1J15A

Benzamidine in complex with rat trypsin mutant x99/175/190rt
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRETYNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASSSFIITDNMVCVGFLEGGKDACQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin II, anionic
publication title Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-induced Structural Plasticity
pubmed doi rcsb
source organism Rattus norvegicus
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j15A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j15A02
4WMEA 2C8ZB 2BMGB 1HAGE 5A0CA 2OC0A 2XYAA 4SGAE 2A2QH 4F49A 3K2UA 1BCUH 2HNTE 3VXFH 5ABWA 1TMBH 4UONA 5LPEA 1C5WB 5FPTA 1G32B 4BTUB 4BXWA 2FESH 1QFKH 2HALA 1GCTC 1EASA 3HKIB 4UE7H 1TRNA 2UUJB 1QY6A 1XUJA 1K9OE 2PKSC 4XSKU 3RC5A 2A4RA 4GCHF 1YGCH 4U32A 3F9FA 1GG6B 4JZ1A 1NS3A 2PSYA 3SJOA 2J4IA 1MBMA 2NWNA 3STJA 2VVCA 3A84A 1UO6A 4OGXA 1KLJH 1C1QA 3Q3YA 3SNDA 1TNGA 3E16B 3BTHE 4KKDA 1JIRA 1GJDB 1O3AA 3RMMH 4FUHA 2FEQH 5E2PA 3A8BA 1GMDF 4AG1A 4XBBA 1AE5A 1IAUA 2AS9A 8LPRA 2G4TA 3P6ZB 2XC4A 3O8RA 1BRCE 1YCPK 3RU4T 4U01A 3ATWA 1W2KH 2ZTZA 4I8KA 1BIOA 1F5KU 5ESBA 1HRTH 1GBEA 3RU4D 1G3CA 2STBE 1O2HA 1SQOA 1MTUA 3E1XB 2J92A 3OY5U 3RLWH 4DURA 2JH0D 1ZRBA 2OTVA 3SV6A 4MNVA 1IQEA 4E7RG 2BQ6B 4KELA 2DE9A 3ATLA 1HCGA 3SZNA 2PFEA 4WXIA 5E0HA 3U1IB 1NFUA 5AFYH 1QL9A 2O8LA 2XWAA 3PV4A 1FQ3A 1WQVH 1ABIH 1ETSH 5TCCA 1C2MA 4B75A 2BVRH 1UVSH 1AVWA 3A7ZA 1LVOA 1QRXA 2UUKB 3A7XA 2W26A 2TGAA 1O2PA 1TRYA 1G37A 1GBFA 2TGPZ 2Z6BD 2VWMA 1SGQE 4Z0KA 5AF9H 3MNCA 1MTWA 3QTOH 1GHZA 1K2I1 4JZEH 3BTTE 3UTUH 1PPBH 2R2MB 3RMOH 1S84A 1Z7KA 1C5ZB 3PMJA 1C5UA 2D1JA 3GY4A 3RXHA 1O2LA 2ZHWH 2CV3A 1NZQH 1ETRH 2VIVA 1HJAB 2Q6FA 4F4OC 1V2PT 2A4QA 1O2UA 1NPMA 3RXAA 1H9LB 2Z94A 1QA7A 2ZFSA 1KXFA 3A7WA 4B2AA 1AKSA 1TBQH 1S6HA 3GY7A 4ZH8A 4YOJA 3A8CA 5FHTA 1F0SA 4GLYA 1SMFE 1O2NA 1P09A 5EGMA 1V2MT 2TIOA 3SORA 1MU8B 3ZZ5A 5AHGH 4K8YA 3A82A 4NG9H 3RM2H 5IYTA 1OP8A 2J95A 1EZQA 1MQ6A 1RIWC 4ABDA 1KLTA 1HAIH 1PQ7A 3CS0A 2KAIB 5EODA 1TLDA 4CBNA 1AFQC 5GJ4B 1GI9B 4Y71A 1SLVB 4GHTA 1QQ4A 1NO9H 1GDQA 3PMAB 1K22H 2OXSA 4Y11E 1KIGH 1GI0A 1VGCC 4ISNA 3F1SB 1CGIE 1SR5C 1SGEE 4CH8B 1ZHMA 4B76A 1ESBA 3OX7U 3TPIZ 1E0FD 3GYLB 2XCFA 3MI4A 4Y0ZE 2QYIA 3GDSA 1NM6A 1F0RA 2AMPA 2XW9A 5EQSA 4NCYA 2ZTYA 2QV1A 1DDJA 1O3FA 1O5CB 3P95A 4I8HA 4O97A 3UNQA 2AFQB 1C9TA 2AGGX 3DFJA 5BPEA 1ZSJA 3ZZBA 5EQRA 1NU9A 2NU1E 4YLUA 1A3EH 3BTWE 4FU8A 1ELEE 2VGCB 3LOXA 4ABHA 4KGAA 1WAYB 1O37A 4CREA 2RA3A 1P9UA 2O8TA 5DP6A 3A81A 3RC6A 1C5YB 1G3DA 1OWEA 2FI5E 5DO4H 2GZ8A 1GHBG 1QRWA 2IJOB 5DJ7A 3TK5A 1A3BH 2A7CA 2OC1A 1GHBF 1FN8A 1FNIA 1UCYK 1UTKA 3TH4H 2BLVA 3M5NA 1EJNA 3RLYH 5HYOA 2G00A 1SI5H 4U2WA 1HNEE 4ZKSU 2BD4A 5GWZA 4VGCB 2OBQA 3TVJB 1GHAG 3PYHA 3UFAA 1D4PB 1G9IE 7KMEH 5LPFA 1MMJN 1UTMA 1GHAF 1TGBA 1BITA 1XMNB 2JETB 3BG4C 2A0QB 3LIWA 1FY1A 3SI4H 5L2YH 1TYNA 2XXLA 4DIIH 1C9PA 3FP7E 1XKBC 4LZ1H 1QBOA 3PB1E 1GBTA 2BXUH 1C5LH 5JB8S 5C20A 3TJNA 2ZIQH 3E91A 1P2OA 4I31A 2VIPA 2HPPH 2ZGHA 1HAYB 1WTGH 3GCTF 3VB6A 1Y3UA 1FIZA 3Q3XA 2GDEH 2F3CE 2QXHA 1W8BH 3AAUA 3R0FA 5EW2H 1TA2A 5GIBA 2GVFA 6GCHG 1Z1IA 1UK3A 3KQDA 3SUDA 1EOLA 2ZDAH 5DPAA 1C5QA 1ZTLA 2SNWA 6GCHF 1Y8TA 4Q7ZA 1S0QA 2ZA5A 1F0UA 3GCOA 1MU6B 1C1RA 1SLXB 1XX9A 4Q7XA 4D9RA 1Y59T 2F83A 1TPSA 2WPIS 2GV6A 4MG3A 1P11E 4RSPA 3F9GA 2P59A 1O2XA 3MNSA 2FO9A 1O3DA 4NA9H 2VU8E 4DOQA 1C5TA 1QNJA 2WPMS 1AN1E 2PHBA 3SOSA 1L4DA 3I78A 1AZZA 1OWIA 1SGIB 2A7HA 1DT2A 5DP9A 3ZZ4A 1O5BB 1EAUA 2ZDMA 1NN6A 1NTPA 3E90B 3VXEH 5A09A 3L3TA 1MKXH 1BTUA 2OINA 1LKBA 3E6PH 3HK6B 4MVNA 3JZ2B 5F8TA 4TWWA 1H8IH 1O32A 1OYQA 3MO9A 3T25A 3D49H 5LPRA 1ELBA 4I8GA 1XXFA 1C2LA 3MH7A 2BX4A 3M3TA 5CMXH 2XCNA 4AB9A 1XUFA 2JKHA 2FPZA 2WV5A 5DP3A 1UTQA 5G4BA 1OWKA 2B8OH 1ZZZA 2SGPE 3ITIA 4E06H 1KLIH 1B5GH 1A2CH 1L1JA 3RXCA 2P8OC 4ZKNU 2G55A 3P17H 4NZLA 1O5AB 1K21H 1KXAA 4I8LA 1GGDC 2VVVA 3TK9A 5L30H 1K28D 3M35A 2GCTC 3URCA 3TK6A 1C5MD 2ASUB 2ZU3A 1EXFA 4Y79A 3BTDE 1A5GH 3F9EA 4NA8A 1GI2A 1BTYA 1TONA 4X1QU 3GY8A 5A8YA 4YZUA 2BD9A 3RXPA 3MU0A 3S9CA 1TX8A 1GI5A 2G81E 1NT1A 2VH6A 2J34A 1NC6A 1PPFE 1MQ5A 3A85A 2WYGA 3RXJA 1K1IA 5E2OA 1NRSH 3FANA 1RTLA 1NFYA 2XNIA 3E3TA 3RUOA 3B23B 1V2UT 3EE0B 4BAQB 1AWHB 4H6TA 4AX9H 2WPHS 1GBKA 2PV9B 3SUGA 1C2HA 1RD3B 3RXSA 1S82A 1Y3XA 1HAZB 1DICA 1RFNA 5FXLA 1VZQH 4BAOB 3T29A 4HFPB 1OWDA 4CRBA 3Q3KA 4ASHA 5DG6A 3LKWA 1ELAA 1GBHA 3LGTA 3TU7H 5F03A 1IQLA 3L6PA 5C5OA 2QXJA 5CE1A 2ZCLP 2PWXA 4FVDA 2QAAA 3SQEE 4NIYA 2FYQA 3A8AA 2FZZA 2OQUA 3GY6A 2BVSH 4O03A 1WTHD 1NESE 3H7TA 4MNWA 5J4SA 3MU8A 2C4FH 3T2NA 2FTMA 1Q3XA 1GBBA 4AYVB 3B8JA 1V2QT 4Z6AH 3S9BA 2Y7XA 1SGNE 1UTNA 4Y8XA 1HFDA 1FY5A 1Y3WA 1ANBA 2HNTF 3BIVH 1AVXA 4WH6A 4CRFA 5A0BA 2XRCA 2GMTB 1GBLA 5GCHG 2WV4A 3RXUA 2ZP0H 3UUZA 4CR5A 4X6PA 4ABGA 1ZHPA 1YPEH 4OGYA 1C4Y2 1EAWA 3VFEA 5JBTA 2PW8H 4YLQH 3T5FH 3ZZAA 3MH6A 2BY6X 1VITG 4WXVA 9ESTA 1CT2E 3TH3H 1MZAA 3SBKA 1VITF 3QZRA 3SJ8A 3ZZ9A 3MU1A 2R3YA 3HGPA 1LHCH 4MNYA 4X2YA 3SW2B 1MKXK 3A7VA 4GPGA 5FCRA 1C4U2 1UCYE 1ORFA 1LHDH 3KN2A 2D26C 1GG6C 4NIWA 3STIA 1RS0A 2SGFE 3GY3A 1HV7A 2ZGCA 3SV9A 2NU0E 1LHGH 2FI4E 2G51A 2VWLA 1TNJA 1QL7A 4J1YA 2B5TB 3A89A 1SGDE 2EC9H 4A1XA 2GV7A 2C8WB 2G8TA 1EUFA 1O0DH 2FDAA 3LT3A 1O3IA 1V2KT 2V0BA 5EPNA 2VH0A 3V7TA 5HM2A 1GBMA 1PPZA 3PLPA 2W3KA 4DY7B 2KAIA 1GVZA 1H9HE 2R0KA 1H9IE 3GCHB 1YLDA 2A5KA 4FU9A 1FI8A 1O5FH 1BHXB 1EP5A 1SVPA 2GGVB 2W3IA 2ZU5A 1SHHB 2ZC9H 3PTNA 2HWLB 3BV9B 1O3GA 2ZCHP 1SB1H 1TGCA 2HRVA 3SNEA 2AMDA 1SOZA 1BOQA 2ZECA 4JZDH 2ZFFH 2PSXA 4UD9H 3PMBB 1C2IA 1TX6A 2BZ6H 4FUJA 3VB3A 1TALA 1QBVH 3NPSA 2VIQA 4B1TA 1Z8JB 1TB6H 4IS5A 1XUIA 3SGBE 3FZZA 3KQEA 3U8TH 1YYY1 1D3PB 1ABJH 1DY9A 3EA9A 2GZ7A 1BBRH 1T8OA 1IQKA 1P10A 3ZVFA 3LC3A 1BJUA 2PR3A 4GCHG 3M5OA 1SG8B 1E35B 1GHVH 1B7XB 1JXPA 1OS8A 2A2XH 1A61H 2DE8A 4NWKA 1TQ7B 1UHBB 2XWBI 1LMWB 2PTNA 2H9TH 2FLBH 3MH4A 1O3HA 4Q2KA 4IBLH 4A1VA 5JBBS 4K60A 1HJAC 2Y82A 4CRGA 1M9UA 5EXNA 2XBXA 3PROA 4CRDA 1D3QB 1V6DA 3SU0A 1A46H 4K3JA 1G30B 3RMLH 5JBCS 3A7YA 1Y3YA 1P2MA 2EI6A 4FUCA 1HJ9A 1GMDG 3GICB 1O2MA 1DSUA 2DUCA 3MYWA 1F2SE 1K1MA 1ZTKA 4LK4A 1ELGA 1ESAA 4A92A 1ANDA 1WCZA 3BG8A 3URDA 3IG6B 4WF8A 4CRAA 4FU7A 2ANYA 4MTBA 4GUXA 5K0HA 2F9VA 1AI8H 1ARBA 2BX3A 2G5VA 1EOJA 3LGYA 1YC0A 1G2MA 1YPMH 2BYAX 1AFEH 2Y5HA 2G5NA 1YBWA 1AVGH 2ZHFH 1TMTH 3MO6A 1DUEA 3LONA 2D2DA 4FUFA 7GCHG 4MLFB 3M7UA 1W3CA 1NFWA 4I32A 2F9PA 7GCHF 2SFAA 4ZROA 2FODA 4IGDA 5BRRE 3RXVA 1KDQB 2VIWA 4IN1A 2ANWA 3DFLA 3VGCB 5FPSA 2ZGXH 2W7UA 5GXPA 8KME2 1AY6H 3QK1A 4JK6A 1P2QA 4YT6H 1JIMA 3RDZA 1QBNA 5TJXA 5DP7A 2FOAA 1X7AC 3VPKA 4HGCA 1BT7A 2CHAB 3TJOA 2H9HA 1TFXA 2ZHDA 1BRAA 1JMOH 2UWLA 4ZMAH 1O3EA 3CP7A 1XUHA 1P2IA 1ANCA 1L4ZA 1NRPH 3QTVH 4X1SU 2GCHF 1ETTH 1FY3A 1V3XA 1EAIA 4BXSA 3VEQB 2XC5A 1C1PA 3KL6A 2VGCC 1DPOA 1CGHA 1VCPA 4YOIA 2IOTA 1FONA 1TIOA 4NGAH 1W14U 3O8DA 1O2WA 1SGFA 2P94A 4CBOA 4Y6DA 1SPJA 3RXOA 1DWDH 1PQ5A 2ZFQH 4ABJA 1C2GA 2BTCE 3O8CA 1GDNA 1G36A 3UIRA 1P04A 1GCTB 1HXFH 1O2VA 3SU6A 3QUMP 2HGTH 3D62A 2ZQ2A 3M7QA 4Q80A 1C1UH 1EB1H 1ZMLA 1J16A 3PO1B 3K65B 1PQAA 4WWYA 3RXGA 6CHAB 1TQ0B 3RXRA 3GISB 4VGCC 1Z8RA 3KEEA 1QB1A 1T4VH 1JBUH 1VCWA 2QXGA 3N7OA 3M37A 1TGTA 3EA8A 5H4IB 2ANKH 3SUEA 4DGJA 2OUAA 2BDAA 4ABBA 2JETC 1WUNH 3ZVDA 1UK2A 2BB4A 1F92A 2Z9IA 3A80A 4MPXA 1K1NA 1AHTH 5A2MH 2ZCKP 3U8OH 1P01A 1BBRK 2FLRH 5JYIA 1ZPZA 3UREA 1C5SA 4X1NU 1HAPH 1EZSC 2BD8A 3C1KA 3KGPA 1QL8A 1GBDA 1XKAC 2C8XB 2WYJA 1SFQB 1TX7A 3SU1A 3ZYDA 3RXEA 4X8VH 3UWIA 2O8UA 4UDWH 2J2UA 1K1PA 1UTPA 1O3OA 5DGJA 5DKMA 2RDLA 2D8WA 4JYTA 1GL1A 4DW2U 2FOFA 1GMHG 1HPGA 5B6OA 1AQ7A 3UQVA 2Z3CA 3MH5A 3FFGA 3ZVAA 1FAXA 1C4V2 1EATA 1THSH 3FZDA 1GMHF 1GPZA 2ZTXA 2F9NA 3LJJA 1GJBB 1O2TA 1TA6A 1W12U 4A7IB 1O3JA 4AYYB 1QGFA 3QLPH 2AMQA 1SGPE 2XTTB 5AFZH 1BMLA 1MD8A 3LGVA 1LVYA 1V2OT 3SU5A 1ZOMA 7LPRA 1EP6A 4NIXA 1LPKB 2ZFRH 2Y6TA 1O39A 1O3PB 2PUXB 4LOYH 4JCNA 1VJ9U 2SGEE 1HXEH 4OS4A 1MTVA 1MZDA 1PFXC 5C3NA 3NUMA 3P8NA 1W0YH 2HOBA 4OS6A 4IN2A 4D76A 1BRBE 2ZFTA 1EQ9A 1P0SH 1GWAA 1BRUP 1G3EA 1BTXA 1PQ8A 3H5CB 1T8NA 1O3CA 2XBVA 5EXMA 4ABAA 3F68H 2G52A 2QY0B 3LPRA 1XXDA 1HDTH 3BIUH 3NZIA 2A5AA 5PTPA 4X2VA 4TYDA 4MQAA 1GJ4H 1T31A 2QXIA 3SHAH 4WH8A 1CBWB 1FY8E 1BMNH 3SU3A 2QA9E 1YPKH 4FUDA 3GCTG 1MAXA 1CA0B 1V2JT 2R0LA 1P3CA 5IDKA 3TITA 1SGRE 3TGKE 1YLCA 1WYKA 2FXRA 2FOCA 1RXPA 2FOMB 4K1TA 1LQDB 2B0FA 4O9VA 2YNBA 1RIWB 3PWCA 2ZG0H 3MU5A 1SC8U 3TNSA 3K6YA 1SGFG 2ODYB 1C1SA 3MOCA 1S85A 2UUFB 3SV2H 2EI8A 4H6SB 1BMAA 1QR3E 1XM1A 3PWBA 4INLA 1GBCA 4HI3A 1N6XA 1RTKA 1ZTJA 4MPUA 1C2EA 3K6ZA 3ZZDA 4YO9A 3SN8A 1AWFH 5DK1A 3R3GB 3FAOA 3P8OA 1FUJA 2EA3A 1P2KA 3UNSA 5A8ZA 3LGWA 1DWBH 1O31A 4AG2A 1QURH 4R8TB 1Z71A 3TGJE 3BEUA 1SGCA 4X1PU 2GTBA 4Y8YA 2NU3E 3ZV9A 1P9SA 3RXIA 3PTBA 4XE4A 1HIAB 1A7SA 4JZIA 1KSNA 1FN6A 4NWLA 1WSSH 5FX5A 5C5NA 1HAVB 3QO6A 4CH2B 1CHOF 2PUQH 2AH4X 2GT8A 1MCTA 2OBOA 4INKA 2BLWA 1TGSZ 2JH6D 4X8SH 2ZFPH 1INCA 1YPHE 3BTFE 3HATH 3SNAA 1FPHH 3UNRA 1MBQA 1K1LA 1TWXB 2QF0A 1SQAA 2FOBA 2GMTC 2Q6GA 1E37B 1O5GH 1OP2A 3RC4A 1UVOA 2SGDE 4DIHH 3W95A 1ZPBA 2FIRH 2P3UB 1TRMA 2BY7X 3QWCH 5LGOA 2CGAA 2STAE 2VIDA 1O2QA 2EEKA 3B9FH 2LPRA 2ZI2H 5EU8A 2J9NA 4MPWA 1AKSB 2ZPSA 3M3VA 4YM9A 2BHGA 1O3BA 3SV8A 1C5PA 1KXDA 2QN5T 3NKKA 1FMGA 1C1VH 1P12E 1D3TB 2ZGBH 1BZXE 1C2FA 1YP9A 2BY9X 4WVPE 3KQCA 2WUBA 4X8UH 2ZWLH 3G01A 1ELVA 4JYVH 3C27B 1OWHA 1AO5A 1TNHA 1E38B 3NK8A 2OC7A 4D9QA 5EQQA 1GI7B 1EJAA 2P93A 5C67A 1WOFA 2AIPA 1Z6EA 4H4FA 2A5IA 3OY6U 1AB9C 3QGJA 1ANEA 1XVMA 1IQFA 1P05A 2R3UA 2BOHB 4QT8C 4XOJA 4CRCA 1P2NA 2BDBA 2TGTA 1S0RA 1Y5BT 1YCPM 3TJVA 1HBTH 1T7CA 4X2WA 3SUFA 3GCHC 1IQMA 5ETXA 4IMQA 4IC6A 3MNBA 2H5CA 3A87A 2ZF0H 3LH3A 2OQ5A 3ZZ7A 3RXQA 4FUBA 4DVAU 2V3OH 3PLKA 3QZQA 2GX4A 5I46H 1ZJKA 4YT7H 1OXGA 3BTGE 3RXDA 1O5EH 2FP7B 4GSOA 2ALPA 1XVOA 3P92A 1YM0A 2ZZUH 1J14A 2CJIA 1MKWH 2HPQH 2BDGA 2FOGA 3UR6A 2G4UA 1UTOA 3AASA 1FZZA 1DWCH 5CHAB 2YNAA 3P70B 1O3MA 1T4UH 1QHRB 3GOVB 4ZHLU 2GDDA 2F9OA 2PKAB 1GVKB 4ZUHA 1BQYA 1N1LA 2CXVA 2BDHA 2ULLA 5E0JA 2QIQA 5DP8A 1W7GH 1SHYA 1QRZA 3WY8A 3I77A 3L33A 3D23A 1W10U 2ZEBA 1C5RA 2ANMH 3U98H 3VB4A 1DLEA 1P57B 3CS7A 5T6GA 1ZMJA 2F9UA 3NXPA 3PM3A 3BTEE 3V12A 1DANH 4INHA 4AGKA 3FP6E 1BHXF 2UWPA 2ZDVH 3Q76A 3SJ9A 3QN7A 1H8DH 1QB6A 1GMCG 4WMDA 4X6MA 4ABIA 1TNIA 3ENSB 4A5TS 1C5VA 3I29A 3KCGH 3LGIA 3SNCA 4ZKOU 1GMCF 3RMNH 4TWYA 1ZLRA 1C1NA 4K1EA 2TPIZ 4THNH 1D6RA 1LVMA 1UK4A 2Z9JA 3ZVCA 1Q31A 2A31A 4NSYA 3IITA 3OTJE 1LCYA 1IHTH 2SGQE 1O36A 1BTWA 1DOJA 1THPB 2A4OA 4KTSA 1P3EA 1V2ST 4K1SA 1DVAH 1FXYA 1ZGVA 3OU0A 1L0ZA 4MNXA 1EX3A 1GI6A 1ELTA 1Y3VA 4K8BA 4OS5A 2C8YB 1UJ1A 3UY9A 1YPLH 4DCDA 3V0XA 3AVZA 3EGKH 1O2GH 1RRKA 4WMFA 4BANB 1SGYE 2WPJS 3T62A 4M7GA 1CSOE 1B0FA 3TGIE 1TBRH 3RP2A 3VGCC 3SNBA 2V35A 4LXBH 2Z9LA 4Y76A 3W94A 2ILNA 1F0TA 1LHFH 2IN2A 1ZGIA 2A1DB 2BDYA 2CHAC 1FDPA 1MTNB 4AZ2B 3AW0A 1BDAA 1LKAA 4Y7AA 3E0PB 2V3HH 1YKTA 1GI3A 2HLCA 4ZXYH 2ZDKA 3DUXH 3GCNA 1WBGB 1O34A 1C5OH 2ODPA 2R9PA 2M5TA 4CHAB 1J15A 3FP8E 1O30A 1EZXC 3RXMA 3SO3A 1O2IA 1IQNA 4MPVA 2VVUA 1KY9A 4X2XA 2FX6A 1VJAU 3M7TA 2QCYA 1A1RA 2FS8A 3PO1C 1H1BA 2SGAA 4I33A 1SFIA 6CHAC 1CE5A 3DA9B 2PLXA 1C5NH 4XDEA 2H6MA 2VWOA 4K5ZA 1DM4B 1BMMH 1O3NA 1LO6A 2F9BH 1P06A 1LQEA 1C1OA 2P3TB 2QC2A 1QA0A 1JRSA 4ABFA 4B71A 1HB0B 2C90B 5DP5A 1K1OA 2J94A 4R0IA 1CU1A 1FJSA 3A7TA 3NWUA 3TLOA 1MKWK 2ZQ1A 1LVBA 2IPHA 3DT0H 1N8OB 1QIXB 2XBWA 1O3KA 1B0EA 2BQ7B 1UVTH 3RXKA 5C1UA 1TOMH 4E7NA 1EJMA 2A45B 1L1NA 4BAMB 4FVBA 5EW1H 3QDZB 3BTQE 1UCYH 4KTUA 4O3TA 3MNXA 3TH2H 1V2LT 1EPTB 1G2LA 1NU7B 2F91A 1JWTA 5I25A 3BN9A 2ZU4A 3ZVGA 1TPPA 3ELAH 1DFPA 4AOQA 1O3LA 1PYTC 2Q6DA 3LU9B 1V2NT 3S0NA 2GCHG 3IWMA 1LPZB 1P8VC 3EAJA 1O38A 4ZXXH 4I7YH 2B7DH 1KXEA 1WU1A 1A4WH 3TJUA 1KXCA 3ZVBA 1ZSLA 1O2RA 2Y80A 1SL3A 2BY5X 1ZMNA 2W5EA 4Y7BA 4UEHH 2ZHEH 1HAHH 3GY2A 4D8NA 1HIAA 1NFXA 2TGDA 5HGGA 3SI3H 3TNTA 3D65E 4AORA 1HAVA 1KYNA 1OPHB 1GJ9B 3S9AA 1ZHRA 2PKSB 3RXBA 4YOGA 3T27A 1TAWA 1MD7A 1O2SA 3KF2A 4TPYA 1GJ8B 1YPJH 1J8AA 1GCDA 1AGJA 4JMYA 1BB0B 5FPYA 1IQHA 2FX4A 2BD7A 4XBCA 5JDUB 1UVPA 4K69A 1MUEB 1TMUH 1S83A 3MMGA 5E0GA 1YPHC 2OLGA 1BUIA 3CENA 3HK3B 2PGQB 2WINI 2ZU1A 3FVFB 1PYTD 1DSTA 1HLTH 3MFJA 1GJ6A 5C1YA 1A0JA 1AMHA 1XUGA 4AFUA 4ISLA 4ZHAA 1CBWC 1ID5H 1O2JA 1CA0C 3P8FA 1LTOA 2Z9GA 2THFB 4RKOB 4D7GA 2BQWB 4ISOA 3AW1A 1CT0E 1CHGA 3KIDU 1J9CH 1GJCB 2ZO3H 1Z8GA 3QX5H 2Z7FE 3U69H 3A86A 1G3BA 1SOTA 1RTFB 4GAWA 3UOPA 4D7FA 5LH8A 1CT4E 1O33A 1GBJA 1ZR0A 4NIVA 5GPIB 4GHQA 4AFSA 5EPYA 3TIUA 1WV7H 2V6NA 1OKXA 2AIQA 4BOHA 3SJKA 3K9XB 1QCPA 4XFQA 4BTIB 1RJXB 1VITH 4H42U 4WY3A 3SGAE 3ZZ3A 3V13A 4GVUA 1BTPA 2A7JA 7ESTE 3SU2A 1U6QA 2LNCA 4ZAEA 3OSYA 1HUTH 2FMJA 3UPEA 5DP4A 1DXPA 4E05H 1DLKB 1MAYA 1V2TT 3ODDA 3RU4E 8ESTE 1GI4A 1TGNA 1A0LA 1NRRH 2UWOA 1O2ZA 5HXFA 2NU2E 3A83A 3ZYEA 2CN0H 1LDTT 3OYPA 3ZZ8A 1P03A 1TBZH 1PPHE 4TY7A 4UFEH 5F8XA 4X6NA 4DJZB 1TNLA 2RA0A 3MHWU 1FPCH 2BLOA 4JZFH 3SGQE 4FUGA 8GCHG 1QJ1B 3M5MA 3PLBA 1NRNH 5FAHA 1GBAA 1QJ6B 4A6LA 5FCKA 4AGJA 2ZDNA 1FLEE 3DHKH 1ELCA 8GCHF 1BA8B 3EA7A 4AFZA 2FYRA 3LH1A 1FV9A 3MWIU 2OCVB 1DX5M 2ALVA 4UFDH 2ZU2A 1DE7H 1EAXA 1ELDE 4JK5A 2FOEA 1NROH 1SLWB 1GHWH 2PKAA 2Y81A 1P2JA 1GI1A 4TY6A 4OS2A 3RM0H 5EOKA 3QGNB 4Q7YA 1LHEH 1TABE 1EZUC 4BNRA 3AAVA 5FX6A 1TOCB 2GKVE 4B74A 2ESTE 1IOEA 3S69A 3KHVA 1GVLA 4FXGH 1SBWA 4SGBE 4YESB 1KXBA 1O2OA 1AFQB 2FOHA 1ZSKA 1GJ7B 2ZGJA 4AN7A 2FWWA 2Y7ZA 3E8LA 2VINA 1SSXA 2Z9KA 5E8EH 2BY8X 1OWJA 5FBEA 4KTCA 3S7KB 1VGCB 3ESTA 2AGIX 5J4QA 5ESTE 1AUTC 1BTHH 1IHSH 1J17T 2ZHQH 1WQSA 3F9HA 4ZHMU 1SLUB 3LC5A 5EXLA 3V3MA 1OOKB 1QTFA 4NZQA 4RKJB 1L1GA 5F6MA 2GT7A 4IC5A 2SNVA 2VWNA 1E36B 3MO3A 4ISIH 3SU4A 2AYWA 1PPEE 4WJG2 4K2YA 5A0AE 4Y8ZA 4NSVA 4AB8A 1E34B 2BD3A 3ATKA 4BTTB 2VB0A 1CHOG 5JPMH 1GL0E 4J2YB 2BZAA 3RXLA 5K7RA 2A32A 2I6QA 3Q00A 4B2CA 1OX1A 1P02A 4X8TH 4HZHA 4YTAA 1CGJE 2CF9H 1GI8B 3T28A 3A88A 4Y10E 2PTCE 1DS2E 1O2KA 4JYUH 4B73A 3MU4A 5GDSH 2UUYA 1RGQA 2YOLA 1ZRKA 2OP9A 2PGBB 3NCLA 2AGEX 3ZZCA 2BDCA 1V2VT 2VNTA 6LPRA 2K1QA 4CR9A 1ELFA 1Y5AT 1D9IA 1XUKA 5CHAC 2BM2A 5C2ZA 3O8BA 1ZJDA 1HGTH 3ZVEA 1DUAA 1JOUB 2XBYA 3BG4B 3EYDA 4TPIZ 2VJ1A 2GP9B 1K1JA 1H4WA 3VB7A 3BTME 4B2BA 5JBAS 5T6FA 4U30A 1UHBA 1ZPCA 1S6FA 1THRH 1Z8IB 5F8ZA 1NRQH 3HGNA 1SQTA 3M36A 1W11U 3E0NB 1QQUA 1YPGH 5HM9A 1NY22 1V2WT 4X1RU 3SQHE 1A0HB 1C5XB 1HYLA 1MH0A 2HNTC 5AVDA 1C2DA 5SGAE 2ODQA 4DT7B 5HMAA 1FY4A 3HPTB 1D3DB 2OD3B 3H7OA 3MTYA 1TNKA 2Z3DA 4ABEA 5EG4A 1DXWA 5T3HA 1PJPA 5C1XA 1CQQA 2BOKA 4IMZA 2NU4E 1A5IA 1CO7E 2A4GA 4MDSA 1AU8A 1IQIA 2AERH 3U1JB 1C1MA 1GDUA 1ZYOA 2GD4B 2P3FH 1O5DH 1CVWH 1KTSB 1Y5UT 1T8LA 1BBRE 2BLQA 4O3UA 1L2EA 3BEIB 2QF3A 4LZ4B 4UFFH 5JB9S 1QJ7B 1FAKH 1KDQA 1VR1H 1O2YA 2BD5A 4ISHH 1EB2A 2O8MA 2WUCA 3LGUA 5T6DA 5TCAA 1EKBB 1DWEH 3LDXH 2I6SA 2ZDLA 1EPTA 1T8MA 3SJIA 2Z3EA 1UMAH 4DG4A 1MTSA 1C1WH 3DD2H 2XC0A 3GYMA 4BAHB 1HAOH 1C1TA 2C3SA 1GJ5H 2P95A 3UQOA 3GY5A 1AUJA 3BF6H 3UR9A 2WPLS 1GBIA 3EDXB 3UOUA 4A1TA 2P16A 3EQ0H 2B9LA 1AZ8A 2BXTH 2BVXH 1HJ8A 3LJOA 1W0ZU 2VIOA 4XBDA 4OS1A 2P8OB 1AD8H 3UWJH 1MTNC 1UVUH 3RXFA 4FUEA 1A5HA 1GGDB 1LPGB 1QB9A 2O8WA 2GCTB 2GZ9A 1YCPH 5FBIA 3BEFB 2Y5GA 3A8DA 1AE8H 1DITH 5GCHF 4AFQA 1S81A 2R2WU 4CHAC 1GJAB 1ACBE 2W7SA 2WPKS 1TE0A 2H9EH 3T26A 4NFFA 4BAKB 2FS9A 1F5LA 4ESTE 3Q77A 1CA8B 1O35A 1C2KA 1BJVA 2BDIA 3GDVA 4I8JA 3ODFA 4X6OA 1F7ZA 5A8XA 2AEIH 1V2RT 1KTTB 4OS7A 1ARCA 2HVXA 1GHYH 1GHXH 4PROA 1MCVA 2RG3A 3F6UH 2Y5FA 3SV7A 1TPOA 2OC8A 2ZPQA 2Q1JA 2ZKSA 1Z6JH 1SGTA 2H1UA 1DY8A 2H2ZA 3VB5A 4NFEA 3GDUA 5L2ZH 4KP0A 1IQJA 1S5SA 3RXTA 3KNXA 1ESTA 1TPAE 3ZV8A 1D6WA 5L6NH 3U8RH 2BD2A 2TBSA 1T32A 1AB9B 1Q2WA 1N6YA 2CMYA 2C93B 3HKJB 1N8OC 3U9AH 1PPCE 1F5RA 1FIWA 4RN6A 4X0WU 4FUIA 3S7HB 3BTKE 3P8GA 4UFGH 1UTLM 6ESTA 1OSSA 1OP0A 3ATMA 4Y0YE 1Z1JA 2FM2A 1VCQA 3SHCH 1OYTH 1BTZA 3M5LA 1W13U 1HAXB 2CF8H 2TRMA 2EI7A 3PMHB 3ATIA 3M3SA 1YF4A 3KQBA 1EPTC 2ZPRA 2FI3E 2H5DA 1JRTA 3M61U 1PPGE 3ZZ6A 9LPRA 4HTCH 2JH5D 2QGRA 1C2JA 4IW4E 2J38A 4NA7A 1W7XH 3JZ1B 1AIXH 2FTLE 4ZKRU 1UTJA 2ZNKH 2O9QA 2RCEA 1IQGA 3BSQA
chains in the Genus database with same CATH superfamily
4WMEA 2C8ZB 2BMGB 1HAGE 5A0CA 2OC0A 2XYAA 4SGAE 2A2QH 4F49A 3K2UA 1BCUH 2HNTE 3VXFH 5ABWA 1TMBH 4UONA 5LPEA 1C5WB 5FPTA 1G32B 4BTUB 4BXWA 2FESH 1QFKH 2HALA 1GCTC 1EASA 3HKIB 3NRLA 4UE7H 1TRNA 2UUJB 1MABB 1QY6A 1XUJA 1K9OE 2PKSC 4XSKU 3RC5A 2A4RA 4GCHF 1YGCH 4U32A 3F9FA 1GG6B 4JZ1A 1NS3A 2J98A 2PSYA 3SJOA 2J4IA 1MBMA 2NWNA 3STJA 4M9FA 2VVCA 3KQ5A 3A84A 1UO6A 4OGXA 1KLJH 1C1QA 3Q3YA 3SNDA 1TNGA 3E16B 2EQNA 3BTHE 4KKDA 1JIRA 1GJDB 1O3AA 3RMMH 4FUHA 4P02A 2FEQH 5E2PA 3A8BA 1GMDF 4AG1A 4XBBA 1AE5A 1IAUA 2AS9A 8LPRA 2G4TA 3P6ZB 2XC4A 3O8RA 1BRCE 1YCPK 3RU4T 4U01A 3ATWA 1W2KH 2ZTZA 4I8KA 1BIOA 1F5KU 1EFRD 5ESBA 1HRTH 1GBEA 3RU4D 1G3CA 2STBE 1O2HA 1SQOA 1MTUA 3E1XB 2J92A 1H8HD 3OY5U 3RLWH 4DURA 2JH0D 1ZRBA 2OTVA 3SV6A 4MNVA 1IQEA 4E7RG 2BQ6B 4KELA 2DE9A 3ATLA 1HCGA 3SZNA 2PFEA 1SKYE 4WXIA 5E0HA 3U1IB 2V3MA 1NFUA 5AFYH 1QL9A 2O8LA 2XWAA 3PV4A 1FQ3A 1WQVH 1ABIH 1ETSH 5TCCA 1C2MA 4B75A 2BVRH 1UVSH 1AVWA 3A7ZA 1LVOA 1QRXA 2UUKB 3A7XA 2W26A 2TGAA 1O2PA 1TRYA 1G37A 1GBFA 2TGPZ 2Z6BD 2VWMA 1SGQE 4Z0KA 5AF9H 3MNCA 1MTWA 3QTOH 1GHZA 1K2I1 4JZEH 3BTTE 3UTUH 1PPBH 2R2MB 3RMOH 1S84A 1Z7KA 1C5ZB 3DSOA 3PMJA 1C5UA 2D1JA 3GY4A 1E79D 3RXHA 1O2LA 2ZHWH 2CV3A 1NZQH 1ETRH 2VIVA 1HJAB 2Q6FA 2J5UA 4F4OC 1V2PT 2A4QA 1O2UA 1NPMA 3RXAA 1H9LB 2Z94A 1QA7A 2ZFSA 1KXFA 3A7WA 4B2AA 1AKSA 1TBQH 1S6HA 3GY7A 4ZH8A 4YOJA 3A8CA 5FHTA 1F0SA 4GLYA 1SMFE 1O2NA 1P09A 4RI0A 5EGMA 1V2MT 2TIOA 3SORA 1MU8B 3ZZ5A 5AHGH 2L74A 4K8YA 1K0HA 3A82A 3H09A 2YMSC 4NG9H 3RM2H 5IYTA 1OP8A 2J95A 1EZQA 1MQ6A 1RIWC 4ABDA 1KLTA 1HAIH 1PQ7A 3CS0A 2KAIB 5EODA 1TLDA 4CBNA 1AFQC 5GJ4B 1GI9B 4Y71A 1SLVB 4GHTA 1QQ4A 1NO9H 1GDQA 3PMAB 1K22H 2OXSA 2QE7D 4Y11E 1KIGH 1S6LA 1GI0A 1VGCC 4ISNA 3F1SB 1CGIE 1SR5C 1SGEE 4CH8B 1ZHMA 4B76A 1ESBA 3OX7U 3TPIZ 1E0FD 3GYLB 2XCFA 3MI4A 4Y0ZE 2QYIA 3GDSA 4Z1MD 1NM6A 2HVYB 1F0RA 2AMPA 2XW9A 2PP6A 5EQSA 4NCYA 2ZTYA 2QV1A 1DDJA 1O3FA 1O5CB 3P95A 4I8HA 4O97A 3UNQA 2AFQB 1C9TA 2AGGX 3DFJA 5BPEA 1ZSJA 3ZZBA 2KX4A 5EQRA 1NU9A 2NU1E 4B6FA 4YLUA 1A3EH 3BTWE 4FU8A 1ELEE 2VGCB 3LOXA 2JJ1D 5DSFA 4ABHA 4KGAA 1WAYB 1O37A 4CREA 2RA3A 1P9UA 2O8TA 5DP6A 3A81A 2YMSD 1C5YB 3RC6A 1G3DA 1OWEA 2FI5E 5DO4H 2GZ8A 1GHBG 1QRWA 2IJOB 5DJ7A 3TK5A 1A3BH 2A7CA 2OC1A 1GHBF 1FN8A 1FNIA 1UCYK 4I86A 1UTKA 3TH4H 2BLVA 2LP6A 3M5NA 1EJNA 3RLYH 5HYOA 2G00A 1SI5H 4U2WA 1HNEE 2WZQA 4ZKSU 2BD4A 5GWZA 4VGCB 2OBQA 3TVJB 1GHAG 3PYHA 3UFAA 1D4PB 1G9IE 7KMEH 5LPFA 1MMJN 1UTMA 1GHAF 1TGBA 1BITA 1XMNB 5FL7D 2JETB 3BG4C 2A0QB 3LIWA 1FY1A 3SI4H 5L2YH 1TYNA 2XXLA 4DIIH 1C9PA 3FP7E 1E1QD 1XKBC 2WHXA 4LZ1H 1QBOA 3PB1E 1GBTA 2BXUH 1C5LH 3GS9A 5JB8S 5C20A 3N7DA 2ZIQH 3E91A 1P2OA 4I31A 3TJNA 2VIPA 2HPPH 2ZGHA 1HAYB 1WTGH 3GCTF 3VB6A 1Y3UA 1FIZA 3Q3XA 2V7QD 5EJZA 2GDEH 2F3CE 2QXHA 1W8BH 3AAUA 3R0FA 5EW2H 1TA2A 5GIBA 2GVFA 6GCHG 1Z1IA 2HLDD 1UK3A 3KQDA 3SUDA 1EOLA 2ZDAH 5DPAA 1C5QA 1ZTLA 2SNWA 6GCHF 1Y8TA 4Q7ZA 1S0QA 2ZA5A 1F0UA 3GCOA 1MU6B 2KCYA 1C1RA 1SLXB 1XX9A 4Q7XA 4D9RA 1Y59T 2F83A 1TPSA 2WPIS 2GV6A 4MG3A 1P11E 4RSPA 3F9GA 5C17A 2P59A 1O2XA 3MNSA 2FO9A 1O3DA 4NA9H 2VU8E 4DOQA 1C5TA 1QNJA 2WPMS 1AN1E 2PHBA 3SOSA 1L4DA 3I78A 1AZZA 1OWIA 1SGIB 2A7HA 1DT2A 5DP9A 3ZZ4A 1O5BB 1EAUA 2ZDMA 1NN6A 1NTPA 3E90B 3VXEH 5A09A 3L3TA 1MKXH 1BTUA 2OINA 1LKBA 3E6PH 3HK6B 4MVNA 3JZ2B 5F8TA 4TWWA 1H8IH 1O32A 1OYQA 3MO9A 3T25A 3D49H 5LPRA 1ELBA 4I8GA 1XXFA 1C2LA 3MH7A 2BX4A 3M3TA 5CMXH 2XCNA 4AB9A 1XUFA 2JKHA 2FPZA 2WV5A 5DP3A 2RFKC 1UTQA 5G4BA 1OWKA 2B8OH 1ZZZA 2SGPE 3ITIA 4E06H 4OM9A 1KLIH 1B5GH 1A2CH 1L1JA 3RXCA 2P8OC 4ZKNU 2G55A 3P17H 4NZLA 1O5AB 1K21H 1KXAA 4I8LA 1GGDC 2VVVA 3TK9A 5L30H 1K28D 3M35A 2GCTC 3URCA 3TK6A 1C5MD 2ASUB 2ZU3A 1EXFA 4Y79A 3BTDE 1A5GH 3F9EA 1NBMD 4NA8A 5C0TA 1GI2A 1BTYA 1TONA 4X1QU 3GY8A 5A8YA 4YZUA 2BD9A 3RXPA 3MU0A 3S9CA 1TX8A 1GI5A 2G81E 1NT1A 2VH6A 2J34A 1NC6A 1PPFE 1MQ5A 3A85A 2WYGA 3RXJA 1K1IA 1OHHD 5E2OA 1NRSH 2XNDD 3FANA 1RTLA 1NFYA 2XNIA 3E3TA 3RUOA 3B23B 1V2UT 3EE0B 4BAQB 1AWHB 4H6TA 4AX9H 2WPHS 1GBKA 2PV9B 3SUGA 1C2HA 1RD3B 3RXSA 1S82A 1Y3XA 1HAZB 1DICA 1RFNA 5FXLA 1VZQH 4BAOB 3T29A 4HFPB 1OWDA 4CRBA 3Q3KA 4ASHA 5DG6A 3LKWA 4HG6A 1ELAA 1GBHA 3LGTA 3TU7H 5F03A 1IQLA 3L6PA 5C5OA 2QXJA 5CE1A 2ZCLP 2PWXA 4FVDA 2QAAA 3SQEE 4NIYA 2FYQA 3A8AA 2FZZA 2OQUA 3GY6A 2BVSH 4O03A 1WTHD 1NESE 3H7TA 4MNWA 5J4SA 3MU8A 2C4FH 3T2NA 2FTMA 1Q3XA 1GBBA 4AYVB 3B8JA 1V2QT 4Z6AH 3S9BA 2Y7XA 1SGNE 1UTNA 4Y8XA 1HFDA 1FY5A 1Y3WA 1ANBA 2HNTF 3BIVH 1AVXA 4WH6A 4CRFA 5A0BA 2XRCA 2GMTB 2RDEA 1GBLA 5GCHG 2WV4A 3RXUA 2ZP0H 3UUZA 4CR5A 4X6PA 4ABGA 1ZHPA 1YPEH 4OGYA 1C4Y2 1EAWA 3VFEA 5JBTA 2PW8H 4YLQH 3T5FH 3ZZAA 3MH6A 2BY6X 1VITG 4WXVA 9ESTA 1CT2E 3TH3H 1MZAA 3SBKA 1VITF 3QZRA 3SJ8A 3ZZ9A 3MU1A 2R3YA 3HGPA 1LHCH 4MNYA 4X2YA 3SW2B 1MKXK 3A7VA 4GPGA 5FCRA 1C4U2 1UCYE 1ORFA 1LHDH 3KN2A 2D26C 1GG6C 4NIWA 3STIA 1RS0A 2SGFE 3GY3A 1HV7A 2ZGCA 5HKKD 3SV9A 2NU0E 1LHGH 2FI4E 2G51A 2VWLA 1TNJA 1QL7A 4J1YA 2B5TB 3A89A 1SGDE 2EC9H 3W1EA 4A1XA 2GV7A 2C8WB 2G8TA 1EUFA 1O0DH 2FDAA 3LT3A 1O3IA 1V2KT 2V0BA 5EPNA 2VH0A 3V7TA 2K0QA 1GBMA 5HM2A 1PPZA 3PLPA 2W3KA 4DY7B 2KAIA 1GVZA 1H9HE 2R0KA 1H9IE 3GCHB 1YLDA 2A5KA 4FU9A 1FI8A 1O5FH 1BHXB 1EP5A 1SVPA 2GGVB 2W3IA 2ZU5A 1SHHB 2ZC9H 3PTNA 2HWLB 3BV9B 1O3GA 2ZCHP 1SB1H 1TGCA 2HRVA 3SNEA 2AMDA 1SOZA 1BOQA 2ZECA 4JZDH 2ZFFH 2PSXA 4UD9H 3PMBB 1C2IA 1TX6A 2BZ6H 4FUJA 3VB3A 1TALA 1QBVH 3NPSA 2VIQA 4B1TA 1Z8JB 1TB6H 4IS5A 1XUIA 5KGOA 3SGBE 3FZZA 3KQEA 3U8TH 1YYY1 1D3PB 1ABJH 1DY9A 3EA9A 2GZ7A 1BBRH 1T8OA 1IQKA 1P10A 3ZVFA 3LC3A 1BJUA 2PR3A 4GCHG 3M5OA 1SG8B 1E35B 1GHVH 1B7XB 1JXPA 2KFWA 1OS8A 2A2XH 2JJ2D 1A61H 2DE8A 4NWKA 1TQ7B 1UHBB 2XWBI 1LMWB 2PTNA 2H9TH 2FLBH 3MH4A 1O3HA 4Q2KA 4IBLH 4A1VA 5JBBS 4K60A 1HJAC 2Y82A 4CRGA 1M9UA 5EXNA 2XBXA 3PROA 4CRDA 1D3QB 1V6DA 3SU0A 1A46H 4K3JA 1G30B 3RMLH 5JBCS 3A7YA 2M2AA 1Y3YA 1P2MA 2EI6A 4FUCA 1HJ9A 1GMDG 3GICB 1O2MA 1DSUA 2DUCA 3MYWA 1F2SE 1K1MA 1ZTKA 4LK4A 1ELGA 1ESAA 4A92A 1ANDA 1WCZA 3BG8A 3URDA 3IG6B 4WF8A 4CRAA 4FU7A 2ANYA 4MTBA 4GUXA 5K0HA 2F9VA 1AI8H 2L6OA 1ARBA 2BX3A 2G5VA 1EOJA 3LGYA 1YC0A 3FKSD 1G2MA 1YPMH 2BYAX 1AFEH 2Y5HA 2G5NA 1YBWA 1AVGH 2ZHFH 1TMTH 3MO6A 4F55A 2EY4C 1DUEA 3LONA 2D2DA 4FUFA 7GCHG 4MLFB 3M7UA 1W3CA 1NFWA 4I32A 2F9PA 7GCHF 2SFAA 3F2HA 4ZROA 2FODA 4IGDA 5BRRE 3RXVA 1KDQB 2VIWA 4IN1A 2ANWA 3DFLA 3VGCB 5FPSA 2ZGXH 2W7UA 5GXPA 8KME2 1AY6H 3QK1A 4JK6A 1P2QA 4YT6H 1JIMA 4RT0A 3RDZA 1QBNA 5TJXA 5DP7A 2FOAA 1X7AC 3VPKA 4HGCA 1BT7A 2CHAB 3TJOA 2H9HA 1TFXA 2ZHDA 1BRAA 1YY3A 1JMOH 2UWLA 4ZMAH 1O3EA 3CP7A 1XUHA 1P2IA 1ANCA 1L4ZA 1NRPH 3QTVH 4X1SU 2GCHF 1ETTH 1FY3A 1V3XA 1EAIA 4BXSA 3VEQB 2XC5A 1C1PA 3KL6A 2VGCC 1DPOA 3WWFA 1CGHA 1VCPA 4YOIA 4ACAA 2IOTA 1FONA 1TIOA 4NGAH 1W14U 3O8DA 1O2WA 1SGFA 2P94A 4CBOA 4Y6DA 1SPJA 3RXOA 1DWDH 1PQ5A 2ZFQH 4ABJA 1C2GA 2BTCE 3O8CA 1GDNA 1G36A 3UIRA 1P04A 1GCTB 1HXFH 1O2VA 3SU6A 3QUMP 2HGTH 3D62A 2ZQ2A 3M7QA 4Q80A 1C1UH 1EB1H 1ZMLA 5DN6D 1J16A 3PO1B 3K65B 1PQAA 4WWYA 3RXGA 6CHAB 1TQ0B 3RXRA 3GISB 4VGCC 1Z8RA 3KEEA 1QB1A 1T4VH 1WXRA 1JBUH 1VCWA 1UW7A 2QXGA 3N7OA 3M37A 1TGTA 3EA8A 5H4IB 2ANKH 3SUEA 4DGJA 2OUAA 3ZIAD 2BDAA 4ABBA 2JETC 1WUNH 3ZVDA 1UK2A 2BB4A 1F92A 4ACBA 2Z9IA 2OK5A 1FX0B 2CK3D 3A80A 4MPXA 1K1NA 1AHTH 5A2MH 2ZCKP 3U8OH 1P01A 1BBRK 2FLRH 5JYIA 1ZPZA 3UREA 1C5SA 4X1NU 1HAPH 1EZSC 2BD8A 3C1KA 3KGPA 1QL8A 1GBDA 1XKAC 2C8XB 2WYJA 1SFQB 1TX7A 3SU1A 3ZYDA 2K8IA 3RXEA 4X8VH 3UWIA 2O8UA 4UDWH 2J2UA 1K1PA 1UTPA 1O3OA 5DGJA 5DKMA 2RDLA 2D8WA 4JYTA 4F48B 1GL1A 4DW2U 2FOFA 1GMHG 1HPGA 5B6OA 1AQ7A 3UQVA 2Z3CA 3MH5A 3FFGA 3ZVAA 1FAXA 1C4V2 1EATA 1THSH 2WPDD 3FZDA 1GMHF 1GPZA 2ZTXA 2F9NA 3LJJA 1GJBB 1O2TA 1TA6A 1W12U 4A7IB 1O3JA 4AYYB 1QGFA 3QLPH 2AMQA 5F53A 2QF4A 1SGPE 2XTTB 5AFZH 1BMLA 1MD8A 3LGVA 1LVYA 1V2OT 3SU5A 1ZOMA 2W6ID 7LPRA 1EP6A 4NIXA 1LPKB 3VG8A 2ZFRH 2Y6TA 1O39A 1O3PB 2PUXB 4LOYH 4JCNA 1VJ9U 2SGEE 1HXEH 4OS4A 1MTVA 1MZDA 1PFXC 1BMFD 2WSSD 3NUMA 5C3NA 3P8NA 1W0YH 2HOBA 4OS6A 4IN2A 4D76A 1BRBE 2JIZD 2ZFTA 1EQ9A 4Q63A 1P0SH 1GWAA 1BRUP 1G3EA 1BTXA 1PQ8A 3H5CB 3OTPA 1T8NA 1O3CA 2XBVA 5EXMA 4ABAA 3F68H 2G52A 2QY0B 3LPRA 1XXDA 1HDTH 3BIUH 3NZIA 2A5AA 4ZCNA 2F4LA 5PTPA 4X2VA 4TYDA 4MQAA 1GJ4H 1T31A 2QXIA 3SHAH 4WH8A 1CBWB 1FY8E 1BMNH 3OFND 3SU3A 2QA9E 1YPKH 4FUDA 3GCTG 1MAXA 1CA0B 1V2JT 2R0LA 1P3CA 4XRNA 5IDKA 3TITA 1SGRE 3TGKE 1YLCA 1WYKA 2FXRA 2FOCA 1RXPA 2FOMB 3U28C 4K1TA 1LQDB 2B0FA 4O9VA 2YNBA 1RIWB 3PRBA 3PWCA 2ZG0H 3MU5A 1SC8U 3TNSA 3K6YA 1SGFG 2ODYB 3WW7A 1C1SA 3MOCA 4ASUD 1S85A 2UUFB 3SV2H 2EI8A 4H6SB 1E1RD 1BMAA 1QR3E 1XM1A 3PWBA 4INLA 4AC9A 1GBCA 3KYGA 4HI3A 1N6XA 1RTKA 1ZTJA 2KZ4A 4MPUA 1C2EA 3K6ZA 3WWBA 3ZZDA 4YO9A 3PV2A 3SN8A 1AWFH 5DK1A 3R3GB 3FAOA 3P8OA 1FUJA 2EA3A 1P2KA 3UNSA 5A8ZA 3LGWA 1DWBH 1O31A 4AG2A 1QURH 4R8TB 1Z71A 3TGJE 3BEUA 1SGCA 4X1PU 2GTBA 4Y8YA 2NU3E 3ZV9A 1P9SA 3RXIA 3PTBA 4XE4A 1HIAB 1A7SA 4JZIA 1KSNA 3SZEA 1FN6A 4NWLA 1WSSH 5FX5A 5C5NA 1HAVB 2F43B 3UB0A 3QO6A 4CH2B 1CHOF 2PUQH 2AH4X 2GT8A 1MCTA 2OBOA 4INKA 2BLWA 1TGSZ 2JH6D 4X8SH 2ZFPH 1INCA 1YPHE 3BTFE 3HATH 3SNAA 1FPHH 3CNRA 3UNRA 1MBQA 1K1LA 1TWXB 2QF0A 1SQAA 2FOBA 2GMTC 2Q6GA 1E37B 1O5GH 1OP2A 3RC4A 1UVOA 2SGDE 4DIHH 3W95A 1ZPBA 4TT3D 2FIRH 2P3UB 1TRMA 2BY7X 3QWCH 5LGOA 2CGAA 3OEHD 2STAE 2VIDA 1O2QA 2EEKA 3B9FH 2LPRA 2ZI2H 5EU8A 2J9NA 4MPWA 1AKSB 2ZPSA 3M3VA 4YM9A 2BHGA 1O3BA 2KCPA 3SV8A 1SQRA 1C5PA 1KXDA 2QN5T 3NKKA 1FMGA 1C1VH 1P12E 3DSGA 1D3TB 2ZGBH 1BZXE 1C2FA 1YP9A 2BY9X 4WVPE 3KQCA 2WUBA 4X8UH 2ZWLH 3G01A 1ELVA 4JYVH 3C27B 1OWHA 1AO5A 1TNHA 1E38B 3NK8A 2OC7A 4D9QA 5EQQA 1GI7B 1EJAA 2P93A 5C67A 1WOFA 2AIPA 1Z6EA 4H4FA 2A5IA 3OY6U 1AB9C 3QGJA 1ANEA 1XVMA 3PV5A 1IQFA 1P05A 2R3UA 2BOHB 2KM0A 4QT8C 4XOJA 4CRCA 2W6JD 1P2NA 2BDBA 2TGTA 1S0RA 1Y5BT 1YCPM 3TJVA 1HBTH 1T7CA 4X2WA 3SUFA 3GCHC 1IQMA 5ETXA 4IMQA 4IC6A 3MNBA 2H5CA 3A87A 2ZF0H 3LH3A 2OQ5A 3ZZ7A 3RXQA 4FUBA 2LELA 4DVAU 2V3OH 3PLKA 3QZQA 2GX4A 5I46H 1ZJKA 4YT7H 1OXGA 3BTGE 3RXDA 1O5EH 2FP7B 4GSOA 2ALPA 3OAAD 1XVOA 2KCAA 3P92A 1YM0A 2ZZUH 1J14A 2CJIA 1MKWH 2HPQH 2BDGA 2FOGA 3UR6A 2G4UA 1UTOA 3AASA 1FZZA 1DWCH 5CHAB 2YNAA 3P70B 1O3MA 1T4UH 1QHRB 3GOVB 4ZHLU 2GDDA 2F9OA 2PKAB 1GVKB 4ZUHA 1BQYA 1N1LA 2CXVA 2BDHA 2ULLA 5HIYA 5E0JA 2QIQA 5DP8A 1W7GH 1SHYA 1QRZA 3WY8A 3I77A 3L33A 3D23A 1W10U 2ZEBA 1C5RA 2ANMH 3U98H 3VB4A 1DLEA 1P57B 3CS7A 5T6GA 1ZMJA 2F9UA 3NXPA 3PM3A 3BTEE 3V12A 1DANH 4INHA 4AGKA 3FP6E 1BHXF 2UWPA 2ZDVH 3Q76A 3SJ9A 3QN7A 1H8DH 1QB6A 1GMCG 4WMDA 4X6MA 4RT1A 1TNIA 3ENSB 4ABIA 4A5TS 1C5VA 2KR7A 3I29A 3KCGH 3LGIA 3SNCA 4ZKOU 1GMCF 3RMNH 4TWYA 1ZLRA 2AHME 1C1NA 4K1EA 2TPIZ 4THNH 1D6RA 1LVMA 1UK4A 2Z9JA 3ZVCA 1Q31A 2A31A 4NSYA 3IITA 3OTJE 1LCYA 1IHTH 2SGQE 5HIZA 1O36A 1BTWA 1DOJA 1THPB 2A4OA 4KTSA 1P3EA 1V2ST 4K1SA 1DVAH 1FXYA 1ZGVA 4XD7D 3OU0A 1L0ZA 4MNXA 1EX3A 1GI6A 1ELTA 1Y3VA 4K8BA 4OS5A 2C8YB 1UJ1A 3UY9A 1YPLH 4DCDA 3V0XA 3AVZA 4TSFD 3EGKH 1O2GH 1RRKA 3DSPA 4WMFA 4BANB 1SGYE 2WPJS 3T62A 4M7GA 1CSOE 1B0FA 3TGIE 1TBRH 3RP2A 3VGCC 3SNBA 2V35A 4LXBH 2Z9LA 4Y76A 3W94A 2ILNA 1F0TA 1LHFH 2IN2A 3F0OA 1ZGIA 2A1DB 2BDYA 2CHAC 2QF5A 1FDPA 1MTNB 4AZ2B 3AW0A 1BDAA 1LKAA 4Y7AA 3E0PB 2V3HH 1YKTA 1GI3A 2HLCA 4ZXYH 2ZDKA 3DUXH 1W0JD 3GCNA 1WBGB 1O34A 1C5OH 1KMHB 2ODPA 2M5TA 2R9PA 5CHBA 3OE7D 1J15A 4CHAB 3FP8E 2VBCA 1VKYA 1O30A 1EZXC 3RXMA 3SO3A 1O2IA 1IQNA 4MPVA 2VVUA 1KY9A 4X2XA 2FX6A 1VJAU 3M7TA 2QCYA 1A1RA 2FS8A 4P00A 3PO1C 1H1BA 2SGAA 4I33A 5KECA 1SFIA 6CHAC 1CE5A 3DA9B 2PLXA 1C5NH 4XDEA 2H6MA 2VWOA 4K5ZA 1DM4B 1BMMH 1O3NA 1LO6A 2F9BH 1P06A 1LQEA 1C1OA 2P3TB 2QC2A 1QA0A 1JRSA 4ABFA 4B71A 1HB0B 2C90B 5DP5A 1K1OA 5GNDA 2J94A 4R0IA 1CU1A 1FJSA 2KCOA 3A7TA 3NWUA 3TLOA 1MKWK 2ZQ1A 1LVBA 2IPHA 3DT0H 1N8OB 1QIXB 2XBWA 1O3KA 1B0EA 2BQ7B 1UVTH 3RXKA 5C1UA 1TOMH 4E7NA 1EJMA 2A45B 1L1NA 4BAMB 4FVBA 5EW1H 3QDZB 3BTQE 1UCYH 4KTUA 4O3TA 3MNXA 3TH2H 1V2LT 1EPTB 1G2LA 1NU7B 2F91A 1JWTA 5I25A 3BN9A 2ZU4A 3ZVGA 1TPPA 3ELAH 1DFPA 4AOQA 1O3LA 1PYTC 2Q6DA 3LU9B 1V2NT 3S0NA 2GCHG 3IWMA 1LPZB 1P8VC 3EAJA 1O38A 4ZXXH 4I7YH 2B7DH 1KXEA 1W0KD 1A4WH 1WU1A 3TJUA 1KXCA 3ZVBA 1ZSLA 1O2RA 2Y80A 1SL3A 2BY5X 1ZMNA 2W5EA 4Y7BA 4UEHH 1COWD 2ZHEH 1HAHH 3GY2A 4D8NA 1HIAA 1NFXA 2TGDA 5HGGA 3SI3H 3TNTA 3D65E 4AORA 1HAVA 1KYNA 1OPHB 1GJ9B 3S9AA 1ZHRA 2PKSB 3RXBA 4YOGA 3T27A 1TAWA 1MD7A 1O2SA 3KF2A 4TPYA 1GJ8B 1YPJH 1J8AA 1GCDA 1AGJA 4JMYA 3KYFA 5EJ1A 1BB0B 5FPYA 1IQHA 2FX4A 2BD7A 4XBCA 5C0UA 5JDUB 1UVPA 4K69A 1MUEB 1TMUH 1S83A 3MMGA 5E0GA 1YPHC 2J97A 2OLGA 1BUIA 3CENA 3HK3B 2PGQB 2WINI 2ZU1A 3FVFB 1PYTD 1DSTA 1HLTH 3MFJA 1GJ6A 5C1YA 1A0JA 1AMHA 1XUGA 4AFUA 4ISLA 4ZHAA 1CBWC 1ID5H 1O2JA 1CA0C 3P8FA 1LTOA 2Z9GA 2THFB 4RKOB 4D7GA 2BQWB 4ISOA 3AW1A 1CT0E 1CHGA 3KIDU 1J9CH 1GJCB 2ZO3H 1Z8GA 3QX5H 2Z7FE 3U69H 3A86A 1G3BA 1SOTA 1RTFB 4GAWA 3UOPA 4D7FA 5LH8A 1CT4E 1O33A 1GBJA 1ZR0A 4NIVA 5GPIB 4GHQA 4AFSA 5EPYA 3TIUA 1WV7H 2V6NA 1OKXA 2AIQA 4BOHA 1YWUA 3SJKA 3K9XB 1QCPA 4XFQA 4BTIB 1RJXB 3UAIC 1VITH 4H42U 4WY3A 3SGAE 3ZZ3A 3V13A 4GVUA 1BTPA 2A7JA 7ESTE 3SU2A 1U6QA 2LNCA 4ZAEA 3OSYA 1HUTH 2FMJA 3UPEA 5DP4A 1QZ8A 4FOUC 1DXPA 4E05H 1DLKB 1MAYA 1V2TT 3ODDA 3RU4E 8ESTE 1GI4A 1TGNA 1A0LA 1NRRH 2UWOA 1O2ZA 5HXFA 2NU2E 3A83A 3ZYEA 2CN0H 1WDIA 1LDTT 3OYPA 3ZZ8A 1P03A 1TBZH 1PPHE 5EJLA 4YXWD 4TY7A 4UFEH 5F8XA 4X6NA 4DJZB 1TNLA 2RA0A 3MHWU 1FPCH 2BLOA 4JZFH 3SGQE 4FUGA 3MQKC 8GCHG 1QJ1B 3M5MA 3PLBA 1NRNH 5FAHA 1GBAA 1QJ6B 1YLNA 4A6LA 4AGJA 5FCKA 2ZDNA 1FLEE 3DHKH 1ELCA 8GCHF 1BA8B 3EA7A 4AFZA 2J98B 2FYRA 3LH1A 1FV9A 3MWIU 2OCVB 1DX5M 2ALVA 4UFDH 2ZU2A 1DE7H 1EAXA 1ELDE 4JK5A 3F2GA 2FOEA 1NROH 1SLWB 1GHWH 2PKAA 2Y81A 1P2JA 1GI1A 4TY6A 4OS2A 3RM0H 5EOKA 3QGNB 4Q7YA 1LHEH 1TABE 1EZUC 4BNRA 3AAVA 5FX6A 2YMSB 1TOCB 2GKVE 4B74A 2ESTE 1IOEA 3S69A 3KHVA 1GVLA 4FXGH 1SBWA 4SGBE 4YESB 1KXBA 1O2OA 1AFQB 3FN8A 2FOHA 2IPQX 1ZSKA 1GJ7B 2ZGJA 4AN7A 2FWWA 2Y7ZA 3E8LA 2VINA 1SSXA 2Z9KA 1H8ED 5E8EH 2BY8X 1OWJA 5FBEA 4KTCA 3S7KB 1VGCB 3ESTA 2AGIX 5J4QA 5ESTE 1AUTC 1BTHH 1IHSH 1J17T 2ZHQH 1WQSA 3F9HA 4ZHMU 1SLUB 3LC5A 5EXLA 3V3MA 1OOKB 1QTFA 4NZQA 4RKJB 1L1GA 5F6MA 2GT7A 3N7EA 4IC5A 2SNVA 2XOKD 2VWNA 1E36B 3MO3A 4ISIH 3SU4A 2AYWA 1PPEE 2GJGA 4WJG2 4K2YA 5A0AE 4Y8ZA 4NSVA 4AB8A 3SYJA 1E34B 2BD3A 3ATKA 4BTTB 2VB0A 1CHOG 5JPMH 1GL0E 4J2YB 2BZAA 3RXLA 5K7RA 2A32A 2I6QA 3Q00A 4B2CA 1OX1A 1P02A 4X8TH 4HZHA 4YTAA 1CGJE 2CF9H 1GI8B 3T28A 3A88A 4Y10E 2PTCE 1DS2E 1O2KA 4JYUH 4B73A 3MU4A 5GDSH 2UUYA 1RGQA 2YOLA 1ZRKA 2OP9A 2PGBB 3NCLA 2AGEX 2JDID 3ZZCA 2BDCA 1V2VT 2VNTA 6LPRA 2K1QA 4CR9A 1ELFA 1Y5AT 1D9IA 1XUKA 5CHAC 2BM2A 5C2ZA 3O8BA 1ZJDA 1HGTH 3ZVEA 1DUAA 1JOUB 2XBYA 3BG4B 3EYDA 5IK2D 4TPIZ 2VJ1A 2GP9B 1K1JA 1H4WA 3VB7A 3BTME 4B2BA 5JBAS 5T6FA 4U30A 1UHBA 1ZPCA 1S6FA 1THRH 1Z8IB 5F8ZA 1NRQH 3HGNA 1SQTA 5EIYA 3M36A 1W11U 3E0NB 1QQUA 1YPGH 5HM9A 1NY22 1V2WT 4X1RU 3SQHE 1A0HB 1C5XB 1HYLA 5T1VA 1MH0A 2HNTC 5AVDA 1C2DA 3DCLA 5SGAE 2ODQA 4DT7B 5HMAA 1FY4A 3F0PA 3HPTB 1D3DB 2OD3B 3H7OA 3MTYA 1TNKA 2Z3DA 4ABEA 5C94A 5EG4A 1DXWA 3FO8D 5T3HA 1PJPA 5C1XA 1CQQA 2BOKA 4IMZA 2NU4E 1A5IA 1CO7E 4FETA 2WV9A 2A4GA 4MDSA 1AU8A 1IQIA 2AERH 3U1JB 1C1MA 1GDUA 1ZYOA 5CDFE 2GD4B 2P3FH 3PRDA 1O5DH 1CVWH 1KTSB 1Y5UT 1T8LA 1BBRE 2BLQA 4O3UA 1L2EA 3BEIB 2QF3A 4LZ4B 4UFFH 5JB9S 1QJ7B 1FAKH 3F3BA 1KDQA 1VR1H 1O2YA 2BD5A 4ISHH 1EB2A 2O8MA 2WUCA 3LGUA 5T6DA 5TCAA 1EKBB 1DWEH 4DT4A 5KEDA 3LDXH 2I6SA 2ZDLA 1EPTA 1T8MA 3SJIA 2Z3EA 3N99A 1UMAH 4DG4A 1MTSA 1C1WH 3DD2H 2XC0A 3GYMA 4BAHB 1HAOH 1C1TA 2C3SA 1GJ5H 2P95A 3UQOA 3GY5A 1AUJA 3BF6H 3UR9A 2WPLS 1GBIA 3EDXB 3UOUA 4A1TA 2P16A 3EQ0H 2B9LA 1AZ8A 2BXTH 2BVXH 1HJ8A 3F2FA 3LJOA 1W0ZU 2VIOA 4XBDA 4OS1A 2P8OB 1AD8H 3UWJH 1MTNC 1UVUH 3RXFA 4FUEA 1A5HA 1GGDB 1LPGB 1QB9A 2O8WA 2GCTB 2GZ9A 1YCPH 5FBIA 3BEFB 2Y5GA 3A8DA 1AE8H 1DITH 5GCHF 4AFQA 1S81A 2R2WU 4CHAC 1GJAB 1ACBE 4Q4LA 3FOAA 2W7SA 2WPKS 1TE0A 2H9EH 3T26A 4NFFA 4BAKB 2FS9A 1F5LA 4ESTE 3Q77A 1CA8B 1O35A 1C2KA 1BJVA 2BDIA 3GDVA 4I8JA 3ODFA 4X6OA 1F7ZA 5A8XA 2AEIH 1V2RT 1KTTB 4OS7A 1ARCA 2HVXA 1GHYH 1GHXH 4PROA 1MCVA 2RG3A 3F6UH 2Y5FA 3SV7A 1TPOA 2OC8A 2ZPQA 2Q1JA 2ZKSA 1NBME 1Z6JH 1SGTA 3OEED 2H1UA 1DY8A 2H2ZA 3VB5A 4NFEA 3GDUA 5L2ZH 4KP0A 1IQJA 1S5SA 3RXTA 3KNXA 1ESTA 1TPAE 3ZV8A 1D6WA 5L6NH 3U8RH 2BD2A 2TBSA 1T32A 1AB9B 1Q2WA 1N6YA 2CMYA 2C93B 3HKJB 1N8OC 3U9AH 1PPCE 1F5RA 1FIWA 4RN6A 4X0WU 4FUIA 3S7HB 3BTKE 3P8GA 4UFGH 1UTLM 3EE7A 6ESTA 1OSSA 1OP0A 3ATMA 4Y0YE 1Z1JA 2FM2A 1VCQA 3SHCH 1OYTH 3AK5A 1BTZA 3M5LA 1W13U 1HAXB 2CF8H 2TRMA 2EI7A 3PMHB 3ATIA 3M3SA 1YF4A 3KQBA 1EPTC 2ZPRA 2FI3E 2H5DA 1JRTA 2IJD1 3M61U 1PPGE 3ZZ6A 5B6LA 9LPRA 4HTCH 2JH5D 2QGRA 1C2JA 4IW4E 2J38A 4NA7A 4B6EA 1W7XH 3JZ1B 1AIXH 2FTLE 4ZKRU 1UTJA 2ZNKH 2O9QA 2RCEA 1IQGA 3BSQA
chains in the Genus database with same CATH topology
4WMEA 2C8ZB 2BMGB 1HAGE 5A0CA 2OC0A 2XYAA 4SGAE 2A2QH 4F49A 3K2UA 1BCUH 2HNTE 3VXFH 5ABWA 1TMBH 4UONA 5LPEA 1C5WB 5FPTA 1G32B 4BTUB 4BXWA 2FESH 1QFKH 2HALA 1GCTC 1EASA 3HKIB 4UE7H 1TRNA 2UUJB 1QY6A 1XUJA 1K9OE 2PKSC 4XSKU 3RC5A 2A4RA 4GCHF 1YGCH 4U32A 3F9FA 1GG6B 4JZ1A 1NS3A 2PSYA 3SJOA 2J4IA 1MBMA 2NWNA 3STJA 2VVCA 3A84A 1UO6A 4OGXA 1KLJH 1C1QA 3Q3YA 3SNDA 1TNGA 3E16B 3BTHE 4KKDA 1JIRA 1GJDB 1O3AA 3RMMH 4FUHA 2FEQH 5E2PA 3A8BA 1GMDF 4AG1A 4XBBA 1AE5A 1IAUA 2AS9A 8LPRA 2G4TA 3P6ZB 2XC4A 3O8RA 1BRCE 1YCPK 3RU4T 4U01A 3ATWA 1W2KH 2ZTZA 4I8KA 1BIOA 1F5KU 5ESBA 1HRTH 1GBEA 3RU4D 1G3CA 2STBE 1O2HA 1SQOA 1MTUA 3E1XB 2J92A 3OY5U 3RLWH 4DURA 2JH0D 1ZRBA 2OTVA 3SV6A 4MNVA 1IQEA 4E7RG 2BQ6B 4KELA 2DE9A 3ATLA 1HCGA 3SZNA 2PFEA 4WXIA 5E0HA 3U1IB 1NFUA 5AFYH 1QL9A 2O8LA 2XWAA 3PV4A 1FQ3A 1WQVH 1ABIH 1ETSH 5TCCA 1C2MA 4B75A 2BVRH 1UVSH 1AVWA 3A7ZA 1LVOA 1QRXA 2UUKB 3A7XA 2W26A 2TGAA 1O2PA 1TRYA 1G37A 1GBFA 2TGPZ 2Z6BD 2VWMA 1SGQE 4Z0KA 5AF9H 3MNCA 1MTWA 3QTOH 1GHZA 1K2I1 4JZEH 3BTTE 3UTUH 1PPBH 2R2MB 3RMOH 1S84A 1Z7KA 1C5ZB 3PMJA 1C5UA 2D1JA 3GY4A 3RXHA 1O2LA 2ZHWH 2CV3A 1NZQH 1ETRH 2VIVA 1HJAB 2Q6FA 4F4OC 1V2PT 2A4QA 1O2UA 1NPMA 3RXAA 1H9LB 2Z94A 1QA7A 2ZFSA 1KXFA 3A7WA 4B2AA 1AKSA 1TBQH 1S6HA 3GY7A 4ZH8A 4YOJA 3A8CA 5FHTA 1F0SA 4GLYA 1SMFE 1O2NA 1P09A 5EGMA 1V2MT 2TIOA 3SORA 1MU8B 3ZZ5A 5AHGH 4K8YA 3A82A 4NG9H 3RM2H 5IYTA 1OP8A 2J95A 1EZQA 1MQ6A 1RIWC 4ABDA 1KLTA 1HAIH 1PQ7A 3CS0A 2KAIB 5EODA 1TLDA 4CBNA 1AFQC 5GJ4B 1GI9B 4Y71A 1SLVB 4GHTA 1QQ4A 1NO9H 1GDQA 3PMAB 1K22H 2OXSA 4Y11E 1KIGH 1GI0A 1VGCC 4ISNA 3F1SB 1CGIE 1SR5C 1SGEE 4CH8B 1ZHMA 4B76A 1ESBA 3OX7U 3TPIZ 1E0FD 3GYLB 2XCFA 3MI4A 4Y0ZE 2QYIA 3GDSA 1NM6A 1F0RA 2AMPA 2XW9A 5EQSA 4NCYA 2ZTYA 2QV1A 1DDJA 1O3FA 1O5CB 3P95A 4I8HA 4O97A 3UNQA 2AFQB 1C9TA 2AGGX 3DFJA 5BPEA 1ZSJA 3ZZBA 5EQRA 1NU9A 2NU1E 4YLUA 1A3EH 3BTWE 4FU8A 1ELEE 2VGCB 3LOXA 4ABHA 4KGAA 1WAYB 1O37A 4CREA 2RA3A 1P9UA 2O8TA 5DP6A 3A81A 3RC6A 1C5YB 1G3DA 1OWEA 2FI5E 5DO4H 2GZ8A 1GHBG 1QRWA 2IJOB 5DJ7A 3TK5A 1A3BH 2A7CA 2OC1A 1GHBF 1FN8A 1FNIA 1UCYK 1UTKA 3TH4H 2BLVA 3M5NA 1EJNA 3RLYH 5HYOA 2G00A 1SI5H 4U2WA 1HNEE 4ZKSU 2BD4A 5GWZA 4VGCB 2OBQA 3TVJB 1GHAG 3PYHA 3UFAA 1D4PB 1G9IE 7KMEH 5LPFA 1MMJN 1UTMA 1GHAF 1TGBA 1BITA 1XMNB 2JETB 3BG4C 2A0QB 3LIWA 1FY1A 3SI4H 5L2YH 1TYNA 2XXLA 4DIIH 1C9PA 3FP7E 1XKBC 4LZ1H 1QBOA 3PB1E 1GBTA 2BXUH 1C5LH 5JB8S 5C20A 3TJNA 2ZIQH 3E91A 1P2OA 4I31A 2VIPA 2HPPH 2ZGHA 1HAYB 1WTGH 3GCTF 3VB6A 1Y3UA 1FIZA 3Q3XA 2GDEH 2F3CE 2QXHA 1W8BH 3AAUA 3R0FA 5EW2H 1TA2A 5GIBA 2GVFA 6GCHG 1Z1IA 1UK3A 3KQDA 3SUDA 1EOLA 2ZDAH 5DPAA 1C5QA 1ZTLA 2SNWA 6GCHF 1Y8TA 4Q7ZA 1S0QA 2ZA5A 1F0UA 3GCOA 1MU6B 1C1RA 1SLXB 1XX9A 4Q7XA 4D9RA 1Y59T 2F83A 1TPSA 2WPIS 2GV6A 4MG3A 1P11E 4RSPA 3F9GA 2P59A 1O2XA 3MNSA 2FO9A 1O3DA 4NA9H 2VU8E 4DOQA 1C5TA 1QNJA 2WPMS 1AN1E 2PHBA 3SOSA 1L4DA 3I78A 1AZZA 1OWIA 1SGIB 2A7HA 1DT2A 5DP9A 3ZZ4A 1O5BB 1EAUA 2ZDMA 1NN6A 1NTPA 3E90B 3VXEH 5A09A 3L3TA 1MKXH 1BTUA 2OINA 1LKBA 3E6PH 3HK6B 4MVNA 3JZ2B 5F8TA 4TWWA 1H8IH 1O32A 1OYQA 3MO9A 3T25A 3D49H 5LPRA 1ELBA 4I8GA 1XXFA 1C2LA 3MH7A 2BX4A 3M3TA 5CMXH 2XCNA 4AB9A 1XUFA 2JKHA 2FPZA 2WV5A 5DP3A 1UTQA 5G4BA 1OWKA 2B8OH 1ZZZA 2SGPE 3ITIA 4E06H 1KLIH 1B5GH 1A2CH 1L1JA 3RXCA 2P8OC 4ZKNU 2G55A 3P17H 4NZLA 1O5AB 1K21H 1KXAA 4I8LA 1GGDC 2VVVA 3TK9A 5L30H 1K28D 3M35A 2GCTC 3URCA 3TK6A 1C5MD 2ASUB 2ZU3A 1EXFA 4Y79A 3BTDE 1A5GH 3F9EA 4NA8A 1GI2A 1BTYA 1TONA 4X1QU 3GY8A 5A8YA 4YZUA 2BD9A 3RXPA 3MU0A 3S9CA 1TX8A 1GI5A 2G81E 1NT1A 2VH6A 2J34A 1NC6A 1PPFE 1MQ5A 3A85A 2WYGA 3RXJA 1K1IA 5E2OA 1NRSH 3FANA 1RTLA 1NFYA 2XNIA 3E3TA 3RUOA 3B23B 1V2UT 3EE0B 4BAQB 1AWHB 4H6TA 4AX9H 2WPHS 1GBKA 2PV9B 3SUGA 1C2HA 1RD3B 3RXSA 1S82A 1Y3XA 1HAZB 1DICA 1RFNA 5FXLA 1VZQH 4BAOB 3T29A 4HFPB 1OWDA 4CRBA 3Q3KA 4ASHA 5DG6A 3LKWA 1ELAA 1GBHA 3LGTA 3TU7H 5F03A 1IQLA 3L6PA 5C5OA 2QXJA 5CE1A 2ZCLP 2PWXA 4FVDA 2QAAA 3SQEE 4NIYA 2FYQA 3A8AA 2FZZA 2OQUA 3GY6A 2BVSH 4O03A 1WTHD 1NESE 3H7TA 4MNWA 5J4SA 3MU8A 2C4FH 3T2NA 2FTMA 1Q3XA 1GBBA 4AYVB 3B8JA 1V2QT 4Z6AH 3S9BA 2Y7XA 1SGNE 1UTNA 4Y8XA 1HFDA 1FY5A 1Y3WA 1ANBA 2HNTF 3BIVH 1AVXA 4WH6A 4CRFA 5A0BA 2XRCA 2GMTB 1GBLA 5GCHG 2WV4A 3RXUA 2ZP0H 3UUZA 4CR5A 4X6PA 4ABGA 1ZHPA 1YPEH 4OGYA 1C4Y2 1EAWA 3VFEA 5JBTA 2PW8H 4YLQH 3T5FH 3ZZAA 3MH6A 2BY6X 1VITG 4WXVA 9ESTA 1CT2E 3TH3H 1MZAA 3SBKA 1VITF 3QZRA 3SJ8A 3ZZ9A 3MU1A 2R3YA 3HGPA 1LHCH 4MNYA 4X2YA 3SW2B 1MKXK 3A7VA 4GPGA 5FCRA 1C4U2 1UCYE 1ORFA 1LHDH 3KN2A 2D26C 1GG6C 4NIWA 3STIA 1RS0A 2SGFE 3GY3A 1HV7A 2ZGCA 3SV9A 2NU0E 1LHGH 2FI4E 2G51A 2VWLA 1TNJA 1QL7A 4J1YA 2B5TB 3A89A 1SGDE 2EC9H 4A1XA 2GV7A 2C8WB 2G8TA 1EUFA 1O0DH 2FDAA 3LT3A 1O3IA 1V2KT 2V0BA 5EPNA 2VH0A 3V7TA 5HM2A 1GBMA 1PPZA 3PLPA 2W3KA 4DY7B 2KAIA 1GVZA 1H9HE 2R0KA 1H9IE 3GCHB 1YLDA 2A5KA 4FU9A 1FI8A 1O5FH 1BHXB 1EP5A 1SVPA 2GGVB 2W3IA 2ZU5A 1SHHB 2ZC9H 3PTNA 2HWLB 3BV9B 1O3GA 2ZCHP 1SB1H 1TGCA 2HRVA 3SNEA 2AMDA 1SOZA 1BOQA 2ZECA 4JZDH 2ZFFH 2PSXA 4UD9H 3PMBB 1C2IA 1TX6A 2BZ6H 4FUJA 3VB3A 1TALA 1QBVH 3NPSA 2VIQA 4B1TA 1Z8JB 1TB6H 4IS5A 1XUIA 3SGBE 3FZZA 3KQEA 3U8TH 1YYY1 1D3PB 1ABJH 1DY9A 3EA9A 2GZ7A 1BBRH 1T8OA 1IQKA 1P10A 3ZVFA 3LC3A 1BJUA 2PR3A 4GCHG 3M5OA 1SG8B 1E35B 1GHVH 1B7XB 1JXPA 1OS8A 2A2XH 1A61H 2DE8A 4NWKA 1TQ7B 1UHBB 2XWBI 1LMWB 2PTNA 2H9TH 2FLBH 3MH4A 1O3HA 4Q2KA 4IBLH 4A1VA 5JBBS 4K60A 1HJAC 2Y82A 4CRGA 1M9UA 5EXNA 2XBXA 3PROA 4CRDA 1D3QB 1V6DA 3SU0A 1A46H 4K3JA 1G30B 3RMLH 5JBCS 3A7YA 1Y3YA 1P2MA 2EI6A 4FUCA 1HJ9A 1GMDG 3GICB 1O2MA 1DSUA 2DUCA 3MYWA 1F2SE 1K1MA 1ZTKA 4LK4A 1ELGA 1ESAA 4A92A 1ANDA 1WCZA 3BG8A 3URDA 3IG6B 4WF8A 4CRAA 4FU7A 2ANYA 4MTBA 4GUXA 5K0HA 2F9VA 1AI8H 1ARBA 2BX3A 2G5VA 1EOJA 3LGYA 1YC0A 1G2MA 1YPMH 2BYAX 1AFEH 2Y5HA 2G5NA 1YBWA 1AVGH 2ZHFH 1TMTH 3MO6A 1DUEA 3LONA 2D2DA 4FUFA 7GCHG 4MLFB 3M7UA 1W3CA 1NFWA 4I32A 2F9PA 7GCHF 2SFAA 4ZROA 2FODA 4IGDA 5BRRE 3RXVA 1KDQB 2VIWA 4IN1A 2ANWA 3DFLA 3VGCB 5FPSA 2ZGXH 2W7UA 5GXPA 8KME2 1AY6H 3QK1A 4JK6A 1P2QA 4YT6H 1JIMA 3RDZA 1QBNA 5TJXA 5DP7A 2FOAA 1X7AC 3VPKA 4HGCA 1BT7A 2CHAB 3TJOA 2H9HA 1TFXA 2ZHDA 1BRAA 1JMOH 2UWLA 4ZMAH 1O3EA 3CP7A 1XUHA 1P2IA 1ANCA 1L4ZA 1NRPH 3QTVH 4X1SU 2GCHF 1ETTH 1FY3A 1V3XA 1EAIA 4BXSA 3VEQB 2XC5A 1C1PA 3KL6A 2VGCC 1DPOA 1CGHA 1VCPA 4YOIA 2IOTA 1FONA 1TIOA 4NGAH 1W14U 3O8DA 1O2WA 1SGFA 2P94A 4CBOA 4Y6DA 1SPJA 3RXOA 1DWDH 1PQ5A 2ZFQH 4ABJA 1C2GA 2BTCE 3O8CA 1GDNA 1G36A 3UIRA 1P04A 1GCTB 1HXFH 1O2VA 3SU6A 3QUMP 2HGTH 3D62A 2ZQ2A 3M7QA 4Q80A 1C1UH 1EB1H 1ZMLA 1J16A 3PO1B 3K65B 1PQAA 4WWYA 3RXGA 6CHAB 1TQ0B 3RXRA 3GISB 4VGCC 1Z8RA 3KEEA 1QB1A 1T4VH 1JBUH 1VCWA 2QXGA 3N7OA 3M37A 1TGTA 3EA8A 5H4IB 2ANKH 3SUEA 4DGJA 2OUAA 2BDAA 4ABBA 2JETC 1WUNH 3ZVDA 1UK2A 2BB4A 1F92A 2Z9IA 3A80A 4MPXA 1K1NA 1AHTH 5A2MH 2ZCKP 3U8OH 1P01A 1BBRK 2FLRH 5JYIA 1ZPZA 3UREA 1C5SA 4X1NU 1HAPH 1EZSC 2BD8A 3C1KA 3KGPA 1QL8A 1GBDA 1XKAC 2C8XB 2WYJA 1SFQB 1TX7A 3SU1A 3ZYDA 3RXEA 4X8VH 3UWIA 2O8UA 4UDWH 2J2UA 1K1PA 1UTPA 1O3OA 5DGJA 5DKMA 2RDLA 2D8WA 4JYTA 1GL1A 4DW2U 2FOFA 1GMHG 1HPGA 5B6OA 1AQ7A 3UQVA 2Z3CA 3MH5A 3FFGA 3ZVAA 1FAXA 1C4V2 1EATA 1THSH 3FZDA 1GMHF 1GPZA 2ZTXA 2F9NA 3LJJA 1GJBB 1O2TA 1TA6A 1W12U 4A7IB 1O3JA 4AYYB 1QGFA 3QLPH 2AMQA 1SGPE 2XTTB 5AFZH 1BMLA 1MD8A 3LGVA 1LVYA 1V2OT 3SU5A 1ZOMA 7LPRA 1EP6A 4NIXA 1LPKB 2ZFRH 2Y6TA 1O39A 1O3PB 2PUXB 4LOYH 4JCNA 1VJ9U 2SGEE 1HXEH 4OS4A 1MTVA 1MZDA 1PFXC 5C3NA 3NUMA 3P8NA 1W0YH 2HOBA 4OS6A 4IN2A 4D76A 1BRBE 2ZFTA 1EQ9A 1P0SH 1GWAA 1BRUP 1G3EA 1BTXA 1PQ8A 3H5CB 1T8NA 1O3CA 2XBVA 5EXMA 4ABAA 3F68H 2G52A 2QY0B 3LPRA 1XXDA 1HDTH 3BIUH 3NZIA 2A5AA 5PTPA 4X2VA 4TYDA 4MQAA 1GJ4H 1T31A 2QXIA 3SHAH 4WH8A 1CBWB 1FY8E 1BMNH 3SU3A 2QA9E 1YPKH 4FUDA 3GCTG 1MAXA 1CA0B 1V2JT 2R0LA 1P3CA 5IDKA 3TITA 1SGRE 3TGKE 1YLCA 1WYKA 2FXRA 2FOCA 1RXPA 2FOMB 4K1TA 1LQDB 2B0FA 4O9VA 2YNBA 1RIWB 3PWCA 2ZG0H 3MU5A 1SC8U 3TNSA 3K6YA 1SGFG 2ODYB 1C1SA 3MOCA 1S85A 2UUFB