3IG6B

Low molecular weigth human urokinase type plasminogen activator 2-[6-(3'-aminomethyl-biphenyl-3-yloxy)-4-(3-dimethylamino-pyrrolidin-1-yl)-3,5-difluoro-pyridin-2-yloxy]-4-dimethylamino-benzoic acid complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Identification of orally bioavailable, non-amidine inhibitors of Urokinase Plasminogen Activator (uPA)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 245
sequence length 245
chains with identical sequence D
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ig6B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ig6B01
4IC5A 4WXVA 1ARCA 1TABE 1GI0A 1UVSH 1RTLA 1G36A 2BQ7B 1TMBH 2SFAA 4Y8YA 1HGTH 4CHAC 3HK6B 1AKSB 5GWZA 3B9FH 1GJ6A 1YF4A 4FUFA 1E34B 3Q3XA 1J15A 4OGYA 1GJ9B 2ZIQH 1C9TA 2DUCA 4ISNA 3QN7A 2YNAA 1O2ZA 1OP8A 1HFDA 2K1QA 3SUEA 3CS0A 4AYYB 4B76A 3F6UH 1O3GA 4MNWA 1GJ7B 2FODA 2C90B 2WV5A 1BMNH 1FNIA 2XYAA 3BTGE 3N7OA 2I6QA 3OYPA 5FPYA 1E37B 1TOCB 1F92A 1UTKA 1O5AB 1OWEA 2W26A 4JYTA 6ESTA 1HLTH 1DICA 5DP7A 4Y7BA 4YESB 5JB9S 4MTBA 5LPEA 1XUFA 2R0KA 4HZHA 1PPGE 5BRRE 1PPZA 1C5YB 1AHTH 1KTSB 1HPGA 2C8YB 1WBGB 2ZG0H 3E3TA 3MH6A 3ZZCA 1P2IA 4BAMB 1SHHB 4UFEH 1ZGVA 1G32B 5E0JA 3NWUA 3BG4B 1O2VA 3RXVA 4X6OA 3RXEA 1TBRH 3K6YA 3ENSB 3SO3A 1UTPA 3T28A 3D62A 1FLEE 2BD9A 1IAUA 1MMJN 1W10U 1UTMA 2SGDE 4JK5A 2VH6A 3TJNA 4ZKOU 1C4V2 2LPRA 1CBWC 2BD4A 2VIWA 2PW8H 4O3TA 3GCHC 1QY6A 2TPIZ 4DIHH 1T8MA 1NFWA 1GHAF 1XXDA 1V2LT 4KTSA 6GCHF 1Y5UT 1TGNA 3LDXH 4RKOB 1IQGA 1TGCA 2F9BH 2BLQA 3T25A 1HYLA 1O3LA 1GHBG 2HNTC 3E0NB 3ZVEA 2FTLE 4WMDA 3MU4A 3UWIA 3MU8A 3QZQA 5DJ7A 1S0QA 1IQKA 2PGQB 2FOEA 4TWWA 1V2PT 3H5CB 1S81A 4NWLA 1C1RA 3FZDA 3E90B 1H9LB 2R2WU 2ANKH 2ZC9H 1YPHE 1MCVA 3RXGA 1YP9A 3LGIA 1TBQH 2H9TH 3HATH 3CP7A 1BA8B 1O3DA 1OP0A 1ZGIA 3B8JA 3KEEA 4B2BA 4MNXA 4ZKSU 4WMEA 2BY5X 3WY8A 2G00A 3E91A 1WTGH 1XUJA 1TA6A 2CXVA 1AVWA 3GDVA 2UWLA 3PB1E 1O2WA 3QDZB 5FXLA 4YOJA 4FUDA 3OTJE 2PTCE 1N6XA 1GGDB 1O2GH 5DK1A 3RXCA 3SNBA 1HJAB 1O2TA 1B7XB 5EXNA 1WU1A 1NTPA 3SNDA 3SN8A 1H9HE 1WAYB 2FLRH 4MDSA 4GCHF 1KXBA 1TNLA 3D23A 2ZU5A 1LTOA 3GY5A 1W14U 2VGCB 3FP7E 4YZUA 1O2MA 1NPMA 2Y6TA 1A0LA 1C5TA 5C67A 1O3PB 2CHAC 3RXSA 2SGEE 3GY6A 2AGIX 2C8ZB 1C2HA 3FAOA 5EODA 4FUCA 3GCTF 1QR3E 3R0FA 5EXMA 3UOUA 1EZUC 3RXMA 3LGWA 1ANEA 3KL6A 3P17H 2Z9LA 2XCFA 3Q3KA 1G30B 1GJ8B 1BJVA 2GVFA 1DT2A 1TX6A 1VITH 2A4QA 4ZROA 5FX5A 2W5EA 4ZHAA 3RXTA 1RIWB 5T6GA 2A5AA 1DANH 2GKVE 2SNVA 4MG3A 4CBNA 1GMDF 1A3BH 4I8JA 3M5OA 2JETC 1P2MA 3RU4T 5DP4A 3UPEA 4TY7A 1VITG 1V3XA 1N6YA 1DS2E 5L30H 1IHTH 4D9RA 1W8BH 2ZHEH 2SGAA 1TMTH 2NU0E 3A7ZA 5ETXA 5C5NA 1N8OC 2EI7A 3SUGA 4HGCA 3A8DA 1JBUH 2BY7X 1DUAA 4CH8B 2WPLS 1FPHH 2QXHA 3PYHA 3E8LA 1VZQH 1L1GA 1UTNA 2V35A 2QGRA 2GZ9A 1GMCF 2BD7A 3EQ0H 1L0ZA 3EE0B 1DWCH 2BMGB 1O3NA 2JH5D 1EJNA 3M7UA 1H4WA 2FP7B 5A8YA 2B0FA 1AB9B 1PYTD 1GJCB 2ZI2H 4UDWH 1O3KA 5C20A 3I29A 2A5IA 4K8YA 4DURA 4DT7B 1K1PA 4OS1A 2G8TA 4ABEA 5HYOA 4K2YA 4WH6A 2H9EH 3ZZ6A 1OXGA 2ZU2A 1NZQH 4X8UH 1AIXH 5HGGA 1C5PA 1QB9A 3IITA 1CGIE 1W13U 3OX7U 1UTQA 1ACBE 1OYTH 3TK9A 1HJ9A 4MPVA 3P8OA 1ZTKA 3O8DA 1O5EH 4CH2B 3SV9A 4R8TB 3SV2H 1BTZA 3AASA 1BBRH 2I6SA 4LOYH 1F0SA 3DHKH 4WH8A 5ABWA 1OWHA 5A0CA 2BD5A 1BMLA 1C1NA 1G3BA 3ZZBA 1LKBA 1EP6A 3A8AA 1IQEA 4AB8A 2W3KA 4QT8C 2J4IA 4BXSA 4BXWA 4AG2A 1BMMH 1G3CA 3CENA 2BZ6H 1TGSZ 2EEKA 1BHXF 2Z3DA 3LGVA 5JB8S 2QV1A 4Y10E 1P09A 1G2MA 1T8NA 5DG6A 5E2OA 5E0HA 2OBOA 1O39A 3MU1A 3ZZ3A 1GBMA 1PPCE 1ELBA 3K2UA 1ZSLA 2BM2A 1LHEH 3QUMP 1NS3A 2G52A 1SGQE 1ZYOA 1RRKA 2WV4A 3QO6A 2LNCA 2O8WA 4IBLH 3RXBA 8GCHF 3UIRA 1GMHG 2PKSB 1MH0A 1T31A 2ESTE 4J2YB 4BAKB 1UVPA 3TLOA 4MNYA 1SSXA 2RG3A 7ESTE 4NG9H 1GI7B 1O3MA 2XC5A 2HVXA 3A8CA 3HK3B 1GJBB 1VJ9U 2ZQ2A 4A1XA 1ZR0A 2FESH 2OP9A 4X0WU 2BLVA 7GCHG 1WQSA 1FXYA 1F7ZA 3P8NA 4GLYA 3PTBA 1YCPH 4Y76A 3MO3A 2ZFQH 4E7NA 5ESBA 4BTTB 1KLIH 3HKIB 1XUHA 2Z94A 2GTBA 2Z9GA 2EI8A 3S9AA 3RC6A 1RTFB 1C2GA 1C1TA 2M5TA 3U8TH 1GI3A 2BYAX 1FIZA 1SLUB 3BG4C 1DSTA 3ATIA 3BIVH 3EDXB 3RXKA 1TONA 1TNIA 1UVTH 1Z8IB 2A0QB 1GI9B 1H8IH 2UUYA 1O30A 5FPSA 1ELVA 1O36A 3SJ9A 2BY9X 9ESTA 3FZZA 3T29A 8ESTE 3PV4A 5GXPA 2R0LA 1Z1IA 1SQTA 2GCHG 5EQSA 1C1PA 1YPHC 4K60A 1WTHD 8GCHG 1O2RA 1TPPA 1TX7A 3RXFA 3A7YA 1FZZA 3BEIB 3MWIU 2O8TA 1QL9A 1Z8JB 3RC4A 1GHYH 1C2FA 1QA7A 2A4GA 1BJUA 1SLWB 5I46H 2BDGA 4NZLA 1RS0A 1GI8B 1N1LA 3KQEA 2UUKB 9LPRA 1PPHE 3RMLH 3DD2H 4BOHA 1ANDA 2FOGA 1A2CH 3ZYDA 4F49A 3UQOA 1DWBH 1DY8A 3A83A 1QHRB 1L4DA 1A7SA 4FU9A 1ZHPA 1SC8U 1CHOF 1UK2A 1FN6A 2ODQA 2JH0D 1A1RA 1ZJKA 3QGNB 4ZKRU 4XBDA 5EG4A 4NIYA 2Q6DA 1OWJA 5EPYA 2ZDAH 4Z0KA 1C5OH 3F9FA 2HGTH 4AFQA 5JBCS 3DFJA 1A0JA 4Y7AA 3RMNH 2ALVA 3PWBA 1O5GH 2UWOA 4GAWA 2PKAB 3AW1A 1YC0A 2Y5FA 5EQRA 1GGDC 2GV6A 3A8BA 2C4FH 1OWDA 1DX5M 3A7XA 2R3UA 1HJAC 4YT6H 1ELDE 1W7GH 2QC2A 4AFSA 1C2MA 1O5DH 1UMAH 4A1VA 4AB9A 1P10A 3P8GA 2W7SA 4X2YA 5EPNA 3UNSA 2VGCC 1AE8H 1EZXC 1ESAA 5F8ZA 3SHCH 2QY0B 3VXFH 3UUZA 1HJ8A 3M35A 1CVWH 3A7TA 4A92A 4GSOA 4ABHA 1C5XB 4X1NU 3VFEA 4D76A 1WOFA 6LPRA 3SU2A 1WSSH 1MKXK 5C1XA 1L1JA 4HTCH 1C1SA 3U69H 1V2VT 1K1MA 1AY6H 3TJUA 5C2ZA 1O31A 1QA0A 2ZGXH 3BTKE 2BLWA 1A3EH 1Q3XA 4I32A 1DXPA 3LGYA 1K1JA 1Y3WA 1HRTH 3M5MA 2CGAA 1G37A 4IN2A 1NROH 4K1SA 1TB6H 1SQAA 2XNIA 3A81A 1D3TB 1RIWC 2AMQA 1EPTB 5TJXA 3LGTA 1QBVH 3GY2A 1GDUA 3BTWE 1Y3XA 1RJXB 5EW1H 1C2IA 4TYDA 5EQQA 2ZFTA 1T4UH 2FLBH 4LZ1H 2Q6FA 3NXPA 5GIBA 1SGFA 3EA9A 2ODYB 2STAE 2IN2A 1ZRKA 2OLGA 4U2WA 1LPKB 3I77A 1THRH 3GDSA 4XFQA 1AWHB 5L2ZH 1TNGA 1E0FD 3KCGH 4AX9H 3RP2A 1VGCB 1A61H 1WV7H 1D6WA 1YPKH 1C5NH 1AVXA 2AFQB 3F68H 3HPTB 1INCA 3SORA 2J92A 1AB9C 2F9OA 3SBKA 1P11E 1O3OA 1MKWK 3L3TA 1U6QA 1AE5A 1OOKB 1OWIA 1K2I1 2WYGA 1BDAA 1KXEA 2FZZA 2VVVA 1SGTA 5EU8A 1MAYA 1NC6A 1YLCA 1E35B 1Z6JH 2Z9KA 3LOXA 1FIWA 2HPQH 1SI5H 4BAHB 2FX4A 1DITH 1BCUH 4DIIH 3PO1B 1JOUB 1NT1A 1AQ7A 1CE5A 1AGJA 1IQJA 2FOMB 3UR6A 5K7RA 1HAGE 1S6HA 4RKJB 2CF8H 3MNCA 4INKA 3SU0A 4TY6A 1HV7A 4MVNA 2ZFSA 2VNTA 4YLUA 1DY9A 1TRNA 3KGPA 2ZU4A 3TH3H 1O2IA 3PM3A 3TJVA 3RDZA 4JZ1A 1FY5A 1IQFA 3PMAB 1GHBF 1RD3B 2XWAA 1YPLH 2CN0H 3LJOA 4Q7YA 2BD3A 2PSXA 3M37A 1QJ7B 1YLDA 4MNVA 1O2QA 1DLEA 1JMOH 1VR1H 1OYQA 4INLA 1ZLRA 1MU6B 1ANBA 4I8GA 2ZU3A 1OP2A 5A8ZA 1TMUH 1PQAA 3PLKA 2WYJA 4IC6A 2ZPRA 4INHA 5JBTA 1GI4A 2G4TA 1NY22 1T4VH 4X2VA 1UCYE 3BV9B 2PKSC 1MAXA 1F2SE 1O2OA 5A09A 2HOBA 2GT7A 4AG1A 1O2SA 5JBBS 4K5ZA 3S9CA 4NA9H 1O3HA 2A4RA 1GBCA 1VJAU 4OS6A 3F9GA 2ZHQH 5TCCA 2FOAA 3BF6H 2F9PA 2PSYA 3ATLA 3QX5H 1SGDE 1C1WH 4IS5A 1DM4B 5GCHG 1P04A 2FS8A 4UFDH 2HALA 2Y5HA 1KTTB 4U01A 2BQ6B 2HWLB 4XDEA 4H6TA 1YPJH 2GD4B 2ZDNA 1TQ0B 4O03A 2HRVA 2Z7FE 1ANCA 4X1QU 3FFGA 2ZECA 2WPMS 4TPYA 3A80A 1BQYA 3DUXH 3PTNA 4Q7ZA 3RLWH 3STJA 3RUOA 1TGBA 3RU4D 1CO7E 2H2ZA 1XKBC 3KN2A 1C1VH 4NA7A 4OS4A 5PTPA 2O8LA 5HM9A 3TK6A 1FY3A 1NFUA 1P2QA 2VH0A 4YT7H 3M3SA 1S5SA 4WMFA 1MD8A 4FVBA 1SOTA 3UREA 1O3JA 2A45B 2BTCE 2ZFPH 1TGTA 1JWTA 4NFEA 3A89A 1NESE 1FUJA 3SNAA 1DE7H 1QRZA 2RA0A 1MTNB 4OGXA 5LGOA 2EA3A 3VEQB 3LH1A 4JK6A 2V3HH 4WVPE 1MU8B 3PLPA 6CHAB 1SGIB 3LGUA 1G3EA 2XBYA 2SNWA 1VITF 3KIDU 2BX4A 3RXHA 1HAVA 1A5IA 1P0SH 1P3CA 2G4UA 2PGBB 4NWKA 4KP0A 4AGJA 3M7QA 1V2KT 1VCWA 1RFNA 2VIQA 2ZWLH 2FPZA 2G81E 1QNJA 1SB1H 1TALA 1XUIA 1C4Y2 1KSNA 2Y80A 1LKAA 1LPZB 1Y3VA 4FUJA 4UONA 2ZNKH 1F5RA 2IJOB 2ZA5A 1W2KH 1QL8A 1YPGH 4Y8XA 4MLFB 4ZMAH 3SGQE 2XC0A 1YKTA 2P8OB 2PKAA 4I8HA 4B1TA 2ZPQA 4FUBA 3VGCB 3TH2H 3URDA 1IHSH 3Q76A 4CBOA 3MFJA 2Q6GA 3SJ8A 2QCYA 1PJPA 2SGQE 3SQHE 3C1KA 2ZDLA 4D9QA 3A82A 1BRUP 3ITIA 4IMQA 2NU3E 4I31A 3V13A 3RXRA 1UJ1A 2VIOA 2ZDMA 2OD3B 3L6PA 2AGEX 3E6PH 5DP8A 1LCYA 2P95A 1UCYK 3ATWA 1AWFH 3U8OH 4XE4A 3W94A 2B5TB 2XBXA 2C93B 3S69A 4CRDA 3SOSA 2EI6A 4ABBA 1H8DH 3BEFB 1ZPCA 4AZ2B 2ZP0H 4D7FA 1XVMA 3PWCA 2F9NA 1Y3YA 1GBKA 1O0DH 3SW2B 3TNTA 1EJAA 1SGFG 4X2WA 5ESTE 1MTSA 4Y11E 2P59A 4FUHA 1PQ7A 1EPTC 1CT0E 1B0FA 3RM0H 1P12E 1CT4E 1K1OA 1BRBE 3ATMA 2BX3A 1EPTA 1NRNH 1O33A 1AU8A 1O3BA 4ESTE 3V7TA 2ZU1A 1LHCH 3T62A 2ZEBA 2OC7A 5FCKA 3RXIA 4CRCA 1CA0B 3SUDA 3SI3H 3MI4A 3A87A 1GL0E 4M7GA 3A88A 2H5CA 1GMHF 2R2MB 4X1RU 3T2NA 1C5VA 1SBWA 1ZJDA 1O2NA 2TBSA 2B8OH 4I7YH 1GHWH 1UVOA 3KQDA 2UUJB 3RXOA 1Z8RA 5DO4H 2ZHWH 3SNEA 5GDSH 1VGCC 1BT7A 5L2YH 7GCHF 1BTYA 3PMBB 3RXLA 1MCTA 1TRMA 4GHQA 2BD8A 3SU5A 1PPEE 1C5WB 3RXDA 1TNHA 4Q80A 1TA2A 1GBFA 5G4BA 4ISLA 1XMNB 2A32A 1GI5A 1KXCA 1LVYA 1MTVA 1TQ7B 5HMAA 2GMTB 2EC9H 1G9IE 2AGGX 1RXPA 4AFZA 3RM2H 2ZDVH 2FOCA 1V2NT 3MU5A 1ELAA 2Z9IA 1PPBH 1GJDB 1WQVH 3VB4A 4FVDA 1P57B 1B0EA 3BTTE 4O3UA 4ABFA 2ULLA 2XTTB 2ANWA 1DSUA 3LKWA 1EB2A 1O2XA 3PO1C 1IQLA 1A5GH 1BTXA 5I25A 2IPHA 2O9QA 1H1BA 2VIVA 3SZNA 4XBBA 2ZTXA 2GCHF 2HNTF 3KHVA 4NSVA 3U9AH 1GBTA 3F9HA 5DPAA 2AEIH 2P94A 4ISHH 5F8XA 2FMJA 1GPZA 3M5NA 4FUGA 3O8CA 4YTAA 1HB0B 1EP5A 1ELFA 1Z1JA 2ZFRH 3GY4A 1O32A 3M3VA 3HGNA 1WYKA 7KMEH 2F91A 3U98H 5SGAE 1XX9A 1ETRH 5FBEA 3ZZ9A 4K3JA 3H7TA 2VWNA 4ZXXH 3OY5U 1BHXB 3SJOA 5AFYH 3ZVBA 2ZGJA 1SVPA 1TNKA 1JXPA 2WINI 3BTQE 3BTME 3SU4A 2THFB 1A0HB 3Q77A 1FQ3A 1OKXA 3SV8A 4DVAU 4ABIA 3K6ZA 4CR5A 5HXFA 1LVMA 1MKWH 1UVUH 1GBAA 2QN5T 1ZOMA 5LPRA 2WPJS 2PUXB 2VIPA 3U1JB 2P16A 5C1UA 4WY3A 5E8EH 1ZTLA 2Z6BD 1UTOA 1V2UT 2D8WA 2P3UB 3JZ2B 3SU1A 1QCPA 2STBE 2A1DB 1L1NA 3E16B 2J95A 2UWPA 2BY8X 3MH7A 4AN7A 1J16A 3DFLA 1YBWA 1DVAH 1ESTA 2HLCA 2WUCA 2WPIS 1EOLA 2PR3A 2ZZUH 1FY4A 1W11U 1HAVB 4XOJA 2G5VA 1DDJA 3M7TA 1QRWA 2Y81A 4F4OC 1S82A 3B23B 1O38A 3R3GB 3UR9A 1C1OA 3C27B 4X8VH 1MD7A 2A31A 1DOJA 1EOJA 1OPHB 1PQ8A 1P2OA 1Y5AT 1KXDA 3QZRA 4FU8A 2YOLA 2FX6A 3ZZDA 3U1IB 2G5NA 1A5HA 4ASHA 5GJ4B 2VWMA 5J4SA 4ISOA 3S7HB 2D1JA 1NRQH 2FI3E 1ETSH 4LZ4B 1YGCH 1C9PA 5EW2H 3EYDA 2NU4E 2ANYA 1MTWA 1MTNC 3BTFE 1P2KA 1HAZB 3TNSA 1AUTC 2C8WB 2OQ5A 1BTUA 5C5OA 1NU7B 4X8SH 2QF3A 1J14A 1O2HA 2C3SA 2F9UA 4Y0YE 5CHAB 6CHAC 5A0AE 4XBCA 1IQHA 4VGCB 2NU2E 2Y82A 5DKMA 3GISB 4U30A 2BDIA 3V0XA 1NFYA 4B2CA 3ZYEA 1HNEE 3DT0H 3M5LA 1KLTA 5AHGH 1NRPH 1ORFA 1TPOA 1BTPA 3E0PB 1BRAA 1V2OT 2GGVB 2XW9A 1FJSA 4JCNA 2SGFE 2ZHFH 1PYTC 1QIXB 1BBRK 1C1QA 1ZHRA 3NUMA 2SGPE 3A7WA 4UE7H 2TRMA 3NPSA 1UTJA 1O37A 1MQ5A 2BDCA 1SQOA 3EAJA 1UTLM 3SGAE 1GJAB 3RXPA 5DP9A 3TPIZ 7LPRA 1HAPH 1O5CB 5EOKA 1K1LA 3UY9A 1IQMA 2P8OC 4RSPA 3RXAA 4ZHLU 4NA8A 3F9EA 1K1NA 2CF9H 2GDDA 3RLYH 5B6OA 1NO9H 3BEUA 4IGDA 1GJ4H 1GWAA 8KME2 3VGCC 1AFQB 4TWYA 4KTCA 2PV9B 3A86A 3SHAH 1FY1A 1XUGA 2F9VA 1GJ5H 4Y79A 5FX6A 1C2LA 3URCA 3ZZAA 2GX4A 1VCQA 4AFUA 3I78A 4FXGH 4UFGH 1YPEH 1C5SA 3ZZ5A 4X8TH 2AYWA 2Y7XA 4Q2KA 2BDAA 3M3TA 2A2QH 3UWJH 5AVDA 1Z8GA 1KDQA 3IWMA 4JYVH 2BDYA 5JYIA 4YLQH 2PFEA 1UO6A 1TPSA 2RA3A 4KELA 4XSKU 5F6MA 3SV7A 1EZSC 1V2ST 4X6MA 3A85A 3BG8A 1P03A 1KIGH 1J9CH 1ELGA 3T27A 1O2LA 1YCPK 1JRTA 1YCPM 4KGAA 4CREA 1ZPBA 1SL3A 2AERH 3HKJB 3TJOA 1HAXB 1L2EA 1G3DA 4YOIA 2CV3A 1CT2E 3PMJA 1EASA 1P8VC 1EX3A 2QA9E 3FANA 1HIAB 3BSQA 4GPGA 4RN6A 2FYQA 1CA0C 2F3CE 1LVBA 2BLOA 2ZGHA 1MQ6A 1NN6A 4B73A 2Y5GA 1EUFA 2NU1E 3RMOH 8LPRA 2A7JA 4CR9A 4LK4A 1X7AC 1GCTB 1MZDA 1SGNE 3SU6A 4MPXA 2Y7ZA 2AS9A 2BB4A 2RCEA 2TGDA 1MBMA 3Q3YA 1HAHH 2VVCA 2CJIA 2XBWA 4X6NA 1GI2A 3G01A 1P3EA 3NKKA 1HAYB 3AVZA 1GVKB 2BHGA 3E1XB 4D7GA 4Y8ZA 2D2DA 5A2MH 2JKHA 1QTFA 1C1MA 2BVSH 1OSSA 2FI4E 5GCHF 3MNBA 3RC5A 3TGKE 2OUAA 2QYIA 1C2EA 3RXJA 1LHGH 2GMTC 2V0BA 3LU9B 4ZXYH 4D8NA 5JBAS 1BRCE 1C1UH 1UCYH 1TRYA 3S9BA 2ZCHP 4HFPB 4E05H 1CA8B 2QIQA 1P06A 3EGKH 1UK3A 4U32A 5C1YA 1ZHMA 2FI5E 2J2UA 1SR5C 1GHXH 2A4OA 4FUIA 1AN1E 3ZZ7A 4AYVB 1BB0B 4B71A 1GHZA 1C5QA 1XVOA 4CRGA 1EZQA 3MMGA 5FHTA 3FP6E 4H42U 2DE8A 3QTOH 1Z71A 1W0ZU 1Y5BT 3VB6A 2QF0A 1E36B 2XWBI 3NCLA 4B75A 2J94A 1MUEB 2FDAA 4ABAA 4R0IA 3GOVB 3RU4E 4BAQB 4I8LA 2TIOA 1LHFH 1OX1A 5T6DA 5K0HA 1AVGH 2AH4X 1P02A 4CRFA 1HXFH 2PUQH 2OBQA 2Q1JA 2G51A 1ELEE 2O8MA 2F83A 4OS2A 1RGQA 1V2RT 1GI6A 1THPB 1LMWB 5HM2A 3AAUA 1V2TT 3KQCA 4ZUHA 1ZZZA 5EXLA 4NIVA 2FWWA 1LVOA 4CRBA 3BIUH 2BDBA 1CGHA 1A46H 1GBIA 2QXGA 5E2PA 2A7HA 2V6NA 3GY3A 1A4WH 1C5RA 3LIWA 3SUFA 5IYTA 3ZVDA 2VJ1A 1EQ9A 2O8UA 2NWNA 1GDQA 5FBIA 1K9OE 1QJ6B 4MPWA 4YOGA 1BTWA 3ZVAA 1LQDB 3TGJE 2BOKA 3FVFB 5LH8A 1W3CA 1TOMH 1FAXA 1XKAC 2J34A 4K1TA 2PWXA 2FEQH 1EJMA 2VU8E 2FO9A 2TGAA 3GY7A 3ESTA 2XRCA 1SGRE 1SGEE 5AFZH 2JH6D 1K28D 3GYLB 1UHBB 1JIRA 1QRXA 3Q00A 1C2JA 3QK1A 5FPTA 2RDLA 1EKBB 1FY8E 1LDTT 3STIA 5BPEA 1PQ5A 1SHYA 1BMAA 1ELTA 5DP3A 1F0TA 4X1SU 3SQEE 4DJZB 2ODPA 4E7RG 2VVUA 3NK8A 1SLVB 2BVXH 1AO5A 4IW4E 3UTUH 3MO6A 1G2LA 2BXTH 3LJJA 3SU3A 1FI8A 2FYRA 4NSYA 5CE1A 4ZKNU 1GBHA 1SGYE 4DGJA 2ZO3H 3OSYA 4WXIA 1GHAG 3MU0A 2OTVA 1QGFA 2TGTA 6GCHG 4Y71A 1CQQA 2D26C 1O2YA 4DG4A 4DW2U 1CU1A 3GCNA 1Q2WA 1SFIA 1SFQB 3PMHB 3SJKA 1C2DA 3W95A 1C5ZB 2B9LA 2VIDA 3UQVA 1QJ1B 1Y8TA 4HI3A 1TPAE 1FONA 2G55A 3T5FH 1AZ8A 2PTNA 5T3HA 4BNRA 4NFFA 1D4PB 1D6RA 1Y3UA 2GCTB 5CHAC 4UEHH 1T8LA 1D9IA 5A0BA 1J17T 4NZQA 4VGCC 1MBQA 3T26A 1O3AA 1ZMNA 1O3EA 3VXEH 2AIQA 4BTUB 3GDUA 5LPFA 3SI4H 1O3FA 4JZEH 2FIRH 3P92A 1KDQB 1QB6A 1YM0A 3P8FA 1GG6B 4OS7A 3QGJA 2HPPH 1SPJA 2ZFFH 1TNJA 3OY6U 3EA8A 3EA7A 1V2WT 2IOTA 4A7IB 2J38A 2XC4A 3MO9A 4Z6AH 2A7CA 1TLDA 1FN8A 5J4QA 1DXWA 1T8OA 4K8BA 4TPIZ 2BOHB 4MQAA 5EGMA 1BIOA 3ZVGA 2KAIB 1AFQC 5AF9H 4KTUA 1UK4A 1FDPA 2GV7A 4GCHG 1D3PB 1V2MT 2GZ7A 3ATKA 1AUJA 4I33A 1OS8A 1O5FH 1TAWA 3BN9A 4JZFH 4BTIB 4GUXA 4DOQA 1Z6EA 3GY8A 4BANB 1BOQA 2P3TB 4GHTA 3TVJB 1D3QB 2AIPA 1Z7KA 3GCTG 3LC5A 2A2XH 3RXUA 1O5BB 3TH4H 4E06H 4NCYA 1SGCA 2ALPA 3MHWU 4MPUA 1W12U 1NFXA 3ZZ4A 4CHAB 4UD9H 2J9NA 4KKDA 1AZZA 4NIXA 1ID5H 5CMXH 3SNCA 4LXBH 3MH5A 3HGPA 3TITA 5TCAA 4ABGA 4YM9A 1ZPZA 1IOEA 4I8KA 1TYNA 1Y59T 1YPMH 1D3DB 1BZXE 1V2JT 2VINA 1O2PA 2AMDA 1GMDG 3P95A 3P6ZB 3ZV9A 1WCZA 5DP6A 4DCDA 4O9VA 2R3YA 4GVUA 1QQUA 2XCNA 1B5GH 1P9SA 5F03A 1K22H 4UFFH 2A5KA 3ZVFA 2ZCKP 3BTDE 3MYWA 1DFPA 5JDUB 2FOBA 3ELAH 3VB5A 3QWCH 1ABJH 1HIAA 4CRAA 1MKXH 2OXSA 1GDNA 2PLXA 1GCTC 1ZMJA 3DA9B 3D65E 1AKSA 1GMCG 4ISIH 1ELCA 4X6PA 1O35A 2WPKS 1GBLA 1DWDH 1SMFE 3LONA 3QTVH 3AAVA 1CGJE 1BBRE 1BITA 1EATA 1E38B 1KLJH 2ZF0H 3MOCA 1EB1H 2FM2A 3GCOA 1LQEA 3MTYA 1O2UA 3QLPH 1P05A 1T32A 3AW0A 4PROA 3PROA 1GVZA 3O8RA 1HAOH 1ZMLA 5A8XA 1P2NA 4JYUH 1FMGA 2H1UA 1O3CA 1AD8H 1GBJA 2VWOA 3KF2A 4FUEA 4WWYA 1TWXB 3S0NA 4OS5A 1HBTH 5JPMH 1NU9A 2FOHA 1NRRH 1K21H 3A84A 4SGAE 4DY7B 1GHVH 1GI1A 1V2QT 1THSH 1XUKA 1AFEH 4YO9A 1HUTH 1CBWB 1QB1A 1LHDH 1ABIH 3GCHB 3NZIA 4NGAH 1JRSA 4BAOB 4K69A 4ABJA 1ESBA 1QQ4A 2VWLA 2YNBA 1DUEA 1MTUA 5DGJA 3UOPA 4B74A 5E0GA 4X1PU 2ZTYA 3UNQA 1IQIA 3M61U 4AORA 1DLKB 4A6LA 2ZKSA 4H4FA 2C8XB 2ZPSA 3MH4A 2ASUB 1HAIH 1QL7A 1SGPE 5DP5A 2BZAA 2VB0A 4ZAEA 1SG8B 2ZGCA 4ZH8A 4WF8A 1GBBA 4JZIA 3LPRA 3CS7A 5FAHA 1ARBA 1C2KA 1OWKA 1O2KA 1F0UA 1JIMA 1AMHA 2P93A 4AGKA 3LH3A 3UFAA 1HXEH 1V6DA 2XBVA 3VB3A 1ZSKA 4O97A 5IDKA 4J1YA 2HNTE 3PLBA 4A5TS 1FAKH 1TX8A 1LPGB 1S83A 1K1IA 1TBZH 2R9PA 2PHBA 2ZHDA 3VPKA 1ZSJA 2H5DA 4Y0ZE 1M9UA 3K65B 2GZ8A 1KY9A 1XXFA 2OC1A 2ZQ1A 1QFKH 1HDTH 2OQUA 2QXIA 4NIWA 3F1SB 1QURH 1ETTH 3OU0A 1S84A 2BD2A 1XM1A 2TGPZ 2BXUH 3RMMH 1ZTJA 3MNSA 3ZVCA 1AI8H 3UNRA 4K1EA 2ILNA 3TK5A 2UUFB 1TFXA 1KXFA 1SLXB 4ZHMU 3RXQA 3V12A 1RTKA 4IN1A 4JZDH 5H4IB 1UHBA 1YYY1 1BUIA 1FPCH 1C5UA 3V3MA 2FTMA 1GBEA 3U8RH 5L6NH 3TGIE 2CHAB 1GBDA 4FU7A 1O2JA 3P70B 4ABDA 2ZDKA 3ZV8A 2BDHA 2ANMH 1ZRBA 3IG6B 5GPIB 2W3IA 1S85A 1VCPA 2V3OH 4Q7XA 4AOQA 1NRSH 1P9UA 1Q31A 3D49H 2ZCLP 2AMPA 2GDEH 4SGBE 1SOZA 3ODDA 2QXJA 3O8BA 1HCGA 1PFXC 5C3NA 3ODFA 2JETB 2XXLA 3M36A 3KQBA 3TU7H 4H6SB 1EXFA 2GCTC 2B7DH 2WPHS 3SGBE 1KYNA 2Z3EA 1O3IA 1CHOG 3H7OA 1TIOA 2OC8A 1N8OB 2QAAA 2OINA 1IQNA 2BQWB 2WUBA 2OCVB 1EAUA 1C4U2 5FCRA 1LO6A 1GVLA 1F0RA 1DPOA 1S6FA 2P3FH 1W7XH 1L4ZA 5T6FA 1DWEH 1NM6A 2ZGBH 4WJG2 4B2AA 1GG6C 1F5KU 1CHGA 1O34A 3BTEE 2GT8A 2BVRH 1CSOE 3ZZ8A 1EAIA 5F8TA 3SJIA 1TE0A 2BY6X 1T7CA 1S0RA 4Y6DA 1BTHH 3BTHE 2FOFA 3FP8E 3VB7A 2FS9A 4X2XA 1WUNH 1W0YH 3L33A 1H9IE 2Z9JA 2FXRA 1F5LA 2W7UA 3KNXA 2H6MA 2Z3CA 4THNH 1QBNA 1FV9A 1EAWA 1EAXA 1PPFE 2GP9B 3MNXA 3SV6A 4IMZA 2KAIA 2ZTZA 1C5MD 1GCDA 4JMYA 1P2JA 3A7VA 3GICB 4A1TA 3LC3A 3GYMA 1C5LH 2CMYA 3S7KB 1QBOA 1MZAA 3TIUA 3JZ1B 2DE9A 1KXAA 3K9XB 1J8AA 1P01A 2H9HA 2OC0A 3LT3A 1GL1A
chains in the Genus database with same CATH superfamily
4IC5A 4WXVA 1ARCA 1TABE 1GI0A 1UVSH 1RTLA 1G36A 2BQ7B 1TMBH 2SFAA 4Y8YA 1HGTH 4CHAC 3HK6B 1AKSB 5GWZA 3B9FH 1GJ6A 1YF4A 4FUFA 1E34B 3Q3XA 1J15A 4OGYA 1GJ9B 2ZIQH 1C9TA 2DUCA 4ISNA 3QN7A 2YNAA 4RI0A 1O2ZA 1OP8A 1HFDA 2K1QA 3SUEA 3CS0A 4AYYB 4B76A 3N7DA 3F6UH 1O3GA 4MNWA 1GJ7B 2FODA 2C90B 2WV5A 1BMNH 1FNIA 2V3MA 2XYAA 3BTGE 3N7OA 2I6QA 3OYPA 5FPYA 1E37B 1TOCB 1F92A 1UTKA 1O5AB 1OWEA 2W26A 3PV2A 4JYTA 6ESTA 1HLTH 1DICA 5DP7A 4FOUC 4Y7BA 3FO8D 4YESB 5JB9S 4MTBA 5LPEA 4TT3D 1XUFA 5DSFA 2R0KA 4HZHA 1PPGE 5BRRE 1PPZA 1C5YB 1AHTH 1KTSB 1HPGA 2C8YB 1WBGB 2ZG0H 3E3TA 3MH6A 3ZZCA 1P2IA 4BAMB 3OEED 1SHHB 5IK2D 5C94A 4UFEH 1ZGVA 1G32B 5E0JA 3NWUA 3BG4B 2KM0A 1O2VA 3RXVA 2W6ID 4X6OA 3RXEA 1TBRH 3K6YA 3ENSB 3SO3A 1UTPA 3T28A 1SQRA 3D62A 1FLEE 2BD9A 1IAUA 1MMJN 1W10U 1UTMA 1KMHB 2SGDE 4JK5A 2VH6A 3TJNA 4ZKOU 1C4V2 2LPRA 1CBWC 2BD4A 2VIWA 2PW8H 4O3TA 3GCHC 1QY6A 2TPIZ 4DIHH 1T8MA 1NFWA 1GHAF 1XXDA 1V2LT 4KTSA 6GCHF 1Y5UT 1TGNA 2LP6A 3LDXH 4RKOB 1IQGA 1TGCA 2F9BH 2BLQA 3T25A 1HYLA 1O3LA 1GHBG 2HNTC 2WZQA 3E0NB 3ZVEA 2FTLE 2KZ4A 2XNDD 4WMDA 3MU4A 3UWIA 3MU8A 3QZQA 5DJ7A 1S0QA 1IQKA 2CK3D 2FOEA 2PGQB 4TWWA 1V2PT 3H5CB 1S81A 4NWLA 1C1RA 3FZDA 3E90B 1H9LB 2R2WU 2ANKH 2ZC9H 1YPHE 1MCVA 3RXGA 1YP9A 3LGIA 1TBQH 2H9TH 4XD7D 3HATH 3CP7A 1BA8B 1O3DA 1OP0A 1ZGIA 3B8JA 3KEEA 4B2BA 4MNXA 4ZKSU 4WMEA 2BY5X 3WY8A 2G00A 3E91A 1WTGH 1XUJA 1TA6A 2CXVA 3ZIAD 3OAAD 1AVWA 3GDVA 1YWUA 2UWLA 3PB1E 1O2WA 3QDZB 5FXLA 1QZ8A 4YOJA 4FUDA 3OTJE 2PTCE 1N6XA 1GGDB 1O2GH 5DK1A 3RXCA 3SNBA 1HJAB 1O2TA 1B7XB 5EXNA 1WU1A 1NTPA 3SNDA 3SN8A 1H9HE 1WAYB 2FLRH 4MDSA 4GCHF 1H8ED 1KXBA 1TNLA 3D23A 2ZU5A 1LTOA 3GY5A 1W14U 2VGCB 3FP7E 4YZUA 1O2MA 1NPMA 2Y6TA 1A0LA 1C5TA 5C67A 1O3PB 2CHAC 3RXSA 2SGEE 3GY6A 2AGIX 2C8ZB 1C2HA 3FAOA 2IJD1 5EODA 4FUCA 3GCTF 1QR3E 3R0FA 5EXMA 3UOUA 1EZUC 3RXMA 3LGWA 1ANEA 3KL6A 3P17H 2Z9LA 2XCFA 3Q3KA 1G30B 1GJ8B 1BJVA 2GVFA 1DT2A 1TX6A 1VITH 2A4QA 4ZROA 5FX5A 3W1EA 2W5EA 4ZHAA 3RXTA 1RIWB 5T6GA 2A5AA 5HIYA 1DANH 2GKVE 2SNVA 4MG3A 4CBNA 1GMDF 1A3BH 4I8JA 3M5OA 2JETC 1P2MA 3RU4T 5DP4A 3UPEA 4TY7A 1VITG 1V3XA 1N6YA 1DS2E 5L30H 1IHTH 4D9RA 1W8BH 2ZHEH 2SGAA 1TMTH 2NU0E 1W0JD 3A7ZA 5ETXA 1N8OC 5C5NA 2EI7A 3SUGA 4HGCA 3A8DA 1JBUH 2BY7X 1DUAA 4CH8B 2WPLS 1FPHH 2QXHA 3PYHA 3E8LA 1VZQH 1L1GA 1UTNA 2V35A 2QGRA 2GZ9A 1GMCF 2BD7A 5KECA 3EQ0H 1L0ZA 3EE0B 1DWCH 2BMGB 1O3NA 2JH5D 2L74A 3F2FA 1EJNA 3M7UA 1H4WA 2FP7B 5A8YA 2B0FA 1AB9B 1PYTD 1GJCB 2ZI2H 4ASUD 4UDWH 1O3KA 5C20A 3I29A 2A5IA 4K8YA 4DURA 4DT7B 1K1PA 4OS1A 2G8TA 4ABEA 5HYOA 4K2YA 4WH6A 2H9EH 3ZZ6A 1OXGA 2ZU2A 1NZQH 4X8UH 1AIXH 5HGGA 1C5PA 1QB9A 3IITA 1CGIE 1W13U 3OX7U 1UTQA 1ACBE 1OYTH 3TK9A 4TSFD 1HJ9A 4MPVA 3P8OA 1ZTKA 3O8DA 1O5EH 4CH2B 3SV9A 4R8TB 3SV2H 1E79D 1BTZA 3AASA 1BBRH 2I6SA 4LOYH 1F0SA 3DHKH 4WH8A 5ABWA 1OWHA 5A0CA 2BD5A 1BMLA 1C1NA 1G3BA 3ZZBA 1LKBA 1EP6A 4Q63A 3A8AA 1IQEA 4AB8A 2W3KA 4QT8C 2J4IA 2QE7D 4BXSA 4BXWA 4AG2A 1BMMH 1G3CA 3CENA 2BZ6H 1TGSZ 2EEKA 1BHXF 2Z3DA 3LGVA 5JB8S 2QV1A 4Y10E 1P09A 1G2MA 1T8NA 5DG6A 5E2OA 5E0HA 2OBOA 1O39A 3MU1A 3ZZ3A 1GBMA 1PPCE 1ELBA 3K2UA 1ZSLA 1VKYA 2BM2A 1LHEH 3QUMP 1NS3A 2G52A 1SGQE 1ZYOA 1RRKA 2WV4A 3QO6A 2LNCA 2O8WA 4IBLH 3RXBA 8GCHF 3UIRA 1GMHG 2PKSB 1MH0A 4P00A 1T31A 2ESTE 4J2YB 4BAKB 1UVPA 3TLOA 4MNYA 1SSXA 2K8IA 2RG3A 7ESTE 4NG9H 1GI7B 1O3MA 2XC5A 2HVXA 3A8CA 3HK3B 5HKKD 1GJBB 1VJ9U 2ZQ2A 4A1XA 1ZR0A 2FESH 2OP9A 4X0WU 2BLVA 7GCHG 1WQSA 1FXYA 1F7ZA 3P8NA 4GLYA 3PTBA 1YCPH 4Y76A 4ZCNA 3MO3A 2ZFQH 4E7NA 5ESBA 4BTTB 1KLIH 3HKIB 2JJ1D 1XUHA 2Z94A 2GTBA 2Z9GA 2EI8A 3S9AA 3RC6A 4F48B 1RTFB 1C2GA 1C1TA 2K0QA 2M5TA 3U8TH 1GI3A 2BYAX 1FIZA 1SLUB 3BG4C 1DSTA 3ATIA 3BIVH 3EDXB 3RXKA 1TONA 1TNIA 1UVTH 1Z8IB 2A0QB 1GI9B 1H8IH 2UUYA 1O30A 5FPSA 1ELVA 1O36A 3SJ9A 2BY9X 9ESTA 3FZZA 3T29A 8ESTE 3PV4A 5GXPA 3OEHD 2R0LA 1Z1IA 1SQTA 2GCHG 5EQSA 1C1PA 1YPHC 4K60A 1WTHD 8GCHG 1O2RA 5B6LA 1TPPA 1TX7A 3RXFA 3A7YA 1FZZA 3BEIB 3MWIU 2O8TA 1QL9A 1Z8JB 3RC4A 1GHYH 1C2FA 1QA7A 2A4GA 1BJUA 1SLWB 5I46H 2BDGA 4NZLA 1RS0A 1GI8B 1N1LA 3KQEA 2UUKB 9LPRA 1PPHE 3RMLH 3DD2H 4BOHA 1ANDA 2FOGA 1A2CH 3ZYDA 4F49A 3UQOA 1DWBH 1DY8A 3A83A 1QHRB 1L4DA 1A7SA 4FU9A 1ZHPA 1SC8U 1CHOF 5EIYA 1UK2A 1FN6A 2ODQA 2JH0D 1A1RA 1ZJKA 3QGNB 4ZKRU 4XBDA 5EG4A 4NIYA 2Q6DA 1OWJA 5EPYA 2ZDAH 4Z0KA 3PRDA 1C5OH 3F9FA 2HGTH 4AFQA 5JBCS 3DFJA 1A0JA 4Y7AA 3RMNH 2ALVA 3PWBA 1O5GH 2UWOA 4GAWA 2PKAB 3AW1A 1YC0A 2Y5FA 5EQRA 1GGDC 2GV6A 3A8BA 2C4FH 1OHHD 1DX5M 1OWDA 3A7XA 2R3UA 1HJAC 4YT6H 1ELDE 2KFWA 1W7GH 3KYFA 2QC2A 4AFSA 2WHXA 1C2MA 1O5DH 1UMAH 2YMSD 4A1VA 4ACAA 4AB9A 1P10A 3P8GA 2W7SA 2JDID 4X2YA 5EPNA 2JJ2D 2VGCC 3UNSA 1AE8H 1EZXC 1ESAA 5F8ZA 3SHCH 2QY0B 2L6OA 3VXFH 3UUZA 4I86A 1HJ8A 3M35A 1CVWH 3A7TA 4A92A 4GSOA 4ABHA 1C5XB 4X1NU 3VFEA 4D76A 1WOFA 6LPRA 3OFND 1WSSH 3SU2A 1MKXK 1FX0B 1L1JA 5C1XA 4HTCH 1C1SA 3U69H 1V2VT 1K1MA 1AY6H 3TJUA 5C2ZA 1O31A 1QA0A 2ZGXH 3BTKE 2BLWA 1A3EH 1Q3XA 4I32A 1DXPA 3LGYA 1K1JA 1Y3WA 1HRTH 3M5MA 2CGAA 1G37A 4IN2A 1NROH 4K1SA 5EJ1A 1TB6H 1SQAA 2XNIA 2WV9A 3A81A 1D3TB 1RIWC 2AMQA 1EPTB 2OK5A 5TJXA 3LGTA 1QBVH 3U28C 3GY2A 1GDUA 3BTWE 1Y3XA 1RJXB 2J5UA 5EW1H 1C2IA 3N99A 4TYDA 5EQQA 2ZFTA 1T4UH 2FLBH 4LZ1H 2Q6FA 3NXPA 5GIBA 1SGFA 3EA9A 2ODYB 2STAE 2IN2A 1ZRKA 2OLGA 4U2WA 1LPKB 3I77A 1THRH 3GDSA 4XFQA 1AWHB 5L2ZH 1TNGA 1E0FD 3KCGH 4AX9H 3RP2A 1VGCB 1A61H 1WV7H 1D6WA 1YPKH 1C5NH 1AVXA 2AFQB 3F68H 3HPTB 1INCA 3SORA 2J92A 1AB9C 2HVYB 2F9OA 3SBKA 1P11E 2LELA 1O3OA 1MKWK 3L3TA 1U6QA 1AE5A 1OOKB 1OWIA 1K2I1 2WYGA 1BDAA 3DSOA 1KXEA 2FZZA 2VVVA 1SGTA 5EU8A 1MAYA 1NC6A 5C0TA 1YLCA 1E35B 1Z6JH 2Z9KA 3LOXA 1FIWA 2HPQH 1SI5H 4BAHB 2FX4A 3NRLA 1DITH 1BCUH 4DIIH 3PO1B 1JOUB 3WWBA 1NT1A 1AQ7A 1CE5A 1AGJA 1IQJA 2FOMB 3UR6A 5K7RA 1HAGE 1S6HA 4RKJB 2CF8H 4AC9A 3MNCA 3SZEA 4INKA 3SU0A 4B6FA 4TY6A 1HV7A 4MVNA 2ZFSA 2VNTA 4YLUA 1DY9A 1TRNA 2GJGA 3KGPA 2ZU4A 3TH3H 1O2IA 3PM3A 3TJVA 3RDZA 4JZ1A 1FY5A 1IQFA 3PMAB 1GHBF 1RD3B 2XWAA 1YPLH 2CN0H 3LJOA 4Q7YA 2BD3A 2PSXA 3M37A 1QJ7B 1YLDA 4MNVA 1O2QA 1DLEA 1JMOH 1VR1H 1OYQA 4INLA 2V7QD 1ZLRA 1MU6B 1ANBA 4I8GA 2ZU3A 1OP2A 5A8ZA 1TMUH 1PQAA 3PLKA 2WYJA 4IC6A 5FL7D 2ZPRA 4INHA 5JBTA 1GI4A 1SKYE 2G4TA 3DSGA 1NY22 1T4VH 4X2VA 1UCYE 3BV9B 2PKSC 3UAIC 1MAXA 1F2SE 1O2OA 5A09A 2F43B 2HOBA 2GT7A 4AG1A 1O2SA 5JBBS 4K5ZA 3S9CA 4NA9H 1O3HA 2A4RA 1GBCA 1S6LA 1VJAU 4OS6A 3F9GA 2ZHQH 5TCCA 2FOAA 3BF6H 2F9PA 2PSYA 3ATLA 3QX5H 1SGDE 1C1WH 4IS5A 1DM4B 5GCHG 1P04A 2FS8A 4UFDH 2HALA 2Y5HA 1KTTB 2J97A 4U01A 2BQ6B 2KX4A 2HWLB 4XDEA 4H6TA 1YPJH 2GD4B 2ZDNA 1TQ0B 4O03A 2HRVA 2Z7FE 1ANCA 4X1QU 3FFGA 2ZECA 2WPMS 3FOAA 4TPYA 3A80A 1BQYA 3DUXH 3PTNA 4Q7ZA 3RLWH 3VG8A 3STJA 3RUOA 1TGBA 3RU4D 1CO7E 2H2ZA 1XKBC 3KN2A 1C1VH 3F2HA 4NA7A 4OS4A 2O8LA 5PTPA 5HM9A 3TK6A 1FY3A 1NFUA 1P2QA 2VH0A 4YT7H 3M3SA 1S5SA 4WMFA 1MD8A 4FVBA 1SOTA 3UREA 1O3JA 2A45B 2BTCE 2ZFPH 1TGTA 1JWTA 4NFEA 3A89A 1NESE 1FUJA 3SNAA 1DE7H 1QRZA 2RA0A 1MTNB 4OGXA 5LGOA 2EA3A 3VEQB 3LH1A 4JK6A 2V3HH 4WVPE 1MU8B 3PLPA 6CHAB 1SGIB 3LGUA 1G3EA 4HG6A 2XBYA 2SNWA 1VITF 3KIDU 2BX4A 3RXHA 1HAVA 1A5IA 1P0SH 1P3CA 2G4UA 2PGBB 4NWKA 4OM9A 1K0HA 4KP0A 4AGJA 3M7QA 1V2KT 2RDEA 1VCWA 1RFNA 2VIQA 2ZWLH 2FPZA 2G81E 1QNJA 1SB1H 1TALA 4P02A 1XUIA 1YLNA 1UW7A 1C4Y2 1KSNA 2Y80A 5C0UA 1LKAA 1LPZB 1Y3VA 4FUJA 4UONA 1COWD 2ZNKH 1F5RA 2IJOB 2ZA5A 1W2KH 1QL8A 1YPGH 4Y8XA 5CDFE 4MLFB 4ZMAH 3SGQE 2XC0A 2AHME 1YKTA 2P8OB 2PKAA 4I8HA 4RT0A 4B1TA 2ZPQA 4FUBA 3VGCB 3TH2H 3URDA 1IHSH 3Q76A 4CBOA 3MFJA 2Q6GA 3SJ8A 2QCYA 1PJPA 2SGQE 3SQHE 3C1KA 3UB0A 2ZDLA 4D9QA 3DSPA 3A82A 1BRUP 3ITIA 4IMQA 2NU3E 4I31A 3V13A 3RXRA 1UJ1A 2VIOA 2ZDMA 2OD3B 1H8HD 2KCYA 3L6PA 2AGEX 5DN6D 3E6PH 5DP8A 1LCYA 2P95A 1UCYK 3ATWA 1AWFH 3U8OH 4XE4A 3W94A 2B5TB 2XBXA 2C93B 3S69A 4CRDA 3SOSA 2EI6A 4ABBA 1H8DH 3BEFB 1ZPCA 4AZ2B 2ZP0H 4D7FA 1XVMA 3PWCA 2F9NA 1Y3YA 1GBKA 1O0DH 3SW2B 3TNTA 1EJAA 1SGFG 4X2WA 5ESTE 1MTSA 4Y11E 2P59A 4FUHA 1PQ7A 1EPTC 1CT0E 1B0FA 3RM0H 1P12E 1CT4E 1K1OA 1BRBE 3ATMA 2BX3A 1EPTA 1NRNH 1O33A 1AU8A 1O3BA 2KR7A 4ESTE 3V7TA 3GS9A 2ZU1A 1LHCH 3T62A 2ZEBA 2OC7A 5FCKA 3RXIA 4CRCA 1CA0B 3SUDA 3SI3H 3MI4A 3A87A 1GL0E 4M7GA 3A88A 2H5CA 1GMHF 2R2MB 4X1RU 3T2NA 1C5VA 1SBWA 1ZJDA 1O2NA 2TBSA 2B8OH 4I7YH 1GHWH 1UVOA 3KQDA 2UUJB 3RXOA 1Z8RA 5DO4H 2ZHWH 3SNEA 5GDSH 1VGCC 1BT7A 5L2YH 7GCHF 1BTYA 3PMBB 3RXLA 1MCTA 1TRMA 4GHQA 2BD8A 3SU5A 1PPEE 1C5WB 3RXDA 1TNHA 4Q80A 1TA2A 1GBFA 5G4BA 4ISLA 1XMNB 2A32A 1GI5A 1KXCA 1LVYA 1MTVA 1TQ7B 5HMAA 2GMTB 2EC9H 1G9IE 2AGGX 1RXPA 4AFZA 3RM2H 2ZDVH 2FOCA 1V2NT 2JIZD 3MU5A 1ELAA 2Z9IA 1PPBH 1W0KD 1GJDB 1WQVH 3VB4A 4FVDA 1P57B 1B0EA 3BTTE 4O3UA 4Q4LA 2ULLA 2XTTB 4ABFA 2ANWA 1DSUA 3LKWA 1EB2A 1O2XA 3PO1C 1IQLA 1A5GH 1BTXA 5I25A 2IPHA 2O9QA 1H1BA 2M2AA 2VIVA 3SZNA 4XBBA 2ZTXA 2GCHF 2HNTF 3KHVA 4NSVA 3U9AH 1GBTA 3F9HA 5DPAA 2AEIH 2P94A 4ISHH 5F8XA 2FMJA 1GPZA 3M5NA 4FUGA 3O8CA 4YTAA 1HB0B 1EP5A 3FKSD 1ELFA 1Z1JA 2ZFRH 3GY4A 1O32A 3M3VA 3HGNA 1E1RD 1WYKA 7KMEH 2F91A 3U98H 5SGAE 1XX9A 1ETRH 5FBEA 3ZZ9A 4K3JA 3H7TA 2VWNA 4ZXXH 3OY5U 1BHXB 3SJOA 1WXRA 5AFYH 3ZVBA 2IPQX 2ZGJA 1SVPA 1TNKA 1JXPA 2WINI 3BTQE 3BTME 3SU4A 2THFB 1A0HB 3Q77A 1FQ3A 1OKXA 3SV8A 4DVAU 4ABIA 3K6ZA 4CR5A 5HXFA 1LVMA 1MKWH 1UVUH 1GBAA 2QN5T 1ZOMA 5LPRA 2WPJS 2YMSB 2PUXB 2VIPA 3U1JB 2P16A 5C1UA 4WY3A 5E8EH 1ZTLA 2Z6BD 1UTOA 1V2UT 2D8WA 2P3UB 3JZ2B 3SU1A 1QCPA 2STBE 2A1DB 1L1NA 3E16B 2J95A 2UWPA 2BY8X 3MH7A 4AN7A 1J16A 3DFLA 1YBWA 1DVAH 1ESTA 2HLCA 2WUCA 2WPIS 1EOLA 2PR3A 2ZZUH 1FY4A 1W11U 1HAVB 4XOJA 2G5VA 1DDJA 3M7TA 1QRWA 2Y81A 4F4OC 1S82A 3B23B 1O38A 3R3GB 3UR9A 1C1OA 3C27B 4X8VH 1MD7A 2A31A 1DOJA 1EOJA 1OPHB 1PQ8A 1P2OA 1Y5AT 1KXDA 1YY3A 3QZRA 4FU8A 2YOLA 2FX6A 3ZZDA 3U1IB 2G5NA 1A5HA 3N7EA 5GJ4B 4ASHA 2VWMA 5J4SA 4ISOA 3S7HB 2D1JA 1NRQH 2FI3E 1ETSH 4LZ4B 1YGCH 2RFKC 1C9PA 5EW2H 3EYDA 2NU4E 2ANYA 1MTWA 1MTNC 3BTFE 1P2KA 1HAZB 3TNSA 1AUTC 2C8WB 2OQ5A 1BTUA 5C5OA 1NU7B 4X8SH 2QF3A 1J14A 1O2HA 2C3SA 2F9UA 4Y0YE 5CHAB 6CHAC 5A0AE 4XBCA 1IQHA 3WW7A 4VGCB 2NU2E 2Y82A 5DKMA 3GISB 4U30A 3OTPA 2BDIA 3V0XA 1NFYA 4B2CA 3ZYEA 1HNEE 3DT0H 3M5LA 1KLTA 5AHGH 1NRPH 1ORFA 1TPOA 1BTPA 3E0PB 1BRAA 1V2OT 2GGVB 2XW9A 1FJSA 4JCNA 2SGFE 2ZHFH 1PYTC 1QIXB 1BBRK 1C1QA 1ZHRA 3NUMA 2SGPE 3A7WA 5HIZA 4UE7H 4YXWD 2TRMA 3NPSA 1UTJA 1O37A 1MQ5A 2BDCA 3FN8A 1SQOA 3EAJA 1UTLM 3SGAE 1GJAB 3RXPA 5DP9A 3TPIZ 7LPRA 1HAPH 1O5CB 5EOKA 1K1LA 3UY9A 1IQMA 2P8OC 4RSPA 3RXAA 4ZHLU 4NA8A 3F9EA 1K1NA 2CF9H 2GDDA 3RLYH 5B6OA 1NO9H 3BEUA 4IGDA 1GJ4H 1GWAA 8KME2 3VGCC 1AFQB 4TWYA 4KTCA 2PV9B 3A86A 3SHAH 1FY1A 1XUGA 2F9VA 1GJ5H 4Y79A 5FX6A 1C2LA 3URCA 3ZZAA 2GX4A 1VCQA 4AFUA 3I78A 4FXGH 4UFGH 1YPEH 1C5SA 3ZZ5A 3F0PA 4X8TH 2AYWA 2Y7XA 4Q2KA 2BDAA 3M3TA 2A2QH 3UWJH 5AVDA 1Z8GA 1KDQA 3IWMA 4JYVH 2BDYA 5JYIA 4YLQH 2PFEA 1UO6A 1TPSA 2RA3A 4KELA 4XSKU 5F6MA 3DCLA 2KCAA 3SV7A 1EZSC 1V2ST 4X6MA 3A85A 2VBCA 3BG8A 1P03A 1KIGH 2EY4C 1J9CH 1ELGA 3T27A 1O2LA 1YCPK 2PP6A 1JRTA 1YCPM 4KGAA 4CREA 2J98B 1ZPBA 1SL3A 2AERH 3HKJB 3TJOA 1HAXB 1L2EA 2HLDD 1G3DA 4YOIA 2CV3A 1CT2E 3PMJA 1EASA 1P8VC 1EX3A 2QA9E 3FANA 1HIAB 3BSQA 4GPGA 4RN6A 2FYQA 1CA0C 2F3CE 3PRBA 1LVBA 2BLOA 2ZGHA 1MQ6A 1NN6A 4B73A 2Y5GA 1EUFA 2NU1E 5EJLA 3RMOH 8LPRA 2A7JA 4CR9A 4LK4A 1X7AC 1GCTB 1MZDA 1SGNE 3SU6A 4MPXA 2Y7ZA 2AS9A 2BB4A 2RCEA 2TGDA 1MBMA 3Q3YA 1HAHH 2VVCA 2CJIA 2XBWA 4X6NA 1GI2A 3G01A 1P3EA 3NKKA 1HAYB 3AVZA 1GVKB 2BHGA 3E1XB 4D7GA 4Y8ZA 2D2DA 5A2MH 2JKHA 1QTFA 1C1MA 2BVSH 1OSSA 2FI4E 1BMFD 5F53A 3MNBA 5GCHF 3RC5A 3TGKE 2OUAA 2QYIA 1C2EA 3RXJA 1LHGH 2GMTC 2V0BA 3LU9B 4ZXYH 4D8NA 5JBAS 1BRCE 1C1UH 1UCYH 1TRYA 3S9BA 2ZCHP 4HFPB 4E05H 1CA8B 2QIQA 1P06A 3EGKH 1UK3A 4U32A 5C1YA 1ZHMA 3KYGA 2FI5E 2J2UA 1SR5C 1GHXH 2A4OA 4FUIA 1AN1E 3ZZ7A 4AYVB 1BB0B 4B71A 1GHZA 1C5QA 1XVOA 4CRGA 1EZQA 3MMGA 5FHTA 3FP6E 4H42U 2DE8A 3QTOH 1Z71A 1W0ZU 5KGOA 1Y5BT 3VB6A 2QF0A 1E36B 2XWBI 3NCLA 4B75A 2J94A 1MUEB 2FDAA 4ABAA 3F3BA 4R0IA 3GOVB 3RU4E 4BAQB 4I8LA 2TIOA 1LHFH 1OX1A 5T6DA 5K0HA 1AVGH 2AH4X 1P02A 4CRFA 1HXFH 2PUQH 2OBQA 2KCOA 2Q1JA 2G51A 1ELEE 2O8MA 2F83A 4OS2A 1RGQA 1V2RT 1GI6A 1THPB 1LMWB 5HM2A 3AAUA 2QF4A 1V2TT 3KQCA 4ZUHA 1ZZZA 5EXLA 4NIVA 2FWWA 1LVOA 4CRBA 3BIUH 2BDBA 1CGHA 1A46H 1GBIA 2QXGA 5E2PA 2A7HA 2V6NA 3GY3A 1A4WH 1C5RA 3LIWA 3SUFA 5IYTA 3ZVDA 2VJ1A 1EQ9A 2O8UA 2NWNA 1GDQA 5FBIA 1K9OE 1QJ6B 4MPWA 4YOGA 1BTWA 3ZVAA 1LQDB 3TGJE 4RT1A 2BOKA 3FVFB 5LH8A 1W3CA 1TOMH 1FAXA 1XKAC 2J34A 4K1TA 2PWXA 2FEQH 1EJMA 2VU8E 2YMSC 2FO9A 2TGAA 3GY7A 3ESTA 2XRCA 1SGRE 1SGEE 5AFZH 2JH6D 1K28D 3GYLB 1UHBB 1JIRA 1QRXA 3Q00A 4F55A 1C2JA 3KQ5A 3QK1A 5FPTA 2RDLA 1EKBB 1FY8E 1LDTT 3STIA 5BPEA 1PQ5A 1SHYA 1WDIA 1BMAA 1ELTA 5DP3A 1F0TA 4X1SU 3SQEE 4DJZB 2ODPA 4E7RG 2VVUA 3NK8A 1SLVB 2BVXH 1AO5A 4IW4E 3UTUH 3F0OA 1G2LA 2BXTH 3LJJA 3MO6A 3SU3A 1FI8A 2FYRA 4NSYA 5CE1A 4ZKNU 1GBHA 1SGYE 4DGJA 2ZO3H 3OSYA 4WXIA 1GHAG 3MU0A 3OE7D 2OTVA 1QGFA 2TGTA 6GCHG 4Z1MD 4Y71A 1CQQA 2D26C 1O2YA 4DG4A 4DW2U 1CU1A 3GCNA 1Q2WA 1SFIA 1SFQB 3PMHB 3SJKA 1C2DA 3W95A 1C5ZB 2B9LA 2VIDA 3UQVA 1QJ1B 5CHBA 1Y8TA 4HI3A 1TPAE 1FONA 2G55A 3T5FH 1AZ8A 2PTNA 5T3HA 4BNRA 4NFFA 1D4PB 1D6RA 1Y3UA 2GCTB 5CHAC 4UEHH 1T8LA 1D9IA 5A0BA 1J17T 4NZQA 4VGCC 1MBQA 3T26A 1O3AA 1ZMNA 1O3EA 3VXEH 2AIQA 4BTUB 3GDUA 5LPFA 3SI4H 1O3FA 4FETA 4JZEH 2FIRH 3P92A 1KDQB 1QB6A 1YM0A 3P8FA 1GG6B 4OS7A 3QGJA 2HPPH 1SPJA 2ZFFH 1TNJA 3OY6U 3EA8A 3EA7A 1V2WT 2IOTA 4A7IB 2J38A 2XC4A 3MO9A 4Z6AH 2A7CA 1TLDA 2KCPA 1FN8A 5J4QA 1DXWA 1T8OA 4K8BA 4TPIZ 2BOHB 4MQAA 5EGMA 5C17A 1BIOA 3ZVGA 3AK5A 2KAIB 1AFQC 5AF9H 1NBME 4KTUA 1MABB 1FDPA 1UK4A 2GV7A 4GCHG 1D3PB 1V2MT 2GZ7A 3ATKA 1AUJA 4I33A 1OS8A 1O5FH 1TAWA 3BN9A 4JZFH 4BTIB 4GUXA 4DOQA 1Z6EA 3GY8A 4BANB 1BOQA 2P3TB 3H09A 4GHTA 3TVJB 1D3QB 2AIPA 1Z7KA 3GCTG 3LC5A 2A2XH 3RXUA 1O5BB 3TH4H 4E06H 4XRNA 5KEDA 4NCYA 1SGCA 2ALPA 3MHWU 4MPUA 1W12U 1NFXA 3ZZ4A 4CHAB 4UD9H 2J9NA 4KKDA 1AZZA 4NIXA 1ID5H 5CMXH 2WSSD 3SNCA 4LXBH 3MH5A 3HGPA 3TITA 5TCAA 4ABGA 4YM9A 1ZPZA 1NBMD 1IOEA 4I8KA 1TYNA 3PV5A 1Y59T 1YPMH 1D3DB 1BZXE 1E1QD 1V2JT 2VINA 1O2PA 2AMDA 1GMDG 3P95A 3P6ZB 3ZV9A 5EJZA 1WCZA 5DP6A 4DCDA 2J98A 4O9VA 2R3YA 4GVUA 1QQUA 2XCNA 1B5GH 1P9SA 5GNDA 5F03A 2W6JD 1K22H 4UFFH 2A5KA 3ZVFA 2ZCKP 3BTDE 3MYWA 1DFPA 5JDUB 2FOBA 3ELAH 3VB5A 3QWCH 1ABJH 1HIAA 4CRAA 1MKXH 2OXSA 1GDNA 2PLXA 1GCTC 1ZMJA 3DA9B 3D65E 1AKSA 1GMCG 4ISIH 1ELCA 4X6PA 1O35A 2WPKS 4ACBA 1GBLA 1DWDH 1SMFE 3LONA 3QTVH 3AAVA 1CGJE 1BBRE 1BITA 1EATA 1E38B 1KLJH 2ZF0H 3MOCA 2FM2A 1EB1H 2EQNA 1LQEA 3GCOA 1O2UA 3MTYA 1P05A 3QLPH 1T32A 3AW0A 4PROA 3PROA 1GVZA 3O8RA 1HAOH 1ZMLA 5A8XA 1P2NA 4B6EA 4JYUH 1FMGA 2H1UA 1O3CA 1AD8H 1GBJA 2VWOA 3KF2A 4FUEA 4WWYA 1TWXB 3S0NA 4OS5A 1HBTH 5JPMH 1NU9A 2FOHA 1NRRH 1K21H 3A84A 4SGAE 4DY7B 1GHVH 1GI1A 1V2QT 1THSH 1XUKA 1AFEH 4YO9A 1HUTH 1CBWB 1QB1A 1LHDH 1ABIH 3EE7A 3GCHB 3NZIA 4NGAH 1JRSA 4BAOB 4K69A 4ABJA 1ESBA 1QQ4A 2VWLA 2YNBA 1DUEA 1MTUA 5DGJA 3UOPA 4B74A 5E0GA 4X1PU 2ZTYA 3UNQA 1IQIA 3M61U 4AORA 1DLKB 4A6LA 2ZKSA 4H4FA 2C8XB 2ZPSA 3MH4A 2ASUB 1HAIH 1QL7A 1SGPE 5DP5A 2BZAA 2VB0A 4ZAEA 1SG8B 2ZGCA 4ZH8A 4WF8A 1GBBA 4JZIA 3LPRA 3CS7A 2F4LA 5FAHA 1ARBA 1C2KA 1OWKA 3SYJA 1O2KA 1F0UA 1JIMA 1AMHA 2P93A 4AGKA 3LH3A 3UFAA 3MQKC 1HXEH 1V6DA 2XBVA 3VB3A 1ZSKA 4O97A 5IDKA 4J1YA 2HNTE 3PLBA 5T1VA 4A5TS 1FAKH 1TX8A 1LPGB 1S83A 1K1IA 1TBZH 2R9PA 2PHBA 2ZHDA 3VPKA 1ZSJA 2H5DA 4Y0ZE 2QF5A 1M9UA 3K65B 2GZ8A 1KY9A 1XXFA 2OC1A 2ZQ1A 1QFKH 1HDTH 2OQUA 2QXIA 4NIWA 3F1SB 1QURH 1ETTH 3OU0A 1S84A 2BD2A 1XM1A 2TGPZ 2BXUH 3RMMH 1ZTJA 3MNSA 3ZVCA 1AI8H 3UNRA 4K1EA 2ILNA 3TK5A 2UUFB 1TFXA 1KXFA 1SLXB 4ZHMU 3RXQA 3V12A 1RTKA 4IN1A 4JZDH 5H4IB 1UHBA 1YYY1 1BUIA 1FPCH 1C5UA 3V3MA 2FTMA 1GBEA 3U8RH 5L6NH 3TGIE 4M9FA 2CHAB 3F2GA 1GBDA 4FU7A 1O2JA 3P70B 4ABDA 2ZDKA 3CNRA 3ZV8A 2BDHA 2ANMH 1ZRBA 3IG6B 5GPIB 1EFRD 2W3IA 1S85A 1VCPA 2V3OH 4Q7XA 4AOQA 1NRSH 1P9UA 1Q31A 3D49H 2ZCLP 2AMPA 2GDEH 4SGBE 1SOZA 3ODDA 2QXJA 3O8BA 1HCGA 1PFXC 5C3NA 3ODFA 2JETB 2XXLA 3M36A 3KQBA 3TU7H 4H6SB 1EXFA 2GCTC 2B7DH 2WPHS 2XOKD 3SGBE 1KYNA 2Z3EA 1O3IA 1CHOG 3H7OA 3WWFA 1TIOA 2OC8A 1N8OB 2QAAA 2OINA 1IQNA 2BQWB 2WUBA 2OCVB 1EAUA 1C4U2 2WPDD 5FCRA 1LO6A 1GVLA 4DT4A 1F0RA 1DPOA 1S6FA 2P3FH 1W7XH 1L4ZA 5T6FA 1DWEH 1NM6A 2ZGBH 4WJG2 4B2AA 1GG6C 1F5KU 1CHGA 1O34A 3BTEE 2GT8A 2BVRH 1CSOE 3ZZ8A 1EAIA 5F8TA 3SJIA 1TE0A 2BY6X 1T7CA 1S0RA 4Y6DA 1BTHH 3BTHE 2FOFA 3FP8E 3VB7A 2FS9A 4X2XA 1WUNH 1W0YH 3L33A 1H9IE 2Z9JA 2FXRA 1F5LA 2W7UA 3KNXA 2H6MA 2Z3CA 4THNH 1QBNA 1FV9A 1EAWA 1EAXA 1PPFE 2GP9B 3MNXA 3SV6A 4IMZA 2KAIA 2ZTZA 1C5MD 1GCDA 4JMYA 1P2JA 3A7VA 3GICB 4A1TA 3LC3A 3GYMA 1C5LH 2CMYA 3S7KB 1QBOA 1MZAA 3TIUA 3JZ1B 2DE9A 1KXAA 3K9XB 1J8AA 1P01A 2H9HA 2OC0A 3LT3A 1GL1A
chains in the Genus database with same CATH topology
4IC5A 4WXVA 1ARCA 1TABE 1GI0A 1UVSH 1RTLA 1G36A 2BQ7B 1TMBH 2SFAA 4Y8YA 1HGTH 4CHAC 3HK6B 1AKSB 5GWZA 3B9FH 1GJ6A 1YF4A 4FUFA 1E34B 3Q3XA 1J15A 4OGYA 1GJ9B 2ZIQH 1C9TA 2DUCA 4ISNA 3QN7A 2YNAA 1O2ZA 1OP8A 1HFDA 2K1QA 3SUEA 3CS0A 4AYYB 4B76A 3F6UH 1O3GA 4MNWA 1GJ7B 2FODA 2C90B 2WV5A 1BMNH 1FNIA 2XYAA 3BTGE 3N7OA 2I6QA 3OYPA 5FPYA 1E37B 1TOCB 1F92A 1UTKA 1O5AB 1OWEA 2W26A 4JYTA 6ESTA 1HLTH 1DICA 5DP7A 4Y7BA 4YESB 5JB9S 4MTBA 5LPEA 1XUFA 2R0KA 4HZHA 1PPGE 5BRRE 1PPZA 1C5YB 1AHTH 1KTSB 1HPGA 2C8YB 1WBGB 2ZG0H 3E3TA 3MH6A 3ZZCA 1P2IA 4BAMB 1SHHB 4UFEH 1ZGVA 1G32B 5E0JA 3NWUA 3BG4B 1O2VA 3RXVA 4X6OA 3RXEA 1TBRH 3K6YA 3ENSB 3SO3A 1UTPA 3T28A 3D62A 1FLEE 2BD9A 1IAUA 1MMJN 1W10U 1UTMA 2SGDE 4JK5A 2VH6A 3TJNA 4ZKOU 1C4V2 2LPRA 1CBWC 2BD4A 2VIWA 2PW8H 4O3TA 3GCHC 1QY6A 2TPIZ 4DIHH 1T8MA 1NFWA 1GHAF 1XXDA 1V2LT 4KTSA 6GCHF 1Y5UT 1TGNA 3LDXH 4RKOB 1IQGA 1TGCA 2F9BH 2BLQA 3T25A 1HYLA 1O3LA 1GHBG 2HNTC 3E0NB 3ZVEA 2FTLE 4WMDA 3MU4A 3UWIA 3MU8A 3QZQA 5DJ7A 1S0QA 1IQKA 2PGQB 2FOEA 4TWWA 1V2PT 3H5CB 1S81A 4NWLA 1C1RA 3FZDA 3E90B 1H9LB 2R2WU 2ANKH 2ZC9H 1YPHE 1MCVA 3RXGA 1YP9A 3LGIA 1TBQH 2H9TH 3HATH 3CP7A 1BA8B 1O3DA 1OP0A 1ZGIA 3B8JA 3KEEA 4B2BA 4MNXA 4ZKSU 4WMEA 2BY5X 3WY8A 2G00A 3E91A 1WTGH 1XUJA 1TA6A 2CXVA 1AVWA 3GDVA 2UWLA 3PB1E 1O2WA 3QDZB 5FXLA 4YOJA 4FUDA 3OTJE 2PTCE 1N6XA 1GGDB 1O2GH 5DK1A 3RXCA 3SNBA 1HJAB 1O2TA 1B7XB 5EXNA 1WU1A 1NTPA 3SNDA 3SN8A 1H9HE 1WAYB 2FLRH 4MDSA 4GCHF 1KXBA 1TNLA 3D23A 2ZU5A 1LTOA 3GY5A 1W14U 2VGCB 3FP7E 4YZUA 1O2MA 1NPMA 2Y6TA 1A0LA 1C5TA 5C67A 1O3PB 2CHAC 3RXSA 2SGEE 3GY6A 2AGIX 2C8ZB 1C2HA 3FAOA 5EODA 4FUCA 3GCTF 1QR3E 3R0FA 5EXMA 3UOUA 1EZUC 3RXMA 3LGWA 1ANEA 3KL6A 3P17H 2Z9LA 2XCFA 3Q3KA 1G30B 1GJ8B 1BJVA 2GVFA 1DT2A 1TX6A 1VITH 2A4QA 4ZROA 5FX5A 2W5EA 4ZHAA 3RXTA 1RIWB 5T6GA 2A5AA 1DANH 2GKVE 2SNVA 4MG3A 4CBNA 1GMDF 1A3BH 4I8JA 3M5OA 2JETC 1P2MA 3RU4T 5DP4A 3UPEA 4TY7A 1VITG 1V3XA 1N6YA 1DS2E 5L30H 1IHTH 4D9RA 1W8BH 2ZHEH 2SGAA 1TMTH 2NU0E 3A7ZA 5ETXA 5C5NA 1N8OC 2EI7A 3SUGA 4HGCA 3A8DA 1JBUH 2BY7X 1DUAA 4CH8B 2WPLS 1FPHH 2QXHA 3PYHA 3E8LA 1VZQH 1L1GA 1UTNA 2V35A 2QGRA 2GZ9A 1GMCF 2BD7A 3EQ0H 1L0ZA 3EE0B 1DWCH 2BMGB 1O3NA 2JH5D 1EJNA 3M7UA 1H4WA 2FP7B 5A8YA 2B0FA 1AB9B 1PYTD 1GJCB 2ZI2H 4UDWH 1O3KA 5C20A 3I29A 2A5IA 4K8YA 4DURA 4DT7B 1K1PA 4OS1A 2G8TA 4ABEA 5HYOA 4K2YA 4WH6A 2H9EH 3ZZ6A 1OXGA 2ZU2A 1NZQH 4X8UH 1AIXH 5HGGA 1C5PA 1QB9A 3IITA 1CGIE 1W13U 3OX7U 1UTQA 1ACBE 1OYTH 3TK9A 1HJ9A 4MPVA 3P8OA 1ZTKA 3O8DA 1O5EH 4CH2B 3SV9A 4R8TB 3SV2H 1BTZA 3AASA 1BBRH 2I6SA 4LOYH 1F0SA 3DHKH 4WH8A 5ABWA 1OWHA 5A0CA 2BD5A 1BMLA 1C1NA 1G3BA 3ZZBA 1LKBA 1EP6A 3A8AA 1IQEA 4AB8A 2W3KA 4QT8C 2J4IA 4BXSA 4BXWA 4AG2A 1BMMH 1G3CA 3CENA 2BZ6H 1TGSZ 2EEKA 1BHXF 2Z3DA 3LGVA 5JB8S 2QV1A 4Y10E 1P09A 1G2MA 1T8NA 5DG6A 5E2OA 5E0HA 2OBOA 1O39A 3MU1A 3ZZ3A 1GBMA 1PPCE 1ELBA 3K2UA 1ZSLA 2BM2A 1LHEH 3QUMP 1NS3A 2G52A 1SGQE 1ZYOA 1RRKA 2WV4A 3QO6A 2LNCA 2O8WA 4IBLH 3RXBA 8GCHF 3UIRA 1GMHG 2PKSB 1MH0A 1T31A 2ESTE 4J2YB 4BAKB 1UVPA 3TLOA 4MNYA 1SSXA 2RG3A 7ESTE 4NG9H 1GI7B 1O3MA 2XC5A 2HVXA 3A8CA 3HK3B 1GJBB 1VJ9U 2ZQ2A 4A1XA 1ZR0A 2FESH 2OP9A 4X0WU 2BLVA 7GCHG 1WQSA 1FXYA 1F7ZA 3P8NA 4GLYA 3PTBA 1YCPH 4Y76A 3MO3A 2ZFQH 4E7NA 5ESBA 4BTTB 1KLIH 3HKIB 1XUHA 2Z94A 2GTBA 2Z9GA 2EI8A 3S9AA 3RC6A 1RTFB 1C2GA 1C1TA 2M5TA 3U8TH 1GI3A 2BYAX 1FIZA 1SLUB 3BG4C 1DSTA 3ATIA 3BIVH 3EDXB 3RXKA 1TONA 1TNIA 1UVTH 1Z8IB 2A0QB 1GI9B 1H8IH 2UUYA 1O30A 5FPSA 1ELVA 1O36A 3SJ9A 2BY9X 9ESTA 3FZZA 3T29A 8ESTE 3PV4A 5GXPA 2R0LA 1Z1IA 1SQTA 2GCHG 5EQSA 1C1PA 1YPHC 4K60A 1WTHD 8GCHG 1O2RA 1TPPA 1TX7A 3RXFA 3A7YA 1FZZA 3BEIB 3MWIU 2O8TA 1QL9A 1Z8JB 3RC4A 1GHYH 1C2FA 1QA7A 2A4GA 1BJUA 1SLWB 5I46H 2BDGA 4NZLA 1RS0A 1GI8B 1N1LA 3KQEA 2UUKB 9LPRA 1PPHE 3RMLH 3DD2H 4BOHA 1ANDA 2FOGA 1A2CH 3ZYDA 4F49A 3UQOA 1DWBH 1DY8A 3A83A 1QHRB 1L4DA 1A7SA 4FU9A 1ZHPA 1SC8U 1CHOF 1UK2A 1FN6A 2ODQA 2JH0D 1A1RA 1ZJKA 3QGNB 4ZKRU 4XBDA 5EG4A 4NIYA 2Q6DA 1OWJA 5EPYA 2ZDAH 4Z0KA 1C5OH 3F9FA 2HGTH 4AFQA 5JBCS 3DFJA 1A0JA 4Y7AA 3RMNH 2ALVA 3PWBA 1O5GH 2UWOA 4GAWA 2PKAB 3AW1A 1YC0A 2Y5FA 5EQRA 1GGDC 2GV6A 3A8BA 2C4FH 1OWDA 1DX5M 3A7XA 2R3UA 1HJAC 4YT6H 1ELDE 1W7GH 2QC2A 4AFSA 1C2MA 1O5DH 1UMAH 4A1VA 4AB9A 1P10A 3P8GA 2W7SA 4X2YA 5EPNA 3UNSA 2VGCC 1AE8H 1EZXC 1ESAA 5F8ZA 3SHCH 2QY0B 3VXFH 3UUZA 1HJ8A 3M35A 1CVWH 3A7TA 4A92A 4GSOA 4ABHA 1C5XB 4X1NU 3VFEA 4D76A 1WOFA 6LPRA 3SU2A 1WSSH 1MKXK 5C1XA 1L1JA 4HTCH 1C1SA 3U69H 1V2VT 1K1MA 1AY6H 3TJUA 5C2ZA 1O31A 1QA0A 2ZGXH 3BTKE 2BLWA 1A3EH 1Q3XA 4I32A 1DXPA 3LGYA 1K1JA 1Y3WA 1HRTH 3M5MA 2CGAA 1G37A 4IN2A 1NROH 4K1SA 1TB6H 1SQAA 2XNIA 3A81A 1D3TB 1RIWC 2AMQA 1EPTB 5TJXA 3LGTA 1QBVH 3GY2A 1GDUA 3BTWE 1Y3XA 1RJXB 5EW1H 1C2IA 4TYDA 5EQQA 2ZFTA 1T4UH 2FLBH 4LZ1H 2Q6FA 3NXPA 5GIBA 1SGFA 3EA9A 2ODYB 2STAE 2IN2A 1ZRKA 2OLGA 4U2WA 1LPKB 3I77A 1THRH 3GDSA 4XFQA 1AWHB 5L2ZH 1TNGA 1E0FD 3KCGH 4AX9H 3RP2A 1VGCB 1A61H 1WV7H 1D6WA 1YPKH 1C5NH 1AVXA 2AFQB 3F68H 3HPTB 1INCA 3SORA 2J92A 1AB9C 2F9OA 3SBKA 1P11E 1O3OA 1MKWK 3L3TA 1U6QA 1AE5A 1OOKB 1OWIA 1K2I1 2WYGA 1BDAA 1KXEA 2FZZA 2VVVA 1SGTA 5EU8A 1MAYA 1NC6A 1YLCA 1E35B 1Z6JH 2Z9KA 3LOXA 1FIWA 2HPQH 1SI5H 4BAHB 2FX4A 1DITH 1BCUH 4DIIH 3PO1B 1JOUB 1NT1A 1AQ7A 1CE5A 1AGJA 1IQJA 2FOMB 3UR6A 5K7RA 1HAGE 1S6HA 4RKJB 2CF8H 3MNCA 4INKA 3SU0A 4TY6A 1HV7A 4MVNA 2ZFSA 2VNTA 4YLUA 1DY9A 1TRNA 3KGPA 2ZU4A 3TH3H 1O2IA 3PM3A 3TJVA 3RDZA 4JZ1A 1FY5A 1IQFA 3PMAB 1GHBF 1RD3B 2XWAA 1YPLH 2CN0H 3LJOA 4Q7YA 2BD3A 2PSXA 3M37A 1QJ7B 1YLDA 4MNVA 1O2QA 1DLEA 1JMOH 1VR1H 1OYQA 4INLA 1ZLRA 1MU6B 1ANBA 4I8GA 2ZU3A 1OP2A 5A8ZA 1TMUH 1PQAA 3PLKA 2WYJA 4IC6A 2ZPRA 4INHA 5JBTA 1GI4A 2G4TA 1NY22 1T4VH 4X2VA 1UCYE 3BV9B 2PKSC 1MAXA 1F2SE 1O2OA 5A09A 2HOBA 2GT7A 4AG1A 1O2SA 5JBBS 4K5ZA 3S9CA 4NA9H 1O3HA 2A4RA 1GBCA 1VJAU 4OS6A 3F9GA 2ZHQH 5TCCA 2FOAA 3BF6H 2F9PA 2PSYA 3ATLA 3QX5H 1SGDE 1C1WH 4IS5A 1DM4B 5GCHG 1P04A 2FS8A 4UFDH 2HALA 2Y5HA 1KTTB 4U01A 2BQ6B 2HWLB 4XDEA 4H6TA 1YPJH 2GD4B 2ZDNA 1TQ0B 4O03A 2HRVA 2Z7FE 1ANCA 4X1QU 3FFGA 2ZECA 2WPMS 4TPYA 3A80A 1BQYA 3DUXH 3PTNA 4Q7ZA 3RLWH 3STJA 3RUOA 1TGBA 3RU4D 1CO7E 2H2ZA 1XKBC 3KN2A 1C1VH 4NA7A 4OS4A 5PTPA 2O8LA 5HM9A 3TK6A 1FY3A 1NFUA 1P2QA 2VH0A 4YT7H 3M3SA 1S5SA 4WMFA 1MD8A 4FVBA 1SOTA 3UREA 1O3JA 2A45B 2BTCE 2ZFPH 1TGTA 1JWTA 4NFEA 3A89A 1NESE 1FUJA 3SNAA 1DE7H 1QRZA 2RA0A 1MTNB 4OGXA 5LGOA 2EA3A 3VEQB 3LH1A 4JK6A 2V3HH 4WVPE 1MU8B 3PLPA 6CHAB 1SGIB 3LGUA 1G3EA 2XBYA 2SNWA 1VITF 3KIDU 2BX4A 3RXHA 1HAVA 1A5IA 1P0SH 1P3CA 2G4UA 2PGBB 4NWKA 4KP0A 4AGJA 3M7QA 1V2KT 1VCWA 1RFNA 2VIQA 2ZWLH 2FPZA 2G81E 1QNJA 1SB1H 1TALA 1XUIA 1C4Y2 1KSNA 2Y80A 1LKAA 1LPZB 1Y3VA 4FUJA 4UONA 2ZNKH 1F5RA 2IJOB 2ZA5A 1W2KH 1QL8A 1YPGH 4Y8XA 4MLFB 4ZMAH 3SGQE 2XC0A 1YKTA 2P8OB 2PKAA 4I8HA 4B1TA 2ZPQA 4FUBA 3VGCB 3TH2H 3URDA 1IHSH 3Q76A 4CBOA 3MFJA 2Q6GA 3SJ8A 2QCYA 1PJPA 2SGQE 3SQHE 3C1KA 2ZDLA 4D9QA 3A82A 1BRUP 3ITIA 4IMQA 2NU3E 4I31A 3V13A 3RXRA 1UJ1A 2VIOA 2ZDMA 2OD3B 3L6PA 2AGEX 3E6PH 5DP8A 1LCYA 2P95A 1UCYK 3ATWA 1AWFH 3U8OH 4XE4A 3W94A 2B5TB 2XBXA 2C93B 3S69A 4CRDA 3SOSA 2EI6A 4ABBA 1H8DH 3BEFB 1ZPCA 4AZ2B 2ZP0H 4D7FA 1XVMA 3PWCA 2F9NA 1Y3YA 1GBKA 1O0DH 3SW2B 3TNTA 1EJAA 1SGFG 4X2WA 5ESTE 1MTSA 4Y11E 2P59A 4FUHA 1PQ7A 1EPTC 1CT0E 1B0FA 3RM0H 1P12E 1CT4E 1K1OA 1BRBE 3ATMA 2BX3A 1EPTA 1NRNH 1O33A 1AU8A 1O3BA 4ESTE 3V7TA 2ZU1A 1LHCH 3T62A 2ZEBA 2OC7A 5FCKA 3RXIA 4CRCA 1CA0B 3SUDA 3SI3H 3MI4A 3A87A 1GL0E 4M7GA 3A88A 2H5CA 1GMHF 2R2MB 4X1RU 3T2NA 1C5VA 1SBWA 1ZJDA 1O2NA 2TBSA 2B8OH 4I7YH 1GHWH 1UVOA 3KQDA 2UUJB 3RXOA 1Z8RA 5DO4H 2ZHWH 3SNEA 5GDSH 1VGCC 1BT7A 5L2YH 7GCHF 1BTYA 3PMBB 3RXLA 1MCTA 1TRMA 4GHQA 2BD8A 3SU5A 1PPEE 1C5WB 3RXDA 1TNHA 4Q80A 1TA2A 1GBFA 5G4BA 4ISLA 1XMNB 2A32A 1GI5A 1KXCA 1LVYA 1MTVA 1TQ7B 5HMAA 2GMTB 2EC9H 1G9IE 2AGGX 1RXPA 4AFZA 3RM2H 2ZDVH 2FOCA 1V2NT 3MU5A 1ELAA 2Z9IA 1PPBH 1GJDB 1WQVH 3VB4A