5EU8A

Structure of fipv main protease in complex with dual inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
300
structure length
300
Chain Sequence
SSGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRVINYENELSSVRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFTEIVSTDAFNMLAAKTGYSVEKLLECIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords main protease
publication title Crystal Structure of Feline Infectious Peritonitis Virus Main Protease in Complex with Synergetic Dual Inhibitors
pubmed doi rcsb
source organism Feline infectious peritonitis virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 84
structure length 300
sequence length 300
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5eu8A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5eu8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5eu8A01
4INLA 6LPRA 1G32B 2ODQA 3S9BA 1TOMH 1O3EA 1L1NA 2PLXA 3UQVA 2BDGA 2FEQH 2SGFE 4WMEA 5EQQA 1P2QA 1ZJDA 4AFQA 1GBKA 4Y7BA 1PYTD 3F9HA 1L4ZA 1K1IA 3GCHC 1RJXB 1ZHMA 4AB8A 2Y7ZA 4B71A 1GI2A 3GICB 3ZYEA 3SU1A 2ZFRH 1DUEA 1O0DH 2O8TA 5GCHG 1W10U 3TJUA 4D7FA 4ASHA 2BDIA 5FBIA 2BD5A 2ODYB 3FP8E 5JB8S 3RM2H 1Y8TA 5AHGH 1C5QA 1L1GA 5ESBA 1ZMLA 4FUIA 1D6RA 3GOVB 1C2GA 2FOFA 1SLWB 1Y5AT 4UD9H 1PPHE 3BG8A 1Q3XA 4ZROA 5J4QA 1FV9A 2VIPA 1ID5H 4FUBA 2JETC 1N6YA 3R0FA 1UCYH 1DVAH 1AWFH 1EP5A 4MPVA 1GDNA 1Z71A 2Q6FA 1HBTH 2UUKB 5T3HA 1TA2A 3NZIA 4H4FA 1FLEE 1P3CA 8ESTE 4JZ1A 2P94A 5FAHA 1NU7B 1SFIA 1J16A 1KXBA 3P8FA 1C5VA 1YCPH 2ZGCA 3MNBA 1TX8A 1GI1A 3VFEA 1S81A 4IC5A 4MNVA 1C2KA 3HGPA 1EOLA 1GCDA 1RD3B 3EGKH 2RG3A 3HKJB 1QL9A 2ZU2A 5FCKA 2W26A 3BTGE 1SGYE 4IMZA 4MNXA 1IQLA 1GHZA 2YNAA 1OS8A 3BTFE 3LJJA 4I8JA 1KLIH 4O3UA 1EAIA 2NU3E 5C1YA 5HXFA 1WOFA 3GY5A 3T25A 3VGCB 1J17T 1C5OH 2BQ7B 3KGPA 5JBTA 2B5TB 2RA0A 1XM1A 3VB3A 1SVPA 2ZDNA 3CS7A 1MU6B 5EXLA 1LO6A 1LPKB 1O5CB 2UUJB 1ZZZA 1CSOE 2ZTYA 2FLBH 3GY8A 4LXBH 1ABIH 3UR6A 2XYAA 1VCQA 4YLQH 1GBDA 1GI5A 4WH8A 1P10A 1SGFG 1HAVB 1ELCA 4XE4A 3E6PH 1RIWB 2G51A 3RXVA 2GZ7A 2VGCB 1QTFA 2OD3B 3A8DA 3F1SB 3BEFB 2FWWA 1S84A 1O2IA 4J1YA 3M5OA 2ANKH 1YLDA 2J95A 1V2WT 4FU7A 5EQRA 3S7HB 2BZ6H 5FCRA 2WV4A 1GBHA 1EPTA 1GCTC 1BA8B 4ABGA 1GGDB 3PLKA 1A5IA 1DSUA 1OKXA 1GJ8B 1D3TB 2B8OH 3FP6E 2BVXH 2Z9KA 1HXEH 4WMDA 3ZZBA 2PSYA 4KP0A 4VGCB 3KQEA 3ITIA 1XVMA 4YM9A 3GY4A 1P09A 2P95A 5E0HA 1TNLA 2FOAA 2GKVE 3BTDE 1PQ7A 1ELBA 3LKWA 1C1UH 5CHAB 2GZ9A 1UCYK 5JBBS 5DP8A 2C8ZB 2HPPH 1EQ9A 1ZYOA 3BTTE 5F8ZA 1KY9A 2ANMH 1P06A 2ZGXH 1V2MT 4E7NA 1BMNH 1LHEH 2TGPZ 2OP9A 5AFZH 3SNEA 2ZQ1A 1FAXA 1QRWA 4ZKSU 2VVUA 2I6SA 1AVWA 1YCPK 2O9QA 3UOPA 4M7GA 2HNTE 2PGQB 1T4VH 2PKAB 4XDEA 5I25A 4AYVB 1JXPA 2QXHA 4ISLA 1W0YH 4X1NU 1O2ZA 1A3BH 4X6NA 1KTTB 5DP4A 5GDSH 2VNTA 1FNIA 4E05H 1V2JT 1MCVA 2VJ1A 2SGQE 3RUOA 1O2MA 1T4UH 1H8IH 3OY5U 1A46H 2VH0A 2VWNA 1DOJA 1C5UA 1GMHF 4YT6H 3RXCA 3ZZCA 3URDA 3TPIZ 1P02A 2IJOB 1UK3A 5ESTE 3U9AH 2P8OC 3TK9A 4U32A 3VXFH 1G2LA 2BX3A 5HGGA 1CT2E 1QNJA 1D3QB 1BHXB 4ZHMU 1ESTA 3A83A 2BXUH 3BG4C 4HFPB 1CT4E 1GVLA 5EOKA 1WYKA 1SL3A 1K1PA 1BTZA 1A0LA 3P17H 1BT7A 5DG6A 1WU1A 3VB5A 3BTQE 1LMWB 1MQ5A 2CF9H 3E90B 2Z7FE 3QZQA 4YOGA 5E2PA 1YKTA 2A2QH 3SBKA 1AWHB 4AFZA 3NPSA 1P2JA 3UPEA 1SGFA 4WVPE 1BHXF 4A5TS 2GTBA 4I8GA 3TGKE 1K1MA 1G3DA 2AIPA 3QX5H 3M61U 4XBCA 4JYVH 3T27A 3SU4A 2K1QA 1N6XA 2AFQB 1TBQH 2FYQA 1GHAG 2SGDE 1GHAF 2ZFTA 3A81A 1UTKA 6GCHG 4GCHF 6GCHF 2F9VA 1GBJA 1A5GH 3RXTA 4DIHH 1RTLA 1V3XA 1SOTA 1C1SA 1D9IA 3MFJA 4ABFA 1AB9B 3MU0A 4X2VA 3IWMA 1T7CA 3PTNA 3JZ1B 5A2MH 4CRDA 2P3FH 3A89A 3SN8A 1QBVH 4AGKA 1O36A 3A8CA 6CHAC 3A84A 3UUZA 3LGIA 1FY5A 2OBOA 2ZTZA 2BM2A 5F6MA 4WF8A 1MZDA 1VGCB 2FI5E 2ZU4A 1BRUP 2J34A 2G52A 1GJ4H 3KCGH 3T2NA 1X7AC 2IPHA 3SQHE 2ZU5A 1NESE 1EPTC 1LVMA 2XW9A 1OP2A 3U8OH 1K21H 4CBOA 4JZDH 3LGWA 3AAVA 3TH4H 4HGCA 2TBSA 1O3JA 4AG2A 2AMDA 3ENSB 1EZQA 1BJUA 3ZV9A 3ZYDA 1EXFA 1JBUH 1PFXC 4K69A 3SUFA 3UIRA 3S0NA 1XMNB 4NIWA 3PROA 1NRNH 1XX9A 3URCA 1FIWA 1BRBE 1V2PT 2GMTC 1W0ZU 4NSVA 2FS8A 1HYLA 3TH2H 1CVWH 2VVCA 2OLGA 1SGDE 3UTUH 1GBLA 1BRCE 1JWTA 3U1JB 3F9EA 1TNHA 3ZVBA 4FUGA 1XUFA 3FAOA 1AGJA 5TJXA 1GI0A 3EE0B 3MU5A 1NC6A 1MKXH 3QTOH 3K6YA 1TWXB 3A80A 3RP2A 1MKWH 1TONA 2EEKA 3A87A 3STJA 1S85A 1CU1A 3HK3B 2ODPA 1AKSA 5DO4H 1GL1A 1G2MA 1O33A 2AGGX 2PWXA 3RXEA 1C5SA 3ELAH 1NRSH 1G3EA 4WXIA 1KDQB 4Y7AA 2J92A 2GCHG 1BZXE 2GDEH 3GCNA 1MTVA 1O5EH 2BD3A 1N8OC 3UQOA 3OY6U 1MZAA 4TWYA 2BY8X 1DLKB 1RRKA 2CF8H 1IQNA 1JIMA 3PMAB 3RXKA 2AYWA 7GCHG 1CGHA 1ELAA 4AOQA 2J38A 5CE1A 1QQUA 1GG6B 2XCFA 4D9RA 5AF9H 3A7WA 1HPGA 4FUHA 5LH8A 4NA9H 1TNIA 1T8NA 1ZTJA 5DGJA 3CENA 5FPSA 1V2LT 3MU4A 1Y3UA 1KLJH 1SGTA 1O3OA 3D49H 1TPOA 1AZZA 1KIGH 2F9PA 3A7TA 3HATH 4NA8A 4X8VH 1TGCA 1CHGA 1QY6A 1O5DH 4I31A 1XVOA 3AASA 1HJAC 3QLPH 4MQAA 3TH3H 1C1WH 1GJBB 3RU4T 3E1XB 1GJ9B 3GDVA 3QK1A 1P05A 1IQKA 1P03A 2P59A 2RDLA 1AVGH 4YOJA 3TNTA 2NU1E 3SU3A 1AFEH 3QDZB 4RN6A 1QL8A 4LK4A 1NS3A 1QBNA 5JDUB 3A7XA 2A32A 3H5CB 4UEHH 3KQBA 4AGJA 4X6PA 1OWDA 2EI7A 1EP6A 4B76A 1AO5A 1O3LA 2BMGB 3RXDA 1EJNA 2ZP0H 2Y81A 2BX4A 1GVZA 1AMHA 1Y59T 2JH0D 4MTBA 4R8TB 1GJDB 4AZ2B 3M36A 4TWWA 3SV2H 4BTUB 5EPYA 5A0BA 2J4IA 1TQ7B 4X1RU 4CH2B 1BTYA 1O2UA 3RXMA 1UHBA 1EZUC 2QF3A 2BTCE 1NZQH 1O5AB 3I29A 1AY6H 1CA8B 2VGCC 3Q77A 1MKWK 1HGTH 2FI3E 1CBWB 1EKBB 2C90B 1HFDA 2TRMA 3B9FH 4YT7H 1DY8A 3SW2B 3RXQA 1MBMA 3E0PB 1OYTH 2ZPRA 1MAXA 1C2LA 2A31A 2TGDA 2VIVA 4XBDA 1ZPCA 1Y3WA 4GAWA 1SI5H 1V2RT 2OXSA 2OUAA 2HNTF 1XUIA 3O8RA 3V12A 9ESTA 1MTSA 3P95A 1QJ1B 2BXTH 2BY6X 2F9NA 4CRCA 3GYMA 5FHTA 2ZDAH 3V7TA 4DVAU 3U98H 4INHA 3RU4E 3SGAE 3PMJA 4ZHAA 5CHAC 2VWLA 1P11E 5TCAA 1O2PA 1SLUB 1O35A 1Z8IB 4GLYA 1D3DB 2ZEBA 2CMYA 3C27B 2BY9X 1GMDF 2XC4A 1C5ZB 5K0HA 3Q3YA 2STAE 4MG3A 4ABHA 1Q2WA 4E06H 1LTOA 2QN5T 4K1SA 1F92A 1O2HA 1DXPA 2ZTXA 1H8DH 1ARBA 2PKSC 3H7OA 3SNAA 1XUKA 3RXGA 2PUXB 4INKA 5E2OA 2HVXA 4HZHA 3RMMH 1G3BA 1P2MA 2GT8A 1C5TA 4BAKB 9LPRA 4U2WA 1SGRE 1LVOA 4NCYA 3ZV8A 1ORFA 3G01A 1HAYB 4Z6AH 1QJ7B 3LPRA 2ZCLP 1B7XB 1YCPM 2A7JA 2DUCA 4X6MA 5JBCS 3M37A 4DY7B 2XWBI 1AZ8A 2O8UA 1HAOH 2EI6A 1MH0A 1MU8B 1DS2E 2ZG0H 3MI4A 1EAWA 1E35B 3ZZDA 1GBAA 4B73A 2GDDA 2WPMS 3A7YA 4BTIB 1ETRH 1MCTA 5A8ZA 1INCA 2FS9A 2QIQA 5CMXH 5AFYH 2OTVA 1RTFB 3QTVH 2R3UA 4K5ZA 1N1LA 1O3CA 1C5RA 1OP8A 2AGEX 4AB9A 3SU5A 4B2CA 1C5NH 2OC7A 1TOCB 3QZRA 3TJOA 2SNWA 4Y76A 3MO9A 1V2QT 1FMGA 3SV9A 1GDQA 2CHAB 4CHAB 4I33A 7KMEH 1F0UA 1ZHRA 2A7HA 1KSNA 1EZSC 1K1NA 3JZ2B 2FOEA 3DT0H 1T8LA 3ATIA 3L3TA 1RGQA 4B1TA 4Y71A 4F49A 2IN2A 3RXBA 4BNRA 2W3IA 1PYTC 2RA3A 3RDZA 1THPB 3Q3XA 2YNBA 1C4V2 1LPGB 3TK5A 3ATWA 4X1PU 1B0EA 3Q3KA 3K65B 2ZHWH 1F0RA 2G81E 3OYPA 2G55A 1OPHB 2ZPSA 1FDPA 4B2AA 4TY6A 3DFJA 2LNCA 1L2EA 2O8LA 1K22H 4RKOB 4IS5A 3B23B 4B75A 5EQSA 4XSKU 3O8BA 1YPGH 4FUEA 4X2XA 4JYTA 3ZVDA 5C1UA 1BMMH 2A2XH 3M7UA 1XXFA 3UFAA 1C1MA 1IQMA 2ZZUH 5DJ7A 3TGIE 4WY3A 3QGNB 1U6QA 3RXPA 3A8AA 1DLEA 1XUJA 4BTTB 1V2TT 2GCTB 3ZVFA 5BRRE 4GSOA 2WPLS 1C2JA 2A5AA 4D9QA 4MPXA 4B2BA 4X6OA 2EA3A 1GPZA 1QURH 2BD2A 1GHYH 1GVKB 3GDSA 8KME2 1J8AA 1LKBA 3ZZ4A 1KTSB 2DE9A 4Y8ZA 2A4QA 2FOHA 3KF2A 1P57B 2VB0A 3A8BA 2R2MB 4NWKA 5EXMA 1BB0B 1ELTA 1A3EH 1F5KU 3TNSA 1IQHA 1UVSH 3LC3A 4FU9A 2ZF0H 3KQDA 1OYQA 4UFFH 1FPHH 5EPNA 2CV3A 3ATMA 4DG4A 1V6DA 1J14A 4IGDA 2ZU1A 2Z9GA 3LONA 5HYOA 1SQTA 4ZXYH 1AFQC 4IC6A 3MTYA 2FTMA 2Z3DA 5DP3A 1FY1A 4BOHA 1FXYA 3SGQE 3SNCA 3GDUA 2G8TA 3RMNH 1YF4A 1WV7H 4XBBA 5T6FA 1FY4A 4MNYA 2P16A 1EB2A 3SU2A 2ILNA 4H6SB 3M5NA 2HPQH 1O3BA 1S82A 2BLQA 2NWNA 3PO1C 1G3CA 2TIOA 1L1JA 2ANYA 3TJNA 1HAXB 1IOEA 1S83A 2B9LA 3HGNA 3PWCA 1HIAB 2G5NA 2ZECA 2CJIA 1CE5A 1SHHB 2A5KA 2F91A 3MO3A 2AGIX 1ZSLA 1J15A 3S7KB 4CREA 4K3JA 3QO6A 2SGEE 3ZZ3A 1FN8A 3LGVA 3MNXA 1ZTLA 1G9IE 2OCVB 2BYAX 1UVOA 2FI4E 8GCHF 3LH3A 1C1TA 1VITH 2FX4A 1LDTT 4Y0ZE 1CHOG 3D65E 1MD8A 4TYDA 1CHOF 3KNXA 5TCCA 1DWEH 1QJ6B 3M3SA 2V6NA 3ZZAA 1O2OA 2ZKSA 1ZGIA 3PMBB 1GMHG 1VCPA 3NKKA 3SHCH 3DFLA 2GP9B 1ABJH 1O2QA 4JK6A 1HJ9A 3RXHA 4PROA 4NZQA 2F9OA 1B5GH 3NK8A 1PPEE 1C1QA 3S69A 2BDAA 2BZAA 2ZHFH 3GCOA 3ATLA 1FY8E 2PR3A 5A8XA 3SI3H 1ANEA 3BTWE 1TRYA 1K1JA 1VJ9U 3GCHB 2PV9B 1NROH 2J2UA 1Y3XA 1GBCA 1HLTH 2FMJA 2WYGA 4NA7A 3L33A 1HAPH 5A09A 1E37B 3T5FH 1ANDA 1XXDA 3PYHA 4SGAE 1C5WB 1UTJA 1P2NA 2FIRH 1QHRB 3EA7A 1WCZA 3MOCA 1DUAA 1GI9B 1F7ZA 2XTTB 3EQ0H 2G4UA 1P3EA 1C1PA 3P92A 4TPYA 1FI8A 2BLVA 2HALA 1CA0C 4WXVA 4IW4E 2XBVA 1IQIA 2ZWLH 1SMFE 3EA8A 1Z7KA 1SGNE 1NFYA 4ABAA 2JETB 1TX6A 3VB4A 1BBRE 2BB4A 2BHGA 1VCWA 4MVNA 2VIQA 4FU8A 3AVZA 3PMHB 1A0HB 3RXSA 1BRAA 3A86A 3V0XA 4UONA 4GCHG 4XFQA 4O3TA 1DITH 1SPJA 3PB1E 2FXRA 3S9CA 3LJOA 5DP7A 2ANWA 3TVJB 1AIXH 2SGPE 1O5BB 1OP0A 1FUJA 2ZA5A 1AE8H 5DPAA 2QA9E 1L0ZA 3SNDA 4K1TA 4WWYA 4YOIA 5EG4A 5I46H 1O2JA 2PUQH 1SLVB 1SOZA 1HAVA 4DOQA 1GWAA 2QXIA 1ZJKA 2PTNA 4ISHH 2Q1JA 1LHDH 1C1RA 3DA9B 4H42U 3MH5A 1TRMA 1V2OT 1VR1H 2H6MA 4CRBA 5BPEA 3SHAH 3SI4H 4B74A 4NIXA 1UK2A 1V2ST 4CR9A 2IOTA 1C5PA 4AYYB 1BTXA 3LH1A 1H9LB 1ACBE 5JBAS 3ZZ6A 1DFPA 2A7CA 1O2KA 5JPMH 2RCEA 1BIOA 1THSH 3E16B 2D8WA 4FUCA 1GJCB 1WQVH 4RKJB 4AG1A 2KAIB 4XOJA 1GHVH 2UWOA 2XXLA 5IDKA 1YPJH 4A1VA 4O03A 1HAGE 1PPFE 1UO6A 2GD4B 5DP9A 2P3UB 2PGBB 3GYLB 3IG6B 4RSPA 5A0CA 4D76A 1IQEA 3GY2A 2QAAA 3FANA 2WPHS 1HIAA 1P8VC 1LPZB 2ZFFH 3LIWA 4JMYA 1T8OA 1PPCE 1FPCH 2V3OH 1Y5UT 3BF6H 1GCTB 2EI8A 3EBNA 2ZFPH 2Q6DA 3BTHE 3C1KA 5AVDA 3E0NB 3BIUH 1O2WA 2F3CE 2F9UA 4KGAA 1BBRH 4Z0KA 2JKHA 3L6PA 4KTCA 4KKDA 1YBWA 2XC5A 4WMFA 1TX7A 3ODFA 2SGAA 1C1NA 1P0SH 2PKAA 1TABE 1A2CH 1O34A 1GJ6A 1RTKA 2ZFQH 2WINI 1A1RA 2Z9JA 4YLUA 1PJPA 4Y6DA 3PLPA 4YTAA 1VJAU 1UTNA 1OSSA 3RC4A 1BCUH 1O39A 3TU7H 3DD2H 3F9FA 2EC9H 1GBMA 1QRXA 2FTLE 1ZHPA 4FUJA 1O3FA 3MYWA 1GBTA 2AMQA 1C2HA 2BDYA 4UDWH 4NG9H 1ARCA 1HDTH 1W7GH 4I8KA 5K7RA 1HRTH 2ESTE 1VITF 3SU0A 5L2YH 1NT1A 1ZR0A 1GHBF 1AHTH 4CHAC 4ZH8A 4Q7ZA 4ZMAH 5J4SA 1DXWA 2UWLA 1W2KH 5FPTA 1C2FA 1V2VT 2ASUB 1QRZA 5F03A 3PWBA 1L4DA 2H9HA 1FQ3A 2A4GA 4CRGA 2NU2E 2FOBA 4I32A 1Y5BT 3FZZA 4JYUH 3MNCA 2XNIA 5EW2H 2P8OB 5GJ4B 1W8BH 1TE0A 4Y8XA 3PLBA 2ZHEH 1F5RA 1Z8RA 2BOHB 2H9EH 2LPRA 1O2RA 1C5XB 4E7RG 2THFB 2Y7XA 1E38B 1OWHA 3BG4B 4ZKNU 3NXPA 2R2WU 3MU1A 1UTPA 1TMTH 3VGCC 1H9IE 5C5NA 1GMCF 3K2UA 4FVDA 3O8DA 5A0AE 3R3GB 4NZLA 1WTHD 1XKBC 3NUMA 1SBWA 1ELEE 4KTUA 1XUGA 2ZO3H 5IYTA 3A7VA 4DCDA 3TK6A 1YPMH 3ZZ7A 1C1OA 2OQUA 1RIWC 1F0TA 3P8GA 1W11U 2ZGJA 2BDBA 1DPOA 3ZVEA 1KYNA 4AFUA 2BD7A 3UOUA 4YESB 3KEEA 1O3NA 1TAWA 2W7SA 5HM9A 2Z9IA 1BBRK 3UWJH 1Q31A 4GPGA 3BTKE 1GGDC 3QUMP 1Z6JH 1ZRBA 1HXFH 1TLDA 1OWJA 2FESH 7ESTE 4OGXA 1JRTA 1O3GA 4X0WU 2BDHA 1OXGA 2B0FA 4OS6A 4BANB 1E34B 3SV7A 1A0JA 3MNSA 4VGCC 4NSYA 4Q80A 3SQEE 4ISOA 6CHAB 2ZHDA 1YPHC 4GUXA 2QCYA 3ZVCA 1MD7A 1O38A 4NFEA 4WJG2 3P6ZB 1LKAA 5H4IB 4Y0YE 5L30H 1FONA 1BITA 3I78A 1EPTB 1Z8GA 5LGOA 1GMDG 4FUDA 2ULLA 1NFUA 8LPRA 2C8YB 4DT7B 3SJIA 1UTMA 1NM6A 1S6FA 2QC2A 3EA9A 1OWEA 1NRPH 1ESBA 1DWDH 2ZGBH 5C3NA 2WV5A 2ZDLA 2C8WB 5EODA 1Z1IA 1O2TA 5ABWA 2Z9LA 2AIQA 3E8LA 1TYNA 1EATA 1KDQA 3BIVH 2BOKA 4ABJA 1BUIA 1W7XH 1KXAA 1O2GH 1GL0E 4ZUHA 1C4Y2 3A82A 2TGAA 2GX4A 1SSXA 1DICA 1F0SA 1TIOA 1NFWA 1JIRA 2H2ZA 1YC0A 1MBQA 1C2IA 4F4OC 1G30B 3UNSA 4IBLH 2GV7A 3MH7A 2HRVA 1SFQB 1HAHH 5E0GA 3MMGA 1O3IA 4AN7A 2FM2A 2BD4A 2R9PA 3F9GA 1O3PB 2VH6A 5EW1H 2XRCA 2VWMA 1TBRH 1SLXB 1TPPA 1UVTH 3F6UH 3RXUA 3IITA 4Y8YA 3SUEA 2VU8E 3VEQB 1C2MA 4UE7H 1Z1JA 2CGAA 5GCHF 1QB1A 2G5VA 2C8XB 2FPZA 2R0LA 1N8OB 2AMPA 4NFFA 1SGIB 1DWBH 1EJMA 2ZDVH 3FFGA 4UFDH 3U1IB 4J2YB 3TJVA 3W94A 2B7DH 1SQOA 2P3TB 7LPRA 2QXJA 1DX5M 1ZRKA 5L6NH 3LDXH 1OX1A 3TLOA 3BTME 1TRNA 4CRFA 1CGIE 4X8TH 1ANBA 2G4TA 3KHVA 3B8JA 3V13A 1GJ5H 1O2NA 2HLCA 5C1XA 4I8HA 2HWLB 3RMLH 2H5CA 1ZLRA 2J94A 1ETTH 2BQWB 2VWOA 3HKIB 3BEIB 1AB9C 2FZZA 1SGCA 3VXEH 1HJAB 3V3MA 5F8TA 1CGJE 3S9AA 2Y6TA 5GPIB 1GBBA 5HMAA 1O2XA 3SUGA 1KXFA 1NN6A 1TQ0B 3M5LA 2Y5HA 5B6OA 2R0KA 4OS2A 1TA6A 1HNEE 1IQFA 1P01A 2BLWA 1LHGH 1FIZA 1T8MA 1OOKB 2BVSH 3SNBA 2UWPA 1AI8H 3KN2A 4I8LA 4U30A 4BAQB 1VGCC 1DSTA 1TGNA 1GBEA 2ALPA 2CN0H 1Z8JB 1MTNB 1G36A 3DHKH 5T6DA 5G4BA 4HTCH 3MU8A 1ESAA 2WUBA 3UNRA 1KXCA 3BV9B 4BAHB 4OS7A 3RC5A 4IN1A 4DIIH 1RFNA 3VPKA 1GBFA 2ZC9H 3CP7A 3PV4A 1C5MD 2SNVA 2GT7A 3ODDA 4MNWA 5FPYA 3SV8A 2VVVA 1BJVA 1TMUH 2FOMB 1NO9H 1S0QA 1CT0E 2ZFSA 5EU8A 3Q00A 1LQDB 4AORA 1O2VA 4Y79A 1QQ4A 2SFAA 1C2EA 2D2DA 1A5HA 2ZDKA 3RXLA 1NPMA 3LT3A 2FOCA 3M3TA 3A85A 4Q7XA 1MUEB 2BY7X 1YPKH 2A45B 2UUFB 5EGMA 2QGRA 4MDSA 2XC0A 4AFSA 3I77A 3EYDA 1LVBA 4JZIA 1ZSJA 1ZSKA 1DT2A 1J9CH 2FP7B 1FY3A 3HK6B 1NY22 1WSSH 4OS1A 1RXPA 1YGCH 5EXNA 2OQ5A 4UFGH 1PQ8A 4DURA 3RXFA 1TBZH 1AVXA 5GIBA 4BXSA 4ZKOU 1TNJA 3SJ9A 1EOJA 3W95A 2VINA 8GCHG 1YP9A 4BAMB 3UWIA 1SG8B 4X2YA 1QB6A 1HV7A 4GHTA 1C5LH 2BVRH 4CH8B 2FO9A 4UFEH 1GG6C 1A4WH 2H9TH 3ZVAA 1FJSA 1FAKH 4OGYA 1C2DA 1W12U 4ABEA 3GY6A 5JYIA 1AKSB 2AH4X 2ZGHA 2PKSB 1MMJN 1ETSH 1TPAE 3PM3A 4BXWA 2A5IA 1BOQA 1TMBH 1IHTH 1QA7A 3T62A 4NIVA 2W5EA 4HI3A 1EZXC 1QCPA 2D1JA 4CRAA 1O2YA 3HPTB 3DUXH 1D3PB 3SZNA 1BTWA 1WBGB 2JH6D 2ZQ2A 1HUTH 1O3DA 1FN6A 2ZNKH 1HB0B 1SGQE 2NU0E 3Q76A 1KXEA 2V3HH 4TY7A 1TNKA 3VB7A 1AU8A 3QWCH 2HOBA 1QL7A 3UY9A 4ABIA 2XWAA 2PHBA 4ESTE 2BLOA 1SHYA 2VIOA 1C4U2 2QY0B 4D8NA 1P9UA 1DANH 4A1XA 4BAOB 1SGEE 2F9BH 1TGSZ 1NRRH 1YM0A 2BD8A 4MPUA 3FVFB 3OU0A 1GDUA 2W3KA 4O97A 5SGAE 2OC1A 2WPKS 3LGUA 1KLTA 1WTGH 4LOYH 3QN7A 1AE5A 1BQYA 1GI8B 1QBOA 1S5SA 1TB6H 1TPSA 2HNTC 3RXRA 3SJOA 2XBYA 1P2OA 1Z6EA 1RS0A 3T29A 1W14U 1SQAA 1Y3YA 2VIDA 3BTEE 2H1UA 2A4RA 1PQAA 3WY8A 5GXPA 2Z6BD 1P12E 1IQGA 1C5YB 1CBWC 1LCYA 3OX7U 1MTWA 1BMAA 4K8BA 4JCNA 4NGAH 3FZDA 1ELDE 1ZMNA 1GJ7B 2G00A 3LGTA 4LZ4B 1W13U 5JB9S 1HCGA 3AW0A 5HM2A 1D6WA 3VB6A 1NRQH 2FOGA 1UTQA 3MO6A 2Z3EA 1EJAA 2PSXA 3EDXB 1DDJA 4DGJA 1BTHH 1BDAA 1UHBB 1O32A 1VZQH 3FP7E 1QFKH 1S6HA 4KTSA 1ZTKA 2FODA 3PTBA 1EB1H 1K2I1 2Y5FA 2WPIS 3D62A 1GI7B 3RXOA 2YOLA 3OTJE 1F5LA 1O30A 5FXLA 2M5TA 5FBEA 1T32A 4K2YA 5F8XA 3AAUA 3NWUA 5E8EH 3SU6A 1H1BA 1O2SA 1P04A 5ETXA 4A92A 2QV1A 4X8SH 2WYJA 1D4PB 3GY3A 1P9SA 1PPZA 5DP5A 3MWIU 3RXIA 1QA0A 3U8TH 3SJKA 1K1OA 1O3HA 3A88A 5DP6A 3D23A 2Q6GA 1GHWH 4OS4A 1DY9A 1PQ5A 4YO9A 1PPGE 2D26C 5L2ZH 5T6GA 1C9PA 1HAZB 1QR3E 1NU9A 3SO3A 4IMQA 3BN9A 4X1QU 1ZOMA 2XBXA 2DE8A 2W7UA 3F68H 1Y3VA 1ZMJA 2QXGA 1P2KA 5E0JA 1AFQB 1XUHA 2BDCA 3BSQA 3RM0H 2OC8A 3ZZ8A 5LPFA 1DM4B 4ISNA 1GI3A 2GV6A 1JMOH 3RXAA 1UVUH 4ZAEA 1UVPA 1FZZA 1YPLH 3RLYH 4WH6A 4DW2U 1O3AA 2C3SA 1IHSH 1BMLA 2OINA 4ABBA 3M3VA 2ZCKP 4GVUA 1A7SA 2O8WA 2P93A 3ZZ9A 4X8UH 1JRSA 3PO1B 3ATKA 3SUDA 5DK1A 1OWIA 4JK5A 1E0FD 1H9HE 4Q2KA 4CR5A 1DWCH 1TNGA 1WAYB 5FX6A 1MQ6A 2AEIH 5A8YA 1AUJA 1TGTA 2ZU3A 1OWKA 4OS5A 3UR9A 4X2WA 1K1LA 1AD8H 1YLCA 1G37A 1GBIA 2Y80A 1ZGVA 2GVFA 4MLFB 1ANCA 3GCTG 4K8YA 4QT8C 3GCTF 1SB1H 2CXVA 2GCHF 2OBQA 3K9XB 2FYRA 3T26A 4A6LA 2ZDMA 2K7XA 1VITG 5C20A 2HGTH 1GHBG 2CHAC 3MH6A 1QIXB 1MAYA 1EASA 7GCHF 1EAUA 3AW1A 2ZIQH 3BEUA 1ELVA 2PW8H 4U01A 5PTPA 1LHCH 1NFXA 3SV6A 2F83A 2BQ6B 2H5DA 4O9VA 2NU4E 3T28A 3M35A 5GWZA 3ZVGA 1LQEA 4DJZB 1AUTC 1UTLM 5C5OA 1A61H 4H6TA 3SOSA 3U8RH 3U69H 1CO7E 2ZHQH 3P8NA 1HAIH 5C67A 2J9NA 3MHWU 3SJ8A 3P70B 4I7YH 3E3TA 3ESTA 2O8MA 3RLWH 1TGBA 1EX3A 2AS9A 3KQCA 3SGBE 5C2ZA 3TGJE 1XKAC 1UK4A 2TGTA 1GHXH 1NTPA 3O8CA 1O37A 1JOUB 1GMCG 1QGFA 5LPEA 4FVBA 2BY5X 1V2NT 4NWLA 2R3YA 4SGBE 1YPHE 1O3MA 3P8OA 2XCNA 2LIZA 1O5FH 2QF0A 1EUFA 3LOXA 1V2KT 2STBE 1ZPBA 3M7TA 4X1SU 1QB9A 2GCTC 1PPBH 4ZXXH 1YPEH 2A1DB 3SORA 1MTNC 2Z94A 1W3CA 1CA0B 4JZFH 4NIYA 1B0FA 4FXGH 1BTPA 3GY7A 4Q7YA 6ESTA 4ISIH 5LPRA 2OC0A 1IAUA 3LGYA 4IN2A 1ELFA 2I6QA 2V0BA 1AN1E 4A1TA 4KELA 3LC5A 4K60A 1SC8U 3RMOH 3M5MA 4LZ1H 1M9UA 3RC6A 2PFEA 1T31A 4TPIZ 2FX6A 3A7ZA 4Y10E 2WPJS 4A7IB 1MKXK 2WUCA 1ELGA 1THRH 2JH5D 1O5GH 1AQ7A 3K6ZA 3NCLA 4MPWA 2C93B 1P2IA 1SR5C 2VIWA 3KL6A 2TPIZ 3QGJA 2KAIA 2ZCHP 1HJ8A 4ABDA 4K1EA 1UTOA 5DKMA 2FLRH 1UCYE 1GJAB 3STIA 2BD9A 5FX5A 1YYY1 2AERH 1C9TA 4Y11E 1EAXA 1GI6A 4AX9H 2GZ8A 1H4WA 4FUFA 1E36B 4D7GA 1F2SE 4JZEH 2C4FH 2XBWA 1TALA 1UMAH 1O31A 3H7TA 2ZPQA 1IQJA 1GI4A 3EAJA 1DE7H 2PTCE 3LU9B 1K9OE 2A4OA 4R0IA 4CBNA 4GHQA 3MH4A 3ZZ5A 1KXDA 3OSYA 4ZKRU 1WQSA 1UJ1A 3RU4D 1WUNH 2V35A 2GGVB 1O3KA 1CQQA 2A0QB 2QYIA 2Y5GA 2Y82A 2GMTB 1ZPZA 4THNH 2FDAA 1MTUA 2ZI2H 3UREA 3RXJA 1LHFH 2UUYA 4ZHLU 3N7OA 1SGPE 3E91A 1BTUA 1C1VH 1V2UT 3CS0A 3GISB 2Z3CA 1LVYA 4YZUA 1K28D 3M7QA 3UNQA 3TIUA 3TITA 1S0RA 1O2LA 3KIDU 1TFXA 2ALVA
chains in the Genus database with same CATH superfamily
4INLA 6LPRA 1G32B 2ODQA 2JJ1D 3S9BA 1TOMH 1O3EA 1L1NA 2PLXA 3UQVA 2BDGA 2FEQH 2SGFE 4WMEA 5EQQA 1P2QA 1ZJDA 4AFQA 1GBKA 4Y7BA 1PYTD 3F9HA 1L4ZA 1K1IA 3GCHC 1RJXB 2V3MA 1ZHMA 4AB8A 2Y7ZA 4B71A 1GI2A 3GICB 3ZYEA 3SU1A 1QZ8A 2ZFRH 1DUEA 1O0DH 2O8TA 5GCHG 1W10U 3TJUA 4D7FA 4ASHA 2BDIA 5FBIA 2BD5A 2ODYB 3FP8E 5JB8S 3RM2H 1Y8TA 5AHGH 1C5QA 1L1GA 5ESBA 1ZMLA 4FUIA 3VG8A 1D6RA 3GOVB 1C2GA 2FOFA 1SLWB 1Y5AT 4UD9H 1PPHE 3BG8A 1Q3XA 4ZROA 5J4QA 1FV9A 2VIPA 1ID5H 4FUBA 2JETC 1N6YA 3F2GA 3R0FA 1UCYH 1DVAH 1AWFH 1EP5A 4MPVA 1GDNA 1Z71A 2Q6FA 1HBTH 2UUKB 5T3HA 1TA2A 3NZIA 4H4FA 1FLEE 1P3CA 8ESTE 4JZ1A 2P94A 5GNDA 5FAHA 1NU7B 1SFIA 1J16A 1KXBA 3P8FA 1C5VA 1YCPH 2ZGCA 3MNBA 2AHME 1TX8A 1GI1A 3VFEA 1S81A 4IC5A 4MNVA 1C2KA 3HGPA 1EOLA 1GCDA 1RD3B 3EGKH 2RG3A 3HKJB 1QL9A 2ZU2A 5FCKA 2W26A 3BTGE 1SGYE 4IMZA 4MNXA 1IQLA 1GHZA 2YNAA 1OS8A 3BTFE 3LJJA 4I8JA 1KLIH 4O3UA 1EAIA 2NU3E 5C1YA 5HXFA 1WOFA 3GY5A 3T25A 3VGCB 1J17T 1C5OH 2BQ7B 3KGPA 5JBTA 2B5TB 2RA0A 1XM1A 3VB3A 1SVPA 2ZDNA 3CS7A 1MU6B 5EXLA 1LO6A 1LPKB 1O5CB 2UUJB 1ZZZA 1CSOE 2ZTYA 2FLBH 3GY8A 4LXBH 1ABIH 3UR6A 2XYAA 1VCQA 4YLQH 1GBDA 1GI5A 4WH8A 1P10A 1SGFG 4F55A 1HAVB 1ELCA 4XE4A 3OEED 3E6PH 1RIWB 2G51A 3RXVA 2GZ7A 2VGCB 1QTFA 2OD3B 3A8DA 3F1SB 3BEFB 2FWWA 1S84A 1O2IA 4J1YA 3M5OA 2ANKH 1YLDA 2J95A 1V2WT 4FU7A 5EQRA 3S7HB 2BZ6H 2YMSB 5FCRA 2WV4A 1GBHA 1EPTA 2HLDD 1GCTC 1BA8B 3N7DA 4ABGA 1GGDB 3PLKA 1A5IA 1DSUA 1OKXA 1GJ8B 1D3TB 2B8OH 3FP6E 2BVXH 2Z9KA 1EFRD 1HXEH 4WMDA 5CDFE 3ZZBA 2PSYA 4KP0A 2RFKC 4VGCB 3KQEA 3ITIA 1XVMA 2K0QA 4YM9A 3GY4A 1P09A 2P95A 5E0HA 1TNLA 2FOAA 2GKVE 3BTDE 1PQ7A 1ELBA 3LKWA 1C1UH 2KZ4A 5CHAB 1K0HA 2GZ9A 1UCYK 5JBBS 5DP8A 2C8ZB 2HPPH 1EQ9A 1ZYOA 3BTTE 5F8ZA 1KY9A 2ANMH 1P06A 2ZGXH 1V2MT 4E7NA 1BMNH 3KQ5A 1LHEH 2TGPZ 2OP9A 5AFZH 3SNEA 2ZQ1A 1FAXA 1QRWA 4ZKSU 2VVUA 2I6SA 1AVWA 1YCPK 2O9QA 3UOPA 4M7GA 2HNTE 2PGQB 1T4VH 2PKAB 4XDEA 5I25A 4AYVB 1JXPA 2QXHA 4ISLA 5C0UA 1W0YH 4X1NU 1O2ZA 1A3BH 4X6NA 1KTTB 5DP4A 5GDSH 2VNTA 1FNIA 4E05H 1V2JT 1MCVA 2VJ1A 2SGQE 3RUOA 1O2MA 1T4UH 1H8IH 3OY5U 1A46H 2VH0A 2VWNA 1DOJA 1C5UA 1GMHF 4YT6H 3RXCA 3ZZCA 3URDA 3TPIZ 3WW7A 1P02A 2IJOB 1UK3A 5ESTE 3U9AH 2P8OC 3TK9A 4U32A 3VXFH 1MABB 1G2LA 2BX3A 5HGGA 1CT2E 1QNJA 1D3QB 1BHXB 4ZHMU 1ESTA 3A83A 2BXUH 3BG4C 4HFPB 1CT4E 1GVLA 5EOKA 1WYKA 1SL3A 1K1PA 2KCYA 1BTZA 1A0LA 3P17H 1BT7A 5DG6A 1WU1A 3VB5A 3BTQE 1LMWB 1MQ5A 2CF9H 3E90B 3PV2A 2Z7FE 4F48B 5HIYA 3QZQA 4YOGA 4Q63A 5E2PA 1YKTA 2A2QH 3SBKA 1AWHB 4AFZA 3NPSA 1P2JA 3UPEA 1SGFA 4WVPE 1BHXF 4A5TS 2GTBA 4I8GA 1UW7A 3TGKE 1K1MA 1G3DA 2AIPA 3QX5H 3M61U 4XBCA 4JYVH 3T27A 3SU4A 2K1QA 1N6XA 2F43B 2VBCA 2AFQB 1TBQH 2FYQA 1GHAG 2SGDE 1GHAF 2ZFTA 3A81A 1UTKA 6GCHG 4GCHF 6GCHF 2F9VA 1GBJA 4RI0A 1A5GH 3RXTA 4DIHH 1RTLA 1V3XA 1SOTA 1C1SA 1D9IA 3MFJA 4ABFA 1AB9B 3MU0A 4X2VA 3IWMA 1T7CA 3PTNA 2IPQX 1E1QD 3JZ1B 5A2MH 4CRDA 2P3FH 3A89A 3SN8A 1QBVH 4AGKA 1O36A 3A8CA 6CHAC 3A84A 3UUZA 3LGIA 1FY5A 2OBOA 2ZTZA 2BM2A 5F6MA 4WF8A 1MZDA 1VGCB 2FI5E 2ZU4A 1BRUP 1NBMD 2J34A 2G52A 1GJ4H 3KCGH 3T2NA 1X7AC 2IPHA 3SQHE 2ZU5A 1NESE 1EPTC 1LVMA 2XW9A 1OP2A 3U8OH 1K21H 4CBOA 4JZDH 3LGWA 3AAVA 3TH4H 4HGCA 2TBSA 1O3JA 4AG2A 2AMDA 3ENSB 1EZQA 1BJUA 3ZV9A 3ZYDA 1EXFA 1JBUH 1PFXC 4K69A 3SUFA 3UIRA 3S0NA 1XMNB 4NIWA 3PROA 1NRNH 1XX9A 3URCA 1FIWA 1BRBE 1V2PT 2GMTC 1W0ZU 2W6JD 4NSVA 2FS8A 1HYLA 3TH2H 1CVWH 2VVCA 2OLGA 1SGDE 3UTUH 1GBLA 1BRCE 1JWTA 3U1JB 3F9EA 1TNHA 3ZVBA 4FUGA 1XUFA 2L6OA 3FAOA 1AGJA 5TJXA 1GI0A 3EE0B 3MU5A 1NC6A 1MKXH 3QTOH 3KYGA 3K6YA 1TWXB 3A80A 3RP2A 1MKWH 1TONA 2EEKA 3A87A 3STJA 1S85A 1CU1A 3DSOA 3EE7A 3HK3B 2ODPA 1AKSA 5DO4H 1GL1A 1G2MA 1O33A 2AGGX 3F0PA 2PWXA 3RXEA 1C5SA 3ELAH 1NRSH 1G3EA 4WXIA 1KDQB 4Y7AA 2J92A 2GCHG 1BZXE 2GDEH 3GCNA 1MTVA 1O5EH 2BD3A 1N8OC 3UQOA 3OY6U 1MZAA 4TWYA 2BY8X 1DLKB 1RRKA 2CF8H 1IQNA 1JIMA 3PMAB 3RXKA 2AYWA 7GCHG 1CGHA 1ELAA 4AOQA 2J38A 5CE1A 1QQUA 2M2AA 1GG6B 2XCFA 4D9RA 5AF9H 3A7WA 1HPGA 4FUHA 2KCPA 5LH8A 2J98A 4NA9H 4Z1MD 1TNIA 1T8NA 1ZTJA 5DGJA 3CENA 5FPSA 1V2LT 3MU4A 1Y3UA 1KLJH 1SGTA 1O3OA 3D49H 1TPOA 1AZZA 1KIGH 2F9PA 3A7TA 3HATH 4NA8A 4X8VH 1TGCA 1CHGA 1QY6A 1O5DH 4I31A 1XVOA 3AASA 1HJAC 3QLPH 3SZEA 4MQAA 3TH3H 1C1WH 1GJBB 3RU4T 3E1XB 1GJ9B 3GDVA 3QK1A 1P05A 1IQKA 1P03A 2P59A 2YMSD 2RDLA 5C94A 1AVGH 4YOJA 3TNTA 2NU1E 3SU3A 1AFEH 3QDZB 4RN6A 1QL8A 4LK4A 1NS3A 1QBNA 5JDUB 3A7XA 2A32A 3H5CB 4UEHH 3KQBA 4AGJA 4X6PA 1OWDA 2EI7A 1EP6A 4B76A 1AO5A 1O3LA 2BMGB 3RXDA 1EJNA 2ZP0H 2Y81A 2BX4A 1GVZA 5CHBA 1AMHA 1Y59T 2JH0D 4MTBA 4R8TB 1GJDB 4AZ2B 3M36A 4TWWA 3SV2H 4BTUB 2GJGA 5EPYA 5A0BA 2J4IA 1TQ7B 4X1RU 4CH2B 1BTYA 1O2UA 3RXMA 1UHBA 1EZUC 2QF3A 2BTCE 1NZQH 1O5AB 3I29A 4TT3D 1AY6H 1CA8B 2VGCC 3Q77A 1MKWK 1HGTH 2FI3E 1CBWB 1EKBB 2C90B 1HFDA 2TRMA 3B9FH 4YT7H 1DY8A 3SW2B 5HIZA 3RXQA 1MBMA 3E0PB 1OYTH 2ZPRA 1MAXA 1C2LA 2A31A 2TGDA 2VIVA 4XBDA 1ZPCA 1Y3WA 4GAWA 1SI5H 1V2RT 2OXSA 2OUAA 2HNTF 1XUIA 3O8RA 3V12A 9ESTA 1YLNA 3MQKC 1MTSA 3P95A 1QJ1B 2BXTH 2BY6X 2F9NA 4CRCA 3GYMA 5FHTA 2ZDAH 3V7TA 4DVAU 3U98H 4INHA 3RU4E 3SGAE 3OE7D 3PMJA 4ZHAA 5CHAC 2VWLA 1P11E 5TCAA 1O2PA 1SLUB 1O35A 1Z8IB 4GLYA 1D3DB 2ZEBA 2CMYA 3C27B 2BY9X 1GMDF 2XC4A 1C5ZB 5K0HA 3Q3YA 2STAE 4MG3A 4ABHA 1Q2WA 4E06H 1LTOA 2QN5T 4K1SA 1F92A 1O2HA 1DXPA 2ZTXA 1H8DH 1ARBA 2PKSC 3H7OA 3SNAA 1XUKA 3RXGA 2PUXB 4INKA 5E2OA 2HVXA 4HZHA 3RMMH 1G3BA 1P2MA 2GT8A 1C5TA 4BAKB 9LPRA 4U2WA 1SGRE 1LVOA 3KYFA 4NCYA 3ZV8A 1ORFA 3G01A 1HAYB 4Z6AH 1QJ7B 3LPRA 2ZCLP 1B7XB 1YCPM 2A7JA 2DUCA 4X6MA 5JBCS 3U28C 3M37A 4DY7B 2XWBI 1AZ8A 2O8UA 1HAOH 2EI6A 1MH0A 1MU8B 1DS2E 2ZG0H 3MI4A 1EAWA 1E35B 3ZZDA 1GBAA 4B73A 2GDDA 2WPMS 3A7YA 4BTIB 1ETRH 1MCTA 5A8ZA 1INCA 2FS9A 2QIQA 5CMXH 5AFYH 2OTVA 1RTFB 3QTVH 2R3UA 4K5ZA 1N1LA 1O3CA 1C5RA 1OP8A 2AGEX 4AB9A 3SU5A 4B2CA 1C5NH 2OC7A 1TOCB 3QZRA 3TJOA 2SNWA 4Y76A 3MO9A 1V2QT 1FMGA 3SV9A 1GDQA 2CHAB 5DSFA 4CHAB 4I33A 7KMEH 1F0UA 1ZHRA 2A7HA 1KSNA 1EZSC 5EJZA 1K1NA 4ZCNA 3JZ2B 2FOEA 3DT0H 1T8LA 3ATIA 3L3TA 1RGQA 4B1TA 2JJ2D 3PRDA 4OM9A 4Y71A 4F49A 2IN2A 3RXBA 4BNRA 2W3IA 5IK2D 1PYTC 2RA3A 3RDZA 1THPB 3Q3XA 2YNBA 1C4V2 1LPGB 3TK5A 3ATWA 4X1PU 1B0EA 3Q3KA 3K65B 2ZHWH 1F0RA 2G81E 3OYPA 2G55A 1OPHB 2ZPSA 2F4LA 3OAAD 1FDPA 4B2AA 3ZIAD 4TY6A 4YXWD 3DFJA 2LNCA 1L2EA 2O8LA 1K22H 2JDID 4RKOB 4IS5A 3B23B 4B75A 5EQSA 4XSKU 3O8BA 1YPGH 4FUEA 4X2XA 4JYTA 3ZVDA 5C1UA 1BMMH 2A2XH 3M7UA 1XXFA 3UFAA 1C1MA 1IQMA 2ZZUH 5DJ7A 3TGIE 4WY3A 3QGNB 1U6QA 3RXPA 3A8AA 1DLEA 1XUJA 4BTTB 1V2TT 2GCTB 3ZVFA 5BRRE 4GSOA 2WPLS 1C2JA 2A5AA 4D9QA 4MPXA 4B2BA 4X6OA 2EA3A 1GPZA 1QURH 2BD2A 5KGOA 1GHYH 1GVKB 3GDSA 8KME2 1J8AA 1LKBA 3ZZ4A 1KTSB 2DE9A 4Y8ZA 2A4QA 1H8HD 2FOHA 3KF2A 1P57B 2VB0A 3A8BA 2R2MB 4NWKA 5EXMA 1BB0B 1ELTA 1A3EH 1F5KU 3TNSA 1IQHA 1UVSH 3LC3A 4FU9A 2ZF0H 3KQDA 1OYQA 4UFFH 1FPHH 5EPNA 2CV3A 3ATMA 4DG4A 1V6DA 1J14A 4IGDA 2ZU1A 2Z9GA 3LONA 5HYOA 1SQTA 4ZXYH 1AFQC 3F2FA 4IC6A 3MTYA 2FTMA 3H09A 2Z3DA 5DP3A 1FY1A 2KCOA 4BOHA 1FXYA 3SGQE 3SNCA 3GDUA 1W0KD 2G8TA 3RMNH 1YF4A 1WV7H 4XBBA 3AK5A 5T6FA 1FY4A 4MNYA 2P16A 1EB2A 3SU2A 2ILNA 4H6SB 3M5NA 2HPQH 1O3BA 1S82A 2BLQA 3F3BA 2NWNA 3PO1C 1G3CA 2TIOA 1L1JA 2ANYA 3TJNA 1HAXB 1IOEA 1S83A 2B9LA 3HGNA 3PWCA 1HIAB 2G5NA 2ZECA 3W1EA 2CJIA 1CE5A 1SHHB 2A5KA 2F91A 3MO3A 2AGIX 1ZSLA 1J15A 3S7KB 4CREA 4K3JA 3QO6A 2SGEE 3UB0A 3WWFA 3ZZ3A 1FN8A 5B6LA 3LGVA 3MNXA 1ZTLA 1G9IE 2OCVB 2BYAX 1UVOA 2FI4E 8GCHF 3LH3A 3DSGA 1C1TA 1VITH 2FX4A 1LDTT 4Y0ZE 1CHOG 3D65E 1MD8A 4TYDA 2EQNA 1CHOF 3KNXA 5TCCA 3OFND 1DWEH 1QJ6B 3M3SA 2V6NA 3ZZAA 4Q4LA 1O2OA 2ZKSA 1ZGIA 3PMBB 2KR7A 1GMHG 1VCPA 3NKKA 3SHCH 3DFLA 2GP9B 1ABJH 1O2QA 4JK6A 1HJ9A 3RXHA 4PROA 4NZQA 2F9OA 1B5GH 2QE7D 3NK8A 1PPEE 1C1QA 3S69A 2BDAA 2BZAA 2ZHFH 3GCOA 3ATLA 1FY8E 2PR3A 5A8XA 3SI3H 1ANEA 3BTWE 1TRYA 1K1JA 1VJ9U 3GCHB 2PV9B 1NROH 2J2UA 1Y3XA 1GBCA 1HLTH 2WZQA 2FMJA 2WYGA 4NA7A 3L33A 1HAPH 1YWUA 5A09A 1E37B 3T5FH 1ANDA 1XXDA 3PYHA 4SGAE 1C5WB 1UTJA 1P2NA 2FIRH 1QHRB 3EA7A 1WCZA 3MOCA 1DUAA 1GI9B 1F7ZA 2XTTB 3EQ0H 2G4UA 1P3EA 1C1PA 3P92A 4TPYA 1FI8A 2BLVA 2HALA 1CA0C 4WXVA 4IW4E 2XBVA 1IQIA 2ZWLH 1SMFE 3EA8A 1Z7KA 4ACAA 2WV9A 1SGNE 1NFYA 4ABAA 2JETB 1TX6A 3VB4A 1BBRE 2BB4A 2BHGA 1VCWA 4MVNA 2HVYB 2VIQA 4FU8A 3AVZA 3PMHB 3OTPA 1A0HB 3RXSA 1BRAA 3A86A 3UAIC 3V0XA 4UONA 4GCHG 4XFQA 4O3TA 1DITH 5KECA 1SPJA 3PB1E 2FXRA 3S9CA 3LJOA 5DP7A 2ANWA 3TVJB 1AIXH 1WDIA 2SGPE 1O5BB 1OP0A 1FUJA 2ZA5A 1AE8H 5DPAA 2QA9E 1L0ZA 3SNDA 4K1TA 4WWYA 4YOIA 5EG4A 5I46H 1O2JA 2PUQH 1SLVB 1SOZA 1HAVA 4DOQA 1GWAA 2QXIA 1ZJKA 2PTNA 4ISHH 2Q1JA 1LHDH 1C1RA 4FETA 3DA9B 4H42U 3MH5A 5DN6D 1TRMA 1V2OT 1VR1H 2H6MA 2J5UA 5FL7D 4CRBA 5BPEA 3SHAH 3SI4H 4B74A 3N7EA 4NIXA 1UK2A 1V2ST 4CR9A 2IOTA 1C5PA 4AYYB 1BTXA 3LH1A 1H9LB 1ACBE 5JBAS 3ZZ6A 1DFPA 2A7CA 1O2KA 1YY3A 5JPMH 2RCEA 1BIOA 1THSH 3E16B 2D8WA 4FUCA 1GJCB 1WQVH 4RKJB 4AG1A 1WXRA 4M9FA 2KAIB 4XOJA 1GHVH 2UWOA 2XXLA 5IDKA 1YPJH 4A1VA 4O03A 1HAGE 1PPFE 1UO6A 2GD4B 5DP9A 2P3UB 2PGBB 3GYLB 3IG6B 4RSPA 5A0CA 4D76A 1IQEA 3GY2A 2QAAA 3FANA 2WPHS 1HIAA 1P8VC 1LPZB 2ZFFH 3LIWA 4JMYA 1T8OA 1PPCE 1FPCH 2V3OH 1Y5UT 3BF6H 1GCTB 2EI8A 3EBNA 2ZFPH 2Q6DA 3BTHE 3C1KA 5AVDA 3E0NB 3BIUH 1O2WA 2F3CE 2F9UA 4KGAA 1BBRH 4Z0KA 2JKHA 3L6PA 4KTCA 4KKDA 1YBWA 2JIZD 2XC5A 4WMFA 1TX7A 3ODFA 2SGAA 1C1NA 1P0SH 2PKAA 1TABE 1A2CH 1O34A 1GJ6A 1RTKA 3FOAA 2ZFQH 5EJLA 2WINI 1A1RA 2Z9JA 4YLUA 1PJPA 4Y6DA 3PLPA 4YTAA 1VJAU 1UTNA 1OSSA 3RC4A 1BCUH 1O39A 3TU7H 3DD2H 3F9FA 2EC9H 1GBMA 1QRXA 2FTLE 1ZHPA 4FUJA 1O3FA 3MYWA 1GBTA 2AMQA 1C2HA 2BDYA 4UDWH 4NG9H 1ARCA 2QF4A 1HDTH 1W7GH 2WPDD 1E79D 4I8KA 5K7RA 1HRTH 2ESTE 1VITF 2KCAA 3SU0A 5L2YH 1NT1A 1ZR0A 1GHBF 1AHTH 4CHAC 2CK3D 4ZH8A 4Q7ZA 4ZMAH 5J4SA 1DXWA 2UWLA 1W2KH 5FPTA 1C2FA 1V2VT 2ASUB 1QRZA 5F03A 3PWBA 1L4DA 2H9HA 1FQ3A 2A4GA 4CRGA 2NU2E 2FOBA 4I32A 1Y5BT 3FZZA 4JYUH 3MNCA 2XNIA 5EW2H 2P8OB 5GJ4B 1W8BH 1TE0A 4Y8XA 3PLBA 2ZHEH 1F5RA 1Z8RA 2BOHB 2H9EH 2LPRA 1O2RA 1C5XB 4E7RG 2THFB 2Y7XA 1E38B 1OWHA 3BG4B 4ZKNU 3NXPA 5F53A 2R2WU 3MU1A 1UTPA 1TMTH 3VGCC 1H9IE 5C5NA 1GMCF 3K2UA 4FVDA 3O8DA 5A0AE 3R3GB 4NZLA 1WTHD 1XKBC 3NUMA 1SBWA 1ELEE 4KTUA 1XUGA 2ZO3H 1SQRA 5IYTA 3A7VA 2KFWA 4DCDA 3TK6A 1YPMH 3ZZ7A 1C1OA 2OQUA 4XRNA 1RIWC 1F0TA 3P8GA 1W11U 2ZGJA 2BDBA 1DPOA 3ZVEA 1KYNA 4AFUA 2BD7A 3UOUA 4YESB 3KEEA 1O3NA 1TAWA 2W7SA 5HM9A 2Z9IA 1BBRK 3FN8A 2YMSC 3UWJH 1Q31A 4GPGA 3BTKE 1GGDC 3QUMP 1Z6JH 1ZRBA 1HXFH 1TLDA 2EY4C 1OWJA 2FESH 7ESTE 2XOKD 4OGXA 1JRTA 1O3GA 4X0WU 2BDHA 1OXGA 2B0FA 4OS6A 4BANB 1E34B 3SV7A 1A0JA 3MNSA 4VGCC 4NSYA 4Q80A 3SQEE 4ISOA 6CHAB 2ZHDA 1YPHC 4GUXA 2QCYA 3ZVCA 1E1RD 1MD7A 1O38A 4NFEA 4WJG2 3P6ZB 1LKAA 5H4IB 4Y0YE 5L30H 1FONA 2IJD1 1BITA 3I78A 1EPTB 1Z8GA 5LGOA 1GMDG 4FUDA 2ULLA 1NFUA 8LPRA 2C8YB 4DT7B 3SJIA 1UTMA 5C17A 1NM6A 1S6FA 2QC2A 3EA9A 1OWEA 1NRPH 1ESBA 1DWDH 2L74A 2ZGBH 5C3NA 2WV5A 2ZDLA 2C8WB 5EODA 1Z1IA 2WSSD 1O2TA 5ABWA 2Z9LA 2AIQA 3E8LA 1TYNA 1EATA 1KDQA 3BIVH 2BOKA 4ABJA 1BUIA 1W7XH 1KXAA 1O2GH 1GL0E 4ZUHA 3PRBA 1C4Y2 3A82A 2TGAA 2GX4A 1SSXA 1DICA 1F0SA 1TIOA 1NFWA 4AC9A 1JIRA 2H2ZA 1YC0A 1MBQA 1C2IA 4DT4A 4F4OC 1G30B 3UNSA 4IBLH 2GV7A 3MH7A 2HRVA 1SFQB 1HAHH 5E0GA 3MMGA 1O3IA 4AN7A 2FM2A 2BD4A 2R9PA 3F9GA 1O3PB 2VH6A 5EW1H 2XRCA 2VWMA 1TBRH 1SLXB 1TPPA 1UVTH 3F6UH 3RXUA 3IITA 4Y8YA 3SUEA 2VU8E 3VEQB 1C2MA 4UE7H 1Z1JA 2CGAA 5GCHF 1QB1A 2G5VA 2C8XB 2FPZA 2R0LA 1N8OB 2AMPA 4NFFA 1SGIB 1DWBH 1EJMA 2ZDVH 3FFGA 4UFDH 3U1IB 4J2YB 3TJVA 3W94A 2B7DH 1SQOA 2P3TB 7LPRA 2QXJA 1DX5M 1ZRKA 1VKYA 5L6NH 3LDXH 1OX1A 3TLOA 3BTME 1TRNA 4CRFA 1CGIE 4X8TH 1ANBA 2G4TA 3KHVA 3B8JA 3V13A 1GJ5H 1O2NA 2HLCA 5C1XA 4I8HA 2HWLB 3RMLH 2H5CA 1ZLRA 2J94A 1ETTH 2BQWB 2VWOA 3HKIB 3BEIB 5EJ1A 1AB9C 2FZZA 1SGCA 3VXEH 1HJAB 3F2HA 3V3MA 5F8TA 1CGJE 3S9AA 2Y6TA 5GPIB 1GBBA 5HMAA 1O2XA 3SUGA 1KXFA 2QF5A 1NN6A 1TQ0B 3M5LA 2Y5HA 5B6OA 2R0KA 4OS2A 1TA6A 1HNEE 1IQFA 4TSFD 1P01A 2BLWA 1LHGH 1FIZA 1T8MA 1OOKB 2BVSH 3SNBA 2UWPA 1AI8H 3KN2A 4I8LA 4U30A 4BAQB 1VGCC 1DSTA 1TGNA 1GBEA 2ALPA 2PP6A 2CN0H 1Z8JB 1MTNB 1G36A 3DHKH 5T6DA 5G4BA 4HTCH 3MU8A 1ESAA 2KM0A 2WUBA 1KMHB 3UNRA 1KXCA 2J97A 3BV9B 4BAHB 4OS7A 3RC5A 4IN1A 4DIIH 1RFNA 3VPKA 1GBFA 2ZC9H 3CP7A 3PV4A 1C5MD 2SNVA 2GT7A 3ODDA 4MNWA 5FPYA 3SV8A 2VVVA 1BJVA 1TMUH 2FOMB 1NO9H 1S0QA 1CT0E 2ZFSA 5EU8A 3Q00A 1LQDB 1COWD 4AORA 4I86A 1O2VA 4Y79A 1QQ4A 2SFAA 1C2EA 2D2DA 1A5HA 2ZDKA 3RXLA 1NPMA 3LT3A 2FOCA 3M3TA 3A85A 4Q7XA 1MUEB 2BY7X 1YPKH 2A45B 2UUFB 5EGMA 2QGRA 4MDSA 2XC0A 4AFSA 3I77A 3EYDA 1LVBA 4JZIA 1ZSJA 1ZSKA 1DT2A 1J9CH 2FP7B 1FY3A 4XD7D 3HK6B 1NY22 1WSSH 3DCLA 4OS1A 1RXPA 1YGCH 1OHHD 5EXNA 2OQ5A 4UFGH 1PQ8A 4DURA 3RXFA 1TBZH 1AVXA 5GIBA 4BXSA 4ZKOU 1TNJA 3SJ9A 1EOJA 3W95A 4P00A 2VINA 8GCHG 1YP9A 4BAMB 3UWIA 1SG8B 4X2YA 1QB6A 1HV7A 3CNRA 4GHTA 1C5LH 2BVRH 4CH8B 2FO9A 4UFEH 1GG6C 1A4WH 2H9TH 3ZVAA 1FJSA 1FAKH 4OGYA 1C2DA 1W12U 2K8IA 3GY6A 4ABEA 5JYIA 1AKSB 2AH4X 2ZGHA 2PKSB 1MMJN 1ETSH 1TPAE 3PM3A 4BXWA 2A5IA 1BOQA 1TMBH 1IHTH 1QA7A 3T62A 4NIVA 2W5EA 4HI3A 1EZXC 1QCPA 2D1JA 4CRAA 1O2YA 3HPTB 3DUXH 1D3PB 3SZNA 1BTWA 1WBGB 1FX0B 3FO8D 2JH6D 2ZQ2A 1HUTH 1O3DA 1FN6A 2ZNKH 1HB0B 1SGQE 2OK5A 2NU0E 3Q76A 1KXEA 2V3HH 4TY7A 1TNKA 3VB7A 1AU8A 3QWCH 2HOBA 1QL7A 3SYJA 3UY9A 4ACBA 4ABIA 2J98B 2XWAA 2LELA 2PHBA 4ESTE 4RT1A 2BLOA 1SHYA 2VIOA 1C4U2 2QY0B 4D8NA 1P9UA 1DANH 3N99A 5T1VA 4A1XA 4BAOB 1SGEE 2F9BH 1TGSZ 1NRRH 1YM0A 2BD8A 4MPUA 3FVFB 3OU0A 1GDUA 2W3KA 4O97A 5SGAE 2OC1A 2WPKS 3LGUA 1KLTA 1WTGH 4LOYH 3GS9A 1AE5A 3QN7A 1BQYA 1GI8B 1QBOA 1S5SA 1TB6H 1TPSA 2HNTC 3RXRA 3SJOA 2XBYA 1P2OA 1Z6EA 1RS0A 3T29A 1W14U 1SQAA 1Y3YA 2VIDA 3BTEE 2H1UA 2A4RA 1PQAA 3WY8A 5GXPA 2Z6BD 1P12E 1IQGA 1C5YB 1CBWC 1LCYA 3OX7U 3FKSD 1BMFD 5KEDA 1MTWA 1BMAA 4K8BA 4JCNA 4NGAH 3FZDA 1ELDE 1ZMNA 1GJ7B 2G00A 3LGTA 4LZ4B 1W13U 5JB9S 1NBME 1HCGA 3AW0A 5HM2A 1D6WA 3VB6A 1NRQH 2FOGA 1UTQA 3MO6A 2Z3EA 1EJAA 2PSXA 3EDXB 4B6FA 1DDJA 4DGJA 1BTHH 1BDAA 1UHBB 1O32A 1VZQH 3FP7E 1QFKH 1S6HA 4KTSA 3PV5A 1ZTKA 2WHXA 2FODA 3PTBA 1EB1H 4RT0A 1K2I1 2Y5FA 2WPIS 3D62A 1GI7B 3RXOA 2YOLA 3OTJE 1F5LA 1O30A 5FXLA 2M5TA 5FBEA 1T32A 4K2YA 5F8XA 3AAUA 3NWUA 5E8EH 3SU6A 1H1BA 1O2SA 1W0JD 1P04A 5ETXA 4A92A 2QV1A 4X8SH 2WYJA 1D4PB 3GY3A 1P9SA 1PPZA 5DP5A 3MWIU 3RXIA 1QA0A 3U8TH 3SJKA 1K1OA 1O3HA 3A88A 5DP6A 3D23A 2Q6GA 1GHWH 4OS4A 1DY9A 1PQ5A 4YO9A 1PPGE 2D26C 5L2ZH 5T6GA 1C9PA 1HAZB 1QR3E 1NU9A 3SO3A 4IMQA 3BN9A 4X1QU 1ZOMA 2XBXA 2DE8A 2W7UA 3F68H 1Y3VA 1ZMJA 2QXGA 1P2KA 5E0JA 1AFQB 1XUHA 2BDCA 3BSQA 3RM0H 2OC8A 3ZZ8A 5LPFA 1DM4B 4ISNA 1GI3A 2GV6A 1JMOH 3RXAA 1UVUH 4ZAEA 1UVPA 1FZZA 1YPLH 3RLYH 4WH6A 4DW2U 1O3AA 2C3SA 1IHSH 1BMLA 2OINA 4ABBA 3M3VA 2ZCKP 4GVUA 1A7SA 2O8WA 2P93A 3ZZ9A 4X8UH 1JRSA 3PO1B 3ATKA 3SUDA 5DK1A 1OWIA 4JK5A 1E0FD 3OEHD 1H9HE 4Q2KA 4CR5A 2KX4A 1DWCH 1TNGA 1WAYB 5FX6A 1MQ6A 2AEIH 5A8YA 1AUJA 1TGTA 2ZU3A 1OWKA 4OS5A 3UR9A 4X2WA 1K1LA 1AD8H 1YLCA 1G37A 1GBIA 2Y80A 1ZGVA 2GVFA 4P02A 4MLFB 1ANCA 3GCTG 4K8YA 4QT8C 3GCTF 1SB1H 2CXVA 2GCHF 2OBQA 3K9XB 2FYRA 3T26A 4A6LA 2ZDMA 2K7XA 1VITG 5C20A 2HGTH 1GHBG 2CHAC 3MH6A 1QIXB 1MAYA 1EASA 7GCHF 1EAUA 3AW1A 2ZIQH 2V7QD 3BEUA 1ELVA 2PW8H 4U01A 5PTPA 1LHCH 1NFXA 3NRLA 3SV6A 2F83A 2BQ6B 2H5DA 4O9VA 2NU4E 3T28A 3M35A 5GWZA 3ZVGA 1LQEA 4DJZB 1AUTC 1UTLM 5C5OA 1A61H 4H6TA 3SOSA 3U8RH 5EIYA 3U69H 1CO7E 2ZHQH 3P8NA 1HAIH 5C67A 2J9NA 3MHWU 3SJ8A 3P70B 4I7YH 3E3TA 3ESTA 2O8MA 3RLWH 1TGBA 1EX3A 2AS9A 3KQCA 3SGBE 5C2ZA 3TGJE 1XKAC 1UK4A 2TGTA 1GHXH 1NTPA 3O8CA 1O37A 1JOUB 1GMCG 1QGFA 5LPEA 4FVBA 2BY5X 1V2NT 4FOUC 4NWLA 2R3YA 5HKKD 4SGBE 1YPHE 1O3MA 3P8OA 2XCNA 2LIZA 1O5FH 1H8ED 2QF0A 1EUFA 3LOXA 1V2KT 2STBE 1ZPBA 3M7TA 4X1SU 1QB9A 2GCTC 1PPBH 4ZXXH 1YPEH 2A1DB 3SORA 1MTNC 2Z94A 1W3CA 1CA0B 4JZFH 2W6ID 1B0FA 4FXGH 1BTPA 4NIYA 3GY7A 4Q7YA 6ESTA 1SKYE 3F0OA 4ISIH 5LPRA 2OC0A 1IAUA 3LGYA 4IN2A 1ELFA 2XNDD 2I6QA 2V0BA 1AN1E 4A1TA 4KELA 3LC5A 4K60A 1SC8U 3RMOH 3M5MA 4LZ1H 1M9UA 3RC6A 2PFEA 1T31A 4TPIZ 2FX6A 3A7ZA 4Y10E 2WPJS 4A7IB 1MKXK 2WUCA 1ELGA 1THRH 2JH5D 1O5GH 1AQ7A 3K6ZA 1S6LA 3NCLA 4MPWA 3WWBA 2C93B 1P2IA 1SR5C 2VIWA 3KL6A 2TPIZ 3QGJA 2KAIA 3DSPA 2ZCHP 1HJ8A 4ABDA 4K1EA 1UTOA 4B6EA 5DKMA 2FLRH 2LP6A 1UCYE 1GJAB 3STIA 2BD9A 5FX5A 1YYY1 5C0TA 2AERH 1C9TA 4Y11E 1EAXA 1GI6A 4ASUD 4AX9H 2GZ8A 1H4WA 4FUFA 1E36B 4D7GA 1F2SE 4JZEH 2C4FH 2XBWA 1TALA 1UMAH 1O31A 3H7TA 2ZPQA 1IQJA 1GI4A 3EAJA 1DE7H 2PTCE 3LU9B 1K9OE 2A4OA 4R0IA 4CBNA 4GHQA 3MH4A 3ZZ5A 1KXDA 4HG6A 3OSYA 4ZKRU 1WQSA 1UJ1A 3RU4D 1WUNH 2V35A 2GGVB 1O3KA 1CQQA 2A0QB 2QYIA 2Y5GA 2Y82A 2GMTB 1ZPZA 4THNH 2FDAA 1MTUA 2ZI2H 3UREA 3RXJA 1LHFH 2UUYA 4ZHLU 3N7OA 1SGPE 3E91A 2RDEA 1BTUA 1C1VH 1V2UT 3CS0A 3GISB 2Z3CA 1LVYA 4YZUA 1K28D 3M7QA 3UNQA 3TIUA 3TITA 1S0RA 1O2LA 3KIDU 1TFXA 2ALVA
chains in the Genus database with same CATH topology
4INLA 6LPRA 1G32B 2ODQA 3S9BA 1TOMH 1O3EA 1L1NA 2PLXA 3UQVA 2BDGA 2FEQH 2SGFE 4WMEA 5EQQA 1P2QA 1ZJDA 4AFQA 1GBKA 4Y7BA 1PYTD 3F9HA 1L4ZA 1K1IA 3GCHC 1RJXB 1ZHMA 4AB8A 2Y7ZA 4B71A 1GI2A 3GICB 3ZYEA 3SU1A 2ZFRH 1DUEA 1O0DH 2O8TA 5GCHG 1W10U 3TJUA 4D7FA 4ASHA 2BDIA 5FBIA 2BD5A 2ODYB 3FP8E 5JB8S 3RM2H 1Y8TA 5AHGH 1C5QA 1L1GA 5ESBA 1ZMLA 4FUIA 1D6RA 3GOVB 1C2GA 2FOFA 1SLWB 1Y5AT 4UD9H 1PPHE 3BG8A 1Q3XA 4ZROA 5J4QA 1FV9A 2VIPA 1ID5H 4FUBA 2JETC 1N6YA 3R0FA 1UCYH 1DVAH 1AWFH 1EP5A 4MPVA 1GDNA 1Z71A 2Q6FA 1HBTH 2UUKB 5T3HA 1TA2A 3NZIA 4H4FA 1FLEE 1P3CA 8ESTE 4JZ1A 2P94A 5FAHA 1NU7B 1SFIA 1J16A 1KXBA 3P8FA 1C5VA 1YCPH 2ZGCA 3MNBA 1TX8A 1GI1A 3VFEA 1S81A 4IC5A 4MNVA 1C2KA 3HGPA 1EOLA 1GCDA 1RD3B 3EGKH 2RG3A 3HKJB 1QL9A 2ZU2A 5FCKA 2W26A 3BTGE 1SGYE 4IMZA 4MNXA 1IQLA 1GHZA 2YNAA 1OS8A 3BTFE 3LJJA 4I8JA 1KLIH 4O3UA 1EAIA 2NU3E 5C1YA 5HXFA 1WOFA 3GY5A 3T25A 3VGCB 1J17T 1C5OH 2BQ7B 3KGPA 5JBTA 2B5TB 2RA0A 1XM1A 3VB3A 1SVPA 2ZDNA 3CS7A 1MU6B 5EXLA 1LO6A 1LPKB 1O5CB 2UUJB 1ZZZA 1CSOE 2ZTYA 2FLBH 3GY8A 4LXBH 1ABIH 3UR6A 2XYAA 1VCQA 4YLQH 1GBDA 1GI5A 4WH8A 1P10A 1SGFG 1HAVB 1ELCA 4XE4A 3E6PH 1RIWB 2G51A 3RXVA 2GZ7A 2VGCB 1QTFA 2OD3B 3A8DA 3F1SB 3BEFB 2FWWA 1S84A 1O2IA 4J1YA 3M5OA 2ANKH 1YLDA 2J95A 1V2WT 4FU7A 5EQRA 3S7HB 2BZ6H 5FCRA 2WV4A 1GBHA 1EPTA 1GCTC 1BA8B 4ABGA 1GGDB 3PLKA 1A5IA 1DSUA 1OKXA 1GJ8B 1D3TB 2B8OH 3FP6E 2BVXH 2Z9KA 1HXEH 4WMDA 3ZZBA 2PSYA 4KP0A 4VGCB 3KQEA 3ITIA 1XVMA 4YM9A 3GY4A 1P09A 2P95A 5E0HA 1TNLA 2FOAA 2GKVE 3BTDE 1PQ7A 1ELBA 3LKWA 1C1UH 5CHAB 2GZ9A 1UCYK 5JBBS 5DP8A 2C8ZB 2HPPH 1EQ9A 1ZYOA 3BTTE 5F8ZA 1KY9A 2ANMH 1P06A 2ZGXH 1V2MT 4E7NA 1BMNH 1LHEH 2TGPZ 2OP9A 5AFZH 3SNEA 2ZQ1A 1FAXA 1QRWA 4ZKSU 2VVUA 2I6SA 1AVWA 1YCPK 2O9QA 3UOPA 4M7GA 2HNTE 2PGQB 1T4VH 2PKAB 4XDEA 5I25A 4AYVB 1JXPA 2QXHA 4ISLA 1W0YH 4X1NU 1O2ZA 1A3BH 4X6NA 1KTTB 5DP4A 5GDSH 2VNTA 1FNIA 4E05H 1V2JT 1MCVA 2VJ1A 2SGQE 3RUOA 1O2MA 1T4UH 1H8IH 3OY5U 1A46H 2VH0A 2VWNA 1DOJA 1C5UA 1GMHF 4YT6H 3RXCA 3ZZCA 3URDA 3TPIZ 1P02A 2IJOB 1UK3A 5ESTE 3U9AH 2P8OC 3TK9A 4U32A 3VXFH 1G2LA 2BX3A 5HGGA 1CT2E 1QNJA 1D3QB 1BHXB 4ZHMU 1ESTA 3A83A 2BXUH 3BG4C 4HFPB 1CT4E 1GVLA 5EOKA 1WYKA 1SL3A 1K1PA 1BTZA 1A0LA 3P17H 1BT7A 5DG6A 1WU1A 3VB5A 3BTQE 1LMWB 1MQ5A 2CF9H 3E90B 2Z7FE 3QZQA 4YOGA 5E2PA 1YKTA 2A2QH 3SBKA 1AWHB 4AFZA 3NPSA 1P2JA 3UPEA 1SGFA 4WVPE 1BHXF 4A5TS 2GTBA 4I8GA 3TGKE 1K1MA 1G3DA 2AIPA 3QX5H 3M61U 4XBCA 4JYVH 3T27A 3SU4A 2K1QA 1N6XA 2AFQB 1TBQH 2FYQA 1GHAG 2SGDE 1GHAF 2ZFTA 3A81A 1UTKA 6GCHG 4GCHF 6GCHF 2F9VA 1GBJA 1A5GH 3RXTA 4DIHH 1RTLA 1V3XA 1SOTA 1C1SA 1D9IA 3MFJA 4ABFA 1AB9B 3MU0A 4X2VA 3IWMA 1T7CA 3PTNA 3JZ1B 5A2MH 4CRDA 2P3FH 3A89A 3SN8A 1QBVH 4AGKA 1O36A 3A8CA 6CHAC 3A84A 3UUZA 3LGIA 1FY5A 2OBOA 2ZTZA 2BM2A 5F6MA 4WF8A 1MZDA 1VGCB 2FI5E 2ZU4A 1BRUP 2J34A 2G52A 1GJ4H 3KCGH 3T2NA 1X7AC 2IPHA 3SQHE 2ZU5A 1NESE 1EPTC 1LVMA 2XW9A 1OP2A 3U8OH 1K21H 4CBOA 4JZDH 3LGWA 3AAVA 3TH4H 4HGCA 2TBSA 1O3JA 4AG2A 2AMDA 3ENSB 1EZQA 1BJUA 3ZV9A 3ZYDA 1EXFA 1JBUH 1PFXC 4K69A 3SUFA 3UIRA 3S0NA 1XMNB 4NIWA 3PROA 1NRNH 1XX9A 3URCA 1FIWA 1BRBE 1V2PT 2GMTC 1W0ZU 4NSVA 2FS8A 1HYLA 3TH2H 1CVWH 2VVCA 2OLGA 1SGDE 3UTUH 1GBLA 1BRCE 1JWTA 3U1JB 3F9EA 1TNHA 3ZVBA 4FUGA 1XUFA 3FAOA 1AGJA 5TJXA 1GI0A 3EE0B 3MU5A 1NC6A 1MKXH 3QTOH 3K6YA 1TWXB 3A80A 3RP2A 1MKWH 1TONA 2EEKA 3A87A 3STJA 1S85A 1CU1A 3HK3B 2ODPA 1AKSA 5DO4H 1GL1A 1G2MA 1O33A 2AGGX 2PWXA 3RXEA 1C5SA 3ELAH 1NRSH 1G3EA 4WXIA 1KDQB 4Y7AA 2J92A 2GCHG 1BZXE 2GDEH 3GCNA 1MTVA 1O5EH 2BD3A 1N8OC 3UQOA 3OY6U 1MZAA 4TWYA 2BY8X 1DLKB 1RRKA 2CF8H 1IQNA 1JIMA 3PMAB 3RXKA 2AYWA 7GCHG 1CGHA 1ELAA 4AOQA 2J38A 5CE1A 1QQUA 1GG6B 2XCFA 4D9RA 5AF9H 3A7WA 1HPGA 4FUHA 5LH8A 4NA9H 1TNIA 1T8NA 1ZTJA 5DGJA 3CENA 5FPSA 1V2LT 3MU4A 1Y3UA 1KLJH 1SGTA 1O3OA 3D49H 1TPOA 1AZZA 1KIGH 2F9PA 3A7TA 3HATH 4NA8A 4X8VH 1TGCA 1CHGA 1QY6A 1O5DH 4I31A 1XVOA 3AASA 1HJAC 3QLPH 4MQAA 3TH3H 1C1WH 1GJBB 3RU4T 3E1XB 1GJ9B 3GDVA 3QK1A 1P05A 1IQKA 1P03A 2P59A 2RDLA 1AVGH 4YOJA 3TNTA 2NU1E 3SU3A 1AFEH 3QDZB 4RN6A 1QL8A 4LK4A 1NS3A 1QBNA 5JDUB 3A7XA 2A32A 3H5CB 4UEHH 3KQBA 4AGJA 4X6PA 1OWDA 2EI7A 1EP6A 4B76A 1AO5A 1O3LA 2BMGB 3RXDA 1EJNA 2ZP0H 2Y81A 2BX4A 1GVZA 1AMHA 1Y59T 2JH0D 4MTBA 4R8TB 1GJDB 4AZ2B 3M36A 4TWWA 3SV2H 4BTUB 5EPYA 5A0BA 2J4IA 1TQ7B 4X1RU 4CH2B 1BTYA 1O2UA 3RXMA 1UHBA 1EZUC 2QF3A 2BTCE 1NZQH 1O5AB 3I29A 1AY6H 1CA8B 2VGCC 3Q77A 1MKWK 1HGTH 2FI3E 1CBWB 1EKBB 2C90B 1HFDA 2TRMA 3B9FH 4YT7H 1DY8A 3SW2B 3RXQA 1MBMA 3E0PB 1OYTH 2ZPRA 1MAXA 1C2LA 2A31A 2TGDA 2VIVA 4XBDA 1ZPCA 1Y3WA 4GAWA 1SI5H 1V2RT 2OXSA 2OUAA 2HNTF 1XUIA 3O8RA 3V12A 9ESTA 1MTSA 3P95A 1QJ1B 2BXTH 2BY6X 2F9NA 4CRCA 3GYMA 5FHTA 2ZDAH 3V7TA 4DVAU 3U98H 4INHA 3RU4E 3SGAE 3PMJA 4ZHAA 5CHAC 2VWLA 1P11E 5TCAA 1O2PA 1SLUB 1O35A 1Z8IB 4GLYA 1D3DB 2ZEBA 2CMYA 3C27B 2BY9X 1GMDF 2XC4A 1C5ZB 5K0HA 3Q3YA 2STAE 4MG3A 4ABHA 1Q2WA 4E06H 1LTOA 2QN5T 4K1SA 1F92A 1O2HA 1DXPA 2ZTXA 1H8DH 1ARBA 2PKSC 3H7OA 3SNAA 1XUKA 3RXGA 2PUXB 4INKA 5E2OA 2HVXA 4HZHA 3RMMH 1G3BA 1P2MA 2GT8A 1C5TA 4BAKB 9LPRA 4U2WA 1SGRE 1LVOA 4NCYA 3ZV8A 1ORFA 3G01A 1HAYB 4Z6AH 1QJ7B 3LPRA 2ZCLP 1B7XB 1YCPM 2A7JA 2DUCA 4X6MA 5JBCS 3M37A 4DY7B 2XWBI 1AZ8A 2O8UA 1HAOH 2EI6A 1MH0A 1MU8B 1DS2E 2ZG0H 3MI4A 1EAWA 1E35B 3ZZDA 1GBAA 4B73A 2GDDA 2WPMS 3A7YA 4BTIB 1ETRH 1MCTA 5A8ZA 1INCA 2FS9A 2QIQA 5CMXH 5AFYH 2OTVA 1RTFB 3QTVH 2R3UA 4K5ZA 1N1LA 1O3CA 1C5RA 1OP8A 2AGEX 4AB9A 3SU5A 4B2CA 1C5NH 2OC7A 1TOCB 3QZRA 3TJOA 2SNWA 4Y76A 3MO9A 1V2QT 1FMGA 3SV9A 1GDQA 2CHAB 4CHAB 4I33A 7KMEH 1F0UA 1ZHRA 2A7HA 1KSNA 1EZSC 1K1NA 3JZ2B 2FOEA 3DT0H 1T8LA 3ATIA 3L3TA 1RGQA 4B1TA 4Y71A 4F49A 2IN2A 3RXBA 4BNRA 2W3IA 1PYTC 2RA3A 3RDZA 1THPB 3Q3XA 2YNBA 1C4V2 1LPGB 3TK5A 3ATWA 4X1PU 1B0EA 3Q3KA 3K65B 2ZHWH 1F0RA 2G81E 3OYPA 2G55A 1OPHB 2ZPSA 1FDPA 4B2AA 4TY6A 3DFJA 2LNCA 1L2EA 2O8LA 1K22H 4RKOB 4IS5A 3B23B 4B75A 5EQSA 4XSKU 3O8BA 1YPGH 4FUEA 4X2XA 4JYTA 3ZVDA 5C1UA 1BMMH 2A2XH 3M7UA 1XXFA 3UFAA 1C1MA 1IQMA 2ZZUH 5DJ7A 3TGIE 4WY3A 3QGNB 1U6QA 3RXPA 3A8AA 1DLEA 1XUJA 4BTTB 1V2TT 2GCTB 3ZVFA 5BRRE 4GSOA 2WPLS 1C2JA 2A5AA 4D9QA 4MPXA 4B2BA 4X6OA 2EA3A 1GPZA 1QURH 2BD2A 1GHYH 1GVKB 3GDSA 8KME2 1J8AA 1LKBA 3ZZ4A 1KTSB 2DE9A 4Y8ZA 2A4QA 2FOHA 3KF2A 1P57B 2VB0A 3A8BA 2R2MB 4NWKA 5EXMA 1BB0B 1ELTA 1A3EH 1F5KU 3TNSA 1IQHA 1UVSH 3LC3A 4FU9A 2ZF0H 3KQDA 1OYQA 4UFFH 1FPHH 5EPNA 2CV3A 3ATMA 4DG4A 1V6DA 1J14A 4IGDA 2ZU1A 2Z9GA 3LONA 5HYOA 1SQTA 4ZXYH 1AFQC 4IC6A 3MTYA 2FTMA 2Z3DA 5DP3A 1FY1A 4BOHA 1FXYA 3SGQE 3SNCA 3GDUA 2G8TA 3RMNH 1YF4A 1WV7H 4XBBA 5T6FA 1FY4A 4MNYA 2P16A 1EB2A 3SU2A 2ILNA 4H6SB 3M5NA 2HPQH 1O3BA 1S82A 2BLQA 2NWNA 3PO1C 1G3CA 2TIOA 1L1JA 2ANYA 3TJNA 1HAXB 1IOEA 1S83A 2B9LA 3HGNA 3PWCA 1HIAB 2G5NA 2ZECA 2CJIA 1CE5A 1SHHB 2A5KA 2F91A 3MO3A 2AGIX 1ZSLA 1J15A 3S7KB 4CREA 4K3JA 3QO6A 2SGEE 3ZZ3A 1FN8A 3LGVA 3MNXA 1ZTLA 1G9IE 2OCVB 2BYAX 1UVOA 2FI4E 8GCHF 3LH3A 1C1TA 1VITH 2FX4A 1LDTT 4Y0ZE 1CHOG 3D65E 1MD8A 4TYDA 1CHOF 3KNXA 5TCCA 1DWEH 1QJ6B 3M3SA 2V6NA 3ZZAA 1O2OA 2ZKSA 1ZGIA 3PMBB 1GMHG 1VCPA 3NKKA 3SHCH 3DFLA 2GP9B 1ABJH 1O2QA 4JK6A 1HJ9A 3RXHA 4PROA 4NZQA 2F9OA 1B5GH 3NK8A 1PPEE 1C1QA 3S69A 2BDAA 2BZAA 2ZHFH 3GCOA 3ATLA 1FY8E 2PR3A 5A8XA 3SI3H 1ANEA 3BTWE 1TRYA 1K1JA 1VJ9U 3GCHB 2PV9B 1NROH 2J2UA 1Y3XA 1GBCA 1HLTH 2FMJA 2WYGA 4NA7A 3L33A 1HAPH 5A09A 1E37B 3T5FH 1ANDA 1XXDA 3PYHA 4SGAE 1C5WB 1UTJA 1P2NA 2FIRH 1QHRB 3EA7A 1WCZA 3MOCA 1DUAA 1GI9B 1F7ZA 2XTTB 3EQ0H 2G4UA 1P3EA 1C1PA 3P92A 4TPYA 1FI8A 2BLVA 2HALA 1CA0C 4WXVA 4IW4E 2XBVA 1IQIA 2ZWLH 1SMFE 3EA8A 1Z7KA 1SGNE 1NFYA 4ABAA 2JETB 1TX6A 3VB4A 1BBRE 2BB4A 2BHGA 1VCWA 4MVNA 2VIQA 4FU8A 3AVZA 3PMHB 1A0HB 3RXSA 1BRAA 3A86A 3V0XA 4UONA 4GCHG 4XFQA 4O3TA 1DITH 1SPJA 3PB1E 2FXRA 3S9CA 3LJOA 5DP7A 2ANWA 3TVJB 1AIXH 2SGPE 1O5BB 1OP0A 1FUJA 2ZA5A 1AE8H 5DPAA 2QA9E 1L0ZA 3SNDA 4K1TA 4WWYA 4YOIA 5EG4A 5I46H 1O2JA 2PUQH 1SLVB