3IG6B

Low molecular weigth human urokinase type plasminogen activator 2-[6-(3'-aminomethyl-biphenyl-3-yloxy)-4-(3-dimethylamino-pyrrolidin-1-yl)-3,5-difluoro-pyridin-2-yloxy]-4-dimethylamino-benzoic acid complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Identification of orally bioavailable, non-amidine inhibitors of Urokinase Plasminogen Activator (uPA)
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 245
sequence length 245
chains with identical sequence D
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ig6B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ig6B01
2ZQ2A 1RFNA 1HV7A 3QO6A 3K65B 1O5FH 1GI2A 4XBCA 1XXFA 1TB6H 2BDCA 1GI5A 4ABGA 4B71A 1GBEA 2BQ7B 3GY7A 4TPIZ 1CU1A 1AY6H 1DSTA 1UTNA 4OS4A 1C5ZB 2CHAB 4Y79A 5FBIA 2EI8A 2C8XB 1NU7B 3AAUA 4MNYA 5FXLA 1BTWA 1RIWC 1QJ1B 2M5TA 1OXGA 3LONA 4QT8C 3ZZCA 3E91A 3ZZ9A 4LZ1H 1P12E 4TY6A 9ESTA 2BLOA 2EEKA 4A5TS 3A85A 3M5NA 5LPFA 3EQ0H 4YTAA 2SGEE 2OLGA 2VIVA 3SNAA 3RXTA 1DT2A 3DHKH 5JB9S 3VB6A 1P2QA 4WMFA 3SNEA 1KXFA 3LH3A 2TGPZ 3BG4C 4NFFA 1UO6A 1AZZA 3UPEA 4X1NU 2Q6DA 2WPLS 3FAOA 4I8LA 2VWLA 1GGDC 5A8XA 5EPNA 4K5ZA 1H9LB 2FX6A 1A3EH 1EAIA 1GJCB 2GZ9A 2BTCE 2SGFE 2SGQE 4NGAH 1O2ZA 4E06H 4BAQB 3A89A 1ARCA 4AFQA 1DLKB 2AERH 3S7HB 3UNRA 4JCNA 3TH4H 3RXRA 3SV9A 2V0BA 3T62A 3D49H 3MHWU 3HGNA 4UE7H 5GIBA 3UQOA 2ZFFH 1GJ4H 2O8UA 3ZZ3A 2XC4A 3SU4A 1K1IA 1YPKH 2BQ6B 3C27B 5A0CA 5DP4A 2BY8X 1TONA 3M5MA 3GDVA 1PPFE 1U6QA 2Z3DA 1TPPA 4ZHAA 4UD9H 1A7SA 2ZHFH 3BTWE 1P10A 3E1XB 4CRGA 4B2AA 1N6YA 3KL6A 1V2MT 1BMMH 2NU1E 1JMOH 3QZQA 6GCHG 1QY6A 1O35A 1ANBA 1O5EH 3HATH 2TBSA 7KMEH 4BAMB 4ESTE 1FY1A 1DFPA 2UUJB 3FFGA 2ZDNA 2GV6A 2FLRH 4UDWH 4AYVB 1NFUA 1ZJKA 3QZRA 3RLYH 8GCHG 1ZHRA 1CA8B 2Z9JA 3RXFA 1ETSH 1V2UT 1WOFA 3G01A 2FIRH 1O3JA 1SLUB 4KTCA 3UNSA 3MO6A 3Q76A 1QTFA 2B8OH 1O2YA 1V2RT 5EW1H 1AKSB 2QCYA 5IYTA 1J9CH 3QX5H 3URCA 1O3CA 2OP9A 3MNBA 4XFQA 2BD9A 2PUXB 1ELTA 1ESAA 1A0HB 4CBOA 2JETB 3LPRA 1KLTA 2R3UA 1NT1A 3RXQA 1MBQA 1C9TA 1GL0E 1QBNA 2W5EA 4YT7H 1NPMA 2BDAA 1EZQA 3S9AA 2GCHF 3KQDA 1WBGB 1GHWH 3BTDE 5G4BA 4Y8YA 1EQ9A 1O2PA 1QQUA 1P57B 3SJOA 1KDQA 1O2RA 2ZCHP 1SI5H 4FVBA 2FX4A 2BD7A 1O33A 2FOFA 4D9QA 1MUEB 4Q7ZA 1OWKA 1HPGA 2Y7XA 1AZ8A 3V13A 4A1TA 3E90B 1QHRB 1GJ6A 1YCPM 3RUOA 1C1NA 2PHBA 3BG8A 1KTTB 3Q3YA 2GT7A 4A92A 2JH5D 2J9NA 1D9IA 4KGAA 1TGBA 3S7KB 1HAHH 1YCPH 1UHBA 2NU0E 1LVYA 1T8OA 3P17H 3A7YA 5FPTA 3EAJA 5AFZH 2C8ZB 1BRBE 1C2JA 2AIPA 4AZ2B 1BHXF 4XSKU 3ZVGA 2G4UA 1MAYA 1ZZZA 1TLDA 4HZHA 1RTLA 2ZTZA 1DOJA 1RD3B 3RC4A 3U69H 1Q2WA 1O3HA 1VJ9U 3EDXB 2VWNA 1DLEA 1TA6A 5K0HA 4F49A 5FPSA 1LHEH 2P95A 2YNAA 1PYTC 1SLWB 3P70B 3PLKA 1LPGB 1BTZA 1S82A 1Z8GA 3T29A 1AUJA 4JZEH 3GDUA 1V2TT 2UWPA 3MO9A 1MTNB 1DICA 1YM0A 1BTHH 3RXPA 2P3UB 1WV7H 1Z1JA 3FVFB 3M5OA 4GHTA 1TOMH 2WPJS 3ZVEA 1GMHF 1XM1A 3TU7H 3SUFA 1J16A 2P3FH 1SFQB 2R0KA 2AMPA 2GDEH 1EZUC 1O2VA 1RJXB 4I8KA 3RXCA 1UVSH 4LOYH 5L2YH 2C93B 1EAWA 1PPBH 3DFLA 4UEHH 3VGCB 1GI0A 4H6TA 2BD2A 1O3PB 1YBWA 3UR9A 1LKBA 4OS2A 1F7ZA 2H9EH 1BTXA 3EE0B 3ZZAA 3DT0H 5EQSA 3KNXA 4FUCA 3UWJH 1NRRH 4B75A 1ANEA 2TGAA 2B7DH 1FY4A 4AG1A 2B5TB 1T32A 1ZPBA 1KIGH 1TGTA 2BLVA 2BDBA 1W11U 1SR5C 1GBHA 2WV5A 3B23B 1IQJA 1O2SA 4BXSA 1A0LA 1GMDF 3IITA 5CHAB 1BJUA 5JDUB 4B74A 2G00A 1HNEE 4UFEH 1TRNA 3ZYDA 1GMCG 3A7TA 2WV4A 3MO3A 1CA0C 1MTVA 4X6OA 4ABDA 2B0FA 1QR3E 3RDZA 4KTSA 1PYTD 3A84A 3A7ZA 1GI4A 3UY9A 1VITF 1DUEA 1P05A 5J4SA 1GDNA 3QGJA 1EP6A 1UCYH 1GI9B 2G52A 1SGNE 2GTBA 2JH6D 1D4PB 3BTTE 4I8HA 1SGFG 3ODDA 1JWTA 2OC8A 1SQAA 2P59A 1EP5A 1C1SA 2RA0A 1H1BA 3TJUA 5FCRA 1SGIB 1W12U 1YCPK 5DP7A 1ESBA 1NFWA 2NU2E 1MBMA 2PSYA 1BA8B 1HJ8A 2AGEX 4CH8B 1O2UA 1RIWB 1ZTLA 2IJOB 3PROA 4CRDA 2Y82A 1KY9A 4K60A 5E8EH 1QB6A 1WQSA 1ANCA 5AF9H 3VB3A 3TIUA 3I77A 2A31A 2Y80A 1O5BB 5GJ4B 5DP3A 3F9HA 2F9PA 2BD4A 3RU4T 2QGRA 1GHAG 1KTSB 2BLWA 3Q77A 4SGAE 2OC0A 3I29A 1EJNA 1RGQA 4WVPE 3PLBA 3ZZ7A 5DO4H 1SGDE 3LGUA 2VVUA 1YPMH 3BTGE 5JBAS 4DIHH 1BJVA 1C4V2 3E8LA 1A1RA 1GGDB 1V2WT 1J8AA 1C2FA 3RXOA 2O9QA 4O3UA 2LPRA 1MQ5A 3MTYA 2Y6TA 1EOJA 2HVXA 4MPXA 1CT4E 1ETRH 3TK6A 1KXEA 3SJ8A 2BVSH 1TGNA 2ODQA 2GP9B 1GVLA 2PR3A 3D65E 3VEQB 1O31A 3NKKA 2IN2A 3SU1A 1W0ZU 1EB1H 4WH8A 1AVXA 1LTOA 4YM9A 5K7RA 1K22H 1UK2A 1ZRKA 1LVMA 1DX5M 1GI8B 2VH0A 1B7XB 2Z94A 1MAXA 1P06A 1PQAA 1TNIA 2GZ8A 1TMBH 1IQGA 1D3DB 1BHXB 1O2GH 1O2OA 5EG4A 3TNTA 2R3YA 4ZMAH 1V6DA 2ZCKP 5JBTA 2OBQA 5F8TA 5JPMH 3D23A 1C5TA 1UCYK 4NWLA 2QA9E 2ZNKH 5DP8A 4K3JA 5HM2A 1O3KA 1V2ST 5E0HA 1C1MA 1WTGH 3HK6B 1E36B 1TA2A 3SU6A 2BY5X 1C5WB 1UTOA 1UK3A 4NA8A 2SGAA 1C5XB 4X2YA 2ALVA 5CMXH 1NN6A 1F0SA 2PWXA 2XW9A 1C2GA 3Q3XA 1GG6C 2Z3EA 1GBKA 1HYLA 2OC1A 2F9OA 3A8CA 3SI4H 3V3MA 4UFFH 2D26C 3RXBA 4FUIA 2P3TB 4XE4A 4YT6H 1DY9A 5ESTE 1TNGA 1YPGH 1LHFH 1T4UH 1Z8IB 2K1QA 3MNXA 4CHAB 1C1VH 1T8MA 2VINA 2EI6A 1NFYA 4IMQA 1IOEA 1O2QA 3SU2A 3BTEE 4DIIH 4DOQA 1ANDA 1OPHB 5FX5A 4FU8A 3A8BA 2VIPA 1SB1H 1ZR0A 1SVPA 3TK5A 3NXPA 5DP5A 5JBBS 3PO1C 4HI3A 3VB7A 2SNVA 4FVDA 1A5GH 3P8OA 1OS8A 1GJ7B 4RKJB 2ZTYA 1Z6JH 1O3NA 1Y3UA 1CT0E 2FI3E 1AVGH 3TH3H 3M37A 2F83A 1MD7A 1CHOG 2YNBA 2OINA 2G5VA 2R0LA 1V2VT 3RMLH 1ZOMA 2FPZA 1SQOA 2BLQA 4ZHMU 1ESTA 1ELEE 2CV3A 1C5VA 1ZGVA 1O3MA 1HIAA 2FODA 4A1VA 5FAHA 1MH0A 5DKMA 2HNTF 1GBAA 1TFXA 4WJG2 2XBXA 2FDAA 1XMNB 1GMCF 4ZH8A 3GICB 4OS7A 3KQBA 2STAE 1ZSKA 1ZYOA 1L4DA 2KAIB 2XXLA 5F8XA 1C2DA 3BIVH 4I7YH 2Q6FA 1AVWA 3EA7A 3HKJB 8KME2 3UUZA 3STJA 3M3SA 1HAXB 4NA9H 3LJJA 4AN7A 4ZXXH 2A4RA 4D76A 1PPGE 2HPPH 4FU7A 1F5RA 2WUCA 1O2XA 4X2VA 1THSH 2P93A 3SNBA 1O30A 1IQHA 1EX3A 2QAAA 1OSSA 2ANMH 1OWIA 3MYWA 2TGDA 5FX6A 2Z6BD 3SUDA 1G30B 2IPHA 3MMGA 4GCHF 4Y10E 1UVPA 1BITA 3UOUA 1EJMA 1GJ8B 2XNIA 3QWCH 3T26A 3KQCA 1P2OA 4ZROA 1N8OB 2A5IA 2ULLA 2CF9H 3RXDA 5A2MH 5HGGA 3TJNA 1P02A 1O2TA 3ATMA 3GCHB 4WY3A 1ZPCA 1QJ6B 1PQ8A 1GBDA 5AHGH 3ATWA 5C1YA 1S83A 2RCEA 1CA0B 4SGBE 4YLQH 1W10U 2TGTA 2EI7A 3MNCA 1BBRE 1HXFH 7GCHF 1Y59T 1CBWB 3LDXH 3GY6A 3UOPA 3A83A 2EA3A 2W26A 4K1SA 5HMAA 2QC2A 5DK1A 3SW2B 2FOBA 1VCQA 3TH2H 4AFZA 1J15A 4NIYA 5DGJA 1GI7B 5LPEA 4BTIB 1XKAC 2A7CA 3RXGA 5BRRE 4BANB 3GCTG 1ZSJA 2BY7X 1EPTA 1L1GA 3GY4A 2AGGX 2VWOA 2ZPSA 5E2PA 1P9UA 2O8TA 3UNQA 1ELGA 3A88A 3RXIA 3K6YA 2V35A 1C4U2 1BIOA 5GCHG 1FUJA 1FMGA 2GX4A 3QTVH 1O2LA 1GDUA 4MNVA 2VH6A 1YF4A 2FYRA 3IG6B 4NG9H 1EUFA 1HLTH 3SOSA 3JZ2B 3MH7A 1H9HE 3P8GA 1DWBH 1MU8B 1N1LA 4DG4A 3TNSA 1ZHPA 1HAOH 1O2WA 2HRVA 2STBE 1WU1A 4BTTB 1EB2A 1O3DA 1MCTA 1PQ5A 2TPIZ 2FESH 3U98H 3UIRA 4NZQA 2Q6GA 4IMZA 1EZSC 1P0SH 2C8YB 2H5DA 2ESTE 1BRCE 5AFYH 3OYPA 1O5AB 3M7UA 3PMHB 5F8ZA 4I8GA 3QK1A 5DPAA 4X8VH 3BEUA 2PUQH 1CVWH 1ZJDA 3LGIA 2XWAA 2GDDA 1QNJA 1Y8TA 4VGCC 1GCTC 3M3VA 3SU0A 1O3AA 4AFUA 2BVXH 1S6FA 2PSXA 4DGJA 4I32A 1T7CA 4AGKA 1NC6A 1ELCA 1C1QA 4IS5A 4GUXA 1G9IE 2XC0A 1MZAA 1QA7A 4JYVH 4BAOB 3M5LA 1EOLA 4Y6DA 1QL8A 2JH0D 3TPIZ 1G3EA 1D6RA 3AAVA 2SFAA 1O36A 4JZIA 2BDGA 3NPSA 2XBWA 4X0WU 5C3NA 1MCVA 3NZIA 2BHGA 2OXSA 4E7RG 2CJIA 3RXUA 1NS3A 1EZXC 1FI8A 1H8IH 6CHAC 3VB4A 3Q00A 3R3GB 2P8OC 4O3TA 1AHTH 1F0RA 1SBWA 3RMNH 1C5LH 2CMYA 1YPEH 4ABEA 1QL9A 9LPRA 2ZEBA 1FXYA 5TCCA 1YLDA 3GY2A 1OP8A 3RP2A 1GBIA 4U01A 5L2ZH 1GG6B 2G8TA 1W8BH 1O5CB 2PV9B 2ZU4A 3RC5A 1PJPA 4AB8A 5E2OA 1GBCA 4CRCA 4AORA 3HKIB 1Q31A 3RXLA 4M7GA 1C2KA 3LH1A 3UR6A 2WYJA 4ABBA 3RC6A 3ZVDA 1SFIA 2ZZUH 1RTFB 2WINI 1L1JA 2VIOA 1N6XA 1SOTA 3SHAH 2XYAA 5I25A 2BDHA 2A4GA 2UUFB 1IQKA 3ODFA 2FWWA 4OGYA 5FPYA 3A81A 1FN6A 4FUGA 1O3OA 1TPSA 4ZXYH 2ODYB 2G81E 2J94A 1CHGA 2Z7FE 1MTUA 1QURH 2QN5T 1WAYB 3L3TA 2AGIX 1F92A 1ZMNA 1DWDH 1LPKB 1P3CA 1FIZA 3BV9B 5IDKA 2J2UA 5J4QA 2PKSB 1IQIA 4WH6A 1E38B 2GMTC 1EKBB 2H5CA 4J1YA 1IQFA 1FAKH 1LQEA 3V0XA 4X8TH 1FLEE 1E0FD 3MI4A 3PV4A 1GBTA 2FLBH 3VXFH 2FEQH 4WMDA 2ZTXA 3DA9B 4ABIA 1F2SE 4K1TA 3U8OH 1BMNH 1EASA 3M61U 4Z0KA 1VITH 3F9GA 4INHA 1HXEH 3ZZDA 1MQ6A 2GVFA 3E6PH 1D3TB 5T6DA 3U1JB 1HAGE 1PFXC 1A61H 2QYIA 4FUEA 1NROH 1AFQB 4UONA 2GD4B 5DJ7A 1Y3WA 1AB9C 2SGPE 3GCTF 3GYLB 3EYDA 2Y5GA 1F5LA 3UFAA 1ELAA 4H6SB 2XWBI 1G3CA 2CGAA 2A1DB 1ZGIA 4FXGH 3PTNA 2BB4A 2GT8A 1G2LA 3TVJB 1FDPA 2A0QB 3EA8A 1S81A 1P2KA 1A46H 4NWKA 3SV7A 1TQ7B 3U1IB 2XCFA 3BEFB 2FOCA 3OY6U 1D3QB 1DUAA 1ELVA 3CP7A 1B0EA 1HFDA 5JBCS 2V3OH 5A0BA 3EGKH 1O3GA 3SNCA 3L6PA 4TY7A 1TPAE 4DURA 1SG8B 1GI3A 1IQNA 1BB0B 2QXHA 4A1XA 2RDLA 1C5OH 3SV2H 2FTLE 2PW8H 3M36A 1YPHC 1IHTH 2XC5A 2C3SA 1KYNA 2BXUH 1UTMA 4ZUHA 3ATKA 1ARBA 2BMGB 2F9NA 1MTWA 1LHCH 2THFB 3DFJA 2VIWA 3U8RH 1V2OT 4ABAA 2XCNA 3A7XA 5I46H 1GHYH 3HPTB 2ZIQH 2ZPQA 2FO9A 5EXNA 4HGCA 4D8NA 3NUMA 1O5GH 1QCPA 3SQHE 3RXVA 1V2QT 1OKXA 1GJ9B 1L1NA 4R8TB 1XUGA 1M9UA 4Q2KA 5EXMA 2J92A 2F9BH 3MOCA 1V2PT 1DDJA 1C5SA 3GOVB 1OYQA 1VCWA 1T8LA 1DXWA 6GCHF 1Y3VA 1SHYA 1GVZA 3SBKA 1C5YB 3T28A 2FS8A 1HAPH 1JIMA 1ID5H 3RM0H 2PTCE 1S0RA 2ODPA 1QBVH 3BG4B 1C5QA 1SMFE 1XXDA 1C5MD 2OD3B 2FTMA 1PPHE 1Q3XA 3RXEA 8GCHF 3ZVAA 2ZHWH 5DG6A 1C5RA 1TX6A 1BOQA 3FP7E 1O3EA 2ZCLP 1J17T 1AQ7A 1RTKA 1YP9A 2PLXA 4OS6A 3ZVBA 3M3TA 4B1TA 3R0FA 3ZV8A 1C9PA 2CF8H 4B2BA 4R0IA 4D9RA 8LPRA 4ABFA 3AASA 4DW2U 2R9PA 2GCTC 4YZUA 2ZGJA 1ZSLA 3A87A 4BXWA 1NTPA 4LK4A 2UWOA 2ZDMA 1TBZH 2H9TH 3SO3A 1AKSA 1G37A 1H9IE 2VB0A 4TWYA 1ZTKA 1PPCE 1W7XH 2TIOA 2A2XH 4AX9H 2B9LA 3DD2H 3KHVA 2BOHB 1VCPA 2BZAA 1SPJA 3OTJE 4MDSA 1UTKA 4DVAU 1VJAU 2H1UA 1HDTH 4TYDA 2Z9GA 4VGCB 3SU5A 2OBOA 2PFEA 2IOTA 1CGHA 1MKWH 1NRPH 2ZHDA 1FY3A 2OC7A 1SOZA 2Z9LA 1G32B 1GVKB 2BXTH 3MU0A 1OX1A 4X2XA 1WCZA 1HAIH 1JIRA 1SGFA 2VGCC 4ZKSU 4CR9A 4Y0YE 1W7GH 1WYKA 2VVVA 3P8FA 3RXHA 1ETTH 3O8CA 3RLWH 2ZFPH 3KIDU 4DCDA 2OCVB 1YLCA 3ESTA 3N7OA 1SGTA 2Y5HA 1EAXA 3LGWA 2PKAB 2QXGA 1BTPA 1K1NA 2GV7A 2ZGXH 4IGDA 4F4OC 4ZKRU 3ZZ4A 1E37B 4PROA 1JRTA 5EQRA 3F9EA 1ABJH 2ANKH 4CR5A 1P8VC 2FXRA 1Y3YA 3GY3A 2JETC 3HGPA 6CHAB 4MQAA 1GBMA 2P8OB 1ORFA 4MPWA 5JYIA 1DWEH 5FBEA 3U8TH 1GJDB 1TWXB 1O32A 5EOKA 3RM2H 1FIWA 1D6WA 2SNWA 4YOJA 1QFKH 1YPHE 1OP0A 1GHXH 2ZGBH 4H42U 2BYAX 2HGTH 1P03A 3FP6E 4JZDH 3K9XB 2EC9H 4FUFA 3KGPA 4ASHA 2OUAA 3UREA 2ZC9H 1C5UA 1GDQA 2FOMB 3FZDA 3MU8A 2Z9KA 5EGMA 3PYHA 2GZ7A 4IN1A 4NIWA 4UFGH 4IW4E 4Y11E 3RXKA 2RG3A 1BBRH 1F5KU 3GY8A 2P94A 1HCGA 2FOAA 5ABWA 1UVTH 3PWBA 1S85A 3M35A 1GHVH 1A5IA 3SN8A 5AVDA 1HB0B 1A4WH 3AVZA 3NK8A 2QXJA 4IN2A 4YOIA 1TBQH 2VWMA 2ZG0H 1XX9A 1CGJE 1GHBG 1HGTH 2SGDE 2A45B 1LMWB 3KCGH 4HTCH 3PM3A 2G4TA 3SUEA 1J14A 2BY6X 1O39A 1FAXA 2QY0B 4Y7BA 3A86A 5DP9A 5TCAA 1MTNC 5DP6A 1KXDA 2A7JA 4ZKNU 2FOGA 1C1UH 1TNLA 3AW1A 4B76A 1CGIE 1F0UA 1C1TA 1MKWK 1GI6A 2WYGA 2NU3E 2QF3A 5GXPA 1C1RA 4ISLA 4GHQA 1RXPA 4ZKOU 3P92A 3ZYEA 1A0JA 4MPUA 2ZGCA 3I78A 5L30H 4Y0ZE 3TK9A 2I6QA 1H4WA 3KEEA 1W0YH 4WXIA 1DANH 5ETXA 1TQ0B 1V2KT 3BTME 4GSOA 1AWHB 1KXCA 1E35B 2A2QH 4ISOA 1AI8H 1GBJA 1SGYE 3BN9A 1GI1A 1QL7A 1IQMA 3MFJA 2XRCA 4ZHLU 3GYMA 4WWYA 3NWUA 2Q1JA 3RU4D 1ZMJA 2O8WA 2UWLA 1AB9B 1CE5A 1DS2E 4U32A 5C20A 5CHAC 3SGQE 1LO6A 2ZKSA 2G5NA 2FI5E 1GHAF 2FMJA 1UMAH 3ENSB 2H6MA 1MKXH 3BIUH 1AIXH 2BZ6H 1AWFH 1DITH 1G3BA 1NU9A 1ZTJA 1UVOA 3GY5A 1TGCA 4RKOB 1SQTA 1GMHG 2QXIA 1JRSA 2W7UA 1NO9H 5CE1A 2O8MA 3B8JA 5H4IB 3LOXA 3SZNA 4Z6AH 3QUMP 2OTVA 2BDYA 1O3FA 4JZ1A 2WPHS 1WQVH 1AO5A 2A7HA 1G3DA 2ZF0H 3GDSA 4NSYA 4IC5A 3PB1E 1GBBA 1Z8JB 4KP0A 2ZFQH 3H7TA 1BBRK 4AB9A 1P01A 1YGCH 2ZPRA 1GJAB 1INCA 3E0PB 1O2NA 2TRMA 3L33A 2G55A 4JYTA 1CQQA 1NZQH 3F68H 4XDEA 2OQ5A 4TPYA 3BTHE 1UVUH 5SGAE 1GPZA 3ZZ6A 1EATA 1TAWA 2J38A 1ZMLA 3LGYA 3BTKE 3KN2A 1O2KA 2F3CE 2ZDVH 3FZZA 1GMDG 1L2EA 5B6OA 3ITIA 1EAUA 4I8JA 1P11E 1NRSH 1AMHA 2DE8A 3T27A 3TGIE 4OGXA 1GJBB 3IWMA 1FV9A 1DY8A 1V2NT 2QV1A 2VIQA 5T6GA 3RU4E 1EPTC 2ZU5A 1VITG 5A09A 4E05H 4DY7B 2PTNA 2ZFTA 1BZXE 4MTBA 5TJXA 2WPMS 1O2HA 1DWCH 2ZHEH 2DE9A 1HBTH 1SLXB 4FUDA 3A7WA 4GVUA 5C2ZA 3V7TA 1Z8RA 2XBVA 1QJ7B 1HAZB 2UUYA 2RA3A 1YC0A 1GJ5H 2C90B 1T8NA 2GCTB 1WTHD 2ZU3A 3LC5A 3ZVFA 1EJAA 1W2KH 1UTQA 2BX3A 2R2MB 2VVCA 4YESB 5F03A 2PKAA 4CBNA 1THRH 4A7IB 2ZA5A 2Y81A 2Y5FA 3RMOH 3EA9A 4Q7YA 3O8DA 3ZZ5A 1VGCC 2CN0H 1Y5AT 1TGSZ 1O3LA 1F0TA 1DE7H 1P04A 2A4QA 3A8DA 3K6ZA 3SI3H 2AMQA 2A32A 4YOGA 4B2CA 1MKXK 4X6NA 1HJ9A 4ISHH 1RRKA 4ABHA 2ZECA 2H9HA 4I31A 1XKBC 1AD8H 2XBYA 4NIVA 2FYQA 4JK6A 3ZZBA 2AH4X 3MWIU 1OOKB 1TNHA 2C8WB 2HOBA 2VGCB 3E3TA 3JZ1B 1SHHB 4K8YA 2HPQH 1Y3XA 3MH4A 1FNIA 2ZHQH 1PPEE 1BRAA 3S9CA 2AS9A 1FONA 2F9UA 1XUJA 1CHOF 1G2MA 1W3CA 2O8LA 1UK4A 1QB9A 2BX4A 1DXPA 5C5NA 1TRYA 1DPOA 3O8RA 1H8DH 3QDZB 2F91A 4X2WA 4JK5A 1O2MA 1QRWA 1TABE 5LH8A 3F9FA 3SUGA 2LNCA 3GISB 3TGJE 1GHBF 1LDTT 8ESTE 1ZHMA 3O8BA 4ISIH 3QN7A 4XBDA 3A82A 1KXBA 1TRMA 1NY22 4LXBH 2AYWA 1CT2E 3WY8A 4CHAC 2HWLB 1CSOE 5JB8S 1ELFA 2BM2A 4NIXA 2VIDA 3RXMA 4X1QU 1LCYA 5E0GA 3LJOA 2XTTB 1XVMA 2BD5A 1FZZA 4FU9A 1IQEA 4TWWA 2W7SA 3MU4A 3TJVA 3AW0A 1NRQH 3SQEE 2A5KA 3KF2A 1SGEE 1QRZA 2J95A 1OWDA 2KAIA 2FS9A 4JMYA 1GWAA 3PLPA 2FOHA 3PO1B 4BTUB 1OWEA 1QIXB 3T25A 2FZZA 1UTPA 3BEIB 5T3HA 2BY9X 3W94A 1ACBE 2AFQB 1G36A 1D3PB 1Y5UT 5T6FA 4AFSA 7ESTE 3QGNB 2BD3A 4OS1A 5ESBA 3UQVA 1JXPA 4X1RU 4ISNA 1K21H 1B0FA 1QQ4A 1TBRH 1QGFA 3M7TA 1V2JT 4JYUH 4Q80A 4X1SU 1P09A 1PPZA 1O0DH 1OWHA 5C1UA 1BUIA 2A5AA 5FHTA 4H4FA 4XBBA 1XUFA 1MMJN 4IC6A 4NA7A 1MU6B 1BMAA 1GBLA 2BD8A 4Y71A 1MZDA 1Z1IA 1C1OA 1L4ZA 3UWIA 1SLVB 2Y7ZA 3W95A 1OWJA 3OX7U 1LQDB 3RXJA 1HJAC 1K1LA 4Y76A 1QA0A 1YYY1 1C1WH 1KXAA 3P8NA 1C2IA 1C5NH 4YO9A 2ZFSA 3OY5U 2BVRH 2NWNA 2ZO3H 4MLFB 1BT7A 1E34B 1HAYB 4FUBA 5L6NH 5GDSH 1LKAA 5PTPA 4Q7XA 3MH5A 1TMTH 1KLIH 2FOEA 2VJ1A 3CS0A 4LZ4B 1XUHA 5GWZA 1LHDH 1OP2A 1HIAB 3HK3B 3U9AH 1T31A 1P2NA 1DSUA 1RS0A 1TMUH 5A8ZA 3ATIA 3H7OA 4UFDH 1FPHH 1K1OA 1N8OC 1NFXA 4D7GA 1VR1H 1HAVB 5GCHF 1FJSA 1K2I1 4BAHB 2ZU1A 1ZPZA 2BQWB 5A8YA 5C67A 1OYTH 5HM9A 4KTUA 1WSSH 3A80A 1IQLA 2ANWA 1O2IA 5FCKA 1S0QA 2ZP0H 3GCHC 3LU9B 1LVOA 4K2YA 1YKTA 4J2YB 1FPCH 1O3BA 2GGVB 1TALA 1SGCA 1TIOA 1CBWC 2C4FH 4X6PA 3V12A 2CHAC 3K2UA 3TITA 1SGQE 4NSVA 4RN6A 4AGJA 4MG3A 5EU8A 4NCYA 3DUXH 3FANA 4MNWA 3UTUH 3A7VA 1NRNH 1THPB 1PQ7A 2DUCA 5LPRA 3S0NA 3SGAE 1ZRBA 4OS5A 1IHSH 5HXFA 2UUKB 4X8UH 4B73A 1AU8A 3BSQA 1GCDA 4CH2B 4BNRA 1A3BH 3GCOA 2FI4E 1B5GH 4CREA 4INKA 4GCHG 2F9VA 4NFEA 4RSPA 1BTUA 2Z3CA 3D62A 1ABIH 2A4OA 1ELDE 5F6MA 3E0NB 5C1XA 1K1PA 4AG2A 2W3KA 1O34A 2P16A 4KELA 1P3EA 4GAWA 2QIQA 2PGBB 1AUTC 4AYYB 5LGOA 2ZDKA 3LGTA 2I6SA 5EPYA 3MNSA 1W14U 2ZFRH 4U30A 7GCHG 1TNKA 1EPTB 1LVBA 1UTJA 2ANYA 4BAKB 1DVAH 2HLCA 2ZGHA 1O37A 1DM4B 4I33A 2BDIA 1Z6EA 1QB1A 1MD8A 1ZLRA 3PMJA 1TOCB 1LHGH 3A8AA 4KKDA 1K1MA 3E16B 5EXLA 3ZVCA 2WPIS 1BTYA 1TPOA 4THNH 3BTQE 1W13U 1HUTH 4HFPB 3TJOA 3VXEH 4A6LA 2ZI2H 5EQQA 5C5OA 3SGBE 1VZQH 6LPRA 1FY8E 1GCTB 1A2CH 1SGRE 3SNDA 4Y7AA 5EODA 1UCYE 1C4Y2 1T4VH 3TGKE 1YPLH 3OU0A 1TYNA 1HRTH 1TNJA 1BQYA 1AGJA 2GKVE 5HYOA 3T2NA 1AE8H 3LGVA 1VGCB 4E7NA 2D2DA 2ILNA 2VNTA 4O97A 1GHZA 1C5PA 3PMBB 3LC3A 6ESTA 1Y5BT 3SJKA 1S6HA 4BOHA 1C2HA 3QTOH 3TLOA 1JOUB 4GLYA 4CRBA 3PMAB 1P2IA 2HNTC 1K1JA 2AEIH 2ALPA 2AIQA 1X7AC 3MU5A 2NU4E 4FUJA 1GL1A 3CENA 1O3IA 1TX7A 2D8WA 1AN1E 1IAUA 1P2MA 1KSNA 3LKWA 1GBFA 2YOLA 4JZFH 1QBOA 1S5SA 1KLJH 4X6MA 3FP8E 1ELBA 4INLA 4O9VA 2ZWLH 3T5FH 2ZDLA 1S84A 3C1KA 5GPIB 4CRAA 2V6NA 2ASUB 3SORA 4CRFA 1O2JA 1BDAA 3H5CB 3LT3A 3MH6A 4U2WA 5BPEA 4Y8XA 4ZAEA 2OQUA 2V3HH 3F6UH 1C2LA 4DJZB 2G51A 3VPKA 3OSYA 4X8SH 1SC8U 3CS7A 4MNXA 2QF0A 2Z9IA 1Z7KA 3GCNA 3B9FH 2H2ZA 3P6ZB 3ATLA 4WXVA 3ZV9A 1K28D 2CXVA 3F1SB 4K69A 4K8BA 4MPVA 3SU3A 1UTLM 1JBUH 2J4IA 2BOKA 3RMMH 1K9OE 4MVNA 3BTFE 1AE5A 1XVOA 2PGQB 1KDQB 3MU1A 3ZZ8A 1BRUP 3SV6A 2FM2A 3RXAA 4Y8ZA 1TX8A 1NM6A 2HALA 4YLUA 4X1PU 3P95A 1L0ZA 2GCHG 2J34A 3ELAH 3LIWA 2PKSC 2AMDA 4NZLA 3S69A 4ABJA 1A5HA 1FY5A 5EW2H 1UHBB 4WF8A 1BMLA 2GMTB 2JKHA 2VU8E 2ZQ1A 2ZU2A 2R2WU 3NCLA 4WMEA 1FN8A 1P2JA 3VB5A 1HAVA 2ZDAH 1SGPE 3SV8A 3VGCC 1V2LT 1C2MA 3URDA 1C1PA 4D7FA 7LPRA 1V3XA 1BCUH 1HJAB 3VFEA 1SSXA 1MTSA 1XUIA 3RXSA 5A0AE 3BF6H 2D1JA 1WUNH 3SJ9A 1AFQC 4O03A 1EXFA 2WUBA 5E0JA 1O5DH 3SJIA 3PTBA 1QRXA 1LPZB 4AOQA 2W3IA 1NESE 4DT7B 1CO7E 1XUKA 4XOJA 3Q3KA 1SL3A 1FQ3A 3M7QA 3S9BA 3SHCH 1UJ1A 1YPJH 4GPGA 1Z71A 3PWCA 2FP7B 3QLPH 2WPKS 1C2EA 4FUHA 4IBLH 3STIA 1P9SA 4K1EA 1TE0A 1O38A 3KQEA 1AFEH 2HNTE
chains in the Genus database with same CATH superfamily
2ZQ2A 1RFNA 1HV7A 3QO6A 3K65B 1O5FH 1GI2A 4XBCA 1XXFA 1TB6H 2BDCA 1GI5A 4ABGA 4B71A 1GBEA 2BQ7B 3GY7A 4TPIZ 1CU1A 1AY6H 1DSTA 1UTNA 4OS4A 1C5ZB 2CHAB 4Y79A 5FBIA 2EI8A 2C8XB 1NU7B 3AAUA 4MNYA 5FXLA 1BTWA 1RIWC 1QJ1B 2M5TA 1OXGA 2GJGA 3LONA 4QT8C 3ZZCA 3E91A 3ZZ9A 4LZ1H 1P12E 4TY6A 9ESTA 2BLOA 2EEKA 4A5TS 3A85A 3M5NA 5LPFA 3EQ0H 4YTAA 2SGEE 4TT3D 2OLGA 2VIVA 3SNAA 3RXTA 1DT2A 3DHKH 5JB9S 3VB6A 1P2QA 4WMFA 3SNEA 3WWFA 1KXFA 3LH3A 2TGPZ 3BG4C 4NFFA 1UO6A 1AZZA 3UPEA 4X1NU 2Q6DA 2WPLS 3FAOA 4I8LA 2VWLA 1GGDC 5A8XA 5EPNA 4K5ZA 1H9LB 2FX6A 1A3EH 1EAIA 1GJCB 2JDID 2GZ9A 2BTCE 2SGFE 2SGQE 4NGAH 1O2ZA 4E06H 4BAQB 3A89A 1ARCA 4AFQA 1DLKB 2AERH 3S7HB 3UNRA 4JCNA 3TH4H 3RXRA 3SV9A 2V0BA 3T62A 3D49H 3MHWU 3HGNA 4UE7H 5GIBA 3UQOA 2ZFFH 1GJ4H 2O8UA 3ZZ3A 2XC4A 3SU4A 1K1IA 1YPKH 2BQ6B 3C27B 5A0CA 5DP4A 2BY8X 1TONA 3M5MA 3GDVA 1PPFE 1U6QA 5EJLA 2Z3DA 1TPPA 4ZHAA 2JIZD 4UD9H 1A7SA 2ZHFH 3BTWE 1P10A 3E1XB 4CRGA 4B2AA 1N6YA 3KL6A 1V2MT 1BMMH 2NU1E 1JMOH 1SQRA 3QZQA 5DN6D 6GCHG 1QY6A 1O35A 1ANBA 1O5EH 5KECA 3HATH 2TBSA 7KMEH 4BAMB 4ESTE 1FY1A 1DFPA 2UUJB 3FFGA 3SZEA 2ZDNA 2GV6A 2FLRH 4UDWH 3WW7A 1NFUA 1ZJKA 3QZRA 3RLYH 4AYVB 2AHME 1ZHRA 1CA8B 2Z9JA 3RXFA 1ETSH 1V2UT 1WOFA 3G01A 2FIRH 1O3JA 1SLUB 4KTCA 3UNSA 3MO6A 3Q76A 1QTFA 2B8OH 1O2YA 1V2RT 5EW1H 1AKSB 2QCYA 5IYTA 3FN8A 1J9CH 3QX5H 3URCA 1O3CA 2OP9A 3MNBA 4XFQA 2BD9A 2PUXB 1ELTA 1ESAA 1A0HB 4CBOA 2JETB 3LPRA 1KLTA 2R3UA 1NT1A 3RXQA 1MBQA 1C9TA 1GL0E 1QBNA 2W5EA 4YT7H 1NPMA 2BDAA 1EZQA 3S9AA 2GCHF 3KQDA 1WBGB 1GHWH 3BTDE 5G4BA 4Y8YA 1EQ9A 1O2PA 4Z1MD 3F3BA 1QQUA 1P57B 3SJOA 1KDQA 1O2RA 2ZCHP 1SI5H 4FVBA 2FX4A 2CK3D 2BD7A 1O33A 2FOFA 4D9QA 1MUEB 4Q7ZA 1OWKA 1HPGA 2Y7XA 1AZ8A 3V13A 4A1TA 3E90B 1QHRB 1GJ6A 1YCPM 3RUOA 1C1NA 2PHBA 3BG8A 1KTTB 3Q3YA 4FOUC 2GT7A 4A92A 2JH5D 2J9NA 1D9IA 4KGAA 1TGBA 4Q4LA 3S7KB 1HAHH 1YCPH 1UHBA 2NU0E 1LVYA 1T8OA 3P17H 3A7YA 5FPTA 3EAJA 5AFZH 2C8ZB 1BRBE 1C2JA 2AIPA 4AZ2B 1BHXF 4XSKU 3ZVGA 2G4UA 1MAYA 1ZZZA 1TLDA 4HZHA 1RTLA 2ZTZA 1DOJA 1RD3B 3RC4A 3U69H 1Q2WA 1O3HA 1VJ9U 3EDXB 2VWNA 1DLEA 1TA6A 5K0HA 4F49A 5FPSA 1LHEH 2P95A 1H8HD 1PYTC 2YNAA 1SLWB 3P70B 3PLKA 1LPGB 1BTZA 1S82A 1Z8GA 3T29A 1AUJA 4JZEH 3GDUA 1V2TT 2UWPA 3MO9A 1MTNB 1DICA 1YM0A 1BTHH 3RXPA 2P3UB 1WV7H 1Z1JA 3FVFB 3M5OA 4GHTA 1TOMH 2KZ4A 2WPJS 1GMHF 3ZVEA 1XM1A 3TU7H 3SUFA 1J16A 2P3FH 2RFKC 1SFQB 2R0KA 2AMPA 2GDEH 1EZUC 1O2VA 1RJXB 4I8KA 2KCYA 1UVSH 4LOYH 3RXCA 5L2YH 2C93B 1EAWA 1PPBH 3DFLA 4UEHH 3VGCB 1GI0A 3AK5A 4H6TA 2BD2A 1O3PB 1YBWA 3UR9A 1LKBA 4OS2A 1F7ZA 2H9EH 1BTXA 3EE0B 3ZZAA 3DT0H 5EQSA 3KNXA 4FUCA 3UWJH 1NRRH 4B75A 1ANEA 2TGAA 2B7DH 1FY4A 4AG1A 2B5TB 1T32A 1ZPBA 3ZIAD 1KIGH 3F0OA 1TGTA 2BLVA 2BDBA 1W11U 1SR5C 1GBHA 2WV5A 3B23B 1IQJA 1O2SA 4BXSA 1A0LA 1GMDF 3IITA 5CHAB 1BJUA 5JDUB 4B74A 2G00A 1HNEE 4UFEH 1TRNA 3ZYDA 1GMCG 3A7TA 2WV4A 3MO3A 1CA0C 1MTVA 4X6OA 4ABDA 2B0FA 1QR3E 3RDZA 4KTSA 1PYTD 3A84A 3A7ZA 1GI4A 3UY9A 1VITF 1DUEA 1P05A 2J98A 1GDNA 5J4SA 3QGJA 1EP6A 1UCYH 1GI9B 2G52A 1SGNE 2GTBA 2JH6D 1D4PB 3BTTE 4I8HA 1SGFG 3ODDA 1JWTA 1SKYE 2OC8A 1SQAA 2P59A 1EP5A 1C1SA 2RA0A 1H1BA 3TJUA 2JJ2D 5FCRA 1SGIB 1W12U 1YCPK 5KEDA 5DP7A 1ESBA 1NFWA 2NU2E 1MBMA 2PSYA 1BA8B 1HJ8A 2AGEX 4CH8B 1O2UA 1RIWB 1ZTLA 2IJOB 3PROA 4CRDA 2Y82A 1KY9A 4K60A 2WV9A 5E8EH 1QB6A 1WQSA 1ANCA 5AF9H 3VB3A 3TIUA 1MABB 2A31A 2Y80A 1O5BB 3I77A 5GJ4B 5DP3A 3F9HA 2F9PA 2BD4A 3RU4T 2QGRA 1GHAG 1KTSB 2BLWA 3Q77A 4SGAE 2OC0A 3I29A 1EJNA 1RGQA 4WVPE 3PLBA 3ZZ7A 5DO4H 1SGDE 3LGUA 3PRBA 2VVUA 1YPMH 3BTGE 5JBAS 4DIHH 1BJVA 1C4V2 3E8LA 1A1RA 1GGDB 1V2WT 1J8AA 1C2FA 2M2AA 3DSGA 3RXOA 2O9QA 4O3UA 2LPRA 1MQ5A 3MTYA 2Y6TA 1EOJA 2HVXA 4MPXA 1CT4E 1ETRH 3TK6A 1KXEA 3SJ8A 2BVSH 1TGNA 2ODQA 2GP9B 1GVLA 2PR3A 3D65E 3VEQB 1O31A 3NKKA 4F48B 2IN2A 3SU1A 1W0ZU 1EB1H 4WH8A 1AVXA 3UB0A 5CDFE 1LTOA 4YM9A 5K7RA 1K22H 1UK2A 1ZRKA 1LVMA 1DX5M 1GI8B 2VH0A 1B7XB 2Z94A 2LELA 1MAXA 1P06A 1PQAA 1TNIA 2GZ8A 1TMBH 1IQGA 1D3DB 1BHXB 1O2GH 2K0QA 1O2OA 5EG4A 3TNTA 2R3YA 4ZMAH 3PV5A 1V6DA 2ZCKP 5JBTA 2OBQA 5F8TA 5JPMH 3D23A 1C5TA 1UCYK 4NWLA 2QA9E 2ZNKH 5DP8A 4K3JA 5HM2A 1O3KA 4I86A 1V2ST 5E0HA 1C1MA 1WTGH 3HK6B 4HG6A 1E36B 1TA2A 3SU6A 2BY5X 1C5WB 1UTOA 1UK3A 4NA8A 2SGAA 5C0TA 1C5XB 4X2YA 2ALVA 5C17A 5CMXH 1NN6A 1F0SA 4DT4A 2PWXA 2XW9A 1C2GA 3Q3XA 1GG6C 2Z3EA 1GBKA 1HYLA 2OC1A 2F9OA 3A8CA 3SI4H 3V3MA 4UFFH 2D26C 3RXBA 4FUIA 2P3TB 4XE4A 4YT6H 1DY9A 5ESTE 1TNGA 1YPGH 1LHFH 1T4UH 1Z8IB 2K1QA 3MNXA 4CHAB 1C1VH 1T8MA 2VINA 2EI6A 1NFYA 4IMQA 1IOEA 1O2QA 3SU2A 3BTEE 4DIIH 4DOQA 1ANDA 1OPHB 5FX5A 4FU8A 2IPQX 3A8BA 2VIPA 1SB1H 1ZR0A 1SVPA 3FOAA 3TK5A 3NXPA 5DP5A 5JBBS 3PO1C 4HI3A 3VB7A 2SNVA 3F2GA 4FVDA 1A5GH 3P8OA 4XRNA 1OS8A 1GJ7B 2IJD1 4RKJB 2ZTYA 2KR7A 1Z6JH 5CHBA 1O3NA 1Y3UA 1CT0E 2FI3E 1AVGH 3TH3H 3M37A 2F83A 1MD7A 1CHOG 2YNBA 2OINA 2G5VA 2R0LA 1V2VT 3RMLH 1ZOMA 2FPZA 1SQOA 2BLQA 4ZHMU 1ESTA 1ELEE 2CV3A 1C5VA 1ZGVA 1O3MA 1HIAA 2FODA 4A1VA 5FAHA 1MH0A 5DKMA 2HNTF 1GBAA 3EE7A 1TFXA 4WJG2 2XBXA 2FDAA 1XMNB 1GMCF 4ZH8A 3GICB 4OS7A 3KQBA 2STAE 1ZSKA 1ZYOA 1L4DA 2KAIB 2XXLA 5F8XA 1C2DA 3BIVH 4I7YH 2Q6FA 1AVWA 3EA7A 3HKJB 8KME2 3UUZA 3STJA 3M3SA 1HAXB 4NA9H 3LJJA 4AN7A 4ZXXH 2A4RA 4D76A 1PPGE 2HPPH 4FU7A 1F5RA 2WUCA 1O2XA 4X2VA 1THSH 2P93A 3SNBA 1O30A 1IQHA 1EX3A 2QAAA 1OSSA 2ANMH 1OWIA 2KCOA 2TGDA 3MYWA 5FX6A 2Z6BD 3SUDA 1G30B 2IPHA 3MMGA 4GCHF 4Y10E 1UVPA 1BITA 3UOUA 2HVYB 1EJMA 1GJ8B 2XNIA 3QWCH 3T26A 3KQCA 1P2OA 4ZROA 1N8OB 2A5IA 2ULLA 2CF9H 3RXDA 5A2MH 3FO8D 5HGGA 3TJNA 1P02A 1O2TA 5GNDA 1W0JD 3ATMA 3GCHB 4WY3A 1K0HA 1ZPCA 1QJ6B 1PQ8A 1GBDA 5AHGH 3ATWA 5C1YA 1E1RD 1S83A 2RCEA 1CA0B 3OE7D 4SGBE 1W10U 4YLQH 2TGTA 2EI7A 3MNCA 1BBRE 1HXFH 7GCHF 1Y59T 1CBWB 3LDXH 3GY6A 3UOPA 3A83A 2EA3A 2KCAA 2W26A 4K1SA 5HMAA 2QC2A 5DK1A 3SW2B 2FOBA 1VCQA 3TH2H 4Q63A 4AFZA 1J15A 4NIYA 5DGJA 1GI7B 5LPEA 4BTIB 1XKAC 2A7CA 3RXGA 5BRRE 4BANB 3GCTG 1ZSJA 3KQ5A 2BY7X 1EPTA 1L1GA 4OM9A 3GY4A 2AGGX 2EQNA 2VWOA 2ZPSA 5E2PA 1P9UA 2O8TA 3UNQA 1ELGA 3A88A 3RXIA 3K6YA 2V35A 1C4U2 1BIOA 2OK5A 5GCHG 1FUJA 1FMGA 2GX4A 3QTVH 1O2LA 1GDUA 4MNVA 2VH6A 1YF4A 2FYRA 3IG6B 3OTPA 4NG9H 1EUFA 1HLTH 3SOSA 3JZ2B 3MH7A 1H9HE 3P8GA 4F55A 1DWBH 1MU8B 1N1LA 4DG4A 3TNSA 1ZHPA 1HAOH 1O2WA 2HRVA 2STBE 1WU1A 2WPDD 4BTTB 3PV2A 1EB2A 1E79D 1MCTA 1O3DA 1PQ5A 2TPIZ 2FESH 3U98H 3UIRA 4NZQA 2Q6GA 4IMZA 1EZSC 2KX4A 1P0SH 2C8YB 2H5DA 2ESTE 1BRCE 5AFYH 3OYPA 1O5AB 1E1QD 3M7UA 3PMHB 5F8ZA 4I8GA 3QK1A 5DPAA 4X8VH 3BEUA 4TSFD 2PUQH 1CVWH 1ZJDA 3LGIA 2XWAA 2GDDA 1QNJA 1Y8TA 4VGCC 1GCTC 3M3VA 3SU0A 1O3AA 4AFUA 2BVXH 1S6FA 2PSXA 4DGJA 4I32A 1T7CA 4AGKA 1NC6A 1ELCA 1C1QA 4IS5A 4GUXA 1G9IE 2XC0A 1MZAA 1QA7A 4JYVH 2J97A 4BAOB 3M5LA 1EOLA 4Y6DA 1QL8A 2JH0D 3TPIZ 1G3EA 1D6RA 3AAVA 2SFAA 1O36A 4JZIA 2BDGA 3NPSA 2XBWA 4X0WU 5C3NA 1MCVA 3NZIA 2BHGA 2OXSA 4E7RG 2CJIA 3RXUA 1NS3A 1EZXC 1FI8A 1H8IH 6CHAC 3VB4A 3Q00A 3R3GB 2P8OC 4O3TA 1AHTH 1F0RA 1SBWA 3RMNH 1C5LH 2CMYA 1YPEH 4ABEA 1QL9A 5EJZA 3WWBA 9LPRA 2ZEBA 1FXYA 5TCCA 1YLDA 3GY2A 1OP8A 3NRLA 3RP2A 1GBIA 4U01A 5L2ZH 1GG6B 2G8TA 1W8BH 1O5CB 2PV9B 2ZU4A 3RC5A 1PJPA 4AB8A 5E2OA 1GBCA 4CRCA 4AORA 1BMFD 3HKIB 1Q31A 3RXLA 4M7GA 1C2KA 3LH1A 3UR6A 2WYJA 4ABBA 3RC6A 3ZVDA 1YY3A 1SFIA 2ZZUH 4ACAA 1RTFB 2WINI 1L1JA 1YLNA 1N6XA 1SOTA 2VIOA 2XYAA 3SHAH 5I25A 2BDHA 2A4GA 2UUFB 1IQKA 3ODFA 2FWWA 4OGYA 5FPYA 2QE7D 3A81A 1FN6A 4FUGA 1O3OA 1TPSA 4ZXYH 2ODYB 2G81E 2J94A 1CHGA 2Z7FE 1MTUA 1QURH 2QN5T 1WAYB 3L3TA 2AGIX 1F92A 1ZMNA 1DWDH 1LPKB 1P3CA 1FIZA 3BV9B 5IDKA 2J2UA 5J4QA 2PKSB 1IQIA 4WH6A 1E38B 2GMTC 1EKBB 2H5CA 2HLDD 4J1YA 1IQFA 1FAKH 1LQEA 3V0XA 4X8TH 1FLEE 1E0FD 3MI4A 3PV4A 1GBTA 2FLBH 3VXFH 2FEQH 4WMDA 2ZTXA 3DA9B 4ABIA 1F2SE 4K1TA 3U8OH 1BMNH 1EASA 3M61U 4Z0KA 1VITH 5FL7D 3F9GA 2L6OA 1HXEH 4INHA 3ZZDA 1MQ6A 2GVFA 3E6PH 1D3TB 5T6DA 3U1JB 1HAGE 1PFXC 1A61H 2QYIA 4FUEA 1NROH 1AFQB 4UONA 2GD4B 5DJ7A 1Y3WA 1AB9C 2SGPE 3GCTF 3GYLB 3EYDA 2VBCA 2Y5GA 1F5LA 3UFAA 1ELAA 4H6SB 2XWBI 1G3CA 2CGAA 3UAIC 2A1DB 1ZGIA 4FXGH 3PTNA 2BB4A 2GT8A 1G2LA 3TVJB 1FDPA 2A0QB 3EA8A 1S81A 1P2KA 1A46H 4NWKA 3SV7A 1TQ7B 3U1IB 2XCFA 3BEFB 2FOCA 3OY6U 1D3QB 1DUAA 1ELVA 3CP7A 1B0EA 1HFDA 5JBCS 2V3OH 1KMHB 5A0BA 4M9FA 3EGKH 1O3GA 3SNCA 3L6PA 4TY7A 1TPAE 4DURA 1SG8B 1GI3A 3OEHD 1IQNA 1BB0B 2QXHA 4A1XA 2RDLA 1C5OH 3SV2H 2FTLE 2PW8H 3M36A 1YPHC 1IHTH 2XC5A 2C3SA 1KYNA 2BXUH 1UTMA 4ZUHA 3ATKA 1ARBA 2BMGB 2F9NA 1MTWA 1LHCH 2THFB 3DFJA 2VIWA 3U8RH 1V2OT 4ABAA 2XCNA 3A7XA 5I46H 1GHYH 3HPTB 2ZIQH 2ZPQA 2FO9A 5EXNA 4HGCA 4D8NA 3NUMA 1O5GH 1QCPA 3SQHE 3RXVA 1V2QT 1OKXA 1GJ9B 1L1NA 4R8TB 1XUGA 1M9UA 4Q2KA 5EXMA 2J92A 2F9BH 3MOCA 1V2PT 1DDJA 1C5SA 3GOVB 1OYQA 1VCWA 1T8LA 1DXWA 6GCHF 1Y3VA 1SHYA 1GVZA 3SBKA 1C5YB 3T28A 2FS8A 1HAPH 1JIMA 1ID5H 3RM0H 2PTCE 1S0RA 2ODPA 1QBVH 3BG4B 1C5QA 1SMFE 1XXDA 1C5MD 2OD3B 2FTMA 1PPHE 1Q3XA 3RXEA 8GCHF 3ZVAA 2ZHWH 2YMSC 5DG6A 1C5RA 1TX6A 1BOQA 3FP7E 1O3EA 1UW7A 2ZCLP 1J17T 1AQ7A 1YWUA 1RTKA 1YP9A 2PLXA 4OS6A 3ZVBA 3M3TA 4B1TA 3R0FA 3ZV8A 1C9PA 2CF8H 3CNRA 4B2BA 4R0IA 4D9RA 8LPRA 4ABFA 3AASA 3N7EA 4DW2U 2R9PA 2GCTC 4YZUA 2ZGJA 1ZSLA 3A87A 4BXWA 1NTPA 4LK4A 2UWOA 2ZDMA 1TBZH 2H9TH 3SO3A 1AKSA 1G37A 1H9IE 2VB0A 4TWYA 1ZTKA 5KGOA 1PPCE 1W7XH 2TIOA 2A2XH 4AX9H 2B9LA 3DD2H 3KHVA 2BOHB 1VCPA 2BZAA 1SPJA 3OTJE 4MDSA 1UTKA 4DVAU 1VJAU 2H1UA 1HDTH 4TYDA 2Z9GA 4VGCB 3SU5A 2OBOA 2PFEA 2IOTA 1CGHA 1MKWH 1NRPH 2ZHDA 1FY3A 2OC7A 1SOZA 2Z9LA 1G32B 1GVKB 2BXTH 3MU0A 1OX1A 4X2XA 1WCZA 1HAIH 1JIRA 1SGFA 2VGCC 4RT1A 4ZKSU 4CR9A 4Y0YE 1W7GH 1WYKA 2VVVA 3P8FA 3RXHA 1ETTH 3O8CA 3RLWH 2ZFPH 3KIDU 4DCDA 2OCVB 2YMSD 1YLCA 3ESTA 3N7OA 1SGTA 2Y5HA 1EAXA 3LGWA 2PKAB 2QXGA 1BTPA 1K1NA 2GV7A 2ZGXH 4IGDA 4F4OC 4ZKRU 3ZZ4A 1E37B 4PROA 1JRTA 5EQRA 3F9EA 1ABJH 2ANKH 4CR5A 1P8VC 2FXRA 1Y3YA 3GY3A 2JETC 3HGPA 6CHAB 4MQAA 1GBMA 2P8OB 2RDEA 1ORFA 4MPWA 5JYIA 1DWEH 5FBEA 3U8TH 1GJDB 1TWXB 1O32A 5EOKA 3RM2H 1FIWA 1D6WA 2SNWA 2LP6A 1QFKH 3F2HA 4YOJA 1YPHE 1OP0A 1GHXH 2ZGBH 4H42U 2BYAX 2HGTH 1P03A 3FP6E 4JZDH 3K9XB 2EC9H 4FUFA 3KGPA 4ASHA 5IK2D 2OUAA 2WHXA 2ZC9H 3UREA 1C5UA 1GDQA 3N7DA 2FOMB 3N99A 3FZDA 3MU8A 2Z9KA 5EGMA 4AC9A 3PYHA 2GZ7A 4IN1A 4NIWA 4UFGH 4IW4E 4Y11E 3RXKA 2RG3A 1BBRH 1F5KU 3GY8A 2P94A 1HCGA 2FOAA 5ABWA 1UVTH 3PWBA 1S85A 3M35A 1GHVH 2W6JD 1A5IA 3SN8A 5AVDA 1HB0B 1A4WH 3AVZA 3NK8A 2QXJA 4IN2A 4YOIA 1TBQH 4B6FA 2VWMA 2ZG0H 1XX9A 1CGJE 1GHBG 1HGTH 2SGDE 2A45B 1LMWB 3KCGH 4ZCNA 4HTCH 3PM3A 2G4TA 3SUEA 1J14A 2BY6X 1O39A 1FAXA 2QY0B 4Y7BA 3A86A 5DP9A 5TCAA 1MTNC 3KYGA 5DP6A 1KXDA 2A7JA 4ZKNU 3H09A 2FOGA 1C1UH 1TNLA 3AW1A 4B76A 1CGIE 1F0UA 1C1TA 1MKWK 1GI6A 2WYGA 3F2FA 2NU3E 2QF3A 5GXPA 1C1RA 4ISLA 4GHQA 1RXPA 4ZKOU 3P92A 3ZYEA 1A0JA 4MPUA 2ZGCA 3I78A 5L30H 4Y0ZE 3TK9A 2I6QA 1H4WA 3KEEA 1W0YH 4WXIA 1DANH 2WZQA 5ETXA 1TQ0B 1V2KT 3BTME 4GSOA 1AWHB 1KXCA 1E35B 2A2QH 4ISOA 1AI8H 1GBJA 1SGYE 3BN9A 1GI1A 1QL7A 1IQMA 3MFJA 2XRCA 4XD7D 3GYMA 4WWYA 4ZHLU 3NWUA 2Q1JA 3RU4D 1ZMJA 2O8WA 2UWLA 1AB9B 2F4LA 1CE5A 1DS2E 4U32A 5C20A 5CHAC 3SGQE 1LO6A 2ZKSA 2G5NA 5EIYA 2FI5E 1GHAF 2FMJA 1UMAH 3ENSB 2H6MA 1MKXH 3BIUH 1AIXH 2BZ6H 1AWFH 1DITH 1G3BA 1NU9A 1ZTJA 1UVOA 3GY5A 1TGCA 4RKOB 1SQTA 1GMHG 2QXIA 5HKKD 1JRSA 2W7UA 3DSOA 1NO9H 5CE1A 2O8MA 3B8JA 5H4IB 3LOXA 3SZNA 4Z6AH 3QUMP 2OTVA 2BDYA 1O3FA 4JZ1A 2WPHS 1WQVH 1AO5A 2A7HA 1G3DA 2ZF0H 3GDSA 4NSYA 4IC5A 3PB1E 1GBBA 1Z8JB 4KP0A 2ZFQH 3H7TA 1BBRK 4AB9A 1P01A 1YGCH 2ZPRA 1GJAB 1INCA 3E0PB 1O2NA 2TRMA 3L33A 2G55A 4JYTA 1CQQA 1NZQH 3F68H 4XDEA 2OQ5A 4TPYA 3BTHE 1UVUH 5SGAE 1GPZA 3ZZ6A 1EATA 1TAWA 1EFRD 4RI0A 2J38A 1ZMLA 3LGYA 3BTKE 3KN2A 1O2KA 2F3CE 2ZDVH 3FZZA 1GMDG 1L2EA 2J98B 5B6OA 3ITIA 1EAUA 4I8JA 1P11E 1NRSH 1AMHA 5EJ1A 2DE8A 3T27A 3TGIE 4OGXA 1GJBB 1QZ8A 3IWMA 2JJ1D 1FV9A 1DY8A 1V2NT 2QV1A 2VIQA 5T6GA 3RU4E 5HIYA 1EPTC 2ZU5A 1VITG 5A09A 4E05H 2YMSB 4DY7B 2PTNA 2ZFTA 1BZXE 3DCLA 4MTBA 5TJXA 2WPMS 1O2HA 1DWCH 2ZHEH 2DE9A 1HBTH 2QF5A 1SLXB 4FUDA 3A7WA 4GVUA 5C2ZA 3V7TA 1Z8RA 2XBVA 1QJ7B 1HAZB 2UUYA 2RA3A 1YC0A 1GJ5H 2C90B 1T8NA 2GCTB 1WTHD 2ZU3A 3LC5A 3ZVFA 1EJAA 1W2KH 1UTQA 2BX3A 2R2MB 2VVCA 4YESB 5F03A 2PKAA 4CBNA 1THRH 4A7IB 2ZA5A 2Y81A 2Y5FA 3RMOH 3EA9A 4Q7YA 3O8DA 3ZZ5A 1VGCC 2CN0H 2V7QD 1Y5AT 2KCPA 1OHHD 1TGSZ 1O3LA 1F0TA 1DE7H 1P04A 2A4QA 3A8DA 3K6ZA 3SI3H 3VG8A 2AMQA 1VKYA 2A32A 4YOGA 4B2CA 1MKXK 1W0KD 1HJ9A 4X6NA 4ISHH 1RRKA 4ABHA 2ZECA 2H9HA 4I31A 1XKBC 1AD8H 2XBYA 4NIVA 2FYQA 4JK6A 3ZZBA 2AH4X 3MWIU 1OOKB 1TNHA 2C8WB 2HOBA 2VGCB 3E3TA 3JZ1B 1SHHB 4K8YA 2HPQH 1Y3XA 3MH4A 1FNIA 2ZHQH 1PPEE 1BRAA 3S9CA 2AS9A 1FONA 2F9UA 2KFWA 1XUJA 1CHOF 1G2MA 1W3CA 2O8LA 1UK4A 1QB9A 2BX4A 1DXPA 3OFND 5C5NA 1TRYA 1DPOA 3O8RA 1H8DH 3QDZB 2F91A 4X2WA 4JK5A 1O2MA 1QRWA 1TABE 5LH8A 3F9FA 3SUGA 2LNCA 3GISB 3MQKC 3TGJE 1GHBF 1LDTT 8ESTE 1ZHMA 3O8BA 4ISIH 4P02A 3QN7A 4XBDA 3A82A 1KXBA 1TRMA 1NY22 4LXBH 2AYWA 1CT2E 3WY8A 4CHAC 2HWLB 5DSFA 1CSOE 5JB8S 1ELFA 2BM2A 4NIXA 2VIDA 3RXMA 4X1QU 1LCYA 5E0GA 3LJOA 2XTTB 1XVMA 2BD5A 1FZZA 2QF4A 4FU9A 1IQEA 4YXWD 4ASUD 4TWWA 2W7SA 3MU4A 3W1EA 3TJVA 3AW0A 1NRQH 3SQEE 2A5KA 3KF2A 1SGEE 1QRZA 2J95A 1OWDA 2KAIA 2FS9A 4JMYA 4P00A 5F53A 1GWAA 3PLPA 2FOHA 3PO1B 4RT0A 4BTUB 1OWEA 1QIXB 1WXRA 3T25A 5C94A 2FZZA 1UTPA 3BEIB 5T3HA 2BY9X 3W94A 1ACBE 2AFQB 1G36A 1D3PB 1Y5UT 5T6FA 4AFSA 7ESTE 3QGNB 2BD3A 4OS1A 5ESBA 3UQVA 1JXPA 4X1RU 4ISNA 1K21H 1B0FA 1QQ4A 1TBRH 1QGFA 3M7TA 1V2JT 4JYUH 4Q80A 4X1SU 1P09A 1PPZA 1O0DH 1OWHA 5C1UA 1BUIA 2A5AA 5FHTA 4H4FA 4XBBA 1XUFA 1MMJN 4IC6A 4NA7A 1MU6B 1BMAA 1GBLA 2BD8A 4Y71A 1MZDA 1Z1IA 1C1OA 1L4ZA 3UWIA 1SLVB 2Y7ZA 3U28C 3W95A 1OWJA 3OX7U 1LQDB 3RXJA 1HJAC 1K1LA 4Y76A 1QA0A 1YYY1 1C1WH 1KXAA 3P8NA 1C2IA 1C5NH 4YO9A 2ZFSA 3OY5U 2BVRH 2NWNA 2ZO3H 4MLFB 1BT7A 1E34B 1HAYB 4FUBA 5L6NH 5GDSH 1LKAA 5PTPA 4Q7XA 5T1VA 3MH5A 1TMTH 2XNDD 1KLIH 2FOEA 2VJ1A 3CS0A 5HIZA 4LZ4B 5C0UA 1XUHA 5GWZA 1LHDH 1OP2A 1HIAB 3HK3B 3U9AH 1T31A 3FKSD 1P2NA 1DSUA 1FX0B 1RS0A 1TMUH 5A8ZA 3ATIA 3H7OA 4UFDH 1FPHH 1K1OA 1N8OC 1NFXA 4D7GA 1VR1H 1HAVB 5GCHF 1FJSA 1K2I1 4BAHB 2ZU1A 1ZPZA 2BQWB 5A8YA 5C67A 1OYTH 5HM9A 4KTUA 1WSSH 3A80A 1IQLA 2ANWA 1O2IA 2J5UA 1S0QA 2ZP0H 3GCHC 3LU9B 5FCKA 3OEED 3SYJA 1LVOA 4K2YA 1YKTA 4J2YB 1FPCH 1O3BA 2GGVB 1WDIA 1TALA 1SGCA 1TIOA 1CBWC 2C4FH 4X6PA 3V12A 2CHAC 3K2UA 3TITA 1SGQE 4NSVA 4RN6A 4AGJA 4MG3A 5EU8A 4NCYA 3DUXH 3FANA 4MNWA 3UTUH 3A7VA 1NRNH 1THPB 1PQ7A 2DUCA 5LPRA 3S0NA 3SGAE 1ZRBA 4OS5A 1IHSH 5HXFA 2UUKB 4X8UH 4B73A 1AU8A 3BSQA 1GCDA 4CH2B 4BNRA 1A3BH 3GCOA 2FI4E 1B5GH 4CREA 4INKA 2XOKD 4GCHG 2F9VA 4NFEA 2L74A 4RSPA 1BTUA 2Z3CA 3D62A 1ABIH 2A4OA 1ELDE 5F6MA 3E0NB 5C1XA 1K1PA 4AG2A 2W3KA 1O34A 2P16A 4KELA 1P3EA 4GAWA 2QIQA 2PGBB 1AUTC 4AYYB 5LGOA 2ZDKA 3LGTA 2I6SA 5EPYA 3MNSA 1W14U 2ZFRH 4U30A 7GCHG 1TNKA 3OAAD 1EPTB 1LVBA 2KM0A 1UTJA 2ANYA 4BAKB 1DVAH 2HLCA 2ZGHA 1O37A 1DM4B 2W6ID 4I33A 2BDIA 4B6EA 1Z6EA 1QB1A 1MD8A 1ZLRA 3PMJA 1TOCB 1LHGH 3A8AA 1COWD 1K1MA 3E16B 4KKDA 2F43B 5EXLA 3ZVCA 2WPIS 1BTYA 1TPOA 4THNH 3BTQE 1W13U 1HUTH 4HFPB 3TJOA 3VXEH 4A6LA 2ZI2H 5EQQA 5C5OA 3SGBE 1VZQH 6LPRA 1FY8E 1GCTB 1A2CH 1SGRE 3PRDA 3SNDA 4Y7AA 5EODA 1UCYE 1C4Y2 1T4VH 3TGKE 1YPLH 3OU0A 1TYNA 1HRTH 1TNJA 1BQYA 1AGJA 2GKVE 5HYOA 3T2NA 1AE8H 3LGVA 1VGCB 2EY4C 2D2DA 2ILNA 2VNTA 4E7NA 4O97A 1GHZA 1C5PA 3PMBB 3LC3A 6ESTA 1Y5BT 3SJKA 1S6HA 4BOHA 1C2HA 3QTOH 3TLOA 1JOUB 4GLYA 4CRBA 3PMAB 1P2IA 2HNTC 1K1JA 2AEIH 2ALPA 2AIQA 1X7AC 3MU5A 2PP6A 2NU4E 4FUJA 1GL1A 3CENA 1O3IA 1TX7A 2D8WA 1AN1E 1IAUA 1P2MA 1KSNA 2V3MA 3LKWA 1GBFA 2YOLA 5B6LA 1NBMD 4JZFH 1QBOA 1S5SA 1KLJH 4X6MA 3FP8E 1ELBA 4INLA 4O9VA 2ZWLH 3T5FH 2ZDLA 1S84A 3C1KA 5GPIB 4CRAA 2V6NA 2ASUB 3SORA 4CRFA 1O2JA 1BDAA 3H5CB 3LT3A 3MH6A 4U2WA 5BPEA 4Y8XA 4ZAEA 2OQUA 2V3HH 3F6UH 1C2LA 4DJZB 3GS9A 2G51A 3VPKA 3OSYA 2K8IA 1SC8U 3CS7A 3KYFA 4X8SH 4MNXA 2QF0A 2Z9IA 1Z7KA 3GCNA 3B9FH 2H2ZA 3P6ZB 3ATLA 4WXVA 3ZV9A 1K28D 2CXVA 3F1SB 4K69A 4K8BA 4MPVA 3SU3A 1UTLM 1JBUH 2J4IA 2BOKA 3RMMH 1K9OE 4MVNA 3BTFE 1AE5A 1XVOA 2PGQB 1KDQB 3MU1A 3ZZ8A 8GCHG 1BRUP 3SV6A 2FM2A 3RXAA 4Y8ZA 1TX8A 1NM6A 2HALA 4YLUA 4X1PU 3P95A 1L0ZA 2GCHG 2J34A 3ELAH 1S6LA 3LIWA 2PKSC 2AMDA 4NZLA 4ACBA 3S69A 4ABJA 1A5HA 1H8ED 1FY5A 5EW2H 1UHBB 1NBME 4WF8A 1BMLA 2GMTB 2JKHA 2VU8E 2ZQ1A 2ZU2A 2R2WU 3NCLA 4WMEA 1FN8A 1P2JA 3VB5A 1HAVA 2ZDAH 1SGPE 3SV8A 3VGCC 4FETA 1V2LT 1C2MA 3URDA 1C1PA 4D7FA 7LPRA 3F0PA 1V3XA 1BCUH 1HJAB 3VFEA 1SSXA 1MTSA 1XUIA 2WSSD 3RXSA 5A0AE 3BF6H 2D1JA 1WUNH 3SJ9A 3DSPA 1AFQC 4O03A 1EXFA 2WUBA 5E0JA 1O5DH 3SJIA 3PTBA 1QRXA 1LPZB 4AOQA 2W3IA 1NESE 4DT7B 1CO7E 1XUKA 4XOJA 3Q3KA 1SL3A 1FQ3A 3M7QA 3S9BA 3SHCH 1UJ1A 1YPJH 4GPGA 1Z71A 3PWCA 2FP7B 3QLPH 2WPKS 1C2EA 4FUHA 4IBLH 3STIA 1P9SA 4K1EA 1TE0A 1O38A 3KQEA 1AFEH 2HNTE
chains in the Genus database with same CATH topology
2ZQ2A 1RFNA 1HV7A 3QO6A 3K65B 1O5FH 1GI2A 4XBCA 1XXFA 1TB6H 2BDCA 1GI5A 4ABGA 4B71A 1GBEA 2BQ7B 3GY7A 4TPIZ 1CU1A 1AY6H 1DSTA 1UTNA 4OS4A 1C5ZB 2CHAB 4Y79A 5FBIA 2EI8A 2C8XB 1NU7B 3AAUA 4MNYA 5FXLA 1BTWA 1RIWC 1QJ1B 2M5TA 1OXGA 3LONA 4QT8C 3ZZCA 3E91A 3ZZ9A 4LZ1H 1P12E 4TY6A 9ESTA 2BLOA 2EEKA 4A5TS 3A85A 3M5NA 5LPFA 3EQ0H 4YTAA 2SGEE 2OLGA 2VIVA 3SNAA 3RXTA 1DT2A 3DHKH 5JB9S 3VB6A 1P2QA 4WMFA 3SNEA 1KXFA 3LH3A 2TGPZ 3BG4C 4NFFA 1UO6A 1AZZA 3UPEA 4X1NU 2Q6DA 2WPLS 3FAOA 4I8LA 2VWLA 1GGDC 5A8XA 5EPNA 4K5ZA 1H9LB 2FX6A 1A3EH 1EAIA 1GJCB 2GZ9A 2BTCE 2SGFE 2SGQE 4NGAH 1O2ZA 4E06H 4BAQB 3A89A 1ARCA 4AFQA 1DLKB 2AERH 3S7HB 3UNRA 4JCNA 3TH4H 3RXRA 3SV9A 2V0BA 3T62A 3D49H 3MHWU 3HGNA 4UE7H 5GIBA 3UQOA 2ZFFH 1GJ4H 2O8UA 3ZZ3A 2XC4A 3SU4A 1K1IA 1YPKH 2BQ6B 3C27B 5A0CA 5DP4A 2BY8X 1TONA 3M5MA 3GDVA 1PPFE 1U6QA 2Z3DA 1TPPA 4ZHAA 4UD9H 1A7SA 2ZHFH 3BTWE 1P10A 3E1XB 4CRGA 4B2AA 1N6YA 3KL6A 1V2MT 1BMMH 2NU1E 1JMOH 3QZQA 6GCHG 1QY6A 1O35A 1ANBA 1O5EH 3HATH 2TBSA 7KMEH 4BAMB 4ESTE 1FY1A 1DFPA 2UUJB 3FFGA 2ZDNA 2GV6A 2FLRH 4UDWH 4AYVB 1NFUA 1ZJKA 3QZRA 3RLYH 8GCHG 1ZHRA 1CA8B 2Z9JA 3RXFA 1ETSH 1V2UT 1WOFA 3G01A 2FIRH 1O3JA 1SLUB 4KTCA 3UNSA 3MO6A 3Q76A 1QTFA 2B8OH 1O2YA 1V2RT 5EW1H 1AKSB 2QCYA 5IYTA 1J9CH 3QX5H 3URCA 1O3CA 2OP9A 3MNBA 4XFQA 2BD9A 2PUXB 1ELTA 1ESAA 1A0HB 4CBOA 2JETB 3LPRA 1KLTA 2R3UA 1NT1A 3RXQA 1MBQA 1C9TA 1GL0E 1QBNA 2W5EA 4YT7H 1NPMA 2BDAA 1EZQA 3S9AA 2GCHF 3KQDA 1WBGB 1GHWH 3BTDE 5G4BA 4Y8YA 1EQ9A 1O2PA 1QQUA 1P57B 3SJOA 1KDQA 1O2RA 2ZCHP 1SI5H 4FVBA 2FX4A 2BD7A 1O33A 2FOFA 4D9QA 1MUEB 4Q7ZA 1OWKA 1HPGA 2Y7XA 1AZ8A 3V13A 4A1TA 3E90B 1QHRB 1GJ6A 1YCPM 3RUOA 1C1NA 2PHBA 3BG8A 1KTTB 3Q3YA 2GT7A 4A92A 2JH5D 2J9NA 1D9IA 4KGAA 1TGBA 3S7KB 1HAHH 1YCPH 1UHBA 2NU0E 1LVYA 1T8OA 3P17H 3A7YA 5FPTA 3EAJA 5AFZH 2C8ZB 1BRBE 1C2JA 2AIPA 4AZ2B 1BHXF 4XSKU 3ZVGA 2G4UA 1MAYA 1ZZZA 1TLDA 4HZHA 1RTLA 2ZTZA 1DOJA 1RD3B 3RC4A 3U69H 1Q2WA 1O3HA 1VJ9U 3EDXB 2VWNA 1DLEA 1TA6A 5K0HA 4F49A 5FPSA 1LHEH 2P95A 2YNAA 1PYTC 1SLWB 3P70B 3PLKA 1LPGB 1BTZA 1S82A 1Z8GA 3T29A 1AUJA 4JZEH 3GDUA 1V2TT 2UWPA 3MO9A 1MTNB 1DICA 1YM0A 1BTHH 3RXPA 2P3UB 1WV7H 1Z1JA 3FVFB 3M5OA 4GHTA 1TOMH 2WPJS 3ZVEA 1GMHF 1XM1A 3TU7H 3SUFA 1J16A 2P3FH 1SFQB 2R0KA 2AMPA 2GDEH 1EZUC 1O2VA 1RJXB 4I8KA 3RXCA 1UVSH 4LOYH 5L2YH 2C93B 1EAWA 1PPBH 3DFLA 4UEHH 3VGCB 1GI0A 4H6TA 2BD2A 1O3PB 1YBWA 3UR9A 1LKBA 4OS2A 1F7ZA 2H9EH 1BTXA 3EE0B 3ZZAA 3DT0H 5EQSA 3KNXA 4FUCA 3UWJH 1NRRH 4B75A 1ANEA 2TGAA 2B7DH 1FY4A 4AG1A 2B5TB 1T32A 1ZPBA 1KIGH 1TGTA 2BLVA 2BDBA 1W11U 1SR5C 1GBHA 2WV5A 3B23B 1IQJA 1O2SA 4BXSA 1A0LA 1GMDF 3IITA 5CHAB 1BJUA 5JDUB 4B74A 2G00A 1HNEE 4UFEH 1TRNA 3ZYDA 1GMCG 3A7TA 2WV4A 3MO3A 1CA0C 1MTVA 4X6OA 4ABDA 2B0FA 1QR3E 3RDZA 4KTSA 1PYTD 3A84A 3A7ZA 1GI4A 3UY9A 1VITF 1DUEA 1P05A 5J4SA 1GDNA 3QGJA 1EP6A 1UCYH 1GI9B 2G52A 1SGNE 2GTBA 2JH6D 1D4PB 3BTTE 4I8HA 1SGFG 3ODDA 1JWTA 2OC8A 1SQAA 2P59A 1EP5A 1C1SA 2RA0A 1H1BA 3TJUA 5FCRA 1SGIB 1W12U 1YCPK 5DP7A 1ESBA 1NFWA 2NU2E 1MBMA 2PSYA 1BA8B 1HJ8A 2AGEX 4CH8B 1O2UA 1RIWB 1ZTLA 2IJOB 3PROA 4CRDA 2Y82A 1KY9A 4K60A 5E8EH 1QB6A 1WQSA 1ANCA 5AF9H 3VB3A 3TIUA 3I77A 2A31A 2Y80A 1O5BB 5GJ4B 5DP3A 3F9HA 2F9PA 2BD4A 3RU4T 2QGRA 1GHAG 1KTSB 2BLWA 3Q77A 4SGAE 2OC0A 3I29A 1EJNA 1RGQA 4WVPE 3PLBA 3ZZ7A 5DO4H 1SGDE 3LGUA 2VVUA 1YPMH 3BTGE 5JBAS 4DIHH 1BJVA 1C4V2 3E8LA 1A1RA 1GGDB 1V2WT 1J8AA 1C2FA 3RXOA 2O9QA 4O3UA 2LPRA 1MQ5A 3MTYA 2Y6TA 1EOJA 2HVXA 4MPXA 1CT4E 1ETRH 3TK6A 1KXEA 3SJ8A 2BVSH 1TGNA 2ODQA 2GP9B 1GVLA 2PR3A 3D65E 3VEQB 1O31A 3NKKA 2IN2A 3SU1A 1W0ZU 1EB1H 4WH8A 1AVXA 1LTOA 4YM9A 5K7RA 1K22H 1UK2A 1ZRKA 1LVMA 1DX5M 1GI8B 2VH0A 1B7XB 2Z94A 1MAXA 1P06A 1PQAA 1TNIA 2GZ8A 1TMBH 1IQGA 1D3DB 1BHXB 1O2GH 1O2OA 5EG4A 3TNTA 2R3YA 4ZMAH 1V6DA 2ZCKP 5JBTA 2OBQA 5F8TA 5JPMH 3D23A 1C5TA 1UCYK 4NWLA 2QA9E 2ZNKH 5DP8A 4K3JA 5HM2A 1O3KA 1V2ST 5E0HA 1C1MA 1WTGH 3HK6B 1E36B 1TA2A 3SU6A 2BY5X 1C5WB 1UTOA 1UK3A 4NA8A 2SGAA 1C5XB 4X2YA 2ALVA 5CMXH 1NN6A 1F0SA 2PWXA 2XW9A 1C2GA 3Q3XA 1GG6C 2Z3EA 1GBKA 1HYLA 2OC1A 2F9OA 3A8CA 3SI4H 3V3MA 4UFFH 2D26C 3RXBA 4FUIA 2P3TB 4XE4A 4YT6H 1DY9A 5ESTE 1TNGA 1YPGH 1LHFH 1T4UH 1Z8IB 2K1QA 3MNXA 4CHAB 1C1VH 1T8MA 2VINA 2EI6A 1NFYA 4IMQA 1IOEA 1O2QA 3SU2A 3BTEE 4DIIH 4DOQA 1ANDA 1OPHB 5FX5A 4FU8A 3A8BA 2VIPA 1SB1H 1ZR0A 1SVPA 3TK5A 3NXPA 5DP5A 5JBBS 3PO1C 4HI3A 3VB7A 2SNVA 4FVDA 1A5GH 3P8OA 1OS8A 1GJ7B 4RKJB 2ZTYA 1Z6JH 1O3NA 1Y3UA 1CT0E 2FI3E 1AVGH 3TH3H 3M37A 2F83A 1MD7A 1CHOG 2YNBA 2OINA 2G5VA 2R0LA 1V2VT 3RMLH 1ZOMA 2FPZA 1SQOA 2BLQA 4ZHMU 1ESTA 1ELEE 2CV3A 1C5VA 1ZGVA 1O3MA 1HIAA 2FODA 4A1VA 5FAHA 1MH0A 5DKMA 2HNTF 1GBAA 1TFXA 4WJG2 2XBXA 2FDAA 1XMNB 1GMCF 4ZH8A 3GICB 4OS7A 3KQBA 2STAE 1ZSKA 1ZYOA 1L4DA 2KAIB 2XXLA 5F8XA 1C2DA 3BIVH 4I7YH 2Q6FA 1AVWA 3EA7A 3HKJB 8KME2 3UUZA 3STJA 3M3SA 1HAXB 4NA9H 3LJJA 4AN7A 4ZXXH 2A4RA 4D76A 1PPGE 2HPPH 4FU7A 1F5RA 2WUCA 1O2XA 4X2VA 1THSH 2P93A 3SNBA 1O30A 1IQHA 1EX3A 2QAAA 1OSSA 2ANMH 1OWIA 3MYWA 2TGDA 5FX6A 2Z6BD 3SUDA 1G30B 2IPHA 3MMGA 4GCHF 4Y10E 1UVPA 1BITA 3UOUA 1EJMA 1GJ8B 2XNIA 3QWCH 3T26A 3KQCA 1P2OA 4ZROA 1N8OB 2A5IA 2ULLA 2CF9H 3RXDA 5A2MH 5HGGA 3TJNA 1P02A 1O2TA 3ATMA 3GCHB 4WY3A 1ZPCA 1QJ6B 1PQ8A 1GBDA 5AHGH 3ATWA 5C1YA 1S83A 2RCEA 1CA0B 4SGBE 4YLQH 1W10U 2TGTA 2EI7A 3MNCA 1BBRE 1HXFH 7GCHF 1Y59T 1CBWB 3LDXH 3GY6A 3UOPA 3A83A 2EA3A 2W26A 4K1SA 5HMAA 2QC2A 5DK1A 3SW2B 2FOBA 1VCQA 3TH2H 4AFZA 1J15A 4NIYA 5DGJA 1GI7B 5LPEA 4BTIB 1XKAC 2A7CA 3RXGA 5BRRE 4BANB 3GCTG 1ZSJA 2BY7X 1EPTA 1L1GA 3GY4A 2AGGX 2VWOA 2ZPSA 5E2PA 1P9UA 2O8TA 3UNQA 1ELGA 3A88A 3RXIA 3K6YA 2V35A 1C4U2 1BIOA 5GCHG 1FUJA 1FMGA 2GX4A 3QTVH 1O2LA 1GDUA 4MNVA 2VH6A 1YF4A 2FYRA 3IG6B 4NG9H 1EUFA 1HLTH 3SOSA 3JZ2B 3MH7A 1H9HE 3P8GA 1DWBH 1MU8B 1N1LA 4DG4A 3TNSA 1ZHPA 1HAOH 1O2WA 2HRVA 2STBE 1WU1A 4BTTB 1EB2A 1O3DA 1MCTA 1PQ5A 2TPIZ 2FESH 3U98H 3UIRA 4NZQA 2Q6GA 4IMZA 1EZSC 1P0SH 2C8YB 2H5DA 2ESTE 1BRCE 5AFYH 3OYPA 1O5AB 3M7UA 3PMHB 5F8ZA 4I8GA 3QK1A 5DPAA 4X8VH 3BEUA 2PUQH 1CVWH 1ZJDA 3LGIA 2XWAA 2GDDA 1QNJA 1Y8TA 4VGCC 1GCTC 3M3VA 3SU0A 1O3AA 4AFUA 2BVXH 1S6FA 2PSXA 4DGJA 4I32A 1T7CA 4AGKA 1NC6A 1ELCA 1C1QA 4IS5A 4GUXA 1G9IE 2XC0A 1MZAA 1QA7A 4JYVH 4BAOB 3M5LA 1EOLA 4Y6DA 1QL8A 2JH0D 3TPIZ 1G3EA 1D6RA 3AAVA 2SFAA 1O36A 4JZIA 2BDGA 3NPSA 2XBWA 4X0WU 5C3NA 1MCVA 3NZIA 2BHGA 2OXSA 4E7RG 2CJIA 3RXUA 1NS3A 1EZXC 1FI8A 1H8IH 6CHAC 3VB4A 3Q00A 3R3GB 2P8OC 4O3TA 1AHTH 1F0RA 1SBWA 3RMNH 1C5LH 2CMYA 1YPEH 4ABEA 1QL9A 9LPRA 2ZEBA 1FXYA 5TCCA 1YLDA 3GY2A 1OP8A 3RP2A 1GBIA 4U01A 5L2ZH 1GG6B 2G8TA 1W8BH 1O5CB 2PV9B 2ZU4A 3RC5A 1PJPA 4AB8A 5E2OA 1GBCA 4CRCA 4AORA 3HKIB 1Q31A 3RXLA 4M7GA 1C2KA 3LH1A 3UR6A 2WYJA 4ABBA 3RC6A 3ZVDA 1SFIA 2ZZUH 1RTFB 2WINI 1L1JA 2VIOA 1N6XA 1SOTA 3SHAH 2XYAA 5I25A 2BDHA 2A4GA 2UUFB 1IQKA 3ODFA 2FWWA 4OGYA 5FPYA 3A81A 1FN6A 4FUGA 1O3OA 1TPSA 4ZXYH 2ODYB 2G81E 2J94A 1CHGA 2Z7FE 1MTUA 1QURH 2QN5T 1WAYB 3L3TA 2AGIX 1F92A 1ZMNA 1DWDH 1LPKB 1P3CA 1FIZA 3BV9B 5IDKA 2J2UA 5J4QA 2PKSB 1IQIA 4WH6A 1E38B 2GMTC 1EKBB 2H5CA 4J1YA 1IQFA 1FAKH 1LQEA 3V0XA 4X8TH 1FLEE 1E0FD 3MI4A 3PV4A 1GBTA 2FLBH 3VXFH 2FEQH 4WMDA 2ZTXA 3DA9B 4ABIA 1F2SE 4K1TA 3U8OH 1BMNH 1EASA 3M61U 4Z0KA 1VITH 3F9GA 4INHA 1HXEH 3ZZDA 1MQ6A 2GVFA 3E6PH 1D3TB 5T6DA 3U1JB 1HAGE 1PFXC 1A61H 2QYIA 4FUEA 1NROH 1AFQB 4UONA 2GD4B 5DJ7A 1Y3WA 1AB9C 2SGPE 3GCTF 3GYLB 3EYDA 2Y5GA 1F5LA 3UFAA 1ELAA 4H6SB 2XWBI 1G3CA 2CGAA 2A1DB 1ZGIA 4FXGH 3PTNA 2BB4A 2GT8A 1G2LA 3TVJB 1FDPA 2A0QB 3EA8A 1S81A 1P2KA 1A46H 4NWKA 3SV7A 1TQ7B 3U1IB 2XCFA 3BEFB 2FOCA 3OY6U 1D3QB 1DUAA 1ELVA 3CP7A 1B0EA 1HFDA 5JBCS 2V3OH 5A0BA 3EGKH 1O3GA 3SNCA 3L6PA 4TY7A 1TPAE 4DURA 1SG8B 1GI3A 1IQNA 1BB0B 2QXHA 4A1XA 2RDLA 1C5OH 3SV2H 2FTLE 2PW8H 3M36A 1YPHC 1IHTH 2XC5A 2C3SA 1KYNA 2BXUH 1UTMA 4ZUHA 3ATKA 1ARBA 2BMGB 2F9NA 1MTWA 1LHCH 2THFB 3DFJA 2VIWA 3U8RH 1V2OT 4ABAA 2XCNA 3A7XA 5I46H 1GHYH