2ZNKH
chains in the Genus database with same CATH superfamily
1P9SA 2A4OA 1O3LA 4TT3D 3RC4A 3VG8A 2G52A 1V2JT 3FO8D 3BTEE 3M3VA 3OTPA 4UD9H 1T4VH 2QYIA 3LDXH 4NFFA 2PFEA 3TIUA 1BMNH 5EJ1A 4F4OC 6GCHF 1HBTH 1ANEA 2G55A 4YZUA 1HAVA 3ZVAA 4AZ2B 4VGCB 1O2UA 5JYIA 1GDUA 5DP8A 3LPRA 4DVAU 2Z9IA 3MH7A 3A81A 1HGTH 1XUIA 2PGQB 3U1JB 2KX4A 2PW8H 3M5LA 1VITH 2IJD1 1HXFH 3KCGH 3PM3A 5L6NH 3N7OA 2ZDLA 4IS5A 2HGTH 5DP5A 1VCQA 1OXGA 1LQEA 2XC5A 1O2JA 1ELAA 2ZU3A 3TJVA 3KNXA 1L1NA 3BG4C 1O38A 3WW7A 2IN2A 3S9CA 1IQNA 1IQJA 1MAYA 3QK1A 2BY9X 4B71A 2GDEH 1C5TA 3WWBA 2ZDKA 5FCKA 2G4TA 4TPYA 4XBBA 4F55A 1B7XB 1TNLA 1MD8A 2PSYA 1OWHA 2WYJA 3RXLA 1TYNA 4BAOB 1DSTA 1SGFA 1VJAU 1KXCA 4CHAB 3AK5A 2J4IA 2BVXH 3SUGA 3PWBA 3SUFA 1A0JA 5LGOA 1RRKA 3ZYDA 1LPKB 1QHRB 3LJJA 1DOJA 3GOVB 4AN7A 2CGAA 1QURH 1HLTH 2ANWA 1OOKB 4WJG2 1GI4A 3UWIA 4ZKRU 3MNCA 1BIOA 4ABAA 1SHYA 2Z6BD 3RXEA 4X1SU 3SI3H 1RTLA 3MNXA 4Q7ZA 3F2FA 1V2RT 1A3BH 1O32A 2OCVB 4ZXXH 2AMPA 4B6FA 1ETSH 3VXEH 1C5ZB 1XMNB 3F9EA 5G4BA 1O31A 1FX0B 1DX5M 1Y3VA 1K1JA 2OC8A 2P3UB 3ATLA 3ZV9A 1WTGH 1XKAC 2BYAX 1BTZA 1LQDB 5T6FA 1SGNE 5FBIA 5F8TA 1AFQC 1O3DA 4F48B 3K6YA 2ILNA 3BIVH 3AAVA 1AHTH 3BV9B 1GJDB 4FUDA 2UWPA 4B2BA 4YESB 4ZHAA 1LHFH 1IQLA 2B8OH 2BD2A 3S69A 3SW2B 4ABJA 2JH5D 1IAUA 2ZTYA 1IQHA 4AOQA 1AZ8A 1DWBH 1GCDA 3C1KA 3GY2A 3SV6A 2FIRH 3ZYEA 4IC5A 1CVWH 3AW0A 3PMBB 1EOLA 3D23A 3SHCH 4CR5A 2SFAA 1A46H 4MVNA 1O3AA 3RXOA 4WH6A 1CGHA 4HFPB 2W26A 1HRTH 2CV3A 2GZ8A 2GD4B 2P3FH 2C4FH 2VIPA 5EG4A 3UQOA 2J98B 4UFEH 3SNEA 1WAYB 4X8UH 2J98A 1NFWA 4BOHA 2FOMB 3VB3A 4U01A 1W0ZU 1QJ1B 2BQ6B 2JETB 2C8YB 3BTQE 4TWWA 1O3MA 3SJ9A 1KLJH 1J17T 2SGPE 1JBUH 4LXBH 4DW2U 1KLTA 2ZCLP 1G3BA 1KYNA 3HK3B 1PFXC 3VB6A 3ZIAD 1C1QA 1G3EA 3A8DA 1H8ED 4FVBA 5LPRA 3QWCH 1EAUA 2SGDE 3D62A 1G32B 1LHCH 1CA0C 1WBGB 3UTUH 1CGJE 4NSYA 1G36A 1RTFB 1GL1A 1QTFA 1O3BA 3JZ1B 2HVYB 2BY7X 7GCHF 3RXTA 2Q6FA 4ZH8A 2AIPA 3P17H 1ELCA 1FN6A 1QCPA 1GBDA 3RP2A 2CMYA 3CP7A 1W3CA 3VPKA 1TRMA 1SMFE 2HALA 5I25A 1JRTA 3EA9A 1XXDA 4ZROA 2VVCA 1T4UH 4CRAA 1EPTA 2J9NA 2ZFTA 3FOAA 3E90B 4AB9A 3U9AH 1YYY1 5HM2A 1E1QD 1UW7A 5F03A 5TCAA 2QE7D 2ZU1A 4AC9A 1F0UA 2ZKSA 1TONA 3DA9B 5GPIB 1IOEA 2AEIH 5LPFA 1Z71A 1Y3UA 3SHAH 1EASA 4TPIZ 1RJXB 5GDSH 1MD7A 3P8FA 4HI3A 2OBQA 1QA0A 2Q1JA 4WMFA 2KM0A 1ZRBA 1KXBA 2FOEA 1UVTH 4MNWA 2Q6GA 1KIGH 5C67A 3A7WA 3QX5H 1SGFG 1SLVB 3QZRA 2Y6TA 1UMAH 2TRMA 1P3CA 1TPPA 2F9OA 1DM4B 5EXMA 1HDTH 1MBQA 5JB8S 3PV5A 1DS2E 2FOAA 3DCLA 2PV9B 3FAOA 1K21H 3MO6A 1P2KA 1GHWH 3K2UA 4Y8XA 4QT8C 1YBWA 3L6PA 1FMGA 1HAYB 4I86A 9ESTA 1GMDG 2F3CE 3SO3A 5DO4H 2F9BH 1UCYE 5E0HA 2ZF0H 1ANDA 4I8JA 1MBMA 3KEEA 3DFJA 1YPKH 3O8RA 3FZZA 4Y11E 3R3GB 4CRDA 3Q3XA 2TGPZ 1P05A 3DD2H 1C5PA 1PPZA 2GV7A 2CF9H 1DLEA 2J5UA 5IK2D 3MHWU 1MKWH 4DGJA 3RUOA 3TITA 5EQSA 4OGYA 1C5LH 1XXFA 4X1RU 4I8HA 2BVRH 1ZSJA 5A2MH 4K69A 2GJGA 2KZ4A 1QB1A 5T1VA 1V2TT 3A8CA 1PYTD 4ABGA 4CHAC 3UIRA 3F1SB 2G5NA 4I8GA 2O8TA 2ZFRH 3BF6H 3MYWA 2RA3A 1NT1A 2ANYA 2Z3DA 3I29A 1FY5A 1AY6H 2HPPH 1F92A 1FV9A 2YNAA 3AAUA 3UOPA 1O3HA 1C4U2 1THPB 3ELAH 1MKWK 4B2AA 5TJXA 2QV1A 1XVMA 1OWKA 3SU0A 1GVZA 5HM9A 1C1UH 2AHME 3RC6A 2K8IA 4NSVA 1L2EA 4WH8A 1QQUA 1TLDA 2QXIA 1DLKB 1O2RA 4OS1A 1SHHB 1VITF 4P00A 3RMLH 1ARBA 2K1QA 2EI8A 2Q6DA 3T29A 3U1IB 1VZQH 2ALPA 1S83A 1OWIA 4D9QA 2IOTA 1SOZA 3GCTF 1O5FH 1S6HA 1TIOA 3A8BA 7LPRA 2HNTC 3CS7A 3OFND 2FOCA 4ESTE 2WINI 1BBRH 2KR7A 1C2LA 4UE7H 1E35B 1XUFA 1E34B 3W1EA 1O3GA 1GBTA 1KDQB 4LZ1H 3CNRA 1PYTC 3U8OH 1KDQA 1CT2E 4AGKA 2VB0A 3NZIA 4IBLH 1GL0E 1ZHRA 2QIQA 1BRCE 2AERH 1GGDB 2OQ5A 3O8CA 6GCHG 1TB6H 1BMAA 1NRPH 2Z9LA 1LVBA 3ATKA 1UTLM 2BDAA 3N99A 3TH4H 3UR9A 5E2PA 5KECA 4H4FA 1XM1A 1DY9A 4KTSA 2HPQH 2ZHQH 2PSXA 1UO6A 1P2MA 2BD3A 5LH8A 3A7YA 3BEUA 5A0BA 2FEQH 3M61U 5HMAA 4X0WU 1TNHA 4B75A 1K1NA 3TNTA 2P8OB 1C5MD 1D3TB 3HK6B 1SQTA 3HKIB 2JETC 5I46H 5FL7D 2WPMS 2BD9A 2ZQ1A 2BQWB 1ACBE 1O2IA 2BDGA 2QC2A 3KQDA 1WDIA 1G9IE 3RXJA 1F5KU 3E0NB 1C1RA 1F0TA 1SL3A 3O8BA 2ODQA 4NFEA 1IHSH 5DKMA 4INKA 4BAHB 5ESBA 3LJOA 1PPGE 4CH8B 2DE8A 1P57B 3LC3A 4X2VA 2PTNA 4R8TB 3S7HB 2VGCB 3MU1A 3P8NA 2VH0A 1AKSB 2FO9A 2ZGCA 1NS3A 1CSOE 1AKSA 1GJ4H 1O3KA 2R3UA 2ZGBH 4LOYH 5B6OA 4LK4A 4JYTA 1O37A 4HG6A 4IC6A 2HVXA 2WZQA 3FVFB 1V2MT 2BZ6H 2BLQA 3UNQA 1O33A 5CHAC 4ZKNU 2VVVA 3ZZ9A 4D7FA 3UPEA 1C5VA 2TPIZ 1BOQA 1LVMA 4FVDA 2WUCA 1NBME 2TBSA 1W10U 2BOHB 4JZIA 1AUJA 1K22H 1HJAB 3W94A 1ESAA 1O5BB 4B74A 2ULLA 2BXUH 1C5UA 1GCTC 1Y3WA 2FLBH 4GAWA 4K5ZA 1V2QT 3PLKA 1CBWC 4I8KA 5HIYA 1JWTA 3U8TH 3GDSA 1GBJA 2C90B 2XOKD 3MU5A 3M37A 4E7NA 1E0FD 2Z9JA 2FPZA 1RGQA 1P2OA 2VU8E 1SGDE 4D8NA 3T62A 2B5TB 5TCCA 3CS0A 1S0QA 1FQ3A 1QRWA 4MNXA 1HFDA 1QL9A 4FUBA 5EW1H 2VIDA 3SU5A 2D2DA 5FBEA 4YTAA 2BDBA 2WPIS 4ISHH 4ISNA 1K9OE 1WOFA 2GX4A 3NUMA 1YP9A 1BTWA 4NCYA 1TPOA 1P8VC 1YPLH 3A88A 3RLWH 1BTHH 1S5SA 1UVOA 3SV9A 2PP6A 3NXPA 4X2YA 4JZDH 5HIZA 1GJ7B 1S85A 3LGVA 3UOUA 1TQ0B 3KQEA 2EI6A 3SV8A 3S9AA 1S0RA 4DIIH 1EUFA 1O34A 1S6LA 2J94A 1ZRKA 1OYTH 1PQ8A 1Y5BT 2DE9A 2QXHA 3UB0A 1N8OB 2CN0H 2AYWA 1ZTJA 5HGGA 2W7UA 3LGUA 1HAOH 5JDUB 3DHKH 4MNVA 2Z3CA 4K1EA 1H8HD 1BMMH 4GCHG 1DITH 2GDDA 3F9HA 1TPSA 1SFQB 5DP9A 3KF2A 3BTDE 3GCHC 2SGAA 5C94A 1OWJA 1FZZA 5DPAA 3V0XA 5JBAS 1TWXB 3BTGE 1GJ8B 1BTXA 3PLPA 4XBDA 2KCYA 3SQEE 4ABFA 1K0HA 1MAXA 1PPBH 3SV7A 4FUHA 2R2MB 1GG6B 3M35A 2ASUB 1O2QA 4H6SB 7GCHG 4SGAE 4NZLA 3D65E 2FZZA 1AWHB 1SGPE 1AVWA 1O2VA 4AX9H 4R0IA 1TE0A 5ABWA 1HAIH 3EA7A 1T8MA 3DUXH 3NRLA 4K8YA 2KFWA 1HAVB 1P2JA 2OQUA 4I32A 3ZZCA 4XBCA 1C2EA 2BX3A 1P04A 1TOMH 1E1RD 4Y76A 3RC5A 2OP9A 2J38A 1GBMA 3N7EA 4ASUD 4ZMAH 3F2GA 1YCPM 5H4IB 1FY4A 1ZMLA 2EQNA 2ZFPH 2OK5A 1OPHB 3F3BA 4JMYA 4O3UA 4NIYA 2F4LA 2F91A 2J92A 4OGXA 2B0FA 2PTCE 3PB1E 4DURA 1QL8A 3BSQA 2H6MA 4RSPA 3PTBA 5BPEA 3ZV8A 3SU6A 1DWCH 4AG2A 3M5MA 1GHXH 2J34A 1TGTA 2C8WB 2FOBA 3Q3KA 1HAGE 4IN2A 2ZTZA 1C1WH 2D26C 1K1IA 3TJNA 2ZU5A 1XUKA 1UTMA 2ZP0H 5K7RA 1FXYA 1GBCA 1O2WA 2HOBA 4FUCA 2FYQA 1A5GH 3GICB 3MO3A 5FCRA 2Y5FA 2RG3A 2A4RA 1BT7A 3SGQE 2XCFA 1TGCA 1TBRH 1SGEE 2EEKA 4H42U 3V3MA 1P3EA 4WY3A 1CHOF 2VJ1A 1NTPA 1C5RA 2V35A 2ZGXH 1THRH 1Z7KA 3HGNA 2QGRA 2SGFE 4A7IB 5DN6D 4AFQA 4BAKB 3SNAA 1H9HE 1QBNA 1EAWA 2V3MA 1E79D 4MG3A 2FX6A 2D8WA 3EGKH 2JJ1D 3STIA 2GZ9A 2P8OC 2QF3A 2P3TB 3KL6A 3F6UH 1G2MA 6CHAB 1EZXC 1YM0A 1MTNB 3TGKE 5A8ZA 1GBHA 1YY3A 2YOLA 2WPLS 1UTPA 1ZOMA 3VB4A 2HLDD 3SORA 6LPRA 2ANKH 3F68H 4GPGA 4U2WA 2SNWA 1SR5C 3AW1A 1SB1H 5FPSA 3E8LA 1UK4A 2GVFA 4ZKOU 1DVAH 3PMHB 4XSKU 3MH4A 4FUFA 2EA3A 1SOTA 1NZQH 1ZZZA 1O3NA 2BDCA 3GY7A 4MPVA 1DDJA 1W0YH 5AFZH 3V13A 3VFEA 2WPKS 1GJAB 1LHGH 1NRRH 1K1MA 2VIVA 1P2IA 1O2SA 4BAQB 1ZYOA 3GYLB 2PGBB 4O3TA 2ZHFH 2WYGA 1QGFA 2ZCKP 4NIVA 1S6FA 1KY9A 1UVPA 1EQ9A 3ZZ7A 3TGIE 1GHAF 5AFYH 3M5OA 2ZCHP 2AH4X 1DY8A 5EIYA 5GCHF 1NESE 3B8JA 8GCHG 3BG8A 1H8IH 1BTYA 2NU1E 1ZHMA 3GCTG 5C0TA 2CJIA 1ELFA 4YOIA 3OEHD 3Q77A 1FPCH 1WXRA 3LH3A 2V7QD 2Y7ZA 2V0BA 3SNDA 1GI7B 2FTMA 3M36A 2KCAA 1A3EH 2H9HA 2C8XB 5FXLA 2H2ZA 2WV4A 1NRQH 1GI9B 1J16A 2XWAA 3VEQB 1TAWA 4FUEA 3T27A 3MTYA 5E2OA 8KME2 3QTOH 1TNGA 3GY3A 1D6RA 1DUAA 1F5RA 1C5NH 1GI8B 5L30H 1AU8A 1QRXA 3SJ8A 2QXGA 3P92A 3KYFA 1H4WA 3UREA 4B2CA 1C4Y2 2VWOA 5EXLA 4ISLA 1TBZH 2H9TH 1C5OH 1DWDH 3SU1A 2H1UA 1C5YB 4YO9A 2Z7FE 1W2KH 1BB0B 5FX5A 2BB4A 1UTOA 1O35A 1O5CB 3PV4A 2Z9GA 4DG4A 2BD4A 3E0PB 4B1TA 3SOSA 3S0NA 2W3IA 1A5HA 1ABJH 2TIOA 2ZC9H 3A83A 1QRZA 3QO6A 3A7ZA 1EPTB 1NFYA 2UUKB 3HGPA 5DJ7A 1VJ9U 4MPUA 2FOGA 2ZDVH 3GY5A 4WWYA 4A5TS 5JPMH 1MZDA 1ZTLA 2LP6A 2J97A 8ESTE 3RMNH 8LPRA 2BZAA 1D3QB 2P93A 2ZECA 2VVUA 5EU8A 3E1XB 3VXFH 2W3KA 3KQBA 3P8GA 1IHTH 2Y81A 2F9NA 2ZI2H 4K8BA 1SPJA 1TX7A 1BMLA 1C9PA 4ABBA 1L4ZA 5EW2H 2G8TA 3UUZA 4O9VA 2XBYA 3ENSB 1TMUH 1GG6C 5AHGH 4XFQA 1KXFA 2EY4C 4X1NU 1GMHG 4X6MA 1QB9A 2LPRA 4BXWA 3A8AA 4ABDA 1SG8B 5DP4A 1GJ6A 2IJOB 1XX9A 2A45B 3A82A 1Y8TA 5C1XA 1C1NA 5EGMA 3B9FH 3UY9A 3WWFA 3DSOA 4YLUA 1PPCE 4VGCC 3SN8A 1J14A 3RU4T 3ZVFA 5J4QA 1Z6EA 2ZEBA 3MH6A 1NFUA 5DSFA 1K1LA 2ZPQA 1SGRE 5C1UA 3RXIA 4UEHH 3UNSA 1ZSKA 1J9CH 3RXGA 3BTFE 1BRUP 1ZR0A 5BRRE 1AO5A 3GY8A 1Z6JH 5C2ZA 5JBCS 1RTKA 1P12E 1P9UA 2WV5A 1P10A 1GHVH 3F9GA 1YPHC 5CDFE 3EQ0H 3PO1B 5J4SA 1BJVA 3LONA 1C1SA 1A2CH 4Q80A 5DP6A 3M7UA 1GBKA 1GBAA 1INCA 4UFGH 1C2GA 2AGGX 1G30B 5FHTA 1BHXF 1W7GH 4I8LA 1AD8H 2ZZUH 1GI6A 3NCLA 1YF4A 1V2UT 4TYDA 1ANBA 3RXCA 1ABIH 3GDVA 4KGAA 1RIWB 4BXSA 1P03A 3A87A 1A0LA 3QLPH 4OS6A 1MABB 1HPGA 3PLBA 1ELDE 2PKSB 5A0CA 2NWNA 1W7XH 1O5DH 2SGEE 1P06A 1LVOA 1HV7A 2GZ7A 4MQAA 1SSXA 4YOJA 3T5FH 1BITA 3TGJE 3GY4A 2OC1A 2JIZD 3GY6A 3VGCB 1LHDH 1TFXA 4SGBE 1BCUH 1TRNA 1P2NA 3HATH 4BTUB 1MKXH 3PYHA 2OD3B 1V2NT 1ZGVA 1EAIA 2BLVA 1Z8JB 2GP9B 1BRAA 2A2QH 2FMJA 1HAPH 1JOUB 2BY6X 1PJPA 3OX7U 4YOGA 4CRGA 1GMCG 4MNYA 2A31A 1A61H 1SGQE 2ZDNA 1N6XA 4Y8ZA 1WQSA 1OP2A 2PKAB 1QFKH 3GYMA 1NPMA 2BTCE 1LVYA 1N6YA 1D6WA 3IWMA 2PKAA 2B7DH 2R3YA 3M3TA 4WXIA 4FOUC 5EODA 1AE5A 1CA8B 2TGTA 2BLWA 3TK6A 1TGNA 1ZJDA 1GBLA 1G2LA 2EC9H 1Y3XA 3MH5A 9LPRA 2AMDA 1VR1H 4D9RA 1NO9H 1UVSH 3BTTE 3F9FA 1FY1A 1BDAA 4ABIA 1HYLA 4THNH 3E6PH 2VNTA 3QN7A 1HAXB 3A7XA 1DSUA 2RDEA 2STBE 1BBRK 3BG4B 4UDWH 2BD5A 4TSFD 1COWD 1OP0A 4DT7B 2ALVA 4RKJB 3FP7E 1C2FA 1FI8A 2LELA 2A2XH 1LHEH 2AGEX 2XW9A 4BNRA 3RU4E 2Z9KA 3PRDA 3ZZBA 1O5EH 2AIQA 2OBOA 1C2JA 1TABE 2PHBA 1W8BH 1FY3A 3LOXA 4NA7A 1ZMJA 3OAAD 4YXWD 1YGCH 4IMZA 3TLOA 5C0UA 1AWFH 3TK9A 1C4V2 1RD3B 2LNCA 1T32A 4AYYB 4FETA 5A09A 2FOFA 3ZZ5A 1SBWA 3MU4A 3MQKC 1C5XB 1PQ7A 3SU2A 3EE7A 2F9VA 1X7AC 2THFB 2YNBA 1G3DA 2JH6D 5DGJA 2GCTB 2NU3E 1SFIA 1Z1JA 4X6NA 1O2GH 4WMEA 4X8VH 2ZG0H 1UK3A 1L0ZA 3OY6U 1O3PB 4FUIA 1ID5H 1MQ5A 4Q63A 3OE7D 3A7TA 2XXLA 1CHOG 5FPTA 3MU8A 1HNEE 2NU2E 4A1VA 2P94A 1FY8E 1C2KA 1B5GH 3QZQA 4CH2B 2ZQ2A 4K2YA 1EJMA 2IPQX 1Z1IA 4YT7H 2O8WA 2XBWA 1HIAB 4D76A 1O3IA 1EPTC 4ZHLU 1HIAA 3ATMA 3TNSA 2ODPA 2ESTE 1RS0A 4X1PU 1SLWB 1LO6A 3U69H 4ASHA 1LCYA 3F0PA 1HXEH 2A4GA 2L6OA 1ZLRA 2UUJB 3VB5A 3RXMA 1GHBF 1P09A 3H09A 4K60A 2FTLE 4I31A 2ZPSA 5B6LA 2ZPRA 1O2MA 1T8OA 2Y7XA 1BA8B 3JZ2B 4U30A 4B76A 1E37B 4AG1A 1WTHD 1IQGA 3RM0H 1BMFD 1GVKB 1MTWA 5GIBA 1BTPA 2I6QA 4Y7AA 2H5CA 3V12A 1S81A 2OLGA 1TNIA 4CRFA 3C27B 1CGIE 1CE5A 1S84A 1EB2A 1SKYE 3RMOH 4U32A 5ESTE 3RXKA 2W5EA 3A80A 1VCPA 1O39A 1GI2A 3B23B 2PLXA 1D3PB 1GBEA 4YLQH 1SGIB 1GHAG 4ZXYH 2Y5GA 2L74A 1NBMD 4X6PA 2FI5E 1XKBC 2J95A 3KQ5A 2A4QA 2GV6A 2HNTF 1DICA 2R9PA 4JK5A 1ELGA 2GT7A 4A1XA 4HTCH 3RXAA 1Q2WA 1L4DA 1JIRA 2ZHDA 4NG9H 1MTUA 2GTBA 4DJZB 2G00A 1YLDA 1ZGIA 1CA0B 3MO9A 2RDLA 1NFXA 1AGJA 1S82A 1YWUA 2BD8A 4ZAEA 1TX6A 1V2OT 3PO1C 1IQKA 3D49H 1RFNA 4JZEH 1Y5AT 3A7VA 3BTWE 1O5GH 5HXFA 2XNDD 1ZJKA 2JJ2D 3TH3H 1C1TA 1O2XA 4XE4A 3M7TA 2FXRA 5EQQA 1QBVH 1T8NA 5T6DA 4DY7B 4X2XA 1RIWC 3E16B 3EE0B 5EJLA 3Q76A 3TK5A 1GJBB 2VH6A 5ETXA 3UNRA 1YLCA 2WPDD 1OS8A 1D3DB 2PKSC 1HJ9A 1EAXA 4TY7A 4AGJA 5AF9H 1YPMH 2ZA5A 1GDNA 3BEIB 2F9PA 3STJA 3PWCA 2UUYA 1C2IA 1GJCB 1BZXE 3SUEA 2RCEA 4X8TH 1O2ZA 4E05H 2FS8A 3KN2A 3RXHA 1DXPA 3SNBA 3A89A 5F8ZA 3N7DA 2Y5HA 3QUMP 2BLOA 2BY8X 3NK8A 2B9LA 4HGCA 1VCWA 3Q00A 1KSNA 3T28A 3T2NA 5F8XA 3BTHE 3KIDU 2CK3D 3S7KB 4E7RG 2M5TA 3TU7H 4XOJA 4Z6AH 4NWLA 2BDYA 3TH2H 1ZMNA 5IYTA 1EATA 4E06H 1O2KA 2WPJS 1HUTH 4K1TA 1MUEB 2R0LA 1O0DH 2AGIX 3E91A 1W14U 4BANB 1GVLA 2EI7A 1TX8A 1PPEE 3L33A 1V2PT 1TGSZ 3FP8E 4JZ1A 3ZVEA 1YC0A 5HYOA 4JYVH 1KMHB 2A32A 2A0QB 1UJ1A 2GCHF 4A1TA 1SLUB 2FOHA 1K1PA 1ARCA 5JBBS 2FODA 1KLIH 4NGAH 3CENA 2AMQA 2A5KA 1ZPBA 1NRNH 1GGDC 1PQAA 2W7SA 4NWKA 4A6LA 1AVGH 5FPYA 3URDA 2ZGHA 1TNJA 3K65B 3MNSA 1THSH 3ODDA 1JIMA 2CF8H 4K3JA 1MTSA 1NU9A 4X8SH 2R2WU 5L2YH 3SQHE 3RXSA 1ANCA 1A4WH 4AFZA 3EDXB 2XC0A 2YMSB 3BN9A 1QY6A 4NZQA 1YKTA 4Q4LA 2JKHA 4MTBA 2GMTB 2ZDMA 1GJ9B 5F6MA 2BD7A 1FAKH 1JRSA 1YLNA 1GHZA 3MWIU 1UTKA 4ZHMU 2QF5A 1GI0A 4XRNA 2C93B 4WVPE 1AMHA 3LGYA 3HPTB 3NPSA 1CT0E 1YPEH 4GSOA 4AB8A 1EKBB 1SC8U 1YPGH 2BDHA 1DT2A 4OS7A 3RXVA 2GCTC 3LGTA 1BJUA 5FAHA 3URCA 1TALA 1W11U 1SGCA 2SNVA 3RXDA 4LZ4B 1P2QA 1O36A 1FAXA 1WUNH 3VB7A 2VGCC 1XUJA 4CBNA 4Q2KA 1Y59T 3GDUA 3ESTA 1O3JA 1HCGA 2XWBI 4BAMB 1E38B 3FFGA 3MFJA 1AIXH 2Y80A 3LIWA 1UTNA 5JBTA 2BMGB 3SJOA 1AB9B 1P11E 1NROH 3PMJA 4JYUH 1DUEA 3L3TA 1AVXA 2BXTH 2FDAA 2VBCA 1A5IA 1AUTC 4IMQA 4JZFH 1OSSA 5F53A 2VIOA 4Y6DA 5LPEA 1EJAA 4Y0YE 1FUJA 1VITG 2GKVE 5CHBA 4ZUHA 4AFUA 1VGCB 1ESBA 2V3HH 1WYKA 1LMWB 1CT4E 1QBOA 3I77A 3H5CB 1FJSA 3W95A 3KHVA 2RA0A 1QNJA 5C5OA 3U8RH 4WXVA 3ZZ6A 1HJAC 4Q7YA 1V2WT 3FANA 1UTQA 2TGDA 3GS9A 5EQRA 1LDTT 5JB9S 1TMBH 4FU7A 3A86A 2A7HA 3WY8A 2WV9A 1GBBA 2XRCA 2WSSD 5IDKA 3OEED 2A7CA 4OM9A 4ISOA 4OS5A 2KAIB 2FWWA 4JCNA 1C1PA 3RXFA 1DXWA 3MU0A 3TVJB 1WU1A 2KAIA 1TNKA 1ELEE 2VWLA 4Y10E 1FONA 1WV7H 1DE7H 1LTOA 2H5DA 1HAZB 2JDID 2ODYB 5DP3A 2XC4A 1NRSH 1QA7A 2WUBA 2BOKA 4GCHF 4Y7BA 5EOKA 1BUIA 2PUQH 4XDEA 5GNDA 3SJKA 4ZCNA 3ZZ3A 1WCZA 1YPHE 4B73A 2G5VA 3KGPA 1FLEE 1TGBA 3ATWA 2SGQE 4KTCA 4H6TA 5A8XA 3SI4H 1N8OC 1SVPA 1DPOA 2BM2A 1EZQA 5HKKD 1ZTKA 4GHTA 2XBVA 2QN5T 2OTVA 4Z0KA 1MZAA 2R0KA 3UR6A 2M2AA 3P6ZB 2IPHA 1SQRA 4ACAA 1CU1A 1O2NA 2XTTB 1Z8GA 3EYDA 1QJ6B 3ZZDA 3BTKE 1T8LA 5CHAB 2FI4E 2A1DB 2QY0B 3LC5A 4FXGH 3ATIA 4M9FA 3KQCA 2QAAA 1ETRH 3ODFA 3QGJA 4FUJA 3ZZ4A 1TMTH 4CBOA 1EFRD 2BVSH 3OU0A 5C17A 1Y3YA 1D4PB 1UCYH 5FX6A 1V2ST 1FIWA 2A5AA 3BEFB 2F83A 4WF8A 4Y8YA 3SU4A 5K0HA 3RXRA 1LKAA 1WSSH 1C1VH 1GPZA 1IQIA 1P0SH 2VWNA 4OS2A 3K9XB 3U98H 1GCTB 1CO7E 1F5LA 4MPXA 1CBWB 1OP8A 1YCPH 1A7SA 4MDSA 4DT4A 3GISB 2OC0A 3TJUA 3M3SA 5C20A 2CXVA 5C5NA 5DK1A 1J15A 2QXJA 1DANH 1N1LA 2HNTE 4Y0ZE 1AI8H 2YMSD 5E8EH 2AS9A 1V3XA 2ZFFH 4Y79A 1UCYK 1B0EA 4FU8A 3SNCA 1OYQA 1GHBG 1O30A 3EAJA 1ORFA 2K0QA 3E3TA 2NU0E 1V2LT 2C8ZB 2UWLA 5EXNA 3QTVH 3T25A 1Q3XA 1SI5H 3MI4A 3DT0H 1YCPK 1CHGA 4KP0A 5PTPA 5E0GA 1MH0A 1HAHH 3SU3A 3FZDA 1J8AA 2CHAB 3UFAA 5EPYA 1TRYA 3DSGA 4TY6A 4J2YB 1DWEH 3BIUH 1OKXA 2O9QA 2W6ID 5GJ4B 4AFSA 3SBKA 3QDZB 4ABEA 1HJ8A 4YT6H 3SGBE 3EA8A 1IQMA 2BX4A 1PPFE 1PQ5A 3V7TA 3FN8A 3M7QA 3SZEA 3ZVGA 2HRVA 4O03A 3GCHB 5EJZA 1KTTB 2FP7B 2AFQB 1OX1A 2I6SA 4RT0A 2YMSC 2FESH 1DFPA 3PV2A 4I33A 5SGAE 1XUGA 1LKBA 3GCOA 2GT8A 4FUGA 1TOCB 1QB6A 1EP6A 1KXDA 2F43B 2QCYA 3R0FA 4RI0A 3UAIC 2GMTC 5DG6A 3AASA 5C1YA 2BDIA 6CHAC 1MTNC 1ESTA 4X6OA 2QF0A 1C1OA 1XUHA 1FPHH 1O3CA 1O2OA 1C5WB 4OS4A 2P95A 4TWYA 2BQ7B 2PR3A 4D7GA 4A92A 1H1BA 1A0HB 7KMEH 1F0SA 1QZ8A 2C3SA 4INHA 4DCDA 1O2YA 1Q31A 1AZZA 5A8YA 3NWUA 7ESTE 3H7OA 1EOJA 1MKXK 8GCHF 4MLFB 3P70B 2VIWA 4X1QU 3G01A 1FDPA 1O5AB 1H9LB 1SGYE 1TQ7B 2G4UA 4CR9A 2OINA 1D9IA 1GI5A 1C2DA 3PTNA 1Z8IB 3QGNB 4ACBA 2A7JA 2VINA 3IITA 4P02A 1ELTA 1JMOH 1AB9C 4WMDA 3SYJA 1O3OA 3U28C 1BRBE 2OC7A 1IQFA 2FLRH 2ZU4A 1CQQA 4PROA 1GBFA 2F9UA 1EZSC 4J1YA 1QIXB 4JK6A 3SGAE 2ZTXA 1KXEA 3H7TA 1O2TA 4YM9A 1GI1A 1VGCC 1SGTA 2ZGJA 4F49A 3MMGA 1O3EA 2FYRA 1C9TA 2H9EH 1TA6A 3MOCA 4AORA 1W13U 2UUFB 3RXUA 3AVZA 4NA9H 1SQOA 4CREA 1OHHD 2V3OH 3PRBA 4UONA 1NY22 1ZPCA 2QA9E 1C1MA 4DIHH 3F0OA 1B0FA 1W0KD 1QL7A 2HWLB 2FX4A 2XCNA 1TPAE 3RDZA 3S9BA 1MQ6A 3OTJE 1UHBB 1BBRE 2STAE 2GCHG 4MPWA 1H8DH 1UHBA 4UFFH 1EP5A 1L1JA 3FKSD 3SV2H 4RKOB 2ZO3H 4K1SA 4BTTB 5CE1A 5C3NA 1VKYA 4ISIH 1MCVA 3LH1A 3O8DA 2A5IA 1A1RA 1F0RA 2NU4E 3BTME 1ETTH 3PMAB 1UVUH 4IGDA 3PROA 4NIXA 3LGIA 4B6EA 1O2HA 1OWDA 3OSYA 4CRCA 5CMXH 1SQAA 1OWEA 3ZVDA 3KYGA 1V6DA 3UQVA 1C5SA 1W0JD 2FM2A 1WQVH 1BQYA 5GXPA 4KKDA 2O8MA 2FS9A 3RU4D 3NKKA 1EXFA 1SLXB 2J2UA 4BTIB 2D1JA 4RN6A 3LKWA 1V2KT 1AFQB 1FN8A 5KGOA 1NN6A 4GLYA 3RM2H 2KCPA 2Z3EA 1AN1E 1GMHF 2XYAA 1AQ7A 2BY5X 3OY5U 1IQEA 2ZU2A 3RXPA 3Q3YA 2Y82A 1BHXB 4HZHA 3SJIA 4GHQA 5L2ZH 2GGVB 4GVUA 2WHXA 1XVOA 3A84A 1C2MA 2ZHEH 1O3FA 2QF4A 1ZSLA 3IG6B 2HLCA 1G37A 4O97A 4Q7XA 1PPHE 2JH0D 2VWMA 5A0AE 3K6ZA 3M5NA 3RMMH 4I7YH 1GMDF 2P59A 1YPJH 1C2HA 1G3CA 1T31A 2V6NA 1P01A 1EX3A 4CRBA 3TJOA 1U6QA 1MU6B 4NIWA 4FU9A 3ITIA 5KEDA 2O8UA 4IW4E 1AFEH 2ZDAH 2ZWLH 5T3HA 6ESTA 1LPZB 1NM6A 2OXSA 3TPIZ 3SUDA 1FNIA 1H9IE 3I78A 5GCHG 4X2WA 3RXBA 4Z1MD 2ZHWH 2O8LA 1M9UA 4UFDH 4AYVB 4NA8A 1O2LA 1ZHPA 1FIZA 1AE8H 1QR3E 2RFKC 2OUAA 1NU7B 2PWXA 4IN1A 3LT3A 2ZFSA 3ZZ8A 3ZZAA 2TGAA 1EZUC 3RXQA 1EJNA 1F2SE 3A85A 2ZFQH 1QQ4A 2UWOA 4GUXA 1GDQA 2WPHS 1TBQH 2VIQA 1F7ZA 1K1OA 1P02A 2XNIA 1MCTA 1QJ7B 3DFLA 3LU9B 3RLYH 4XD7D 1O2PA 1Y5UT 5GWZA 2CHAC 1T7CA 2DUCA 2W6JD 3SZNA 1Z8RA 1L1GA 3HKJB 1MU8B 1NC6A 2PUXB 1KTSB 2KCOA 2XBXA 1ELVA 1KXAA 3DSPA 2Z94A 1RXPA 4KELA 3GCNA 5EPNA 3T26A 3UWJH 1W12U 1UK2A 5AVDA 3ZVCA 1K28D 4DOQA 1UTJA 1GHYH 1EB1H 1C5QA 3FP6E 1ELBA 1GI3A 2P16A 1MMJN 1HB0B 2G51A 4RT1A 1BTUA 1TA2A 1JXPA 4ABHA 5E0JA 4ZKSU 3F2HA 1GMCF 2FI3E 1E36B 3LGWA 4M7GA 2ANMH 2G81E 4INLA 3VGCC 2ZIQH 2BHGA 3OYPA 5DP7A 1LPGB 3P95A 3MNBA 1K2I1 4KTUA 1MTVA 1GBIA 1V2VT 3ZVBA 1GWAA 1GJ5H 4Y71A 1ZPZA 3P8OA 5T6GA 2ZNKH
chains in the Genus database with same CATH topology
1P9SA 2A4OA 1O3LA 3RC4A 2G52A 1V2JT 3M3VA 3BTEE 4UD9H 1T4VH 2QYIA 3LDXH 4NFFA 2PFEA 3TIUA 1BMNH 4F4OC 6GCHF 1HBTH 1ANEA 2G55A 4YZUA 1HAVA 3ZVAA 4AZ2B 4VGCB 1O2UA 5JYIA 1GDUA 5DP8A 3LPRA 4DVAU 2Z9IA 3MH7A 3A81A 1HGTH 1XUIA 2PGQB 3U1JB 2PW8H 3M5LA 1VITH 1HXFH 3KCGH 3PM3A 5L6NH 3N7OA 2ZDLA 4IS5A 2HGTH 5DP5A 1VCQA 1OXGA 1LQEA 2XC5A 1O2JA 1ELAA 2ZU3A 3TJVA 3KNXA 1L1NA 3BG4C 1O38A 3S9CA 2IN2A 1IQNA 1IQJA 1MAYA 3QK1A 2BY9X 4B71A 2GDEH 1C5TA 2ZDKA 5FCKA 2G4TA 4TPYA 4XBBA 1B7XB 1TNLA 1MD8A 2PSYA 1OWHA 2WYJA 3RXLA 1TYNA 4BAOB 1DSTA 1SGFA 1VJAU 1KXCA 4CHAB 2J4IA 2BVXH 3SUGA 3PWBA 3SUFA 1A0JA 5LGOA 1RRKA 3ZYDA 1LPKB 1QHRB 3LJJA 1DOJA 3GOVB 4AN7A 2CGAA 1QURH 1HLTH 2ANWA 1OOKB 4WJG2 1GI4A 3UWIA 4ZKRU 3MNCA 1BIOA 4ABAA 1SHYA 2Z6BD 3RXEA 4X1SU 3SI3H 1RTLA 3MNXA 4Q7ZA 1V2RT 1A3BH 1O32A 2OCVB 4ZXXH 2AMPA 1ETSH 3VXEH 1C5ZB 1XMNB 3F9EA 5G4BA 1O31A 1DX5M 1Y3VA 1K1JA 2OC8A 2P3UB 3ATLA 3ZV9A 1WTGH 1XKAC 2BYAX 1BTZA 1LQDB 5T6FA 1SGNE 5FBIA 5F8TA 1AFQC 1O3DA 3K6YA 2ILNA 3BIVH 3AAVA 1AHTH 3BV9B 1GJDB 4FUDA 2UWPA 4B2BA 4YESB 4ZHAA 1LHFH 1IQLA 2B8OH 2BD2A 3S69A 3SW2B 4ABJA 2JH5D 1IAUA 2ZTYA 1IQHA 4AOQA 1AZ8A 1DWBH 1GCDA 3C1KA 3GY2A 3SV6A 2FIRH 3ZYEA 4IC5A 1CVWH 3AW0A 3PMBB 1EOLA 3D23A 3SHCH 4CR5A 2SFAA 1A46H 4MVNA 1O3AA 3RXOA 4WH6A 1CGHA 4HFPB 2W26A 1HRTH 2CV3A 2GZ8A 2GD4B 2P3FH 2C4FH 2VIPA 5EG4A 3UQOA 4UFEH 3SNEA 1WAYB 4X8UH 1NFWA 4BOHA 2FOMB 3VB3A 4U01A 1W0ZU 1QJ1B 2BQ6B 2JETB 2C8YB 3BTQE 4TWWA 1O3MA 3SJ9A 1KLJH 1J17T 2SGPE 1JBUH 4LXBH 4DW2U 1KLTA 2ZCLP 1G3BA 1KYNA 3HK3B 1PFXC 3VB6A 1C1QA 1G3EA 3A8DA 4FVBA 5LPRA 3QWCH 1EAUA 2SGDE 3D62A 1G32B 1LHCH 1CA0C 1WBGB 3UTUH 1CGJE 4NSYA 1G36A 1RTFB 1GL1A 1QTFA 1O3BA 3JZ1B 2BY7X 7GCHF 3RXTA 2Q6FA 4ZH8A 2AIPA 3P17H 1ELCA 1FN6A 1QCPA 1GBDA 3RP2A 2CMYA 3CP7A 1W3CA 3VPKA 1TRMA 1SMFE 2HALA 5I25A 1JRTA 3EA9A 1XXDA 4ZROA 2VVCA 1T4UH 4CRAA 1EPTA 2J9NA 2ZFTA 3E90B 4AB9A 3U9AH 1YYY1 5HM2A 5F03A 5TCAA 2ZU1A 1F0UA 2ZKSA 1TONA 3DA9B 5GPIB 1IOEA 2AEIH 5LPFA 1Z71A 1Y3UA 3SHAH 1EASA 4TPIZ 1RJXB 5GDSH 1MD7A 3P8FA 4HI3A 2OBQA 1QA0A 2Q1JA 4WMFA 1ZRBA 1KXBA 2FOEA 1UVTH 4MNWA 2Q6GA 1KIGH 5C67A 3A7WA 3QX5H 1SGFG 1SLVB 3QZRA 2Y6TA 1UMAH 2TRMA 1P3CA 1TPPA 2F9OA 1DM4B 5EXMA 1HDTH 1MBQA 5JB8S 1DS2E 2FOAA 2PV9B 3FAOA 1K21H 3MO6A 1P2KA 1GHWH 3K2UA 4Y8XA 4QT8C 1YBWA 3L6PA 1FMGA 1HAYB 9ESTA 1GMDG 2F3CE 3SO3A 5DO4H 2F9BH 1UCYE 5E0HA 2ZF0H 1ANDA 4I8JA 1MBMA 3KEEA 3DFJA 1YPKH 3O8RA 3FZZA 4Y11E 3R3GB 4CRDA 3Q3XA 2TGPZ 1P05A 3DD2H 1C5PA 1PPZA 2GV7A 2CF9H 1DLEA 3MHWU 1MKWH 4DGJA 3RUOA 3TITA 5EQSA 4OGYA 1C5LH 1XXFA 4X1RU 4I8HA 2BVRH 1ZSJA 5A2MH 4K69A 1QB1A 1V2TT 3A8CA 1PYTD 4ABGA 4CHAC 3UIRA 3F1SB 2G5NA 4I8GA 2O8TA 2ZFRH 3BF6H 3MYWA 2RA3A 1NT1A 2ANYA 2Z3DA 3I29A 1FY5A 1AY6H 2HPPH 1F92A 1FV9A 2YNAA 3AAUA 3UOPA 1O3HA 1C4U2 1THPB 3ELAH 1MKWK 4B2AA 5TJXA 2QV1A 1XVMA 1OWKA 3SU0A 1GVZA 5HM9A 1C1UH 3RC6A 4NSVA 1L2EA 4WH8A 1QQUA 1TLDA 2QXIA 1DLKB 1O2RA 4OS1A 1SHHB 1VITF 3RMLH 1ARBA 2K1QA 2EI8A 2Q6DA 3T29A 3U1IB 1VZQH 2ALPA 1S83A 1OWIA 4D9QA 2IOTA 1SOZA 3GCTF 1O5FH 1S6HA 1TIOA 3A8BA 7LPRA 2HNTC 3CS7A 2FOCA 4ESTE 2WINI 1BBRH 1C2LA 4UE7H 1E35B 1XUFA 1E34B 1O3GA 1GBTA 1KDQB 4LZ1H 1PYTC 3U8OH 1KDQA 1CT2E 4AGKA 2VB0A 3NZIA 4IBLH 1GL0E 1ZHRA 2QIQA 1BRCE 2AERH 1GGDB 2OQ5A 3O8CA 6GCHG 1TB6H 1BMAA 1NRPH 2Z9LA 1LVBA 3ATKA 1UTLM 2BDAA 3TH4H 3UR9A 5E2PA 4H4FA 1XM1A 1DY9A 4KTSA 2HPQH 2ZHQH 2PSXA 1UO6A 1P2MA 2BD3A 5LH8A 3A7YA 3BEUA 5A0BA 2FEQH 3M61U 5HMAA 4X0WU 1TNHA 4B75A 1K1NA 3TNTA 2P8OB 1C5MD 1D3TB 3HK6B 1SQTA 3HKIB 2JETC 5I46H 2WPMS 2BD9A 2ZQ1A 2BQWB 1ACBE 1O2IA 2BDGA 2QC2A 3KQDA 1G9IE 3RXJA 1F5KU 3E0NB 1C1RA 1F0TA 1SL3A 3O8BA 2ODQA 4NFEA 1IHSH 5DKMA 4INKA 4BAHB 5ESBA 3LJOA 1PPGE 4CH8B 2DE8A 1P57B 3LC3A 4X2VA 2PTNA 4R8TB 3S7HB 2VGCB 3MU1A 3P8NA 2VH0A 1AKSB 2FO9A 2ZGCA 1NS3A 1CSOE 1AKSA 1GJ4H 1O3KA 2R3UA 2ZGBH 4LOYH 5B6OA 4LK4A 4JYTA 1O37A 4IC6A 2HVXA 3FVFB 1V2MT 2BZ6H 2BLQA 3UNQA 1O33A 5CHAC 4ZKNU 2VVVA 3ZZ9A 4D7FA 3UPEA 1C5VA 2TPIZ 1BOQA 1LVMA 4FVDA 2WUCA 2TBSA 1W10U 2BOHB 4JZIA 1AUJA 1K22H 1HJAB 3W94A 1ESAA 1O5BB 4B74A 2ULLA 2BXUH 1C5UA 1GCTC 1Y3WA 2FLBH 4GAWA 4K5ZA 1V2QT 3PLKA 1CBWC 4I8KA 1JWTA 3U8TH 3GDSA 1GBJA 2C90B 3MU5A 3M37A 4E7NA 1E0FD 2Z9JA 2FPZA 1RGQA 1P2OA 2VU8E 1SGDE 4D8NA 3T62A 2B5TB 5TCCA 3CS0A 1S0QA 1FQ3A 1QRWA 4MNXA 1HFDA 1QL9A 4FUBA 5EW1H 2VIDA 3SU5A 2D2DA 5FBEA 4YTAA 2BDBA 2WPIS 4ISHH 4ISNA 1K9OE 1WOFA 2GX4A 3NUMA 1YP9A 1BTWA 4NCYA 1TPOA 1P8VC 1YPLH 3A88A 3RLWH 1BTHH 1S5SA 1UVOA 3SV9A 3NXPA 4X2YA 4JZDH 1GJ7B 1S85A 3LGVA 3UOUA 1TQ0B 3KQEA 2EI6A 3SV8A 3S9AA 1S0RA 4DIIH 1EUFA 1O34A 2J94A 1ZRKA 1OYTH 1PQ8A 1Y5BT 2DE9A 2QXHA 1N8OB 2CN0H 2AYWA 1ZTJA 5HGGA 2W7UA 3LGUA 1HAOH 5JDUB 3DHKH 4MNVA 2Z3CA 4K1EA 1BMMH 4GCHG 1DITH 2GDDA 3F9HA 1TPSA 1SFQB 5DP9A 3KF2A 3BTDE 3GCHC 2SGAA 1OWJA 1FZZA 5DPAA 3V0XA 5JBAS 1TWXB 3BTGE 1GJ8B 1BTXA 3PLPA 4XBDA 3SQEE 4ABFA 1MAXA 1PPBH 3SV7A 4FUHA 2R2MB 1GG6B 3M35A 2ASUB 1O2QA 4H6SB 7GCHG 4SGAE 4NZLA 3D65E 2FZZA 1AWHB 1SGPE 1AVWA 1O2VA 4AX9H 4R0IA 1TE0A 5ABWA 1HAIH 3EA7A 1T8MA 3DUXH 4K8YA 1HAVB 1P2JA 2OQUA 4I32A 3ZZCA 4XBCA 1C2EA 2BX3A 1P04A 1TOMH 4Y76A 3RC5A 2OP9A 2J38A 1GBMA 4ZMAH 1YCPM 5H4IB 1FY4A 1ZMLA 2ZFPH 1OPHB 4JMYA 4O3UA 4NIYA 2F91A 2J92A 4OGXA 2B0FA 2PTCE 3PB1E 4DURA 1QL8A 3BSQA 2H6MA 4RSPA 3PTBA 5BPEA 3ZV8A 3SU6A 1DWCH 4AG2A 3M5MA 1GHXH 2J34A 1TGTA 2C8WB 2FOBA 3Q3KA 1HAGE 4IN2A 2ZTZA 1C1WH 2D26C 1K1IA 3TJNA 2ZU5A 1XUKA 1UTMA 2ZP0H 5K7RA 1FXYA 1GBCA 1O2WA 2HOBA 4FUCA 2FYQA 1A5GH 3GICB 3MO3A 5FCRA 2Y5FA 2RG3A 2A4RA 1BT7A 3SGQE 2XCFA 1TGCA 1TBRH 1SGEE 2EEKA 4H42U 3V3MA 1P3EA 4WY3A 1CHOF 2VJ1A 1NTPA 1C5RA 2V35A 2ZGXH 1THRH 1Z7KA 3HGNA 2QGRA 2SGFE 4A7IB 4AFQA 4BAKB 3SNAA 1H9HE 1QBNA 1EAWA 4MG3A 2FX6A 2D8WA 3EGKH 3STIA 2GZ9A 2P8OC 2QF3A 2P3TB 3KL6A 3F6UH 1G2MA 6CHAB 1EZXC 1YM0A 1MTNB 3TGKE 5A8ZA 1GBHA 2YOLA 2WPLS 1UTPA 1ZOMA 3VB4A 3SORA 6LPRA 2ANKH 3F68H 4GPGA 4U2WA 2SNWA 1SR5C 3AW1A 1SB1H 5FPSA 3E8LA 1UK4A 2GVFA 4ZKOU 1DVAH 3PMHB 4XSKU 3MH4A 4FUFA 2EA3A 1SOTA 1NZQH 1ZZZA 1O3NA 2BDCA 3GY7A 4MPVA 1DDJA 1W0YH 5AFZH 3V13A 3VFEA 2WPKS 1GJAB 1LHGH 1NRRH 1K1MA 2VIVA 1P2IA 1O2SA 4BAQB 1ZYOA 3GYLB 2PGBB 4O3TA 2ZHFH 2WYGA 1QGFA 2ZCKP 4NIVA 1S6FA 1KY9A 1UVPA 1EQ9A 3ZZ7A 3TGIE 1GHAF 5AFYH 3M5OA 2ZCHP 2AH4X 1DY8A 5GCHF 1NESE 3B8JA 8GCHG 3BG8A 1H8IH 1BTYA 2NU1E 1ZHMA 3GCTG 2CJIA 1ELFA 4YOIA 3Q77A 1FPCH 3LH3A 2Y7ZA 2V0BA 3SNDA 1GI7B 2FTMA 3M36A 1A3EH 2H9HA 2C8XB 5FXLA 2H2ZA 2WV4A 1NRQH 1GI9B 1J16A 2XWAA 3VEQB 1TAWA 4FUEA 3T27A 3MTYA 5E2OA 8KME2 3QTOH 1TNGA 3GY3A 1D6RA 1DUAA 1F5RA 1C5NH 1GI8B 5L30H 1AU8A 1QRXA 3SJ8A 2QXGA 3P92A 1H4WA 3UREA 4B2CA 1C4Y2 2VWOA 5EXLA 4ISLA 1TBZH 2H9TH 1C5OH 1DWDH 3SU1A 2H1UA 1C5YB 4YO9A 2Z7FE 1W2KH 1BB0B 5FX5A 2BB4A 1UTOA 1O35A 1O5CB 3PV4A 2Z9GA 4DG4A 2BD4A 3E0PB 4B1TA 3SOSA 3S0NA 2W3IA 1A5HA 1ABJH 2TIOA 2ZC9H 3A83A 1QRZA 3QO6A 3A7ZA 1EPTB 1NFYA 2UUKB 3HGPA 5DJ7A 1VJ9U 4MPUA 2FOGA 2ZDVH 3GY5A 4WWYA 4A5TS 5JPMH 1MZDA 1ZTLA 8ESTE 3RMNH 8LPRA 2BZAA 1D3QB 2P93A 2ZECA 2VVUA 5EU8A 3E1XB 3VXFH 2W3KA 3KQBA 3P8GA 1IHTH 2Y81A 2F9NA 2ZI2H 4K8BA 1SPJA 1TX7A 1BMLA 1C9PA 4ABBA 1L4ZA 5EW2H 2G8TA 3UUZA 4O9VA 2XBYA 3ENSB 1TMUH 1GG6C 5AHGH 4XFQA 1KXFA 4X1NU 1GMHG 4X6MA 1QB9A 2LPRA 4BXWA 3A8AA 4ABDA 1SG8B 5DP4A 1GJ6A 2IJOB 1XX9A 2A45B 3A82A 1Y8TA 5C1XA 1C1NA 5EGMA 3B9FH 3UY9A 4YLUA 1PPCE 4VGCC 3SN8A 1J14A 3RU4T 3ZVFA 5J4QA 1Z6EA 2ZEBA 3MH6A 1NFUA 1K1LA 2ZPQA 1SGRE 5C1UA 3RXIA 4UEHH 3UNSA 1ZSKA 1J9CH 3RXGA 3BTFE 1BRUP 1ZR0A 5BRRE 1AO5A 3GY8A 1Z6JH 5C2ZA 5JBCS 1RTKA 1P12E 1P9UA 2WV5A 1P10A 1GHVH 3F9GA 1YPHC 3EQ0H 3PO1B 5J4SA 1BJVA 3LONA 1C1SA 1A2CH 4Q80A 5DP6A 3M7UA 1GBKA 1INCA 1GBAA 4UFGH 1C2GA 2AGGX 1G30B 5FHTA 1BHXF 1W7GH 4I8LA 1AD8H 2ZZUH 1GI6A 3NCLA 1YF4A 1V2UT 4TYDA 1ANBA 3RXCA 1ABIH 3GDVA 4KGAA 1RIWB 4BXSA 1P03A 3A87A 1A0LA 3QLPH 4OS6A 1HPGA 3PLBA 1ELDE 2PKSB 5A0CA 2NWNA 1W7XH 1O5DH 2SGEE 1P06A 1LVOA 1HV7A 2GZ7A 4MQAA 1SSXA 4YOJA 3T5FH 1BITA