5EU8A

Structure of fipv main protease in complex with dual inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
300
structure length
300
Chain Sequence
b'SSGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRVINYENELSSVRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFTEIVSTDAFNMLAAKTGYSVEKLLECIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords main protease
publication title Crystal Structure of Feline Infectious Peritonitis Virus Main Protease in Complex with Synergetic Dual Inhibitors
pubmed doi rcsb
source organism Feline infectious peritonitis virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 84
structure length 300
sequence length 300
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5eu8A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5eu8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5eu8A01
1EOJA 2BB4A 1LPGB 2C8WB 1FY4A 1KXDA 1WTGH 1MD8A 3Q3XA 1H8DH 1WU1A 3LPRA 3OY6U 1T32A 1VITF 4U01A 2BY9X 2GZ7A 1MU8B 2XCFA 4ZUHA 1OXGA 1T8LA 1J14A 2V3HH 3M37A 4ZXYH 1AVGH 3BV9B 2BXTH 3I78A 1C2DA 3LU9B 1WCZA 4JK6A 5E2PA 3STIA 1MCVA 4MG3A 1OWJA 1ELAA 1ARCA 4XBBA 1TRMA 4DJZB 1C5YB 3UPEA 1O3CA 1CA0B 4F49A 3B8JA 2OC0A 4ISIH 2A0QB 1O3PB 3SO3A 7KMEH 2C90B 3EBNA 1AWFH 1HAVB 1A5IA 2TGTA 1TGTA 2ZDKA 2FDAA 1O35A 3SZNA 1DWDH 1K21H 4Y7AA 1D3TB 3GCHB 5BPEA 1HAIH 2BX3A 1GJBB 3ZVGA 1C5TA 1MBMA 2BM2A 5F03A 3Q3YA 3UR6A 2BDYA 1F92A 4E7NA 1O3EA 5C1YA 3W95A 2ZQ1A 1HIAA 1CHOF 1ZRKA 5GCHG 4UFFH 4U30A 2VNTA 2AGGX 1UVPA 3QGJA 1O2UA 4H4FA 5EW2H 2Z9GA 1XUHA 4Y0ZE 1B7XB 3PLBA 2A4GA 1HCGA 4H6SB 4NFEA 1GBTA 3S9BA 1F2SE 1JRTA 1GGDB 2B0FA 2QXGA 3E16B 4ZHAA 4XE4A 1SGPE 2BDHA 2ZGBH 3T25A 8LPRA 2VWLA 1AKSA 1GHAG 1HGTH 3PM3A 1P57B 1HXEH 3TVJB 4E7RG 1PPFE 1UCYK 5GIBA 2KAIB 1A5GH 1AQ7A 1IQGA 1TB6H 4ABIA 4WY3A 1BCUH 1WUNH 2ZFSA 4BAQB 6LPRA 3U8RH 5J4SA 1GBAA 1C9PA 4ABFA 2R9PA 2A2XH 5TJXA 1UTLM 2GP9B 5EQSA 4UFEH 2GMTC 1ZMLA 5I46H 1O30A 2STAE 1O5EH 2W3KA 3GYLB 3UUZA 3ITIA 2BHGA 1O5CB 1SGIB 3RXCA 1C1SA 1G3BA 1A7SA 1C2EA 5DO4H 1JRSA 3TITA 3ZZ6A 2D8WA 4OS4A 1GI8B 1TPAE 2XBXA 1TQ7B 2C4FH 5FX6A 5GJ4B 1FY3A 2PSXA 1BMNH 1D3DB 2ZHDA 3HGPA 1BHXF 1P05A 4X8UH 3TJVA 1EATA 5F8XA 1O2GH 4B71A 3SJKA 4DIIH 4DGJA 1GDNA 3OU0A 4NIYA 1YPHE 3M7TA 3HKJB 1SOZA 3QUMP 1O2OA 2TGAA 4OS1A 1NFYA 5L30H 2D1JA 1O2SA 1XKAC 2WPJS 3PWCA 1FI8A 1SHHB 1SC8U 2BY8X 2M5TA 1TONA 2GCTB 5C1UA 3VB7A 1O3DA 1V2LT 1BDAA 1QQUA 3T62A 1T8OA 1BBRE 1Y3YA 2ILNA 4GUXA 2J4IA 1HLTH 3O8RA 2W3IA 2FESH 4XSKU 3SU2A 4CHAC 3Q3KA 3C1KA 4D7FA 4WH8A 3U98H 4BTTB 3T2NA 1Y5BT 3E0PB 1YP9A 1W0ZU 2QF3A 3ZVEA 2SFAA 1O2XA 1SB1H 5AFZH 5ESTE 3LC5A 2LIZA 3KIDU 1CGHA 1L4DA 1S5SA 1THPB 1ZRBA 3RU4D 4INHA 1P2OA 2ZCLP 3A86A 1INCA 4A1TA 2R0LA 4TPIZ 3SV7A 1ANBA 3RDZA 1TRYA 2OC1A 4JMYA 3A81A 8GCHF 2WV5A 2FS9A 1GG6C 1OOKB 4AB9A 3ENSB 4AFUA 1AFQB 1T8MA 2BDCA 4X2VA 1L1GA 2PV9B 1BMLA 4I32A 3LH1A 3RXAA 2PR3A 1EZXC 1GI6A 3SU6A 3OY5U 4OS5A 4X0WU 2GKVE 2AIQA 1QRXA 3RXJA 2AIPA 3GY8A 3GOVB 1H9IE 1DUAA 3RC4A 1NS3A 3A85A 1NRPH 4CH8B 2PFEA 3E3TA 3GCTF 3TH3H 1GVKB 1K1MA 1CT4E 2TGDA 1V2KT 3LDXH 3SW2B 2VIQA 1ZZZA 1MQ6A 4I8KA 2HNTE 1FNIA 5LH8A 1XX9A 1SGQE 3PMHB 1W7GH 1A2CH 1C5WB 1O3KA 4NWKA 3LGUA 3EDXB 3A80A 4OS7A 4H42U 4CRBA 3RXRA 2Z9KA 2QXJA 4JZEH 3ATIA 4Z0KA 3ZVFA 5C5NA 2EI8A 4LZ4B 1P12E 2A45B 2Y6TA 3TNSA 5ETXA 3FP7E 5DG6A 1DS2E 3FANA 2ODYB 1ID5H 2FTMA 2R2WU 1RXPA 2ZWLH 1TX6A 3BTWE 1MTNC 1HAHH 2ZU5A 3SGQE 2JH5D 1MMJN 1ZHRA 2F9NA 4JZDH 2P94A 1VCQA 1QA7A 1LHFH 1SLWB 2Z9LA 2QYIA 2UUFB 1NRNH 4FUCA 4WWYA 5A8ZA 3VFEA 3IWMA 3D62A 1PPCE 1TGSZ 3PWBA 1WSSH 1YPMH 4QT8C 3M3VA 1PYTC 2NWNA 2UUYA 1O2JA 1FAKH 3AAUA 1DSUA 3IG6B 5CE1A 1ESBA 2C8YB 2ZZUH 3LGIA 2DUCA 4K8BA 1HAXB 1TNIA 1K2I1 1GDQA 2B7DH 1N8OC 1QHRB 1ZHMA 4MPUA 3TK9A 1P02A 1K1JA 2I6QA 2ANKH 1O2YA 4FUHA 3DHKH 5FHTA 1TX7A 1EAWA 3ESTA 1AO5A 2OCVB 1F0TA 3A8AA 1NROH 2BZAA 1JBUH 2PKAB 1G9IE 5DP4A 2FIRH 3KL6A 4ZHMU 5FPYA 2A4QA 1EJNA 2ZDVH 1EAXA 4NGAH 4KTUA 1SQOA 1YCPH 1FUJA 1F0SA 3SHAH 2G8TA 5FAHA 1V2JT 1ZPBA 2JH0D 3SJIA 1S83A 1G3CA 3LIWA 2YNBA 1ZJDA 1W7XH 1TIOA 2OQ5A 2TIOA 4JCNA 5K7RA 2G81E 1V2MT 1CE5A 1SL3A 4FUGA 3URDA 4ZKOU 1NU9A 1PJPA 1DFPA 5HM9A 4CREA 1OYQA 1VR1H 3EAJA 3ODDA 5JBCS 2GD4B 3WY8A 3UR9A 1ETRH 4SGBE 3MU8A 1O3AA 3M3SA 3BEFB 1EUFA 1XXDA 1P01A 1U6QA 2HLCA 3UQVA 1C5PA 5EQQA 1DT2A 1GL0E 1T31A 6GCHF 3BTFE 2ZFFH 1BTUA 2QC2A 1LKAA 1LMWB 1FY5A 5H4IB 5T3HA 2VWMA 2GGVB 3R3GB 3STJA 4X1RU 4AG1A 3QZRA 4Y8ZA 3SNBA 2GCHF 2FOGA 4ZAEA 4DIHH 1HFDA 2FX4A 1AUJA 1KIGH 1TE0A 3GY2A 3SJOA 1NT1A 2TGPZ 3P8GA 4NZLA 1Y8TA 1ACBE 3JZ1B 2BVSH 2Y7XA 5L2ZH 1QR3E 3AW1A 4Y10E 3MNSA 4MPWA 1B5GH 4WMDA 7ESTE 3U8OH 4ABDA 1MAYA 1SOTA 1YPGH 2Z6BD 4O3UA 2BQ7B 2AERH 4VGCC 1O2MA 2G52A 1E38B 5CHAB 3UTUH 1KXAA 1HRTH 1T4VH 5EXMA 2XXLA 4NWLA 4IS5A 2GVFA 1MTNB 4KKDA 2Q1JA 1LDTT 1BTYA 2F83A 5JBBS 4AYYB 2O8MA 1GCTC 1TGBA 1EZUC 2FTLE 1BTHH 4JYTA 2OD3B 1L0ZA 1AIXH 3MH4A 4SGAE 2EI7A 5T6DA 2ZFRH 2AS9A 3RXQA 2ZFTA 1L1NA 3DFLA 2J34A 1C1NA 1GHZA 1AE8H 2XC0A 2EI6A 1HJ8A 3FZDA 2P8OB 3DT0H 3U9AH 1Q3XA 1S82A 1FDPA 3KEEA 4FUBA 1UMAH 1P2NA 2ZGJA 4UD9H 2BVXH 1S0RA 4I8GA 4O97A 3LJOA 1XKBC 1KXBA 5TCAA 1C4Y2 3VB5A 1BIOA 1O2IA 3LJJA 4OGXA 5TCCA 1P2KA 1TAWA 1NN6A 4AG2A 1SGRE 1UK2A 3S9AA 3SNEA 1LKBA 2OXSA 1TX8A 1OPHB 3ZZDA 2ZP0H 3MO3A 2OC7A 4X6OA 3PLKA 2LPRA 3TJUA 3TPIZ 1GBKA 1PQ8A 1W0YH 3MU4A 1WQVH 1YCPK 1QJ7B 2BYAX 1ZHPA 1UVUH 2ZTYA 2ODPA 1QRZA 3GDUA 3LT3A 3LKWA 4ABGA 1NRRH 4TPYA 5C1XA 2AYWA 1LPZB 2BTCE 1ELFA 1J8AA 1BBRH 1WQSA 1TALA 2ZPSA 5HYOA 4KTSA 2GTBA 1ABIH 5EXNA 1TNLA 2P3UB 1H1BA 2ASUB 3SNDA 5JPMH 1S6HA 2WPIS 3A8BA 2FLBH 2CMYA 3QK1A 1L4ZA 4NZQA 2GDDA 2THFB 3A7YA 1SPJA 3DFJA 4FXGH 4ZKSU 5C3NA 1P3EA 3OYPA 1TGNA 1P2MA 3ZYEA 1MTSA 5CMXH 1AWHB 5EW1H 1D3PB 2SGDE 3PO1B 3UWIA 1TNJA 1A3BH 2IN2A 1SMFE 3EA8A 5GCHF 3RMNH 1UTMA 2VIDA 3TH2H 2Q6GA 3SHCH 3NWUA 1V2PT 1HB0B 4D76A 3PTBA 1EAIA 1GMCG 2BD3A 1ANEA 2QGRA 1BTPA 4CRCA 2RDLA 1JMOH 1Y3UA 5L6NH 1A5HA 1H9HE 2UWOA 3MU0A 1OX1A 4AB8A 4BAHB 5C2ZA 1O3HA 7LPRA 1RTFB 3RXEA 1TABE 2YNAA 3ZZ3A 1O0DH 1GMDG 1GHAF 1OWDA 2WYGA 4HGCA 3SNAA 4I8HA 1VJAU 3MFJA 1LVMA 1O5AB 3F1SB 2CJIA 3S0NA 3PMJA 2ALPA 3FZZA 4CH2B 3VB3A 4KTCA 1ELEE 1NESE 1PPGE 3BTGE 4VGCB 2P95A 4UDWH 3D23A 1UHBB 2IJOB 2CHAB 4WH6A 4Y71A 3EGKH 3BEIB 1GBDA 4Y11E 1T4UH 1PQ5A 2OC8A 1EPTB 1WV7H 2V0BA 5LPRA 3GCOA 1C2IA 1D6RA 2SGAA 5EG4A 4RSPA 2CGAA 1GVZA 1YPEH 4NSVA 1VJ9U 1ZTLA 4YESB 3KQBA 2DE9A 1QB6A 3RMLH 1NZQH 4BAOB 3H7TA 1M9UA 3UOPA 4CR5A 4Y76A 3O8DA 1FZZA 1K1OA 1WYKA 1P10A 2BY6X 1GBIA 4JK5A 1AE5A 1NU7B 1O2HA 1P2QA 2R2MB 3D49H 1D4PB 2XWBI 4IMQA 1RTKA 2STBE 2QCYA 3SI4H 2VIVA 1TNKA 5AF9H 4B2BA 2J2UA 1AZZA 4NIWA 3SV8A 3A83A 3QTVH 5JBTA 1SGFA 1XXFA 3SJ8A 1EJMA 1S84A 1C5OH 5EPNA 1L2EA 1VCPA 3NPSA 3T5FH 1W14U 1Y3VA 1HIAB 3SU0A 1TA6A 1DPOA 1BBRK 4MNXA 4WXVA 4KGAA 5G4BA 4BXWA 1CGJE 4K5ZA 1GI5A 1ZSLA 1DLKB 1RRKA 2J94A 3SBKA 1GI1A 2A4RA 3KN2A 2Y80A 1F0RA 4FU7A 2ZQ2A 1P06A 2ZU1A 1PPHE 1UO6A 5C5OA 4TY6A 4X2XA 2R0KA 1A0HB 2VU8E 2QV1A 1SR5C 4KP0A 1C4U2 3A7TA 3E91A 1GHBG 1AKSB 1Y59T 4ZMAH 4WMFA 1DE7H 1HJAB 3T29A 1OS8A 1SI5H 1MCTA 2A5KA 4I8JA 1G30B 1LCYA 1FMGA 3PTNA 6CHAB 3M5NA 1TFXA 3EE0B 1O36A 4A92A 1MAXA 3M35A 1C1QA 1W2KH 1D6WA 4B2CA 4ZROA 2FOCA 3L3TA 4FUJA 1KDQA 1QB9A 2QXIA 1ZTKA 2ZA5A 5F6MA 2OQUA 5EXLA 3O8BA 2J9NA 4ISLA 4AYVB 1TNHA 4I33A 5SGAE 3T27A 3ZZ5A 4A1XA 2EC9H 3LC3A 1GMHG 1GBMA 4GHQA 1EB2A 1ETSH 5I25A 2F3CE 1Z6JH 4X1QU 2SGQE 1DWCH 3UOUA 3ELAH 1ZLRA 3EQ0H 1Z7KA 2A5IA 3NK8A 1BRUP 1BB0B 1VGCC 1O5GH 5A2MH 3KGPA 1OWIA 3PMBB 4D9QA 3NKKA 1A3EH 4Y0YE 1LPKB 3NUMA 2PHBA 2XYAA 5JB8S 2ZDMA 3SQEE 1SQTA 1JOUB 5FBIA 1GBJA 1YF4A 1MZAA 3ATWA 2NU1E 2BD9A 4D9RA 1HNEE 3V12A 2GV7A 2GV6A 3SU5A 2FODA 1NTPA 1TPSA 1NM6A 3GY7A 3A82A 2H5DA 3K9XB 3P6ZB 3MNCA 4GCHG 1BA8B 5AFYH 2ZTZA 4LK4A 1SQAA 1DOJA 1K28D 3UY9A 2WINI 1P2IA 5A09A 1UTQA 2IPHA 4A1VA 5E8EH 3PB1E 1O5DH 4YLUA 2VIWA 2FYRA 3JZ2B 3GICB 4YOGA 1BRCE 1QBNA 2QN5T 1B0FA 1UVTH 4K69A 2CV3A 1C5VA 2ALVA 1AGJA 1C5SA 1Y3WA 3BG8A 5T6FA 3ZVCA 1YYY1 4K1EA 2H9TH 2SNVA 4WVPE 2Y5GA 5J4QA 1K1LA 4NA9H 2C93B 3S9CA 1EJAA 1G3EA 1QL9A 2K7XA 3ZZ4A 1LVOA 3SI3H 3BEUA 3F6UH 5E0JA 1KXCA 3BTTE 3A7XA 3VB6A 4CBNA 3FP8E 1O2PA 2P93A 4AGJA 3TGJE 1CBWC 2W5EA 3HGNA 2EA3A 3BTDE 1BRBE 1RD3B 3RXGA 4DURA 1PQ7A 1A0LA 4MTBA 4JYUH 4ABAA 3U69H 1CQQA 3LGYA 3F9HA 1V2ST 2BDIA 2JETC 2UWLA 1SGCA 2BOKA 1SGYE 1O31A 2OBOA 1LHEH 1V6DA 1H4WA 2W26A 1TMBH 1ESTA 5GDSH 5F8TA 1SGTA 1E37B 3TK6A 2GMTB 1YM0A 3MOCA 4GAWA 3TNTA 4J2YB 3ZV8A 1JIMA 1QURH 4XBDA 5C20A 4MNYA 1BHXB 1V2RT 1WBGB 3BTEE 5ESBA 2Z94A 1BRAA 3HK6B 2CN0H 4I7YH 2Z3EA 4YTAA 1V2OT 1O2VA 1TBZH 5DKMA 1HAYB 1O2QA 2G51A 2LNCA 5AHGH 1EP5A 2H9HA 3HPTB 3W94A 2OLGA 1E36B 3MH7A 1O3GA 2BLVA 3I77A 2H6MA 2YOLA 1FIZA 3RUOA 4MVNA 4LZ1H 3FAOA 1K22H 3ZZ7A 1PPEE 2HALA 2GZ8A 3QN7A 1GHVH 2PGBB 2ZNKH 2VVUA 3OX7U 4NSYA 1XUGA 1OP0A 4X6PA 1VGCB 1ELCA 4MNVA 5JYIA 1K1NA 1FAXA 1TA2A 1AHTH 1O2ZA 3A7WA 3E0NB 2BD7A 1O33A 2B5TB 3RLWH 4CHAB 1MQ5A 3QGNB 1ELDE 1UTKA 1IQJA 2FEQH 4I31A 2ZGHA 1DVAH 1QA0A 2BVRH 1O2RA 2FO9A 1IHTH 4A6LA 3L33A 1TRNA 1PQAA 3QX5H 3ZZ8A 2A32A 3CENA 2PWXA 1GI9B 2VGCC 3NCLA 2GDEH 1P0SH 2PGQB 1HAPH 3A87A 1FPHH 1A46H 2VWOA 4ABEA 1MU6B 2P59A 5E2OA 4O03A 3LGWA 5PTPA 1SLUB 4H6TA 1D9IA 4Z6AH 1EKBB 3DUXH 2SNWA 4RKJB 1C2KA 1GG6B 3ZYDA 2NU4E 1AB9C 5DJ7A 1F0UA 3P8NA 1F5LA 3MH6A 2PUXB 5A0CA 1LHCH 4X8TH 1C5RA 1DANH 1THSH 3SUDA 1FXYA 2NU2E 3L6PA 4BAMB 4AFZA 5FCRA 3E1XB 1AI8H 2AMDA 1ABJH 4A7IB 1OP2A 1O5FH 1O3FA 2BD4A 1JIRA 4AOQA 4TWWA 3QWCH 2TBSA 5GPIB 2BLQA 2AMQA 3GYMA 3Q77A 1WTHD 3SV6A 2ZHQH 1AVWA 1C5XB 1HPGA 1CA8B 2A1DB 2ZHFH 4K3JA 4F4OC 4UFDH 3VGCC 4Q7XA 2XRCA 2H1UA 3GDVA 3RXFA 1TMUH 1DX5M 1Z8RA 4NA7A 2AFQB 1W3CA 4INLA 3S69A 2FOFA 2G4UA 3FP6E 4Y79A 2OP9A 4ISHH 4YLQH 2VJ1A 2A2QH 1LTOA 1GBFA 3UFAA 1C2LA 3LONA 1ELBA 2XCNA 3M61U 1BTZA 2VB0A 4MDSA 1Z71A 3LH3A 2W7UA 5FBEA 5A8XA 1C1WH 1W10U 4MLFB 3RM2H 1GJ4H 3SOSA 2CXVA 1BJVA 1Z1IA 2SGEE 3MHWU 1EX3A 3QLPH 3E90B 1RIWC 1NY22 3ZZCA 2C8XB 4D7GA 1P9UA 1GMCF 2UUJB 4B2AA 3MI4A 2ZHEH 1MKWH 5DP7A 1GJ5H 4DG4A 4JZIA 1GBBA 1E34B 3PYHA 2WV4A 1QIXB 3PMAB 3O8CA 1P03A 2HNTF 2OBQA 4I8LA 1DICA 1TNGA 1GMDF 3LGTA 1ZSKA 4AN7A 1TLDA 2XBYA 4ESTE 3PV4A 1G3DA 3RP2A 1N8OB 3Q00A 1D3QB 3RXDA 1QNJA 3M7UA 1CA0C 1A4WH 3RXUA 1E0FD 1W12U 2SGFE 2VVVA 2Y5FA 2WPKS 1GJ9B 1EQ9A 3G01A 3ATMA 1ETTH 2VWNA 3AW0A 1QL8A 5LPEA 3P8FA 2F91A 1BZXE 2ZTXA 1MTUA 1CSOE 4ABJA 3GCHC 3KQCA 4MNWA 1YC0A 4A5TS 4UONA 2XWAA 1OP8A 1WOFA 1SFIA 1AMHA 4CBOA 4ZKNU 1A0JA 1RS0A 4TYDA 5DP6A 2D26C 2PLXA 3P17H 5IYTA 2GT8A 4FUDA 3RXOA 3SGAE 1O3MA 3RXLA 1B0EA 3SV9A 1QB1A 2BQWB 1EP6A 3SN8A 3Q76A 4X1PU 6GCHG 3M36A 1YLDA 2RCEA 2V35A 3KNXA 1KTSB 1UVSH 1WAYB 4B74A 4E05H 2A5AA 3E8LA 4X1NU 1GJCB 2P3FH 2ZIQH 2BQ6B 3RXKA 3SGBE 2WPMS 2GCHG 3P95A 4ISOA 1JWTA 1C2HA 3U8TH 2ZU3A 1DY9A 2G5VA 1X7AC 5FXLA 3VPKA 3F9EA 4XDEA 5B6OA 3RU4T 1BOQA 1S0QA 1A1RA 1ZYOA 1ELVA 1SG8B 1FJSA 1AZ8A 1V2QT 4YOJA 1BJUA 1N6YA 3SORA 1H8IH 2ZI2H 1ESAA 3ZZAA 1QFKH 1GWAA 3KCGH 3TH4H 1GBHA 1PPZA 3HK3B 4FUEA 4BNRA 2Q6FA 2H9EH 2WUBA 3BIUH 3SJ9A 4Y7BA 3SU3A 3CP7A 2FM2A 4R0IA 2J38A 1LQEA 1CGIE 1CT2E 2HPQH 3MNXA 4X2YA 1ZGIA 4U2WA 3BG4C 2AH4X 1HAOH 1ARBA 3PROA 3RC5A 3M3TA 2FX6A 3VGCB 1L1JA 2Q6DA 1IQIA 7GCHG 3FFGA 3DD2H 4B73A 1GCDA 3MU5A 3KQDA 1SGNE 1GHBF 4FU9A 1LQDB 5JB9S 1CU1A 3BN9A 5L2YH 4OS6A 4D8NA 2A7JA 4IBLH 1C1RA 3HKIB 3RXPA 2A7HA 5IDKA 2ODQA 2RA3A 5HMAA 1G2MA 2J95A 1FQ3A 2GCTC 2Y7ZA 1GCTB 3OSYA 1Z1JA 1ZMJA 2ZO3H 1GJ6A 1MKWK 1QTFA 3BIVH 1UJ1A 1YPJH 1TWXB 5JDUB 1NFUA 1GJAB 3ZZ9A 3MMGA 5F8ZA 4X6MA 1V2WT 1QRWA 1T7CA 1MKXK 5DP8A 3T28A 1GBLA 3F68H 5DP5A 1GMHF 1XM1A 3M5OA 1DWEH 3TLOA 2NU3E 1EAUA 5EOKA 4NFFA 4YM9A 3ZZBA 2P3TB 3SU4A 2BY5X 5EQRA 2PUQH 2ZF0H 1HAVA 1O3JA 3H5CB 1YPKH 1ZPZA 4O9VA 4DY7B 2AGIX 4K1TA 2ZU2A 1FN8A 2V3OH 1DDJA 2HGTH 2I6SA 4M7GA 2FZZA 3AAVA 1AFQC 1SGFG 1BITA 3BSQA 4YZUA 4DVAU 1THRH 1C5LH 1K1IA 3A84A 3UQOA 1IQNA 3QTOH 2ZDLA 1O2KA 5E0GA 2O8WA 2P16A 1G37A 3QO6A 1Q2WA 1NRQH 1V3XA 3TGIE 1PFXC 1FPCH 1C2MA 1Y3XA 4ABBA 4FU8A 3P8OA 5K0HA 1FN6A 2TRMA 1GJDB 4Y8YA 2XW9A 1O3IA 2UUKB 4GLYA 3VB4A 1SVPA 1F5KU 2HRVA 1IHSH 2ZHWH 1VZQH 2PKSC 1SLXB 1AD8H 3MTYA 4UFGH 2ZGXH 1O34A 3RXSA 1C4V2 3UNSA 1SGEE 4IC6A 1G2LA 1GI0A 2GZ9A 1HYLA 1N6XA 1G36A 3MO9A 1IAUA 1MBQA 4ZHLU 4Q7ZA 1QBOA 2O9QA 1P8VC 4Q7YA 1UVOA 4GCHF 5FX5A 2ZCKP 1DLEA 3K65B 5DK1A 4BTIB 1F5RA 1PPBH 1J16A 2KAIA 3R0FA 3RM0H 1C9TA 4YT6H 3VXFH 3SUGA 1LO6A 2XC4A 3NXPA 1PYTD 2F9PA 2UWPA 1TBQH 1HUTH 3EA7A 2Z3CA 2FOEA 1AFEH 1C2FA 1MD7A 2ZPRA 4INKA 3V13A 4Q2KA 1BMMH 4IMZA 3NZIA 1ELTA 5HM2A 2FMJA 1Z8JB 2WPLS 3U1JB 2A4OA 1LHGH 4MPVA 1OWHA 3M7QA 3AVZA 1OWKA 1J15A 5DPAA 3KQEA 4UEHH 1GI4A 4Y6DA 1O5BB 2BXUH 2OINA 2HOBA 3GY5A 4YT7H 5A0AE 1GVLA 1O2WA 1BUIA 5LPFA 1YLCA 1GPZA 1A61H 1O3BA 1VITG 3UREA 1VITH 1KLIH 1ORFA 3RXTA 1C5UA 4E06H 2ZCHP 1KDQB 2RA0A 1P2JA 4IW4E 3RC6A 1TOMH 3RXHA 1IQLA 1G32B 2ESTE 3RXVA 1XUFA 1GDUA 3BG4B 2VIPA 4BTUB 1OWEA 1TOCB 1UTPA 2FYQA 1MTVA 3PLPA 1H9LB 4AFSA 1E35B 1F7ZA 1ZMNA 4AFQA 3S7HB 4X1SU 1SHYA 1BT7A 2PSYA 1OKXA 3SUFA 3GCNA 4BOHA 1KLTA 5DP9A 3M5MA 3GY3A 3TIUA 4TWYA 1EASA 2BDBA 2GT7A 3TK5A 1OYTH 2Z3DA 2VINA 3P92A 2BDGA 5FPTA 1C1VH 1O2NA 4XFQA 1KYNA 4JYVH 2XBVA 4B76A 4HI3A 3RLYH 1CHOG 1DY8A 4GHTA 2XC5A 5EU8A 2V6NA 4FVDA 4YOIA 2B8OH 4NIVA 1V2NT 3RU4E 4J1YA 1EB1H 1KXFA 1UCYE 5A8YA 1GI2A 1AY6H 4OGYA 1JXPA 2BY7X 1HBTH 1TMTH 3AASA 4RKOB 2FOHA 2VH6A 1EXFA 3SUEA 4BXSA 1AU8A 3C27B 4WF8A 2G5NA 5EPYA 1XVMA 1XUKA 2F9OA 2JKHA 3SQHE 3MNBA 4U32A 1HJ9A 2AEIH 5LGOA 4GPGA 1XVOA 2EEKA 1SFQB 3ATKA 1QJ1B 3V0XA 3A7VA 2K1QA 2QA9E 4B75A 2ANMH 1KXEA 2WUCA 1FLEE 5AVDA 1QL7A 1P04A 2PTCE 1K9OE 4ISNA 1O3OA 2Z7FE 5FPSA 1V2UT 1V2VT 4CRGA 8ESTE 3BTHE 4ABHA 6ESTA 1GJ8B 2PKSB 2QY0B 1KY9A 4ZKRU 2BX4A 4IGDA 1FV9A 4AX9H 3V7TA 2R3UA 1C1PA 2Z9IA 4WJG2 4Y8XA 3MU1A 4Q80A 4WMEA 5BRRE 4HZHA 4K8YA 4AGKA 1HAZB 4CRAA 2IOTA 2F9UA 4TY7A 1MH0A 1W11U 1YBWA 5CHAC 1CHGA 2CF9H 3CS7A 3TU7H 1DXWA 3CS0A 3IITA 1O3NA 4IN1A 2OUAA 2XBWA 2XTTB 2VH0A 1ZR0A 4NG9H 1BTWA 1YCPM 2FP7B 2QF0A 2Y5HA 1ZPCA 3P70B 4CRDA 2QIQA 1LVBA 1RJXB 4THNH 8KME2 1NO9H 1C1UH 3BTQE 4XOJA 1GHWH 1UK3A 2P8OC 4BAKB 3UWJH 3RMOH 4RN6A 1ZOMA 1Q31A 3TGKE 2VIOA 4X6NA 2CF8H 1LVYA 3V3MA 3ODFA 8GCHG 2PKAA 2ULLA 1RTLA 1IQMA 1NC6A 1O32A 1QY6A 3MH5A 2WYJA 5E0HA 1C5NH 1EZSC 4R8TB 3ZV9A 4NIXA 1UTNA 4LOYH 3B9FH 3A8CA 2XNIA 2ZDNA 1SSXA 4X8VH 1YKTA 1C1TA 1S81A 1IQFA 2C8ZB 4MPXA 2JH6D 2O8LA 1VCWA 1ZSJA 1P9SA 2BD8A 3B23B 3RMMH 1CT0E 1BQYA 1TBRH 3GCTG 3H7OA 1C5ZB 3UIRA 4DT7B 3I29A 1ANCA 3BTME 2FOBA 3EA9A 4GVUA 1FY8E 3U1IB 2F9VA 1O3LA 4X8SH 1AVXA 1C5MD 1XUJA 4CRFA 1C2JA 1YPHC 5EGMA 2FXRA 1XUIA 2FLRH 4ASHA 2TPIZ 1XMNB 1DXPA 1GBCA 4JZFH 4DW2U 2ZFQH 1FY1A 1KLJH 4FUIA 1SGDE 3TJNA 1Z8GA 1DSTA 2BMGB 4PROA 2HPPH 4X2WA 5JBAS 3F9FA 4HFPB 1QCPA 3A89A 2O8TA 2BZ6H 4AORA 1IQKA 2A31A 3T26A 1C1OA 3PO1C 1QBVH 2ZFPH 2BD2A 2W7SA 2HVXA 1T8NA 1OSSA 1J17T 1ZJKA 3MWIU 4BANB 2WPHS 1DM4B 2FI3E 3M5LA 1C1MA 1HDTH 1GI3A 2QAAA 2FWWA 1UK4A 2Y81A 1TGCA 3A7ZA 9ESTA 2ZU4A 3A88A 3QDZB 3TJOA 5ABWA 3S7KB 4GSOA 1HV7A 4IC5A 2R3YA 3MO6A 4FVBA 1NFWA 4O3TA 4FUFA 1DWBH 3MYWA 2G4TA 4ZH8A 1O38A 2PW8H 3BTKE 1CBWB 3ZVAA 1BMAA 1N1LA 4WXIA 2J92A 1TPOA 3N7OA 1YGCH 3OTJE 2FOAA 2G55A 1J9CH 2OTVA 1HXFH 2JETB 2HNTC 3F9GA 2CHAC 2ZG0H 5FCKA 1IQHA 2D2DA 1AUTC 5EODA 1Z6EA 3UNRA 4YO9A 2H5CA 2B9LA 2FI5E 1RGQA 5GWZA 1ZTJA 1IOEA 2BD5A 1MKXH 1MUEB 1Y5AT 2H2ZA 1EPTC 3E6PH 2SGPE 5GXPA 4NCYA 3GY4A 2BLWA 1GBEA 5DP3A 1SLVB 1TQ0B 2RG3A 7GCHF 4KELA 1DUEA 1UTOA 3GY6A 3DA9B 1IQEA 1EOLA 2NU0E 1FONA 2AGEX 9LPRA 5C67A 3VEQB 1GHXH 3QZQA 2ZGCA 1Z8IB 2AMPA 4CR9A 3GISB 1O37A 1GL1A 1MTWA 1NFXA 2ZECA 1AN1E 1KTTB 4OS2A 2Y82A 2GX4A 2ZPQA 3RXMA 2ANYA 1P09A 1P11E 1V2TT 5HGGA 1HAGE 3BF6H 1O2TA 5T6GA 2C3SA 1O39A 3SV2H 2ZC9H 4JZ1A 1TPPA 3GDSA 1ANDA 2PTNA 1EZQA 4XBCA 4UE7H 1C5QA 4LXBH 1GI7B 1Y5UT 1RFNA 3FVFB 2VGCB 1DITH 3EYDA 1UTJA 1P3CA 1KSNA 2A7CA 1GGDC 3VXEH 1MZDA 2VVCA 1QQ4A 3HATH 1NRSH 3ZVDA 4DOQA 5HXFA 3K6YA 3K2UA 2O8UA 1AB9B 3RXBA 1YPLH 3KF2A 1BTXA 4NA8A 3D65E 3LGVA 2ZEBA 1ELGA 1UCYH 2ZDAH 2FOMB 3LOXA 3URCA 4K60A 1HJAC 4K2YA 2F9BH 2G00A 3ZVBA 4K1SA 4B1TA 1NPMA 1CVWH 1C2GA 5A0BA 6CHAC 2BLOA 4MQAA 1FIWA 2FI4E 3K6ZA 1QJ6B 1GHYH 1QGFA 1TYNA 3A8DA 3KHVA 4IN2A 3UNQA 2BOHB 1CO7E 2ZKSA 2DE8A 2Z9JA 1O2LA 4DCDA 1K1PA 1ZGVA 3SU1A 1S85A 1W13U 2BDAA 3SNCA 1GJ7B 2FS8A 1SBWA 4ZXXH 1LHDH 1W8BH 4HTCH 1UHBA 2QXHA 2HWLB 3RXIA 3ATLA 1RIWB 2FPZA 4AZ2B 5DGJA 2ANWA 1S6FA 1EPTA
chains in the Genus database with same CATH superfamily
1EOJA 2BB4A 1LPGB 2C8WB 1FY4A 1KXDA 1WTGH 1MD8A 3Q3XA 1H8DH 1WU1A 3LPRA 3OY6U 1T32A 1VITF 4U01A 2BY9X 2GZ7A 1MU8B 2XCFA 2L6OA 4ZUHA 1OXGA 1T8LA 1J14A 2V3HH 4ZCNA 3M37A 4ZXYH 1AVGH 3BV9B 2BXTH 3I78A 1C2DA 3LU9B 1WCZA 4JK6A 5E2PA 3STIA 1MCVA 4MG3A 1OWJA 1ELAA 1ARCA 4XBBA 1TRMA 4P00A 4DJZB 1C5YB 3UPEA 1O3CA 1CA0B 4F49A 3B8JA 2OC0A 4ISIH 2A0QB 1O3PB 3SO3A 5HIYA 7KMEH 2C90B 3EBNA 1AWFH 1HAVB 1A5IA 2TGTA 1TGTA 2ZDKA 2FDAA 1O35A 3SZNA 1DWDH 1K21H 4Y7AA 1D3TB 3GCHB 5BPEA 1HAIH 2BX3A 1GJBB 3ZVGA 1C5TA 1MBMA 2BM2A 5F03A 3Q3YA 3UR6A 2BDYA 1F92A 4E7NA 1O3EA 5C1YA 3W95A 2ZQ1A 1HIAA 1CHOF 1ZRKA 5GCHG 4UFFH 4U30A 2VNTA 2AGGX 1UVPA 3QGJA 1O2UA 4H4FA 5EW2H 2Z9GA 1XUHA 4Y0ZE 1B7XB 3PLBA 2A4GA 1HCGA 4H6SB 4NFEA 1GBTA 3S9BA 1F2SE 5F53A 1JRTA 1GGDB 2B0FA 2QXGA 3E16B 4ZHAA 3PV5A 4XE4A 4Z1MD 1SGPE 2BDHA 2ZGBH 3T25A 8LPRA 2VWLA 1AKSA 1GHAG 1HGTH 3PM3A 1P57B 1HXEH 3TVJB 4E7RG 1PPFE 1UCYK 5GIBA 2KAIB 1A5GH 1AQ7A 1IQGA 1TB6H 4ABIA 4WY3A 1BCUH 1WUNH 4YXWD 2ZFSA 4BAQB 6LPRA 3U8RH 5J4SA 1GBAA 1C9PA 4ABFA 2R9PA 2A2XH 5TJXA 1UTLM 2GP9B 5EQSA 4UFEH 2GMTC 1ZMLA 5I46H 1O30A 2STAE 1O5EH 2W3KA 3GYLB 3UUZA 3ITIA 2BHGA 1O5CB 1SGIB 3RXCA 1C1SA 1G3BA 1A7SA 1C2EA 5DO4H 1JRSA 3TITA 3ZZ6A 2D8WA 4OS4A 1GI8B 1TPAE 2XBXA 1TQ7B 2C4FH 5FX6A 5GJ4B 1FY3A 2PSXA 1BMNH 1D3DB 2ZHDA 2F43B 3HGPA 1BHXF 1P05A 4X8UH 3TJVA 1EATA 5F8XA 1O2GH 4RT0A 4B71A 3SJKA 4DIIH 4DGJA 1GDNA 3OU0A 2KCAA 4NIYA 1YPHE 3M7TA 3HKJB 1SOZA 3QUMP 1O2OA 2TGAA 4OS1A 1NFYA 5L30H 2D1JA 1O2SA 1XKAC 2WPJS 3PWCA 2LELA 1FI8A 1SHHB 1SC8U 2BY8X 2M5TA 1TONA 2GCTB 5C1UA 3VB7A 1O3DA 1V2LT 1BDAA 1QQUA 3T62A 1T8OA 1BBRE 1Y3YA 2ILNA 4GUXA 2J4IA 1HLTH 3O8RA 2W3IA 3OFND 2FESH 4XSKU 3SU2A 4CHAC 3Q3KA 3C1KA 4D7FA 4WH8A 3U98H 4BTTB 3T2NA 1Y5BT 3E0PB 5IK2D 1YP9A 1W0ZU 2QF3A 3ZVEA 2SFAA 1O2XA 1SB1H 5AFZH 5ESTE 3LC5A 2LIZA 3KIDU 1CGHA 1L4DA 1S5SA 1THPB 1ZRBA 3RU4D 4INHA 1P2OA 2ZCLP 3A86A 1INCA 4A1TA 2R0LA 4TPIZ 3SV7A 1ANBA 3PRBA 2JJ2D 3RDZA 1TRYA 2OC1A 4JMYA 3A81A 8GCHF 2WV5A 2FS9A 1GG6C 1OOKB 4AB9A 3ENSB 2AHME 2JDID 4AFUA 1AFQB 1T8MA 2BDCA 2KM0A 4X2VA 1L1GA 2PV9B 1BMLA 4I32A 3LH1A 3RXAA 2PR3A 1EZXC 1GI6A 3SU6A 3OY5U 4OS5A 2CK3D 2GKVE 2AIQA 4X0WU 1QRXA 3RXJA 2AIPA 3GY8A 3GOVB 1H9IE 1DUAA 3RC4A 1NS3A 3A85A 1NRPH 3OAAD 4CH8B 2PFEA 2OK5A 3E3TA 3GCTF 3TH3H 1GVKB 1K1MA 1CT4E 2TGDA 1V2KT 3LDXH 3SW2B 2KCOA 2VIQA 1ZZZA 1MQ6A 4I8KA 2HNTE 3N99A 1FNIA 5LH8A 1XX9A 1SGQE 3PMHB 1W7GH 1A2CH 1C5WB 3NRLA 1O3KA 4NWKA 3LGUA 3EDXB 2KX4A 3A80A 4OS7A 4H42U 4CRBA 3RXRA 2Z9KA 2QXJA 4I86A 3ATIA 4JZEH 4Z0KA 5C5NA 1W0JD 2EI8A 3ZVFA 4LZ4B 1P12E 2A45B 2Y6TA 3TNSA 5ETXA 3FP7E 5DG6A 1DS2E 3FANA 2ODYB 1ID5H 2FTMA 2R2WU 1RXPA 2ZWLH 1TX6A 1E1RD 3BTWE 1MTNC 1HAHH 2GJGA 2ZU5A 3SGQE 2JH5D 2W6ID 1MMJN 1ZHRA 2F9NA 4JZDH 2P94A 3KYGA 1VCQA 2QF5A 1QA7A 1LHFH 1SLWB 2Z9LA 2QYIA 2UUFB 1NRNH 4FUCA 4WWYA 5A8ZA 3VFEA 3IWMA 3D62A 1PPCE 1TGSZ 3PWBA 1WSSH 1YPMH 4QT8C 3M3VA 1PYTC 2NWNA 2UUYA 1O2JA 1FAKH 3AAUA 1DSUA 3IG6B 5CE1A 1ESBA 2C8YB 2ZZUH 3LGIA 2DUCA 4K8BA 1HAXB 1TNIA 1K2I1 1GDQA 2B7DH 1N8OC 1E79D 1QHRB 1ZHMA 4MPUA 3TK9A 1P02A 1K1JA 2I6QA 2ANKH 1O2YA 4FUHA 3DHKH 5FHTA 1TX7A 1EAWA 3ESTA 1AO5A 2OCVB 1F0TA 3A8AA 1NROH 2BZAA 1JBUH 2PKAB 1G9IE 5DP4A 4Q4LA 2FIRH 3KL6A 4ZHMU 5FPYA 2A4QA 1EJNA 2ZDVH 1EAXA 4NGAH 4KTUA 1SQOA 1YCPH 1FUJA 1F0SA 3SHAH 2G8TA 5FAHA 1V2JT 1ZPBA 2JH0D 3SJIA 1S83A 4B6EA 1G3CA 3LIWA 2YNBA 1ZJDA 1W7XH 1TIOA 2OQ5A 2TIOA 4JCNA 5T1VA 5K7RA 2G81E 1V2MT 1CE5A 1SL3A 4FUGA 3EE7A 3URDA 4ZKOU 1NU9A 1PJPA 1DFPA 5HM9A 4CREA 1OYQA 1VR1H 3EAJA 3ODDA 5JBCS 2GD4B 3WY8A 3UR9A 1ETRH 4SGBE 3MU8A 2WV9A 1O3AA 3M3SA 4XRNA 3BEFB 1EUFA 1XXDA 1P01A 1U6QA 2HLCA 3UQVA 1C5PA 5EQQA 1DT2A 1GL0E 1T31A 6GCHF 3BTFE 2ZFFH 1BTUA 2QC2A 1LKAA 1LMWB 1FY5A 5H4IB 5T3HA 2VWMA 2GGVB 3R3GB 3STJA 4X1RU 4AG1A 3QZRA 4Y8ZA 3SNBA 2GCHF 2FOGA 4ZAEA 4DIHH 1HFDA 2FX4A 1AUJA 1KIGH 5HKKD 1TE0A 3GY2A 3SJOA 1NT1A 2TGPZ 3P8GA 4NZLA 1Y8TA 1ACBE 3JZ1B 2BVSH 2Y7XA 5L2ZH 1QR3E 3AW1A 4Y10E 3MNSA 4MPWA 1B5GH 4WMDA 7ESTE 3U8OH 4ABDA 1MAYA 1SOTA 1YPGH 2Z6BD 4O3UA 2BQ7B 2AERH 4VGCC 1O2MA 2G52A 1E38B 3F0OA 5CHAB 3UTUH 1KXAA 1HRTH 1T4VH 5EXMA 2XXLA 4NWLA 4IS5A 2GVFA 1MTNB 4KKDA 2Q1JA 1LDTT 1BTYA 2F83A 5JBBS 4AYYB 2O8MA 1GCTC 1TGBA 1EZUC 2FTLE 1BTHH 4JYTA 2OD3B 1L0ZA 3FN8A 1AIXH 3MH4A 4SGAE 2EI7A 5T6DA 2ZFRH 2AS9A 3RXQA 2ZFTA 1L1NA 3DFLA 2J34A 1C1NA 5EJ1A 1GHZA 1AE8H 2XC0A 2EI6A 1HJ8A 3FZDA 2P8OB 3DT0H 3U9AH 1Q3XA 1S82A 1FDPA 3KEEA 4FUBA 1UMAH 1P2NA 2ZGJA 4UD9H 2BVXH 1S0RA 4I8GA 4O97A 3LJOA 1XKBC 1KXBA 5TCAA 1C4Y2 3VB5A 1BIOA 1O2IA 3LJJA 4OGXA 5TCCA 1P2KA 4RT1A 1TAWA 1NN6A 4AG2A 1SGRE 1UK2A 3S9AA 3SNEA 1LKBA 2OXSA 1TX8A 1OPHB 3ZZDA 2ZP0H 3MO3A 4B6FA 2OC7A 4X6OA 3PLKA 2LPRA 3TJUA 3TPIZ 1GBKA 1PQ8A 1W0YH 3MU4A 1WQVH 1YCPK 2LP6A 1QJ7B 2BYAX 1ZHPA 1UVUH 2ZTYA 2ODPA 1QRZA 3GDUA 3LT3A 3LKWA 4ABGA 1NRRH 1SKYE 3MQKC 4TPYA 5C1XA 2AYWA 1LPZB 2BTCE 1ELFA 1J8AA 1BBRH 1OHHD 1WQSA 1TALA 2ZPSA 5HYOA 4KTSA 2GTBA 2YMSC 1ABIH 5EXNA 1TNLA 2P3UB 1H1BA 2J98A 2ASUB 3SNDA 5JPMH 1S6HA 2WPIS 3A8BA 2FLBH 2CMYA 3QK1A 1L4ZA 4NZQA 2GDDA 2THFB 3A7YA 1SPJA 3DFJA 4FXGH 3DSPA 4ZKSU 5C3NA 1P3EA 3OYPA 1TGNA 1P2MA 3ZYEA 1MTSA 5CMXH 1AWHB 5EW1H 1D3PB 2SGDE 3PO1B 3UWIA 1TNJA 1A3BH 2IN2A 1SMFE 3EA8A 5GCHF 3RMNH 1UTMA 2VIDA 3TH2H 2Q6GA 1H8HD 3SHCH 3NWUA 1V2PT 1HB0B 4D76A 3PTBA 1EAIA 1GMCG 2BD3A 2IPQX 1ANEA 2QGRA 1BTPA 4CRCA 2RDLA 1JMOH 1Y3UA 5L6NH 1A5HA 1H9HE 2UWOA 3MU0A 1OX1A 4AB8A 4BAHB 5C2ZA 4TT3D 1O3HA 7LPRA 1RTFB 3RXEA 1TABE 2YNAA 3ZZ3A 1O0DH 2RDEA 1GMDG 1FX0B 1GHAF 2KCYA 1OWDA 2WYGA 4HGCA 3SNAA 4I8HA 1VJAU 3MFJA 1LVMA 1O5AB 3F1SB 2CJIA 3S0NA 3PMJA 2ALPA 3FZZA 4CH2B 3VB3A 4KTCA 1H8ED 1ELEE 1NESE 1PPGE 3BTGE 4VGCB 2P95A 4UDWH 3D23A 1UHBB 2IJOB 2CHAB 4WH6A 3FOAA 4Y71A 3EGKH 3BEIB 1GBDA 4Y11E 1T4UH 1PQ5A 2OC8A 1EPTB 1WV7H 2V0BA 5LPRA 3GCOA 1C2IA 1D6RA 2SGAA 5EG4A 4RSPA 2CGAA 1GVZA 3WWFA 1YPEH 4NSVA 1VJ9U 1ZTLA 4YESB 3KQBA 2DE9A 1QB6A 3RMLH 1NZQH 4BAOB 3H7TA 1M9UA 3UOPA 4CR5A 4Y76A 3O8DA 1FZZA 1K1OA 1WYKA 1P10A 5C0TA 2BY6X 1GBIA 4JK5A 1AE5A 1NU7B 3OEHD 1O2HA 1P2QA 2R2MB 3D49H 1D4PB 2XWBI 4IMQA 1RTKA 2STBE 2QCYA 3SI4H 2VIVA 1TNKA 5AF9H 4B2BA 2J2UA 1AZZA 4NIWA 3SV8A 3A83A 3QTVH 5JBTA 1SGFA 1XXFA 3SJ8A 1EJMA 1S84A 1C5OH 5EPNA 1L2EA 1VCPA 3NPSA 3T5FH 1W14U 1Y3VA 1HIAB 4F55A 3SU0A 1TA6A 1DPOA 1BBRK 4MNXA 4WXVA 4KGAA 5G4BA 4BXWA 1CGJE 4K5ZA 1GI5A 1ZSLA 1DLKB 1RRKA 2J94A 3SBKA 1GI1A 2A4RA 3KN2A 2Y80A 1F0RA 4FU7A 2ZQ2A 1P06A 2ZU1A 1PPHE 1UO6A 5C5OA 4TY6A 4X2XA 2R0KA 1A0HB 4AC9A 2VU8E 2QV1A 1SR5C 4KP0A 1C4U2 3A7TA 3E91A 4DT4A 1GHBG 1AKSB 1Y59T 4ZMAH 4WMFA 1DE7H 1HJAB 3T29A 1OS8A 1SI5H 1MCTA 2A5KA 4I8JA 1G30B 1BMFD 1LCYA 1FMGA 3PTNA 6CHAB 3M5NA 1TFXA 3EE0B 1O36A 4A92A 1MAXA 3M35A 1C1QA 1W2KH 1D6WA 4B2CA 4ZROA 2FOCA 3L3TA 2KCPA 4FUJA 3OEED 1KDQA 1QB9A 2QXIA 1ZTKA 2ZA5A 5F6MA 2OQUA 5EXLA 1QZ8A 3O8BA 2J9NA 4ISLA 4AYVB 1TNHA 4I33A 5SGAE 3T27A 3ZZ5A 4A1XA 2EC9H 3LC3A 1GMHG 1GBMA 4GHQA 1EB2A 1ETSH 5I25A 2F3CE 1Z6JH 4X1QU 2SGQE 3PV2A 1COWD 1DWCH 3UOUA 3ELAH 1ZLRA 3EQ0H 1Z7KA 2A5IA 3NK8A 1BRUP 1BB0B 1VGCC 3AK5A 1O5GH 5A2MH 3KGPA 3N7DA 1OWIA 3PMBB 5EJZA 4D9QA 3NKKA 1A3EH 4Y0YE 1LPKB 3NUMA 2PHBA 2XYAA 5JB8S 2ZDMA 3SQEE 1SQTA 1JOUB 5FBIA 3SZEA 1GBJA 2QE7D 1YF4A 1MZAA 5DN6D 3ATWA 2NU1E 2BD9A 4D9RA 1HNEE 3V12A 2GV7A 2GV6A 3SU5A 2FODA 1NTPA 1TPSA 1NM6A 3GY7A 3A82A 4HG6A 2H5DA 3K9XB 3P6ZB 3MNCA 4GCHG 1BA8B 5AFYH 2ZTZA 4LK4A 1SQAA 1DOJA 1K28D 3UY9A 2WINI 1P2IA 5C94A 5A09A 1UTQA 2IPHA 4A1VA 5E8EH 3PB1E 1O5DH 4YLUA 2VIWA 2FYRA 3JZ2B 3GICB 4YOGA 1BRCE 1QBNA 2QN5T 1B0FA 1UVTH 4K69A 2CV3A 1C5VA 2ALVA 1AGJA 1C5SA 1Y3WA 3BG8A 5T6FA 3UAIC 3ZVCA 1YYY1 5B6LA 4K1EA 2H9TH 5FL7D 2SNVA 4WVPE 2Y5GA 5J4QA 1K1LA 4NA9H 2C93B 3S9CA 1EJAA 1G3EA 1QL9A 2K7XA 3ZZ4A 1LVOA 3SI3H 3BEUA 3F6UH 5E0JA 1KXCA 3BTTE 3A7XA 3VB6A 4CBNA 3FP8E 1O2PA 2P93A 4AGJA 3TGJE 1CBWC 2W5EA 3HGNA 2EA3A 3BTDE 1BRBE 1RD3B 3RXGA 4DURA 1PQ7A 1A0LA 4MTBA 4JYUH 4ABAA 3U69H 1CQQA 3LGYA 3F9HA 1V2ST 2BDIA 2JETC 2UWLA 1SGCA 2BOKA 1SGYE 1O31A 2OBOA 1LHEH 1V6DA 1H4WA 2W26A 1TMBH 1ESTA 5GDSH 5F8TA 1SGTA 1E37B 3TK6A 2GMTB 1YM0A 3MOCA 4GAWA 3TNTA 4J2YB 3ZV8A 1JIMA 1QURH 2K8IA 4XBDA 5C20A 4MNYA 1BHXB 1V2RT 1WBGB 3BTEE 5ESBA 2Z94A 1BRAA 3HK6B 4RI0A 2CN0H 4I7YH 2Z3EA 4YTAA 1V2OT 1O2VA 1E1QD 1TBZH 5DKMA 1HAYB 1NBME 1O2QA 2G51A 2LNCA 5AHGH 1EP5A 2H9HA 3HPTB 3W94A 2OLGA 1E36B 3MH7A 2QF4A 1O3GA 2BLVA 3I77A 2H6MA 2YOLA 1FIZA 3RUOA 4MVNA 4LZ1H 3FAOA 1YLNA 1K22H 5EJLA 3ZZ7A 1PPEE 2HALA 2GZ8A 3QN7A 5C17A 1GHVH 2PGBB 2ZNKH 2VVUA 3OX7U 1WDIA 3DCLA 4NSYA 1XUGA 1OP0A 4X6PA 1VGCB 1ELCA 4MNVA 5JYIA 1K1NA 1FAXA 1TA2A 1AHTH 1O2ZA 3A7WA 3E0NB 2BD7A 1O33A 2B5TB 3RLWH 4CHAB 1MQ5A 3QGNB 1ELDE 1UTKA 1IQJA 2FEQH 4I31A 2ZGHA 1DVAH 1QA0A 2BVRH 1O2RA 2FO9A 1IHTH 4A6LA 3L33A 1TRNA 1PQAA 3QX5H 3ZZ8A 2A32A 3CENA 2PWXA 1GI9B 2VGCC 3NCLA 2GDEH 1P0SH 2PGQB 1HAPH 2EQNA 3A87A 1FPHH 1A46H 2VWOA 4ABEA 1MU6B 2P59A 5E2OA 4O03A 3LGWA 5PTPA 1SLUB 4H6TA 1D9IA 4Z6AH 1EKBB 3DUXH 2SNWA 4RKJB 1C2KA 1GG6B 3ZYDA 2NU4E 1AB9C 1KMHB 5DJ7A 1F0UA 3P8NA 5KECA 1F5LA 3MH6A 2PUXB 5A0CA 1LHCH 4X8TH 1C5RA 1DANH 1THSH 3SUDA 1FXYA 2NU2E 3L6PA 4BAMB 4AFZA 5FCRA 3E1XB 1AI8H 2AMDA 1ABJH 4A7IB 1OP2A 1O5FH 1O3FA 2BD4A 1JIRA 3WW7A 4AOQA 4TWWA 3QWCH 2TBSA 5GPIB 2BLQA 2AMQA 5EIYA 3GYMA 3Q77A 1WTHD 3SV6A 2ZHQH 1AVWA 1C5XB 1HPGA 1CA8B 2A1DB 2ZHFH 4K3JA 4F4OC 4UFDH 3VGCC 4Q7XA 2XRCA 2H1UA 3GDVA 3RXFA 1TMUH 1DX5M 1Z8RA 4NA7A 2AFQB 1W3CA 4INLA 3S69A 2FOFA 2G4UA 3FP6E 4Y79A 2OP9A 4ISHH 4YLQH 2VJ1A 2A2QH 1LTOA 1GBFA 3UFAA 1C2LA 3LONA 1ELBA 2XCNA 3M61U 1BTZA 2VB0A 4MDSA 1Z71A 3LH3A 2W7UA 2WSSD 5FBEA 5A8XA 1C1WH 1W10U 4MLFB 3RM2H 1GJ4H 3SOSA 2CXVA 1BJVA 1Z1IA 2SGEE 3MHWU 1EX3A 3QLPH 3E90B 1RIWC 1NY22 3ZZCA 2C8XB 4D7GA 1P9UA 1GMCF 2UUJB 4B2AA 3MI4A 2ZHEH 1MKWH 5DP7A 1GJ5H 4DG4A 4JZIA 1GBBA 2XNDD 1E34B 3PYHA 2WV4A 1QIXB 3PMAB 3O8CA 1P03A 2WPDD 2HNTF 2OBQA 4I8LA 1DICA 1TNGA 1GMDF 3LGTA 1ZSKA 4AN7A 1TLDA 2XBYA 4ESTE 3PV4A 1G3DA 3RP2A 1N8OB 3Q00A 1D3QB 3RXDA 1QNJA 3M7UA 1CA0C 1A4WH 3RXUA 1E0FD 1W12U 2SGFE 2J97A 2VVVA 2Y5FA 2WPKS 1GJ9B 1EQ9A 1YWUA 3G01A 3ATMA 1ETTH 2VWNA 3AW0A 1QL8A 5LPEA 3P8FA 2F91A 2WHXA 1BZXE 2ZTXA 1MTUA 1K0HA 1CSOE 4ABJA 3GCHC 3KQCA 4MNWA 1YC0A 4A5TS 4UONA 2XWAA 1OP8A 1WOFA 1SFIA 1AMHA 4CBOA 4ZKNU 1A0JA 1RS0A 4TYDA 5DP6A 2D26C 2PLXA 3F2FA 3P17H 5IYTA 2GT8A 4FUDA 3RXOA 3SGAE 1O3MA 3RXLA 1B0EA 3SV9A 1QB1A 2BQWB 1EP6A 3SN8A 3Q76A 4X1PU 6GCHG 3M36A 1YLDA 2RCEA 2V35A 3KNXA 1KTSB 1UVSH 1WAYB 4B74A 4E05H 2A5AA 3E8LA 4X1NU 1GJCB 2P3FH 2ZIQH 2BQ6B 3RXKA 3SGBE 2WPMS 2GCHG 3P95A 1VKYA 4ISOA 1JWTA 1C2HA 3U8TH 3GS9A 2ZU3A 1DY9A 2G5VA 2J98B 1X7AC 5FXLA 2WZQA 3VPKA 4ACBA 3F9EA 4XDEA 5B6OA 3RU4T 1BOQA 1S0QA 1A1RA 1ZYOA 1ELVA 1SG8B 1FJSA 1AZ8A 1V2QT 4YOJA 1BJUA 1N6YA 3SORA 1H8IH 3KYFA 2ZI2H 1ESAA 3ZZAA 1QFKH 1GWAA 3KCGH 3TH4H 1GBHA 1PPZA 3HK3B 2V7QD 4FUEA 4BNRA 2Q6FA 2H9EH 2WUBA 3BIUH 3SJ9A 4Y7BA 3SU3A 3CP7A 2FM2A 4R0IA 2J38A 1LQEA 1CGIE 1CT2E 2HPQH 3MNXA 4X2YA 1ZGIA 4U2WA 3BG4C 2AH4X 1HAOH 1ARBA 3PROA 3RC5A 3M3TA 2FX6A 3VGCB 1UW7A 1L1JA 2Q6DA 1IQIA 7GCHG 3FFGA 3OTPA 3W1EA 3DD2H 4B73A 1GCDA 3MU5A 3KQDA 1SGNE 1GHBF 4FU9A 1LQDB 5JB9S 1CU1A 2M2AA 3BN9A 5L2YH 4OS6A 4D8NA 2A7JA 4IBLH 1C1RA 3HKIB 3RXPA 2A7HA 5IDKA 2ODQA 2RA3A 5HMAA 1G2MA 2J95A 1FQ3A 2GCTC 2Y7ZA 1GCTB 3OSYA 1Z1JA 1ZMJA 2ZO3H 1GJ6A 1MKWK 1QTFA 3BIVH 1UJ1A 1YPJH 1TWXB 5JDUB 1NFUA 1GJAB 3ZZ9A 3MMGA 5F8ZA 4X6MA 1V2WT 1QRWA 1T7CA 1MKXK 5DP8A 3T28A 1GBLA 3F68H 5DP5A 1GMHF 1XM1A 3M5OA 1DWEH 3TLOA 2NU3E 1EAUA 5EOKA 4NFFA 4YM9A 3ZZBA 2P3TB 3SU4A 2BY5X 3ZIAD 5EQRA 2PUQH 2ZF0H 3F0PA 1HAVA 4P02A 1O3JA 3H5CB 1YPKH 1ZPZA 4O9VA 4DY7B 2AGIX 4K1TA 2ZU2A 1FN8A 2V3OH 1DDJA 2HGTH 2I6SA 4M7GA 2FZZA 3AAVA 1AFQC 1SGFG 1BITA 3BSQA 4YZUA 4DVAU 5KEDA 1THRH 1C5LH 1K1IA 3A84A 3UQOA 1IQNA 3QTOH 2ZDLA 1O2KA 5E0GA 2O8WA 2P16A 2J5UA 1G37A 3QO6A 1Q2WA 1NRQH 1V3XA 3TGIE 1PFXC 1FPCH 1C2MA 1Y3XA 4ABBA 4FU8A 3P8OA 5K0HA 1FN6A 3KQ5A 2TRMA 1GJDB 4Y8YA 2XW9A 1O3IA 2UUKB 4GLYA 3VB4A 2KZ4A 1SVPA 1F5KU 2HRVA 1IHSH 2ZHWH 1VZQH 2PKSC 2YMSB 1SLXB 1AD8H 3MTYA 4UFGH 2ZGXH 1O34A 3RXSA 1C4V2 3UNSA 1SGEE 4IC6A 1G2LA 1GI0A 2GZ9A 1HYLA 1N6XA 1G36A 1SQRA 3MO9A 1IAUA 1MBQA 4ZHLU 4Q7ZA 1QBOA 2O9QA 1P8VC 4Q7YA 1UVOA 4GCHF 5FX5A 2ZCKP 1DLEA 3K65B 5DK1A 3FO8D 4BTIB 1F5RA 1PPBH 1J16A 2KAIA 3R0FA 3RM0H 1C9TA 4YT6H 3VXFH 4F48B 3SUGA 1LO6A 2XC4A 3NXPA 1PYTD 2F9PA 2UWPA 1TBQH 1HUTH 3EA7A 2Z3CA 2FOEA 1AFEH 1C2FA 1MD7A 2ZPRA 4INKA 3V13A 4Q2KA 1BMMH 4IMZA 3NZIA 1ELTA 5HM2A 2FMJA 1Z8JB 2WPLS 3U1JB 2A4OA 1LHGH 4MPVA 1OWHA 3M7QA 3AVZA 1OWKA 1J15A 5DPAA 3KQEA 4UEHH 3N7EA 1GI4A 4Y6DA 1O5BB 2BXUH 2OINA 2HOBA 3GY5A 4YT7H 5A0AE 1GVLA 1O2WA 1BUIA 5LPFA 1YLCA 1GPZA 1A61H 1O3BA 1VITG 3UREA 1VITH 1KLIH 1ORFA 3RXTA 1C5UA 5GNDA 4E06H 2ZCHP 1KDQB 2RA0A 1P2JA 4IW4E 3RC6A 1TOMH 3RXHA 1IQLA 1G32B 2ESTE 3RXVA 1XUFA 1GDUA 3BG4B 2VIPA 4BTUB 1OWEA 1TOCB 1UTPA 2FYQA 1MTVA 3PLPA 1H9LB 4AFSA 1E35B 1F7ZA 1ZMNA 3SYJA 4AFQA 3S7HB 4X1SU 1SHYA 1BT7A 2PSYA 1OKXA 3SUFA 3GCNA 4BOHA 1KLTA 5DP9A 3M5MA 4ACAA 3GY3A 3TIUA 4TWYA 1EASA 2BDBA 2GT7A 3TK5A 1OYTH 2Z3DA 4M9FA 2VINA 3P92A 2BDGA 5FPTA 1C1VH 1O2NA 4XFQA 1KYNA 4JYVH 2XBVA 4B76A 4HI3A 3RLYH 1CHOG 1DY8A 4GHTA 2XC5A 5EU8A 2V6NA 4FVDA 4YOIA 2B8OH 4NIVA 1V2NT 3RU4E 2HVYB 4J1YA 1EB1H 1KXFA 1UCYE 5A8YA 2JIZD 1GI2A 2IJD1 1AY6H 4OGYA 1JXPA 2BY7X 1HBTH 1TMTH 3AASA 4RKOB 2FOHA 2VH6A 1EXFA 3SUEA 4BXSA 1AU8A 3C27B 4WF8A 2G5NA 5EPYA 1XVMA 1XUKA 2F9OA 2JKHA 3SQHE 3MNBA 4Q63A 4U32A 1HJ9A 2AEIH 5LGOA 4GPGA 1XVOA 2EEKA 1SFQB 3ATKA 1QJ1B 3V0XA 3A7VA 2K1QA 2QA9E 4B75A 2ANMH 1KXEA 2WUCA 1FLEE 5AVDA 3FKSD 1QL7A 1P04A 2PTCE 5KGOA 1K9OE 4ISNA 1O3OA 2Z7FE 5FPSA 1V2UT 1V2VT 4CRGA 8ESTE 3BTHE 3CNRA 2EY4C 4ABHA 6ESTA 1GJ8B 2PKSB 2QY0B 5DSFA 1KY9A 2KR7A 4ZKRU 2BX4A 4IGDA 1FV9A 4AX9H 3V7TA 2R3UA 1C1PA 2Z9IA 4WJG2 4Y8XA 3MU1A 4Q80A 4WMEA 5BRRE 4HZHA 1WXRA 4K8YA 4AGKA 1HAZB 4CRAA 2IOTA 2F9UA 4TY7A 1MH0A 1W11U 1YBWA 5CHAC 1CHGA 2CF9H 3CS7A 3TU7H 1DXWA 3CS0A 3IITA 1O3NA 4IN1A 2OUAA 2XBWA 2XTTB 2VH0A 1ZR0A 3PRDA 4NG9H 1BTWA 1YCPM 2FP7B 2HLDD 2QF0A 3F2HA 2Y5HA 1ZPCA 3P70B 4CRDA 2QIQA 1LVBA 1RJXB 2KFWA 4THNH 8KME2 1NO9H 1C1UH 3BTQE 4XOJA 1GHWH 1UK3A 2P8OC 4BAKB 3UWJH 3RMOH 4RN6A 1ZOMA 1NBMD 1Q31A 1S6LA 3TGKE 2VIOA 4X6NA 2CF8H 2F4LA 1LVYA 3V3MA 3ODFA 8GCHG 2PKAA 2ULLA 2YMSD 1RTLA 1IQMA 1NC6A 1O32A 1QY6A 3MH5A 2WYJA 5E0HA 1C5NH 1EZSC 4R8TB 3ZV9A 4NIXA 1UTNA 4LOYH 3B9FH 3A8CA 2XNIA 2ZDNA 1SSXA 4X8VH 1YKTA 1C1TA 1S81A 1IQFA 2C8ZB 4MPXA 1MABB 2JH6D 2O8LA 1VCWA 1ZSJA 1P9SA 2BD8A 3B23B 3RMMH 1CT0E 1BQYA 1TBRH 3GCTG 3H7OA 1C5ZB 3UIRA 2VBCA 4DT7B 3I29A 1ANCA 3F3BA 3BTME 3U28C 2FOBA 3EA9A 4GVUA 1FY8E 3U1IB 2F9VA 1O3LA 4X8SH 1AVXA 1C5MD 1XUJA 4CRFA 1C2JA 1YPHC 5EGMA 2FXRA 1XUIA 2FLRH 4ASHA 2TPIZ 1XMNB 1DXPA 1GBCA 2PP6A 4JZFH 4DW2U 2ZFQH 1FY1A 1KLJH 4FUIA 1SGDE 3TJNA 1Z8GA 1DSTA 2BMGB 4PROA 2HPPH 4X2WA 5JBAS 3F9FA 4HFPB 1QCPA 3A89A 2O8TA 2BZ6H 4AORA 1IQKA 2A31A 3T26A 1C1OA 3PO1C 1QBVH 2ZFPH 2BD2A 2W7SA 2HVXA 3UB0A 1T8NA 1OSSA 1J17T 1ZJKA 3MWIU 4BANB 2WPHS 1DM4B 2FI3E 3M5LA 1C1MA 1HDTH 1GI3A 2QAAA 2FWWA 1UK4A 4FOUC 2Y81A 1TGCA 3A7ZA 3OE7D 9ESTA 2ZU4A 3A88A 3QDZB 3TJOA 5ABWA 3DSGA 3S7KB 4GSOA 1HV7A 4IC5A 2R3YA 3MO6A 4FVBA 1NFWA 4O3TA 4FUFA 1DWBH 3MYWA 2G4TA 4ZH8A 1O38A 2PW8H 3BTKE 1CBWB 3ZVAA 1BMAA 1N1LA 2K0QA 4WXIA 2J92A 1TPOA 3N7OA 1YGCH 3OTJE 2FOAA 2G55A 1J9CH 2OTVA 1HXFH 4FETA 3DSOA 2JETB 3VG8A 2HNTC 3F9GA 2CHAC 2ZG0H 2L74A 5FCKA 1IQHA 2D2DA 4OM9A 2RFKC 1AUTC 5EODA 1Z6EA 3UNRA 4YO9A 2JJ1D 2H5CA 2B9LA 2FI5E 1RGQA 5GWZA 1ZTJA 1IOEA 2BD5A 1MKXH 1MUEB 1Y5AT 2H2ZA 1EPTC 5C0UA 3E6PH 2SGPE 5GXPA 4NCYA 3GY4A 2BLWA 1GBEA 5DP3A 1SLVB 1TQ0B 2RG3A 7GCHF 4KELA 1DUEA 1UTOA 3GY6A 3DA9B 1IQEA 1EOLA 2NU0E 1FONA 2AGEX 9LPRA 5C67A 3VEQB 1GHXH 3QZQA 2ZGCA 1Z8IB 2AMPA 4CR9A 3GISB 1O37A 1GL1A 1MTWA 1NFXA 2ZECA 1AN1E 1KTTB 4OS2A 2Y82A 2GX4A 2ZPQA 3RXMA 2ANYA 1P09A 1P11E 1V2TT 5HGGA 1HAGE 3BF6H 1W0KD 3WWBA 1O2TA 5T6GA 2C3SA 1O39A 3SV2H 2ZC9H 4JZ1A 1TPPA 3GDSA 1ANDA 3F2GA 2PTNA 1EZQA 4XBCA 4UE7H 1C5QA 4LXBH 1GI7B 1Y5UT 1RFNA 3FVFB 2VGCB 1DITH 3EYDA 1UTJA 1P3CA 1KSNA 2A7CA 1GGDC 3VXEH 1MZDA 2VVCA 1QQ4A 2XOKD 3HATH 1NRSH 3ZVDA 4DOQA 5HXFA 3K6YA 3K2UA 2W6JD 2O8UA 1AB9B 3RXBA 1YPLH 3KF2A 1BTXA 4NA8A 3D65E 3LGVA 2ZEBA 1ELGA 1UCYH 2ZDAH 1YY3A 4ASUD 2FOMB 3LOXA 3URCA 4K60A 1HJAC 4K2YA 2F9BH 5HIZA 2G00A 3ZVBA 4K1SA 4B1TA 1NPMA 1CVWH 1C2GA 3H09A 5A0BA 6CHAC 2V3MA 5CDFE 2BLOA 4MQAA 1FIWA 2FI4E 3K6ZA 1QJ6B 1GHYH 1QGFA 1TYNA 3A8DA 3KHVA 4IN2A 3UNQA 2BOHB 1CO7E 2ZKSA 2DE8A 2Z9JA 1O2LA 4DCDA 1K1PA 1ZGVA 3SU1A 1S85A 1W13U 2BDAA 3SNCA 1GJ7B 2FS8A 1SBWA 4ZXXH 4XD7D 1LHDH 5CHBA 1W8BH 4HTCH 1UHBA 2QXHA 2HWLB 3RXIA 4TSFD 3ATLA 1EFRD 1RIWB 2FPZA 4AZ2B 5DGJA 2ANWA 1S6FA 1EPTA
chains in the Genus database with same CATH topology
1EOJA 2BB4A 1LPGB 2C8WB 1FY4A 1KXDA 1WTGH 1MD8A 3Q3XA 1H8DH 1WU1A 3LPRA 3OY6U 1T32A 1VITF 4U01A 2BY9X 2GZ7A 1MU8B 2XCFA 4ZUHA 1OXGA 1T8LA 1J14A 2V3HH 3M37A 4ZXYH 1AVGH 3BV9B 2BXTH 3I78A 1C2DA 3LU9B 1WCZA 4JK6A 5E2PA 3STIA 1MCVA 4MG3A 1OWJA 1ELAA 1ARCA 4XBBA 1TRMA 4DJZB 1C5YB 3UPEA 1O3CA 1CA0B 4F49A 3B8JA 2OC0A 4ISIH 2A0QB 1O3PB 3SO3A 7KMEH 2C90B 3EBNA 1AWFH 1HAVB 1A5IA 2TGTA 1TGTA 2ZDKA 2FDAA 1O35A 3SZNA 1DWDH 1K21H 4Y7AA 1D3TB 3GCHB 5BPEA 1HAIH 2BX3A 1GJBB 3ZVGA 1C5TA 1MBMA 2BM2A 5F03A 3Q3YA 3UR6A 2BDYA 1F92A 4E7NA 1O3EA 5C1YA 3W95A 2ZQ1A 1HIAA 1CHOF 1ZRKA 5GCHG 4UFFH 4U30A 2VNTA 2AGGX 1UVPA 3QGJA 1O2UA 4H4FA 5EW2H 2Z9GA 1XUHA 4Y0ZE 1B7XB 3PLBA 2A4GA 1HCGA 4H6SB 4NFEA 1GBTA 3S9BA 1F2SE 1JRTA 1GGDB 2B0FA 2QXGA 3E16B 4ZHAA 4XE4A 1SGPE 2BDHA 2ZGBH 3T25A 8LPRA 2VWLA 1AKSA 1GHAG 1HGTH 3PM3A 1P57B 1HXEH 3TVJB 4E7RG 1PPFE 1UCYK 5GIBA 2KAIB 1A5GH 1AQ7A 1IQGA 1TB6H 4ABIA 4WY3A 1BCUH 1WUNH 2ZFSA 4BAQB 6LPRA 3U8RH 5J4SA 1GBAA 1C9PA 4ABFA 2R9PA 2A2XH 5TJXA 1UTLM 2GP9B 5EQSA 4UFEH 2GMTC 1ZMLA 5I46H 1O30A 2STAE 1O5EH 2W3KA 3GYLB 3UUZA 3ITIA 2BHGA 1O5CB 1SGIB 3RXCA 1C1SA 1G3BA 1A7SA 1C2EA 5DO4H 1JRSA 3TITA 3ZZ6A 2D8WA 4OS4A 1GI8B 1TPAE 2XBXA 1TQ7B 2C4FH 5FX6A 5GJ4B 1FY3A 2PSXA 1BMNH 1D3DB 2ZHDA 3HGPA 1BHXF 1P05A 4X8UH 3TJVA 1EATA 5F8XA 1O2GH 4B71A 3SJKA 4DIIH 4DGJA 1GDNA 3OU0A 4NIYA 1YPHE 3M7TA 3HKJB 1SOZA 3QUMP 1O2OA 2TGAA 4OS1A 1NFYA 5L30H 2D1JA 1O2SA 1XKAC 2WPJS 3PWCA 1FI8A 1SHHB 1SC8U 2BY8X 2M5TA 1TONA 2GCTB 5C1UA 3VB7A 1O3DA 1V2LT 1BDAA 1QQUA 3T62A 1T8OA 1BBRE 1Y3YA 2ILNA 4GUXA 2J4IA 1HLTH 3O8RA 2W3IA 2FESH 4XSKU 3SU2A 4CHAC 3Q3KA 3C1KA 4D7FA 4WH8A 3U98H 4BTTB 3T2NA 1Y5BT 3E0PB 1YP9A 1W0ZU 2QF3A 3ZVEA 2SFAA 1O2XA 1SB1H 5AFZH 5ESTE 3LC5A 2LIZA 3KIDU 1CGHA 1L4DA 1S5SA 1THPB 1ZRBA 3RU4D 4INHA 1P2OA 2ZCLP 3A86A 1INCA 4A1TA 2R0LA 4TPIZ 3SV7A 1ANBA 3RDZA 1TRYA 2OC1A 4JMYA 3A81A 8GCHF 2WV5A 2FS9A 1GG6C 1OOKB 4AB9A 3ENSB 4AFUA 1AFQB 1T8MA 2BDCA 4X2VA 1L1GA 2PV9B 1BMLA 4I32A 3LH1A 3RXAA 2PR3A 1EZXC 1GI6A 3SU6A 3OY5U 4OS5A 4X0WU 2GKVE 2AIQA 1QRXA 3RXJA 2AIPA 3GY8A 3GOVB 1H9IE 1DUAA 3RC4A 1NS3A 3A85A 1NRPH 4CH8B 2PFEA 3E3TA 3GCTF 3TH3H 1GVKB 1K1MA 1CT4E 2TGDA 1V2KT 3LDXH 3SW2B 2VIQA 1ZZZA 1MQ6A 4I8KA 2HNTE 1FNIA 5LH8A 1XX9A 1SGQE 3PMHB 1W7GH 1A2CH 1C5WB 1O3KA 4NWKA 3LGUA 3EDXB 3A80A 4OS7A 4H42U 4CRBA 3RXRA 2Z9KA 2QXJA 4JZEH 3ATIA 4Z0KA 3ZVFA 5C5NA 2EI8A 4LZ4B 1P12E 2A45B 2Y6TA 3TNSA 5ETXA 3FP7E 5DG6A 1DS2E 3FANA 2ODYB 1ID5H 2FTMA 2R2WU 1RXPA 2ZWLH 1TX6A 3BTWE 1MTNC 1HAHH 2ZU5A 3SGQE 2JH5D 1MMJN 1ZHRA 2F9NA 4JZDH 2P94A 1VCQA 1QA7A 1LHFH 1SLWB 2Z9LA 2QYIA 2UUFB 1NRNH 4FUCA 4WWYA 5A8ZA 3VFEA 3IWMA 3D62A 1PPCE 1TGSZ 3PWBA 1WSSH 1YPMH 4QT8C 3M3VA 1PYTC 2NWNA 2UUYA 1O2JA 1FAKH 3AAUA 1DSUA 3IG6B 5CE1A 1ESBA 2C8YB 2ZZUH 3LGIA 2DUCA 4K8BA 1HAXB 1TNIA 1K2I1 1GDQA 2B7DH 1N8OC 1QHRB 1ZHMA 4MPUA 3TK9A 1P02A 1K1JA 2I6QA 2ANKH 1O2YA 4FUHA 3DHKH 5FHTA 1TX7A 1EAWA 3ESTA 1AO5A 2OCVB 1F0TA 3A8AA 1NROH 2BZAA 1JBUH 2PKAB 1G9IE 5DP4A 2FIRH 3KL6A 4ZHMU 5FPYA 2A4QA 1EJNA 2ZDVH 1EAXA 4NGAH 4KTUA 1SQOA 1YCPH 1FUJA 1F0SA 3SHAH 2G8TA 5FAHA 1V2JT 1ZPBA 2JH0D 3SJIA 1S83A 1G3CA 3LIWA 2YNBA 1ZJDA 1W7XH 1TIOA 2OQ5A 2TIOA 4JCNA 5K7RA 2G81E 1V2MT 1CE5A 1SL3A 4FUGA 3URDA 4ZKOU 1NU9A 1PJPA 1DFPA 5HM9A 4CREA 1OYQA 1VR1H 3EAJA 3ODDA 5JBCS 2GD4B 3WY8A 3UR9A 1ETRH 4SGBE 3MU8A 1O3AA 3M3SA 3BEFB 1EUFA 1XXDA 1P01A 1U6QA 2HLCA 3UQVA 1C5PA 5EQQA 1DT2A 1GL0E 1T31A 6GCHF 3BTFE 2ZFFH 1BTUA 2QC2A 1LKAA 1LMWB 1FY5A 5H4IB 5T3HA 2VWMA 2GGVB 3R3GB 3STJA 4X1RU 4AG1A 3QZRA 4Y8ZA 3SNBA 2GCHF 2FOGA 4ZAEA 4DIHH 1HFDA 2FX4A 1AUJA 1KIGH 1TE0A 3GY2A 3SJOA 1NT1A 2TGPZ 3P8GA 4NZLA 1Y8TA 1ACBE 3JZ1B 2BVSH 2Y7XA 5L2ZH 1QR3E 3AW1A 4Y10E 3MNSA 4MPWA 1B5GH 4WMDA 7ESTE 3U8OH 4ABDA 1MAYA 1SOTA 1YPGH 2Z6BD 4O3UA 2BQ7B 2AERH 4VGCC 1O2MA 2G52A 1E38B 5CHAB 3UTUH 1KXAA 1HRTH 1T4VH 5EXMA 2XXLA 4NWLA 4IS5A 2GVFA 1MTNB 4KKDA 2Q1JA 1LDTT 1BTYA 2F83A 5JBBS 4AYYB 2O8MA 1GCTC 1TGBA 1EZUC 2FTLE 1BTHH 4JYTA 2OD3B 1L0ZA 1AIXH 3MH4A 4SGAE 2EI7A 5T6DA 2ZFRH 2AS9A 3RXQA 2ZFTA 1L1NA 3DFLA 2J34A 1C1NA 1GHZA 1AE8H 2XC0A 2EI6A 1HJ8A 3FZDA 2P8OB 3DT0H 3U9AH 1Q3XA 1S82A 1FDPA 3KEEA 4FUBA 1UMAH 1P2NA 2ZGJA 4UD9H 2BVXH 1S0RA 4I8GA 4O97A 3LJOA 1XKBC 1KXBA 5TCAA 1C4Y2 3VB5A 1BIOA 1O2IA 3LJJA 4OGXA 5TCCA 1P2KA 1TAWA 1NN6A 4AG2A 1SGRE 1UK2A 3S9AA 3SNEA 1LKBA 2OXSA 1TX8A 1OPHB 3ZZDA 2ZP0H 3MO3A 2OC7A 4X6OA 3PLKA 2LPRA 3TJUA 3TPIZ 1GBKA 1PQ8A 1W0YH 3MU4A 1WQVH 1YCPK 1QJ7B 2BYAX 1ZHPA 1UVUH 2ZTYA 2ODPA 1QRZA 3GDUA 3LT3A 3LKWA 4ABGA 1NRRH 4TPYA 5C1XA 2AYWA 1LPZB 2BTCE 1ELFA 1J8AA 1BBRH 1WQSA 1TALA 2ZPSA 5HYOA 4KTSA 2GTBA 1ABIH 5EXNA 1TNLA 2P3UB 1H1BA 2ASUB 3SNDA 5JPMH 1S6HA 2WPIS 3A8BA 2FLBH 2CMYA 3QK1A 1L4ZA 4NZQA 2GDDA 2THFB 3A7YA 1SPJA 3DFJA 4FXGH 4ZKSU 5C3NA 1P3EA 3OYPA 1TGNA 1P2MA 3ZYEA 1MTSA 5CMXH 1AWHB 5EW1H 1D3PB 2SGDE 3PO1B 3UWIA 1TNJA 1A3BH 2IN2A 1SMFE 3EA8A 5GCHF 3RMNH 1UTMA 2VIDA 3TH2H 2Q6GA 3SHCH 3NWUA 1V2PT 1HB0B 4D76A 3PTBA 1EAIA 1GMCG 2BD3A 1ANEA 2QGRA 1BTPA 4CRCA 2RDLA 1JMOH 1Y3UA 5L6NH 1A5HA 1H9HE 2UWOA 3MU0A 1OX1A 4AB8A 4BAHB 5C2ZA 1O3HA 7LPRA 1RTFB 3RXEA 1TABE 2YNAA 3ZZ3A 1O0DH 1GMDG 1GHAF 1OWDA 2WYGA 4HGCA 3SNAA 4I8HA 1VJAU 3MFJA 1LVMA 1O5AB 3F1SB 2CJIA 3S0NA 3PMJA 2ALPA 3FZZA 4CH2B 3VB3A 4KTCA 1ELEE 1NESE 1PPGE 3BTGE 4VGCB 2P95A 4UDWH 3D23A 1UHBB 2IJOB 2CHAB 4WH6A 4Y71A 3EGKH 3BEIB 1GBDA 4Y11E 1T4UH 1PQ5A 2OC8A 1EPTB 1WV7H 2V0BA 5LPRA 3GCOA 1C2IA 1D6RA 2SGAA 5EG4A 4RSPA 2CGAA 1GVZA 1YPEH 4NSVA 1VJ9U 1ZTLA 4YESB 3KQBA 2DE9A 1QB6A 3RMLH 1NZQH 4BAOB 3H7TA 1M9UA 3UOPA 4CR5A 4Y76A 3O8DA 1FZZA 1K1OA 1WYKA 1P10A 2BY6X 1GBIA 4JK5A 1AE5A 1NU7B 1O2HA 1P2QA 2R2MB 3D49H 1D4PB 2XWBI 4IMQA 1RTKA 2STBE 2QCYA 3SI4H 2VIVA 1TNKA 5AF9H 4B2BA 2J2UA 1AZZA 4NIWA 3SV8A 3A83A 3QTVH 5JBTA 1SGFA 1XXFA 3SJ8A 1EJMA 1S84A 1C5OH 5EPNA 1L2EA 1VCPA 3NPSA 3T5FH 1W14U 1Y3VA 1HIAB 3SU0A 1TA6A 1DPOA 1BBRK 4MNXA 4WXVA 4KGAA 5G4BA 4BXWA 1CGJE 4K5ZA 1GI5A 1ZSLA 1DLKB 1RRKA 2J94A 3SBKA 1GI1A 2A4RA 3KN2A 2Y80A 1F0RA 4FU7A 2ZQ2A 1P06A 2ZU1A 1PPHE 1UO6A 5C5OA 4TY6A 4X2XA 2R0KA 1A0HB 2VU8E 2QV1A 1SR5C 4KP0A 1C4U2 3A7TA 3E91A 1GHBG 1AKSB 1Y59T 4ZMAH 4WMFA 1DE7H 1HJAB 3T29A 1OS8A 1SI5H 1MCTA 2A5KA 4I8JA 1G30B 1LCYA 1FMGA 3PTNA 6CHAB 3M5NA 1TFXA 3EE0B 1O36A 4A92A 1MAXA 3M35A 1C1QA 1W2KH 1D6WA 4B2CA 4ZROA 2FOCA 3L3TA 4FUJA 1KDQA 1QB9A 2QXIA 1ZTKA 2ZA5A 5F6MA 2OQUA 5EXLA 3O8BA 2J9NA 4ISLA 4AYVB 1TNHA 4I33A 5SGAE 3T27A 3ZZ5A 4A1XA 2EC9H 3LC3A 1GMHG 1GBMA 4GHQA 1EB2A 1ETSH 5I25A 2F3CE 1Z6JH 4X1QU 2SGQE 1DWCH 3UOUA 3ELAH 1ZLRA 3EQ0H 1Z7KA 2A5IA 3NK8A 1BRUP 1BB0B 1VGCC 1O5GH 5A2MH 3KGPA 1OWIA 3PMBB 4D9QA 3NKKA 1A3EH 4Y0YE 1LPKB 3NUMA 2PHBA 2XYAA 5JB8S 2ZDMA 3SQEE 1SQTA 1JOUB 5FBIA 1GBJA 1YF4A 1MZAA 3ATWA 2NU1E 2BD9A 4D9RA 1HNEE 3V12A 2GV7A 2GV6A 3SU5A 2FODA 1NTPA 1TPSA 1NM6A 3GY7A 3A82A 2H5DA 3K9XB 3P6ZB 3MNCA 4GCHG 1BA8B 5AFYH 2ZTZA 4LK4A 1SQAA 1DOJA 1K28D 3UY9A 2WINI 1P2IA 5A09A 1UTQA 2IPHA 4A1VA 5E8EH 3PB1E 1O5DH 4YLUA 2VIWA 2FYRA 3JZ2B 3GICB 4YOGA 1BRCE 1QBNA 2QN5T 1B0FA 1UVTH 4K69A 2CV3A 1C5VA 2ALVA 1AGJA 1C5SA 1Y3WA 3BG8A 5T6FA 3ZVCA 1YYY1 4K1EA 2H9TH 2SNVA 4WVPE 2Y5GA 5J4QA 1K1LA 4NA9H 2C93B 3S9CA 1EJAA 1G3EA 1QL9A 2K7XA 3ZZ4A 1LVOA 3SI3H 3BEUA 3F6UH 5E0JA 1KXCA 3BTTE 3A7XA 3VB6A 4CBNA 3FP8E 1O2PA 2P93A 4AGJA 3TGJE 1CBWC 2W5EA 3HGNA 2EA3A 3BTDE 1BRBE 1RD3B 3RXGA 4DURA 1PQ7A 1A0LA 4MTBA 4JYUH 4ABAA 3U69H 1CQQA 3LGYA 3F9HA 1V2ST 2BDIA 2JETC 2UWLA 1SGCA 2BOKA 1SGYE 1O31A 2OBOA 1LHEH 1V6DA 1H4WA 2W26A 1TMBH 1ESTA 5GDSH 5F8TA 1SGTA 1E37B 3TK6A 2GMTB 1YM0A 3MOCA 4GAWA 3TNTA 4J2YB 3ZV8A 1JIMA 1QURH 4XBDA 5C20A 4MNYA 1BHXB 1V2RT 1WBGB 3BTEE 5ESBA 2Z94A 1BRAA 3HK6B 2CN0H 4I7YH 2Z3EA 4YTAA 1V2OT 1O2VA 1TBZH 5DKMA 1HAYB 1O2QA 2G51A 2LNCA 5AHGH 1EP5A 2H9HA 3HPTB 3W94A 2OLGA 1E36B 3MH7A 1O3GA 2BLVA 3I77A 2H6MA 2YOLA 1FIZA 3RUOA 4MVNA 4LZ1H 3FAOA 1K22H 3ZZ7A 1PPEE 2HALA 2GZ8A </