3IG6B

Low molecular weigth human urokinase type plasminogen activator 2-[6-(3'-aminomethyl-biphenyl-3-yloxy)-4-(3-dimethylamino-pyrrolidin-1-yl)-3,5-difluoro-pyridin-2-yloxy]-4-dimethylamino-benzoic acid complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of orally bioavailable, non-amidine inhibitors of Urokinase Plasminogen Activator (uPA)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 52
structure length 245
sequence length 245
chains with identical sequence D
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ig6B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ig6B01
1INCA 2BD8A 3W94A 2ZU4A 4ABFA 4X1RU 1CBWB 1IQFA 1O30A 1PPHE 1K1PA 1GHYH 3SO3A 1AE8H 3BG4C 3LIWA 1HLTH 1JIMA 2FP7B 3TH4H 1O3GA 2FOFA 3A89A 1V2VT 4K1TA 1D3QB 3DFLA 2GMTC 5AHGH 3Q3XA 4I8HA 2G4UA 1BMLA 3NPSA 2AYWA 1CGHA 2J2UA 1DUAA 1GHAG 1TONA 4Y7BA 3IG6B 1Z1JA 2ZA5A 1O0DH 3A82A 1P05A 2HWLB 4A1VA 2EI6A 2J94A 3TNTA 2J34A 2G00A 4CRFA 2BYAX 5EGMA 2EA3A 1HIAB 2NU3E 1H1BA 3TLOA 4YESB 3JZ2B 1SLWB 3LU9B 1P09A 2F83A 1T4UH 3BEUA 4O03A 1RTKA 1IQGA 2Z9IA 1B5GH 1OWKA 2IPHA 3ITIA 2A32A 1GVKB 2VVCA 2ZO3H 3BTEE 1HXFH 1UCYE 1EJAA 4ZUHA 1XXFA 1MZDA 3EA9A 1ZMJA 4TWYA 3RXMA 3LPRA 1SFQB 1P03A 1DDJA 2ZF0H 2ZI2H 4OS2A 4AGKA 1UJ1A 1O2QA 2BX4A 1ZTLA 3BN9A 2XYAA 1O5DH 2GT8A 3D65E 4DJZB 3LGYA 4ISIH 2B5TB 1A4WH 1W2KH 5T6FA 2ZTYA 2BM2A 2P95A 4JZFH 1O2KA 1LKAA 3UIRA 4B2BA 2DE8A 2ZHEH 4U30A 6ESTA 2OC8A 6GCHF 3KIDU 2HVXA 1GJ7B 4Y8ZA 3A8CA 3GCTG 1SSXA 2GDEH 1C2JA 1OWDA 1MKXK 5CMXH 4GVUA 1C1RA 4MDSA 3RXOA 1AE5A 3LGIA 2TPIZ 2KAIB 3NZIA 1E35B 2AH4X 1HAXB 3M3SA 1O3MA 1KY9A 1O3IA 2UUFB 2A4QA 1RS0A 3TJOA 1A5GH 1VZQH 1UTKA 1FY4A 1OWHA 1LQDB 3SU0A 3ZVEA 1HAOH 1OPHB 3I29A 1CGIE 1GG6C 1GCTB 2R2WU 4OS6A 2BY8X 1QBOA 5L30H 1EOLA 1ZTKA 2SGFE 1QB9A 4GLYA 4NSYA 2HNTE 1OSSA 4FU9A 3RXPA 1SOZA 3TPIZ 3UOPA 1ANDA 1MMJN 1K1MA 3ATLA 1Q3XA 4FVDA 4GCHF 1FDPA 1XUIA 5AFZH 5C5NA 1NFWA 3E16B 5EPYA 2Z9KA 4X1NU 3DFJA 4ASHA 3E3TA 1JRTA 1OXGA 1Y3UA 3UNRA 1K21H 3SQEE 4I33A 1S5SA 3SU6A 5IDKA 4JZIA 1V2LT 1ZMLA 1GBJA 2FX4A 3ESTA 1UCYH 1MAXA 4ZXYH 3U8TH 1ANCA 1GL1A 2GCTB 4WWYA 5L2ZH 1A61H 3M36A 1LVMA 2G5NA 1GI9B 3BTKE 1F5RA 1LDTT 3C27B 5DKMA 1TGBA 1HAYB 2FYRA 3BTME 1V2WT 1KXBA 1O3JA 3F9EA 3BV9B 3BTGE 2F9VA 2BY9X 1IQLA 4KP0A 3PTBA 5J4SA 3O8DA 2K1QA 4H4FA 1HUTH 3AAVA 1QL7A 2PGQB 1P11E 3ZYEA 1CE5A 1AWHB 3LJOA 1N1LA 3SUFA 2BLQA 1ZOMA 1JMOH 1QIXB 4I31A 3ZZCA 1EZSC 4GPGA 1UTOA 1KLTA 1SGIB 3TITA 1YPHE 2PKSB 2SGQE 2PLXA 4KELA 4H6SB 4ABJA 1HJ8A 1TGCA 1QHRB 2QC2A 4AZ2B 1V3XA 1RTLA 1V2TT 3F68H 5HXFA 2ZGJA 2ZPSA 1GJ5H 2BDHA 1XX9A 5SGAE 5EODA 1FXYA 1TMBH 4K5ZA 1N6XA 3ENSB 1GMDF 1T8OA 4DT7B 4O3TA 5I25A 1X7AC 2ZU3A 5LPRA 2GZ9A 1PQ8A 3PWCA 1S6FA 1AZZA 2STAE 2WV4A 1SLVB 4F49A 2Z9GA 2O8LA 1SLUB 3M5OA 4X8SH 5GIBA 2OLGA 3I77A 1O2XA 3CP7A 2GV6A 3STIA 3ZZ3A 1C5OH 4OS1A 2GT7A 1O5CB 1SFIA 1O2RA 1NRPH 3K6YA 3E1XB 2OXSA 5A2MH 1V2OT 2P94A 3MNXA 4KTUA 1XXDA 1TGSZ 2A2XH 1TA2A 1V2JT 1HNEE 1A1RA 1O37A 3K65B 2BD5A 1EASA 2B8OH 1NRQH 2RA0A 1EPTA 2CV3A 3UPEA 1EP6A 2ZTZA 3RLYH 3RXDA 3GY2A 3LC5A 4Q80A 1FLEE 4AOQA 4NIYA 1JRSA 1JOUB 3RXIA 1ZHRA 3H5CB 2Z3DA 3MMGA 4E7RG 1ZPBA 1GCTC 5F8XA 4X1QU 1AY6H 1GI4A 1BDAA 4KTCA 3GOVB 2W5EA 4FU7A 1YF4A 1QB6A 1DFPA 1KDQB 4Y6DA 1K1JA 3VB5A 3ZZ7A 1GJDB 1OP0A 1UTNA 1NFUA 1NS3A 1HAZB 1B0EA 1Z6JH 1K28D 4CREA 1QJ6B 2PWXA 1JXPA 1QJ1B 1GMDG 3QZQA 1TGNA 3P8OA 3RDZA 3TGKE 3ELAH 3PV4A 1BQYA 3TK9A 1EB2A 1ELAA 3SNEA 4MPWA 3RC6A 2F9PA 1FUJA 2CN0H 3ZYDA 8KME2 1C2MA 4H6TA 2Y5HA 1Z8JB 2G51A 2FOGA 3MNBA 3M7UA 1GHXH 3SNCA 2FYQA 2LNCA 4KKDA 5TCCA 2DE9A 1D3PB 1VCWA 2WPHS 2F3CE 2ZHWH 4OS5A 2AIQA 3GCHC 2BQWB 1IQIA 4MQAA 4RSPA 3MH7A 4IW4E 4CH2B 1NESE 1PYTD 1N6YA 3F1SB 2GCTC 1UK2A 5JYIA 2ZGHA 3MH6A 1ANBA 1UCYK 5ESTE 1RD3B 2WPMS 2G5VA 3SGAE 3M37A 5A0CA 1E37B 4WXVA 1THSH 2Y80A 1SPJA 3SJ9A 3ZZ8A 1HAHH 3UFAA 3ODFA 2Z94A 1XKAC 3DT0H 2QXGA 2TBSA 2QA9E 4YT6H 2VIDA 1ZSLA 1ABIH 3RC4A 2J92A 2BB4A 2XBXA 1FJSA 4FUGA 2CMYA 1KTTB 4AYYB 3SHAH 1NFYA 2VB0A 1SC8U 4WMEA 1A0JA 1K1LA 3SHCH 5L6NH 1H9HE 3SI3H 4HFPB 2ZCKP 2PKSC 3O8RA 1ZHPA 2SGAA 5J4QA 1BHXB 2QXIA 1CO7E 1JIRA 4X8TH 4E06H 1UTLM 5E2OA 1A0LA 1O5AB 4XDEA 4NFEA 1T4VH 1RIWC 4I8GA 1FMGA 1PJPA 1CT2E 1KSNA 1MKWH 2AGGX 3A8DA 4X0WU 4YOIA 2GMTB 2W3IA 3KQBA 4OGYA 2GDDA 1SGFG 2PFEA 1P2NA 2BY5X 1QFKH 3LC3A 1TPAE 7LPRA 2NU1E 1TYNA 1BRAA 2G55A 1O3DA 4ZKOU 1ZGIA 2ZU5A 4NIXA 5E0GA 1C2IA 3ZZDA 1ETTH 2Z9LA 1LKBA 3EYDA 3KGPA 2A4OA 1KIGH 3V13A 3LGVA 2A4RA 5A0AE 3U1JB 3SBKA 2GX4A 1UTPA 2FTLE 4NIWA 3VGCC 3QTOH 1MD8A 1AN1E 2QY0B 1VITF 4IMZA 4WF8A 1S83A 2VJ1A 1LPKB 1C2HA 1GMHG 4HZHA 1WCZA 3QTVH 2ILNA 2VGCB 1V2PT 5HGGA 1SG8B 2CF8H 1FIZA 2QF0A 1LHEH 2FOMB 2TIOA 1XUKA 2FEQH 4HI3A 2WPLS 5A8YA 1NT1A 2ZP0H 2G8TA 3PLKA 1O2PA 3BTDE 4I7YH 1YYY1 2BVSH 2Y82A 4MTBA 2SGPE 1YPEH 1S81A 5JBCS 8ESTE 1QY6A 2H9HA 1OWJA 3P95A 4U32A 1O2UA 1XVOA 1HXEH 1K1NA 1MBQA 1C2DA 1VJ9U 3RXCA 3MHWU 3T26A 1MTVA 3A84A 1SGPE 1GHBF 2XC5A 3ATKA 5F03A 1XVMA 4B2AA 1ZZZA 4UFEH 5HM2A 2OD3B 5FCKA 4B73A 4Y7AA 4PROA 1RGQA 1DE7H 3PB1E 1EQ9A 3TVJB 1EPTB 1UK4A 1OWIA 4NA7A 3OYPA 3N7OA 4X8UH 2UUJB 4KTSA 1GBMA 1OYTH 1GBAA 2BOHB 1TNIA 5EG4A 1Y3YA 3LT3A 4F4OC 1Z8IB 1KDQA 1G37A 3DD2H 1BRBE 1C4Y2 1C5XB 3FP6E 4AFQA 3A7XA 4NG9H 4ZHLU 5JDUB 2FOEA 4WVPE 3I78A 4NZLA 3T5FH 1GI0A 3SV7A 4ZH8A 1EAWA 4DW2U 5EQSA 2BD9A 1LQEA 2BVXH 2BQ6B 3HKIB 4YOGA 3ATMA 1F92A 4H42U 1KXFA 1O3NA 1AB9B 3P8FA 2QAAA 2AEIH 2FOCA 3UR9A 4B71A 1GDQA 2PW8H 1S6HA 5DP9A 2ZDNA 5DJ7A 5DP5A 1HAIH 1E0FD 1XKBC 1DT2A 1H9LB 3ZV9A 4Q2KA 1A46H 2BDBA 2BQ7B 1DM4B 1NO9H 3MO3A 1ETRH 4ISLA 1L4ZA 3ATIA 1PYTC 2TGPZ 3SOSA 2F91A 5HMAA 1THPB 3VXEH 6GCHG 1BMMH 3SGQE 5JPMH 4Y11E 1UTQA 5F8TA 3MI4A 3M5MA 3QX5H 4U01A 1T31A 3QGNB 2VGCC 4X2XA 1EP5A 1GHVH 1G3CA 3MTYA 1TA6A 3LJJA 3L33A 1CA0B 1F0UA 1T8NA 1QCPA 4X6MA 1FONA 1BRUP 3E6PH 3LH3A 3A7YA 2QIQA 2VIQA 1FAXA 4Y10E 2FLRH 1EAXA 3NUMA 1NPMA 1XUFA 4BTIB 1EZXC 1NZQH 1ACBE 1L0ZA 1TPPA 2C8XB 1AD8H 2AGEX 2ZPQA 1DXWA 4X1SU 1DANH 1D9IA 2Z6BD 3GDUA 3UWJH 2VH0A 3PMBB 1VGCC 1LPZB 1P02A 4FUHA 1V2ST 1V2QT 1WQSA 2XWAA 4YO9A 3LONA 3NCLA 2A2QH 1WU1A 1OKXA 3SV8A 3TJVA 3SN8A 3UQVA 1P3CA 1Z1IA 2J4IA 3SU2A 1W0YH 2ZECA 4ZXXH 1P9UA 5EQQA 4MG3A 2AMPA 1O2OA 3QK1A 4UD9H 2BD4A 4BAKB 4K1EA 3RMNH 1TNKA 1C1OA 4CHAC 1SGCA 2QCYA 3ZZ4A 4GHTA 2STBE 2XXLA 2QF3A 5A0BA 1G2MA 1C5ZB 1OWEA 5FX5A 3GY3A 3DHKH 1K1IA 1KXEA 2R0LA 4K8YA 1OP8A 5GDSH 2Q6GA 2ZIQH 2JH5D 1MU6B 1K2I1 4ABGA 1BJUA 2BDAA 3DUXH 2FZZA 1ZSKA 4DURA 4NA9H 1KXCA 4Z6AH 1HDTH 3H7OA 5C1UA 4JYVH 4ZKSU 1VCPA 4ISNA 5EXNA 4D8NA 2H2ZA 2ZHDA 3ZV8A 3E90B 1C5PA 1DWBH 1MBMA 1YCPK 1BTYA 1GVZA 1ELEE 3MOCA 5DP3A 4INHA 4ABDA 2C90B 4ESTE 5HM9A 1BTPA 4UEHH 1Q31A 1KXDA 1TIOA 3CS0A 4AG2A 3GY7A 1NRRH 4BANB 1S85A 4GAWA 1P04A 2YNAA 1GI7B 1GI1A 2W7UA 1H8DH 6LPRA 2QXHA 4FUFA 1C9TA 1ZSJA 4AFUA 1O5FH 5LH8A 4Y79A 1FY5A 1QURH 3SJOA 2NU2E 1WUNH 5GJ4B 3M3VA 5AVDA 4ABIA 2G4TA 3RMMH 1MAYA 1QL9A 4MNVA 1Y5BT 1F7ZA 1ID5H 1NFXA 3V3MA 2VIOA 4XFQA 2BX3A 1C1WH 2YNBA 1LCYA 4DGJA 1SQOA 1MTNB 2UWOA 3EDXB 3EAJA 2P3UB 4FUJA 3VB3A 1W11U 4IGDA 3SJKA 2ODQA 4YLQH 2O8WA 3GY4A 2BDCA 2WPKS 2PSXA 4Y8XA 3BEIB 1IQEA 1RTFB 4BAHB 4IS5A 4AB9A 2XCNA 1JBUH 5DK1A 3H7TA 1HJ9A 5LPFA 1PQAA 1AKSA 2VIPA 1O2GH 1BIOA 3EGKH 1YPHC 3RM2H 2ZEBA 2FODA 1YGCH 3BG8A 1BCUH 4FUBA 4X1PU 5B6OA 1T32A 1LMWB 1XUHA 5JB8S 5AF9H 4A92A 4WXIA 1O2NA 3SORA 1G2LA 2F9UA 2C3SA 1EXFA 1ZLRA 1A0HB 2VU8E 4RKOB 4D76A 1GI3A 3RU4E 5DP6A 2BZ6H 3BTQE 3ZZ6A 3SU5A 5DP8A 3AVZA 5EU8A 1C1TA 1AGJA 2ZGXH 2GVFA 8GCHF 2GZ8A 5TCAA 3QZRA 1BMAA 1TAWA 3GISB 4XBBA 1WBGB 3S7HB 2JH0D 3UNSA 1C5VA 1IHSH 3T29A 4THNH 1BTXA 1YPLH 2JKHA 2OBQA 2C8WB 2OQUA 3RXJA 1W0ZU 4DG4A 1MKWK 4D9QA 5F8ZA 1AMHA 1C5LH 3M5NA 5CE1A 1AIXH 1O2VA 2FM2A 4D7GA 5DP7A 4DIIH 3BTFE 5FBIA 3SUEA 1LPGB 2ALPA 2EI8A 1LHDH 5E0HA 1MZAA 5LGOA 1C1UH 1GJAB 2ZTXA 1XMNB 4Q7ZA 4MNYA 5E8EH 1CSOE 1W10U 1XM1A 2Q6DA 4IBLH 1GJ8B 4CHAB 1O2WA 3EA8A 3KN2A 1O3CA 2XTTB 3PLBA 7GCHG 1C1MA 3SV2H 3RU4T 1UO6A 2A45B 3KQEA 1YPMH 4RN6A 3UUZA 9LPRA 9ESTA 3RXUA 5I46H 3RXLA 5IYTA 2OTVA 2ODPA 4JK6A 3FP8E 1TBRH 2BD3A 3BTWE 1TX6A 1C5QA 1BBRK 2SGDE 4NCYA 2VINA 1OX1A 1GBDA 4CRBA 1YCPM 1Y5AT 4D7FA 4BXSA 3ZVGA 2CGAA 1C2FA 2YOLA 3CS7A 3Q76A 4GSOA 1C2KA 3NKKA 2R0KA 1CU1A 3GY8A 1QA0A 3UWIA 2VWOA 2GV7A 4SGAE 3A80A 2ZDLA 3R0FA 4GHQA 5E2PA 1TABE 4YTAA 2F9OA 2GP9B 1O2LA 4AN7A 5EW1H 3KQCA 2QN5T 3QO6A 2P8OB 4YZUA 4BOHA 2JETB 3A7TA 3M7TA 4HGCA 1YC0A 2ZFPH 1HFDA 1C5SA 3RXHA 1LHCH 1QA7A 4YM9A 3S7KB 2NU4E 1YPJH 1GI2A 4Y71A 2J9NA 2FS8A 2ZGBH 4X2VA 4BAOB 4WH6A 4O3UA 5EXLA 1QQUA 1LTOA 2PHBA 1E38B 3PMHB 5ESBA 2BOKA 3BIVH 3FZZA 2ZGCA 1BJVA 2Q6FA 3LGUA 2FESH 1SI5H 2OUAA 1GGDB 2CHAC 5C67A 4MNXA 4YLUA 4NWKA 1A5HA 1N8OC 1L1JA 1TX8A 1ESBA 1F5LA 1GJ9B 3QWCH 2QXJA 3MU4A 2ANKH 1THRH 4UFDH 4I8KA 3ZZ9A 1GBHA 2LPRA 1AVXA 1YLDA 1AU8A 2A5KA 3SZNA 3V0XA 4ABHA 1V6DA 1NROH 5JB9S 1GDUA 3TH3H 2BXUH 3PO1C 3OY5U 1K22H 3F9HA 7ESTE 1O31A 3SNDA 1G3DA 2FX6A 4IN1A 3RXRA 1GBIA 1EB1H 1UVPA 2H9TH 4B1TA 1SGYE 5GWZA 4WY3A 1GBBA 1BTHH 3A8BA 1NC6A 2P93A 4CRCA 1D6RA 3TIUA 1SQAA 2ZC9H 1ZRKA 1YP9A 2SFAA 1IQNA 1BTWA 2Y6TA 1AFQB 4IN2A 1ARCA 2V3HH 3U8RH 3TGJE 1A5IA 3IITA 1HAGE 5FPYA 1DWCH 1FQ3A 3SV6A 2FPZA 3HKJB 3PLPA 1AKSB 1C5TA 1BT7A 1ZPCA 3VB7A 1YCPH 2D26C 2GTBA 5C20A 1ESTA 1GJ6A 4Y76A 1AI8H 3RXGA 2ZFTA 1DITH 1XUGA 1K9OE 3KQDA 6CHAC 4ZAEA 4ZMAH 4AFZA 2GZ7A 3GY5A 4R0IA 1O39A 2WUBA 1EAIA 3QGJA 1ARBA 1Y3VA 1SQTA 2AMDA 3PTNA 1O38A 1A3EH 1F2SE 2EEKA 5K0HA 4K1SA 2HPPH 1O3LA 4CR5A 2RCEA 2XBWA 1TBQH 2BD7A 1QNJA 2UUKB 4FUDA 5JBBS 1MKXH 1SHHB 1EKBB 4LOYH 2VWMA 1IQMA 4NSVA 4MNWA 4ZKNU 4AGJA 1DS2E 4MPUA 4CBOA 4CRDA 3TJNA 4CH8B 3SNBA 1UTMA 2GCHF 1HPGA 1VITH 3M5LA 3A85A 3BIUH 1ZYOA 2TGDA 2R2MB 2BZAA 2XC4A 3UTUH 1BTUA 2W3KA 1FI8A 2P3TB 3T2NA 3AAUA 4WMDA 1J16A 4UFGH 1SLXB 4VGCC 1HAVA 1HGTH 1SVPA 5C2ZA 4BAMB 2ZHQH 2FS9A 4A5TS 1EAUA 1D3TB 2IN2A 3ZVFA 4O9VA 4NFFA 2XNIA 3A7ZA 3V12A 2C8ZB 3KHVA 2Y7XA 3STJA 5K7RA 1O3HA 1P0SH 3RMLH 3ZVAA 3FVFB 3PMJA 4NGAH 1EUFA 1PPBH 1CQQA 4NIVA 3A87A 1MQ5A 5EW2H 1YM0A 1EOJA 1KLIH 1TGTA 1Y5UT 1P2IA 3HGPA 2JETC 1GG6B 2XBVA 3AASA 1AQ7A 2DUCA 3MU1A 3MH4A 1EJNA 1FN6A 5G4BA 1P2JA 1ZTJA 1AO5A 3D62A 1C1QA 2PKAA 1W7GH 3MU5A 3M3TA 5A8XA 3B23B 1MU8B 2FOHA 1DY8A 3KF2A 1TRYA 1HYLA 5GCHF 1ELBA 2HOBA 3NXPA 3B8JA 3MH5A 1SR5C 4ZHMU 5C3NA 3A7VA 2BLVA 4A7IB 3QDZB 1W3CA 2UWPA 2ZFRH 1F0RA 1GHZA 1GBEA 4JZEH 3RM0H 3A81A 1NRSH 2Y81A 1GVLA 1TOCB 3RXVA 1C5UA 5FX6A 1P9SA 3E91A 3EE0B 1P01A 1GI5A 1P3EA 1JWTA 2XCFA 3DA9B 1TX7A 2Z9JA 1UVOA 3LH1A 5T3HA 4FVBA 4A1TA 4J1YA 4BTUB 2D2DA 2D1JA 3U69H 2H6MA 1E34B 3R3GB 2SNWA 3ODDA 1Z8GA 2ZDMA 1TNHA 3FFGA 5EOKA 5ETXA 3RLWH 2VIVA 1O3BA 4CR9A 3GDVA 1GMHF 3A8AA 1ZHMA 3W95A 3B9FH 2EI7A 3O8CA 1WQVH 2FOAA 1Y59T 4XOJA 1Y8TA 5GXPA 4K60A 1D4PB 2ULLA 1EZQA 2A7CA 2I6SA 1K1OA 1IQKA 1FV9A 3TH2H 1S84A 1ESAA 1HB0B 4ABEA 1MUEB 3VGCB 3V7TA 4E7NA 1FAKH 5FHTA 2P3FH 5C1YA 1O2YA 5DG6A 1SMFE 1UMAH 1NU9A 5GCHG 1AB9C 2QGRA 1O5BB 1GI8B 1BBRE 3U98H 1DOJA 2ZCHP 3F9FA 1FZZA 5BPEA 1J15A 2J38A 5TJXA 4XBDA 1J14A 1O5EH 1VJAU 2B9LA 4AFSA 4DOQA 3AW1A 3RXKA 1CGJE 2FLBH 3P8GA 2BXTH 1DWEH 1WAYB 3E0PB 3PWBA 2BHGA 3SU4A 1CA0C 1GBTA 3P92A 1C5RA 1UK3A 3K2UA 3MFJA 2P59A 4ISOA 3KNXA 3LGTA 2GCHG 1DICA 1ELDE 2PTNA 5A8ZA 4JZ1A 1C5WB 2WPIS 4TPYA 1SB1H 3S9CA 4D9RA 1C1PA 4JK5A 2OINA 1TMTH 1YPGH 4NZQA 2A5IA 1EPTC 1ZPZA 3BEFB 3IWMA 4TY6A 1DLEA 2D8WA 3HGNA 2ZHFH 1SGNE 1GHBG 3BTTE 3M7QA 1IOEA 2F9NA 1GCDA 1KLJH 4HTCH 1C1VH 1DSUA 2HPQH 3T27A 1C4U2 1MCTA 2CJIA 3KEEA 1KXAA 3F6UH 3RP2A 2PUXB 2ZWLH 1DY9A 4FUCA 4O97A 1V2RT 2XRCA 2BY6X 4YT7H 1ELGA 1GBFA 3ZVDA 1QRXA 1HBTH 3O8BA 2VH6A 1FN8A 4I8JA 1NY22 3OY6U 2TGTA 1HAVB 1KTSB 1QBNA 5F6MA 3MWIU 1AFQC 1G36A 4WJG2 1OP2A 1J17T 3RXFA 1EJMA 1QRWA 3RMOH 2OP9A 3P6ZB 2ANYA 1Y3WA 4INLA 3A7WA 3MO9A 4I32A 4Y8YA 1AHTH 2ZFFH 2RG3A 2P8OC 1P2KA 4Y0ZE 3QN7A 8LPRA 1CT0E 2AIPA 2H5DA 2PGBB 4JZDH 5FCRA 2A1DB 5HYOA 1BRCE 1MTUA 3VXFH 2ZFSA 4CRGA 1ZRBA 1TQ0B 1GWAA 3GCNA 3S9AA 2ZQ1A 1WSSH 1V2KT 2ZDKA 3URCA 1ETSH 1L1NA 3TGIE 4X2YA 5FPSA 2H1UA 1YLCA 4DIHH 1WYKA 1RJXB 2PKAB 2ZQ2A 1DLKB 4Z0KA 4Q7XA 1VR1H 8GCHG 1NRNH 2VWLA 2B7DH 2V35A 2F9BH 3OU0A 3URDA 1BITA 1SGRE 2BDGA 1GGDC 3BTHE 4K3JA 2PR3A 2SGEE 5DGJA 1BZXE 3TJUA 2ZCLP 3BF6H 2HRVA 1LHFH 1P2OA 5FAHA 4WH8A 3UY9A 4JYUH 2FXRA 4KGAA 4FUEA 2W7SA 1O3KA 2Y7ZA 4ISHH 3UQOA 1GJCB 1YPKH 5DPAA 1A3BH 4ZROA 2V6NA 1C1SA 4B2CA 1TRMA 4BTTB 3ZVCA 2RA3A 3PYHA 4ABAA 1FIWA 2ZPRA 4X6OA 4UFFH 1L4DA 1RRKA 2IOTA 2O8TA 2BVRH 1UHBA 1IHTH 2IJOB 4B76A 1PQ7A 1Z6EA 5FXLA 4BAQB 1AUJA 1FY8E 4IMQA 1HCGA 1VGCB 3ZVBA 3LGWA 5DP4A 3T25A 1TNJA 1BHXF 2FTMA 1GBCA 3RXAA 3TK5A 3GCTF 3ZZBA 3RC5A 4DCDA 1OOKB 1ZJKA 4OS7A 3GCOA 1GMCF 2I6QA 1O5GH 3AW0A 2ZKSA 1P57B 3VPKA 3JZ1B 2BDYA 3LDXH 2FO9A 1CBWC 1GPZA 1ANEA 4TY7A 5L2YH 1C1NA 4AYVB 2FI3E 4Q7YA 1G30B 1HV7A 2VWNA 2ZDAH 1OYQA 1W12U 2AERH 3L6PA 1T8MA 2PUQH 2BMGB 3NK8A 1G3BA 4I8LA 4A1XA 2FI5E 1O2ZA 5PTPA 1F0SA 1GBLA 2BDIA 1E36B 1TWXB 2ZFQH 4NA8A 4GUXA 1SBWA 1Z7KA 1W8BH 5E0JA 2BY7X 3P17H 3QLPH 4X6NA 3SUGA 2VNTA 2C93B 2OCVB 1AZ8A 3HK6B 3PMAB 1LVOA 2H5CA 3PM3A 1P12E 1ELFA 1Y3XA 4R8TB 1U6QA 2V0BA 1W14U 2M5TA 3D49H 3GYLB 2ANMH 1DSTA 2UWLA 4LZ4B 1OS8A 2R3YA 1L1GA 1W13U 2Y5FA 2O8UA 1S0RA 1AFEH 1B7XB 4OGXA 4AORA 1WOFA 4RKJB 1O2TA 3UOUA 1O3FA 1TQ7B 3MU0A 1ZJDA 3MYWA 1HJAC 1O33A 2C8YB 1FPHH 2ZZUH 4SGBE 3UREA 4AG1A 3U1IB 3EA7A 2WINI 4UE7H 4VGCB 1AVGH 5BRRE 2BLWA 3KL6A 2VIWA 2ASUB 3S0NA 4MPVA 4GCHG 5CHAB 3U9AH 1AVWA 4UDWH 3P70B 3M61U 1SGDE 1O36A 1RIWB 1O3AA 2NWNA 1QB1A 1BBRH 1O2MA 1CT4E 3HATH 1CA8B 2HGTH 1AWFH 1C9PA 2W26A 1GL0E 1TE0A 1DUEA 1S0QA 3M35A 1GJBB 7GCHF 1MTNC 2A4GA 3T62A 5DO4H 1O32A 1BB0B 3MNSA 3Q3YA 3SUDA 1BOQA 1MQ6A 1QQ4A 1F0TA 1V2MT 4X6PA 2GGVB 3WY8A 3TNSA 1GI6A 2A31A 1ELVA 2ZNKH 1KYNA 3SV9A 1ORFA 1MD7A 3UNQA 1IAUA 1TRNA 2G52A 1TOMH 1C2GA 1D6WA 2WV5A 1LVBA 3OSYA 1O34A 2FWWA 1GDNA 3Q3KA 1O2HA 2JH6D 4K69A 3HK3B 1ZGVA 1GHAF 2QV1A 1TBZH 1QTFA 1PPZA 2A7HA 4M7GA 1WTGH 4JCNA 2GD4B 5EQRA 3G01A 3UR6A 1H4WA 4WMFA 1UTJA 1QL8A 3VFEA 3OTJE 3D23A 3RXBA 2V3OH 3VB4A 1B0FA 2CF9H 1O2IA 1TB6H 3GCHB 1G3EA 2BTCE 2GKVE 4TPIZ 4MPXA 2PTCE 1S82A 1D3DB 2FIRH 1IQJA 1DX5M 5LPEA 1C2EA 2HNTC 5C5OA 1SL3A 1HAPH 2HNTF 1C5NH 2EC9H 3A88A 1O3OA 3RXQA 3RU4D 4U2WA 1V2NT 1H9IE 3SGBE 1O2SA 2A0QB 4JYTA 1QGFA 3MO6A 3VEQB 3MU8A 1LHGH 2AS9A 3PO1B 2BLOA 2A5AA 3A86A 1H8IH 4IC5A 1FY3A 5JBTA 1EATA 4FUIA 3TK6A 4ZHAA 4DY7B 3QUMP 1MTSA 3GICB 2VVVA 1MTWA 1UHBB 4CRAA 2THFB 3MNCA 1DPOA 3HPTB 2Q1JA 3SNAA 2Z7FE 1QBVH 2XWBI 1EZUC 3E8LA 3P8NA 4BNRA 4TYDA 4X8VH 1BA8B 1QJ7B 1FPCH 3GY6A 4A6LA 5A09A 1FNIA 2Z3CA 2BD2A 2PV9B 2AGIX 2WPJS 4UONA 3Q77A 1G32B 1BUIA 1GBKA 1VITG 1F5KU 2Y5GA 1RFNA 4X2WA 1TALA 1HRTH 1IQHA 1HIAA 1P10A 3BG4B 3LOXA 2P16A 2RDLA 2XBYA 1P2MA 1T8LA 2TRMA 1YBWA 5T6DA 2WYGA 1SGQE 1WTHD 1NU7B 1EX3A 1P8VC 1UVUH 1QR3E 4TWWA 2OC7A 5EXMA 4DVAU 1AUTC 1A7SA 2O8MA 4K2YA 3ZZ5A 3SJ8A 1DXPA 3PROA 1HJAB 2OC1A 6CHAB 1QRZA 2B0FA 1FY1A 2FMJA 3SJIA 2ZG0H 2Z3EA 1G9IE 2OQ5A 3CENA 2NU0E 1ELTA 1J9CH 3RXTA 1A2CH 3U8OH 4NWLA 3VB6A 5AFYH 1T7CA 2C4FH 3RXSA 1BMNH 1O2JA 2OC0A 2R3UA 3FZDA 2WUCA 4IC6A 4JMYA 3S9BA 2CHAB 1SHYA 2ZU2A 4BXWA 1Z8RA 4XE4A 1MCVA 1LO6A 2HALA 4MLFB 1N8OB 3LKWA 2XC0A 5EPNA 4LZ1H 5JBAS 2AFQB 3A83A 4YOJA 1GHWH 1CHGA 3GYMA 3SU3A 2KAIA 3RUOA 3SQHE 2A7JA 1ZMNA 4AX9H 1PFXC 1RXPA 2SNVA 1GMCG 1YKTA 1CVWH 2FDAA 3FANA 3FAOA 4FXGH 2R9PA 4XSKU 2ANWA 3KCGH 3ATWA 5FBEA 4ABBA 1SOTA 2ZDVH 1MH0A 3SI4H 5ABWA 3Q00A 5H4IB 4B75A 2XW9A 4B74A 2ZU1A 1NTPA 1TNLA 2AMQA 3E0NB 2PSYA 1M9UA 3FP7E 3C1KA 2QYIA 3BSQA 4OS4A 1DWDH 4XBCA 2OBOA 1C2LA 3K9XB 1P2QA 1ABJH 2J95A 3L3TA 2CXVA 5FPTA 2ODYB 1VCQA 1TMUH 4INKA 1TPSA 5GPIB 1TFXA 2FOBA 1NM6A 4ZKRU 3RXEA 2ALVA 4CBNA 3T28A 3F9GA 1W7XH 2ESTE 3SW2B 3EQ0H 1Q2WA 1PQ5A 1ZR0A 2HLCA 1TLDA 1ELCA 5T6GA 1PPFE 1BTZA 1WV7H 2UUYA 1PPEE 2WYJA 4K8BA 1C4V2 1J8AA 1UVTH 1CHOF 1P06A 3GDSA 7KMEH 1O3PB 1PPCE 2FI4E 1XUJA 1O35A 4J2YB 1SGEE 3OX7U 4LXBH 2G81E 1LVYA 4AB8A 1O3EA 2O9QA 3S69A 5CHAC 3ZZAA 2H9EH 1SGFA 4FU8A 2VVUA 1UVSH 4MVNA 1PPGE 1SGTA 1V2UT 1Z71A 1L2EA 1TNGA 4Y0YE 1C5MD 1NN6A 1C5YB 1CHOG 4LK4A 2TGAA 1GJ4H 4E05H 3TU7H 3K6ZA 1DVAH 1TPOA 3SU1A 5C1XA 3NWUA 4QT8C
chains in the Genus database with same CATH superfamily
1INCA 2BD8A 3W94A 2ZU4A 4ABFA 4X1RU 1CBWB 1IQFA 1O30A 1EFRD 1H8ED 1PPHE 1K1PA 1GHYH 3SO3A 1AE8H 3BG4C 3LIWA 1HLTH 1JIMA 2FP7B 3TH4H 1O3GA 2FOFA 3A89A 1V2VT 4K1TA 1D3QB 3DFLA 2GMTC 4YXWD 5AHGH 3Q3XA 4I8HA 2G4UA 1BMLA 3OAAD 3NPSA 2AYWA 1CGHA 2J2UA 1DUAA 1GHAG 1TONA 4Y7BA 3IG6B 2LP6A 1Z1JA 2ZA5A 1O0DH 3A82A 1P05A 2HWLB 3OFND 4A1VA 2EI6A 2J94A 3TNTA 2J34A 2G00A 4CRFA 2BYAX 5EGMA 2EA3A 1HIAB 2NU3E 1H1BA 3TLOA 5GNDA 4YESB 3JZ2B 1SLWB 3LU9B 1P09A 2F83A 1T4UH 3BEUA 4O03A 1RTKA 1IQGA 2Z9IA 1B5GH 1OWKA 2IPHA 3ITIA 2A32A 1GVKB 2VVCA 2ZO3H 3BTEE 1HXFH 1UCYE 1EJAA 4ZUHA 1XXFA 1MZDA 3DSGA 3EA9A 5FL7D 1ZMJA 4TWYA 3RXMA 3LPRA 1SFQB 1P03A 1DDJA 2ZF0H 2ZI2H 4OS2A 4AGKA 1UJ1A 1O2QA 2BX4A 1ZTLA 3BN9A 2XYAA 1O5DH 2GT8A 3D65E 4DJZB 3LGYA 4ISIH 2B5TB 1A4WH 1W2KH 5T6FA 2ZTYA 2BM2A 2P95A 4JZFH 1E1QD 1O2KA 1LKAA 3UIRA 4B2BA 2DE8A 2ZHEH 4U30A 6ESTA 2OC8A 6GCHF 3W1EA 3KIDU 2HVXA 3F3BA 1GJ7B 4Y8ZA 3A8CA 3GCTG 1SSXA 2GDEH 1C2JA 1OWDA 1MKXK 5CMXH 4GVUA 1C1RA 4MDSA 3RXOA 1AE5A 3LGIA 2TPIZ 2KAIB 3NZIA 1E35B 3N7DA 2AH4X 1HAXB 3M3SA 1O3MA 1KY9A 1O3IA 2UUFB 2A4QA 1RS0A 3TJOA 1A5GH 1VZQH 1UTKA 1FY4A 1OWHA 1LQDB 3SU0A 3ZVEA 5CDFE 1HAOH 1OPHB 3I29A 1CGIE 1GG6C 1H8HD 1GCTB 2R2WU 4OS6A 2BY8X 1QBOA 5L30H 1EOLA 1ZTKA 3KQ5A 2XOKD 2KFWA 2SGFE 1QB9A 4GLYA 4NSYA 2HNTE 1OSSA 4FU9A 3RXPA 1SOZA 3TPIZ 3UOPA 1ANDA 1MMJN 1K1MA 3ATLA 1Q3XA 4FVDA 4GCHF 1FDPA 1XUIA 5AFZH 5C5NA 2KCPA 1NFWA 1KMHB 3E16B 5EPYA 2Z9KA 1SQRA 4X1NU 3DFJA 4ASHA 3E3TA 1JRTA 1OXGA 1Y3UA 3UNRA 1K21H 3SQEE 4I33A 1S5SA 3SU6A 5IDKA 4JZIA 2YMSB 1V2LT 1ZMLA 1GBJA 2FX4A 3ESTA 1UCYH 1MAXA 4ZXYH 3U8TH 1ANCA 1GL1A 2GCTB 4WWYA 5L2ZH 1A61H 3M36A 1LVMA 2G5NA 1GI9B 3BTKE 1F5RA 1LDTT 3C27B 5EIYA 5DKMA 1TGBA 1HAYB 2FYRA 3BTME 1V2WT 1KXBA 1O3JA 3F9EA 3BV9B 3BTGE 2F9VA 2BY9X 1IQLA 4KP0A 3PTBA 5J4SA 3O8DA 2K1QA 4H4FA 1HUTH 3AAVA 1QL7A 2PGQB 1P11E 3ZYEA 1CE5A 1AWHB 3LJOA 1N1LA 3SUFA 2BLQA 1ZOMA 1JMOH 4XD7D 1QIXB 4I31A 3ZZCA 1EZSC 4GPGA 1UTOA 1KLTA 1SGIB 3TITA 1YPHE 2PKSB 2SGQE 2PLXA 4KELA 4H6SB 4ABJA 1HJ8A 1TGCA 1QHRB 2QC2A 4AZ2B 1V3XA 1RTLA 1V2TT 3F68H 5HXFA 2ZGJA 2ZPSA 1GJ5H 2BDHA 1XX9A 5SGAE 1E79D 5EODA 1FXYA 4DT4A 1TMBH 4K5ZA 1N6XA 3ENSB 1GMDF 1T8OA 4DT7B 4O3TA 5I25A 1X7AC 2ZU3A 5LPRA 2GZ9A 1PQ8A 3PRDA 3PWCA 1S6FA 1AZZA 2STAE 2WV4A 1SLVB 4F49A 2Z9GA 2O8LA 1SLUB 3M5OA 4X8SH 5GIBA 2OLGA 3I77A 1O2XA 3CP7A 2GV6A 3STIA 3ZZ3A 1C5OH 3DSPA 2GT7A 4OS1A 1O5CB 1SFIA 1O2RA 1NRPH 3K6YA 3E1XB 2OXSA 5A2MH 2JJ1D 1V2OT 2P94A 3MNXA 4KTUA 1XXDA 1TGSZ 2JIZD 2A2XH 1TA2A 1V2JT 1HNEE 1A1RA 1O37A 3K65B 4OM9A 2BD5A 1EASA 2B8OH 1NRQH 2RA0A 1EPTA 2CV3A 3UPEA 1EP6A 2ZTZA 3RLYH 3RXDA 3GY2A 3LC5A 3PV5A 1FLEE 4Q80A 4AOQA 4NIYA 1JRSA 1JOUB 3RXIA 1ZHRA 3H5CB 2Z3DA 3MMGA 4E7RG 1ZPBA 1GCTC 5F8XA 1BMFD 4X1QU 1AY6H 1GI4A 1BDAA 4KTCA 3GOVB 2W5EA 4FU7A 1YF4A 3MQKC 2WHXA 1QB6A 1DFPA 1KDQB 4Y6DA 1K1JA 3VB5A 3ZZ7A 1GJDB 1OP0A 1UTNA 1NFUA 3FOAA 3GS9A 1NS3A 1HAZB 1B0EA 1Z6JH 1K28D 4CREA 1QJ6B 2PWXA 4ACBA 1JXPA 1QJ1B 1GMDG 3QZQA 1TGNA 3P8OA 3RDZA 3TGKE 3ELAH 3PV4A 1BQYA 3TK9A 1EB2A 1ELAA 3SNEA 4MPWA 3RC6A 2F9PA 1FUJA 2CN0H 3ZYDA 8KME2 1C2MA 4H6TA 2Y5HA 1Z8JB 2G51A 2FOGA 3MNBA 3M7UA 1GHXH 3SNCA 2J5UA 2FYQA 2LNCA 4KKDA 5TCCA 2DE9A 1D3PB 1VCWA 2WPHS 2F3CE 2ZHWH 4OS5A 2AIQA 3GCHC 2BQWB 1IQIA 4MQAA 4RSPA 3MH7A 4IW4E 4CH2B 1NESE 2EQNA 1PYTD 1N6YA 3F1SB 2GCTC 1UK2A 5JYIA 2ZGHA 3MH6A 1ANBA 1UCYK 5ESTE 1RD3B 2WPMS 2G5VA 3SGAE 3M37A 5A0CA 1E37B 4WXVA 1THSH 2Y80A 1SPJA 3SJ9A 3ZZ8A 1HAHH 2L6OA 3UFAA 3ODFA 2Z94A 1XKAC 3DT0H 2QXGA 2QF4A 2TBSA 2QA9E 4YT6H 2VIDA 1ZSLA 2F43B 1ABIH 3RC4A 2J92A 2BB4A 2XBXA 1FJSA 4FUGA 2CMYA 1KTTB 4AYYB 3SHAH 1NFYA 2VB0A 1SC8U 3ZIAD 4WMEA 1A0JA 1K1LA 3SHCH 5L6NH 1H9HE 3SI3H 4HFPB 2ZCKP 2PKSC 3WWFA 3O8RA 1ZHPA 2SGAA 5J4QA 1BHXB 2QXIA 1CO7E 3NRLA 1JIRA 4X8TH 4E06H 1UTLM 5E2OA 1A0LA 1O5AB 4XDEA 4NFEA 1T4VH 1RIWC 4I8GA 1FMGA 1PJPA 1CT2E 1KSNA 1MKWH 2AGGX 3A8DA 4X0WU 4YOIA 2GMTB 2W3IA 3KQBA 4OGYA 2GDDA 1SGFG 2PFEA 1P2NA 2BY5X 1QFKH 3LC3A 1TPAE 7LPRA 2NU1E 1TYNA 1BRAA 2G55A 1O3DA 4ZKOU 1ZGIA 2ZU5A 3VG8A 3F0PA 4NIXA 5E0GA 1C2IA 3ZZDA 1ETTH 2Z9LA 1LKBA 3EYDA 3KGPA 2A4OA 1KIGH 3V13A 3LGVA 2A4RA 5A0AE 3U1JB 3SBKA 2GX4A 1UTPA 2FTLE 4NIWA 3VGCC 3QTOH 1MD8A 1AN1E 2QY0B 1VITF 4IMZA 4WF8A 1S83A 2VJ1A 1LPKB 1C2HA 1GMHG 4HZHA 1WCZA 3QTVH 2ILNA 2VGCB 1V2PT 5HGGA 1SG8B 4F48B 2CF8H 1FIZA 2QF0A 1LHEH 2FOMB 2TIOA 1XUKA 2FEQH 4HI3A 2WPLS 5A8YA 1NT1A 2ZP0H 2G8TA 3PLKA 1O2PA 2PP6A 3BTDE 4I7YH 1YYY1 2BVSH 2Y82A 4MTBA 2SGPE 1YPEH 1S81A 5JBCS 8ESTE 1QY6A 2H9HA 1OWJA 3P95A 4U32A 1O2UA 1XVOA 1HXEH 1K1NA 1MBQA 1C2DA 1VJ9U 3RXCA 5C17A 3MHWU 3T26A 1MTVA 3A84A 1SGPE 1GHBF 2OK5A 2XC5A 3ATKA 5F03A 1XVMA 4B2AA 1ZZZA 4UFEH 5HM2A 2OD3B 5FCKA 4B73A 4Y7AA 4PROA 1RGQA 1DE7H 3PB1E 1EQ9A 3TVJB 1EPTB 1UK4A 1OWIA 4NA7A 3OYPA 3N7OA 4X8UH 2UUJB 4KTSA 1GBMA 1OYTH 1GBAA 2BOHB 2K0QA 1TNIA 5EG4A 1Y3YA 3LT3A 4F4OC 1Z8IB 1KDQA 1G37A 3DD2H 1BRBE 1C4Y2 1C5XB 3FP6E 4AFQA 4XRNA 3A7XA 3F0OA 4NG9H 4ZHLU 5JDUB 2FOEA 4WVPE 3DSOA 3I78A 2WSSD 4NZLA 3T5FH 1GI0A 2JJ2D 3SV7A 1NBME 1EAWA 4ZH8A 4DW2U 5EQSA 2BD9A 1LQEA 2BVXH 2BQ6B 3HKIB 4YOGA 3ATMA 1F92A 4H42U 1KXFA 1O3NA 1AB9B 3P8FA 2QAAA 2AEIH 2FOCA 3UR9A 4B71A 1GDQA 2PW8H 1S6HA 5DP9A 2ZDNA 5DJ7A 5DP5A 1HAIH 1E0FD 1XKBC 1DT2A 1H9LB 4Q4LA 3ZV9A 4Q2KA 5EJLA 1A46H 2BDBA 5IK2D 2BQ7B 1DM4B 1NO9H 3MO3A 1ETRH 4ISLA 1L4ZA 3ATIA 1PYTC 2TGPZ 3SOSA 2F91A 5HMAA 1THPB 3VXEH 6GCHG 1BMMH 3SGQE 5JPMH 4Y11E 1UTQA 5B6LA 5F8TA 3MI4A 3M5MA 3QX5H 4U01A 1T31A 3QGNB 2VGCC 4X2XA 1EP5A 1GHVH 1G3CA 3MTYA 1TA6A 3LJJA 3L33A 1CA0B 1F0UA 1T8NA 1QCPA 4X6MA 1FONA 1BRUP 3E6PH 5C94A 3LH3A 3A7YA 5C0UA 2QIQA 2VIQA 1FAXA 4Y10E 2FLRH 1EAXA 2KCOA 3NUMA 1NPMA 1XUFA 4BTIB 1EZXC 1NZQH 1ACBE 1L0ZA 1TPPA 2C8XB 1AD8H 2AGEX 2ZPQA 1DXWA 4X1SU 1DANH 1D9IA 2KCYA 2Z6BD 3GDUA 3UWJH 2VH0A 5CHBA 3PMBB 1VGCC 2RFKC 1LPZB 1P02A 3UB0A 4FUHA 1V2ST 1V2QT 1WQSA 2XWAA 4YO9A 3LONA 3NCLA 2A2QH 1WU1A 1YY3A 1OKXA 3SV8A 3TJVA 3SN8A 3UQVA 1P3CA 1Z1IA 2J4IA 3SU2A 1W0YH 2ZECA 4ZXXH 1P9UA 5EQQA 4MG3A 2AMPA 1O2OA 2KM0A 3QK1A 4UD9H 2BD4A 4BAKB 4K1EA 3RMNH 1TNKA 1C1OA 4CHAC 1SGCA 2QCYA 3ZZ4A 4GHTA 2STBE 2XXLA 2QF3A 2JDID 5A0BA 1G2MA 1C5ZB 1OWEA 5FX5A 3GY3A 3DHKH 1K1IA 1KXEA 2R0LA 4K8YA 4P02A 1OP8A 5GDSH 2Q6GA 2ZIQH 2JH5D 1MU6B 1K2I1 4ABGA 1BJUA 2BDAA 3DUXH 2FZZA 1ZSKA 4DURA 4NA9H 1KXCA 4Z6AH 1HDTH 3H7OA 5C1UA 4JYVH 4ZKSU 1VCPA 4ISNA 5EXNA 4D8NA 2H2ZA 2ZHDA 3ZV8A 3E90B 1C5PA 1DWBH 1MBMA 1YCPK 1BTYA 1GVZA 1ELEE 3MOCA 5DP3A 4INHA 4ABDA 2C90B 4ESTE 5HM9A 1BTPA 3PRBA 4UEHH 1Q31A 5T1VA 1KXDA 1TIOA 3CS0A 4AG2A 3GY7A 1NRRH 4BANB 1S85A 4GAWA 1P04A 2YNAA 1GI7B 1GI1A 2AHME 2W7UA 1H8DH 6LPRA 2QXHA 4FUFA 1C9TA 1ZSJA 4AFUA 3FN8A 1O5FH 5LH8A 4Y79A 1FY5A 1QURH 3SJOA 2NU2E 1WUNH 5GJ4B 3M3VA 5AVDA 4ABIA 2G4TA 3RMMH 1MAYA 1QL9A 4MNVA 1Y5BT 1F7ZA 1ID5H 1NFXA 3V3MA 2VIOA 4XFQA 2BX3A 1C1WH 2YNBA 1LCYA 4DGJA 1SQOA 1MTNB 2UWOA 3EDXB 3EAJA 2P3UB 4FUJA 3VB3A 1W11U 4IGDA 3SJKA 2ODQA 4YLQH 2O8WA 3GY4A 2BDCA 2WPKS 2PSXA 4Y8XA 3BEIB 1IQEA 1RTFB 1OHHD 4IS5A 4BAHB 4AB9A 2XCNA 1JBUH 5DK1A 3H7TA 1HJ9A 5LPFA 1PQAA 1AKSA 2VIPA 1O2GH 1BIOA 3EGKH 1YPHC 3EE7A 3RM2H 2ZEBA 2FODA 1YGCH 3BG8A 1BCUH 4FUBA 4X1PU 4ASUD 5B6OA 4RT0A 1T32A 1SKYE 1LMWB 1XUHA 5JB8S 5AF9H 4A92A 4WXIA 1O2NA 3SORA 1G2LA 2F9UA 2C3SA 1EXFA 1ZLRA 1A0HB 2VU8E 4RKOB 4D76A 1GI3A 3RU4E 5DP6A 2BZ6H 3BTQE 3ZZ6A 3SU5A 5DP8A 3AVZA 5EU8A 1C1TA 1W0KD 1AGJA 2ZGXH 2GVFA 8GCHF 5EJ1A 2GZ8A 5TCAA 1UW7A 3QZRA 1BMAA 1TAWA 3GISB 4XBBA 1WBGB 3S7HB 4FETA 2JH0D 2KR7A 3UNSA 1C5VA 1IHSH 3T29A 4THNH 1BTXA 1YPLH 2JKHA 2OBQA 1S6LA 2C8WB 2OQUA 3RXJA 1W0ZU 4DG4A 1MKWK 4D9QA 5F8ZA 1AMHA 1C5LH 3M5NA 5CE1A 1AIXH 1O2VA 2FM2A 4D7GA 5DP7A 4DIIH 3BTFE 5FBIA 3SUEA 1LPGB 2ALPA 1E1RD 2EI8A 1LHDH 5E0HA 1MZAA 5LGOA 1C1UH 1GJAB 2ZTXA 1XMNB 4Q7ZA 4MNYA 5E8EH 1CSOE 1W10U 1XM1A 2Q6DA 2L74A 1GJ8B 4IBLH 4CHAB 1O2WA 3EA8A 3KN2A 1O3CA 2XTTB 3PLBA 7GCHG 1C1MA 3SV2H 3RU4T 1UO6A 2A45B 3KQEA 3KYFA 1YPMH 4RN6A 3UUZA 9LPRA 3FKSD 9ESTA 3RXUA 5I46H 3RXLA 2J97A 5IYTA 2OTVA 2ODPA 4JK6A 3FP8E 1TBRH 2BD3A 3BTWE 1TX6A 1C5QA 1BBRK 2SGDE 4NCYA 2VINA 1OX1A 1GBDA 4CRBA 1YCPM 1Y5AT 4D7FA 4BXSA 3ZVGA 2CGAA 1C2FA 2YOLA 3CS7A 3Q76A 4GSOA 1C2KA 3NKKA 2R0KA 1CU1A 3GY8A 2HVYB 1QA0A 3UWIA 2VWOA 2GV7A 3KYGA 4SGAE 3A80A 2ZDLA 3R0FA 1W0JD 4GHQA 5E2PA 1TABE 4YTAA 2F9OA 2GP9B 1O2LA 4AN7A 5EW1H 3KQCA 2QN5T 1COWD 3QO6A 2P8OB 4YZUA 4BOHA 2JETB 3A7TA 3OTPA 4TT3D 3M7TA 4HGCA 1YC0A 2ZFPH 1HFDA 1C5SA 3RXHA 4B6FA 1LHCH 1QA7A 4YM9A 3S7KB 2NU4E 1YPJH 1GI2A 4Y71A 2J9NA 2FS8A 2ZGBH 4X2VA 4BAOB 4WH6A 4O3UA 5EXLA 1QQUA 1LTOA 2PHBA 1E38B 3PMHB 5ESBA 2BOKA 3BIVH 3FZZA 2ZGCA 1BJVA 2Q6FA 3LGUA 2FESH 1SI5H 2OUAA 1GGDB 2CHAC 5C67A 4MNXA 4YLUA 4NWKA 4Q63A 1A5HA 1N8OC 1L1JA 1TX8A 1ESBA 1F5LA 1GJ9B 3QWCH 2QXJA 3MU4A 2ANKH 1THRH 4UFDH 4I8KA 3ZZ9A 1GBHA 2LPRA 1AVXA 1YLDA 1AU8A 2A5KA 3SZNA 3V0XA 3OEHD 4ABHA 1V6DA 1NROH 5JB9S 1GDUA 3TH3H 2BXUH 3PO1C 3OY5U 1K22H 3F9HA 7ESTE 1O31A 2W6ID 3SNDA 1G3DA 2FX6A 4IN1A 3RXRA 1GBIA 1EB1H 1UVPA 2H9TH 4B1TA 1SGYE 5GWZA 4WY3A 1GBBA 1BTHH 3A8BA 1NC6A 2P93A 2HLDD 4CRCA 1D6RA 3TIUA 1SQAA 2ZC9H 1ZRKA 1YP9A 2SFAA 1IQNA 1BTWA 2Y6TA 1AFQB 4IN2A 1ARCA 2V3HH 3U8RH 3TGJE 1A5IA 3IITA 1HAGE 5FPYA 1DWCH 1FQ3A 3SV6A 2FPZA 3HKJB 3PLPA 1AKSB 1C5TA 1BT7A 1ZPCA 3VB7A 1YCPH 2D26C 2GTBA 5C20A 1ESTA 1GJ6A 4Y76A 1AI8H 3RXGA 2ZFTA 1DITH 4FOUC 1XUGA 1K0HA 1K9OE 3KQDA 6CHAC 4ZAEA 2F4LA 4ZMAH 4AFZA 2GZ7A 3GY5A 4R0IA 1O39A 2WUBA 1EAIA 3QGJA 1ARBA 1Y3VA 1SQTA 2AMDA 3PTNA 3SZEA 1O38A 1A3EH 1F2SE 2EEKA 5K0HA 4K1SA 2HPPH 1O3LA 4CR5A 2RCEA 2XBWA 1TBQH 2BD7A 1QNJA 2UUKB 4FUDA 5JBBS 1MKXH 1SHHB 1EKBB 4LOYH 2VWMA 1IQMA 4NSVA 4MNWA 4ZKNU 4AGJA 1DS2E 4MPUA 4CBOA 4AC9A 4CRDA 3TJNA 4CH8B 3SNBA 1UTMA 2GCHF 1HPGA 1VITH 3M5LA 3A85A 3BIUH 1ZYOA 2TGDA 2R2MB 2BZAA 4M9FA 2XC4A 2IJD1 3UTUH 1BTUA 2W3KA 1FI8A 2P3TB 3T2NA 3AAUA 4WMDA 1J16A 4UFGH 1SLXB 2QF5A 4VGCC 1HAVA 1HGTH 1SVPA 5C2ZA 4BAMB 2ZHQH 2W6JD 2FS9A 4A5TS 1EAUA 1D3TB 2IN2A 3ZVFA 4O9VA 4NFFA 2XNIA 3A7ZA 3V12A 2C8ZB 3KHVA 2Y7XA 3STJA 5K7RA 1O3HA 1P0SH 3RMLH 3ZVAA 3FVFB 3PMJA 4NGAH 1EUFA 1PPBH 1CQQA 4NIVA 3A87A 1MQ5A 5EW2H 1YM0A 1EOJA 4I86A 1KLIH 1TGTA 1Y5UT 3DCLA 1P2IA 3F2GA 3HGPA 2JETC 1GG6B 2XBVA 3AASA 1AQ7A 2DUCA 3MU1A 3MH4A 3H09A 1EJNA 1FN6A 5G4BA 1P2JA 1ZTJA 1AO5A 3D62A 1C1QA 2PKAA 1W7GH 3MU5A 3M3TA 5A8XA 3B23B 1MU8B 2M2AA 2FOHA 1DY8A 3KF2A 1TRYA 1HYLA 5GCHF 1ELBA 2HOBA 5C0TA 3NXPA 3B8JA 3MH5A 1SR5C 4ZHMU 5C3NA 3A7VA 2BLVA 4A7IB 3QDZB 3PV2A 1W3CA 2UWPA 2ZFRH 1F0RA 1GHZA 1GBEA 4JZEH 3RM0H 3A81A 1NRSH 2Y81A 1GVLA 1TOCB 3RXVA 1C5UA 5FX6A 1P9SA 3E91A 3EE0B 1P01A 1GI5A 1P3EA 1JWTA 2XCFA 3DA9B 1TX7A 2Z9JA 1UVOA 3LH1A 5T3HA 4FVBA 4A1TA 4J1YA 4BTUB 2D2DA 4F55A 2D1JA 3U69H 2H6MA 1E34B 3R3GB 2SNWA 3ODDA 1Z8GA 2ZDMA 1TNHA 3FFGA 5EOKA 5ETXA 3RLWH 2VIVA 1O3BA 4CR9A 3GDVA 1GMHF 3A8AA 1ZHMA 3W95A 3B9FH 2EI7A 3O8CA 1WQVH 2FOAA 1Y59T 4XOJA 1Y8TA 5GXPA 4K60A 1D4PB 2ULLA 1EZQA 2A7CA 2I6SA 1K1OA 1IQKA 1FV9A 3TH2H 1S84A 1ESAA 1HB0B 4ABEA 1MUEB 3VGCB 5HKKD 3V7TA 4E7NA 1FAKH 5FHTA 2P3FH 5C1YA 1O2YA 5DG6A 1SMFE 1UMAH 1NU9A 5GCHG 5KEDA 1AB9C 2QGRA 1O5BB 1GI8B 1BBRE 3U98H 1DOJA 2ZCHP 3F9FA 1FZZA 5BPEA 4HG6A 1J15A 2J38A 5TJXA 4XBDA 1J14A 2WPDD 1O5EH 1VJAU 2B9LA 4AFSA 4DOQA 3AW1A 3RXKA 3CNRA 2GJGA 1CGJE 2FLBH 3P8GA 2BXTH 1DWEH 1WAYB 3E0PB 3PWBA 2BHGA 3SU4A 1CA0C 1GBTA 3P92A 1C5RA 1UK3A 3K2UA 3MFJA 2P59A 4ISOA 3KNXA 3LGTA 2GCHG 2WZQA 1DICA 1ELDE 2PTNA 5A8ZA 4JZ1A 1C5WB 2WPIS 3U28C 4TPYA 1SB1H 3S9CA 4D9RA 1C1PA 4JK5A 2OINA 1TMTH 1YPGH 4NZQA 2A5IA 1EPTC 1ZPZA 3BEFB 3IWMA 4TY6A 1DLEA 2D8WA 3HGNA 2ZHFH 1SGNE 1GHBG 3BTTE 3M7QA 1IOEA 2F9NA 1GCDA 1KLJH 4HTCH 2KCAA 1C1VH 1DSUA 2HPQH 5DN6D 3T27A 1C4U2 1MCTA 2CJIA 3KEEA 1KXAA 3F6UH 3RP2A 2PUXB 2ZWLH 1DY9A 4FUCA 4O97A 1V2RT 2XRCA 2BY6X 4TSFD 1ELGA 4YT7H 1GBFA 3ZVDA 1QRXA 1HBTH 3O8BA 2VH6A 1FN8A 4I8JA 1NY22 3OY6U 2TGTA 1HAVB 1KTSB 1QBNA 5F6MA 3MWIU 1AFQC 2YMSD 1G36A 4WJG2 1OP2A 1J17T 3RXFA 1EJMA 1QRWA 3RMOH 2OP9A 3P6ZB 2ANYA 1Y3WA 4INLA 3A7WA 3MO9A 4I32A 4Y8YA 1AHTH 2ZFFH 2RG3A 1VKYA 2P8OC 1P2KA 4Y0ZE 3QN7A 3OEED 8LPRA 1CT0E 2AIPA 2H5DA 2PGBB 4JZDH 5FCRA 2A1DB 5HYOA 1BRCE 1MTUA 3VXFH 2ZFSA 4CRGA 1ZRBA 1TQ0B 1GWAA 2CK3D 3GCNA 3S9AA 2ZQ1A 1WSSH 1V2KT 2ZDKA 3WWBA 3URCA 1ETSH 1L1NA 3TGIE 4X2YA 5FPSA 2H1UA 1YLCA 4DIHH 1WYKA 1RJXB 2PKAB 2ZQ2A 1DLKB 4Z0KA 4Q7XA 1VR1H 3UAIC 8GCHG 1NRNH 2VWLA 1YLNA 2B7DH 2V35A 2F9BH 3OU0A 3URDA 1BITA 1SGRE 2BDGA 1GGDC 3BTHE 4K3JA 2PR3A 2SGEE 5DGJA 1BZXE 3TJUA 2ZCLP 3BF6H 2HRVA 1LHFH 1P2OA 5FAHA 4WH8A 3UY9A 3OE7D 4JYUH 2FXRA 4KGAA 4FUEA 2W7SA 1O3KA 2Y7ZA 4ISHH 3UQOA 1GJCB 1YPKH 5DPAA 1A3BH 4ZROA 2V6NA 1C1SA 4B2CA 1TRMA 4BTTB 3ZVCA 2RA3A 3PYHA 4ABAA 1FIWA 2ZPRA 4X6OA 4UFFH 1L4DA 1RRKA 2IOTA 2O8TA 2BVRH 1UHBA 1IHTH 2IJOB 4B76A 1PQ7A 1Z6EA 5FXLA 4BAQB 1AUJA 1FY8E 4IMQA 1HCGA 5DSFA 1VGCB 3ZVBA 3LGWA 5DP4A 3T25A 1TNJA 1BHXF 2FTMA 1GBCA 3RXAA 3TK5A 3GCTF 3ZZBA 3RC5A 4DCDA 1OOKB 1ZJKA 4OS7A 3GCOA 1GMCF 2I6QA 1O5GH 3AW0A 2ZKSA 1P57B 3VPKA 3JZ1B 2BDYA 3LDXH 3F2FA 2FO9A 1CBWC 1GPZA 1ANEA 4TY7A 5L2YH 1C1NA 4AYVB 2FI3E 4Q7YA 1G30B 1HV7A 2VWNA 2ZDAH 1OYQA 1W12U 2AERH 3L6PA 1T8MA 2PUQH 2BMGB 3NK8A 1G3BA 4I8LA 4RT1A 2FI5E 1O2ZA 4A1XA 5PTPA 1F0SA 1GBLA 2BDIA 1E36B 1TWXB 2ZFQH 4NA8A 4GUXA 1SBWA 1Z7KA 1W8BH 5E0JA 2BY7X 3P17H 3QLPH 4X6NA 3SUGA 2VNTA 2C93B 2OCVB 1AZ8A 3HK6B 3PMAB 1LVOA 2H5CA 3PM3A 1P12E 1ELFA 1Y3XA 4R8TB 1U6QA 2EY4C 4ACAA 2V0BA 1W14U 2M5TA 3D49H 3GYLB 2ANMH 1DSTA 2UWLA 4LZ4B 1OS8A 2R3YA 1L1GA 1W13U 2Y5FA 2O8UA 1S0RA 1AFEH 1B7XB 4OGXA 4AORA 1NBMD 1WOFA 4RKJB 1O2TA 3UOUA 1O3FA 1TQ7B 3MU0A 1ZJDA 3MYWA 1HJAC 1O33A 2C8YB 1FPHH 2ZZUH 4SGBE 3UREA 4AG1A 2WV9A 3U1IB 3EA7A 2WINI 4UE7H 4VGCB 1AVGH 5BRRE 2BLWA 3KL6A 2VIWA 2ASUB 3S0NA 4MPVA 4GCHG 5CHAB 3U9AH 1AVWA 4UDWH 3P70B 3M61U 1SGDE 1O36A 1RIWB 1O3AA 2NWNA 1QB1A 1BBRH 1O2MA 1CT4E 3HATH 2LELA 1CA8B 2HGTH 1AWFH 1C9PA 2VBCA 2W26A 1GL0E 1TE0A 1DUEA 1S0QA 3M35A 1GJBB 7GCHF 1MTNC 2A4GA 3T62A 5DO4H 1O32A 1BB0B 3MNSA 3Q3YA 3SUDA 1BOQA 1MQ6A 1QQ4A 1F0TA 1V2MT 4X6PA 2GGVB 3WY8A 5KECA 3TNSA 1GI6A 2A31A 1ELVA 2ZNKH 1KYNA 3SV9A 1ORFA 1MD7A 3FO8D 3UNQA 1IAUA 1TRNA 2G52A 2J98B 1TOMH 1C2GA 1D6WA 2WV5A 1LVBA 3OSYA 1O34A 2FWWA 1GDNA 3Q3KA 1O2HA 2JH6D 4K69A 3HK3B 1ZGVA 1GHAF 2QV1A 1TBZH 1QTFA 1PPZA 2A7HA 4M7GA 1WTGH 4JCNA 2GD4B 2V7QD 5EQRA 3G01A 3UR6A 1H4WA 2XNDD 4WMFA 1UTJA 1QL8A 3VFEA 4RI0A 3OTJE 3D23A 3RXBA 2V3OH 3VB4A 1B0FA 2CF9H 1O2IA 1TB6H 3GCHB 1G3EA 2BTCE 2GKVE 4TPIZ 4MPXA 2PTCE 1S82A 2IPQX 1D3DB 2FIRH 1IQJA 1DX5M 5LPEA 1C2EA 2HNTC 5C5OA 1SL3A 1HAPH 2HNTF 4Z1MD 1C5NH 2EC9H 3A88A 1O3OA 3RXQA 3RU4D 4U2WA 1V2NT 1H9IE 3SGBE 1O2SA 2A0QB 4JYTA 1QGFA 3MO6A 3VEQB 3MU8A 5HIZA 1LHGH 2AS9A 3PO1B 4B6EA 2BLOA 2A5AA 3A86A 1H8IH 4IC5A 1FY3A 5JBTA 1EATA 4FUIA 3TK6A 4ZHAA 4DY7B 3QUMP 1MTSA 3GICB 2VVVA 1MTWA 1UHBB 4CRAA 2THFB 3MNCA 1DPOA 3HPTB 2Q1JA 3SNAA 2Z7FE 1QBVH 2V3MA 2XWBI 1EZUC 3E8LA 3P8NA 4BNRA 4TYDA 4X8VH 1BA8B 1QJ7B 1FPCH 3GY6A 4A6LA 5A09A 1FNIA 2Z3CA 2BD2A 2PV9B 1QZ8A 2AGIX 2WPJS 3N99A 4UONA 3Q77A 1G32B 1BUIA 1GBKA 1VITG 1F5KU 2Y5GA 1RFNA 4X2WA 1TALA 5KGOA 1HRTH 1IQHA 1HIAA 1P10A 3BG4B 3LOXA 2P16A 2RDLA 1P2MA 1T8LA 2TRMA 2XBYA 1YBWA 5T6DA 3N7EA 2WYGA 1SGQE 1WTHD 1NU7B 1EX3A 1P8VC 1UVUH 1QR3E 4TWWA 2OC7A 5EXMA 4DVAU 1AUTC 1A7SA 2O8MA 4K2YA 3ZZ5A 4P00A 5F53A 3SJ8A 1DXPA 2K8IA 3PROA 2KZ4A 1HJAB 2OC1A 6CHAB 4ZCNA 1QRZA 2B0FA 1FY1A 2FMJA 3SJIA 2ZG0H 2Z3EA 3F2HA 1G9IE 2OQ5A 3CENA 2NU0E 1ELTA 1J9CH 3RXTA 1A2CH 3U8OH 4NWLA 3VB6A 5AFYH 1T7CA 2C4FH 3RXSA 1BMNH 1O2JA 2OC0A 2R3UA 3FZDA 2WUCA 4IC6A 4JMYA 3S9BA 2CHAB 1SHYA 2ZU2A 4BXWA 1Z8RA 4XE4A 1MCVA 1LO6A 2HALA 4MLFB 1N8OB 3LKWA 2YMSC 2XC0A 5EPNA 5HIYA 4LZ1H 5JBAS 2AFQB 3A83A 4YOJA 1GHWH 1CHGA 3GYMA 3SU3A 3WW7A 1MABB 2KAIA 3RUOA 3SQHE 2A7JA 1ZMNA 4AX9H 1PFXC 1RXPA 2SNVA 1GMCG 1YKTA 1WDIA 1CVWH 1WXRA 2FDAA 3FANA 3FAOA 4FXGH 2R9PA 4XSKU 2ANWA 3KCGH 3ATWA 5FBEA 4ABBA 1SOTA 2ZDVH 1MH0A 3SI4H 5ABWA 3Q00A 5H4IB 4B75A 2XW9A 4B74A 2ZU1A 1NTPA 1TNLA 2AMQA 3E0NB 2PSYA 1M9UA 3FP7E 3C1KA 2QYIA 3BSQA 4OS4A 1DWDH 4XBCA 2OBOA 1C2LA 3K9XB 1P2QA 1ABJH 2J95A 3L3TA 2CXVA 5FPTA 2ODYB 1VCQA 1TMUH 4INKA 1TPSA 5GPIB 1TFXA 2J98A 2FOBA 1NM6A 4ZKRU 3RXEA 2ALVA 4CBNA 3T28A 3F9GA 1W7XH 2ESTE 3SW2B 3EQ0H 1Q2WA 1PQ5A 1ZR0A 2HLCA 1TLDA 1ELCA 5T6GA 1PPFE 1BTZA 1WV7H 2UUYA 1PPEE 2WYJA 4K8BA 2RDEA 1C4V2 1J8AA 1UVTH 1CHOF 1P06A 3GDSA 5EJZA 7KMEH 1O3PB 1PPCE 2FI4E 1XUJA 1O35A 4J2YB 1SGEE 3OX7U 4LXBH 2G81E 1FX0B 2QE7D 1LVYA 4AB8A 1O3EA 2O9QA 3S69A 2KX4A 5CHAC 3ZZAA 3SYJA 3AK5A 2H9EH 1SGFA 4FU8A 2VVUA 1UVSH 4MVNA 1PPGE 1SGTA 1V2UT 1Z71A 1L2EA 1TNGA 4Y0YE 1C5MD 1NN6A 1C5YB 1CHOG 4LK4A 2TGAA 1GJ4H 4E05H 3TU7H 3K6ZA 1DVAH 1TPOA 3SU1A 5C1XA 3NWUA 1YWUA 4QT8C
chains in the Genus database with same CATH topology
1INCA 2BD8A 3W94A 2ZU4A 4ABFA 4X1RU 1CBWB 1IQFA 1O30A 1PPHE 1K1PA 1GHYH 3SO3A 1AE8H 3BG4C 3LIWA 1HLTH 1JIMA 2FP7B 3TH4H 1O3GA 2FOFA 3A89A 1V2VT 4K1TA 1D3QB 3DFLA 2GMTC 5AHGH 3Q3XA 4I8HA 2G4UA 1BMLA 3NPSA 2AYWA 1CGHA 2J2UA 1DUAA 1GHAG 1TONA 4Y7BA 3IG6B 1Z1JA 2ZA5A 1O0DH 3A82A 1P05A 2HWLB 4A1VA 2EI6A 2J94A 3TNTA 2J34A 2G00A 4CRFA 2BYAX 5EGMA 2EA3A 1HIAB 2NU3E 1H1BA 3TLOA 4YESB 3JZ2B 1SLWB 3LU9B 1P09A 2F83A 1T4UH 3BEUA 4O03A 1RTKA 1IQGA 2Z9IA 1B5GH 1OWKA 2IPHA 3ITIA 2A32A 1GVKB 2VVCA 2ZO3H 3BTEE 1HXFH 1UCYE 1EJAA 4ZUHA 1XXFA 1MZDA 3EA9A 1ZMJA 4TWYA 3RXMA 3LPRA 1SFQB 1P03A 1DDJA 2ZF0H 2ZI2H 4OS2A 4AGKA 1UJ1A 1O2QA 2BX4A 1ZTLA 3BN9A 2XYAA 1O5DH 2GT8A 3D65E 4DJZB 3LGYA 4ISIH 2B5TB 1A4WH 1W2KH 5T6FA 2ZTYA 2BM2A 2P95A 4JZFH 1O2KA 1LKAA 3UIRA 4B2BA 2DE8A 2ZHEH 4U30A 6ESTA 2OC8A 6GCHF 3KIDU 2HVXA 1GJ7B 4Y8ZA 3A8CA 3GCTG 1SSXA 2GDEH 1C2JA 1OWDA 1MKXK 5CMXH 4GVUA 1C1RA 4MDSA 3RXOA 1AE5A 3LGIA 2TPIZ 2KAIB 3NZIA 1E35B 2AH4X 1HAXB 3M3SA 1O3MA 1KY9A 1O3IA 2UUFB 2A4QA 1RS0A 3TJOA 1A5GH 1VZQH 1UTKA 1FY4A 1OWHA 1LQDB 3SU0A 3ZVEA 1HAOH 1OPHB 3I29A 1CGIE 1GG6C 1GCTB 2R2WU 4OS6A 2BY8X 1QBOA 5L30H 1EOLA 1ZTKA 2SGFE 1QB9A 4GLYA 4NSYA 2HNTE 1OSSA 4FU9A 3RXPA 1SOZA 3TPIZ 3UOPA 1ANDA 1MMJN 1K1MA 3ATLA 1Q3XA 4FVDA 4GCHF 1FDPA 1XUIA 5AFZH 5C5NA 1NFWA 3E16B 5EPYA 2Z9KA 4X1NU 3DFJA 4ASHA 3E3TA 1JRTA 1OXGA 1Y3UA 3UNRA 1K21H 3SQEE 4I33A 1S5SA 3SU6A 5IDKA 4JZIA 1V2LT 1ZMLA 1GBJA 2FX4A 3ESTA 1UCYH 1MAXA 4ZXYH 3U8TH 1ANCA 1GL1A 2GCTB 4WWYA 5L2ZH 1A61H 3M36A 1LVMA 2G5NA 1GI9B 3BTKE 1F5RA 1LDTT 3C27B 5DKMA 1TGBA 1HAYB 2FYRA 3BTME 1V2WT 1KXBA 1O3JA 3F9EA 3BV9B 3BTGE 2F9VA 2BY9X 1IQLA 4KP0A 3PTBA 5J4SA 3O8DA 2K1QA 4H4FA 1HUTH 3AAVA 1QL7A 2PGQB 1P11E 3ZYEA 1CE5A 1AWHB 3LJOA 1N1LA 3SUFA 2BLQA 1ZOMA 1JMOH 1QIXB 4I31A 3ZZCA 1EZSC 4GPGA 1UTOA 1KLTA 1SGIB 3TITA 1YPHE 2PKSB 2SGQE 2PLXA 4KELA 4H6SB 4ABJA 1HJ8A 1TGCA 1QHRB 2QC2A 4AZ2B 1V3XA 1RTLA 1V2TT 3F68H 5HXFA 2ZGJA 2ZPSA 1GJ5H 2BDHA 1XX9A 5SGAE 5EODA 1FXYA 1TMBH 4K5ZA 1N6XA 3ENSB 1GMDF 1T8OA 4DT7B 4O3TA 5I25A 1X7AC 2ZU3A 5LPRA 2GZ9A 1PQ8A 3PWCA 1S6FA 1AZZA 2STAE 2WV4A 1SLVB 4F49A 2Z9GA 2O8LA 1SLUB 3M5OA 4X8SH 5GIBA 2OLGA 3I77A 1O2XA 3CP7A 2GV6A 3STIA 3ZZ3A 1C5OH 4OS1A 2GT7A 1O5CB 1SFIA 1O2RA 1NRPH 3K6YA 3E1XB 2OXSA 5A2MH 1V2OT 2P94A 3MNXA 4KTUA 1XXDA 1TGSZ 2A2XH 1TA2A 1V2JT 1HNEE 1A1RA 1O37A 3K65B 2BD5A 1EASA 2B8OH 1NRQH 2RA0A 1EPTA 2CV3A 3UPEA 1EP6A 2ZTZA 3RLYH 3RXDA 3GY2A 3LC5A 4Q80A 1FLEE 4AOQA 4NIYA 1JRSA 1JOUB 3RXIA 1ZHRA 3H5CB 2Z3DA 3MMGA 4E7RG 1ZPBA 1GCTC 5F8XA 4X1QU 1AY6H 1GI4A 1BDAA 4KTCA 3GOVB 2W5EA 4FU7A 1YF4A 1QB6A 1DFPA 1KDQB 4Y6DA 1K1JA 3VB5A 3ZZ7A 1GJDB 1OP0A 1UTNA 1NFUA 1NS3A 1HAZB 1B0EA 1Z6JH 1K28D 4CREA 1QJ6B 2PWXA 1JXPA 1QJ1B 1GMDG 3QZQA 1TGNA 3P8OA 3RDZA 3TGKE 3ELAH 3PV4A 1BQYA 3TK9A 1EB2A 1ELAA 3SNEA 4MPWA 3RC6A 2F9PA 1FUJA 2CN0H 3ZYDA 8KME2 1C2MA 4H6TA 2Y5HA 1Z8JB 2G51A 2FOGA 3MNBA 3M7UA 1GHXH 3SNCA 2FYQA 2LNCA 4KKDA 5TCCA 2DE9A 1D3PB 1VCWA 2WPHS 2F3CE 2ZHWH 4OS5A 2AIQA 3GCHC 2BQWB 1IQIA 4MQAA 4RSPA 3MH7A 4IW4E 4CH2B 1NESE 1PYTD 1N6YA 3F1SB 2GCTC 1UK2A 5JYIA 2ZGHA 3MH6A 1ANBA 1UCYK 5ESTE 1RD3B 2WPMS 2G5VA 3SGAE 3M37A 5A0CA 1E37B 4WXVA 1THSH 2Y80A 1SPJA 3SJ9A 3ZZ8A 1HAHH 3UFAA 3ODFA 2Z94A 1XKAC 3DT0H 2QXGA 2TBSA 2QA9E 4YT6H 2VIDA 1ZSLA 1ABIH 3RC4A 2J92A 2BB4A 2XBXA 1FJSA 4FUGA 2CMYA 1KTTB 4AYYB 3SHAH 1NFYA 2VB0A 1SC8U 4WMEA 1A0JA 1K1LA 3SHCH 5L6NH 1H9HE 3SI3H 4HFPB 2ZCKP 2PKSC 3O8RA 1ZHPA 2SGAA 5J4QA 1BHXB 2QXIA 1CO7E 1JIRA 4X8TH 4E06H 1UTLM 5E2OA 1A0LA 1O5AB 4XDEA 4NFEA 1T4VH 1RIWC 4I8GA 1FMGA 1PJPA 1CT2E 1KSNA 1MKWH 2AGGX 3A8DA 4X0WU 4YOIA 2GMTB 2W3IA 3KQBA 4OGYA 2GDDA 1SGFG 2PFEA 1P2NA 2BY5X 1QFKH 3LC3A 1TPAE 7LPRA 2NU1E 1TYNA 1BRAA 2G55A 1O3DA 4ZKOU 1ZGIA 2ZU5A 4NIXA 5E0GA 1C2IA 3ZZDA 1ETTH 2Z9LA 1LKBA 3EYDA 3KGPA 2A4OA 1KIGH 3V13A 3LGVA 2A4RA 5A0AE 3U1JB 3SBKA 2GX4A 1UTPA 2FTLE 4NIWA 3VGCC 3QTOH 1MD8A 1AN1E 2QY0B 1VITF 4IMZA 4WF8A 1S83A 2VJ1A 1LPKB 1C2HA 1GMHG 4HZHA 1WCZA 3QTVH 2ILNA 2VGCB 1V2PT 5HGGA 1SG8B 2CF8H 1FIZA 2QF0A 1LHEH 2FOMB 2TIOA 1XUKA 2FEQH 4HI3A 2WPLS 5A8YA 1NT1A 2ZP0H 2G8TA 3PLKA 1O2PA 3BTDE 4I7YH 1YYY1 2BVSH 2Y82A 4MTBA 2SGPE 1YPEH 1S81A 5JBCS 8ESTE 1QY6A 2H9HA 1OWJA 3P95A 4U32A 1O2UA 1XVOA 1HXEH 1K1NA 1MBQA 1C2DA 1VJ9U 3RXCA 3MHWU 3T26A 1MTVA 3A84A 1SGPE 1GHBF 2XC5A 3ATKA 5F03A 1XVMA 4B2AA 1ZZZA 4UFEH 5HM2A 2OD3B 5FCKA 4B73A 4Y7AA 4PROA 1RGQA 1DE7H 3PB1E 1EQ9A 3TVJB 1EPTB 1UK4A 1OWIA 4NA7A 3OYPA 3N7OA 4X8UH 2UUJB 4KTSA 1GBMA 1OYTH 1GBAA 2BOHB 1TNIA 5EG4A 1Y3YA 3LT3A 4F4OC 1Z8IB 1KDQA 1G37A 3DD2H 1BRBE 1C4Y2 1C5XB 3FP6E 4AFQA 3A7XA 4NG9H 4ZHLU 5JDUB 2FOEA 4WVPE 3I78A 4NZLA 3T5FH 1GI0A 3SV7A 4ZH8A 1EAWA 4DW2U 5EQSA 2BD9A 1LQEA 2BVXH 2BQ6B 3HKIB 4YOGA 3ATMA 1F92A 4H42U 1KXFA 1O3NA 1AB9B 3P8FA 2QAAA 2AEIH 2FOCA 3UR9A 4B71A 1GDQA 2PW8H 1S6HA 5DP9A 2ZDNA 5DJ7A 5DP5A 1HAIH 1E0FD 1XKBC 1DT2A 1H9LB 3ZV9A 4Q2KA 1A46H 2BDBA 2BQ7B 1DM4B 1NO9H 3MO3A 1ETRH 4ISLA 1L4ZA 3ATIA 1PYTC 2TGPZ 3SOSA 2F91A 5HMAA 1THPB 3VXEH 6GCHG 1BMMH 3SGQE 5JPMH 4Y11E 1UTQA 5F8TA 3MI4A 3M5MA 3QX5H 4U01A 1T31A 3QGNB 2VGCC 4X2XA 1EP5A 1GHVH 1G3CA 3MTYA 1TA6A 3LJJA 3L33A 1CA0B 1F0UA 1T8NA 1QCPA 4X6MA 1FONA 1BRUP 3E6PH 3LH3A 3A7YA 2QIQA 2VIQA 1FAXA 4Y10E 2FLRH 1EAXA 3NUMA 1NPMA 1XUFA 4BTIB 1EZXC 1NZQH 1ACBE 1L0ZA 1TPPA 2C8XB 1AD8H 2AGEX 2ZPQA 1DXWA 4X1SU 1DANH 1D9IA 2Z6BD 3GDUA 3UWJH 2VH0A 3PMBB 1VGCC 1LPZB 1P02A 4FUHA 1V2ST 1V2QT 1WQSA 2XWAA 4YO9A 3LONA 3NCLA 2A2QH 1WU1A 1OKXA 3SV8A 3TJVA 3SN8A 3UQVA 1P3CA 1Z1IA 2J4IA 3SU2A 1W0YH 2ZECA 4ZXXH 1P9UA 5EQQA 4MG3A 2AMPA 1O2OA 3QK1A 4UD9H 2BD4A 4BAKB 4K1EA 3RMNH 1TNKA 1C1OA 4CHAC 1SGCA 2QCYA 3ZZ4A 4GHTA 2STBE 2XXLA 2QF3A 5A0BA 1G2MA 1C5ZB 1OWEA 5FX5A 3GY3A 3DHKH 1K1IA 1KXEA 2R0LA 4K8YA 1OP8A 5GDSH 2Q6GA 2ZIQH 2JH5D 1MU6B 1K2I1 4ABGA 1BJUA 2BDAA 3DUXH 2FZZA 1ZSKA 4DURA 4NA9H 1KXCA 4Z6AH 1HDTH 3H7OA 5C1UA 4JYVH 4ZKSU 1VCPA 4ISNA 5EXNA 4D8NA 2H2ZA 2ZHDA 3ZV8A 3E90B 1C5PA 1DWBH 1MBMA 1YCPK 1BTYA 1GVZA 1ELEE 3MOCA 5DP3A 4INHA 4ABDA 2C90B 4ESTE 5HM9A 1BTPA 4UEHH 1Q31A 1KXDA 1TIOA 3CS0A 4AG2A 3GY7A 1NRRH 4BANB 1S85A 4GAWA 1P04A 2YNAA 1GI7B 1GI1A 2W7UA 1H8DH 6LPRA 2QXHA 4FUFA 1C9TA 1ZSJA 4AFUA 1O5FH 5LH8A 4Y79A 1FY5A 1QURH 3SJOA 2NU2E 1WUNH 5GJ4B 3M3VA 5AVDA 4ABIA 2G4TA 3RMMH 1MAYA 1QL9A 4MNVA 1Y5BT 1F7ZA 1ID5H 1NFXA 3V3MA 2VIOA 4XFQA 2BX3A 1C1WH 2YNBA 1LCYA 4DGJA 1SQOA 1MTNB 2UWOA 3EDXB 3EAJA 2P3UB 4FUJA 3VB3A 1W11U 4IGDA 3SJKA 2ODQA 4YLQH 2O8WA 3GY4A 2BDCA 2WPKS 2PSXA 4Y8XA 3BEIB 1IQEA 1RTFB 4BAHB 4IS5A 4AB9A 2XCNA 1JBUH 5DK1A 3H7TA 1HJ9A 5LPFA 1PQAA 1AKSA 2VIPA 1O2GH 1BIOA 3EGKH 1YPHC 3RM2H 2ZEBA 2FODA 1YGCH 3BG8A 1BCUH 4FUBA 4X1PU 5B6OA 1T32A 1LMWB 1XUHA 5JB8S 5AF9H 4A92A 4WXIA 1O2NA 3SORA 1G2LA 2F9UA 2C3SA 1EXFA 1ZLRA 1A0HB 2VU8E 4RKOB 4D76A 1GI3A 3RU4E 5DP6A 2BZ6H 3BTQE 3ZZ6A 3SU5A 5DP8A 3AVZA 5EU8A 1C1TA 1AGJA 2ZGXH 2GVFA 8GCHF 2GZ8A 5TCAA 3QZRA 1BMAA 1TAWA 3GISB 4XBBA 1WBGB 3S7HB 2JH0D 3UNSA 1C5VA 1IHSH 3T29A 4THNH 1BTXA 1YPLH 2JKHA 2OBQA 2C8WB 2OQUA 3RXJA 1W0ZU 4DG4A 1MKWK 4D9QA 5F8ZA 1AMHA 1C5LH 3M5NA 5CE1A 1AIXH 1O2VA 2FM2A 4D7GA 5DP7A 4DIIH 3BTFE 5FBIA 3SUEA 1LPGB 2ALPA 2EI8A 1LHDH 5E0HA 1MZAA 5LGOA 1C1UH 1GJAB 2ZTXA 1XMNB 4Q7ZA 4MNYA 5E8EH 1CSOE 1W10U 1XM1A 2Q6DA 4IBLH 1GJ8B 4CHAB 1O2WA 3EA8A 3KN2A 1O3CA 2XTTB 3PLBA 7GCHG 1C1MA 3SV2H 3RU4T 1UO6A 2A45B 3KQEA 1YPMH 4RN6A 3UUZA 9LPRA 9ESTA 3RXUA 5I46H 3RXLA 5IYTA 2OTVA 2ODPA 4JK6A 3FP8E 1TBRH 2BD3A 3BTWE 1TX6A 1C5QA 1BBRK 2SGDE 4NCYA 2VINA 1OX1A 1GBDA 4CRBA 1YCPM 1Y5AT 4D7FA 4BXSA 3ZVGA 2CGAA 1C2FA 2YOLA 3CS7A 3Q76A 4GSOA 1C2KA 3NKKA 2R0KA 1CU1A 3GY8A 1QA0A 3UWIA 2VWOA 2GV7A 4SGAE 3A80A 2ZDLA 3R0FA 4GHQA 5E2PA 1TABE 4YTAA 2F9OA 2GP9B 1O2LA 4AN7A 5EW1H 3KQCA 2QN5T 3QO6A 2P8OB 4YZUA 4BOHA 2JETB 3A7TA 3M7TA 4HGCA 1YC0A 2ZFPH 1HFDA 1C5SA 3RXHA 1LHCH 1QA7A 4YM9A 3S7KB 2NU4E 1YPJH 1GI2A 4Y71A 2J9NA 2FS8A 2ZGBH 4X2VA 4BAOB 4WH6A</