5EU8A

Structure of fipv main protease in complex with dual inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
300
structure length
300
Chain Sequence
SSGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRVINYENELSSVRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFTEIVSTDAFNMLAAKTGYSVEKLLECIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords main protease
publication title Crystal Structure of Feline Infectious Peritonitis Virus Main Protease in Complex with Synergetic Dual Inhibitors
pubmed doi rcsb
source organism Feline infectious peritonitis virus
total genus 84
structure length 300
sequence length 300
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5eu8A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5eu8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5eu8A01
1MKXH 2BVRH 3PTNA 4MG3A 3BG8A 1LQDB 1XVOA 1V2KT 1FUJA 1YBWA 3Q00A 1TGTA 1V2TT 5C5NA 1THPB 5LPFA 1PQ7A 5GJ4B 1MCTA 4E05H 1MZAA 3EAJA 1HJAC 3GYMA 1QRZA 1BMMH 2ZHWH 1YP9A 1V2ST 3Q77A 1ZPBA 3S9CA 1TX6A 1PPBH 1OPHB 1C1PA 2FIRH 1XVMA 1A4WH 3RU4E 1UVOA 1GJDB 1QRXA 1HAZB 2ZPRA 4ZKSU 3SUEA 1CU1A 2BX4A 4IGDA 4H6SB 2R2MB 4JZIA 3DFJA 3SU1A 4CH8B 3T5FH 2GX4A 4WXVA 3OTJE 2OP9A 1GBIA 3UOPA 4XDEA 1IQFA 1HXEH 1LHEH 3QGJA 3K6YA 4NIXA 4DCDA 2JH0D 1GI7B 2Z7FE 1C5LH 1A5GH 1TNKA 1GI2A 3I29A 5DGJA 7ESTE 3U69H 3ZZ3A 2ZECA 3BTME 4X1PU 1D9IA 2H1UA 4ISHH 3L3TA 2AMDA 5FBEA 1C9TA 1D3TB 3BEUA 1O2YA 1N6XA 1Q2WA 1Y3UA 3PO1B 3MH5A 1ABIH 2Z9IA 3O8DA 3VGCC 2BQ6B 4I33A 4NIVA 4D7FA 1LVBA 8KME2 1LDTT 1ARCA 4O97A 3FFGA 3DT0H 3BG4B 3ZVFA 5T6GA 1AHTH 2ZGHA 1DPOA 2F91A 1OKXA 4RKOB 1TOMH 2EI6A 1AQ7A 3PTBA 1MTNC 1O2LA 1KLIH 2BB4A 1WCZA 5K0HA 2OC7A 3TGJE 1TBQH 1A46H 4ABJA 2LIZA 4CHAB 1FY1A 4I8KA 3FZDA 3FAOA 2ZHFH 3SUDA 3RU4D 3LH1A 2THFB 1MBMA 1VGCC 2ESTE 3ZVEA 5TCCA 1NTPA 2Z6BD 2PKAA 1SLUB 1C5RA 2A7CA 1AI8H 1E36B 1P05A 3TJVA 5HYOA 2QYIA 1GBJA 2P16A 2BD8A 3TGIE 1XUHA 5T6FA 4BOHA 5GDSH 4TY6A 4CR9A 1LHGH 3SNCA 3QX5H 4MPXA 2O8WA 2WPKS 2VH6A 4ZHLU 1PPEE 2AMPA 1G30B 1P04A 1AZ8A 2NU0E 1W7XH 3GY8A 1BBRK 3C1KA 3A7YA 1N8OC 5BPEA 1UK4A 2VIVA 4NSYA 2Y81A 3BEFB 5DP9A 1XKBC 1K28D 4NIYA 2ZU5A 1O2GH 1YPHC 3ZZBA 3W95A 3M5NA 2ZGXH 4NZQA 1TFXA 2J2UA 1O39A 1G3DA 3KL6A 2NU3E 3KQCA 4OGXA 2CMYA 5H4IB 2BX3A 4BAMB 4PROA 1F7ZA 3M35A 1PPFE 3IWMA 2XTTB 2ZGCA 1GG6B 1K1NA 1O3CA 1TMBH 2ZQ1A 3FZZA 1DY8A 3M5MA 4FU7A 5A2MH 1HV7A 2FOHA 1FJSA 2HPQH 1FMGA 4CR5A 3M5LA 4B2AA 1NFYA 5JBTA 5G4BA 3AW1A 3KCGH 3V12A 2FMJA 4B1TA 1HAYB 4FUJA 1XMNB 2HNTF 1PQ5A 1TNGA 4Q7ZA 1A61H 2FS9A 2ZU3A 2V3HH 1C4U2 1XUJA 3RXIA 3F9EA 3CP7A 5DP6A 1DUEA 2OBOA 3A82A 1EPTC 1QGFA 1K1IA 1H9LB 1GPZA 1DITH 4CBOA 2XC5A 3GYLB 2ZZUH 1TPSA 1O3DA 3S7KB 3HKJB 3URDA 2ZPQA 3E90B 5DK1A 5E0JA 1QL8A 1WTGH 4HTCH 5F8ZA 4YESB 1PQ8A 4MNWA 1RTLA 4VGCC 1C1MA 1K1PA 2GDDA 2PKSB 2BDHA 2PFEA 4YT7H 2ZCHP 1F5RA 5ESBA 1TGCA 2H9HA 3A83A 1Q3XA 4K1EA 3MNSA 4O9VA 1ELVA 1UTLM 4UD9H 1KXBA 3MYWA 1O3OA 4JCNA 2CXVA 1GHAG 2D1JA 3MU5A 4ZHAA 2UUKB 1YCPK 1ZRKA 1C2LA 3Q3KA 3BN9A 2ZGJA 2TGDA 2BOKA 3MU8A 1ESAA 2ZHDA 3SJKA 4X1SU 2Q6DA 2XC4A 1ANEA 1GBFA 3UNRA 4K8BA 4MPUA 1CT4E 1O0DH 3K65B 1WAYB 3P17H 4UFGH 4JZDH 1TMTH 1ZMJA 3KQBA 5EQRA 4ABHA 4ABDA 4H6TA 2CJIA 1O5DH 1G9IE 2EC9H 1GHAF 2P59A 1UK2A 3BIVH 1GHWH 1UTKA 5LPEA 1O3AA 4NWLA 4DG4A 4UFEH 4Y7AA 4MNYA 1P10A 1MTUA 3F9FA 6CHAB 1OWIA 1P57B 5A8ZA 1Z6EA 1ANBA 2H6MA 4IMQA 2W3IA 5BRRE 5AFYH 2ZO3H 5I25A 1NU7B 1BB0B 2FO9A 2GMTB 1JXPA 1Z8RA 5FHTA 3ZV8A 3UR6A 1GBEA 3LKWA 3ZZAA 5T6DA 4X1QU 5A0AE 3CENA 5DKMA 3RXLA 3T25A 3H5CB 3SI3H 1QHRB 4Y79A 2HWLB 1GI0A 1K1OA 3ZZ4A 1QR3E 1MCVA 3RDZA 1W0ZU 3HGPA 3MI4A 1QY6A 1FNIA 2VWOA 1E0FD 4NWKA 3U1IB 5EW1H 1ELGA 3VB4A 1FPHH 2HGTH 3GICB 3HPTB 3SO3A 2J92A 2BLOA 3MMGA 2AGIX 3GDVA 1G2MA 4FU8A 1DOJA 4J2YB 3S9AA 4CRDA 1FY4A 2BY6X 3BSQA 3TK5A 3M3SA 1Y5UT 3P8OA 4CRCA 2ZWLH 1O3EA 1CBWC 2P95A 2AERH 1TA2A 1VCQA 3LOXA 1K2I1 1NT1A 1YPKH 3PM3A 4SGAE 3QWCH 2BY9X 3U9AH 2W3KA 1GJ6A 1SOZA 5AFZH 2C8WB 5E2OA 2PGBB 1BRCE 1F5LA 2K1QA 2G52A 3K2UA 4A5TS 1NRRH 2VWNA 1UVUH 2OLGA 3RM0H 2K7XA 3A85A 5CE1A 1KTSB 1TPAE 4CRBA 3PMBB 3SJ8A 1TAWA 5DP8A 3M7TA 1C5SA 5C2ZA 1DT2A 2PV9B 1S6HA 3L6PA 2OXSA 4ISIH 1OWJA 1AE5A 1EJMA 1T8NA 1K21H 2PUXB 1YF4A 4FUFA 4RSPA 4RN6A 4XE4A 1IQNA 4UONA 1DX5M 4K8YA 3JZ1B 2Q6FA 2M5TA 1A2CH 4JYUH 1P2OA 3UWIA 1FXYA 1QJ6B 4AGJA 1VJAU 1P0SH 1QQ4A 1RTFB 1TNHA 4TPYA 1O3PB 5FX6A 2LPRA 1Y3XA 1L0ZA 3GDSA 2Z9LA 3V13A 1J16A 1O2QA 2A5AA 1TNIA 2VGCC 1P2KA 4YTAA 4I31A 1F92A 3IG6B 3SU4A 3KNXA 1KYNA 2F3CE 2BZAA 1V2NT 1O2KA 2LNCA 3UY9A 3BTGE 2UWPA 3LPRA 1B5GH 4BANB 4Y8ZA 4FUBA 3T27A 3RXVA 3U98H 1UHBA 6ESTA 3E91A 3GCOA 1E35B 1MMJN 3MH4A 1NZQH 4Z0KA 3EBNA 5IYTA 3DD2H 5L6NH 4IC6A 1W10U 5JBBS 1N6YA 4KKDA 4KTCA 5AHGH 1T4UH 1MTVA 2JH5D 4Y7BA 8ESTE 1TALA 2BD2A 5ABWA 3A7WA 2PWXA 3T29A 1ZJDA 3TITA 2BY7X 3LONA 1YM0A 1RIWB 4K5ZA 2AIQA 1W13U 1JOUB 1XUIA 1P8VC 1D6RA 3SV8A 3SNDA 3E0NB 2WV4A 3QZQA 2ZFTA 1Z8GA 2BD9A 3ATKA 1P9SA 1MD8A 1AUTC 1SGNE 3E16B 1TA6A 4X2XA 2AH4X 4ESTE 1C2GA 3M7UA 3TPIZ 4DIHH 3F6UH 1KXDA 1BZXE 3RMOH 1DWBH 3L33A 4JYTA 1D3PB 1MTNB 2IOTA 1GMHG 2RA3A 1SC8U 2BYAX 1C1OA 1HFDA 4BTTB 1BQYA 1DICA 1O2SA 2C8ZB 1TBZH 3GCHB 3S69A 2FWWA 2H2ZA 1ANCA 3SU2A 2QCYA 3SW2B 1HAOH 1WUNH 3NWUA 5HGGA 1W14U 3EYDA 4K1TA 1O38A 3A87A 2GT7A 2SNVA 2GD4B 3TH2H 1SGFA 3KN2A 1GDUA 2BY5X 1GMHF 1HAVA 1NO9H 3MFJA 4OGYA 4B73A 2WPHS 2G81E 1DDJA 1KXEA 4XOJA 3UIRA 4BAQB 1V2QT 2VIPA 2OQ5A 1P2MA 4H42U 2ZDMA 2ZFPH 2Y7ZA 4BAHB 4YOIA 2ZPSA 4X2WA 1EJAA 3M5OA 3ZZ7A 3T26A 4ZH8A 3KQEA 4DIIH 1KLJH 2ZU4A 1UTNA 2D26C 3VFEA 1KY9A 3ATMA 2VH0A 4Q80A 1WSSH 2BVSH 1LPGB 1GHVH 1MUEB 1P03A 2BDBA 4JMYA 4WMFA 1CGJE 1SBWA 2FEQH 2A5KA 2ZI2H 3M37A 1T4VH 1QJ7B 2ZGBH 3U8TH 2QIQA 4Y76A 3QO6A 1OXGA 4NG9H 1YPLH 1UK3A 1EXFA 1S5SA 1SOTA 4CRGA 4WF8A 4ZUHA 3I77A 2NU4E 1TMUH 1F2SE 1K22H 4INHA 4A7IB 5CMXH 2WPLS 2Z3CA 1L4DA 2Y5HA 5JDUB 3QTVH 1HAVB 1MD7A 3BTEE 1TYNA 1F0SA 3RXGA 1OOKB 4DJZB 5DO4H 3VXFH 4BNRA 2STBE 1O3MA 1OYTH 3LGIA 1O33A 1KXFA 2FOFA 2HOBA 3MH6A 5JBAS 2BMGB 2HNTE 3V7TA 5JB9S 5K7RA 4VGCB 1GVZA 2SGEE 1DSUA 4ZXXH 4IBLH 3D65E 3STJA 2AFQB 3SU6A 5A8YA 3BTQE 3P95A 2R2WU 3SGQE 4BTIB 1CT0E 1O5GH 1TGNA 2OC0A 5DG6A 1O2TA 2IJOB 3MOCA 2CHAB 3T28A 4X6OA 4XFQA 3ATIA 6GCHG 1LPZB 1J9CH 2FPZA 3M61U 1SGFG 2RCEA 1UJ1A 3ELAH 1SI5H 2GVFA 1UO6A 1HDTH 4OS2A 1GBBA 4OS6A 1BMLA 3TJUA 2H5CA 1ELBA 2TRMA 1CHGA 1K1MA 4GHQA 3VB6A 1LKAA 5GWZA 3QN7A 3S7HB 3CS7A 2OCVB 2C3SA 1B7XB 2XBWA 3OSYA 1LHDH 3QTOH 2B5TB 6GCHF 2AGGX 3SV7A 3TH3H 1C5ZB 1J8AA 3MWIU 1P3EA 2I6QA 1Y59T 2GZ9A 1UTMA 1S0RA 1EB1H 1GMDG 3SOSA 4CREA 1VJ9U 4IMZA 2ZTYA 1IHTH 1UTPA 1VCWA 1KSNA 4HZHA 4ZKNU 1OS8A 3U1JB 4OS7A 2XXLA 3A8CA 4A6LA 2WV5A 3GY4A 1O3IA 1DWDH 1RTKA 5PTPA 4DGJA 2CF8H 8GCHF 4Q2KA 4YO9A 4JK5A 1THSH 2OC1A 1C2JA 2ZNKH 3RM2H 1TPOA 1BOQA 1GDNA 1GMDF 1G3BA 1QB6A 2NU1E 3KGPA 4MNXA 1O37A 4CH2B 1ARBA 1FLEE 2AEIH 4WJG2 3LU9B 4YM9A 3LT3A 1H9HE 1TIOA 1SHHB 3ZZ8A 3BTFE 5I46H 1C5WB 5SGAE 2Y5FA 1BRBE 1B0FA 2EA3A 4WMDA 1FIWA 2ZF0H 3LC3A 2QN5T 5DJ7A 2Z9GA 4J1YA 4IN2A 1AWFH 1QTFA 3RXJA 1EAWA 2FYQA 2OQUA 2FS8A 1VCPA 3RC4A 4DURA 4O03A 1MU8B 1QRWA 1W2KH 2Z9JA 4YOGA 1CBWB 1GCDA 1HNEE 2DE8A 3A84A 2V35A 2O8MA 1SLXB 4OS1A 4XSKU 4I8GA 1UCYH 4A92A 3P8FA 4KTSA 1OWKA 3U8OH 1PPGE 3IITA 3K6ZA 3LGUA 1EUFA 1CA0B 3TNSA 1RFNA 2A4QA 2R0LA 2Z94A 2B8OH 1BMNH 1HGTH 3D49H 1GI3A 4XBBA 1GBHA 2BDCA 3RXTA 4ABEA 4ABBA 4X6NA 3NXPA 2ZKSA 3MU1A 3RXDA 4B2BA 2VIWA 3HKIB 3SU0A 3GY3A 1QJ1B 1G32B 1X7AC 4Y8XA 2FOCA 7GCHF 1L1JA 3BTKE 2FLBH 4MDSA 1P2JA 2ZHQH 1P12E 3LJOA 3SUGA 2ZDLA 1P3CA 4DVAU 2BY8X 5T3HA 2BOHB 3VB5A 3UQOA 1EB2A 5EXNA 2GGVB 4WY3A 1P2IA 2HALA 2ZU1A 5E2PA 2D2DA 2W5EA 2A45B 2BQWB 4ZROA 2V6NA 4H4FA 1DUAA 1RRKA 4GSOA 3EA8A 1O3KA 4UFDH 4AGKA 1T31A 2AS9A 3S9BA 4BXWA 1GGDB 1SGCA 3NCLA 1C5TA 4JZFH 1XUGA 1UMAH 4INKA 2ZTZA 1EZXC 4FXGH 1VITH 2XW9A 4ZHMU 2ODYB 2JETC 1BTZA 1GCTC 1Z71A 1DLKB 3TIUA 1MTSA 1OP2A 5TCAA 2PLXA 3H7TA 3BEIB 1O2WA 1GI6A 1C5YB 2AMQA 2ZQ2A 2GTBA 1L1NA 1H8IH 2FI3E 5EPNA 2ZIQH 1NRPH 5C20A 1IQEA 5J4SA 1J14A 2FI5E 1O2IA 4ASHA 2BD5A 3H7OA 3A88A 3PMAB 1C5QA 5EQQA 1OWEA 2SNWA 1V2UT 1V2LT 4ZXYH 3BTTE 3E3TA 1W8BH 1IQHA 5C67A 1DLEA 3CS0A 1Z1JA 1MU6B 1DXWA 1AWHB 1GHBG 4KGAA 1GI5A 3TU7H 3DFLA 4INLA 4AG2A 1MAYA 1C2DA 3D62A 4HGCA 1LVMA 2UUYA 1XXDA 4D7GA 3LJJA 2BVXH 1P02A 3DUXH 1KIGH 2CF9H 1BTPA 1K1JA 1AFQC 3TJOA 1HAGE 3NPSA 2TIOA 5GIBA 3T2NA 4R8TB 1SLWB 3HK6B 1FY8E 2HVXA 3V3MA 3UREA 1UCYE 1AB9B 2O8UA 1TB6H 4WH8A 5A0BA 4LK4A 2ASUB 4JZ1A 2PSYA 4I8JA 2WINI 3VEQB 4E06H 1GHBF 1GVLA 3A89A 3RXPA 2ZDNA 2FDAA 4I8LA 1C5PA 1IQKA 1AKSA 1ETSH 1GL0E 2FOBA 2ZTXA 4XBCA 4ABAA 2AIPA 2G4UA 2C93B 3ITIA 4NA8A 1ETTH 1F0RA 2HNTC 3MO6A 2UUJB 4R0IA 2FP7B 1S6FA 1P01A 3UOUA 1ZHPA 4CRFA 4OS4A 1ZMLA 3PLKA 4CRAA 5B6OA 5FPTA 2B0FA 2ZFSA 4WMEA 3RLYH 1AN1E 1GJCB 3G01A 4ISNA 3RMNH 1TONA 1DSTA 2F9BH 2FZZA 3BIUH 5HM2A 3A7VA 4AYYB 2GP9B 3RXCA 1EAXA 1O30A 1SGEE 1CGIE 1SGDE 3SZNA 3UTUH 4X0WU 3RXRA 3B9FH 2GCHG 2QXHA 1MKXK 1QBOA 4DT7B 3UR9A 3JZ2B 1KLTA 1O5FH 3M3TA 4IN1A 3NK8A 1H9IE 4NZLA 3BV9B 1BHXB 1HPGA 4RKJB 4WWYA 1OSSA 3U8RH 1NC6A 1A0JA 1EASA 1SGRE 3QGNB 3UUZA 1C9PA 1AFEH 1C5UA 3A8AA 1ELDE 1GDQA 1MBQA 3O8CA 2UWLA 1AKSB 1GG6C 3GCNA 4LOYH 3Q3XA 1HXFH 2GCHF 1NRSH 3RXKA 2P3UB 4AX9H 4AZ2B 1YGCH 3STIA 3UWJH 4MLFB 2HRVA 2STAE 5FCKA 5J4QA 1QA7A 1GJ5H 4XBDA 3OY6U 2TGTA 4D9QA 1QL7A 4D9RA 2DUCA 2P8OC 1IQJA 3SV6A 4ZKOU 1HJAB 1O3LA 3EA9A 4Y71A 2G5NA 3UFAA 5FXLA 3B23B 1C4Y2 1ZGVA 3SJIA 1YPGH 2QXIA 1AUJA 2GT8A 3P70B 1PJPA 1ORFA 1INCA 1AGJA 1Z7KA 1P09A 1O35A 4FUEA 1HAHH 4O3UA 5E0HA 2PKSC 1ZTLA 2ANMH 4X6MA 1LHCH 4O3TA 1FI8A 2C4FH 1C2IA 1AVGH 1A0LA 2VJ1A 4Q7YA 2XWBI 1O2MA 1WBGB 2XYAA 1DFPA 1VZQH 4FUDA 2BD7A 4FUIA 1Y8TA 1ACBE 1FAXA 3M3VA 4MTBA 6LPRA 1T32A 1HAPH 1O2VA 2XCNA 3MO3A 1O2NA 3RXFA 3FVFB 1QCPA 2GZ7A 1YPHE 4NIWA 1AMHA 1C2MA 2OUAA 2YNAA 3ODDA 1GVKB 1WTHD 2OINA 3UPEA 2FX6A 1OWDA 3KEEA 4MVNA 1O5BB 1ABJH 4B2CA 2F9OA 3TVJB 2VWMA 3URCA 1C5OH 3ZVGA 3VGCB 1XKAC 4NCYA 1SGQE 1D4PB 1GBKA 1O5EH 1W12U 1YPMH 2VIOA 4MPVA 3SN8A 1EZUC 2P94A 1O34A 2QF0A 1NPMA 1Z1IA 1GHYH 1MKWH 4MNVA 2F9VA 1THRH 1V2PT 5JB8S 1K1LA 3AAVA 1NM6A 4B75A 3RXQA 4Y8YA 2Z9KA 1ZPCA 2R3YA 1FN6A 1YKTA 4BAKB 2GV7A 1O2JA 1O3FA 6CHAC 1RS0A 1J17T 2A7JA 3ATWA 1P9UA 3RXEA 3RP2A 1FONA 4TYDA 1FV9A 1TLDA 3A80A 1YC0A 2PTCE 1VGCB 4Q7XA 4TWYA 2JH6D 3LC5A 4NFEA 4AFZA 1BBRE 1A7SA 1WOFA 1GWAA 1LTOA 2UWOA 1O2RA 4LZ4B 4FUHA 2ZDVH 2HPPH 2FODA 2KAIB 3MNBA 1Y3WA 2SFAA 3OYPA 2J95A 1O32A 2A5IA 2ZDKA 1M9UA 2BD3A 2C90B 1UCYK 1PPHE 1DANH 2PSXA 4ISOA 1NRNH 1SHYA 1A3EH 1QL9A 1EPTA 2FESH 1P06A 1D3DB 5F8TA 1CT2E 4TY7A 5CHAC 1N8OB 2ZCLP 1D3QB 4SGBE 2BZ6H 4DOQA 4QT8C 4YZUA 4OS5A 1C1NA 3VB7A 3RMLH 1ZR0A 4IS5A 1SPJA 3GY5A 5F03A 5IDKA 5EG4A 5DP4A 1O3JA 4YLQH 3SJ9A 2SGQE 1NFUA 1G3EA 2NWNA 1SSXA 3FP7E 1A0HB 4GCHG 3RXSA 1C4V2 4CBNA 1GBCA 1EOJA 1GBMA 3PLPA 5AF9H 1GL1A 1G2LA 2JKHA 4A1TA 4E7NA 1FQ3A 1ELFA 1IQGA 4ABGA 4F4OC 1ZGIA 1TOCB 2GCTC 3GOVB 1PYTC 2WPIS 5JYIA 1GJ7B 4X6PA 2OBQA 5EQSA 1S82A 1HIAA 3ZYDA 2YNBA 1T8LA 1HB0B 1S0QA 1O2OA 1HUTH 1LHFH 1LPKB 3V0XA 4B74A 3BF6H 2QY0B 5EXLA 1C5MD 3E1XB 2FYRA 2FOAA 3PMHB 5EXMA 4GCHF 1NFXA 3MHWU 1CHOG 1GI4A 1SFIA 2Y7XA 5F6MA 5DP7A 1Q31A 1VR1H 3C27B 1F0TA 1HLTH 1AD8H 4X8VH 3RXHA 1GMCG 1EPTB 1SGPE 2PR3A 4YT6H 1UTQA 2FX4A 5A0CA 8LPRA 3ZVDA 1NU9A 4UFFH 1EKBB 1V6DA 1ZJKA 1XM1A 1KXCA 3RXAA 4Y0ZE 5L2YH 1C5VA 4X1NU 1YPJH 4X8TH 1H8DH 1QIXB 3TLOA 1TE0A 4MQAA 1CHOF 2J94A 5C3NA 5EOKA 2OTVA 4K69A 2WPMS 2SGAA 1V2MT 1H1BA 2TGPZ 1GJBB 3AVZA 4BXSA 3HGNA 1HYLA 1EP6A 1AZZA 3UQVA 1AVXA 1GMCF 1FIZA 3SI4H 2PW8H 5DP5A 2GZ8A 2WYJA 3EE0B 1ZHRA 3S0NA 3RXBA 4KELA 2YOLA 2FOMB 1ZTJA 2BQ7B 1HIAB 2JETB 1GCTB 4K1SA 1O31A 1PPCE 3MO9A 3ZZ5A 1NY22 1QB1A 4AB8A 2A4RA 3VB3A 1C2HA 1MQ5A 2A2XH 2F9PA 1QBVH 3UNSA 3PWBA 3OY5U 1AE8H 1P2QA 1LKBA 4K2YA 4K3JA 1SFQB 2AGEX 3PYHA 1C1VH 4LZ1H 1JBUH 1ZSLA 4A1XA 2H5DA 1GBLA 3ATLA 1HBTH 1ETRH 1E34B 2GV6A 2FOGA 1WV7H 1TNJA 4A1VA 4IC5A 1QNJA 1OP0A 5ETXA 8GCHG 3PMJA 1LO6A 1MTWA 1D6WA 3WY8A 3A7ZA 4FU9A 5L30H 3NUMA 3BTWE 2V3OH 5EW2H 3E6PH 1MQ6A 5EU8A 4LXBH 1XUKA 1RIWC 1O3GA 1TGSZ 3GDUA 1AIXH 1AFQB 3GY7A 3RC5A 2XC0A 1GHZA 2TPIZ 4AN7A 2FTLE 3DA9B 5DP3A 3Q76A 1TRMA 3SBKA 3QDZB 2F9NA 2FM2A 1SR5C 4D8NA 1ZYOA 1BA8B 4X8UH 2VINA 3MTYA 2IPHA 3EDXB 2NU2E 1IOEA 1TGBA 1ZRBA 2ULLA 2H9EH 5FX5A 1EAIA 4AG1A 3PB1E 2ILNA 1S85A 3R0FA 3PROA 1TRNA 1BTXA 1Y5BT 2RDLA 1O2PA 2BDYA 1KTTB 9LPRA 1RD3B 1KXAA 1AVWA 3GCHC 4BAOB 1GI1A 1RGQA 5GPIB 4TPIZ 1UVSH 1TQ0B 2CGAA 5C5OA 1WQSA 2VU8E 2XNIA 4ZAEA 3SQHE 3D23A 1FY3A 1QURH 2G5VA 1PPZA 1YPEH 4I32A 2P3TB 1O36A 3E8LA 4D76A 2CN0H 3F9GA 1MH0A 2J4IA 2C8XB 2VIDA 2ZDAH 3LH3A 3KIDU 2G55A 1IQLA 1Y3VA 3FP6E 3KHVA 3M36A 4IW4E 2R3UA 3EGKH 4B76A 5E8EH 2TBSA 3OU0A 3O8BA 7GCHG 3AW0A 3M7QA 3SNEA 3BTDE 1E38B 3P6ZB 2BLVA 1W0YH 3B8JA 1A1RA 4FVDA 2A7HA 1BTWA 1CQQA 1HJ9A 1BJVA 3TJNA 1O2HA 3AAUA 1UVTH 1ESBA 1QBNA 1DE7H 1NRQH 4AFUA 1OP8A 1S83A 2VVVA 1CVWH 1L4ZA 5FCRA 1TWXB 4Y10E 1ZLRA 3EQ0H 4FUGA 2BLQA 2Z3EA 3SORA 2FI4E 5FPYA 1BCUH 4I8HA 3TK6A 4ABFA 1BDAA 2PKAB 1CO7E 1JRTA 2VVCA 1UTOA 3O8RA 1DWCH 2HLCA 1TPPA 3ZVCA 3A86A 2BXUH 3TH4H 1V2JT 2P8OB 1ZHMA 2QV1A 3T62A 1ESTA 3VXEH 2BDGA 1AO5A 4Y6DA 1TQ7B 1LVYA 3ESTA 3SNAA 5LPRA 2VGCB 3A7TA 1EAUA 2VB0A 3TGKE 1E37B 3LGYA 1U6QA 3F9HA 1ZZZA 4GPGA 2G8TA 2R0KA 3SU5A 4NSVA 1GBDA 1DM4B 4X1RU 5JBCS 3GY2A 2ZFRH 1SQAA 2ODQA 3TK9A 1V2OT 4K60A 5C1UA 1C1WH 2VVUA 1ID5H 4U32A 1ZSKA 2BDAA 1SGIB 2CHAC 3SU3A 1QQUA 1RXPA 4GVUA 1BRUP 4I7YH 1PQAA 1H4WA 3PWCA 2QXGA 3RUOA 1MKWK 1UVPA 1C2FA 2A1DB 3BTHE 4U01A 2DE9A 5FPSA 2QXJA 2ZFQH 1FDPA 2P3FH 5EGMA 1OWHA 2ZHEH 3RLWH 3SHCH 2GKVE 1P2NA 3E0PB 4X8SH 2W7SA 4GAWA 3PO1C 1C1TA 2J34A 1O5AB 4Y11E 3GISB 1IHSH 3ENSB 1SB1H 2SGFE 1ZOMA 2XBVA 1SGYE 3BG4C 2D8WA 2PHBA 3SGAE 3SUFA 4KP0A 2ZCKP 1V2RT 4DY7B 1QA0A 1CSOE 3NKKA 1EOLA 1SVPA 4CHAC 1V2WT 5HXFA 1KDQA 4Y0YE 1ELAA 3ZZCA 5HM9A 2A31A 1MAXA 3N7OA 2ZG0H 4GUXA 5EPYA 2F9UA 2ZP0H 1SMFE 3P92A 4UEHH 2BHGA 3PLBA 4UDWH 3ZVBA 1GI9B 1T8OA 2ZA5A 1LMWB 2BDIA 1FN8A 5E0GA 3GCTG 1L1GA 1SQTA 1WYKA 2F83A 5GXPA 1HCGA 2R9PA 1G3CA 1BTYA 5LH8A 1G37A 2EI8A 1O5CB 1C2KA 1EQ9A 3F68H 5CHAB 4HFPB 1QB9A 1WQVH 2C8YB 1F0UA 5L2ZH 1PYTD 3LIWA 3SJOA 3P8NA 1LQEA 1GHXH 1A5IA 3ZYEA 2B7DH 1LVOA 7KMEH 1DY9A 1FY5A 1BJUA 1J15A 3TNTA 3GCTF 3F1SB 4E7RG 2OC8A 5C1XA 1NN6A 3RC6A 4AORA 2Q6GA 1XUFA 3NZIA 4U2WA 1CA8B 5JPMH 2VIQA 2GCTB 1O3BA 1CA0C 1EP5A 2XWAA 1BBRH 4ISLA 1KDQB 1YLCA 4JYVH 2EEKA 2ZU2A 1L2EA 3QUMP 3A7XA 4M7GA 3AASA 2ZEBA 1Z6JH 2H9TH 3HK3B 1GBAA 3LGVA 2G51A 1FPCH 1GBTA 2A4GA 3ZZDA 3QLPH 3MU0A 4JK6A 1S81A 1CE5A 1RJXB 4FVBA 2J38A 1O2UA 2FOEA 1DXPA 1SGTA 4UE7H 1JRSA 3Q3YA 1TBRH 1JIRA 1UTJA 2Y6TA 4X2YA 1IQMA 1Y5AT 1W3CA 3FANA 2A0QB 1TX8A 4B71A 2I6SA 3PV4A 1TRYA 3R3GB 5DPAA 1C5XB 4AFSA 1DWEH 1TX7A 2AYWA 1EX3A 3RU4T 2SGDE 2A4OA 3MNXA 2RA0A 3HATH 1HJ8A 2BM2A 2CV3A 3MNCA 4YLUA 2ALVA 1C1QA 2ANKH 2WYGA 3KF2A 2IN2A 1G36A 2FTMA 5TJXA 4GHTA 1V2VT 2Y5GA 1ZTKA 1GGDC 1BHXF 1C2EA 1ELCA 3FP8E 2TGAA 4X2VA 1O3NA 1BRAA 5A8XA 3W94A 4MPWA 2P93A 2QC2A 5EODA 2O9QA 3LGWA 1T8MA 3DHKH 3RXUA 2WUCA 2ANYA 2ZC9H 2KAIA 1C5NH 3K9XB 1BUIA 1GJ9B 1B0EA 2W26A 4ZKRU 2FLRH 3SV9A 4U30A 2VWLA 3LGTA 1CGHA 3A8DA 3ZZ9A 1BT7A 4ABIA 1Z8JB 1QFKH 1ZMNA 2ALPA 3RMMH 1MZDA 1HAIH 4NA9H 4WH6A 3QK1A 3ZZ6A 1GJ4H 2FXRA 2XCFA 1O3HA 2Z3DA 1C1RA 1WU1A 2XBYA 1ANDA 3KQDA 3EA7A 1O2ZA 4AB9A 1A3BH 1AU8A 1YCPH 2O8TA 2QAAA 1K9OE 2VNTA 1HAXB 2QGRA 1SQOA 2BLWA 2ANWA 1ELTA 5F8XA 5GCHG 1P11E 1AB9C 1JWTA 1NESE 3OX7U 3RXMA 1DS2E 2BD4A 1IAUA 3RXOA 1XXFA 2BTCE 2W7UA 4HI3A 1DVAH 4BTUB 2GMTC 4NA7A 4AOQA 1ZPZA 1LCYA 3ODFA 9ESTA 1C1SA 3UNQA 5HMAA 3SV2H 1VITG 4KTUA 3SNBA 4AFQA 4Z6AH 3LDXH 4NGAH 1TABE 2O8LA 5GCHF 3P8GA 2RG3A 1UHBB 2ZFFH 1ELEE 5FBIA 1BTHH 2BXTH 2Y82A 1FZZA 4ZMAH 1BITA 1W11U 2GDEH 1A5HA 4F49A 2WUBA 3I78A 5FAHA 3MH7A 3GY6A 1IQIA 2ODPA 1YCPM 2PGQB 3ZVAA 1C1UH 1GI8B 2PTNA 2Y80A 4TWWA 1T7CA 1W7GH 1BIOA 1AY6H 1EZSC 1NFWA 5AVDA 1VITF 1NROH 2UUFB 2OD3B 1S84A 2SGPE 3A8BA 1V3XA 1GJ8B 3SGBE 3ZV9A 1NS3A 1PFXC 1F5KU 2V0BA 1SL3A 2XBXA 5C1YA 1FAKH 1YYY1 1SG8B 3QZRA 4YOJA 1XX9A 3SHAH 3SQEE 1SLVB 4THNH 1BMAA 5ESTE 4FUCA 1EZQA 1OYQA 2EI7A 4NFFA 2G4TA 4AYVB 2WPJS 3VPKA 2G00A 2A32A 1BTUA 7LPRA 2J9NA 2B9LA 4WXIA 1TNLA 1N1LA 4JZEH 1Z8IB 1Y3YA 5LGOA 4GLYA 3A81A 2XRCA 2QF3A 4WVPE 1EATA 1ZSJA 2A2QH 2Q1JA 4DW2U 3MU4A 5A09A 1EJNA 1OX1A 1YLDA 1HRTH 2QA9E 1JMOH 1JIMA 2PUQH 1O2XA 1GJAB
chains in the Genus database with same CATH superfamily
1MKXH 2BVRH 3PTNA 4I86A 4MG3A 3BG8A 1LQDB 1XVOA 1V2KT 1FUJA 1YBWA 3Q00A 4ZCNA 1TGTA 1V2TT 5C5NA 1THPB 5LPFA 1PQ7A 2J5UA 5GJ4B 1MCTA 4E05H 1MZAA 3EAJA 3OFND 1HJAC 3GYMA 1QRZA 1BMMH 2ZHWH 1YP9A 1V2ST 3Q77A 1ZPBA 3S9CA 1TX6A 1PPBH 1OPHB 1C1PA 2FIRH 1XVMA 1A4WH 3RU4E 1UVOA 1GJDB 1QRXA 1HAZB 2ZPRA 4ZKSU 3SUEA 1CU1A 2BX4A 3GS9A 4IGDA 4H6SB 2R2MB 4JZIA 3DFJA 3SU1A 4CH8B 3T5FH 2GX4A 4WXVA 3OTJE 2OP9A 1GBIA 3UOPA 4XDEA 1IQFA 1HXEH 1LHEH 3QGJA 3K6YA 4NIXA 4DCDA 2JH0D 1GI7B 2Z7FE 1C5LH 1A5GH 1TNKA 1GI2A 3I29A 5DGJA 7ESTE 3U69H 5HIYA 3ZZ3A 2ZECA 3BTME 4X1PU 1D9IA 2H1UA 4ISHH 3L3TA 2AMDA 5FBEA 1C9TA 1D3TB 2KCYA 3BEUA 1O2YA 1N6XA 1Q2WA 1Y3UA 3PO1B 3MH5A 1ABIH 2Z9IA 3O8DA 3VGCC 2BQ6B 4I33A 4NIVA 4D7FA 1LVBA 8KME2 1LDTT 1ARCA 4O97A 3FFGA 3DT0H 3BG4B 3ZVFA 2IPQX 5T6GA 1AHTH 2ZGHA 1DPOA 3DSGA 2F91A 1OKXA 4RKOB 1TOMH 2EI6A 1AQ7A 3PTBA 1MTNC 1O2LA 1KLIH 2BB4A 1WCZA 5K0HA 2OC7A 3TGJE 1TBQH 1A46H 4ABJA 2LIZA 4CHAB 1FY1A 4I8KA 3FZDA 3FAOA 2ZHFH 3SUDA 3RU4D 3LH1A 2THFB 1MBMA 1VGCC 2ESTE 3WWBA 3ZVEA 5TCCA 1NTPA 2Z6BD 2PKAA 1SLUB 1C5RA 2A7CA 1AI8H 1E36B 1P05A 3TJVA 5HYOA 2QYIA 1GBJA 2P16A 2BD8A 3TGIE 1XUHA 5T6FA 4BOHA 5GDSH 4TY6A 4CR9A 1LHGH 3SNCA 3QX5H 4MPXA 2O8WA 2WPKS 2VH6A 4ZHLU 1PPEE 2AMPA 1G30B 1P04A 1AZ8A 2NU0E 1W7XH 3GY8A 1BBRK 3C1KA 3A7YA 2L6OA 1N8OC 5BPEA 1UK4A 2VIVA 4NSYA 2Y81A 3BEFB 5DP9A 1XKBC 1K28D 4NIYA 2ZU5A 1O2GH 1YPHC 3ZZBA 3W95A 3M5NA 2ZGXH 4NZQA 1TFXA 2J2UA 1O39A 1G3DA 3KL6A 2NU3E 3KQCA 4OGXA 2CMYA 5H4IB 2BX3A 4BAMB 4PROA 1F7ZA 3M35A 5KGOA 1PPFE 3IWMA 2XTTB 1MABB 2ZGCA 1GG6B 1K1NA 1O3CA 1TMBH 2ZQ1A 3FZZA 1DY8A 3M5MA 4FU7A 5A2MH 1HV7A 2FOHA 1FJSA 2HPQH 1FMGA 4CR5A 2OK5A 3M5LA 4B2AA 1NFYA 5JBTA 5G4BA 3AW1A 3KCGH 3V12A 2FMJA 4B1TA 4B6EA 1HAYB 4FUJA 1XMNB 2HNTF 1PQ5A 1TNGA 4Q7ZA 3FKSD 1A61H 2FS9A 5T1VA 2ZU3A 2V3HH 1C4U2 1XUJA 3RXIA 3F9EA 2CK3D 3CP7A 5DP6A 1DUEA 2OBOA 3A82A 1EPTC 1QGFA 1K1IA 1H9LB 1GPZA 1DITH 4CBOA 2XC5A 3GYLB 2ZZUH 1TPSA 1O3DA 3S7KB 3KYFA 3HKJB 3URDA 2ZPQA 3E90B 5DK1A 5E0JA 1QL8A 1WTGH 4HTCH 5F8ZA 4YESB 1PQ8A 4MNWA 1RTLA 4VGCC 1C1MA 1K1PA 2GDDA 2PKSB 2BDHA 2PFEA 4YT7H 2ZCHP 1F5RA 5ESBA 1TGCA 2H9HA 3A83A 1Q3XA 4K1EA 3MNSA 4O9VA 1ELVA 1UTLM 4UD9H 4ASUD 1KXBA 3MYWA 1O3OA 4JCNA 2CXVA 1GHAG 2D1JA 3MU5A 4ZHAA 2UUKB 1YCPK 1ZRKA 1C2LA 3Q3KA 2HLDD 2ZGJA 2TGDA 2BOKA 3BN9A 3MU8A 1ESAA 2ZHDA 3SJKA 4X1SU 2Q6DA 2XC4A 1ANEA 1GBFA 3UNRA 4K8BA 4MPUA 1CT4E 1O0DH 3K65B 1WAYB 2J98A 3P17H 4UFGH 4JZDH 1TMTH 1ZMJA 3KQBA 5EQRA 4ABHA 4ABDA 4H6TA 2CJIA 1O5DH 1G9IE 2EC9H 1GHAF 2P59A 1UK2A 3BIVH 1GHWH 1UTKA 5LPEA 1O3AA 4NWLA 4DG4A 4UFEH 4Y7AA 4MNYA 1P10A 1MTUA 3F9FA 6CHAB 5B6LA 1OWIA 1P57B 5A8ZA 2QF4A 1Z6EA 1ANBA 2H6MA 4IMQA 2W3IA 5BRRE 5AFYH 2ZO3H 5I25A 1NU7B 1BB0B 2FO9A 2GMTB 4P02A 1JXPA 1Z8RA 5FHTA 3ZV8A 3UR6A 1GBEA 3LKWA 3ZZAA 5T6DA 4X1QU 5A0AE 3CENA 5DKMA 3RXLA 3T25A 3H5CB 3SI3H 1QHRB 4Y79A 2HWLB 1GI0A 1K1OA 3ZZ4A 1WXRA 1QR3E 1MCVA 3RDZA 1W0ZU 3HGPA 3MI4A 4DT4A 1QY6A 1FNIA 2VWOA 1E0FD 2V3MA 4NWKA 3U1IB 5EW1H 1ELGA 3VB4A 1FPHH 2HGTH 2J98B 3GICB 3HPTB 3SO3A 2J92A 2BLOA 3MMGA 2AGIX 3GDVA 1G2MA 4FU8A 1DOJA 4M9FA 4J2YB 3S9AA 4CRDA 1FY4A 2BY6X 3BSQA 3TK5A 3M3SA 1Y5UT 3P8OA 4CRCA 2ZWLH 2GJGA 1O3EA 1CBWC 2P95A 2AERH 1TA2A 1VCQA 3LOXA 1K2I1 1NT1A 1YPKH 3PM3A 4SGAE 3QWCH 2BY9X 3U9AH 2W3KA 1GJ6A 1SOZA 5AFZH 2C8WB 5E2OA 1UW7A 2PGBB 1BRCE 1F5LA 2K1QA 2G52A 3K2UA 1E1RD 4A5TS 1NRRH 2KX4A 2VWNA 1UVUH 2OLGA 3RM0H 2K7XA 3A85A 5CE1A 1KTSB 1TPAE 4CRBA 3PMBB 3SJ8A 1TAWA 5DP8A 3M7TA 5CHBA 1C5SA 5C2ZA 1DT2A 2PV9B 1S6HA 2L74A 3L6PA 2OXSA 4ISIH 1OWJA 1AE5A 1EJMA 1T8NA 1K21H 2PUXB 1YF4A 4FUFA 4RSPA 4RN6A 5EJLA 4XE4A 1IQNA 3W1EA 4UONA 1DX5M 4K8YA 3JZ1B 2Q6FA 2F43B 2M5TA 1A2CH 4JYUH 1P2OA 3UWIA 1FXYA 1QJ6B 4AGJA 2WHXA 1VJAU 1P0SH 1QQ4A 1RTFB 1TNHA 4TPYA 1O3PB 5FX6A 2LPRA 1Y3XA 1L0ZA 3GDSA 2Z9LA 3V13A 1J16A 1O2QA 2KFWA 2A5AA 1TNIA 2VGCC 1P2KA 4YTAA 4I31A 1F92A 3IG6B 3SU4A 3KNXA 1KYNA 2F3CE 2BZAA 1V2NT 1O2KA 2LNCA 3UY9A 2KCPA 3BTGE 2KZ4A 2UWPA 3LPRA 1B5GH 3WW7A 4BANB 4Y8ZA 4FUBA 3T27A 3RXVA 3U98H 1UHBA 6ESTA 3E91A 3GCOA 1E35B 1MMJN 3MH4A 1NZQH 4Z0KA 3EBNA 5IYTA 3DD2H 5L6NH 4IC6A 1W10U 5JBBS 2WPDD 1N6YA 4KKDA 4KTCA 5AHGH 1T4UH 1MTVA 1W0KD 2JH5D 4Y7BA 8ESTE 1TALA 2BD2A 5ABWA 3A7WA 2PWXA 3T29A 1ZJDA 3TITA 2BY7X 3LONA 1YM0A 1RIWB 4K5ZA 2AIQA 1W13U 1JOUB 1XUIA 1P8VC 1D6RA 3SV8A 3SNDA 3E0NB 2WV4A 3QZQA 2ZFTA 1Z8GA 2BD9A 3ATKA 1P9SA 1MD8A 1AUTC 1SGNE 3E16B 1TA6A 4X2XA 2AH4X 4ESTE 1C2GA 3M7UA 3TPIZ 4DIHH 3F6UH 1KXDA 1BZXE 3RMOH 1DWBH 3L33A 4JYTA 1D3PB 1MTNB 1E1QD 2IOTA 1GMHG 2RA3A 1SC8U 2BYAX 1C1OA 1HFDA 4BTTB 1BQYA 1DICA 1O2SA 2C8ZB 4OM9A 1TBZH 3GCHB 2LELA 3S69A 2FWWA 2H2ZA 1ANCA 3SU2A 2QCYA 3SW2B 1HAOH 1WUNH 3NWUA 5HGGA 1W14U 3EYDA 4K1TA 1O38A 3A87A 2GT7A 2SNVA 2GD4B 3TH2H 1SGFA 3KN2A 1GDUA 2BY5X 1GMHF 1HAVA 1NO9H 3MFJA 4OGYA 4B73A 2WPHS 2G81E 1DDJA 1KXEA 4XOJA 3UIRA 4BAQB 1V2QT 2VIPA 2OQ5A 1P2MA 4H42U 2ZDMA 2ZFPH 2Y7ZA 4BAHB 4YOIA 2ZPSA 4X2WA 1EJAA 3M5OA 3ZZ7A 5IK2D 3T26A 4ZH8A 3KQEA 4DIIH 1KLJH 2ZU4A 1WDIA 1UTNA 2D26C 3VFEA 1KY9A 3ATMA 2VH0A 4Q80A 1WSSH 2BVSH 1LPGB 1GHVH 1MUEB 2YMSD 1P03A 2BDBA 4JMYA 4WMFA 1CGJE 1SBWA 2FEQH 2A5KA 2ZI2H 3M37A 1T4VH 4YXWD 1QJ7B 2ZGBH 3U8TH 2QIQA 1QZ8A 4Y76A 3QO6A 1OXGA 4NG9H 1YPLH 1UK3A 1EXFA 3SZEA 1S5SA 1SOTA 4CRGA 4WF8A 4ZUHA 3I77A 2NU4E 3OAAD 1TMUH 1F2SE 1K22H 4INHA 4A7IB 5CMXH 2WPLS 2Z3CA 1L4DA 2Y5HA 1S6LA 5JDUB 3QTVH 1HAVB 1MD7A 4ACBA 3BTEE 1TYNA 1F0SA 4HG6A 3RXGA 1OOKB 4DJZB 5DO4H 3VXFH 4BNRA 2STBE 1O3MA 1OYTH 2XOKD 3LGIA 1O33A 1KXFA 2FOFA 2HOBA 3MH6A 5JBAS 2BMGB 4XRNA 2HNTE 3V7TA 5JB9S 5K7RA 4VGCB 1GVZA 2SGEE 1DSUA 4ZXXH 4IBLH 3D65E 3STJA 2AFQB 3SU6A 5A8YA 3BTQE 3P95A 2R2WU 3SGQE 2J97A 4BTIB 1CT0E 1O5GH 4AC9A 1NBME 1TGNA 2OC0A 3DSPA 5DG6A 1O2TA 2IJOB 3MOCA 2CHAB 3T28A 4X6OA 4XFQA 3ATIA 6GCHG 1LPZB 1J9CH 2FPZA 3M61U 1SGFG 2RCEA 5C94A 1UJ1A 3ELAH 3UAIC 1SI5H 2GVFA 1UO6A 1HDTH 4OS2A 1GBBA 4OS6A 1BMLA 3TJUA 2H5CA 1ELBA 2TRMA 1CHGA 1K1MA 4GHQA 2RFKC 3VB6A 1LKAA 5GWZA 3QN7A 4RT0A 3S7HB 3CS7A 2EY4C 2OCVB 2C3SA 1B7XB 2XBWA 3DCLA 3OSYA 1LHDH 3QTOH 2B5TB 6GCHF 2AGGX 3SV7A 3TH3H 1C5ZB 1J8AA 3MWIU 1P3EA 2I6QA 1Y59T 2GZ9A 2KCOA 1UTMA 1S0RA 1EB1H 1GMDG 2QF5A 3SOSA 4CREA 1VJ9U 4IMZA 2ZTYA 1IHTH 1UTPA 1VCWA 1KSNA 4HZHA 4ZKNU 1OS8A 3N7DA 3U1JB 4OS7A 2XXLA 3A8CA 4A6LA 2WV5A 3GY4A 1O3IA 1DWDH 1RTKA 5PTPA 4DGJA 2CF8H 8GCHF 4Q2KA 4YO9A 4JK5A 1THSH 2OC1A 1C2JA 2ZNKH 3RM2H 1TPOA 1BOQA 1GDNA 1GMDF 1G3BA 1QB6A 2NU1E 3KGPA 4MNXA 1O37A 4CH2B 1ARBA 1FLEE 2AEIH 4WJG2 3LU9B 4YM9A 1NBMD 1H9HE 3LT3A 1TIOA 1SHHB 3ZZ8A 3BTFE 5I46H 1C5WB 5SGAE 2Y5FA 1BRBE 1B0FA 2EA3A 4WMDA 1FIWA 2ZF0H 3LC3A 2QN5T 5DJ7A 2Z9GA 4J1YA 4IN2A 1AWFH 1QTFA 4TSFD 3RXJA 1EAWA 2FYQA 2KCAA 2OQUA 2FS8A 1VCPA 3RC4A 4DURA 4O03A 1MU8B 1QRWA 1W2KH 2Z9JA 4YOGA 1CBWB 1GCDA 1HNEE 2DE8A 3A84A 2V35A 3WWFA 2O8MA 1SLXB 4OS1A 4XSKU 4I8GA 1UCYH 4A92A 3P8FA 4KTSA 1OWKA 3U8OH 1PPGE 3IITA 3K6ZA 3LGUA 1EUFA 1CA0B 3TNSA 1RFNA 2A4QA 2R0LA 2Z94A 2B8OH 1BMNH 1HGTH 3D49H 1GI3A 4XBBA 1GBHA 2BDCA 3RXTA 4ABEA 4ABBA 4X6NA 3NXPA 2ZKSA 3MU1A 3RXDA 4B2BA 2VIWA 3HKIB 3SU0A 3GY3A 1QJ1B 1G32B 1X7AC 4FETA 2FOCA 4Y8XA 2YMSC 7GCHF 1L1JA 2V7QD 3BTKE 2FLBH 4MDSA 1P2JA 2ZHQH 1P12E 3LJOA 3MQKC 3SUGA 2ZDLA 1P3CA 4DVAU 2BY8X 5T3HA 2BOHB 3VB5A 3UQOA 1EB2A 5EXNA 2GGVB 4WY3A 1P2IA 2HALA 2ZU1A 5E2PA 2D2DA 2W5EA 2A45B 2BQWB 4ZROA 2V6NA 3NRLA 4H4FA 1DUAA 1RRKA 4GSOA 3EA8A 1O3KA 4UFDH 4AGKA 1T31A 2AS9A 3S9BA 4BXWA 1GGDB 1SGCA 3NCLA 1C5TA 5C0TA 4JZFH 1XUGA 1UMAH 4INKA 2ZTZA 1EZXC 4FXGH 1VITH 2XW9A 4ZHMU 2ODYB 2JETC 1BTZA 1GCTC 1Z71A 1DLKB 3TIUA 1MTSA 4RT1A 1OP2A 3F3BA 5TCAA 2PLXA 3H7TA 3BEIB 1O2WA 1GI6A 1C5YB 2AMQA 2ZQ2A 2GTBA 1L1NA 1H8IH 2FI3E 5EPNA 2ZIQH 1NRPH 5C20A 1IQEA 5J4SA 1J14A 2FI5E 1O2IA 4ASHA 2BD5A 3H7OA 3A88A 3PMAB 1C5QA 5EQQA 1OWEA 2SNWA 1V2UT 1V2LT 4ZXYH 3BTTE 3E3TA 1W8BH 1IQHA 5C67A 1DLEA 3CS0A 1Z1JA 1MU6B 1DXWA 1AWHB 1GHBG 4KGAA 1GI5A 3TU7H 3DFLA 4INLA 4AG2A 3UB0A 1MAYA 1C2DA 3D62A 4HGCA 1LVMA 2UUYA 1XXDA 4D7GA 3LJJA 2BVXH 1P02A 3DUXH 1KIGH 2CF9H 1BTPA 1K1JA 1AFQC 4Q4LA 1HAGE 3NPSA 3TJOA 2TIOA 5GIBA 3T2NA 4R8TB 1SLWB 3HK6B 1FY8E 2HVXA 5FL7D 3V3MA 3UREA 1UCYE 1AB9B 2O8UA 1TB6H 4WH8A 5A0BA 4LK4A 2ASUB 4JZ1A 2PSYA 4I8JA 2WINI 3VEQB 4E06H 1GHBF 1GVLA 3A89A 3RXPA 2ZDNA 2FDAA 4I8LA 1BMFD 1C5PA 1IQKA 1AKSA 1ETSH 1GL0E 2FOBA 2ZTXA 4XBCA 4ABAA 2AIPA 2G4UA 2C93B 3ITIA 4NA8A 1ETTH 1F0RA 2HNTC 3MO6A 2UUJB 4R0IA 2FP7B 1S6FA 4TT3D 1P01A 3UOUA 1ZHPA 4CRFA 4OS4A 1ZMLA 3ZIAD 3PLKA 4RI0A 4CRAA 5B6OA 5FPTA 2B0FA 2ZFSA 4WMEA 3RLYH 1AN1E 1GJCB 3G01A 4ISNA 1SQRA 3RMNH 1TONA 1DSTA 2F9BH 2FZZA 3BIUH 5HM2A 3A7VA 4AYYB 2GP9B 3F2FA 1EAXA 1O30A 3RXCA 1SGEE 1CGIE 1SGDE 3SZNA 3UTUH 4X0WU 3OEHD 3RXRA 3B9FH 2GCHG 2QXHA 1MKXK 1QBOA 4DT7B 3UR9A 3JZ2B 1KLTA 1O5FH 3M3TA 4IN1A 3NK8A 1H9IE 4NZLA 3BV9B 1BHXB 1HPGA 4RKJB 4WWYA 1OSSA 3U8RH 1NC6A 1A0JA 1EASA 1SGRE 3QGNB 3UUZA 1C9PA 1AFEH 1C5UA 2IJD1 3A8AA 1ELDE 1GDQA 1MBQA 3O8CA 2UWLA 1AKSB 1GG6C 3GCNA 4LOYH 3Q3XA 1HXFH 2GCHF 1NRSH 3RXKA 2P3UB 4AX9H 4AZ2B 1YGCH 3STIA 3UWJH 4MLFB 2HRVA 2STAE 5FCKA 5J4QA 1QA7A 1GJ5H 4XBDA 3OY6U 2TGTA 4D9QA 1QL7A 4D9RA 2DUCA 2P8OC 5DN6D 1IQJA 3SV6A 4ZKOU 1HJAB 1O3LA 3EA9A 4Y71A 2G5NA 3UFAA 5FXLA 3B23B 1C4Y2 1ZGVA 3SJIA 1YPGH 2QXIA 1AUJA 2GT8A 3P70B 1PJPA 1ORFA 1INCA 1AGJA 1Z7KA 1P09A 1O35A 4FUEA 1HAHH 4O3UA 5E0HA 2PKSC 1ZTLA 2ANMH 4X6MA 1LHCH 4O3TA 1FI8A 2C4FH 3FOAA 1C2IA 1AVGH 1A0LA 2VJ1A 4Q7YA 2XWBI 1O2MA 1WBGB 2XYAA 1DFPA 1VZQH 4FUDA 2BD7A 4FUIA 1Y8TA 1ACBE 1FAXA 4Z1MD 3M3VA 4MTBA 6LPRA 1T32A 2JDID 1HAPH 1O2VA 2XCNA 3MO3A 1O2NA 3RXFA 3FVFB 1QCPA 2GZ7A 1YPHE 4NIWA 1AMHA 1C2MA 1OHHD 2OUAA 2YNAA 3ODDA 1GVKB 1WTHD 2OINA 3UPEA 2FX6A 1OWDA 3KEEA 4MVNA 1O5BB 1ABJH 4B2CA 2F9OA 3TVJB 2VWMA 3URCA 1C5OH 3ZVGA 3VGCB 1XKAC 4NCYA 1SGQE 1D4PB 1GBKA 1O5EH 1W12U 1YPMH 2VIOA 4MPVA 3SN8A 1EZUC 2P94A 1O34A 2QF0A 1NPMA 1Z1IA 1GHYH 1MKWH 4MNVA 2F9VA 1THRH 1V2PT 5JB8S 1K1LA 3AAVA 3FO8D 1NM6A 4B75A 3RXQA 4Y8YA 2Z9KA 1ZPCA 2R3YA 1FN6A 1YKTA 4BAKB 2GV7A 1O2JA 1O3FA 6CHAC 1RS0A 1J17T 2A7JA 3ATWA 1P9UA 3RXEA 3RP2A 1FONA 4TYDA 1FV9A 1TLDA 3A80A 1YC0A 2PTCE 1VGCB 4Q7XA 3OEED 4TWYA 2JH6D 3LC5A 4NFEA 4AFZA 1BBRE 1A7SA 1WOFA 1GWAA 1LTOA 2UWOA 1O2RA 4LZ4B 4FUHA 2ZDVH 2HPPH 2FODA 2KAIB 3MNBA 3SYJA 1Y3WA 2SFAA 3OYPA 2J95A 1O32A 2A5IA 2ZDKA 1M9UA 2BD3A 2C90B 1UCYK 1PPHE 1DANH 2PSXA 4ISOA 1NRNH 1SHYA 1A3EH 1QL9A 1EPTA 2FESH 1P06A 1D3DB 5F8TA 1CT2E 4TY7A 5CHAC 1N8OB 2ZCLP 1D3QB 3F0PA 4SGBE 2BZ6H 4DOQA 4QT8C 4YZUA 4OS5A 1C1NA 3VB7A 3RMLH 1ZR0A 4IS5A 1SPJA 3GY5A 5F03A 5IDKA 5EG4A 5DP4A 1O3JA 4YLQH 3SJ9A 2SGQE 1NFUA 1G3EA 2NWNA 1SSXA 3FP7E 1A0HB 4GCHG 3RXSA 1C4V2 4CBNA 1GBCA 1EOJA 1GBMA 3PLPA 5AF9H 1GL1A 1G2LA 2JKHA 4A1TA 4E7NA 4ACAA 1FQ3A 1ELFA 1IQGA 4ABGA 4F4OC 1ZGIA 1TOCB 2GCTC 3GOVB 1PYTC 2WPIS 5JYIA 1E79D 1GJ7B 4X6PA 2OBQA 5EQSA 1S82A 1HIAA 3ZYDA 2YNBA 1T8LA 1HB0B 1S0QA 1O2OA 1HUTH 1LHFH 1LPKB 3V0XA 4B74A 3BF6H 2QY0B 5EXLA 1C5MD 3E1XB 2FYRA 2FOAA 3PMHB 5EXMA 4GCHF 1NFXA 3MHWU 1CHOG 1COWD 1GI4A 1SFIA 2Y7XA 5F6MA 5DP7A 1K0HA 1Q31A 1VR1H 2AHME 3C27B 2YMSB 1F0TA 1HLTH 1AD8H 4X8VH 2JJ1D 3RXHA 1GMCG 1EPTB 1SGPE 2PR3A 4YT6H 1UTQA 2FX4A 5A0CA 8LPRA 3ZVDA 1NU9A 1YY3A 4UFFH 1EKBB 1V6DA 1ZJKA 1XM1A 1KXCA 3RXAA 4Y0ZE 5L2YH 2K8IA 1C5VA 4X1NU 1YPJH 4X8TH 1H8DH 1QIXB 3TLOA 1TE0A 4MQAA 1CHOF 2WZQA 2J94A 5C3NA 5EOKA 2OTVA 4K69A 2WPMS 2SGAA 1V2MT 1H1BA 2TGPZ 1GJBB 3AVZA 4BXSA 3HGNA 1HYLA 1EP6A 1AZZA 3UQVA 1AVXA 1GMCF 1FIZA 3SI4H 2PW8H 5DP5A 2GZ8A 2WYJA 3EE0B 1ZHRA 3S0NA 3RXBA 4KELA 2YOLA 2FOMB 1ZTJA 2BQ7B 1HIAB 2JETB 1GCTB 4K1SA 1O31A 1PPCE 3MO9A 2W6ID 3OTPA 3ZZ5A 1NY22 1QB1A 5C0UA 4AB8A 2A4RA 3VB3A 1C2HA 1MQ5A 2A2XH 3OE7D 2F9PA 1QBVH 3UNSA 3PWBA 3OY5U 1AE8H 1P2QA 1LKBA 4K2YA 4K3JA 1SFQB 2AGEX 3PYHA 1C1VH 4LZ1H 1JBUH 1ZSLA 4A1XA 2H5DA 1GBLA 3ATLA 1HBTH 1ETRH 1E34B 2GV6A 2FOGA 1WV7H 1TNJA 4A1VA 4IC5A 1QNJA 1OP0A 5ETXA 8GCHG 3PMJA 1EFRD 1LO6A 2QE7D 1MTWA 5HKKD 1D6WA 3KQ5A 3A7ZA 4FU9A 3WY8A 3NUMA 5L30H 3BTWE 2V3OH 5EW2H 3E6PH 1MQ6A 5EU8A 2VBCA 4LXBH 1XUKA 1RIWC 1O3GA 1TGSZ 3GDUA 5GNDA 1AIXH 1AFQB 3GY7A 3RC5A 2XC0A 1GHZA 2TPIZ 1YWUA 4AN7A 2FTLE 2JJ2D 3DA9B 5DP3A 3Q76A 1TRMA 3SBKA 3QDZB 2F9NA 2FM2A 1SR5C 4D8NA 1ZYOA 1BA8B 4X8UH 2VINA 3MTYA 2IPHA 3EDXB 3H09A 2NU2E 1IOEA 1TGBA 1ZRBA 2ULLA 2H9EH 5FX5A 1EAIA 4AG1A 3PB1E 2ILNA 1S85A 3R0FA 3PROA 1TRNA 1BTXA 1Y5BT 2RDLA 2WV9A 3F2GA 1O2PA 2BDYA 1KTTB 9LPRA 1RD3B 1KXAA 1AVWA 3GCHC 4BAOB 1GI1A 1RGQA 5EJ1A 5GPIB 4TPIZ 1UVSH 1TQ0B 2CGAA 5C5OA 1WQSA 2VU8E 2XNIA 4ZAEA 3SQHE 3D23A 1FY3A 1QURH 3PV2A 2G5VA 1PPZA 1YPEH 2PP6A 4I32A 2P3TB 1O36A 3E8LA 4D76A 2CN0H 3F9GA 1MH0A 2J4IA 2C8XB 2VIDA 2ZDAH 3LH3A 3KIDU 2G55A 1IQLA 1Y3VA 3CNRA 3FP6E 3KHVA 3M36A 4IW4E 5EJZA 2R3UA 3EGKH 4B76A 5E8EH 2TBSA 3KYGA 3OU0A 2EQNA 3O8BA 7GCHG 3N7EA 3AW0A 3M7QA 3SNEA 3BTDE 1E38B 3P6ZB 2BLVA 1W0YH 3B8JA 1A1RA 4FVDA 2A7HA 1BTWA 1CQQA 1HJ9A 1BJVA 3TJNA 1O2HA 3AAUA 1UVTH 1ESBA 1QBNA 1DE7H 1NRQH 4AFUA 1OP8A 1S83A 2VVVA 1CVWH 1L4ZA 5FCRA 1TWXB 4Y10E 1ZLRA 3EQ0H 4FUGA 5C17A 2BLQA 2Z3EA 3SORA 2FI4E 5FPYA 1BCUH 4I8HA 3TK6A 4ABFA 1BDAA 2PKAB 1CO7E 1JRTA 2VVCA 1UTOA 3O8RA 1DWCH 2HLCA 1TPPA 3ZVCA 3A86A 2BXUH 3TH4H 1V2JT 2P8OB 1ZHMA 2QV1A 3T62A 2K0QA 1ESTA 3VXEH 2BDGA 1AO5A 4Y6DA 1TQ7B 1LVYA 3ESTA 3SNAA 3PRBA 5LPRA 2VGCB 3A7TA 1EAUA 2VB0A 3TGKE 1E37B 3LGYA 1U6QA 3F9HA 1ZZZA 4GPGA 2G8TA 2R0KA 3SU5A 4NSVA 1GBDA 1DM4B 4X1RU 5JBCS 3GY2A 2ZFRH 1SQAA 2ODQA 3TK9A 1V2OT 4K60A 5C1UA 1C1WH 4P00A 2VVUA 1ID5H 4U32A 3F0OA 1ZSKA 2BDAA 1SGIB 2CHAC 3SU3A 1QQUA 1RXPA 4GVUA 1BRUP 4I7YH 1PQAA 5KEDA 1H4WA 3PWCA 2QXGA 3RUOA 1MKWK 1UVPA 1C2FA 2A1DB 3BTHE 4U01A 4F48B 4B6FA 2DE9A 5FPSA 2QXJA 2ZFQH 1FDPA 2P3FH 5EGMA 1OWHA 2ZHEH 3RLWH 3SHCH 2GKVE 2LP6A 3N99A 1P2NA 3E0PB 3EE7A 4X8SH 2W7SA 4F55A 4GAWA 3PO1C 1C1TA 2J34A 1O5AB 2RDEA 4Y11E 3GISB 4Q63A 5CDFE 1IHSH 3ENSB 1SB1H 2SGFE 1ZOMA 2XBVA 1SGYE 3BG4C 2D8WA 2PHBA 3SGAE 3SUFA 4KP0A 5EIYA 2ZCKP 1V2RT 4DY7B 1QA0A 1CSOE 3NKKA 1EOLA 1SVPA 4CHAC 1V2WT 5HXFA 1KDQA 4Y0YE 1ELAA 3ZZCA 5HM9A 2A31A 1MAXA 3N7OA 2ZG0H 4GUXA 5EPYA 2F9UA 2ZP0H 1SMFE 3P92A 3PRDA 4UEHH 2BHGA 3PLBA 3DSOA 4UDWH 3ZVBA 1GI9B 1T8OA 2ZA5A 1LMWB 2BDIA 1FN8A 5E0GA 3GCTG 1L1GA 1SQTA 1WYKA 2F83A 5GXPA 1HCGA 2R9PA 1G3CA 1BTYA 5KECA 5LH8A 1G37A 2EI8A 1O5CB 1C2KA 1EQ9A 3F68H 5CHAB 4HFPB 1QB9A 1WQVH 2C8YB 1F0UA 5L2ZH 1PYTD 3LIWA 3SJOA 3P8NA 1LQEA 1GHXH 2HVYB 1A5IA 3ZYEA 2B7DH 2M2AA 1LVOA 7KMEH 1DY9A 1KMHB 1FY5A 2WSSD 1BJUA 1J15A 3TNTA 3GCTF 3F1SB 4E7RG 2OC8A 5C1XA 1NN6A 3RC6A 4AORA 2Q6GA 1XUFA 3NZIA 4U2WA 1CA8B 5JPMH 2VIQA 2GCTB 1O3BA 1CA0C 1EP5A 2XWAA 1BBRH 4ISLA 1KDQB 1YLCA 4JYVH 2EEKA 2ZU2A 1L2EA 3QUMP 3A7XA 4M7GA 3AASA 2ZEBA 1Z6JH 2H9TH 3HK3B 1GBAA 3LGVA 2G51A 1FPCH 1GBTA 2A4GA 3ZZDA 3QLPH 3MU0A 4JK6A 1FX0B 1S81A 1CE5A 1RJXB 4FVBA 1H8ED 2J38A 1O2UA 2KM0A 2FOEA 1DXPA 1SGTA 4UE7H 1JRSA 2F4LA 3Q3YA 1TBRH 1JIRA 1UTJA 2Y6TA 4X2YA 1IQMA 1Y5AT 1W3CA 3FANA 2A0QB 1TX8A 3F2HA 4B71A 2I6SA 3PV4A 1TRYA 3R3GB 5DPAA 1C5XB 4AFSA 1DWEH 1TX7A 2AYWA 1EX3A 3RU4T 2SGDE 2A4OA 3MNXA 2RA0A 3HATH 1HJ8A 2BM2A 2CV3A 3MNCA 1VKYA 4YLUA 2ALVA 1C1QA 2ANKH 2WYGA 3KF2A 2IN2A 1G36A 2FTMA 5TJXA 4GHTA 1V2VT 2Y5GA 1ZTKA 1GGDC 1BHXF 1C2EA 1ELCA 3FP8E 2TGAA 4X2VA 1O3NA 1BRAA 5A8XA 3W94A 4MPWA 2P93A 2QC2A 5EODA 2O9QA 3LGWA 1T8MA 3DHKH 3RXUA 2WUCA 2ANYA 2ZC9H 2KAIA 1C5NH 3K9XB 1BUIA 1GJ9B 1B0EA 2W26A 4ZKRU 2FLRH 3SV9A 4U30A 2VWLA 3LGTA 1CGHA 3A8DA 3ZZ9A 1BT7A 4ABIA 1Z8JB 1QFKH 1ZMNA 2ALPA 3RMMH 1MZDA 1HAIH 4NA9H 4WH6A 3QK1A 3ZZ6A 1GJ4H 2FXRA 2XCFA 1O3HA 3FN8A 2Z3DA 2JIZD 1C1RA 1WU1A 2XBYA 1ANDA 3KQDA 3EA7A 1O2ZA 4AB9A 1A3BH 1H8HD 1AU8A 1YCPH 2O8TA 2QAAA 1K9OE 2VNTA 1HAXB 2QGRA 1SQOA 1W0JD 2BLWA 2ANWA 1ELTA 5F8XA 5GCHG 4FOUC 1P11E 1AB9C 1JWTA 1NESE 3OX7U 3RXMA 3U28C 1DS2E 2BD4A 1IAUA 3RXOA 1XXFA 2BTCE 2W7UA 4HI3A 4XD7D 1DVAH 4BTUB 1SKYE 2GMTC 4NA7A 4AOQA 1ZPZA 1LCYA 2XNDD 3PV5A 3ODFA 9ESTA 1C1SA 3UNQA 5HMAA 3SV2H 2KR7A 1VITG 4KTUA 3SNBA 4AFQA 4Z6AH 3LDXH 4NGAH 1TABE 2O8LA 5GCHF 3P8GA 2RG3A 1UHBB 2ZFFH 1ELEE 5DSFA 5FBIA 1BTHH 2BXTH 2Y82A 1FZZA 4ZMAH 1BITA 1W11U 2GDEH 1A5HA 4F49A 2WUBA 1YLNA 3I78A 5FAHA 3MH7A 3GY6A 1IQIA 2ODPA 1YCPM 2PGQB 3ZVAA 1C1UH 1GI8B 2PTNA 2Y80A 4TWWA 1T7CA 5F53A 1W7GH 1BIOA 1AY6H 1EZSC 1NFWA 5AVDA 1VITF 1NROH 2UUFB 2OD3B 1S84A 2SGPE 3A8BA 1V3XA 1GJ8B 3AK5A 3SGBE 3ZV9A 1NS3A 1PFXC 1F5KU 2V0BA 1SL3A 2XBXA 5C1YA 1FAKH 1YYY1 1SG8B 3QZRA 4YOJA 1XX9A 3SHAH 3SQEE 1SLVB 4THNH 1BMAA 5ESTE 4FUCA 1EZQA 1OYQA 2EI7A 4NFFA 2G4TA 4AYVB 2WPJS 3VPKA 2G00A 2A32A 1BTUA 7LPRA 2J9NA 2B9LA 4WXIA 1TNLA 1N1LA 4JZEH 1Z8IB 1Y3YA 5LGOA 4GLYA 3A81A 2XRCA 2QF3A 5HIZA 4WVPE 1EATA 1ZSJA 2A2QH 2Q1JA 4DW2U 3MU4A 5A09A 1EJNA 1OX1A 1YLDA 1HRTH 2QA9E 1JMOH 2W6JD 1JIMA 3VG8A 2PUQH 1O2XA 1GJAB
chains in the Genus database with same CATH topology
1MKXH 2BVRH 3PTNA 4MG3A 3BG8A 1LQDB 1XVOA 1V2KT 1FUJA 1YBWA 3Q00A 1TGTA 1V2TT 5C5NA 1THPB 5LPFA 1PQ7A 5GJ4B 1MCTA 4E05H 1MZAA 3EAJA 1HJAC 3GYMA 1QRZA 1BMMH 2ZHWH 1YP9A 1V2ST 3Q77A 1ZPBA 3S9CA 1TX6A 1PPBH 1OPHB 1C1PA 2FIRH 1XVMA 1A4WH 3RU4E 1UVOA 1GJDB 1QRXA 1HAZB 2ZPRA 4ZKSU 3SUEA 1CU1A 2BX4A 4IGDA 4H6SB 2R2MB 4JZIA 3DFJA 3SU1A 4CH8B 3T5FH 2GX4A 4WXVA 3OTJE 2OP9A 1GBIA 3UOPA 4XDEA 1IQFA 1HXEH 1LHEH 3QGJA 3K6YA 4NIXA 4DCDA 2JH0D 1GI7B 2Z7FE 1C5LH 1A5GH 1TNKA 1GI2A 3I29A 5DGJA 7ESTE 3U69H 3ZZ3A 2ZECA 3BTME 4X1PU 1D9IA 2H1UA 4ISHH 3L3TA 2AMDA 5FBEA 1C9TA 1D3TB 3BEUA 1O2YA 1N6XA 1Q2WA 1Y3UA 3PO1B 3MH5A 1ABIH 2Z9IA 3O8DA 3VGCC 2BQ6B 4I33A 4NIVA 4D7FA 1LVBA 8KME2 1LDTT 1ARCA 4O97A 3FFGA 3DT0H 3BG4B 3ZVFA 5T6GA 1AHTH 2ZGHA 1DPOA 2F91A 1OKXA 4RKOB 1TOMH 2EI6A 1AQ7A 3PTBA 1MTNC 1O2LA 1KLIH 2BB4A 1WCZA 5K0HA 2OC7A 3TGJE 1TBQH 1A46H 4ABJA 2LIZA 4CHAB 1FY1A 4I8KA 3FZDA 3FAOA 2ZHFH 3SUDA 3RU4D 3LH1A 2THFB 1MBMA 1VGCC 2ESTE 3ZVEA 5TCCA 1NTPA 2Z6BD 2PKAA 1SLUB 1C5RA 2A7CA 1AI8H 1E36B 1P05A 3TJVA 5HYOA 2QYIA 1GBJA 2P16A 2BD8A 3TGIE 1XUHA 5T6FA 4BOHA 5GDSH 4TY6A 4CR9A 1LHGH 3SNCA 3QX5H 4MPXA 2O8WA 2WPKS 2VH6A 4ZHLU 1PPEE 2AMPA 1G30B 1P04A 1AZ8A 2NU0E 1W7XH 3GY8A 1BBRK 3C1KA 3A7YA 1N8OC 5BPEA 1UK4A 2VIVA 4NSYA 2Y81A 3BEFB 5DP9A 1XKBC 1K28D 4NIYA 2ZU5A 1O2GH 1YPHC 3ZZBA 3W95A 3M5NA 2ZGXH 4NZQA 1TFXA 2J2UA 1O39A 1G3DA 3KL6A 2NU3E 3KQCA 4OGXA 2CMYA 5H4IB 2BX3A 4BAMB 4PROA 1F7ZA 3M35A 1PPFE 3IWMA 2XTTB 2ZGCA 1GG6B 1K1NA 1O3CA 1TMBH 2ZQ1A 3FZZA 1DY8A 3M5MA 4FU7A 5A2MH 1HV7A 2FOHA 1FJSA 2HPQH 1FMGA 4CR5A 3M5LA 4B2AA 1NFYA 5JBTA 5G4BA 3AW1A 3KCGH 3V12A 2FMJA 4B1TA 1HAYB 4FUJA 1XMNB 2HNTF 1PQ5A 1TNGA 4Q7ZA 1A61H 2FS9A 2ZU3A 2V3HH 1C4U2 1XUJA 3RXIA 3F9EA 3CP7A 5DP6A 1DUEA 2OBOA 3A82A 1EPTC 1QGFA 1K1IA 1H9LB 1GPZA 1DITH 4CBOA 2XC5A 3GYLB 2ZZUH 1TPSA 1O3DA 3S7KB 3HKJB 3URDA 2ZPQA 3E90B 5DK1A 5E0JA 1QL8A 1WTGH 4HTCH 5F8ZA 4YESB 1PQ8A 4MNWA 1RTLA 4VGCC 1C1MA 1K1PA 2GDDA 2PKSB 2BDHA 2PFEA 4YT7H 2ZCHP 1F5RA 5ESBA 1TGCA 2H9HA 3A83A 1Q3XA 4K1EA 3MNSA 4O9VA 1ELVA 1UTLM 4UD9H 1KXBA 3MYWA 1O3OA 4JCNA 2CXVA 1GHAG 2D1JA 3MU5A 4ZHAA 2UUKB 1YCPK 1ZRKA 1C2LA 3Q3KA 3BN9A 2ZGJA 2TGDA 2BOKA 3MU8A 1ESAA 2ZHDA 3SJKA 4X1SU 2Q6DA 2XC4A 1ANEA 1GBFA 3UNRA 4K8BA 4MPUA 1CT4E 1O0DH 3K65B 1WAYB 3P17H 4UFGH 4JZDH 1TMTH 1ZMJA 3KQBA 5EQRA 4ABHA 4ABDA 4H6TA 2CJIA 1O5DH 1G9IE 2EC9H 1GHAF 2P59A 1UK2A 3BIVH 1GHWH 1UTKA 5LPEA 1O3AA 4NWLA 4DG4A 4UFEH 4Y7AA 4MNYA 1P10A 1MTUA 3F9FA 6CHAB 1OWIA 1P57B 5A8ZA 1Z6EA 1ANBA 2H6MA 4IMQA 2W3IA 5BRRE 5AFYH 2ZO3H 5I25A 1NU7B 1BB0B 2FO9A 2GMTB 1JXPA 1Z8RA 5FHTA 3ZV8A 3UR6A 1GBEA 3LKWA 3ZZAA 5T6DA 4X1QU 5A0AE 3CENA 5DKMA 3RXLA 3T25A 3H5CB 3SI3H 1QHRB 4Y79A 2HWLB 1GI0A 1K1OA 3ZZ4A 1QR3E 1MCVA 3RDZA 1W0ZU 3HGPA 3MI4A 1QY6A 1FNIA 2VWOA 1E0FD 4NWKA 3U1IB 5EW1H 1ELGA 3VB4A 1FPHH 2HGTH 3GICB 3HPTB 3SO3A 2J92A 2BLOA 3MMGA 2AGIX 3GDVA 1G2MA 4FU8A 1DOJA 4J2YB 3S9AA 4CRDA 1FY4A 2BY6X 3BSQA 3TK5A 3M3SA 1Y5UT 3P8OA 4CRCA 2ZWLH 1O3EA 1CBWC 2P95A 2AERH 1TA2A 1VCQA 3LOXA 1K2I1 1NT1A 1YPKH 3PM3A 4SGAE 3QWCH 2BY9X 3U9AH 2W3KA 1GJ6A 1SOZA 5AFZH 2C8WB 5E2OA 2PGBB 1BRCE 1F5LA 2K1QA 2G52A 3K2UA 4A5TS 1NRRH 2VWNA 1UVUH 2OLGA 3RM0H 2K7XA 3A85A 5CE1A 1KTSB 1TPAE 4CRBA 3PMBB 3SJ8A 1TAWA 5DP8A 3M7TA 1C5SA 5C2ZA 1DT2A 2PV9B 1S6HA 3L6PA 2OXSA 4ISIH 1OWJA 1AE5A 1EJMA 1T8NA 1K21H 2PUXB 1YF4A 4FUFA 4RSPA 4RN6A 4XE4A 1IQNA 4UONA 1DX5M 4K8YA 3JZ1B 2Q6FA 2M5TA 1A2CH 4JYUH 1P2OA 3UWIA 1FXYA 1QJ6B 4AGJA 1VJAU 1P0SH 1QQ4A 1RTFB 1TNHA 4TPYA 1O3PB 5FX6A 2LPRA 1Y3XA 1L0ZA 3GDSA 2Z9LA 3V13A 1J16A 1O2QA 2A5AA 1TNIA 2VGCC 1P2KA 4YTAA 4I31A 1F92A 3IG6B 3SU4A 3KNXA 1KYNA 2F3CE 2BZAA 1V2NT 1O2KA 2LNCA 3UY9A 3BTGE 2UWPA 3LPRA 1B5GH 4BANB 4Y8ZA 4FUBA 3T27A 3RXVA 3U98H 1UHBA 6ESTA 3E91A 3GCOA 1E35B 1MMJN 3MH4A 1NZQH 4Z0KA 3EBNA 5IYTA 3DD2H 5L6NH 4IC6A 1W10U 5JBBS 1N6YA 4KKDA 4KTCA 5AHGH 1T4UH 1MTVA 2JH5D 4Y7BA 8ESTE 1TALA 2BD2A 5ABWA 3A7WA 2PWXA 3T29A 1ZJDA 3TITA 2BY7X 3LONA 1YM0A 1RIWB 4K5ZA 2AIQA 1W13U 1JOUB 1XUIA 1P8VC 1D6RA 3SV8A 3SNDA 3E0NB 2WV4A 3QZQA 2ZFTA 1Z8GA 2BD9A 3ATKA 1P9SA 1MD8A 1AUTC 1SGNE 3E16B 1TA6A 4X2XA 2AH4X 4ESTE 1C2GA 3M7UA 3TPIZ 4DIHH 3F6UH 1KXDA 1BZXE 3RMOH 1DWBH 3L33A 4JYTA 1D3PB 1MTNB 2IOTA 1GMHG 2RA3A 1SC8U 2BYAX 1C1OA 1HFDA 4BTTB 1BQYA 1DICA 1O2SA 2C8ZB 1TBZH 3GCHB 3S69A 2FWWA 2H2ZA 1ANCA 3SU2A 2QCYA 3SW2B 1HAOH 1WUNH 3NWUA 5HGGA 1W14U 3EYDA 4K1TA 1O38A 3A87A 2GT7A 2SNVA 2GD4B 3TH2H 1SGFA 3KN2A 1GDUA 2BY5X 1GMHF 1HAVA 1NO9H 3MFJA 4OGYA 4B73A 2WPHS 2G81E 1DDJA 1KXEA 4XOJA 3UIRA 4BAQB 1V2QT 2VIPA 2OQ5A 1P2MA 4H42U 2ZDMA 2ZFPH 2Y7ZA 4BAHB 4YOIA 2ZPSA 4X2WA 1EJAA 3M5OA 3ZZ7A 3T26A 4ZH8A 3KQEA 4DIIH 1KLJH 2ZU4A 1UTNA 2D26C 3VFEA 1KY9A 3ATMA 2VH0A 4Q80A 1WSSH 2BVSH 1LPGB 1GHVH 1MUEB 1P03A 2BDBA 4JMYA 4WMFA 1CGJE 1SBWA 2FEQH 2A5KA 2ZI2H 3M37A 1T4VH 1QJ7B 2ZGBH 3U8TH 2QIQA 4Y76A 3QO6A 1OXGA 4NG9H 1YPLH 1UK3A 1EXFA 1S5SA 1SOTA 4CRGA 4WF8A 4ZUHA 3I77A 2NU4E 1TMUH 1F2SE 1K22H 4INHA 4A7IB 5CMXH 2WPLS 2Z3CA 1L4DA 2Y5HA 5JDUB 3QTVH 1HAVB 1MD7A 3BTEE 1TYNA 1F0SA 3RXGA 1OOKB 4DJZB 5DO4H 3VXFH 4BNRA 2STBE 1O3MA 1OYTH 3LGIA 1O33A 1KXFA 2FOFA 2HOBA 3MH6A 5JBAS 2BMGB 2HNTE 3V7TA 5JB9S 5K7RA 4VGCB 1GVZA 2SGEE 1DSUA 4ZXXH 4IBLH 3D65E 3STJA 2AFQB 3SU6A 5A8YA 3BTQE 3P95A 2R2WU 3SGQE 4BTIB 1CT0E 1O5GH 1TGNA 2OC0A 5DG6A 1O2TA 2IJOB 3MOCA 2CHAB 3T28A 4X6OA 4XFQA 3ATIA 6GCHG 1LPZB 1J9CH 2FPZA 3M61U 1SGFG 2RCEA 1UJ1A 3ELAH 1SI5H 2GVFA 1UO6A 1HDTH 4OS2A 1GBBA 4OS6A 1BMLA 3TJUA 2H5CA 1ELBA 2TRMA 1CHGA 1K1MA 4GHQA 3VB6A 1LKAA 5GWZA 3QN7A 3S7HB 3CS7A 2OCVB 2C3SA 1B7XB 2XBWA 3OSYA 1LHDH 3QTOH 2B5TB 6GCHF 2AGGX 3SV7A 3TH3H 1C5ZB 1J8AA 3MWIU 1P3EA 2I6QA 1Y59T 2GZ9A 1UTMA 1S0RA 1EB1H 1GMDG 3SOSA 4CREA 1VJ9U 4IMZA 2ZTYA 1IHTH 1UTPA 1VCWA 1KSNA 4HZHA 4ZKNU 1OS8A 3U1JB 4OS7A 2XXLA 3A8CA 4A6LA 2WV5A 3GY4A 1O3IA 1DWDH 1RTKA 5PTPA 4DGJA 2CF8H 8GCHF 4Q2KA 4YO9A 4JK5A 1THSH 2OC1A 1C2JA 2ZNKH 3RM2H 1TPOA 1BOQA 1GDNA 1GMDF 1G3BA 1QB6A 2NU1E 3KGPA 4MNXA 1O37A 4CH2B 1ARBA 1FLEE 2AEIH 4WJG2 3LU9B 4YM9A 3LT3A 1H9HE 1TIOA 1SHHB 3ZZ8A 3BTFE 5I46H 1C5WB 5SGAE 2Y5FA 1BRBE 1B0FA 2EA3A 4WMDA 1FIWA 2ZF0H 3LC3A 2QN5T 5DJ7A 2Z9GA 4J1YA 4IN2A 1AWFH 1QTFA 3RXJA 1EAWA 2FYQA 2OQUA 2FS8A 1VCPA 3RC4A 4DURA 4O03A 1MU8B 1QRWA 1W2KH 2Z9JA 4YOGA 1CBWB 1GCDA 1HNEE 2DE8A 3A84A 2V35A 2O8MA 1SLXB 4OS1A 4XSKU 4I8GA 1UCYH 4A92A 3P8FA 4KTSA 1OWKA 3U8OH 1PPGE 3IITA 3K6ZA 3LGUA 1EUFA 1CA0B 3TNSA 1RFNA 2A4QA 2R0LA 2Z94A 2B8OH 1BMNH 1HGTH 3D49H 1GI3A 4XBBA 1GBHA 2BDCA 3RXTA 4ABEA 4ABBA 4X6NA 3NXPA 2ZKSA 3MU1A 3RXDA 4B2BA 2VIWA 3HKIB 3SU0A 3GY3A 1QJ1B 1G32B 1X7AC 4Y8XA 2FOCA 7GCHF 1L1JA 3BTKE 2FLBH 4MDSA 1P2JA 2ZHQH 1P12E 3LJOA 3SUGA 2ZDLA 1P3CA 4DVAU 2BY8X 5T3HA 2BOHB 3VB5A 3UQOA 1EB2A 5EXNA 2GGVB 4WY3A 1P2IA 2HALA 2ZU1A 5E2PA 2D2DA 2W5EA 2A45B 2BQWB 4ZROA 2V6NA 4H4FA 1DUAA 1RRKA 4GSOA 3EA8A 1O3KA 4UFDH 4AGKA 1T31A 2AS9A 3S9BA 4BXWA 1GGDB 1SGCA 3NCLA 1C5TA 4JZFH 1XUGA 1UMAH 4INKA 2ZTZA 1EZXC 4FXGH 1VITH 2XW9A 4ZHMU 2ODYB 2JETC 1BTZA 1GCTC 1Z71A 1DLKB 3TIUA 1MTSA 1OP2A 5TCAA 2PLXA 3H7TA 3BEIB 1O2WA 1GI6A 1C5YB 2AMQA 2ZQ2A 2GTBA 1L1NA 1H8IH 2FI3E 5EPNA 2ZIQH 1NRPH 5C20A 1IQEA 5J4SA 1J14A 2FI5E 1O2IA 4ASHA 2BD5A 3H7OA 3A88A 3PMAB 1C5QA 5EQQA 1OWEA 2SNWA 1V2UT 1V2LT 4ZXYH 3BTTE 3E3TA 1W8BH 1IQHA 5C67A 1DLEA 3CS0A 1Z1JA 1MU6B 1DXWA 1AWHB 1GHBG 4KGAA 1GI5A 3TU7H 3DFLA 4INLA 4AG2A 1MAYA 1C2DA 3D62A 4HGCA 1LVMA 2UUYA 1XXDA 4D7GA 3LJJA 2BVXH 1P02A 3DUXH 1KIGH 2CF9H 1BTPA 1K1JA 1AFQC 3TJOA 1HAGE 3NPSA 2TIOA 5GIBA 3T2NA 4R8TB 1SLWB 3HK6B 1FY8E 2HVXA 3V3MA 3UREA 1UCYE 1AB9B 2O8UA 1TB6H 4WH8A 5A0BA 4LK4A 2ASUB 4JZ1A 2PSYA 4I8JA 2WINI 3VEQB 4E06H 1GHBF 1GVLA 3A89A 3RXPA 2ZDNA 2FDAA 4I8LA 1C5PA 1IQKA 1AKSA 1ETSH 1GL0E 2FOBA 2ZTXA 4XBCA 4ABAA 2AIPA 2G4UA 2C93B 3ITIA 4NA8A 1ETTH 1F0RA 2HNTC 3MO6A 2UUJB 4R0IA 2FP7B 1S6FA 1P01A 3UOUA 1ZHPA 4CRFA 4OS4A 1ZMLA 3PLKA