3IG6B

Low molecular weigth human urokinase type plasminogen activator 2-[6-(3'-aminomethyl-biphenyl-3-yloxy)-4-(3-dimethylamino-pyrrolidin-1-yl)-3,5-difluoro-pyridin-2-yloxy]-4-dimethylamino-benzoic acid complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of orally bioavailable, non-amidine inhibitors of Urokinase Plasminogen Activator (uPA)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 52
structure length 245
sequence length 245
chains with identical sequence D
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ig6B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ig6B01
2VJ1A 2THFB 5DP5A 1Y3VA 1MBMA 1E38B 3LC3A 4XDEA 4I31A 1Y5BT 4B76A 4ISNA 4JZEH 3MH4A 3OYPA 1SQTA 1MD7A 3SUEA 2XC0A 1O33A 3IG6B 3MU4A 3BTFE 3ZZ7A 1CGHA 2GMTC 4X6NA 3VB4A 4AX9H 1SGNE 1GCTC 3TITA 3SI3H 2WYGA 3SUGA 4AOQA 4WH8A 3VB5A 1ZGVA 3PWCA 1UHBB 1JRSA 2PSYA 3S7KB 3D65E 4AORA 4GHTA 2BVRH 4IC6A 2A1DB 2VINA 1NESE 1UVOA 3LT3A 1P02A 4Y71A 1RTLA 1A61H 3PWBA 2NU1E 1BOQA 1GHVH 2BVSH 1UVPA 1Y3UA 1C5PA 3E16B 1XUIA 1FIZA 1O2MA 3PMAB 3TGIE 1PPEE 1GI1A 4LK4A 4AB8A 2AIQA 2FTLE 2GTBA 4AYYB 2HRVA 5GIBA 4DVAU 1JXPA 2FLRH 4MQAA 3NPSA 5FPYA 1RXPA 1NY22 3SOSA 4CRBA 1PPBH 2QXIA 2VH0A 4I32A 5FPSA 1DWCH 3RC5A 1BRCE 3E1XB 4XBBA 3SU2A 1TQ7B 3MU1A 1S0RA 1CHGA 4ABEA 1EUFA 2ZWLH 3HGNA 2R0LA 1LKBA 2ZECA 4XBCA 3UNRA 1C4V2 4YLUA 1SGQE 5EOKA 3M3SA 2GV7A 4DURA 5T3HA 1DUAA 1C1PA 2BZ6H 3V3MA 4UD9H 3P8FA 3LC5A 3SBKA 1UMAH 1W7XH 1YCPM 1K2I1 1FY3A 1O3CA 3K6ZA 1XMNB 1ZHMA 2HLCA 4A1XA 2IJOB 1W0YH 3M37A 5F8XA 1FY5A 1AY6H 2TGPZ 1P01A 3SJKA 1QBNA 1OP0A 1OOKB 2DE9A 7GCHG 1ZMJA 1NRRH 3RXQA 9ESTA 4DY7B 8LPRA 1NFWA 1ELEE 2ZTZA 1O3EA 3U9AH 3M5LA 3DUXH 1YPJH 1PFXC 1EZQA 3MU8A 1LPKB 4X8UH 4CBOA 1MKWK 2AS9A 1F5KU 4I33A 3QGJA 1GVZA 2BY9X 1SLXB 2PTCE 3RXFA 3URDA 2OC7A 3WY8A 3VXEH 1TGNA 2ZFPH 1L1JA 1P2OA 2ESTE 2BDHA 4AG2A 1WTGH 3VPKA 1ZR0A 3SGQE 1PYTC 2FS8A 2UWLA 5C5NA 3ZZ3A 5BRRE 1T31A 1SGCA 1YP9A 1Z8IB 2WPMS 2BXUH 2TGAA 2PR3A 3MH7A 4OS7A 1W2KH 1Z7KA 3QX5H 2J34A 3RXDA 1TA6A 3U1IB 4KGAA 2BM2A 2FYRA 2GVFA 3PM3A 1EQ9A 3W94A 2BX3A 1ZJKA 1ZTLA 1BMAA 1UVUH 1V3XA 4FUJA 3VGCB 3U69H 1ETTH 3SQHE 3FZDA 2HNTF 2XWAA 4ZKSU 1O2ZA 2FMJA 1FDPA 3GY6A 3L3TA 2STBE 1KXEA 2GX4A 4OGYA 5CHAB 1MD8A 1TRNA 1GBFA 2PKAB 7GCHF 1C1NA 1Z8RA 1OYTH 2H5DA 4WH6A 1HV7A 4WXVA 3SHCH 1BHXF 1C2DA 1W3CA 1WU1A 3IWMA 4NWKA 1TNIA 1Z1IA 3MNBA 2Y5HA 1C1SA 3UWIA 4X6MA 2F9NA 4NWLA 1OWEA 2FI4E 3N7OA 3E91A 2ZGJA 2SGDE 2ZHWH 3MWIU 1T7CA 3UREA 3KQBA 3ATWA 1Z8GA 3T62A 3RXTA 1H9LB 2A2QH 1AQ7A 1K1JA 4OS2A 2C93B 1FQ3A 1YPMH 1SGDE 2A7HA 1PPHE 2ZDLA 2BDCA 1VITH 2I6QA 1WUNH 1JOUB 5EXLA 2BDYA 3C27B 3SV9A 1GI6A 4ISLA 2CJIA 3GCTF 5TCAA 2WUBA 1GJ8B 3EA7A 1QBOA 4DT7B 4RN6A 1OXGA 2GCHG 1SC8U 1C2FA 1ESTA 1FJSA 2EA3A 1V2ST 1VGCB 2B8OH 5FAHA 2YNAA 3T27A 1XUJA 6LPRA 2C8XB 3SUFA 3UNQA 1GI4A 4VGCB 2AGEX 1O3IA 4CRFA 1SGEE 3B8JA 2TBSA 3RP2A 4ESTE 8GCHF 3SORA 1P9SA 1TOCB 3DA9B 3KIDU 1SBWA 2UUYA 1ELTA 2G4UA 1O5AB 1C1OA 3O8BA 1A2CH 1MCVA 4AGJA 3OY5U 1Z1JA 3SNDA 2XBXA 1GBLA 4GCHG 2PUQH 3RXKA 1SGTA 3ZVFA 3RXJA 5C3NA 1J16A 1CBWC 2ZGCA 1RTFB 1O37A 1NFYA 1QJ7B 3GCNA 1GMCF 4H42U 1WOFA 1G30B 4E7RG 1LPGB 1BDAA 1NTPA 3MOCA 5T6DA 1E0FD 2PKSB 2FOCA 3NKKA 2C8YB 1HXEH 3Q3XA 4UDWH 1GBBA 1A1RA 1D3DB 1ZTJA 4MLFB 3A7XA 2KAIB 4MPVA 2HGTH 1LQEA 4NIXA 4BANB 2O9QA 1QJ6B 1AFQC 2TPIZ 2XRCA 4CR9A 3S7HB 4DIIH 1W8BH 1K1NA 2PV9B 4IC5A 1CGIE 3I29A 4OS5A 4OS4A 1TE0A 1RRKA 3LGYA 3A80A 2UWPA 1O3DA 4F49A 4ABHA 2BMGB 1SG8B 1GG6B 5F8ZA 2FM2A 4OGXA 1LO6A 2OQUA 3F9EA 1XUHA 2BQ7B 4WY3A 1HCGA 1IQNA 2AFQB 3ZV9A 2Z9LA 3GY3A 7LPRA 1MU8B 1THRH 4WWYA 3PLBA 3A82A 1BRAA 1BTPA 4O97A 2AH4X 3SJIA 1GMHF 1O2GH 1GI8B 4X2WA 2A45B 3UTUH 4A1TA 4K1TA 1T8LA 3V13A 2HOBA 1GI3A 2ZF0H 5K0HA 2BDIA 2SGAA 3RDZA 1SLWB 2ZP0H 2ZCKP 3RLYH 2HNTE 1K28D 2FOFA 2Z94A 4XOJA 3SI4H 1C1TA 2AYWA 3O8DA 1O2QA 4X1PU 3GCHB 1Y3XA 1THPB 1QIXB 1O3GA 1BQYA 1M9UA 1INCA 4KTSA 5T6FA 1MTWA 3UOPA 1RS0A 4FVBA 4K69A 1BB0B 2CF8H 1S0QA 4D76A 4WMDA 3SNCA 1UTJA 3MO9A 2QAAA 1GJDB 5C20A 3SJ9A 1GL0E 1PQ8A 4SGBE 3FFGA 3GY5A 1RGQA 3QZRA 2FOHA 2V0BA 1KXDA 4Y79A 2H6MA 2V3OH 1GGDB 2WYJA 3MO6A 3E90B 3HK3B 3SZNA 3PV4A 2BD7A 3ZZ5A 3I77A 5JB9S 2C4FH 1BTUA 2UUJB 1HAVA 2RA0A 3TGKE 1FN8A 2ZFSA 1EOJA 1X7AC 4CH8B 1HAVB 3GYLB 4BTTB 3T29A 2H9HA 4YOIA 2G51A 3AVZA 4FU7A 2Z9IA 2Y7ZA 1ESBA 4TY7A 2ZIQH 1QURH 1ZGIA 4YZUA 2RG3A 5A0CA 1Y5AT 3M3VA 1ZJDA 1BMNH 3GCTG 2GZ8A 1P8VC 1Y59T 8KME2 3EDXB 2RCEA 2G81E 1NRSH 1ZRKA 3FP8E 1GDUA 1FMGA 1CSOE 4WMEA 3AAVA 4K1EA 1NRQH 1G3CA 3LH1A 1SLVB 1DANH 1OWHA 1DLEA 1O5GH 2VGCC 1WBGB 1UK3A 3MH5A 1TGBA 5FCKA 2BB4A 3STIA 1F0UA 1DICA 1P2MA 4I7YH 3ZZ4A 5E8EH 3S9BA 4WF8A 1KY9A 1F0SA 1GBMA 2FIRH 4XFQA 4X8SH 1O36A 3TLOA 2PGBB 2VNTA 1P09A 2ZDVH 2STAE 1H4WA 2DE8A 1O3PB 1P3CA 2BOHB 1DWEH 2SNVA 4X8VH 5EQSA 1C2IA 4AGKA 4GVUA 1FI8A 1UTQA 2FEQH 1W0ZU 2ZHEH 1UVSH 1MQ6A 1FN6A 4BXSA 1E37B 1MZAA 1XUKA 5I46H 1TONA 1TBZH 1F2SE 2PHBA 1QQUA 1AE5A 1GHWH 2RA3A 5J4QA 4YOGA 1BUIA 1QB9A 1O2KA 1EJMA 4U2WA 4HGCA 3ZYEA 1KYNA 1H8DH 4I8JA 4AZ2B 3P92A 1P03A 1VITF 1T32A 1A7SA 2QV1A 2B5TB 3A8AA 1LCYA 4TWWA 3TJVA 3TGJE 5E2PA 2VIVA 4NA7A 3M36A 1TMTH 5F8TA 1L2EA 2A5IA 3A7VA 2FWWA 3RXCA 2GDDA 2ZZUH 3ZVGA 1C1MA 4BAOB 2ALPA 2VIDA 2WPJS 1EZUC 1LHFH 3RC4A 4YESB 3KN2A 4DGJA 2Q6GA 1ZSJA 4CRCA 1BRBE 1Z8JB 2H5CA 2Q6FA 1MTUA 1MH0A 3EQ0H 4ZROA 1Z6EA 5FHTA 4CREA 4MTBA 2BZAA 2FI5E 5DP3A 4IMQA 2BHGA 1PPZA 4ABAA 1GI7B 1GI9B 2ZGBH 1HDTH 3TK9A 2ZU3A 4AFQA 2H2ZA 3AW0A 2F9UA 4IBLH 4B2BA 2P3UB 1N8OB 2Q1JA 2WV5A 3KQDA 1O30A 1C5VA 1V2OT 1O2TA 2NU4E 2P93A 1LVMA 3SU4A 2HPQH 1DSUA 1NC6A 1WV7H 3BIVH 5JYIA 1CGJE 2Y7XA 1J8AA 1TGTA 3UY9A 1SHHB 2FTMA 1AVXA 3QGNB 1SVPA 1HGTH 3A88A 1O2XA 1F0TA 4ABIA 4JK5A 4JYUH 1G36A 2UUKB 2ZU1A 5I25A 4XSKU 2JETB 4O9VA 1P04A 1TB6H 1AKSA 3M7TA 3MHWU 2M5TA 1LMWB 4JMYA 3RUOA 2BQWB 1EAIA 3QUMP 3KNXA 5GXPA 4Y8XA 3ATKA 4K8YA 2ZHQH 1HJAB 4ABFA 1EPTC 5JBCS 5FBEA 1B7XB 2J9NA 3P17H 3GOVB 5GDSH 1FV9A 2GDEH 2D1JA 2Q6DA 1NFUA 1C4Y2 1UTMA 4FUGA 3MH6A 4I8GA 4TYDA 1HJ9A 3LIWA 1EATA 1P11E 1GHBG 2J92A 1TNLA 1ANBA 2F9OA 4X1SU 2BLQA 1MQ5A 3P70B 3P8NA 5GPIB 2H1UA 1GJ6A 1WTHD 1A5IA 1V2MT 4Y6DA 1LHGH 4NA9H 4OS1A 1Z6JH 1SFIA 3ELAH 4NGAH 5FXLA 3ZVDA 4KP0A 1IOEA 3A7WA 4ZAEA 1MKXK 1EP6A 2ZTYA 2GT7A 1O5FH 2ASUB 2XCNA 1O5CB 4CHAB 2PW8H 1O3AA 2A31A 2VU8E 2HPPH 4F4OC 3F9FA 1HAIH 2AGGX 2QYIA 1CT4E 1SPJA 2OC1A 4IN2A 1P3EA 1DUEA 1K1IA 3SU5A 4ZMAH 4ISHH 1VCPA 2BD9A 1DWBH 3A7TA 1G9IE 1SR5C 3RXPA 1JBUH 1OS8A 3BV9B 1TBQH 1MKWH 4AFSA 4Z0KA 3C1KA 3BTDE 4R8TB 4H4FA 4U30A 1QBVH 2A5AA 2R2MB 1AKSB 1N1LA 4HTCH 3T28A 1SGFA 3TVJB 3BIUH 3TH2H 1J14A 2P8OC 1SGYE 2PKAA 5A8ZA 2R3UA 3ZZ8A 1GHBF 2B7DH 3F68H 2GCTC 1C2HA 3PO1C 2FS9A 2SGPE 1EP5A 3SQEE 2P94A 2BOKA 1L1NA 1C5TA 2CXVA 2Y82A 3A7ZA 2I6SA 2SFAA 1EKBB 3I78A 3S9CA 1A5GH 1O3JA 2F9BH 1S5SA 5LH8A 2BLWA 2XWBI 2ULLA 1P05A 1QY6A 4LXBH 3TJOA 2FX6A 3TJUA 3W95A 3UNSA 4KKDA 3RU4E 4BAMB 2QC2A 4YTAA 2FP7B 3MYWA 4AFUA 3BTKE 1BMLA 1DXPA 5HYOA 3JZ2B 1KXCA 1T8NA 4M7GA 5C1XA 1P12E 1ELDE 1QR3E 2ZCLP 1MAXA 4XE4A 1MZDA 4ZKOU 4MNXA 1AZZA 1LPZB 1QHRB 1PJPA 2SGFE 1FY4A 3R3GB 1DWDH 1VCQA 3FP7E 1FPHH 4TWYA 1O2IA 2ZU5A 2QF0A 2W5EA 2G5NA 2PKSC 4NCYA 5DP8A 3SW2B 4SGAE 4E05H 3A8CA 3LDXH 1GWAA 1TNKA 1TNHA 4FUEA 1KXFA 3D49H 4D9RA 2FOMB 1O3LA 2GCHF 1TAWA 2VIWA 3HK6B 3P8OA 1RD3B 1Y3WA 3ZZCA 1NM6A 1GHXH 4GHQA 1MUEB 1GHAF 2F9PA 4MPUA 6CHAC 3HATH 6ESTA 2GGVB 2TGDA 1YF4A 3M35A 1YPHE 4VGCC 1BTZA 1L4DA 4H6TA 4ISOA 2BYAX 3KF2A 4NIVA 1WYKA 1TLDA 2Z9JA 1SGIB 1Z71A 1DY8A 1AMHA 1XUFA 3E3TA 4X1QU 1OKXA 4WVPE 5JBBS 2AMPA 1F0RA 1MCTA 1EASA 4D7FA 5ESBA 3S69A 5JDUB 1WQVH 4IMZA 2TIOA 5FX6A 2G4TA 1HJAC 1C5XB 1SOTA 4ISIH 1T8OA 3MU5A 1DY9A 3QN7A 4INHA 1GVLA 5HMAA 2BVXH 3LU9B 3RXMA 1TRMA 3PROA 1A4WH 1O3OA 1SSXA 4A92A 2J4IA 1HAYB 1ANEA 1D6RA 2BD8A 3V12A 1DSTA 3U8OH 4R0IA 1LVYA 5LPFA 1C1UH 1F5LA 2WUCA 5AF9H 1YPLH 4FUCA 1W10U 3EAJA 4Z6AH 4DG4A 1S6FA 1B0EA 4UEHH 5E0GA 3CS7A 1EZXC 3RXGA 1DM4B 4YT7H 2J95A 4MNWA 1IHTH 1O35A 1AUTC 3P95A 1NRPH 3Q3KA 3QK1A 2A4GA 2XBYA 3LGWA 3SGBE 1C5OH 5A0AE 5DKMA 1ANCA 5F03A 4AFZA 1C5LH 1A46H 1O2UA 1FAKH 1W12U 2ZU4A 3T25A 4ZH8A 1BMMH 2ODPA 1K1OA 4GCHF 1O2NA 3G01A 1HB0B 2Y81A 1SGPE 1YKTA 7KMEH 1SB1H 1UCYE 3PMJA 3MU0A 2J38A 4NZQA 2QN5T 1LQDB 3SV2H 4RKOB 2P8OB 1KLIH 1BHXB 1SOZA 3VB7A 2VH6A 3UWJH 1GVKB 5PTPA 5A09A 4BTUB 2ZPRA 1T8MA 2CN0H 3Q3YA 1D3PB 1GL1A 4B1TA 2XNIA 2RDLA 5DO4H 2A4RA 3LOXA 2ZGXH 2ODQA 4IGDA 3TNTA 4J1YA 5C2ZA 4MVNA 1RIWB 1TYNA 1K9OE 3GCOA 3RXUA 1O0DH 2G00A 3P8GA 1BBRE 1G3EA 2ZDAH 4X2VA 4YT6H 2FOEA 4UE7H 5A0BA 1AO5A 2QY0B 1ARBA 1ELBA 2ZQ2A 1D3TB 4CHAC 2CMYA 5DK1A 1ANDA 3LGIA 1GJ4H 5C5OA 4LZ1H 3H7OA 1Y5UT 3ZYDA 4Y10E 5EXMA 2ZQ1A 3H5CB 4O3TA 4UFEH 5CMXH 1LHEH 2QGRA 1EJNA 5EPNA 1C5MD 2Z3CA 2GZ9A 1P9UA 4X2XA 1QTFA 3LKWA 4KTCA 1PQ5A 1UTLM 3UOUA 3ZZDA 3GY2A 2ANYA 1PYTD 4HFPB 2VIPA 2BD2A 1ZZZA 1AB9B 3LGUA 1AFEH 1C5QA 2EI6A 2ZC9H 2ANKH 3GDVA 1O2JA 1SI5H 1UJ1A 2O8WA 4PROA 1P57B 1TGCA 2CV3A 4WMFA 2ZI2H 1SGFG 2CHAB 1ORFA 4AG1A 2Z7FE 3R0FA 2FO9A 1ZTKA 2FOBA 2V3HH 1C2MA 1MTVA 1G3DA 1A0LA 1GPZA 3FANA 3NWUA 3UUZA 3A89A 2LPRA 1F5RA 1QB1A 4FXGH 1PPFE 5AHGH 4ZUHA 3RXSA 1V2UT 3ZV8A 1L1GA 1V2LT 2OCVB 5HXFA 5LPRA 1H8IH 2ODYB 1O5EH 3UQVA 1YCPK 1N6YA 1C2GA 1FY1A 1YCPH 1O3HA 2Y80A 2QCYA 2FPZA 3OSYA 3RXOA 1TQ0B 1HYLA 1D6WA 1ELGA 1CT2E 4A5TS 4Y76A 3A84A 3PLKA 2ZDKA 6GCHF 1HBTH 4XBDA 1PQ7A 1N8OC 1OWIA 3BTEE 2WPKS 1NU9A 3SV7A 2PGQB 1HRTH 3K65B 4IN1A 1S81A 3BTGE 1BIOA 5A8YA 1EOLA 2ZFFH 4FU9A 2O8LA 1C2KA 4K2YA 1NS3A 2F83A 2ZDMA 1AE8H 3SN8A 2PSXA 3VEQB 5JB8S 1TRYA 3UR9A 3MMGA 3S0NA 3S9AA 1V2RT 1CA0C 1ARCA 3ZVBA 2FESH 1LVBA 2PUXB 3BG4B 2ZCHP 2PFEA 3M7QA 1S6HA 1IQHA 4TY6A 1C2LA 3RU4T 4NFFA 3A83A 1O32A 2ZEBA 5HM9A 3SV8A 1GBKA 4FUFA 4U01A 1O2HA 2P3TB 3EGKH 5E0HA 3BEIB 1TA2A 4UFDH 3BG4C 4Q2KA 1FPCH 1VZQH 1O3MA 1BTYA 1U6QA 1C5UA 1BTWA 4ZKNU 1QGFA 1SHYA 1TWXB 1XKBC 2A7JA 2BQ6B 2BXTH 1TNJA 3AW1A 4K60A 3UFAA 3LJJA 4RSPA 1YM0A 2GV6A 3RXEA 2JH5D 1UVTH 2FOAA 3CENA 3ODDA 1OX1A 4DW2U 2JH0D 4FUDA 4GLYA 1G32B 2GD4B 1AD8H 4NA8A 3U8TH 1UCYH 4YOJA 2HALA 5E2OA 2OC0A 4YLQH 1AWHB 1DITH 2R9PA 5TJXA 2VVCA 3A85A 1LHCH 3F6UH 4CR5A 4YO9A 1AI8H 3RM2H 1ELVA 3NCLA 3M5OA 1AUJA 5DP9A 2F3CE 2AMDA 2C8WB 1GMHG 4D9QA 1K1MA 1TX8A 4I8KA 4UFGH 2ZHDA 3GY8A 1V2VT 1HUTH 2ZDNA 2H9TH 4E06H 1S84A 3DHKH 2W26A 3KGPA 1G2LA 1J9CH 3QLPH 4BNRA 1HJ8A 1ELCA 5E0JA 4JYTA 5FX5A 2Z9KA 2BD5A 3A7YA 1BA8B 5JBTA 1FONA 1GG6C 2H9EH 1QB6A 1HAZB 1ZPCA 2VWMA 3ATIA 3KHVA 1CVWH 1W13U 5GCHF 2ZFTA 1MTNC 4K8BA 1EB1H 1AU8A 1VR1H 3EA8A 1BITA 3BN9A 3TIUA 1W11U 1GMDG 4E7NA 3M61U 1VITG 4BAHB 1GBDA 5EODA 3KCGH 2ZNKH 2BX4A 2VIOA 1GHAG 3UR6A 1AB9C 1ELFA 1B5GH 3GDSA 4JZIA 2CHAC 3O8RA 3QDZB 1C1RA 2FODA 1OP8A 5JPMH 1O2YA 1RFNA 2EEKA 1SL3A 1VGCC 5DP7A 2NU2E 3RU4D 3E8LA 2XXLA 5SGAE 1OP2A 1ID5H 1C5RA 3BTQE 1P2IA 3LH3A 2OP9A 4J2YB 1ABIH 1O2PA 3MFJA 1FY8E 1YLCA 2FOGA 3KQCA 3PMHB 1TABE 3FP6E 3RMMH 5DJ7A 1QJ1B 1O3BA 4Q80A 5EGMA 3RXAA 1NU7B 1L0ZA 2WV4A 2TGTA 4KELA 1MBQA 1O5BB 2Z3DA 1P06A 3D23A 3JZ1B 3AAUA 1XXDA 1YC0A 1WQSA 2VWNA 5DP6A 1V2QT 1O38A 3LJOA 3CP7A 3A8DA 3KQEA 2VWLA 1DS2E 3ZVAA 2OXSA 1P0SH 1ZSKA 2O8UA 2OUAA 1NFXA 2AERH 2BD3A 1O34A 4WXIA 3GICB 3EYDA 4B74A 1JWTA 2UWOA 4Q7ZA 2OQ5A 3OTJE 1Q3XA 5CHAC 1CQQA 1XVOA 1HIAA 3SU1A 2ZA5A 5GWZA 2BY6X 2A5KA 3RXVA 2IPHA 1QCPA 1O3KA 2Y5GA 4THNH 1WAYB 3CS0A 2ZHFH 3KEEA 4NG9H 2XC5A 1SLUB 3FZZA 1OWKA 3MO3A 2W7SA 1LDTT 5ESTE 1F92A 1FZZA 3DFJA 1S82A 1F7ZA 1QL7A 2D2DA 5EPYA 2P95A 2ZFQH 3VB3A 3ZZ6A 1CU1A 3TPIZ 1IQMA 4B75A 2VB0A 2PWXA 1CBWB 4CRGA 1P2JA 4ABDA 3RMOH 2ZFRH 1AGJA 2D26C 1K1PA 1C1VH 3NK8A 3DFLA 4I8HA 2QXHA 3P6ZB 1ZLRA 1V2JT 3MI4A 4BAKB 2TRMA 2OC8A 1MAYA 1XXFA 1J17T 5L2YH 3GY7A 2FI3E 4X6OA 1MMJN 3MNSA 4Y0ZE 4ZXYH 1TPPA 5EW2H 1C2JA 1H9IE 1VJ9U 2R2WU 3ATLA 3LGTA 2A4QA 4NFEA 1UK2A 4JCNA 5L6NH 2C3SA 1TPAE 3M5MA 1MTSA 4TPYA 1HAHH 5GJ4B 3U98H 4NSYA 4MNYA 1HXFH 1RTKA 1V2WT 1DOJA 4Y11E 1AN1E 4NIWA 5EQQA 1J15A 3UQOA 4YM9A 4CRDA 3TJNA 3RMNH 1P10A 5FPTA 4GSOA 3QWCH 2J94A 2ZO3H 5EW1H 4GUXA 1HAPH 2ZTXA 1UTOA 4Y0YE 3MNXA 3IITA 1Y3YA 2FXRA 3SU0A 4X1NU 3ENSB 4X0WU 1FUJA 1AVGH 4Q7YA 3ZVEA 3U1JB 3O8CA 1YPGH 1MKXH 1O2OA 5K7RA 1P2QA 3M3TA 5C1YA 2Z3EA 5DG6A 2ZKSA 1KIGH 1Y8TA 1KSNA 2QIQA 3A87A 4K1SA 5EXNA 1TPOA 4IW4E 3SJOA 1O2LA 2EI8A 1C5WB 1EAWA 2GT8A 2A2XH 4B73A 5EU8A 3GDUA 1EPTB 1DDJA 1XKAC 3SU6A 1V6DA 4JZ1A 1RIWC 4ABJA 1ZHRA 2FZZA 1XUGA 4X1RU 1KXBA 2V35A 4CH2B 1WCZA 2ZPSA 2XBWA 3BEFB 3PLPA 2LNCA 2B0FA 3SNBA 1GBJA 1UHBA 3L33A 3A8BA 4LZ4B 3A81A 3ODFA 1EZSC 2D8WA 2JETC 2FX4A 1TIOA 4BOHA 3E6PH 1NROH 1RJXB 1T4UH 1O31A 4UFFH 3BTWE 5CE1A 1KDQB 1C9TA 1D9IA 2CGAA 1ZMLA 1OPHB 1SQOA 5L30H 4NZLA 2AGIX 2KAIA 2ZG0H 5IDKA 5T6GA 2BLOA 3V0XA 2XTTB 4ASHA 2WINI 1GMCG 1ZPBA 1UTNA 1GHYH 1LHDH 1EB2A 1KLTA 3VGCC 1BTXA 4LOYH 2GCTB 1TNGA 1SFQB 9LPRA 5A2MH 1DFPA 1E35B 1ZHPA 1TALA 1IQIA 2BDAA 1QRWA 3B9FH 1BBRH 1C5SA 2P59A 1TFXA 4O03A 3M7UA 2Z9GA 3BG8A 1HNEE 1KDQA 3MNCA 3BTHE 2C8ZB 4Y8YA 1ZRBA 1GBCA 2DUCA 2BTCE 4FVDA 4B2AA 2NU3E 3PTNA 1DT2A 1OSSA 2XYAA 2FYQA 1A3EH 3TNSA 4B71A 3SO3A 3TK6A 5ABWA 3EA9A 2OBQA 5L2ZH 4I8LA 2FDAA 2K1QA 3EE0B 3ESTA 5F6MA 1ZMNA 3BTTE 2EC9H 1LTOA 3PO1B 1GI2A 2JH6D 4JK6A 1ETRH 1EXFA 2CF9H 4A6LA 2P3FH 2BLVA 2F9VA 1GI0A 1OWJA 1GJBB 1QQ4A 4ABBA 1TMUH 1HFDA 1O3FA 1A5HA 1YPEH 1YPHC 4CRAA 2WPLS 3LONA 1S83A 3Q76A 4AB9A 1IHSH 4Y7BA 1C5ZB 3ITIA 4BTIB 3SU3A 1HPGA 2BY7X 4ZHMU 5GCHG 2OD3B 1BTHH 3HPTB 1O3NA 3VB6A 1QA7A 5EQRA 2QXJA 4MG3A 1SGRE 4ABGA 2XW9A 2BDGA 3TK5A 5C1UA 2WPIS 2XCFA 3Q00A 3TH3H 1BRUP 1MTNB 3M5NA 3QZQA 1UTPA 1QRZA 2NU0E 3NUMA 3SGAE 3GYMA 5B6OA 6CHAB 1OYQA 1G3BA 2A32A 3QTOH 3RM0H 1K1LA 4RKJB 4X2YA 1JIRA 3F9HA 3H7TA 1THSH 2IN2A 1ACBE 1C5NH 4JZFH 1GHZA 2FLBH 1TBRH 4K5ZA 3OX7U 4JYVH 4BXWA 1XM1A 3BSQA 1A0HB 1H9HE 1HLTH 1AVWA 2VVUA 1TMBH 4U32A 1IAUA 1SMFE 1JMOH 3DT0H 2OTVA 3RXBA 3PYHA 2Y6TA 3T26A 1VCWA 1GBTA 3RXIA 1FXYA 1S85A 1QA0A 1HIAB 2F91A 3PB1E 2PLXA 1O2RA 1DLKB 1E34B 1QNJA 1GMDF 4OS6A 3T2NA 4AYVB 2O8MA 2ANWA 1C1WH 2AIPA 4CBNA 1ZSLA 3TU7H 1YBWA 1DE7H 5EG4A 1XX9A 2ZPQA 3U8RH 1BJUA 2W7UA 4HI3A 3RMLH 1AIXH 2BDBA 4FUHA 1GDQA 3SNEA 3PTBA 2ILNA 1V2PT 1K21H 1DX5M 4Q7XA 1HAGE 3HKIB 3V7TA 1IQFA 3RXHA 1GCTB 4A1VA 2GMTB 3FVFB 4D7GA 4DCDA 1A0JA 2HVXA 1HAOH 4BAQB 1YYY1 3E0PB 3LPRA 4X6PA 1KTSB 2PTNA 4ZHLU 3QO6A 1D3QB 1LVOA 2XC4A 4MPXA 1FIWA 1CT0E 4NSVA 1WSSH 4QT8C 5AVDA 1GBHA 1IQEA 1QL9A 1TPSA 2VWOA 1Q2WA 3ATMA 5LPEA 3AASA 4GPGA 3RC6A 4K3JA 4B2CA 1EJAA 1AWFH 3RLWH 1JIMA 5BPEA 2W3KA 4ZKRU 3ZZAA 1IQKA 2A0QB 2EI7A 1YLDA 3FAOA 3SJ8A 3OY6U 5DP4A 1DXWA 4DOQA 2BY8X 1N6XA 2A4OA 3DD2H 1AHTH 3K6YA 1AZ8A 6GCHG 2G8TA 2W3IA 3VXFH 3ZZ9A 3L6PA 1CO7E 5IYTA 1ETSH 1CA0B 3D62A 2HNTC 2P16A 4TPIZ 1H1BA 3OU0A 5AFZH 5G4BA 5DGJA 4AN7A 2C90B 4DJZB 4IS5A 3A86A 2SGQE 1VJAU 1BZXE 2VVVA 1G2MA 3ZVCA 3MTYA 1GBAA 1GJ9B 1O2WA 2WPHS 4X8TH 5FBIA 2Y5FA 1FNIA 8GCHG 3K2UA 3TH4H 1D4PB 1P2NA 2G55A 5DPAA 2QF3A 1ZYOA 5J4SA 2YNBA 1C1QA 1GJCB 3RXRA 1UCYK 1V2TT 2UUFB 1NPMA 2XBVA 1KLJH 1GBIA 4HZHA 3SV6A 3F1SB 3RXLA 1O2SA 1QFKH 2V6NA 2J2UA 2AMQA 1HAXB 4FUIA 2JKHA 3QTVH 1LKAA 2QA9E 4D8NA 4H6SB 1G37A 2SNWA 3SUDA 4A7IB 1V2NT 1JRTA 1NN6A 2O8TA 2VGCB 2YOLA 1NRNH 1NT1A 1GJAB 3GY4A 3UPEA 1QRXA 1XVMA 1NZQH 1IQJA 1CE5A 1ZOMA 3SNAA 3NZIA 2BY5X 1PPCE 5TCCA 3VFEA 4DIHH 3NXPA 2NWNA 1CHOG 1EAXA 1DVAH 3STJA 2OLGA 1BBRK 1CA8B 3ZZBA 2R3YA 3E0NB 4JZDH 1BT7A 3BEUA 5ETXA 2R0KA 1W14U 1FAXA 2A7CA 3K9XB 1FLEE 1GJ7B 2GZ7A 4KTUA 3HKJB 1C5YB 1GGDC 1NO9H 1EPTA 4NIYA 1K22H 1IQLA 2OBOA 4MPWA 3UIRA 4UONA 1UTKA 4INLA 1B0FA 1ESAA 3LGVA 2ZGHA 1GCDA 2ANMH 1KTTB 1DPOA 2B9LA 3BF6H 1TGSZ 1GI5A 2BD4A 1GBEA 1TOMH 2G5VA 3F9GA 5JBAS 1O39A 4WJG2 5HGGA 1BCUH 2AEIH 4Y7AA 1C4U2 5AFYH 2GP9B 5A8XA 1PPGE 2VIQA 1YGCH 3GISB 3HGPA 4MDSA 1IQGA 4FUBA 4FU8A 2QXGA 1MU6B 1EX3A 1GJ5H 3B23B 4ZXXH 1V2KT 2Z6BD 1QL8A 1EAUA 5H4IB 1C9PA 3T5FH 1E36B 2SGEE 2ZU2A 1UK4A 3URCA 1KXAA 7ESTE 1P2KA 3KL6A 3BTME 3GCHC 1O5DH 1BJVA 8ESTE 1A3BH 1OWDA 2HWLB 1ABJH 5C67A 1T4VH 2IOTA 1PQAA 1SQAA 1W7GH 1UO6A 4ZHAA 2G52A 2GKVE 1CHOF 5FCRA 1ZPZA 2ALVA 3SHAH 1L4ZA 2OINA 1TX7A 1TX6A 4Y8ZA 4INKA 1Q31A 1O2VA 3Q77A 4GAWA 1C2EA 1AFQB 5HM2A 1GDNA 3PMBB 1YPKH 4MNVA 4O3UA 5LGOA 1ELAA
chains in the Genus database with same CATH superfamily
2VJ1A 2THFB 5DP5A 1Y3VA 1MBMA 1E38B 3LC3A 4XDEA 1VKYA 4I31A 1Y5BT 4B76A 4ISNA 4JZEH 3MH4A 3OYPA 1SQTA 1MD7A 3SUEA 2V7QD 2XC0A 1O33A 3IG6B 3MU4A 3BTFE 3ZZ7A 1CGHA 2GMTC 4X6NA 3VB4A 4AX9H 1SGNE 1GCTC 3TITA 3SI3H 2WYGA 3SUGA 4AOQA 4WH8A 3VB5A 1ZGVA 3PWCA 5HIYA 1UHBB 1JRSA 2PSYA 3S7KB 3D65E 4AORA 4GHTA 2BVRH 4IC6A 2A1DB 2VINA 1NESE 1UVOA 3LT3A 1P02A 4Y71A 1RTLA 1A61H 3PWBA 2NU1E 1BOQA 3U28C 1GHVH 2BVSH 1UVPA 1Y3UA 1C5PA 3E16B 1XUIA 1FIZA 1O2MA 3PMAB 3TGIE 1PPEE 1GI1A 4LK4A 4AB8A 2AIQA 2FTLE 2GTBA 4AYYB 2HRVA 5GIBA 4DVAU 1JXPA 2FLRH 4XRNA 4MQAA 5KECA 3NPSA 5FPYA 1RXPA 1NY22 3SOSA 3VG8A 4CRBA 1PPBH 2QXIA 2VH0A 4I32A 5FPSA 1DWCH 3RC5A 1BRCE 3E1XB 4XBBA 3SU2A 1TQ7B 3MU1A 1S0RA 1CHGA 4ABEA 1EUFA 2ZWLH 3HGNA 2R0LA 1LKBA 2ZECA 4XBCA 3UNRA 1C4V2 2JJ2D 4YLUA 1SGQE 5EOKA 3M3SA 2GV7A 4DURA 5T3HA 1DUAA 1C1PA 2BZ6H 3V3MA 4UD9H 3P8FA 3LC5A 3SBKA 1UMAH 1W7XH 1YCPM 1K2I1 1FY3A 1O3CA 3K6ZA 1XMNB 1ZHMA 2HLCA 4A1XA 2IJOB 1W0YH 5KGOA 3M37A 5F8XA 1FY5A 1AY6H 2TGPZ 1P01A 3SJKA 1QBNA 1OP0A 1OOKB 2DE9A 7GCHG 1ZMJA 1NRRH 3RXQA 9ESTA 4DY7B 8LPRA 1NFWA 1ELEE 2ZTZA 1O3EA 3U9AH 3M5LA 1FX0B 3DUXH 1YPJH 1E79D 1PFXC 1EZQA 3MU8A 1LPKB 4X8UH 4CBOA 1MKWK 2AS9A 1F5KU 4I33A 3QGJA 1GVZA 2BY9X 1SLXB 2PTCE 3RXFA 3URDA 2OC7A 3WY8A 3VXEH 1TGNA 2ZFPH 1L1JA 1P2OA 2ESTE 2BDHA 4AG2A 1WTGH 3VPKA 1ZR0A 3SGQE 1PYTC 2FS8A 2UWLA 5C5NA 3ZZ3A 5BRRE 1T31A 1SGCA 4OM9A 1YP9A 1Z8IB 2WPMS 2BXUH 2TGAA 2PR3A 3MH7A 4OS7A 1W2KH 1Z7KA 3QX5H 2J34A 3RXDA 1TA6A 3U1IB 4KGAA 2BM2A 2FYRA 2GVFA 3PM3A 1EQ9A 3W94A 2BX3A 1ZJKA 1ZTLA 1BMAA 1UVUH 1V3XA 4FUJA 3VGCB 3U69H 1ETTH 3SQHE 3FZDA 2HNTF 2XWAA 4ZKSU 1O2ZA 2FMJA 1FDPA 3GY6A 3L3TA 2STBE 1KXEA 2GX4A 4OGYA 5CHAB 1MD8A 1TRNA 1GBFA 2PKAB 7GCHF 1C1NA 1Z8RA 1OYTH 2H5DA 4WH6A 1HV7A 4WXVA 3SHCH 1BHXF 1C2DA 1W3CA 1WU1A 3IWMA 3F2HA 1E1QD 4NWKA 1TNIA 1Z1IA 3MNBA 2Y5HA 1C1SA 3UWIA 4X6MA 2F9NA 3OTPA 4NWLA 1OWEA 2FI4E 2WZQA 3E91A 3N7OA 2ZGJA 2SGDE 2ZHWH 3MWIU 1T7CA 3UREA 3KQBA 3ATWA 1Z8GA 3T62A 3RXTA 1H9LB 2A2QH 1AQ7A 1K1JA 4OS2A 2C93B 1FQ3A 1YPMH 1SGDE 2A7HA 1PPHE 2ZDLA 2BDCA 1VITH 2I6QA 1WUNH 1JOUB 5EXLA 2BDYA 3C27B 3SV9A 1GI6A 4ISLA 2CJIA 3GCTF 5TCAA 2WUBA 1GJ8B 3EA7A 1QBOA 4DT7B 4RN6A 1OXGA 2GCHG 1SC8U 1EFRD 1C2FA 4HG6A 1ESTA 1FJSA 2EA3A 1V2ST 1VGCB 2B8OH 5FAHA 2YMSC 2YNAA 3T27A 1XUJA 6LPRA 2C8XB 3SUFA 3UNQA 2K0QA 1GI4A 4VGCB 2AGEX 1O3IA 4CRFA 1SGEE 3B8JA 2TBSA 3RP2A 5C94A 4ESTE 8GCHF 3SORA 1P9SA 1TOCB 3DA9B 3KIDU 1SBWA 2UUYA 1ELTA 2G4UA 1O5AB 1C1OA 2K8IA 3O8BA 5DSFA 2KX4A 1A2CH 1MCVA 4AGJA 3OY5U 1Z1JA 3SNDA 2XBXA 1GBLA 4GCHG 2PUQH 3RXKA 1SGTA 3ZVFA 3RXJA 5C3NA 1J16A 1CBWC 2ZGCA 1RTFB 1O37A 1NFYA 1QJ7B 3GCNA 1GMCF 4H42U 1WOFA 1G30B 4E7RG 1LPGB 1BDAA 1NTPA 3MOCA 5T6DA 1E0FD 2PKSB 2FOCA 3WW7A 3NKKA 2C8YB 1HXEH 3Q3XA 4UDWH 1GBBA 1A1RA 1D3DB 1ZTJA 4MLFB 3A7XA 2KAIB 4MPVA 2HGTH 1LQEA 2YMSD 4NIXA 4BANB 2O9QA 1QJ6B 1AFQC 2TPIZ 2XRCA 4CR9A 3S7HB 4DIIH 1W8BH 1K1NA 2PV9B 4IC5A 1CGIE 3I29A 4OS5A 4OS4A 1TE0A 1RRKA 3LGYA 3A80A 2UWPA 1O3DA 4F49A 4ABHA 2BMGB 1SG8B 1GG6B 5F8ZA 2FM2A 4OGXA 1LO6A 2OQUA 3F9EA 1XUHA 2BQ7B 4WY3A 1HCGA 1IQNA 2AFQB 3ZV9A 2Z9LA 3GY3A 7LPRA 1MU8B 1THRH 4WWYA 3PLBA 3A82A 1BRAA 1BTPA 4O97A 2AH4X 3SJIA 1GMHF 1O2GH 1GI8B 4X2WA 2A45B 2QF5A 3UTUH 4A1TA 4K1TA 1T8LA 3V13A 2HOBA 1GI3A 2ZF0H 4M9FA 5K0HA 2BDIA 2SGAA 3RDZA 1SLWB 2ZP0H 2ZCKP 3RLYH 2HNTE 1K28D 2FOFA 2Z94A 4XOJA 3SI4H 1C1TA 2AYWA 3O8DA 1O2QA 4P02A 4X1PU 3OEHD 3GCHB 1Y3XA 1THPB 1QIXB 1O3GA 1BQYA 1M9UA 1INCA 3PRBA 4KTSA 5T6FA 1MTWA 3UOPA 1RS0A 4FVBA 4K69A 1BB0B 2CF8H 1S0QA 4D76A 4WMDA 3SNCA 1UTJA 3MO9A 2QAAA 1GJDB 5C20A 3SJ9A 1GL0E 1PQ8A 4SGBE 3FFGA 3GY5A 1RGQA 3QZRA 2FOHA 2V0BA 1KXDA 4Y79A 2H6MA 2V3OH 1GGDB 2WYJA 3MO6A 3E90B 3HK3B 3SZNA 3PV4A 2BD7A 3ZZ5A 3I77A 5JB9S 2LP6A 2C4FH 1BTUA 2UUJB 1HAVA 2RA0A 3TGKE 1FN8A 2ZFSA 1EOJA 1X7AC 4CH8B 1HAVB 3GYLB 4BTTB 3T29A 2H9HA 4YOIA 2G51A 3AVZA 4FU7A 2Z9IA 2Y7ZA 1ESBA 4TY7A 2ZIQH 1QURH 1ZGIA 4YZUA 2RG3A 5A0CA 1Y5AT 3M3VA 1ZJDA 1SQRA 1BMNH 3GCTG 2GZ8A 1P8VC 1Y59T 8KME2 3EDXB 2RCEA 2G81E 1NRSH 1ZRKA 3FP8E 1GDUA 1FMGA 1CSOE 4WMEA 3AAVA 4K1EA 1NRQH 1G3CA 3LH1A 1SLVB 1DANH 1OWHA 1DLEA 1O5GH 2VGCC 1WBGB 1UK3A 3MH5A 1TGBA 5FCKA 2LELA 2BB4A 1YWUA 3STIA 1F0UA 1DICA 1P2MA 4I7YH 3ZZ4A 5E8EH 3S9BA 4WF8A 1KY9A 1F0SA 1GBMA 2FIRH 4XFQA 4X8SH 1O36A 3TLOA 2PGBB 2VNTA 1P09A 2ZDVH 2STAE 1H4WA 2DE8A 1O3PB 1P3CA 2BOHB 1DWEH 2SNVA 4X8VH 2KFWA 5EQSA 1C2IA 4AGKA 4GVUA 1FI8A 1UTQA 2FEQH 1W0ZU 2ZHEH 1UVSH 1MQ6A 1FN6A 4BXSA 1E37B 1MZAA 1XUKA 3KYFA 5I46H 1TONA 1TBZH 1F2SE 2PHBA 1QQUA 1AE5A 1GHWH 2RA3A 5J4QA 3F2FA 4YOGA 1BUIA 1QB9A 1O2KA 1W0JD 1EJMA 4U2WA 4HGCA 3ZYEA 1KYNA 1H8DH 4I8JA 4AZ2B 3P92A 1P03A 1VITF 1T32A 1A7SA 2QV1A 2B5TB 3A8AA 3F3BA 1LCYA 4TWWA 3WWFA 3TJVA 3TGJE 5E2PA 2VIVA 4NA7A 3M36A 1TMTH 4FOUC 5F8TA 1L2EA 2A5IA 3A7VA 2FWWA 4ACAA 3RXCA 2GDDA 2WPDD 2ZZUH 3ZVGA 3DCLA 4P00A 1C1MA 4BAOB 2ALPA 2VIDA 3FOAA 2WPJS 1EZUC 1LHFH 3RC4A 4YESB 3KN2A 4DGJA 2Q6GA 1ZSJA 4CRCA 2KCPA 1BRBE 1Z8JB 2H5CA 2Q6FA 1MTUA 1MH0A 3EQ0H 4ZROA 4TSFD 1Z6EA 1NBMD 5FHTA 4CREA 4MTBA 2BZAA 2FI5E 5DP3A 4IMQA 2BHGA 1PPZA 4ABAA 1GI7B 1GI9B 2ZGBH 1HDTH 3TK9A 2WHXA 2ZU3A 2H2ZA 4AFQA 3AW0A 3OAAD 2F9UA 4IBLH 4B2BA 2P3UB 1N8OB 2Q1JA 2WV5A 3KQDA 1O30A 1C5VA 1V2OT 1O2TA 2NU4E 2P93A 1LVMA 3SU4A 2HPQH 1DSUA 1NC6A 1WV7H 3BIVH 5JYIA 1CGJE 2Y7XA 1J8AA 1TGTA 3UY9A 1SHHB 5IK2D 2FTMA 1AVXA 3QGNB 1SVPA 1HGTH 3A88A 1O2XA 1F0TA 4ABIA 4JK5A 4JYUH 1G36A 2UUKB 2ZU1A 5I25A 4XSKU 2JETB 4O9VA 1P04A 1TB6H 1AKSA 3M7TA 3MHWU 2M5TA 2OK5A 1LMWB 4JMYA 2QF4A 3RUOA 2BQWB 1EAIA 3QUMP 3KNXA 5GXPA 4Y8XA 3ATKA 4K8YA 2ZHQH 1HJAB 4ABFA 1EPTC 5JBCS 5FBEA 1B7XB 2J9NA 3P17H 3GOVB 5GDSH 1FV9A 2GDEH 2D1JA 2Q6DA 1NFUA 1C4Y2 1UTMA 4FUGA 3MH6A 4I8GA 4TYDA 1HJ9A 3LIWA 1EATA 4AC9A 1P11E 1GHBG 2J92A 1TNLA 1ANBA 2F9OA 1KMHB 4X1SU 2BLQA 1MQ5A 3P70B 1WDIA 2RDEA 3P8NA 2H1UA 5GPIB 1GJ6A 1WTHD 1A5IA 1V2MT 4Y6DA 1LHGH 4NA9H 4OS1A 1Z6JH 1SFIA 3ELAH 4NGAH 5FXLA 3ZVDA 4KP0A 1IOEA 3A7WA 4ZAEA 1MKXK 1EP6A 2ZTYA 2GT7A 1O5FH 2ASUB 2XCNA 1O5CB 4CHAB 5FL7D 2PW8H 1O3AA 2A31A 2VU8E 2HPPH 4F4OC 1K0HA 3F9FA 1HAIH 5T1VA 2AGGX 2QYIA 1CT4E 1SPJA 2OC1A 4IN2A 1P3EA 1DUEA 1K1IA 3SU5A 4ZMAH 4ISHH 1VCPA 2BD9A 1DWBH 3A7TA 1G9IE 1SR5C 3RXPA 1JBUH 1OS8A 3BV9B 1TBQH 1MKWH 4AFSA 5EJLA 4Z0KA 3C1KA 3BTDE 4R8TB 4H4FA 4U30A 1QBVH 2A5AA 2R2MB 1AKSB 1N1LA 4HTCH 3T28A 1SGFA 4ZCNA 3TVJB 3BIUH 3TH2H 1J14A 2P8OC 1SGYE 2PKAA 5A8ZA 2R3UA 3ZZ8A 1GHBF 2B7DH 3F68H 2GCTC 1C2HA 3PO1C 2FS9A 2SGPE 1EP5A 3SQEE 2P94A 2BOKA 1L1NA 1C5TA 2CXVA 2Y82A 3A7ZA 2I6SA 2SFAA 1EKBB 3I78A 3S9CA 1A5GH 1O3JA 2F9BH 1S5SA 5LH8A 2BLWA 2XWBI 2EQNA 2ULLA 1P05A 1QY6A 4LXBH 3TJOA 2FX6A 3TJUA 3W95A 3UNSA 4KKDA 3RU4E 4BAMB 2QC2A 4YTAA 2FP7B 3MYWA 4AFUA 3BTKE 1BMLA 1DXPA 4Z1MD 3JZ2B 1KXCA 5HYOA 1T8NA 4M7GA 5C1XA 1P12E 1ELDE 1QR3E 2ZCLP 1MAXA 4XE4A 3AK5A 1MZDA 4ZKOU 4MNXA 1AZZA 1LPZB 1QHRB 1PJPA 2SGFE 1FY4A 3R3GB 1DWDH 1VCQA 3FP7E 1FPHH 2AHME 1O2IA 4TWYA 2ZU5A 2QF0A 2W5EA 2G5NA 2PKSC 4NCYA 5DP8A 3SYJA 3SW2B 4SGAE 4E05H 3A8CA 3LDXH 1GWAA 1TNKA 1TNHA 1NBME 3N99A 4FUEA 1KXFA 3D49H 4D9RA 2FOMB 1O3LA 2GCHF 1TAWA 4F48B 2VIWA 3HK6B 3P8OA 1RD3B 1Y3WA 3ZZCA 1NM6A 1GHXH 4GHQA 1MUEB 1GHAF 2F9PA 4MPUA 6CHAC 3HATH 6ESTA 2GGVB 2TGDA 1YF4A 3M35A 1YPHE 4VGCC 1BTZA 1L4DA 4H6TA 4ISOA 2BYAX 3KF2A 4NIVA 1WYKA 1TLDA 2Z9JA 1SGIB 1Z71A 1DY8A 1AMHA 1XUFA 3E3TA 4X1QU 1OKXA 4WVPE 5JBBS 2AMPA 4TT3D 1F0RA 1MCTA 1EASA 4D7FA 5ESBA 3S69A 5JDUB 1WQVH 4IMZA 2CK3D 2TIOA 5FX6A 2G4TA 1HJAC 5C0TA 1C5XB 1SOTA 4ISIH 1T8OA 3MU5A 1DY9A 3QN7A 4INHA 1GVLA 5HMAA 2BVXH 3LU9B 3RXMA 1TRMA 3PROA 1A4WH 1O3OA 1SSXA 2J98B 2J4IA 4A92A 1HAYB 1ANEA 1D6RA 2BD8A 3V12A 1DSTA 3U8OH 4R0IA 1LVYA 2J98A 5LPFA 1C1UH 1F5LA 2WUCA 5AF9H 1YPLH 4FUCA 5B6LA 1W10U 3EAJA 5EJZA 4Z6AH 4DG4A 1S6FA 1B0EA 4UEHH 5E0GA 3CS7A 1EZXC 3RXGA 1DM4B 4YT7H 2J95A 4MNWA 1IHTH 3PV5A 2JJ1D 1O35A 1AUTC 3P95A 1NRPH 3Q3KA 3QK1A 2A4GA 2XBYA 3LGWA 3SGBE 1C5OH 5A0AE 5DKMA 1ANCA 5F03A 4AFZA 1C5LH 1A46H 1O2UA 1FAKH 1W12U 2ZU4A 3T25A 4ZH8A 1BMMH 2ODPA 1K1OA 4GCHF 1O2NA 3G01A 1HB0B 2Y81A 1SGPE 1YKTA 7KMEH 1SB1H 1UCYE 2HVYB 1UW7A 3MU0A 3PMJA 2J38A 3UAIC 4NZQA 2QN5T 1LQDB 3SV2H 4RKOB 2P8OB 1KLIH 1BHXB 1SOZA 3VB7A 2VH6A 3UWJH 1GVKB 5EJ1A 5PTPA 5A09A 4BTUB 2ZPRA 1T8MA 2CN0H 3Q3YA 1D3PB 1GL1A 4B1TA 2XNIA 2RDLA 5DO4H 2A4RA 3LOXA 2ZGXH 2ODQA 4IGDA 3TNTA 4J1YA 5C2ZA 4MVNA 1RIWB 1TYNA 1K9OE 3GCOA 3RXUA 1O0DH 2G00A 3P8GA 1BBRE 1G3EA 2ZDAH 4X2VA 4YT6H 2FOEA 4UE7H 5A0BA 1AO5A 2QY0B 3F0PA 1ARBA 1ELBA 2ZQ2A 4FETA 3H09A 1D3TB 4CHAC 2CMYA 5DK1A 1ANDA 2JIZD 3FN8A 1GJ4H 3LGIA 5C5OA 4LZ1H 3H7OA 1Y5UT 3ZYDA 4Y10E 5EXMA 2ZQ1A 3H5CB 4O3TA 1YLNA 4UFEH 5CMXH 1LHEH 2QGRA 1EJNA 3CNRA 5EPNA 1S6LA 1C5MD 4ACBA 2Z3CA 2GZ9A 1P9UA 4X2XA 1QTFA 3LKWA 4KTCA 1PQ5A 1UTLM 3UOUA 3ZZDA 3GY2A 2ANYA 1PYTD 4HFPB 2VIPA 2BD2A 1ZZZA 1AB9B 3LGUA 5HIZA 1AFEH 1C5QA 2EI6A 2ZC9H 2ANKH 3GDVA 1O2JA 1SI5H 1UJ1A 2O8WA 4PROA 1P57B 1TGCA 2CV3A 4WMFA 2ZI2H 1SGFG 4ASUD 2CHAB 1ORFA 4AG1A 2Z7FE 3R0FA 2FO9A 1ZTKA 2FOBA 2V3HH 1C2MA 3DSGA 1MTVA 1G3DA 1A0LA 1GPZA 3FANA 3NWUA 3UUZA 3A89A 2LPRA 1F5RA 1QB1A 2HLDD 4FXGH 1PPFE 5AHGH 4ZUHA 3RXSA 1V2UT 3ZV8A 1L1GA 1V2LT 2OCVB 5HXFA 5LPRA 1H8IH 2ODYB 1O5EH 3UQVA 1YCPK 1N6YA 1C2GA 1FY1A 1YCPH 1O3HA 2Y80A 2QCYA 2FPZA 3OSYA 3RXOA 1TQ0B 1HYLA 1D6WA 1ELGA 1CT2E 4A5TS 2RFKC 4Y76A 3A84A 3PLKA 2ZDKA 6GCHF 1HBTH 4XBDA 3OE7D 1PQ7A 1N8OC 1OWIA 3BTEE 2WPKS 1NU9A 3SV7A 2PGQB 1HRTH 3K65B 4IN1A 1S81A 3BTGE 1BIOA 5A8YA 1EOLA 2ZFFH 4FU9A 2O8LA 1C2KA 2EY4C 1H8ED 4K2YA 1NS3A 2F83A 2ZDMA 1AE8H 3SN8A 2PSXA 3VEQB 5JB8S 1TRYA 3UR9A 3MMGA 3S0NA 3S9AA 1V2RT 1CA0C 1ARCA 3ZVBA 2FESH 1LVBA 2PUXB 3BG4B 2IPQX 1H8HD 2ZCHP 2PFEA 3M7QA 1S6HA 2L74A 1IQHA 4TY6A 1C2LA 4YXWD 3RU4T 4NFFA 3A83A 1O32A 2ZEBA 5HM9A 3SV8A 1GBKA 4FUFA 4U01A 1O2HA 2P3TB 3EGKH 5E0HA 3BEIB 1TA2A 4UFDH 3BG4C 4Q2KA 1FPCH 1VZQH 3DSOA 1O3MA 1BTYA 1U6QA 1C5UA 1BTWA 4ZKNU 1QGFA 1SHYA 1TWXB 1XKBC 2A7JA 2BQ6B 2BXTH 4Q63A 3FKSD 1TNJA 3AW1A 4K60A 3UFAA 3LJJA 4RSPA 3EE7A 1YM0A 2GV6A 3RXEA 2JH5D 4Q4LA 1UVTH 2FOAA 3CENA 3ODDA 1OX1A 4DW2U 2W6ID 2JH0D 4FUDA 4GLYA 3F0OA 1G32B 2GD4B 1AD8H 4NA8A 3U8TH 1WXRA 1UCYH 4YOJA 2HALA 2KZ4A 5E2OA 2OC0A 4YLQH 1AWHB 1DITH 2R9PA 5TJXA 2VVCA 3A85A 1LHCH 3F6UH 4CR5A 4YO9A 1AI8H 3RM2H 1ELVA 3NCLA 3M5OA 1AUJA 5CDFE 5DP9A 2F3CE 2AMDA 2C8WB 3F2GA 1GMHG 4D9QA 1K1MA 1TX8A 4I8KA 4UFGH 2ZHDA 3GY8A 1V2VT 1HUTH 2ZDNA 2H9TH 4E06H 1S84A 3DHKH 2W26A 3KGPA 1G2LA 1J9CH 3QLPH 4BNRA 1HJ8A 1ELCA 5E0JA 4JYTA 5FX5A 2Z9KA 2BD5A 3A7YA 1BA8B 5JBTA 1FONA 1GG6C 2H9EH 1QB6A 1HAZB 1ZPCA 2VWMA 5EIYA 3ATIA 3KHVA 1CVWH 1W13U 5GCHF 2ZFTA 1MTNC 4K8BA 1EB1H 1AU8A 1VR1H 3EA8A 1BITA 3N7DA 3BN9A 3TIUA 1W11U 1GMDG 4E7NA 4B6FA 3M61U 1VITG 4BAHB 1GBDA 5EODA 3KCGH 2ZNKH 2BX4A 2VIOA 1GHAG 3UR6A 1AB9C 1ELFA 1B5GH 3GDSA 4JZIA 2CHAC 3O8RA 3QDZB 1C1RA 2FODA 1OP8A 5JPMH 1O2YA 1RFNA 2EEKA 1SL3A 1VGCC 5DP7A 2NU2E 3RU4D 3E8LA 2XXLA 5SGAE 1OP2A 1ID5H 1C5RA 3BTQE 1P2IA 3LH3A 2OP9A 4J2YB 1ABIH 1O2PA 3MFJA 1FY8E 1YLCA 2FOGA 3KQCA 3PMHB 1TABE 3FP6E 3RMMH 5DJ7A 1QJ1B 1O3BA 4Q80A 5EGMA 3RXAA 1NU7B 1L0ZA 2WV4A 2TGTA 4KELA 1MBQA 1O5BB 2Z3DA 1P06A 3D23A 3JZ1B 3AAUA 1XXDA 1YC0A 1WQSA 2VWNA 5DP6A 1V2QT 1O38A 3LJOA 3CP7A 3A8DA 3KQEA 2VWLA 1DS2E 3ZVAA 2OXSA 1P0SH 1ZSKA 2O8UA 2OUAA 1NFXA 2AERH 2BD3A 1O34A 4WXIA 3GICB 3EYDA 4B74A 1JWTA 2W6JD 2UWOA 4Q7ZA 2OQ5A 3OTJE 1Q3XA 5CHAC 1CQQA 1XVOA 3PRDA 1HIAA 3MQKC 3SU1A 2ZA5A 5GWZA 2BY6X 2A5KA 3RXVA 2IPHA 1QCPA 1O3KA 2Y5GA 4THNH 1WAYB 3CS0A 2ZHFH 3KEEA 4NG9H 2XC5A 1SLUB 3FZZA 1OWKA 3MO3A 1MABB 2W7SA 1LDTT 5ESTE 1F92A 1FZZA 3DFJA 1S82A 1F7ZA 1QL7A 2D2DA 5EPYA 2P95A 2ZFQH 3VB3A 3ZZ6A 1CU1A 1W0KD 3PV2A 3TPIZ 1IQMA 4B75A 2VB0A 2PWXA 1CBWB 4CRGA 1P2JA 4ABDA 3RMOH 2ZFRH 1AGJA 2D26C 1K1PA 1C1VH 3NK8A 3DFLA 4I8HA 2QXHA 3P6ZB 1ZLRA 1V2JT 3MI4A 4BAKB 2F4LA 5C17A 2TRMA 2OC8A 1MAYA 1XXFA 1J17T 5L2YH 2KCYA 3GY7A 2FI3E 3DSPA 4X6OA 1MMJN 3MNSA 3N7EA 4Y0ZE 4ZXYH 1TPPA 5EW2H 1C2JA 1H9IE 1VJ9U 2R2WU 3ATLA 3LGTA 2A4QA 4NFEA 1UK2A 4JCNA 5L6NH 2C3SA 1TPAE 3M5MA 1MTSA 4TPYA 1HAHH 5GJ4B 3U98H 4NSYA 4MNYA 1HXFH 1RTKA 1V2WT 1DOJA 4Y11E 1AN1E 4NIWA 5EQQA 1J15A 2J97A 3UQOA 4YM9A 4CRDA 3TJNA 3RMNH 1P10A 2M2AA 5FPTA 4GSOA 3QWCH 2J94A 2ZO3H 5EW1H 4GUXA 1HAPH 2WSSD 2YMSB 2ZTXA 1UTOA 4Y0YE 3MNXA 3IITA 1Y3YA 2FXRA 3SU0A 4X1NU 3ENSB 4X0WU 1FUJA 1AVGH 4Q7YA 3ZVEA 3U1JB 1OHHD 3O8CA 1YPGH 1SKYE 1MKXH 1O2OA 5K7RA 1P2QA 3M3TA 5C1YA 2Z3EA 5DG6A 2ZKSA 1KIGH 1Y8TA 1KSNA 2QIQA 3A87A 4K1SA 5EXNA 1TPOA 4IW4E 3SJOA 1O2LA 2EI8A 1C5WB 1EAWA 2GT8A 2A2XH 4B73A 5EU8A 3GDUA 1EPTB 1DDJA 1XKAC 3SU6A 1V6DA 4JZ1A 1RIWC 4ABJA 1ZHRA 2FZZA 1XUGA 4X1RU 1KXBA 2V35A 4CH2B 1WCZA 2KR7A 2ZPSA 2XBWA 3BEFB 3PLPA 2LNCA 2B0FA 3SNBA 1GBJA 1UHBA 3L33A 3A8BA 4LZ4B 3A81A 3ODFA 1EZSC 2D8WA 2JETC 2FX4A 1TIOA 4BOHA 3E6PH 1NROH 1RJXB 2KM0A 1T4UH 1O31A 4UFFH 3BTWE 2WV9A 5CE1A 1KDQB 1C9TA 1D9IA 2CGAA 1ZMLA 2GJGA 1OPHB 1SQOA 5L30H 4NZLA 2AGIX 2KAIA 2ZG0H 5IDKA 5T6GA 2BLOA 3V0XA 2XTTB 4ASHA 2WINI 2L6OA 1GMCG 1ZPBA 1UTNA 1GHYH 1LHDH 1EB2A 1KLTA 3VGCC 1BTXA 4LOYH 2GCTB 1TNGA 2IJD1 1SFQB 9LPRA 5A2MH 1DFPA 1E35B 1ZHPA 1TALA 1IQIA 2BDAA 1QRWA 3B9FH 1BBRH 1C5SA 2P59A 1TFXA 4O03A 3M7UA 2Z9GA 3BG8A 1HNEE 5CHBA 1KDQA 3MNCA 3BTHE 2C8ZB 4Y8YA 1ZRBA 1GBCA 2DUCA 2BTCE 4FVDA 4B2AA 2NU3E 3PTNA 1DT2A 1OSSA 2XYAA 2FYQA 4B6EA 1A3EH 3TNSA 3FO8D 4B71A 4XD7D 3SO3A 3TK6A 5ABWA 3EA9A 2OBQA 5L2ZH 4I8LA 2FDAA 2K1QA 3EE0B 1YY3A 4RT1A 3ESTA 5F6MA 1ZMNA 3BTTE 2EC9H 1LTOA 3PO1B 1GI2A 2JH6D 4JK6A 1ETRH 1EXFA 2F43B 2CF9H 4A6LA 5F53A 2P3FH 2BLVA 2F9VA 1GI0A 1OWJA 1GJBB 1QQ4A 4ABBA 2KCOA 2VBCA 1TMUH 1HFDA 1O3FA 1A5HA 1YPEH 1YPHC 4CRAA 2WPLS 3LONA 1S83A 3Q76A 4AB9A 1IHSH 4Y7BA 1C5ZB 3ITIA 4BTIB 3SU3A 1HPGA 2BY7X 4ZHMU 5GCHG 2OD3B 3OEED 1BTHH 3HPTB 1O3NA 3VB6A 1QA7A 5EQRA 2QXJA 4MG3A 1SGRE 4ABGA 2XW9A 2BDGA 3TK5A 5C1UA 2WPIS 2XCFA 3Q00A 3TH3H 1BRUP 1MTNB 3M5NA 3QZQA 1UTPA 1QRZA 2NU0E 3NUMA 3SGAE 3GYMA 5B6OA 1E1RD 6CHAB 1OYQA 1G3BA 2A32A 3QTOH 3RM0H 1K1LA 4RKJB 4X2YA 1JIRA 3F9HA 3H7TA 2V3MA 1THSH 2IN2A 1ACBE 1C5NH 4JZFH 1GHZA 2FLBH 1TBRH 4K5ZA 3OX7U 4JYVH 4BXWA 1XM1A 3BSQA 1A0HB 1H9HE 1HLTH 1AVWA 2VVUA 1TMBH 4U32A 1IAUA 1SMFE 1JMOH 3DT0H 2OTVA 3RXBA 3OFND 3PYHA 2Y6TA 3T26A 1VCWA 1GBTA 3RXIA 1FXYA 1S85A 1QA0A 1HIAB 2F91A 3PB1E 3NRLA 2PLXA 1O2RA 1DLKB 1E34B 1QNJA 1GMDF 4OS6A 3T2NA 3UB0A 4AYVB 2O8MA 2ANWA 1C1WH 2AIPA 4CBNA 1ZSLA 3TU7H 1YBWA 1DE7H 5EG4A 1XX9A 2ZPQA 3U8RH 1BJUA 2W7UA 4HI3A 3KQ5A 3RMLH 1AIXH 2BDBA 4FUHA 1GDQA 3SNEA 3PTBA 3W1EA 2ILNA 1V2PT 1K21H 1DX5M 4Q7XA 1HAGE 3HKIB 3V7TA 1IQFA 3RXHA 1GCTB 5DN6D 4A1VA 2GMTB 3FVFB 4D7GA 5GNDA 4DCDA 1A0JA 2HVXA 1HAOH 4BAQB 1YYY1 3E0PB 3LPRA 4X6PA 1KTSB 3KYGA 2PTNA 1BMFD 4ZHLU 3QO6A 1D3QB 1LVOA 2XC4A 4MPXA 1FIWA 1CT0E 4NSVA 1WSSH 4QT8C 5AVDA 1GBHA 1IQEA 1QL9A 1TPSA 2VWOA 1Q2WA 3ATMA 5LPEA 3AASA 4GPGA 3RC6A 4K3JA 4B2CA 1EJAA 1AWFH 3RLWH 1JIMA 5BPEA 2W3KA 4ZKRU 3ZZAA 1IQKA 2A0QB 2EI7A 1YLDA 3FAOA 3SJ8A 3OY6U 5DP4A 1DXWA 4DOQA 2BY8X 1N6XA 2A4OA 3DD2H 1AHTH 3K6YA 1AZ8A 6GCHG 2G8TA 2W3IA 3VXFH 3ZZ9A 3L6PA 1CO7E 5IYTA 1ETSH 1CA0B 3D62A 2HNTC 2P16A 2XOKD 4TPIZ 1H1BA 3OU0A 5AFZH 5G4BA 5DGJA 4AN7A 2C90B 4DJZB 4IS5A 3A86A 2SGQE 1VJAU 1BZXE 2VVVA 1G2MA 3ZVCA 5HKKD 3MTYA 1GBAA 1GJ9B 1O2WA 2WPHS 4X8TH 5FBIA 2Y5FA 1FNIA 8GCHG 3K2UA 3TH4H 3SZEA 1D4PB 1P2NA 2G55A 5DPAA 2QF3A 1ZYOA 5J4SA 2YNBA 2JDID 1C1QA 1GJCB 3RXRA 1UCYK 1V2TT 2UUFB 1NPMA 2XBVA 1KLJH 1GBIA 4HZHA 3SV6A 3F1SB 3RXLA 1O2SA 1QFKH 2V6NA 2J2UA 2AMQA 1COWD 4I86A 1HAXB 4FUIA 2JKHA 3QTVH 1LKAA 2QA9E 4D8NA 4H6SB 1G37A 2SNWA 3SUDA 4A7IB 4F55A 1V2NT 1JRTA 1NN6A 2O8TA 2VGCB 2YOLA 1NRNH 1NT1A 1GJAB 3GY4A 3UPEA 1QRXA 1XVMA 1NZQH 1IQJA 1CE5A 1ZOMA 2QE7D 3SNAA 3NZIA 2BY5X 1PPCE 5TCCA 3VFEA 4DIHH 3NXPA 2NWNA 1CHOG 1EAXA 1DVAH 2PP6A 3STJA 2OLGA 1BBRK 1CA8B 3ZZBA 2R3YA 5KEDA 3E0NB 4JZDH 1BT7A 4DT4A 3BEUA 5ETXA 2R0KA 1W14U 1FAXA 2A7CA 3K9XB 1FLEE 1GJ7B 2GZ7A 4KTUA 3HKJB 1C5YB 1GGDC 1NO9H 1EPTA 4NIYA 1K22H 1IQLA 2OBOA 4MPWA 3UIRA 4UONA 1UTKA 4INLA 1B0FA 1ESAA 3LGVA 2ZGHA 3ZIAD 1GCDA 2ANMH 1KTTB 1DPOA 2B9LA 3BF6H 1TGSZ 1GI5A 2BD4A 1GBEA 1TOMH 2G5VA 3F9GA 5JBAS 1O39A 4WJG2 5HGGA 1BCUH 2AEIH 5C0UA 4Y7AA 1C4U2 4RI0A 5AFYH 2GP9B 5A8XA 1PPGE 2VIQA 1YGCH 3GISB 2J5UA 3HGPA 4MDSA 1IQGA 4FUBA 4FU8A 4RT0A 2QXGA 1MU6B 1EX3A 1GJ5H 3B23B 2XNDD 4ZXXH 1QZ8A 1V2KT 2Z6BD 1QL8A 1EAUA 5H4IB 1C9PA 3T5FH 1E36B 2SGEE 2ZU2A 1UK4A 3URCA 1KXAA 7ESTE 1P2KA 3KL6A 3BTME 3GCHC 1O5DH 1BJVA 8ESTE 1A3BH 1OWDA 2HWLB 1ABJH 5C67A 1T4VH 2KCAA 2IOTA 1PQAA 1SQAA 1W7GH 1UO6A 4ZHAA 2G52A 3GS9A 2GKVE 1CHOF 5FCRA 1ZPZA 2ALVA 3SHAH 1L4ZA 2OINA 1TX7A 1TX6A 4Y8ZA 4INKA 1Q31A 1O2VA 3Q77A 3WWBA 4GAWA 1C2EA 1AFQB 5HM2A 1GDNA 3PMBB 1YPKH 4MNVA 4O3UA 5LGOA 1ELAA
chains in the Genus database with same CATH topology
2VJ1A 2THFB 5DP5A 1Y3VA 1MBMA 1E38B 3LC3A 4XDEA 4I31A 1Y5BT 4B76A 4ISNA 4JZEH 3MH4A 3OYPA 1SQTA 1MD7A 3SUEA 2XC0A 1O33A 3IG6B 3MU4A 3BTFE 3ZZ7A 1CGHA 2GMTC 4X6NA 3VB4A 4AX9H 1SGNE 1GCTC 3TITA 3SI3H 2WYGA 3SUGA 4AOQA 4WH8A 3VB5A 1ZGVA 3PWCA 1UHBB 1JRSA 2PSYA 3S7KB 3D65E 4AORA 4GHTA 2BVRH 4IC6A 2A1DB 2VINA 1NESE 1UVOA 3LT3A 1P02A 4Y71A 1RTLA 1A61H 3PWBA 2NU1E 1BOQA 1GHVH 2BVSH 1UVPA 1Y3UA 1C5PA 3E16B 1XUIA 1FIZA 1O2MA 3PMAB 3TGIE 1PPEE 1GI1A 4LK4A 4AB8A 2AIQA 2FTLE 2GTBA 4AYYB 2HRVA 5GIBA 4DVAU 1JXPA 2FLRH 4MQAA 3NPSA 5FPYA 1RXPA 1NY22 3SOSA 4CRBA 1PPBH 2QXIA 2VH0A 4I32A 5FPSA 1DWCH 3RC5A 1BRCE 3E1XB 4XBBA 3SU2A 1TQ7B 3MU1A 1S0RA 1CHGA 4ABEA 1EUFA 2ZWLH 3HGNA 2R0LA 1LKBA 2ZECA 4XBCA 3UNRA 1C4V2 4YLUA 1SGQE 5EOKA 3M3SA 2GV7A 4DURA 5T3HA 1DUAA 1C1PA 2BZ6H 3V3MA 4UD9H 3P8FA 3LC5A 3SBKA 1UMAH 1W7XH 1YCPM 1K2I1 1FY3A 1O3CA 3K6ZA 1XMNB 1ZHMA 2HLCA 4A1XA 2IJOB 1W0YH 3M37A 5F8XA 1FY5A 1AY6H 2TGPZ 1P01A 3SJKA 1QBNA 1OP0A 1OOKB 2DE9A 7GCHG 1ZMJA 1NRRH 3RXQA 9ESTA 4DY7B 8LPRA 1NFWA 1ELEE 2ZTZA 1O3EA 3U9AH 3M5LA 3DUXH 1YPJH 1PFXC 1EZQA 3MU8A 1LPKB 4X8UH 4CBOA 1MKWK 2AS9A 1F5KU 4I33A 3QGJA 1GVZA 2BY9X 1SLXB 2PTCE 3RXFA 3URDA 2OC7A 3WY8A 3VXEH 1TGNA 2ZFPH 1L1JA 1P2OA 2ESTE 2BDHA 4AG2A 1WTGH 3VPKA 1ZR0A 3SGQE 1PYTC 2FS8A 2UWLA 5C5NA 3ZZ3A 5BRRE 1T31A 1SGCA 1YP9A 1Z8IB 2WPMS 2BXUH 2TGAA 2PR3A 3MH7A 4OS7A 1W2KH 1Z7KA 3QX5H 2J34A 3RXDA 1TA6A 3U1IB 4KGAA 2BM2A 2FYRA 2GVFA 3PM3A 1EQ9A 3W94A 2BX3A 1ZJKA 1ZTLA 1BMAA 1UVUH 1V3XA 4FUJA 3VGCB 3U69H 1ETTH 3SQHE 3FZDA 2HNTF 2XWAA 4ZKSU 1O2ZA 2FMJA 1FDPA 3GY6A 3L3TA 2STBE 1KXEA 2GX4A 4OGYA 5CHAB 1MD8A 1TRNA 1GBFA 2PKAB 7GCHF 1C1NA 1Z8RA 1OYTH 2H5DA 4WH6A 1HV7A 4WXVA 3SHCH 1BHXF 1C2DA 1W3CA 1WU1A 3IWMA 4NWKA 1TNIA 1Z1IA 3MNBA 2Y5HA 1C1SA 3UWIA 4X6MA 2F9NA 4NWLA 1OWEA 2FI4E 3N7OA 3E91A 2ZGJA 2SGDE 2ZHWH 3MWIU 1T7CA 3UREA 3KQBA 3ATWA 1Z8GA 3T62A 3RXTA 1H9LB 2A2QH 1AQ7A 1K1JA 4OS2A 2C93B 1FQ3A 1YPMH 1SGDE 2A7HA 1PPHE 2ZDLA 2BDCA 1VITH 2I6QA 1WUNH 1JOUB 5EXLA 2BDYA 3C27B 3SV9A 1GI6A 4ISLA 2CJIA 3GCTF 5TCAA 2WUBA 1GJ8B 3EA7A 1QBOA 4DT7B 4RN6A 1OXGA 2GCHG 1SC8U 1C2FA 1ESTA 1FJSA 2EA3A 1V2ST 1VGCB 2B8OH 5FAHA 2YNAA 3T27A 1XUJA 6LPRA 2C8XB 3SUFA 3UNQA 1GI4A 4VGCB 2AGEX 1O3IA 4CRFA 1SGEE 3B8JA 2TBSA 3RP2A 4ESTE 8GCHF 3SORA 1P9SA 1TOCB 3DA9B 3KIDU 1SBWA 2UUYA 1ELTA 2G4UA 1O5AB 1C1OA 3O8BA 1A2CH 1MCVA 4AGJA 3OY5U 1Z1JA 3SNDA 2XBXA 1GBLA 4GCHG 2PUQH 3RXKA 1SGTA 3ZVFA 3RXJA 5C3NA 1J16A 1CBWC 2ZGCA 1RTFB 1O37A 1NFYA 1QJ7B 3GCNA 1GMCF 4H42U 1WOFA 1G30B 4E7RG 1LPGB 1BDAA 1NTPA 3MOCA 5T6DA 1E0FD 2PKSB 2FOCA 3NKKA 2C8YB 1HXEH 3Q3XA 4UDWH 1GBBA 1A1RA 1D3DB 1ZTJA 4MLFB 3A7XA 2KAIB 4MPVA 2HGTH 1LQEA 4NIXA 4BANB 2O9QA 1QJ6B 1AFQC 2TPIZ 2XRCA 4CR9A 3S7HB 4DIIH 1W8BH 1K1NA 2PV9B 4IC5A 1CGIE 3I29A 4OS5A 4OS4A 1TE0A 1RRKA 3LGYA 3A80A 2UWPA 1O3DA 4F49A 4ABHA 2BMGB 1SG8B 1GG6B 5F8ZA 2FM2A 4OGXA 1LO6A 2OQUA 3F9EA 1XUHA 2BQ7B 4WY3A 1HCGA 1IQNA 2AFQB 3ZV9A 2Z9LA 3GY3A 7LPRA 1MU8B 1THRH 4WWYA 3PLBA 3A82A 1BRAA 1BTPA 4O97A 2AH4X 3SJIA 1GMHF 1O2GH 1GI8B 4X2WA 2A45B 3UTUH 4A1TA 4K1TA 1T8LA 3V13A 2HOBA 1GI3A 2ZF0H 5K0HA 2BDIA 2SGAA 3RDZA 1SLWB 2ZP0H 2ZCKP 3RLYH 2HNTE 1K28D 2FOFA 2Z94A 4XOJA 3SI4H 1C1TA 2AYWA 3O8DA 1O2QA 4X1PU 3GCHB 1Y3XA 1THPB 1QIXB 1O3GA 1BQYA 1M9UA 1INCA 4KTSA 5T6FA 1MTWA 3UOPA 1RS0A 4FVBA 4K69A 1BB0B 2CF8H 1S0QA 4D76A 4WMDA 3SNCA 1UTJA 3MO9A 2QAAA 1GJDB 5C20A 3SJ9A 1GL0E 1PQ8A 4SGBE 3FFGA 3GY5A 1RGQA 3QZRA 2FOHA 2V0BA 1KXDA 4Y79A 2H6MA 2V3OH 1GGDB 2WYJA 3MO6A 3E90B 3HK3B 3SZNA 3PV4A 2BD7A 3ZZ5A 3I77A 5JB9S 2C4FH 1BTUA 2UUJB 1HAVA 2RA0A 3TGKE 1FN8A 2ZFSA 1EOJA 1X7AC 4CH8B 1HAVB 3GYLB 4BTTB 3T29A 2H9HA 4YOIA 2G51A 3AVZA 4FU7A 2Z9IA 2Y7ZA 1ESBA 4TY7A 2ZIQH 1QURH 1ZGIA 4YZUA 2RG3A 5A0CA 1Y5AT 3M3VA 1ZJDA 1BMNH 3GCTG 2GZ8A 1P8VC 1Y59T 8KME2 3EDXB 2RCEA 2G81E 1NRSH 1ZRKA 3FP8E 1GDUA 1FMGA 1CSOE 4WMEA 3AAVA 4K1EA 1NRQH 1G3CA 3LH1A 1SLVB 1DANH 1OWHA 1DLEA 1O5GH 2VGCC 1WBGB 1UK3A 3MH5A 1TGBA 5FCKA 2BB4A 3STIA 1F0UA 1DICA 1P2MA 4I7YH 3ZZ4A 5E8EH 3S9BA 4WF8A 1KY9A 1F0SA 1GBMA 2FIRH 4XFQA 4X8SH 1O36A 3TLOA 2PGBB 2VNTA 1P09A 2ZDVH 2STAE 1H4WA 2DE8A 1O3PB 1P3CA 2BOHB 1DWEH 2SNVA 4X8VH 5EQSA 1C2IA 4AGKA 4GVUA 1FI8A 1UTQA 2FEQH 1W0ZU 2ZHEH 1UVSH 1MQ6A 1FN6A 4BXSA 1E37B 1MZAA 1XUKA 5I46H 1TONA 1TBZH 1F2SE 2PHBA 1QQUA 1AE5A 1GHWH 2RA3A 5J4QA 4YOGA 1BUIA 1QB9A 1O2KA 1EJMA 4U2WA 4HGCA 3ZYEA 1KYNA 1H8DH 4I8JA 4AZ2B 3P92A 1P03A 1VITF 1T32A 1A7SA 2QV1A 2B5TB 3A8AA 1LCYA 4TWWA 3TJVA 3TGJE 5E2PA 2VIVA 4NA7A 3M36A 1TMTH 5F8TA 1L2EA 2A5IA 3A7VA 2FWWA 3RXCA 2GDDA 2ZZUH 3ZVGA 1C1MA 4BAOB 2ALPA 2VIDA 2WPJS 1EZUC 1LHFH 3RC4A 4YESB 3KN2A 4DGJA 2Q6GA 1ZSJA 4CRCA 1BRBE 1Z8JB 2H5CA 2Q6FA 1MTUA 1MH0A 3EQ0H 4ZROA 1Z6EA 5FHTA 4CREA 4MTBA 2BZAA 2FI5E 5DP3A 4IMQA 2BHGA 1PPZA 4ABAA 1GI7B 1GI9B 2ZGBH 1HDTH 3TK9A 2ZU3A 4AFQA 2H2ZA 3AW0A 2F9UA 4IBLH 4B2BA 2P3UB 1N8OB 2Q1JA 2WV5A 3KQDA 1O30A 1C5VA 1V2OT 1O2TA 2NU4E 2P93A 1LVMA 3SU4A 2HPQH 1DSUA 1NC6A 1WV7H 3BIVH 5JYIA 1CGJE 2Y7XA 1J8AA 1TGTA 3UY9A 1SHHB 2FTMA 1AVXA 3QGNB 1SVPA 1HGTH 3A88A 1O2XA 1F0TA 4ABIA 4JK5A 4JYUH 1G36A 2UUKB 2ZU1A 5I25A 4XSKU 2JETB 4O9VA 1P04A 1TB6H 1AKSA 3M7TA 3MHWU 2M5TA 1LMWB 4JMYA 3RUOA 2BQWB 1EAIA 3QUMP 3KNXA 5GXPA 4Y8XA 3ATKA 4K8YA 2ZHQH 1HJAB 4ABFA 1EPTC 5JBCS 5FBEA 1B7XB 2J9NA 3P17H 3GOVB 5GDSH 1FV9A 2GDEH 2D1JA 2Q6DA 1NFUA 1C4Y2 1UTMA 4FUGA 3MH6A 4I8GA 4TYDA 1HJ9A 3LIWA 1EATA 1P11E 1GHBG 2J92A 1TNLA 1ANBA 2F9OA 4X1SU 2BLQA 1MQ5A 3P70B 3P8NA 5GPIB 2H1UA 1GJ6A 1WTHD 1A5IA 1V2MT 4Y6DA 1LHGH 4NA9H 4OS1A 1Z6JH 1SFIA 3ELAH 4NGAH 5FXLA 3ZVDA 4KP0A 1IOEA 3A7WA 4ZAEA 1MKXK 1EP6A 2ZTYA 2GT7A 1O5FH 2ASUB 2XCNA 1O5CB 4CHAB 2PW8H 1O3AA 2A31A 2VU8E 2HPPH 4F4OC 3F9FA 1HAIH 2AGGX 2QYIA 1CT4E 1SPJA 2OC1A 4IN2A 1P3EA 1DUEA 1K1IA 3SU5A 4ZMAH 4ISHH 1VCPA 2BD9A 1DWBH 3A7TA 1G9IE 1SR5C 3RXPA 1JBUH 1OS8A 3BV9B 1TBQH 1MKWH 4AFSA 4Z0KA 3C1KA 3BTDE 4R8TB 4H4FA 4U30A 1QBVH 2A5AA 2R2MB 1AKSB 1N1LA 4HTCH 3T28A 1SGFA 3TVJB 3BIUH 3TH2H 1J14A 2P8OC 1SGYE 2PKAA 5A8ZA 2R3UA 3ZZ8A 1GHBF 2B7DH 3F68H 2GCTC 1C2HA 3PO1C 2FS9A 2SGPE 1EP5A 3SQEE 2P94A 2BOKA 1L1NA 1C5TA 2CXVA 2Y82A 3A7ZA 2I6SA 2SFAA 1EKBB 3I78A 3S9CA 1A5GH 1O3JA 2F9BH 1S5SA 5LH8A 2BLWA 2XWBI 2ULLA 1P05A 1QY6A 4LXBH 3TJOA 2FX6A 3TJUA 3W95A 3UNSA 4KKDA 3RU4E 4BAMB 2QC2A 4YTAA 2FP7B 3MYWA 4AFUA 3BTKE 1BMLA 1DXPA 5HYOA 3JZ2B 1KXCA 1T8NA 4M7GA 5C1XA 1P12E 1ELDE 1QR3E 2ZCLP 1MAXA 4XE4A 1MZDA 4ZKOU 4MNXA 1AZZA 1LPZB 1QHRB 1PJPA 2SGFE 1FY4A 3R3GB 1DWDH 1VCQA 3FP7E 1FPHH 4TWYA 1O2IA 2ZU5A 2QF0A 2W5EA 2G5NA 2PKSC 4NCYA 5DP8A 3SW2B 4SGAE 4E05H 3A8CA 3LDXH 1GWAA 1TNKA 1TNHA 4FUEA 1KXFA 3D49H 4D9RA 2FOMB 1O3LA 2GCHF 1TAWA 2VIWA 3HK6B 3P8OA 1RD3B 1Y3WA 3ZZCA 1NM6A 1GHXH 4GHQA 1MUEB 1GHAF 2F9PA 4MPUA 6CHAC 3HATH 6ESTA 2GGVB 2TGDA 1YF4A 3M35A 1YPHE 4VGCC 1BTZA 1L4DA 4H6TA 4ISOA 2BYAX 3KF2A 4NIVA 1WYKA 1TLDA 2Z9JA 1SGIB 1Z71A 1DY8A 1AMHA 1XUFA 3E3TA 4X1QU 1OKXA 4WVPE 5JBBS 2AMPA 1F0RA 1MCTA 1EASA 4D7FA 5ESBA 3S69A 5JDUB 1WQVH 4IMZA 2TIOA 5FX6A 2G4TA 1HJAC 1C5XB 1SOTA 4ISIH 1T8OA 3MU5A 1DY9A 3QN7A 4INHA 1GVLA 5HMAA 2BVXH 3LU9B 3RXMA 1TRMA 3PROA 1A4WH 1O3OA 1SSXA 4A92A 2J4IA 1HAYB 1ANEA 1D6RA 2BD8A 3V12A 1DSTA 3U8OH 4R0IA 1LVYA 5LPFA 1C1UH 1F5LA 2WUCA 5AF9H 1YPLH 4FUCA 1W10U 3EAJA 4Z6AH 4DG4A 1S6FA 1B0EA 4UEHH 5E0GA 3CS7A 1EZXC 3RXGA 1DM4B 4YT7H 2J95A 4MNWA 1IHTH 1O35A 1AUTC 3P95A 1NRPH 3Q3KA 3QK1A 2A4GA 2XBYA 3LGWA 3SGBE 1C5OH 5A0AE 5DKMA 1ANCA 5F03A 4AFZA 1C5LH 1A46H 1O2UA 1FAKH 1W12U 2ZU4A 3T25A 4ZH8A 1BMMH 2ODPA 1K1OA 4GCHF 1O2NA 3G01A 1HB0B 2Y81A 1SGPE 1YKTA 7KMEH 1SB1H 1UCYE 3PMJA 3MU0A 2J38A 4NZQA 2QN5T 1LQDB 3SV2H 4RKOB 2P8OB 1KLIH 1BHXB 1SOZA 3VB7A 2VH6A 3UWJH 1GVKB 5PTPA 5A09A 4BTUB 2ZPRA 1T8MA 2CN0H 3Q3YA 1D3PB 1GL1A 4B1TA 2XNIA 2RDLA 5DO4H 2A4RA 3LOXA 2ZGXH 2ODQA 4IGDA 3TNTA 4J1YA 5C2ZA 4MVNA 1RIWB 1TYNA 1K9OE 3GCOA 3RXUA 1O0DH 2G00A 3P8GA 1BBRE 1G3EA 2ZDAH 4X2VA 4YT6H</