3V13A

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 61
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v13A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v13A02
2ZKSA 2Z3CA 1DDJA 1UK2A 4TPIZ 2ESTE 1VZQH 4IMZA 1GG6C 4Z0KA 4AFZA 3D65E 1FAKH 1ZMNA 2VWMA 2BX4A 4TY6A 1CA0C 1L1GA 2FM2A 1UCYH 1UVOA 3AW1A 5L2YH 1XUFA 1ZLRA 1S81A 1QA7A 3V0XA 4BTTB 2XWAA 3E0NB 1W11U 1S82A 2D8WA 1GBJA 3GOVB 2RDLA 1L4DA 3QWCH 2ZPSA 2AS9A 1C4V2 1MBQA 1O3NA 1BJVA 2G00A 4GVUA 3TNTA 4ZHLU 1LCYA 2BLWA 4YOGA 1BOQA 4KGAA 1XXDA 1Y5AT 5T6GA 4LXBH 1ZTJA 1N6XA 1IQEA 2ZHDA 2ILNA 1SB1H 3P70B 2ZU5A 2XWBI 3UNRA 3M37A 3T62A 1RFNA 1GHVH 4WMEA 1UTMA 4R0IA 5PTPA 1Z7KA 3QDZB 1LMWB 3MU4A 1O2GH 3VXFH 3MU0A 1ZRBA 1P2IA 1QL7A 4NIVA 1BQYA 3RDZA 2OBQA 1ZPBA 1QGFA 1VGCB 1PPHE 1ZSLA 1TQ7B 1YC0A 2ZFTA 1C5UA 4X8SH 1JMOH 1SQOA 2BZAA 2VWNA 1F0TA 3HK6B 5HM2A 3PMBB 3TITA 2VGCB 4AORA 5A2MH 3K6ZA 5E0GA 3VB7A 3F9FA 1ESBA 5L2ZH 1C5SA 2ZG0H 2Z9LA 2ZQ1A 2FXRA 3VB5A 1KIGH 1RRKA 2FS8A 2CHAC 2VH6A 3LOXA 1A2CH 1GI8B 1KXFA 4ZXXH 4FUCA 1RTKA 1C9PA 1F0RA 1G30B 1BHXF 2WV4A 1DSUA 1W14U 2C8XB 1MMJN 2XBVA 4OS1A 1EQ9A 1K2I1 4UFDH 1EAWA 3BTHE 4ISNA 1TBRH 3MU1A 1C2KA 4Q7XA 4WXVA 1PQAA 4KTCA 2XC4A 5A8ZA 3TJUA 1Z8IB 1O31A 1ZGVA 2AIQA 4UFGH 3OX7U 1E35B 1GBEA 2OLGA 1MU6B 3L3TA 1KLIH 1QBVH 1N8OB 2PW8H 3ZVBA 3EA9A 3LU9B 1QB9A 1ZTKA 5ESTE 3UTUH 1NZQH 1OOKB 1XUGA 2G51A 1OP8A 1P02A 3BIUH 2Y7XA 3BTWE 2FZZA 2A1DB 1EJAA 3A82A 1YCPK 2ZZUH 2EI8A 4GSOA 2BXTH 3F9HA 1MTVA 4BNRA 5FX6A 2ZFSA 1F5LA 2Q6FA 1T31A 3GDSA 5DPAA 1JOUB 1FY8E 4MPWA 5GXPA 4TY7A 1BITA 3K2UA 4IC5A 1TMTH 1TOMH 1ETSH 3T29A 1GMDF 1WSSH 4WY3A 3SJOA 1KYNA 2V0BA 4DCDA 5I46H 5F03A 5FPTA 1XX9A 1C1OA 4HFPB 3FP7E 4NGAH 1MCTA 3ZZ5A 1GMDG 4YZUA 2OC1A 3M3TA 3A7ZA 5EQSA 5AHGH 4B2BA 4J1YA 2Z9GA 1NRSH 2BQWB 3F68H 4YLQH 3SJKA 2GDDA 2FTMA 4OS5A 1A4WH 2ZPRA 1V2PT 2WINI 2BTCE 3QLPH 3C1KA 1GGDC 3D62A 3S9CA 2ULLA 3BTGE 3NKKA 1MTSA 3ZYEA 4DVAU 4FU7A 3BIVH 4LK4A 3LJJA 4DOQA 1GI5A 1GVLA 2BY7X 3KQCA 4AB9A 1D6RA 1ZTLA 1V2QT 4CBOA 1D9IA 1OS8A 2C90B 5LPFA 1CSOE 1AFEH 2GCTB 1BTPA 1HBTH 2BD3A 2OINA 3B8JA 4ZUHA 2NU1E 1AMHA 2AH4X 1C5YB 1NTPA 1T8MA 1HRTH 3MO9A 3QUMP 3UUZA 4D76A 1TGNA 2WPJS 3EAJA 1D3TB 4K1TA 1CHOF 1ZZZA 2ZTZA 1V2TT 1GI7B 4I8LA 4LZ4B 1CHOG 1MTWA 2FS9A 1YP9A 5C5OA 3SU5A 1O5FH 3MNCA 2FX6A 3D23A 1TABE 3UQOA 1VGCC 3SORA 2VIQA 3TH2H 1GBHA 2PLXA 3GCNA 2J38A 1SOZA 2ODQA 3UOUA 1ELCA 2JETB 3PWCA 2FOEA 2ZFPH 1NFUA 1OYQA 2G52A 2VGCC 5C1YA 2DE9A 2F3CE 3SOSA 1DWCH 4MNXA 1YPMH 3FANA 4HI3A 5AF9H 1SG8B 1F92A 1LKAA 1ZGIA 4Q7ZA 1KTTB 1O2XA 4MPXA 1QJ1B 1C2MA 2ZGXH 3K6YA 1KXBA 2HOBA 1O5GH 3LH3A 2VINA 2WUBA 2HNTC 1XXFA 3TJOA 1GHWH 2C8ZB 2C3SA 2WPKS 2QGRA 4ABBA 1V2ST 2QF0A 2VIPA 1ELGA 1BMAA 5JYIA 3E0PB 4YT6H 4E7RG 3DFLA 1TB6H 3SGBE 3BTDE 4UONA 1ABJH 5DP6A 3ZVAA 3MHWU 1BTHH 1T4VH 3P17H 1EOLA 2H1UA 1V2VT 4AFUA 3BV9B 1C1SA 3E1XB 2CV3A 1Z1JA 5HM9A 3H7OA 4BAMB 2D26C 1C2FA 5A0CA 1AFQB 1DS2E 2QN5T 1INCA 1P9SA 3FFGA 3BEIB 4BAKB 1YF4A 1ELFA 2BD5A 1HXEH 3SI4H 3UFAA 4KP0A 1PPFE 4YOJA 3CS7A 3NXPA 1TNGA 3RXOA 1D3QB 1VCQA 5A0BA 4MVNA 1BMLA 1FNIA 1UK3A 1SHYA 4E7NA 3LKWA 1FPHH 4FUIA 5FHTA 4INHA 5TCAA 1ZR0A 6LPRA 1O0DH 1PPEE 3ODDA 1QURH 4F49A 2Z94A 4MNVA 1OWKA 2ZC9H 5L30H 1XUHA 3TK5A 2G4UA 2FOGA 3ZZ9A 1B7XB 1K28D 1WUNH 4HGCA 1SQTA 2FOHA 4M7GA 3NPSA 1DLEA 3Q00A 3A81A 1EJMA 3N7OA 5FCRA 3SQEE 3V3MA 2J4IA 1UO6A 2PGQB 1HJAB 4HZHA 1O5CB 2GT8A 1GI2A 1UTPA 5TJXA 4AGJA 2GCTC 3PM3A 3VGCB 3RXTA 3ZVFA 2FODA 1ZHPA 4MG3A 1OSSA 1O2NA 3LH1A 2WPLS 5F6MA 1UHBB 3T27A 1EXFA 5DP9A 1HIAA 1KY9A 2THFB 4Y6DA 2GV6A 2OP9A 3SV9A 5A8YA 4ZHMU 1C5RA 2DE8A 3A7XA 2OC8A 1GBBA 2R3UA 3NWUA 1MKXK 4NA8A 1Q2WA 5GPIB 1TBQH 2EC9H 2QAAA 2Y5HA 3A7VA 3ZYDA 4DT7B 1HYLA 4D9QA 3U9AH 2QIQA 2DUCA 3MWIU 4O3UA 2OD3B 3BN9A 4XBBA 4JZEH 1FI8A 2JETC 3Q3KA 1EKBB 2FDAA 3M7TA 3GICB 2GZ9A 4ZKSU 2SGEE 1NS3A 2VVCA 1TA2A 2H9EH 3QZRA 2FEQH 1KTSB 1AKSB 1O3HA 4H4FA 4AG2A 1V2LT 1QFKH 4ABJA 2C8WB 1HAXB 1UVTH 3H7TA 1QQUA 2TGTA 2J34A 5DK1A 4AOQA 3OY5U 2PSYA 4NSYA 3S9AA 1O2JA 4ZHAA 1MU8B 1TGSZ 1FLEE 4GHTA 3RMNH 3MU8A 2ZDMA 2W7UA 2TPIZ 5F8ZA 3ODFA 2OCVB 4CREA 2EA3A 1LPGB 1QRWA 3SHAH 2P95A 4Y71A 1EAUA 4IN2A 1KXAA 5H4IB 1AN1E 3RM0H 2BVRH 4K8BA 4WMFA 3SU0A 3UR9A 5JBTA 1BCUH 1WTHD 3KN2A 4Y0YE 1L0ZA 4I8JA 2NWNA 3A8BA 1P01A 2I6QA 2GGVB 4MNYA 1ETTH 2PUXB 5EXLA 5C5NA 1QA0A 3BEUA 1YGCH 2XYAA 1AFQC 1WU1A 3L6PA 2V3HH 4I8HA 4NCYA 7GCHF 1NRRH 2HWLB 1K1JA 1C2EA 5FBIA 1C9TA 1WTGH 1NC6A 5FPYA 1M9UA 4MLFB 3SU1A 3GY6A 4ISIH 1Y3XA 2FTLE 1SLUB 2P3FH 1SGFG 2A4RA 4ASHA 2ZHWH 2CF9H 1ZJKA 3TGJE 1Z8JB 1G2MA 1OWJA 1AUTC 1QR3E 1A0HB 1V2UT 1BDAA 1PPZA 2V35A 3RU4E 4CRCA 3TPIZ 2WV5A 1NY22 1UCYK 5E0HA 2ZHEH 4B76A 1EOJA 2G55A 3MO6A 3SW2B 3EGKH 2R9PA 1S6FA 1E37B 2NU3E 3KCGH 1UTKA 1C5WB 4FXGH 3HPTB 1TFXA 2A7CA 3RXSA 3SU2A 1C5PA 3A84A 1C5MD 3A7TA 3PMAB 4UFFH 5T6FA 1TRMA 3PV4A 2Z9IA 3IWMA 1HJAC 3KQBA 3B9FH 4Y11E 1Y3UA 3QGJA 2ZTXA 2BB4A 3SJIA 3VGCC 2XBXA 4A5TS 2QV1A 1SI5H 2BOHB 2F9VA 1GHBF 4NFEA 4AZ2B 2PUQH 2FIRH 3E90B 1YPHE 5LPRA 1GHBG 4B2CA 3SNBA 2AYWA 4KTUA 3RUOA 1B0FA 4B75A 1ZHRA 3ZVEA 1KXDA 1H1BA 2QA9E 2V6NA 1W0YH 4Y76A 8GCHF 1AHTH 1OWDA 1CGHA 2P93A 2OQUA 1HAVA 1GL1A 2RCEA 2WPHS 1LVMA 8GCHG 5LPEA 1HUTH 4U30A 2BOKA 3LGVA 3NUMA 3EYDA 4Y7BA 4K2YA 1MTNC 1C5ZB 3GCHB 4A6LA 2SGAA 1MTUA 3GYLB 2Q6GA 3LGWA 3EA7A 1UTOA 1FUJA 3RXFA 5AFYH 1TALA 4XFQA 1DWBH 3M5NA 2D1JA 3CP7A 2BLOA 1MD7A 2R0LA 3R3GB 1BHXB 2G5VA 4MPVA 3Q77A 3B23B 3HKJB 1A1RA 4TWWA 1FZZA 2Y81A 4IMQA 1FONA 1LO6A 3BTME 1A5HA 2F9BH 2BX3A 2XW9A 4X2VA 4IN1A 1PFXC 1O2UA 5AVDA 3UQVA 1OWIA 1BRAA 1PYTC 1LQDB 1UHBA 4E05H 4JYVH 2PTCE 3S7HB 1ELEE 3H5CB 2BDYA 4NWKA 3SUEA 3W95A 3F9GA 1DPOA 3AW0A 2ODYB 2F9UA 2LPRA 1ELBA 1YPKH 2A2QH 2ODPA 3MI4A 4BXWA 4H6SB 3U1IB 5IYTA 3ENSB 2VIOA 4K3JA 4IGDA 3WY8A 4F4OC 6GCHF 1LHFH 1AVGH 1AZZA 5DP3A 1BBRE 1HJ8A 1O2MA 1RS0A 1BRBE 4WF8A 2VU8E 1YPJH 5A8XA 2VWLA 1L2EA 2VB0A 2WPMS 2HGTH 3P8FA 3DUXH 4YOIA 1LVYA 2XC0A 2C4FH 3GCTF 1DVAH 5T3HA 1O35A 3O8DA 3P8GA 1XVOA 3GCTG 4B73A 2OXSA 2VH0A 4ZMAH 1FAXA 1AKSA 1MH0A 1H8IH 2Z3DA 2ZEBA 3KIDU 4FVDA 3GY4A 1K1IA 3RXJA 2XBWA 1FJSA 2VIWA 1W12U 1P12E 1PPCE 3SJ9A 1LPZB 1O33A 3SV2H 3OTJE 1O3OA 2PKSC 1FIWA 1HAPH 1O2OA 3PWBA 4HTCH 1BMNH 4ABIA 4IS5A 1Y5BT 1XVMA 1C1MA 2BD4A 1GJCB 1OKXA 1GBDA 3LC3A 1ANDA 1AE5A 1GHAF 3T2NA 1P09A 4X1PU 5DP8A 5EQRA 1ZMLA 3K9XB 2PSXA 3KGPA 3UWJH 1GHAG 2BM2A 3QO6A 3VFEA 4NA7A 3LIWA 1TNIA 3FZZA 1SLXB 1O2LA 1A46H 3LPRA 1EZUC 1O3EA 3R0FA 2Y80A 1IAUA 4RKJB 1VCPA 1LHDH 1C1VH 3GY7A 4XSKU 1S84A 1SVPA 3PO1B 1GJ8B 1G36A 2BY6X 4A1TA 1JBUH 1C4Y2 1P11E 2BDHA 4AFSA 1F0SA 2CMYA 3GCHC 2A4GA 2O8UA 4WJG2 4XE4A 3HGNA 1S0QA 1GI6A 3LONA 3VB4A 1MKWH 2J95A 3A83A 2FLBH 3MYWA 5F8XA 3PMHB 3OSYA 4Z6AH 1LHCH 1SGYE 2P8OB 3UNSA 1W0ZU 3U98H 1HV7A 1T8OA 1GBTA 4MPUA 2AMDA 3UIRA 1A0LA 1C5NH 2QXHA 1CBWC 1MD8A 2FYQA 2M5TA 4XBDA 1C1TA 3PYHA 2QY0B 3QTOH 4VGCC 1J9CH 1O3LA 2A2XH 3GYMA 1NRNH 5DGJA 1O3GA 1OWHA 1PPBH 2ZGHA 2AGIX 1QY6A 4I32A 1FPCH 5CMXH 4D7GA 1GI3A 3TGIE 1IQHA 5J4SA 1JIRA 1Y3WA 2BZ6H 1FXYA 4LZ1H 1EB1H 1BZXE 1RXPA 4YM9A 2F91A 1O3MA 4DGJA 1IQLA 4BANB 3MOCA 1A3EH 1P2KA 2F9PA 1GVZA 1GBAA 5JBAS 1N6YA 2H5CA 3M61U 3SBKA 4NA9H 3CENA 2BY9X 4BXSA 3RP2A 1PYTD 4PROA 1JRSA 1NO9H 4AFQA 3A7WA 2FMJA 1W7XH 1GJ5H 3M5MA 1TPOA 5DG6A 1TRNA 1O3CA 2G8TA 1CGIE 4I33A 1OWEA 1CU1A 2B7DH 2IJOB 5C2ZA 3A80A 5JDUB 2JH0D 1GMHF 3T25A 4UDWH 1V2MT 1WQSA 2XXLA 2QCYA 3TGKE 1GMHG 1G37A 2ALPA 1SGPE 1AU8A 3NK8A 4X2YA 2W7SA 2BVSH 3SNEA 2PKAB 3ZZAA 4CHAB 1TOCB 3AVZA 2ZDAH 3RXCA 1DOJA 1W8BH 1DANH 5ETXA 1ZSJA 1ZMJA 1OYTH 2GMTB 3LGTA 4YLUA 1O2WA 3RXIA 2XCNA 3FVFB 3Q3YA 1UMAH 2OC7A 5B6OA 3A88A 4R8TB 1XKAC 2ZQ2A 1UVSH 1BTZA 1VCWA 4OS7A 1MZDA 5HGGA 1FQ3A 3F1SB 3TH4H 1NESE 2TGDA 1FIZA 3BTQE 1RIWB 3DA9B 5FAHA 2TIOA 5C67A 1NPMA 1N8OC 2Z7FE 4MTBA 1MQ6A 1Z6JH 1DUAA 1CT0E 2AMQA 1TNHA 1H4WA 1GI0A 1O3AA 5I25A 1ESAA 3PO1C 2A7JA 4O9VA 1YLDA 3VXEH 3KQEA 1J17T 4OGYA 1HLTH 4Y10E 2SGFE 1HAZB 4KKDA 4I8GA 1TYNA 1WV7H 1J15A 1YLCA 3UNQA 1DFPA 4NIXA 2A5KA 2GX4A 1C2HA 1NFXA 5L6NH 2BD2A 4X1RU 3U8TH 1S85A 3PROA 2P8OC 8LPRA 5K7RA 3RMLH 1V2NT 3SU6A 1Z8RA 3MH6A 4X1SU 1QBOA 1AWFH 2FOMB 3BG4B 4KTSA 2BDGA 1SBWA 1V2WT 2VNTA 3HGPA 2ZFQH 1LDTT 1NFWA 3SU3A 3U69H 2TBSA 1YPLH 3I78A 1TGCA 2ZGBH 5JBBS 3SZNA 4K8YA 3UY9A 1KLTA 1IQKA 2Y7ZA 3M3SA 4JZ1A 2CF8H 1F5KU 4U32A 1U6QA 1GMCF 1EZXC 3P95A 3BEFB 1THSH 1LVOA 2ZCLP 1GMCG 7ESTE 1P9UA 2BD9A 3M3VA 2A5IA 5EOKA 4ABHA 1BRUP 1GDNA 4CBNA 1XKBC 4FUGA 1TGBA 4CR9A 3IG6B 2R2WU 1SFQB 2Y6TA 2RA3A 5F8TA 1NU9A 1C5TA 1YPHC 4INKA 1AIXH 2BQ6B 2FI5E 5T6DA 1SGIB 1FY1A 4X8TH 4ABFA 1HAYB 5GJ4B 1IQMA 1C5QA 1K9OE 1O2PA 1TPSA 1GBFA 1O2HA 1SGDE 2UUKB 3I77A 1GJAB 4A7IB 2FWWA 1Z6EA 3SNDA 1C5XB 1HCGA 2J2UA 3ESTA 3RXDA 1EP6A 1G3CA 3ZZDA 4NSVA 4RN6A 3UPEA 2IOTA 2JH5D 4MQAA 2NU2E 2GCHF 2AMPA 1VR1H 2PHBA 3PTNA 5EG4A 1QBNA 2V3OH 2GCHG 4X1NU 4ZROA 1GHZA 5C20A 1ZOMA 1MAYA 1IQGA 1C1NA 5TCCA 2B8OH 1KLJH 1EAIA 2XC5A 2SGPE 2SNVA 3GCOA 2ZCHP 1DUEA 1UTNA 1AB9B 3K65B 2VVVA 3SUFA 2OUAA 4DIIH 3BTEE 1DICA 2P3TB 3UREA 1DXWA 3RXRA 6ESTA 1RTLA 5A0AE 1AE8H 1BTYA 2BDCA 5A09A 2NU4E 4CHAC 2F9NA 3ZV9A 1RD3B 4I8KA 5C1UA 3L33A 5E2PA 1TNLA 3M35A 1QHRB 4AB8A 6CHAB 2BDBA 4FVBA 1K21H 2GMTC 1KDQB 2GD4B 1Y3YA 4O3TA 1IHTH 1Y5UT 1RJXB 2OBOA 1XUIA 2SGDE 5GIBA 3MNXA 4Q7YA 1DY9A 2Z3EA 1SHHB 2BHGA 3RXBA 9LPRA 2SNWA 1GBMA 4SGBE 2GT7A 3GISB 3RXLA 1C5LH 1C5OH 2GDEH 1AUJA 2ANKH 4X6OA 1F7ZA 1LKBA 1SGEE 3TVJB 1RIWC 3V7TA 3TK6A 4ABAA 5SGAE 3M5OA 1W7GH 2VIDA 1E34B 4JZDH 1IQIA 2FYRA 1CO7E 1CA0B 1ZSKA 1BBRH 4IW4E 3F9EA 2EEKA 3FP8E 5DKMA 2GP9B 1DE7H 2ZU3A 3PLBA 3JZ1B 7GCHG 1SGQE 1L1NA 1GI9B 2G5NA 5JB9S 1QB6A 3A89A 1FV9A 1E36B 1G9IE 1UTLM 2W3KA 1GJ9B 2ZO3H 4OS2A 1UTJA 1AI8H 3FP6E 3ITIA 2CXVA 4A1VA 3QTVH 4O03A 3KHVA 3A85A 1DWEH 4MDSA 3BG4C 1EZQA 1FN8A 1EATA 2SGQE 3A87A 2G4TA 2KAIB 2WUCA 1ELVA 4CRGA 4BTIB 3PLPA 2AERH 2FP7B 5EW1H 1SC8U 1V2KT 4KELA 1Y8TA 4ZH8A 4NZQA 1FMGA 2STAE 5E8EH 5HMAA 4JCNA 4Y0ZE 3MFJA 1GBKA 1ARBA 1W3CA 4FUFA 1TA6A 1UTQA 2ZDLA 5IDKA 2IPHA 1K1PA 4ZKNU 3RXPA 1GJ4H 5EGMA 1TNJA 1DX5M 1QRXA 1YM0A 2K1QA 3HK3B 1GJBB 3EA8A 1JWTA 4A1XA 1Y3VA 5FXLA 8ESTE 1O3DA 1O2TA 1YPEH 4H6TA 1TWXB 2ZU1A 3ZZBA 1GHXH 1K1LA 4XDEA 3RXAA 2BD7A 2ZFFH 2YOLA 1QQ4A 3RC4A 4ABDA 2ANWA 2YNAA 2ZU2A 2ANYA 4RKOB 3MTYA 3ZZ7A 1BTXA 3RLYH 4FUEA 3SNAA 1EP5A 1KXEA 4B1TA 4D8NA 2Q1JA 1P2JA 4GCHF 3A86A 4DJZB 3OYPA 1Y59T 1BTUA 4Q2KA 1FDPA 1UVPA 2UWLA 2FLRH 1PQ8A 1AD8H 2HVXA 2O8WA 1VITH 1O37A 4ABGA 1O34A 1A0JA 3SV6A 3GY3A 1EX3A 1AB9C 3LDXH 1ARCA 2ZI2H 3ATMA 3OY6U 4X0WU 4UFEH 1O2IA 1CVWH 3F6UH 1WOFA 2H5DA 4FU8A 5E0JA 1HPGA 1GCDA 3EDXB 3GY5A 3SN8A 5HYOA 1Q31A 1G3EA 2R2MB 2Y5GA 4Q80A 3LGYA 4ISHH 4WWYA 1HAHH 1SFIA 5EW2H 3DD2H 9ESTA 1QJ7B 4Y7AA 2TGPZ 2A32A 3KNXA 1QIXB 2TRMA 1TMUH 2QC2A 3SJ8A 4GAWA 5JBCS 1IQNA 1EZSC 1O2ZA 1AGJA 3SO3A 1N1LA 5DP4A 2P16A 1KSNA 1O3KA 1SGRE 5C1XA 3OU0A 3MO3A 1O32A 1J14A 1F5RA 4Y8YA 1GGDB 1S0RA 1SQAA 1MKWK 3E3TA 1LTOA 1O3FA 1K1MA 5ESBA 4DY7B 1P3CA 3TIUA 6GCHG 1EPTB 3E91A 4INLA 3RXMA 3FZDA 2CGAA 2EI7A 1UVUH 1V2OT 3TNSA 1FY5A 1AY6H 1G3BA 4DG4A 4FUHA 1MZAA 2FOBA 3URDA 1GCTB 3A8CA 1P2MA 1IQFA 1OP0A 1L4ZA 2EI6A 5EODA 4LOYH 3V12A 1RTFB 4D9RA 4Y8ZA 3URCA 1TAWA 2A31A 1D3PB 1CGJE 1S6HA 4GHQA 1EJNA 2UUFB 4CH2B 3Q76A 2D2DA 1KDQA 1Q3XA 2BDIA 1PPGE 4BAHB 1YPGH 4NWLA 1G2LA 1T4UH 2ZHQH 1F0UA 5G4BA 1TX8A 2QXJA 3UWIA 4UD9H 2O8LA 1DY8A 3AAUA 2HLCA 2R0KA 3RMMH 1C1PA 1TPPA 1THRH 5FBEA 4BAOB 2AEIH 4ZKRU 1ELDE 4FUDA 1LQEA 2ZWLH 1THPB 1PQ5A 1JRTA 4YT7H 1YKTA 1AVWA 3STJA 2FESH 2STBE 3MH7A 1PQ7A 4A92A 2GZ8A 3BTTE 3KEEA 3LGUA 3M5LA 1NN6A 1MCVA 1D3DB 1ZYOA 2JH6D 4THNH 1EASA 4TYDA 1S5SA 3ZZ6A 4AG1A 1Z8GA 1DSTA 4X6PA 1O3IA 1CE5A 2ZFRH 1Z1IA 7KMEH 1P04A 4JYTA 4GLYA 1CQQA 3SHCH 1K1OA 3MNBA 4H42U 2P94A 1O2YA 1K1NA 1O2QA 4NIYA 3SQHE 2BVXH 3LJOA 1MQ5A 2KAIA 1V6DA 1BJUA 2HALA 1G3DA 1ZPCA 1QL9A 5EU8A 2A4QA 3E6PH 4AX9H 3I29A 2OTVA 1HB0B 3SNCA 3UOPA 5FX5A 2O8MA 1ETRH 3HATH 1C2JA 3M7QA 4U01A 2ZNKH 3GY8A 1HIAB 2BXUH 3E8LA 3RMOH 3AAVA 1ELTA 2ZIQH 4DURA 4IBLH 4ZKOU 3VEQB 1ANEA 4OS4A 1H9LB 5FCKA 3MNSA 1SGNE 3SU4A 1HFDA 1DM4B 2ASUB 1TLDA 1SLVB 1BT7A 1Z71A 2BY5X 3V13A 1QJ6B 2GTBA 3P8OA 2BD8A 4ZAEA 2VJ1A 3MH5A 1ZPZA 3ZVGA 1UK4A 4O97A 3T28A 3RU4T 4J2YB 4DW2U 5DP7A 4X8VH 2ZF0H 1TONA 1V3XA 1BIOA 4X6MA 3C27B 2H2ZA 3BG8A 2VWOA 3LT3A 1FN6A 1DWDH 2HRVA 1IHSH 4AN7A 1UCYE 4JZIA 3RC6A 1ID5H 1EPTC 3ATWA 3G01A 4ZXYH 2HNTF 2VIVA 5ABWA 1C5VA 1AVXA 4QT8C 3S69A 1C2DA 1E0FD 1O30A 2PGBB 3TJNA 1O39A 1HNEE 2VVUA 4YTAA 3TJVA 1GCTC 2FI4E 3RXHA 4CRAA 1DXPA 1ZRKA 5DJ7A 2H9TH 2PFEA 4BOHA 1SL3A 1GBCA 1J16A 2PV9B 2XTTB 1WBGB 1ACBE 3BF6H 3KL6A 3ZZCA 3ZV8A 1T32A 3LGIA 1GPZA 5J4QA 4FU9A 3BSQA 2YNBA 4BAQB 3SI3H 1NRQH 3UR6A 2UUYA 3RM2H 1TNKA 3TK9A 1A61H 2OC0A 1O5AB 1C1RA 1W2KH 1LVBA 1TE0A 4Y79A 3SGQE 1QNJA 1EB2A 4K1SA 3M7UA 1JIMA 2W5EA 4WH6A 1YCPH 2GV7A 2PTNA 1SLWB 1E38B 2BY8X 4GUXA 1GWAA 1V2JT 3HKIB 2FI3E 4OS6A 5C3NA 3W94A 1NRPH 1GI4A 1H9IE 5BPEA 1EPTA 5EXNA 2WYGA 2Y82A 2BDAA 1UJ1A 4RSPA 4BTUB 1O5DH 3P6ZB 1C2IA 1HJ9A 1ORFA 3SV8A 1HAIH 1TPAE 4MNWA 1ANBA 1OX1A 4WXIA 3QZQA 1LPKB 1TQ0B 2OQ5A 4TWYA 3GY2A 1P0SH 4ISOA 2BYAX 5K0HA 3PB1E 1EAXA 1V2RT 2A45B 3ZVDA 2QF3A 1J8AA 3JZ2B 7LPRA 1HAGE 5LGOA 2JKHA 1P03A 3O8RA 2J9NA 1SGCA 1WAYB 2BMGB 1AQ7A 5JPMH 3BTKE 5CHAB 1TIOA 4B71A 2UUJB 2BLQA 4B74A 2SFAA 3CS0A 1ABIH 1HAVB 1IOEA 3A8DA 1P2OA 1TMBH 3A8AA 3MU5A 1HAOH 5EQQA 1VJAU 1BA8B 2XRCA 2ZDVH 4B2AA 5HXFA 5EXMA 3NCLA 2UWPA 4X6NA 4AYVB 1AWHB 1BBRK 5JB8S 1G32B 2FO9A 1O2SA 3S7KB 3SUDA 3ZZ4A 1O2VA 3SUGA 3RXGA 1C1WH 3S0NA 1GDUA 1A5IA 4AGKA 1SPJA 2WYJA 2WPIS 2ZTYA 2ZU4A 1LHGH 2GZ7A 1GHYH 1ELAA 3ELAH 2CN0H 2ZP0H 1S83A 2P3UB 4GPGA 2I6SA 4IC6A 2RA0A 1C2GA 1D6WA 3QX5H 4WVPE 3S9BA 3U1JB 1RGQA 2XCFA 3MMGA 1ESTA 3QN7A 1ANCA 4E06H 4CR5A 5E2OA 1GBLA 3MH4A 1O2RA 3RXQA 2PWXA 1QTFA 2G81E 4XOJA 2J92A 4FUJA 1BTWA 3T5FH 2Y5FA 1HDTH 1C1UH 1GJ7B 1O2KA 1YYY1 5DP5A 1GI1A 1W13U 3NZIA 4K5ZA 1C2LA 2CJIA 2B5TB 2FOCA 1NM6A 5GDSH 2QXIA 4ISLA 4WH8A 2Z6BD 1O38A 3O8BA 2IN2A 2ZDKA 5DO4H 4X8UH 2Z9JA 2C8YB 4JK5A 1GDQA 1T7CA 3SV7A 2RG3A 1GBIA 2W26A 4K60A 1MTNB 3TH3H 1O36A 1B0EA 2FPZA 1HGTH 4K69A 1QCPA 1WQVH 4X2WA 4X2XA 1MBMA 2Q6DA 4YESB 1SR5C 4I7YH 1H9HE 1O5BB 4D7FA 2H9HA 2FOAA 2PR3A 1OXGA 1FY4A 3IITA 2AGEX 2R3YA 4WMDA 1K22H 4CH8B 3P92A 2LNCA 2W3IA 2B9LA 1OP2A 1DLKB 1LHEH 2HNTE 2ZA5A 3TLOA 3EE0B 3SGAE 1GG6B 1X7AC 3O8CA 1YBWA 1W10U 3U8OH 8KME2 1TX6A 4U2WA 2A7HA 1C1QA 2QYIA 3AASA 1BMMH 3KF2A 5LH8A 1BUIA 2ZECA 3PTBA 1O3BA 3QGNB 1L1JA 3DFJA 2AFQB 4OGXA 1BB0B 2UWOA 1WCZA 4NIWA 2PKAA 2HPPH 3GDUA 2BQ7B 2XBYA 5CHAC 2A5AA 3RXUA 1GJ6A 4Y8XA 4AYYB 1AZ8A 3ZZ8A 1QB1A 4JK6A 4FUBA 1P57B 3QK1A 1VITF 2GVFA 1A3BH 2FOFA 1MKXH 1QRZA 3RU4D 1TX7A 1VITG 3ATIA 2AIPA 3RXVA 5CE1A 3KQDA 1GJDB 3D49H 1A7SA 2PKSB 5GWZA 2FX4A 3VPKA 2ANMH 1NROH 1SSXA 4ABEA 2F9OA 1QL8A 2BLVA 3A7YA 3E16B 5BRRE 1XUJA 1P05A 2ZPQA 4UE7H 3ZZ3A 1T8LA 4SGAE 4X1QU 3RXEA 2CHAB 3STIA 1IQJA 3U8RH 5EPNA 1CT2E 4JZFH 1MUEB 1O3PB 3RLWH 2XNIA 3VB3A 1YCPM 1NU7B 3DHKH 2P59A 2H6MA 3BTFE 1DT2A 4K1EA 4I31A 2GKVE 1CHGA 2ZGCA 5AFZH 2ZGJA 5FPSA 4YO9A 1EUFA 1O5EH 4JMYA 3GDVA 4ESTE 2AGGX 1ZHMA 2A4OA 4GCHG 1P8VC 2O9QA 4NFFA 4XBCA 1PJPA 1CA8B 2ZDNA 1P06A 3PLKA 1P2NA 2A0QB 2ZHFH 1VJ9U 1XMNB 1NFYA 2TGAA 1P3EA 4CRDA 1C4U2 1GL0E 1TGTA 2B0FA 4NG9H 1SOTA 2ALVA 1F2SE 3T26A 1AO5A 1FY3A 2O8TA 3LC5A 3FAOA 2NU0E 1XUKA 4DIHH 1TBZH 1A5GH 1JXPA 3EQ0H 1P10A 1WYKA 3M36A 1NT1A 1T8NA 5GCHF 1KXCA 1B5GH 2J94A 1CT4E 1O3JA 2F83A 6CHAC 1D4PB 1GVKB 5GCHG 2HPQH 2QXGA 1MAXA 5EPYA 1TRYA 3TU7H 1H8DH 3Q3XA 2C93B 1DITH 3RXKA 3ATKA 4TPYA 1BRCE 4JYUH 1P2QA 4CRFA 1SGTA 1HXFH 1ZJDA 4NZLA 4CRBA 3P8NA 3VB6A 1SGFA 3RC5A 1CBWB 3PMJA 3ATLA 4UEHH 3ZVCA 1SMFE 1OPHB 2Z9KA 3DT0H 1XM1A 2ZCKP 4VGCB
chains in the Genus database with same CATH superfamily
2ZKSA 2Z3CA 1DDJA 1UK2A 1SKYE 4TPIZ 2ESTE 1VZQH 4IMZA 1GG6C 4Z0KA 4AFZA 3D65E 1FAKH 1ZMNA 2VWMA 2BX4A 4TY6A 1CA0C 1L1GA 2FM2A 1UCYH 1UVOA 3AW1A 5L2YH 1XUFA 1ZLRA 4P02A 1S81A 4YXWD 1QA7A 3V0XA 4BTTB 2XWAA 3E0NB 1W11U 1S82A 2D8WA 1GBJA 3GOVB 2RDLA 1L4DA 3QWCH 2ZPSA 2AS9A 3F0OA 1C4V2 1MBQA 1O3NA 1BJVA 2G00A 4GVUA 3TNTA 4ZHLU 1LCYA 2BLWA 4YOGA 1BOQA 4KGAA 1XXDA 1Y5AT 5T6GA 4LXBH 1ZTJA 1N6XA 1IQEA 2ZHDA 2ILNA 1SB1H 1WDIA 3P70B 2ZU5A 2XWBI 3UNRA 3M37A 3T62A 1RFNA 1GHVH 4WMEA 1UTMA 4R0IA 5PTPA 1Z7KA 3QDZB 1LMWB 3MU4A 1O2GH 3VXFH 3MU0A 1ZRBA 1P2IA 1QL7A 1W0JD 1BQYA 4NIVA 2OBQA 1ZPBA 3RDZA 1QGFA 1VGCB 2WV9A 3CNRA 1PPHE 1ZSLA 1TQ7B 1YC0A 2ZFTA 1C5UA 3UAIC 3FO8D 4X8SH 1JMOH 1SQOA 2BZAA 2VWNA 1F0TA 3HK6B 5HM2A 3PMBB 3TITA 2VGCB 4AORA 5A2MH 3K6ZA 5E0GA 3VB7A 3F9FA 1ESBA 5L2ZH 5C94A 1C5SA 2ZG0H 2Z9LA 2ZQ1A 2FXRA 3VB5A 1KIGH 1RRKA 3OEED 2FS8A 2CHAC 2VH6A 3LOXA 1A2CH 1GI8B 1KXFA 4ZXXH 5C17A 4FUCA 1RTKA 1C9PA 1F0RA 1G30B 1BHXF 2WV4A 2EQNA 1DSUA 1W14U 2C8XB 1MMJN 2XBVA 4OS1A 1EQ9A 1K2I1 4UFDH 1EAWA 3BTHE 4ISNA 1TBRH 3MU1A 1C2KA 4Q7XA 4WXVA 1PQAA 4KTCA 2XC4A 5A8ZA 3TJUA 1Z8IB 1O31A 1ZGVA 2AIQA 5FL7D 4UFGH 3OX7U 1E35B 1GBEA 2OLGA 1MU6B 3L3TA 1KLIH 1QBVH 1N8OB 2PW8H 5CHBA 3ZVBA 3EA9A 3LU9B 1QB9A 1ZTKA 5ESTE 3UTUH 1NZQH 1OOKB 1XUGA 2G51A 1OP8A 1P02A 3BIUH 2Y7XA 3BTWE 2FZZA 2A1DB 1EJAA 3A82A 1YCPK 2ZZUH 2EI8A 4GSOA 2BXTH 3F9HA 1MTVA 4BNRA 5FX6A 2ZFSA 1F5LA 2Q6FA 1T31A 3GDSA 5DPAA 1JOUB 1FY8E 2J98B 4MPWA 5B6LA 5GXPA 4TY7A 2F43B 2KCPA 1BITA 3K2UA 4IC5A 1TMTH 1TOMH 1ETSH 3T29A 1GMDF 1WSSH 4WY3A 3SJOA 1KYNA 2V0BA 4DCDA 5I46H 5F03A 5FPTA 1XX9A 1C1OA 4HFPB 3FP7E 4NGAH 1MCTA 3ZZ5A 1GMDG 4YZUA 2OC1A 3M3TA 3A7ZA 5EQSA 5AHGH 4B2BA 4J1YA 2Z9GA 1NRSH 2BQWB 3F68H 4YLQH 3SJKA 2GDDA 2FTMA 4OS5A 1A4WH 2ZPRA 1V2PT 2WINI 2BTCE 3QLPH 3C1KA 1GGDC 2W6ID 3D62A 3DCLA 3S9CA 2ULLA 3BTGE 3NKKA 1MTSA 3ZYEA 4DVAU 4FU7A 3BIVH 4LK4A 3LJJA 4DOQA 1GI5A 1GVLA 2BY7X 3KQCA 4AB9A 1D6RA 1ZTLA 1V2QT 4CBOA 1D9IA 3KYGA 1OS8A 2C90B 5LPFA 1CSOE 1AFEH 2GCTB 1BTPA 1HBTH 2BD3A 2OINA 3B8JA 4ZUHA 2NU1E 1AMHA 2AH4X 1C5YB 1NTPA 1T8MA 1HRTH 3MO9A 3QUMP 3UUZA 4D76A 1TGNA 2WPJS 3EAJA 1D3TB 4K1TA 1CHOF 1ZZZA 2ZTZA 1V2TT 4RI0A 1GI7B 4I8LA 3H09A 4LZ4B 1CHOG 1MTWA 2FS9A 1YP9A 5C5OA 3SU5A 1O5FH 3MNCA 2FX6A 3D23A 1TABE 3UQOA 1VGCC 3SORA 2VIQA 3TH2H 1GBHA 2PLXA 3GCNA 5HKKD 2J38A 1SOZA 2ODQA 3UOUA 1ELCA 2JETB 3PWCA 2FOEA 2ZFPH 1NFUA 1OYQA 2G52A 2VGCC 5C1YA 2DE9A 2F3CE 3SOSA 1DWCH 4MNXA 1YPMH 3FANA 4HI3A 5AF9H 1SG8B 1F92A 1LKAA 1ZGIA 4Q7ZA 1KTTB 1O2XA 4MPXA 1QJ1B 1C2MA 2ZGXH 3K6YA 1KXBA 2HOBA 1O5GH 3LH3A 2VINA 2WUBA 2HNTC 1XXFA 3TJOA 1GHWH 1VKYA 2C8ZB 2C3SA 2WPKS 2QGRA 4ABBA 1V2ST 2QF0A 2VIPA 1ELGA 1BMAA 5JYIA 3E0PB 4YT6H 4E7RG 3DFLA 1TB6H 3SGBE 3BTDE 4UONA 1ABJH 5DP6A 3ZVAA 3MHWU 1BTHH 1T4VH 3P17H 1EOLA 3F0PA 4RT0A 2H1UA 1V2VT 4AFUA 3BV9B 1C1SA 3E1XB 2CV3A 1Z1JA 5HM9A 3H7OA 4BAMB 2D26C 1C2FA 1S6LA 5A0CA 1AFQB 1DS2E 2QN5T 1INCA 1P9SA 3FFGA 3BEIB 4BAKB 1YF4A 1ELFA 2BD5A 1HXEH 3SI4H 3UFAA 4KP0A 1PPFE 4YOJA 3CS7A 3NXPA 1TNGA 5C0UA 3RXOA 1D3QB 1VCQA 5A0BA 4MVNA 1BMLA 1FNIA 1UK3A 1SHYA 4E7NA 3LKWA 1FPHH 4FUIA 5FHTA 5HIYA 4INHA 5TCAA 1ZR0A 6LPRA 1O0DH 1PPEE 3ODDA 1QURH 4F49A 2Z94A 4MNVA 1OWKA 2ZC9H 5L30H 1XUHA 3TK5A 2G4UA 2FOGA 3ZZ9A 1B7XB 1K28D 2OK5A 1WUNH 4HGCA 4M9FA 1SQTA 1NBMD 2FOHA 3PV2A 4M7GA 3NPSA 1DLEA 3Q00A 3A81A 1EJMA 3N7OA 5FCRA 3SQEE 3V3MA 2J4IA 1UO6A 2PGQB 1HJAB 4HZHA 3F2GA 1O5CB 2GT8A 1GI2A 1UTPA 5TJXA 4AGJA 2GCTC 3PM3A 3VGCB 3RXTA 1QZ8A 3ZVFA 2FODA 1ZHPA 4MG3A 1OSSA 1O2NA 3LH1A 2WPLS 5F6MA 1UHBB 3T27A 1EXFA 5DP9A 1HIAA 1KY9A 2THFB 4Y6DA 2GV6A 2OP9A 3SV9A 5A8YA 2XOKD 4ZHMU 1C5RA 2DE8A 2J98A 3A7XA 2OC8A 1GBBA 2R3UA 3NWUA 1MKXK 4NA8A 1Q2WA 3UB0A 5GPIB 1TBQH 2EC9H 2QAAA 2Y5HA 3A7VA 3ZYDA 4DT7B 1HYLA 4D9QA 3U9AH 2L74A 2DUCA 2QIQA 3MWIU 4O3UA 2OD3B 3BN9A 2AHME 4XBBA 2QF4A 1FI8A 2JETC 3FOAA 1EKBB 3Q3KA 4JZEH 2FDAA 3M7TA 3GICB 2GZ9A 4ZKSU 2SGEE 1NS3A 3OE7D 2VVCA 1TA2A 2H9EH 3QZRA 2FEQH 1KTSB 1AKSB 1O3HA 4H4FA 4AG2A 1V2LT 1QFKH 4ABJA 2C8WB 1HAXB 1UVTH 3H7TA 1QQUA 2TGTA 2J34A 5DK1A 4AOQA 3OY5U 2PSYA 4NSYA 3S9AA 1O2JA 4ZHAA 1MU8B 1TGSZ 1FLEE 3N99A 4GHTA 3RMNH 3MU8A 2ZDMA 2W7UA 2TPIZ 5F8ZA 3ODFA 2OCVB 4CREA 2EA3A 1LPGB 1QRWA 3SHAH 2P95A 4Y71A 1EAUA 4IN2A 1KXAA 5H4IB 1AN1E 3RM0H 2BVRH 4K8BA 4WMFA 3SU0A 3UR9A 5JBTA 1BCUH 1WTHD 3KN2A 4Y0YE 1L0ZA 4I8JA 2NWNA 3A8BA 1P01A 1YY3A 4ACBA 2I6QA 2GGVB 1YWUA 4MNYA 1ETTH 2PUXB 5EXLA 5C5NA 1QA0A 3BEUA 1YGCH 2XYAA 1AFQC 2J5UA 1WU1A 3L6PA 2V3HH 4I8HA 4NCYA 7GCHF 1NRRH 2HWLB 1K1JA 1C2EA 5FBIA 1C9TA 1WTGH 1NC6A 5FPYA 1M9UA 4MLFB 3SU1A 3GY6A 4ISIH 1Y3XA 2FTLE 1SLUB 2P3FH 1SGFG 2A4RA 4ASHA 2ZHWH 2CF9H 1ZJKA 3TGJE 1Z8JB 1G2MA 1OWJA 1AUTC 1QR3E 1A0HB 1V2UT 1BDAA 1PPZA 2V7QD 2V35A 3RU4E 4CRCA 3TPIZ 2WV5A 1NY22 1UCYK 5E0HA 2ZHEH 4B76A 1EOJA 2G55A 3MO6A 3SW2B 1COWD 3EGKH 2R9PA 1S6FA 1E37B 2NU3E 3KCGH 1UTKA 1C5WB 4FXGH 3HPTB 1TFXA 2A7CA 3RXSA 3SU2A 1C5PA 3A84A 1C5MD 3A7TA 3PMAB 4UFFH 5T6FA 1TRMA 3PV4A 2Z9IA 3IWMA 1HJAC 3KQBA 4RT1A 3B9FH 4Y11E 1Y3UA 3QGJA 1UW7A 2ZTXA 2BB4A 3SJIA 3VGCC 2XBXA 4A5TS 2QV1A 1SI5H 2BOHB 2F9VA 1GHBF 4NFEA 4AZ2B 2PUQH 2FIRH 3E90B 1YPHE 5LPRA 1GHBG 4B2CA 3SNBA 2AYWA 4KTUA 3RUOA 1B0FA 4B75A 2XNDD 1ZHRA 3ZVEA 1KXDA 1H1BA 2QA9E 2V6NA 1W0YH 4Y76A 8GCHF 1AHTH 1OWDA 1CGHA 2IPQX 2P93A 2OQUA 1HAVA 1GL1A 2RCEA 2WPHS 1LVMA 8GCHG 5LPEA 1HUTH 4U30A 2BOKA 3LGVA 2LP6A 3NUMA 2M2AA 4B6EA 3EYDA 4Y7BA 4K2YA 1MTNC 1C5ZB 3GCHB 4A6LA 2SGAA 1MTUA 3GYLB 2Q6GA 3LGWA 3EA7A 1UTOA 1FUJA 3RXFA 5AFYH 1TALA 4XFQA 2JJ1D 1DWBH 3M5NA 2D1JA 3CP7A 2BLOA 1MD7A 2HVYB 2R0LA 3R3GB 1BHXB 2G5VA 4MPVA 3Q77A 3B23B 3HKJB 1A1RA 4TWWA 1FZZA 2Y81A 4IMQA 1FONA 1LO6A 3BTME 1A5HA 2F9BH 2BX3A 2XW9A 4X2VA 4IN1A 1PFXC 1O2UA 5AVDA 3UQVA 1OWIA 1BRAA 1PYTC 1LQDB 1UHBA 4E05H 4JYVH 2PTCE 3S7HB 1ELEE 3H5CB 2BDYA 4NWKA 3SUEA 3W95A 3F9GA 1DPOA 3AW0A 2ODYB 2F9UA 2LPRA 1ELBA 2PP6A 1YPKH 2A2QH 2ODPA 3MI4A 4BXWA 4H6SB 3U1IB 5IYTA 3ENSB 2VIOA 4K3JA 4IGDA 3WY8A 4TT3D 4F4OC 6GCHF 1LHFH 1AVGH 5DN6D 1AZZA 5DP3A 1BBRE 1HJ8A 1O2MA 1RS0A 1BRBE 2F4LA 4WF8A 2VU8E 1YPJH 5A8XA 2VWLA 1L2EA 2VB0A 2WPMS 2HGTH 3P8FA 3DUXH 4YOIA 1LVYA 2XC0A 2C4FH 3GCTF 1DVAH 5T3HA 1E1QD 2RFKC 1O35A 3O8DA 3P8GA 1XVOA 3GCTG 4B73A 4HG6A 2OXSA 2VH0A 4ZMAH 1FAXA 1AKSA 1MH0A 1H8IH 2Z3DA 2ZEBA 3KIDU 4FVDA 3GY4A 1K1IA 3RXJA 2XBWA 1FJSA 2VIWA 1W12U 2KX4A 1P12E 5KEDA 1PPCE 3SJ9A 1LPZB 1O33A 3SV2H 3OTJE 1O3OA 2PKSC 1FIWA 1HAPH 1O2OA 3PWBA 4HTCH 1BMNH 4ABIA 4IS5A 1Y5BT 1XVMA 1C1MA 2BD4A 1GJCB 1OKXA 1GBDA 3LC3A 1ANDA 1AE5A 1GHAF 3T2NA 1P09A 4X1PU 5DP8A 5EQRA 1ZMLA 3K9XB 2PSXA 3KGPA 3UWJH 1GHAG 5GNDA 2BM2A 3QO6A 3VFEA 4NA7A 3LIWA 1TNIA 3FZZA 1SLXB 1O2LA 1A46H 3LPRA 1MABB 1EZUC 1O3EA 3R0FA 2Y80A 1IAUA 4RKJB 1VCPA 1LHDH 1C1VH 3GY7A 4XSKU 3DSOA 1S84A 1SVPA 3PO1B 1GJ8B 1G36A 2BY6X 4A1TA 1JBUH 1C4Y2 1P11E 1SQRA 2BDHA 4AFSA 1F0SA 2CMYA 3GS9A 3GCHC 2A4GA 2O8UA 4WJG2 4XE4A 3HGNA 1S0QA 1GI6A 3LONA 3VB4A 1MKWH 2J95A 3A83A 2FLBH 3FN8A 3MYWA 5F8XA 3PMHB 3OSYA 4Z6AH 1LHCH 1SGYE 2P8OB 3NRLA 2KCYA 3UNSA 1W0ZU 3U98H 1HV7A 1T8OA 1GBTA 4MPUA 2AMDA 3UIRA 1A0LA 1C5NH 2QXHA 1CBWC 1MD8A 2FYQA 2M5TA 4XBDA 1C1TA 3PYHA 2QY0B 3QTOH 4VGCC 1J9CH 1O3LA 2A2XH 3GYMA 1NRNH 5DGJA 1O3GA 1OWHA 1PPBH 2ZGHA 2AGIX 1QY6A 4I32A 1FPCH 5CMXH 4D7GA 1GI3A 3TGIE 1IQHA 5J4SA 1JIRA 1Y3WA 2BZ6H 1FXYA 4LZ1H 1EB1H 1BZXE 1RXPA 4YM9A 2F91A 1O3MA 4DGJA 1IQLA 4BANB 3MOCA 1A3EH 1P2KA 2F9PA 1GVZA 1GBAA 5JBAS 1N6YA 2H5CA 3M61U 3SBKA 4NA9H 3CENA 2BY9X 4BXSA 3RP2A 1PYTD 4PROA 1JRSA 1NO9H 4AFQA 3A7WA 2FMJA 1W7XH 1GJ5H 3M5MA 1TPOA 5DG6A 3WWBA 1TRNA 1O3CA 2G8TA 1CGIE 4I33A 1OWEA 1CU1A 2B7DH 2IJOB 5C2ZA 3A80A 5JDUB 2JH0D 1GMHF 3T25A 4UDWH 1V2MT 1WQSA 2IJD1 2XXLA 2QCYA 3TGKE 1GMHG 1G37A 5EIYA 2ALPA 1SGPE 1AU8A 3NK8A 4X2YA 2HLDD 2W7SA 5KECA 2BVSH 3SNEA 2PKAB 3ZZAA 4CHAB 1TOCB 3AVZA 2ZDAH 3RXCA 1DOJA 1W8BH 1DANH 4TSFD 5ETXA 1ZSJA 1ZMJA 1OYTH 2GMTB 3LGTA 4YLUA 5EJZA 1O2WA 3RXIA 2XCNA 3FVFB 3Q3YA 1UMAH 2OC7A 5B6OA 3A88A 4R8TB 1XKAC 2ZQ2A 1UVSH 1BTZA 1VCWA 4OS7A 5T1VA 5CDFE 4ACAA 2KCAA 1MZDA 5HGGA 1FQ3A 3F1SB 3TH4H 1NESE 2TGDA 1FIZA 3BTQE 1RIWB 3DA9B 5FAHA 2TIOA 5C67A 1NPMA 1N8OC 2Z7FE 4MTBA 1MQ6A 1Z6JH 1DUAA 1CT0E 2AMQA 1TNHA 1H4WA 1GI0A 1O3AA 5I25A 1ESAA 3PO1C 2A7JA 4O9VA 1YLDA 3VXEH 3KQEA 1J17T 4OGYA 1HLTH 4Y10E 2SGFE 1HAZB 4KKDA 4I8GA 1TYNA 1WV7H 1J15A 1YLCA 3UNQA 1DFPA 4NIXA 2A5KA 2GX4A 1C2HA 1NFXA 5L6NH 2BD2A 4X1RU 3U8TH 1S85A 3PROA 2P8OC 8LPRA 5K7RA 3RMLH 1V2NT 3SU6A 1Z8RA 3MH6A 4X1SU 1QBOA 1AWFH 2FOMB 3BG4B 4KTSA 2BDGA 1SBWA 1V2WT 2VNTA 3HGPA 2ZFQH 1LDTT 1NFWA 3SU3A 3U69H 2TBSA 1YPLH 3I78A 1TGCA 2ZGBH 3DSGA 5JBBS 4K8YA 3SZNA 3UY9A 1KLTA 1IQKA 2Y7ZA 3M3SA 4JZ1A 2CF8H 1F5KU 4U32A 1U6QA 1GMCF 1W0KD 1EZXC 3P95A 3BEFB 1THSH 1LVOA 2ZCLP 1GMCG 7ESTE 1P9UA 2BD9A 3M3VA 2A5IA 5EOKA 4ABHA 1BRUP 1GDNA 4CBNA 1XKBC 4FUGA 1TGBA 4CR9A 3IG6B 2R2WU 1SFQB 2Y6TA 2RA3A 5F8TA 1NU9A 1C5TA 1YPHC 4INKA 1AIXH 2BQ6B 2FI5E 5T6DA 1SGIB 1FY1A 4X8TH 4ABFA 1HAYB 5GJ4B 1IQMA 1C5QA 1K9OE 1O2PA 1TPSA 1GBFA 1O2HA 1SGDE 2UUKB 3I77A 1GJAB 4A7IB 2FWWA 1Z6EA 3SNDA 1C5XB 1HCGA 2J2UA 3ESTA 3RXDA 1EP6A 1G3CA 3ZZDA 4NSVA 4RN6A 3UPEA 2IOTA 2JH5D 4MQAA 3DSPA 2NU2E 2WHXA 2GCHF 2AMPA 1VR1H 2PHBA 3KYFA 3PTNA 3KQ5A 5EG4A 1QBNA 2V3OH 2GCHG 4X1NU 4ZROA 1GHZA 5C20A 1ZOMA 1MAYA 1IQGA 1C1NA 5TCCA 2B8OH 1KLJH 1EAIA 2LELA 2XC5A 2SGPE 2SNVA 3GCOA 2ZCHP 1DUEA 2L6OA 1UTNA 1AB9B 3K65B 2VVVA 3SUFA 2KFWA 2OUAA 4DIIH 3BTEE 1DICA 2P3TB 3UREA 1DXWA 3RXRA 6ESTA 1RTLA 5A0AE 1AE8H 1BTYA 2BDCA 5A09A 2NU4E 4CHAC 2F9NA 3ZV9A 1RD3B 4I8KA 5C1UA 3L33A 5E2PA 1TNLA 3M35A 1QHRB 4AB8A 6CHAB 2BDBA 4FVBA 1K21H 4Q63A 2GMTC 1KDQB 2GD4B 5C0TA 1Y3YA 4O3TA 1IHTH 1Y5UT 1RJXB 2OBOA 1XUIA 2SGDE 5GIBA 3MNXA 2JIZD 4Q7YA 1DY9A 2Z3EA 1SHHB 2BHGA 3RXBA 9LPRA 2SNWA 1GBMA 4SGBE 2GT7A 2J97A 3GISB 1C5LH 3RXLA 1C5OH 2GDEH 1AUJA 2ANKH 4X6OA 1F7ZA 1LKBA 1SGEE 3TVJB 1RIWC 2CK3D 3TK6A 3V7TA 4ABAA 3M5OA 5SGAE 1W7GH 2VIDA 1E34B 4ASUD 4JZDH 1IQIA 2FYRA 1CO7E 1CA0B 1ZSKA 3VG8A 1BBRH 4IW4E 3F9EA 2EEKA 3FP8E 5DKMA 2GP9B 1DE7H 2ZU3A 3PLBA 3JZ1B 7GCHG 1SGQE 1L1NA 1GI9B 2G5NA 5JB9S 1QB6A 3A89A 1FV9A 1E36B 1G9IE 1UTLM 2W3KA 1GJ9B 2ZO3H 4OS2A 1UTJA 1AI8H 3FP6E 4AC9A 3ITIA 2CXVA 4A1VA 3QTVH 4O03A 3KHVA 3A85A 1DWEH 1E79D 4MDSA 3BG4C 1EZQA 4ZCNA 1FN8A 1EATA 2SGQE 3A87A 2G4TA 2KAIB 2WUCA 1ELVA 3WWFA 4CRGA 4BTIB 3PLPA 2AERH 2FP7B 5EW1H 1SC8U 1V2KT 4XRNA 4KELA 2GJGA 1Y8TA 4ZH8A 4NZQA 1FMGA 2STAE 5E8EH 5HMAA 4JCNA 4Y0ZE 3MFJA 1GBKA 1ARBA 1W3CA 4FUFA 1TA6A 1UTQA 2ZDLA 5IDKA 2IPHA 1K1PA 4ZKNU 3RXPA 1GJ4H 5EGMA 1TNJA 1DX5M 1QRXA 1YM0A 2K1QA 3HK3B 1GJBB 3EA8A 1JWTA 4A1XA 1Y3VA 5FXLA 8ESTE 1O3DA 1O2TA 1YPEH 4H6TA 1TWXB 2ZU1A 3ZZBA 1GHXH 1K1LA 4XDEA 3RXAA 2BD7A 2ZFFH 2YOLA 1QQ4A 1WXRA 3RC4A 4ABDA 2ANWA 2YNAA 2EY4C 2ANYA 2ZU2A 4RKOB 3MTYA 3ZZ7A 1BTXA 3RLYH 4FUEA 3SNAA 1EP5A 1KXEA 4B1TA 4D8NA 2Q1JA 1P2JA 4GCHF 3A86A 2YMSB 4DJZB 3OYPA 1Y59T 1BTUA 4Q2KA 1FDPA 1UVPA 2UWLA 2FLRH 1PQ8A 1AD8H 2HVXA 2O8WA 1VITH 1O37A 4ABGA 1O34A 3OFND 1A0JA 3SV6A 3GY3A 1EX3A 1AB9C 3LDXH 1ARCA 2ZI2H 3ATMA 3OY6U 4X0WU 4UFEH 1O2IA 1H8ED 1CVWH 3F6UH 1WOFA 2H5DA 4FU8A 5E0JA 1HPGA 1GCDA 3EDXB 3GY5A 3SN8A 5HYOA 1Q31A 1G3EA 2R2MB 2Y5GA 4Q80A 3LGYA 4ISHH 4WWYA 1HAHH 1E1RD 1SFIA 5EW2H 3DD2H 9ESTA 1QJ7B 4Y7AA 2TGPZ 2A32A 3KNXA 1QIXB 2TRMA 1TMUH 2QC2A 3SJ8A 4GAWA 5JBCS 1IQNA 1EZSC 1O2ZA 1AGJA 3SO3A 1N1LA 5DP4A 2P16A 1KSNA 1O3KA 1SGRE 5C1XA 3OU0A 3MO3A 1O32A 1J14A 1F5RA 4Y8YA 1GGDB 1S0RA 1SQAA 4Z1MD 1MKWK 3E3TA 1LTOA 1O3FA 1K1MA 5ESBA 4DY7B 1P3CA 3TIUA 6GCHG 2K0QA 1EPTB 3E91A 4INLA 3RXMA 3FZDA 3MQKC 2CGAA 2EI7A 1UVUH 1V2OT 3TNSA 2JJ2D 1FY5A 1AY6H 1G3BA 4DG4A 4FUHA 1MZAA 2FOBA 3URDA 1GCTB 3A8CA 1P2MA 4FOUC 1IQFA 1OP0A 1L4ZA 2EI6A 5EODA 4LOYH 3V12A 1RTFB 4D9RA 4Y8ZA 3N7EA 3URCA 1TAWA 2A31A 1D3PB 1CGJE 1S6HA 4GHQA 1EJNA 2UUFB 4CH2B 3Q76A 2D2DA 1KDQA 1Q3XA 2BDIA 1PPGE 4BAHB 2KM0A 3OAAD 1YPGH 4NWLA 5HIZA 1G2LA 1T4UH 2ZHQH 1F0UA 5G4BA 4F48B 1TX8A 2QXJA 3UWIA 4UD9H 2O8LA 1DY8A 3AAUA 2HLCA 2R0KA 4F55A 3RMMH 1C1PA 1TPPA 1THRH 5FBEA 4BAOB 2AEIH 2KZ4A 4P00A 2WPDD 4ZKRU 1ELDE 4DT4A 4FUDA 1LQEA 2ZWLH 1THPB 1PQ5A 1JRTA 4YT7H 1YKTA 1AVWA 3STJA 2FESH 2STBE 3MH7A 1H8HD 1PQ7A 4A92A 2GZ8A 3BTTE 3KEEA 3LGUA 3M5LA 2KCOA 1NN6A 1MCVA 1D3DB 3F2FA 1ZYOA 2JH6D 4THNH 1EASA 4TYDA 1S5SA 3ZZ6A 4AG1A 1Z8GA 1DSTA 4X6PA 1O3IA 1CE5A 2ZFRH 1Z1IA 7KMEH 2YMSC 1P04A 4JYTA 4GLYA 1CQQA 3SHCH 1K0HA 3FKSD 1K1OA 3MNBA 4H42U 2P94A 1O2YA 1K1NA 1O2QA 4NIYA 3SQHE 2BVXH 3LJOA 1MQ5A 2KAIA 1V6DA 4FETA 1BJUA 2HALA 1G3DA 1ZPCA 1QL9A 5EU8A 2A4QA 3E6PH 4AX9H 3I29A 2OTVA 1HB0B 3SNCA 3UOPA 5FX5A 2O8MA 1ETRH 3HATH 1C2JA 3M7QA 4U01A 2ZNKH 3GY8A 3WW7A 1HIAB 2BXUH 3E8LA 3RMOH 3AAVA 1ELTA 2ZIQH 4DURA 4IBLH 4ZKOU 3VEQB 1ANEA 4OS4A 1H9LB 5FCKA 4I86A 1KMHB 3MNSA 1SGNE 3SU4A 1HFDA 1DM4B 2ASUB 1TLDA 1SLVB 1BT7A 3OTPA 1Z71A 2BY5X 3V13A 1QJ6B 2GTBA 3P8OA 2BD8A 4ZAEA 2VJ1A 2WSSD 3MH5A 1ZPZA 3ZVGA 1UK4A 4O97A 3T28A 3RU4T 5KGOA 4J2YB 1BMFD 4DW2U 5DP7A 4X8VH 2ZF0H 1FX0B 1TONA 1V3XA 3AK5A 1BIOA 2JDID 4X6MA 3C27B 2H2ZA 3BG8A 2VWOA 3LT3A 1FN6A 1DWDH 2HRVA 1IHSH 4AN7A 1UCYE 4JZIA 3RC6A 3SYJA 1ID5H 1EPTC 3F2HA 3ATWA 3G01A 4ZXYH 2HNTF 2VIVA 5ABWA 1C5VA 1AVXA 4QT8C 3S69A 1C2DA 1E0FD 1O30A 2PGBB 3TJNA 1O39A 1HNEE 2VVUA 2WZQA 4YTAA 3TJVA 1GCTC 2FI4E 3RXHA 4CRAA 1DXPA 1ZRKA 5DJ7A 2H9TH 3SZEA 2PFEA 4BOHA 1SL3A 1GBCA 1J16A 2PV9B 2VBCA 1WBGB 1ACBE 2XTTB 3BF6H 3KL6A 3ZZCA 3ZV8A 1T32A 3LGIA 1GPZA 5J4QA 4FU9A 3BSQA 2YNBA 4BAQB 3SI3H 1NRQH 3UR6A 2UUYA 3RM2H 1TNKA 3TK9A 1A61H 2OC0A 1O5AB 5IK2D 1C1RA 1W2KH 1LVBA 1TE0A 4Y79A 3SGQE 1QNJA 1EB2A 2K8IA 3M7UA 4K1SA 1JIMA 2W5EA 4WH6A 1YCPH 2GV7A 2PTNA 1SLWB 1E38B 2BY8X 4GUXA 1GWAA 4OM9A 1V2JT 3HKIB 2FI3E 4OS6A 5C3NA 3W94A 1NRPH 1GI4A 1H9IE 5BPEA 2W6JD 1EPTA 5EXNA 2WYGA 2Y82A 2BDAA 1UJ1A 4RSPA 4BTUB 1O5DH 3P6ZB 1C2IA 1HJ9A 1ORFA 3SV8A 1HAIH 1TPAE 4MNWA 1ANBA 1OX1A 2RDEA 4WXIA 3QZQA 1LPKB 1TQ0B 2OQ5A 4TWYA 3GY2A 1P0SH 4ISOA 2BYAX 5K0HA 3N7DA 3PB1E 1EAXA 1V2RT 2A45B 3ZVDA 2QF3A 4XD7D 1J8AA 3JZ2B 7LPRA 1HAGE 5LGOA 2JKHA 1P03A 1YLNA 3O8RA 2J9NA 1SGCA 1WAYB 2BMGB 1AQ7A 2YMSD 5JPMH 3BTKE 5CHAB 1TIOA 4B71A 2UUJB 2BLQA 4B74A 2SFAA 3CS0A 1ABIH 1HAVB 1IOEA 3A8DA 1P2OA 1TMBH 3A8AA 3MU5A 1HAOH 5EQQA 1VJAU 1BA8B 2XRCA 2QE7D 2ZDVH 4B2AA 1NBME 5HXFA 5EXMA 3NCLA 2UWPA 4X6NA 4AYVB 1AWHB 1BBRK 5JB8S 1G32B 2FO9A 1O2SA 2V3MA 3S7KB 3SUDA 3ZZ4A 1O2VA 3F3BA 3SUGA 3RXGA 1C1WH 3S0NA 1GDUA 1A5IA 4AGKA 1SPJA 2WYJA 2WPIS 2ZTYA 2ZU4A 1LHGH 2GZ7A 4Q4LA 1GHYH 1ELAA 3ELAH 2CN0H 5EJ1A 2ZP0H 1S83A 2P3UB 4GPGA 2I6SA 4IC6A 2RA0A 1C2GA 1D6WA 3QX5H 4WVPE 3S9BA 3U1JB 1RGQA 2XCFA 3MMGA 1ESTA 3QN7A 1ANCA 4E06H 3OEHD 4CR5A 5E2OA 1GBLA 3MH4A 1O2RA 3RXQA 2PWXA 1QTFA 2G81E 4XOJA 2J92A 4FUJA 1BTWA 3T5FH 2Y5FA 1HDTH 1C1UH 1GJ7B 1O2KA 1YYY1 5DP5A 1GI1A 1W13U 3NZIA 4K5ZA 1C2LA 2CJIA 2B5TB 2FOCA 1NM6A 5GDSH 2QXIA 4ISLA 4WH8A 2Z6BD 1O38A 3O8BA 2IN2A 2ZDKA 5DO4H 4X8UH 2Z9JA 2C8YB 4JK5A 1GDQA 1T7CA 3SV7A 2RG3A 1GBIA 2W26A 3PV5A 1MTNB 4K60A 1O36A 3TH3H 1B0EA 2FPZA 1HGTH 1EFRD 4K69A 1QCPA 1WQVH 4X2WA 4X2XA 3U28C 1MBMA 2Q6DA 4YESB 1SR5C 4I7YH 1H9HE 1O5BB 4D7FA 2H9HA 2FOAA 2PR3A 1OXGA 1FY4A 3IITA 2AGEX 3PRDA 2R3YA 4WMDA 1K22H 4CH8B 3P92A 2LNCA 2W3IA 2B9LA 1OP2A 3ZIAD 1DLKB 1LHEH 2HNTE 2ZA5A 3TLOA 3EE0B 3SGAE 1GG6B 1X7AC 3O8CA 1YBWA 1W10U 3U8OH 8KME2 1TX6A 4U2WA 2A7HA 1C1QA 2QYIA 3AASA 1BMMH 3KF2A 5LH8A 1BUIA 2ZECA 3PTBA 1O3BA 3QGNB 1L1JA 3DFJA 2AFQB 4OGXA 1BB0B 2UWOA 1WCZA 4NIWA 2PKAA 2HPPH 3GDUA 2BQ7B 2XBYA 5CHAC 2A5AA 3RXUA 1GJ6A 4Y8XA 4AYYB 1AZ8A 1OHHD 3ZZ8A 1QB1A 4JK6A 4FUBA 1P57B 2QF5A 3QK1A 1VITF 2GVFA 1A3BH 2FOFA 1MKXH 1QRZA 3RU4D 1TX7A 1VITG 3ATIA 2AIPA 3RXVA 5CE1A 3KQDA 1GJDB 3D49H 1A7SA 2PKSB 5GWZA 2FX4A 3VPKA 2ANMH 1NROH 1SSXA 4ABEA 2F9OA 1QL8A 2BLVA 3A7YA 3E16B 5BRRE 1XUJA 1P05A 2ZPQA 4UE7H 3ZZ3A 1T8LA 4SGAE 4X1QU 3RXEA 2CHAB 3STIA 1IQJA 5DSFA 3U8RH 5EPNA 1CT2E 4JZFH 1MUEB 1O3PB 3RLWH 2XNIA 3VB3A 1YCPM 1NU7B 3DHKH 2H6MA 2P59A 3BTFE 1DT2A 4K1EA 2KR7A 4I31A 2GKVE 1CHGA 2ZGCA 5AFZH 2ZGJA 5FPSA 4YO9A 1EUFA 1O5EH 4JMYA 3GDVA 4ESTE 2AGGX 1ZHMA 2A4OA 4GCHG 1P8VC 2O9QA 4NFFA 4XBCA 1PJPA 1CA8B 2ZDNA 1P06A 3PLKA 1P2NA 2A0QB 2ZHFH 1VJ9U 1XMNB 1NFYA 2TGAA 1P3EA 4CRDA 1C4U2 1GL0E 1TGTA 2B0FA 4NG9H 1SOTA 2ALVA 1F2SE 3T26A 1AO5A 1FY3A 2O8TA 3LC5A 3FAOA 2NU0E 1XUKA 4DIHH 1TBZH 1A5GH 1JXPA 3EQ0H 1P10A 4B6FA 1WYKA 3M36A 1NT1A 1T8NA 5GCHF 1KXCA 1B5GH 2J94A 1CT4E 1O3JA 2F83A 6CHAC 1D4PB 1GVKB 5GCHG 2HPQH 3EE7A 2QXGA 1MAXA 5EPYA 1TRYA 3TU7H 1H8DH 3Q3XA 2C93B 1DITH 3RXKA 3ATKA 4TPYA 1BRCE 3PRBA 4JYUH 3W1EA 1P2QA 4CRFA 1SGTA 1HXFH 1ZJDA 4NZLA 4CRBA 3P8NA 3VB6A 1SGFA 3RC5A 1CBWB 3PMJA 3ATLA 4UEHH 5F53A 3ZVCA 1SMFE 5EJLA 1OPHB 2Z9KA 3DT0H 1XM1A 2ZCKP 4VGCB
chains in the Genus database with same CATH topology
2ZKSA 2Z3CA 1DDJA 1UK2A 4TPIZ 2ESTE 1VZQH 4IMZA 1GG6C 4Z0KA 4AFZA 3D65E 1FAKH 1ZMNA 2VWMA 2BX4A 4TY6A 1CA0C 1L1GA 2FM2A 1UCYH 1UVOA 3AW1A 5L2YH 1XUFA 1ZLRA 1S81A 1QA7A 3V0XA 4BTTB 2XWAA 3E0NB 1W11U 1S82A 2D8WA 1GBJA 3GOVB 2RDLA 1L4DA 3QWCH 2ZPSA 2AS9A 1C4V2 1MBQA 1O3NA 1BJVA 2G00A 4GVUA 3TNTA 4ZHLU 1LCYA 2BLWA 4YOGA 1BOQA 4KGAA 1XXDA 1Y5AT 5T6GA 4LXBH 1ZTJA 1N6XA 1IQEA 2ZHDA 2ILNA 1SB1H 3P70B 2ZU5A 2XWBI 3UNRA 3M37A 3T62A 1RFNA 1GHVH 4WMEA 1UTMA 4R0IA 5PTPA 1Z7KA 3QDZB 1LMWB 3MU4A 1O2GH 3VXFH 3MU0A 1ZRBA 1P2IA 1QL7A 4NIVA 1BQYA 3RDZA 2OBQA 1ZPBA 1QGFA 1VGCB 1PPHE 1ZSLA 1TQ7B 1YC0A 2ZFTA 1C5UA 4X8SH 1JMOH 1SQOA 2BZAA 2VWNA 1F0TA 3HK6B 5HM2A 3PMBB 3TITA 2VGCB 4AORA 5A2MH 3K6ZA 5E0GA 3VB7A 3F9FA 1ESBA 5L2ZH 1C5SA 2ZG0H 2Z9LA 2ZQ1A 2FXRA 3VB5A 1KIGH 1RRKA 2FS8A 2CHAC 2VH6A 3LOXA 1A2CH 1GI8B 1KXFA 4ZXXH 4FUCA 1RTKA 1C9PA 1F0RA 1G30B 1BHXF 2WV4A 1DSUA 1W14U 2C8XB 1MMJN 2XBVA 4OS1A 1EQ9A 1K2I1 4UFDH 1EAWA 3BTHE 4ISNA 1TBRH 3MU1A 1C2KA 4Q7XA 4WXVA 1PQAA 4KTCA 2XC4A 5A8ZA 3TJUA 1Z8IB 1O31A 1ZGVA 2AIQA 4UFGH 3OX7U 1E35B 1GBEA 2OLGA 1MU6B 3L3TA 1KLIH 1QBVH 1N8OB 2PW8H 3ZVBA 3EA9A 3LU9B 1QB9A 1ZTKA 5ESTE 3UTUH 1NZQH 1OOKB 1XUGA 2G51A 1OP8A 1P02A 3BIUH 2Y7XA 3BTWE 2FZZA 2A1DB 1EJAA 3A82A 1YCPK 2ZZUH 2EI8A 4GSOA 2BXTH 3F9HA 1MTVA 4BNRA 5FX6A 2ZFSA 1F5LA 2Q6FA 1T31A 3GDSA 5DPAA 1JOUB 1FY8E 4MPWA 5GXPA 4TY7A 1BITA 3K2UA 4IC5A 1TMTH 1TOMH 1ETSH 3T29A 1GMDF 1WSSH 4WY3A 3SJOA 1KYNA 2V0BA 4DCDA 5I46H 5F03A 5FPTA 1XX9A 1C1OA 4HFPB 3FP7E 4NGAH 1MCTA 3ZZ5A 1GMDG 4YZUA 2OC1A 3M3TA 3A7ZA 5EQSA 5AHGH 4B2BA 4J1YA 2Z9GA 1NRSH 2BQWB 3F68H 4YLQH 3SJKA 2GDDA 2FTMA 4OS5A 1A4WH 2ZPRA 1V2PT 2WINI 2BTCE 3QLPH 3C1KA 1GGDC 3D62A 3S9CA 2ULLA 3BTGE 3NKKA 1MTSA 3ZYEA 4DVAU 4FU7A 3BIVH 4LK4A 3LJJA 4DOQA 1GI5A 1GVLA 2BY7X 3KQCA 4AB9A 1D6RA 1ZTLA 1V2QT 4CBOA 1D9IA 1OS8A 2C90B 5LPFA 1CSOE 1AFEH 2GCTB 1BTPA 1HBTH 2BD3A 2OINA 3B8JA 4ZUHA 2NU1E 1AMHA 2AH4X 1C5YB 1NTPA 1T8MA 1HRTH 3MO9A 3QUMP 3UUZA 4D76A 1TGNA 2WPJS 3EAJA 1D3TB 4K1TA 1CHOF 1ZZZA 2ZTZA 1V2TT 1GI7B 4I8LA 4LZ4B 1CHOG 1MTWA 2FS9A 1YP9A 5C5OA 3SU5A 1O5FH 3MNCA 2FX6A 3D23A 1TABE 3UQOA 1VGCC 3SORA 2VIQA 3TH2H 1GBHA 2PLXA 3GCNA 2J38A 1SOZA 2ODQA 3UOUA 1ELCA 2JETB 3PWCA 2FOEA 2ZFPH 1NFUA 1OYQA 2G52A 2VGCC 5C1YA 2DE9A 2F3CE 3SOSA 1DWCH 4MNXA 1YPMH 3FANA 4HI3A 5AF9H 1SG8B 1F92A 1LKAA 1ZGIA 4Q7ZA 1KTTB 1O2XA 4MPXA 1QJ1B 1C2MA 2ZGXH 3K6YA 1KXBA 2HOBA 1O5GH 3LH3A 2VINA 2WUBA 2HNTC 1XXFA 3TJOA 1GHWH 2C8ZB 2C3SA 2WPKS 2QGRA 4ABBA 1V2ST 2QF0A 2VIPA 1ELGA 1BMAA 5JYIA 3E0PB 4YT6H 4E7RG 3DFLA 1TB6H 3SGBE 3BTDE 4UONA 1ABJH 5DP6A 3ZVAA 3MHWU 1BTHH 1T4VH 3P17H 1EOLA 2H1UA 1V2VT 4AFUA 3BV9B 1C1SA 3E1XB 2CV3A 1Z1JA 5HM9A 3H7OA 4BAMB 2D26C 1C2FA 5A0CA 1AFQB 1DS2E 2QN5T 1INCA 1P9SA 3FFGA 3BEIB 4BAKB 1YF4A 1ELFA 2BD5A 1HXEH 3SI4H 3UFAA 4KP0A 1PPFE 4YOJA 3CS7A 3NXPA 1TNGA 3RXOA 1D3QB 1VCQA 5A0BA 4MVNA 1BMLA 1FNIA 1UK3A 1SHYA 4E7NA 3LKWA 1FPHH 4FUIA 5FHTA 4INHA 5TCAA 1ZR0A 6LPRA 1O0DH 1PPEE 3ODDA 1QURH 4F49A 2Z94A 4MNVA 1OWKA 2ZC9H 5L30H 1XUHA 3TK5A 2G4UA 2FOGA 3ZZ9A 1B7XB 1K28D 1WUNH 4HGCA 1SQTA 2FOHA 4M7GA 3NPSA 1DLEA 3Q00A 3A81A 1EJMA 3N7OA 5FCRA 3SQEE 3V3MA 2J4IA 1UO6A 2PGQB 1HJAB 4HZHA 1O5CB 2GT8A 1GI2A 1UTPA 5TJXA 4AGJA 2GCTC 3PM3A 3VGCB 3RXTA 3ZVFA 2FODA 1ZHPA 4MG3A 1OSSA 1O2NA 3LH1A 2WPLS 5F6MA 1UHBB 3T27A 1EXFA 5DP9A 1HIAA 1KY9A 2THFB 4Y6DA 2GV6A 2OP9A 3SV9A 5A8YA 4ZHMU 1C5RA 2DE8A 3A7XA 2OC8A 1GBBA 2R3UA 3NWUA 1MKXK 4NA8A 1Q2WA 5GPIB 1TBQH 2EC9H 2QAAA 2Y5HA 3A7VA 3ZYDA 4DT7B 1HYLA 4D9QA 3U9AH 2QIQA 2DUCA 3MWIU 4O3UA 2OD3B 3BN9A 4XBBA 4JZEH 1FI8A 2JETC 3Q3KA 1EKBB 2FDAA 3M7TA 3GICB 2GZ9A 4ZKSU 2SGEE 1NS3A 2VVCA 1TA2A 2H9EH 3QZRA 2FEQH 1KTSB 1AKSB 1O3HA 4H4FA 4AG2A 1V2LT 1QFKH 4ABJA 2C8WB 1HAXB 1UVTH 3H7TA 1QQUA 2TGTA 2J34A 5DK1A 4AOQA 3OY5U 2PSYA 4NSYA 3S9AA 1O2JA 4ZHAA 1MU8B 1TGSZ 1FLEE 4GHTA 3RMNH 3MU8A 2ZDMA 2W7UA 2TPIZ 5F8ZA 3ODFA 2OCVB 4CREA 2EA3A 1LPGB 1QRWA 3SHAH 2P95A 4Y71A 1EAUA 4IN2A 1KXAA 5H4IB 1AN1E 3RM0H 2BVRH 4K8BA 4WMFA 3SU0A 3UR9A 5JBTA 1BCUH 1WTHD 3KN2A 4Y0YE 1L0ZA 4I8JA 2NWNA 3A8BA 1P01A 2I6QA 2GGVB 4MNYA 1ETTH 2PUXB 5EXLA 5C5NA 1QA0A 3BEUA 1YGCH 2XYAA 1AFQC 1WU1A 3L6PA 2V3HH 4I8HA 4NCYA 7GCHF 1NRRH 2HWLB 1K1JA 1C2EA 5FBIA 1C9TA 1WTGH 1NC6A 5FPYA 1M9UA 4MLFB 3SU1A 3GY6A 4ISIH 1Y3XA 2FTLE 1SLUB 2P3FH 1SGFG 2A4RA 4ASHA 2ZHWH 2CF9H 1ZJKA 3TGJE 1Z8JB 1G2MA 1OWJA 1AUTC 1QR3E 1A0HB 1V2UT 1BDAA 1PPZA 2V35A 3RU4E 4CRCA 3TPIZ 2WV5A 1NY22 1UCYK 5E0HA 2ZHEH 4B76A 1EOJA 2G55A 3MO6A 3SW2B 3EGKH 2R9PA 1S6FA 1E37B 2NU3E 3KCGH 1UTKA 1C5WB 4FXGH 3HPTB 1TFXA 2A7CA 3RXSA 3SU2A 1C5PA 3A84A 1C5MD 3A7TA 3PMAB 4UFFH 5T6FA 1TRMA 3PV4A 2Z9IA 3IWMA 1HJAC 3KQBA 3B9FH 4Y11E 1Y3UA 3QGJA 2ZTXA 2BB4A 3SJIA 3VGCC 2XBXA 4A5TS 2QV1A 1SI5H 2BOHB 2F9VA 1GHBF 4NFEA 4AZ2B 2PUQH 2FIRH 3E90B 1YPHE 5LPRA 1GHBG 4B2CA 3SNBA 2AYWA 4KTUA 3RUOA 1B0FA 4B75A 1ZHRA 3ZVEA 1KXDA 1H1BA 2QA9E 2V6NA 1W0YH 4Y76A 8GCHF 1AHTH 1OWDA 1CGHA 2P93A 2OQUA 1HAVA 1GL1A 2RCEA 2WPHS 1LVMA 8GCHG 5LPEA 1HUTH 4U30A 2BOKA 3LGVA 3NUMA 3EYDA 4Y7BA 4K2YA 1MTNC 1C5ZB 3GCHB 4A6LA 2SGAA 1MTUA 3GYLB 2Q6GA 3LGWA 3EA7A 1UTOA 1FUJA 3RXFA 5AFYH 1TALA 4XFQA 1DWBH 3M5NA 2D1JA 3CP7A 2BLOA 1MD7A 2R0LA 3R3GB 1BHXB 2G5VA 4MPVA 3Q77A 3B23B 3HKJB 1A1RA 4TWWA 1FZZA 2Y81A 4IMQA 1FONA 1LO6A 3BTME 1A5HA 2F9BH 2BX3A 2XW9A 4X2VA 4IN1A 1PFXC 1O2UA 5AVDA 3UQVA 1OWIA 1BRAA 1PYTC 1LQDB 1UHBA 4E05H 4JYVH 2PTCE 3S7HB 1ELEE 3H5CB 2BDYA 4NWKA 3SUEA 3W95A 3F9GA 1DPOA 3AW0A 2ODYB 2F9UA 2LPRA 1ELBA 1YPKH 2A2QH 2ODPA 3MI4A 4BXWA 4H6SB 3U1IB 5IYTA 3ENSB 2VIOA 4K3JA 4IGDA 3WY8A 4F4OC 6GCHF 1LHFH 1AVGH 1AZZA 5DP3A 1BBRE 1HJ8A 1O2MA 1RS0A 1BRBE 4WF8A 2VU8E 1YPJH 5A8XA 2VWLA 1L2EA 2VB0A 2WPMS 2HGTH 3P8FA 3DUXH 4YOIA 1LVYA 2XC0A 2C4FH 3GCTF 1DVAH 5T3HA 1O35A 3O8DA 3P8GA 1XVOA 3GCTG 4B73A 2OXSA 2VH0A 4ZMAH 1FAXA 1AKSA 1MH0A 1H8IH 2Z3DA 2ZEBA 3KIDU 4FVDA 3GY4A 1K1IA 3RXJA 2XBWA 1FJSA 2VIWA 1W12U 1P12E 1PPCE 3SJ9A 1LPZB 1O33A 3SV2H 3OTJE 1O3OA 2PKSC 1FIWA 1HAPH 1O2OA 3PWBA 4HTCH 1BMNH 4ABIA 4IS5A 1Y5BT 1XVMA 1C1MA 2BD4A 1GJCB 1OKXA 1GBDA 3LC3A 1ANDA 1AE5A 1GHAF 3T2NA 1P09A 4X1PU 5DP8A 5EQRA 1ZMLA 3K9XB 2PSXA 3KGPA 3UWJH 1GHAG 2BM2A 3QO6A 3VFEA 4NA7A 3LIWA 1TNIA 3FZZA 1SLXB 1O2LA 1A46H 3LPRA 1EZUC 1O3EA 3R0FA 2Y80A 1IAUA 4RKJB 1VCPA 1LHDH 1C1VH 3GY7A 4XSKU 1S84A 1SVPA 3PO1B 1GJ8B 1G36A 2BY6X 4A1TA 1JBUH 1C4Y2 1P11E 2BDHA 4AFSA 1F0SA 2CMYA 3GCHC 2A4GA 2O8UA 4WJG2 4XE4A 3HGNA 1S0QA 1GI6A 3LONA 3VB4A 1MKWH 2J95A 3A83A 2FLBH 3MYWA 5F8XA 3PMHB 3OSYA 4Z6AH 1LHCH 1SGYE 2P8OB 3UNSA 1W0ZU 3U98H 1HV7A 1T8OA 1GBTA 4MPUA 2AMDA 3UIRA 1A0LA 1C5NH 2QXHA 1CBWC 1MD8A 2FYQA 2M5TA 4XBDA 1C1TA 3PYHA 2QY0B 3QTOH 4VGCC 1J9CH 1O3LA 2A2XH 3GYMA 1NRNH 5DGJA 1O3GA 1OWHA 1PPBH 2ZGHA 2AGIX 1QY6A 4I32A 1FPCH 5CMXH 4D7GA 1GI3A 3TGIE 1IQHA 5J4SA 1JIRA 1Y3WA 2BZ6H 1FXYA 4LZ1H 1EB1H 1BZXE 1RXPA 4YM9A 2F91A 1O3MA 4DGJA 1IQLA 4BANB 3MOCA 1A3EH 1P2KA 2F9PA 1GVZA 1GBAA 5JBAS 1N6YA 2H5CA 3M61U 3SBKA 4NA9H 3CENA 2BY9X 4BXSA 3RP2A 1PYTD 4PROA 1JRSA 1NO9H 4AFQA 3A7WA 2FMJA 1W7XH 1GJ5H 3M5MA 1TPOA 5DG6A 1TRNA 1O3CA 2G8TA 1CGIE 4I33A 1OWEA 1CU1A 2B7DH 2IJOB 5C2ZA 3A80A 5JDUB 2JH0D 1GMHF 3T25A 4UDWH 1V2MT 1WQSA 2XXLA 2QCYA 3TGKE 1GMHG 1G37A 2ALPA 1SGPE 1AU8A 3NK8A 4X2YA 2W7SA 2BVSH 3SNEA 2PKAB 3ZZAA 4CHAB 1TOCB 3AVZA 2ZDAH 3RXCA 1DOJA 1W8BH 1DANH 5ETXA 1ZSJA 1ZMJA 1OYTH 2GMTB 3LGTA 4YLUA 1O2WA 3RXIA 2XCNA 3FVFB 3Q3YA 1UMAH 2OC7A 5B6OA 3A88A 4R8TB 1XKAC 2ZQ2A 1UVSH 1BTZA 1VCWA 4OS7A 1MZDA 5HGGA 1FQ3A 3F1SB 3TH4H 1NESE 2TGDA 1FIZA 3BTQE 1RIWB 3DA9B 5FAHA 2TIOA 5C67A 1NPMA 1N8OC 2Z7FE 4MTBA 1MQ6A 1Z6JH 1DUAA 1CT0E 2AMQA 1TNHA 1H4WA 1GI0A 1O3AA 5I25A 1ESAA 3PO1C 2A7JA 4O9VA 1YLDA 3VXEH 3KQEA 1J17T 4OGYA 1HLTH 4Y10E 2SGFE 1HAZB 4KKDA 4I8GA 1TYNA 1WV7H 1J15A 1YLCA 3UNQA 1DFPA 4NIXA 2A5KA 2GX4A 1C2HA 1NFXA 5L6NH 2BD2A 4X1RU 3U8TH 1S85A 3PROA 2P8OC 8LPRA 5K7RA 3RMLH 1V2NT 3SU6A 1Z8RA 3MH6A 4X1SU