1VJAU

Urokinase plasminogen activator b-chain-jt463 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of novel and selective inhibitors of urokinase-type plasminogen activator with improved pharmacokinetic properties for use as antimetastatic agents
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords plasminogen activator, urokinase
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vjaU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vjaU01
2ZQ2A 1FY1A 1K1LA 1F5RA 1O2YA 1P03A 3W94A 1XUHA 4H42U 1HRTH 4SGAE 4U01A 1HV7A 1O3LA 4AG1A 4XFQA 1O2TA 4CRCA 3PLKA 1HAIH 3RLYH 3H7OA 3ZVDA 5GXPA 2NU3E 4Y10E 2CHAC 5G4BA 2VGCC 1CE5A 1EXFA 1K28D 1Y3WA 4JYUH 4IMQA 6LPRA 5TJXA 3M3TA 3M36A 1JIRA 2XBVA 2A31A 5FXLA 5T6FA 4GCHG 1Y3YA 1AUTC 5F8ZA 3M61U 1C5UA 3N7OA 5GJ4B 4NIYA 1BJUA 1K2I1 4X1PU 1GI9B 4FU9A 3SU3A 1AZ8A 1QTFA 2PTCE 4MNYA 3RU4T 5L30H 2C8XB 1DWEH 2BDYA 2GZ9A 1MTSA 4CH2B 1V2UT 5EQQA 2AGIX 2BZ6H 2H9TH 4X6PA 3S7KB 1SGYE 1SLXB 3ZYEA 2QYIA 2VWOA 3LU9B 3V0XA 4WH8A 1GMCG 4MNXA 2WYJA 2FI4E 3S9AA 3QK1A 1MTVA 1SLUB 1AY6H 3LOXA 1QBVH 2ZHFH 1KLJH 4NCYA 2J94A 4HGCA 1O30A 5E0HA 3KEEA 5FCKA 1O34A 1O2HA 4FUGA 1GBBA 3LIWA 1C5MD 2XTTB 1W0YH 4NIXA 1IQHA 2ZFQH 5DP8A 1WQVH 5EW1H 1YM0A 1HDTH 1EP6A 3SQHE 1H4WA 4B71A 5CHAB 2Y7ZA 4Q80A 5PTPA 3PO1B 1HGTH 4E7NA 1F0SA 1TGTA 2WPHS 3QLPH 3M5NA 5EPNA 4AG2A 1ZPBA 2V3HH 1SLVB 1GMDG 1GCTB 2KAIA 5ESTE 1DY9A 1C5OH 4X6MA 4IW4E 4GCHF 4Y7BA 4DT7B 2BZAA 1TPAE 2RA3A 4RSPA 3SU2A 1AWHB 1G30B 1BMNH 3PM3A 5FX6A 3RXVA 1CA0B 1W14U 3T27A 2QXGA 2A5IA 8KME2 1UVOA 5J4SA 1HJ9A 1CBWC 1Y5AT 3MWIU 3A7WA 5A09A 1H8DH 1WTHD 2P8OB 1THSH 1MZAA 2FOFA 3VGCB 4B73A 5DO4H 1EZUC 2GMTC 3GY5A 3M7UA 3OU0A 4BTUB 1XUJA 1K1IA 1LHDH 3SHAH 1QA0A 2FO9A 1BBRH 2R2MB 1UTMA 1GI7B 3PV4A 1ELCA 1BCUH 1DXWA 2ZFRH 1J16A 1KTTB 2PR3A 4K3JA 2VIDA 1NU9A 4FUIA 2TIOA 1DWCH 2O9QA 3E0NB 1CT4E 3LONA 3U9AH 1GHZA 3SJ8A 1GHAF 1O2XA 2ESTE 3Q3XA 3LH1A 3BTKE 4KGAA 1EJNA 2H9EH 5F03A 1TRNA 2VVUA 4A5TS 2P95A 1UVPA 3RXFA 1TWXB 3RXSA 2ZU1A 3PO1C 3ZYDA 1V2LT 2Q6FA 2A1DB 1D9IA 2J92A 2PSYA 3ESTA 1P01A 4DURA 4IMZA 1D6WA 4D9RA 3VXEH 1SL3A 4HI3A 1G32B 5CE1A 1FLEE 4CH8B 3S9CA 2ZG0H 1HAHH 2R9PA 1JOUB 1SGQE 1TBQH 4UD9H 1WV7H 1GCDA 1P2JA 1O2ZA 4DG4A 1SI5H 1EX3A 3M5LA 1C2KA 2PUXB 3UR6A 1GI3A 3ITIA 1D3QB 1EATA 1N6YA 1NROH 1O5AB 1O3EA 1PPZA 2AEIH 1YGCH 1RTLA 4CRGA 3L6PA 1QHRB 1CBWB 1O2LA 2ZEBA 1C1MA 4ZH8A 4BAQB 1ZTKA 4TWYA 4DCDA 3ENSB 5A8ZA 1RJXB 2GTBA 2CF9H 1THPB 1MCTA 2ZHEH 1SOZA 1OYQA 1AVGH 3PMBB 4YTAA 3ZVFA 4H6TA 1O32A 1C2HA 1Y3UA 3MU1A 3HGPA 1Z8IB 2DE8A 2XBXA 1T4UH 4B1TA 1HAVB 2G00A 3AAVA 2OP9A 4JZEH 4WWYA 3F9HA 1C2JA 4YZUA 1VJAU 2ZU2A 2YOLA 3RXBA 1GHBG 1P9SA 2Q6GA 3A85A 3E6PH 3MNSA 5CHAC 4Q2KA 3TGJE 4RKOB 1GVKB 2ZGCA 2Z9KA 2PKAA 1GG6C 1S0RA 2BLWA 4CREA 3GISB 1ELVA 2F9OA 5DG6A 4D7FA 5LH8A 4O9VA 2P3TB 1SFIA 4Y7AA 2WPMS 4WMFA 3RC6A 2Y5FA 3ZVGA 1O37A 3E16B 1WU1A 3GCNA 3MU8A 2FMJA 1MQ6A 1ZHPA 3AAUA 3PLBA 1GBJA 4FUDA 4IC6A 3TVJB 1GJ4H 2Z3DA 5C3NA 5EXLA 5EODA 2KAIB 4BOHA 4IC5A 2BD2A 1C2EA 4JYVH 2ZU3A 3FP6E 3PLPA 1HAPH 2JH5D 4NA7A 1EAUA 5E0GA 1EZSC 2VNTA 2ZPRA 5FBEA 1BBRE 3RXTA 1P2NA 1HAXB 2Y5HA 1ACBE 3MNBA 5JBBS 1IQIA 1O3BA 4ASHA 3MH5A 1IAUA 2ILNA 1C1OA 2BVXH 1RRKA 1O3MA 4OS7A 6CHAB 2J9NA 1EP5A 3LC5A 3M7QA 1Z7KA 4AN7A 1SGCA 4JZIA 5EW2H 2V35A 2FOGA 4ISIH 2NU2E 3ODDA 3BTEE 4UFFH 1ZMLA 5T6GA 1O35A 1DSUA 5A0AE 1A1RA 5JYIA 2FP7B 1GJ7B 1PQ7A 4UDWH 3SUFA 3MU5A 3EA9A 1CVWH 2K1QA 1RXPA 2TGDA 4JCNA 1ELGA 1C2FA 4IN1A 1SB1H 2SGDE 2RG3A 3RU4E 3S0NA 2GDEH 2VINA 2VIPA 4XE4A 2Z6BD 1P09A 1GJCB 1O3GA 3RMMH 1HNEE 1QB1A 1YPHC 2UUYA 1ABJH 1SGFG 2OBOA 1CA8B 1HJ8A 1MTNB 3SV7A 2ANMH 4INHA 5GWZA 3RXOA 1KYNA 2GDDA 1UTJA 3PMAB 4CBOA 4E06H 5EQSA 4J2YB 1A46H 3PB1E 3K2UA 1MTUA 5ABWA 2BY5X 1QL8A 3FANA 5F8XA 1DITH 1K1NA 1AU8A 4Y8YA 2P93A 1C5RA 4I8LA 2VIQA 3T29A 2ODQA 3GCHC 1IQEA 1A2CH 1V2PT 3LT3A 1GVZA 4BXSA 1AZZA 2GX4A 2JKHA 2TGPZ 3P8NA 3P70B 3A86A 1A5IA 1LKAA 3RMLH 2QXJA 1C1RA 2Y82A 5GPIB 1SC8U 1SGTA 5JBCS 5FBIA 5ETXA 1K1MA 1TE0A 1A5GH 2H5DA 1EAXA 1EB1H 1XXFA 4YESB 3BTWE 3KF2A 1BRUP 1H1BA 2D2DA 1QQ4A 1QB9A 1FXYA 1OXGA 2NU0E 3UNSA 3RP2A 3KNXA 3URDA 4FVBA 4BTTB 1DPOA 4WMEA 1G9IE 1LQEA 3RXKA 4X8TH 1G3DA 1P06A 1UO6A 3K9XB 1SGRE 3TGIE 2Y7XA 3EAJA 2G4TA 2PWXA 1DLKB 2IN2A 1YF4A 1IHTH 5FCRA 3UWIA 3ZV8A 1GVLA 2BDHA 2ZIQH 1NPMA 2OC8A 2C4FH 1GBFA 7KMEH 1GGDB 3GCTF 5GIBA 2ASUB 1DS2E 1QA7A 1DANH 5TCCA 1DM4B 3MO3A 2FLRH 2WUCA 1UHBA 3QN7A 3U8RH 3UY9A 2CF8H 2SNWA 4AOQA 1QFKH 2WPKS 3O8CA 2C90B 2PSXA 2ZU4A 1ZSKA 2TGAA 1TLDA 2G51A 4NSVA 1GL0E 1QRXA 1VCQA 4HTCH 4WMDA 2F83A 3RMNH 3M37A 5C1XA 2W5EA 1ELDE 1LPZB 1F2SE 1W2KH 1O3KA 5FAHA 1L1JA 4O3UA 4CRBA 3GCOA 1CA0C 5DKMA 3H5CB 1DWBH 1GI6A 4WXIA 3EGKH 2O8UA 3BTME 1TMTH 3ELAH 2Q1JA 1S85A 4FVDA 1A0JA 2FODA 2RA0A 1O36A 3Q3YA 4UEHH 3DA9B 1ZR0A 2XW9A 1UJ1A 1XUIA 2PGBB 3L3TA 4XBBA 3CENA 3RDZA 2OC0A 2BVSH 3QUMP 1KXDA 5H4IB 2UWOA 1FONA 3HATH 1F92A 1SLWB 3C27B 2Z3EA 3STIA 1QURH 2Z94A 1QJ1B 1GI5A 2WYGA 1C5TA 2QCYA 4K2YA 1LHFH 3GICB 2HGTH 4Y11E 3B9FH 2ZDLA 1JXPA 1NRSH 1C5YB 3FP7E 1NS3A 2GCHF 4D8NA 3QWCH 2VWNA 4KP0A 2SGQE 1ETSH 1EAWA 1DY8A 3DHKH 1OKXA 3RXQA 1SGFA 3D65E 2W3IA 3P8GA 1F5KU 3BTHE 4TY6A 4B75A 2ZGJA 2A4OA 1P2KA 2HWLB 4FUJA 4Z6AH 1ESBA 2H6MA 2CHAB 1JMOH 3A8AA 3GY4A 7GCHG 3EE0B 2ZO3H 2QGRA 1P0SH 1RS0A 3UTUH 4NWLA 3U8OH 5C5NA 3I78A 1T31A 1HAGE 2HVXA 3U1IB 4X8UH 4KTCA 1JIMA 1D4PB 1QJ7B 3MFJA 1LHEH 1VZQH 2V0BA 3PTBA 1AFQC 3E8LA 1G3CA 2WPIS 1ANDA 1Y5BT 1CT2E 2FX6A 3SQEE 5E2PA 2HNTF 1CSOE 1GBMA 1DXPA 3SORA 2VGCB 1LO6A 1TGSZ 2QN5T 3HKIB 1ESAA 1TNIA 4FUEA 5EGMA 1NFUA 4BAKB 1FY5A 1BRAA 4A92A 1GWAA 1XUFA 3BF6H 1O2GH 2H9HA 3L33A 2AIQA 6GCHG 1C5WB 5GCHG 1ANEA 2WPLS 2AH4X 4JYTA 2BB4A 1SG8B 1JRSA 3EYDA 4KTSA 3ZZBA 4X1RU 3M3VA 2ZU5A 2OCVB 2HNTC 1P3CA 5HXFA 3BG8A 2AERH 1AKSB 1DUEA 2CJIA 3GY2A 1C5VA 4K69A 1GI4A 1TGCA 3NCLA 2P3FH 1LQDB 1BJVA 1FAXA 3F9EA 1O5BB 4UONA 3RXPA 2ZNKH 1FNIA 1ABIH 4RKJB 3RUOA 3T25A 4OS1A 1S83A 4D9QA 5HMAA 2VH0A 2IPHA 3STJA 1T8LA 1AQ7A 3V13A 4MNWA 1EJAA 3TH3H 3RM2H 1XUKA 4YOGA 1KY9A 1AB9C 2BDAA 2Z9JA 3MH7A 1QL9A 2PFEA 2FM2A 1L1NA 2BY8X 2AMPA 3A81A 1ELFA 5HGGA 2ZDVH 2HLCA 4HZHA 1YPEH 4NIVA 2FXRA 1O2KA 3KIDU 1BTZA 3PWBA 3LJJA 3UWJH 1C5LH 1O5CB 1V3XA 4X8VH 4AGKA 2P94A 1PJPA 5FPTA 4AFSA 3BTGE 1T8NA 2O8LA 4Y8ZA 1FPCH 2R2WU 3LGVA 3TH2H 1H9HE 2CMYA 1IQNA 1W11U 1Z71A 1P2IA 3GY7A 1IQMA 1ESTA 2M5TA 5JB8S 4Y0YE 1MD7A 3A80A 1CHGA 3SV2H 2EA3A 1P05A 1SBWA 4B2CA 4CHAB 1UHBB 1W3CA 4A1TA 4AB9A 1LMWB 1K22H 1TGNA 1ELTA 5E0JA 2R3UA 2XRCA 1QB6A 3ZZ6A 1O2PA 3IG6B 2ZDNA 1A0LA 3A8DA 1UCYH 4FUFA 1LHCH 2FPZA 1YPGH 4ZHLU 2C8ZB 1QRZA 4OGXA 3SBKA 2UUFB 1KXFA 3UR9A 3TH4H 4A1VA 4X2WA 3KQDA 1YYY1 1G37A 1OS8A 5EU8A 2FOAA 4Y71A 1AVWA 2PKAB 4MPVA 5B6OA 5I46H 4FXGH 1NY22 1XUGA 1TONA 1FMGA 1V2RT 2C93B 2J2UA 2P3UB 1PFXC 5K7RA 1C1SA 1UVTH 3GCTG 3VEQB 3GYMA 7GCHF 2AIPA 2TBSA 1J9CH 2BLVA 3HK6B 3MO9A 1O3DA 1B0EA 4BANB 3OY5U 1TNHA 1O5GH 5BRRE 2OUAA 1Q2WA 1B0FA 1HLTH 4WVPE 1F0UA 1ZHMA 4K8YA 4LZ4B 2OINA 1C5QA 1GHBF 3P8OA 4AFZA 3MU0A 1NZQH 1O38A 1XX9A 1C2MA 5DP5A 3UIRA 3A7ZA 1MZDA 1NFYA 1YCPM 2ZPSA 3AW0A 4J1YA 4NFFA 4OS2A 5AFYH 3ODFA 3AW1A 4I7YH 2G8TA 2ZHQH 1GCTC 5IDKA 2XXLA 1EJMA 2DUCA 3T26A 2FX4A 2SGAA 5A8YA 1ARBA 5DP9A 2GT7A 3A7TA 1TX7A 1GPZA 1KXAA 1BRBE 1HBTH 3IWMA 1BHXB 1UK4A 3GDSA 4NG9H 2ZTXA 1O2VA 3EDXB 2XWAA 1GBAA 4B2AA 1MMJN 2GVFA 1O3HA 1LPKB 1LVOA 4K60A 1LCYA 3QTOH 2LNCA 4B2BA 1Y5UT 2EI8A 2XC0A 1EPTA 1DLEA 3RLWH 4NGAH 2BYAX 2J4IA 3CS7A 1FIZA 2ZFFH 5IYTA 1FJSA 3URCA 1O5EH 1VGCC 2NU1E 1SR5C 4FUBA 3A82A 4MLFB 1D3TB 4YT6H 3CS0A 1ZRBA 2QV1A 3D23A 1ELBA 2UUKB 1CU1A 1SGDE 3PMHB 7ESTE 3A89A 1ETTH 1O2JA 1TNKA 3RXAA 1J15A 1HAZB 3ZVCA 2BTCE 2BXTH 4U30A 1BMAA 1GMHF 1QRWA 3O8BA 2A2QH 3MU4A 3M5OA 4JZDH 3M35A 1GI8B 1TYNA 4JK5A 2VB0A 4ZROA 2FOEA 1A3EH 2XBWA 4NSYA 1O2RA 5FX5A 2GV6A 5L6NH 1YCPH 2PHBA 3B23B 5J4QA 1SGPE 2QIQA 1N1LA 2FS9A 1FV9A 1Z1JA 1L1GA 2QAAA 4O03A 1ZPCA 3DFJA 2O8TA 2XNIA 3RMOH 2W7SA 1BB0B 1SPJA 3S7HB 3HGNA 5FHTA 1NRPH 1ZSJA 1TOCB 1XXDA 1P2OA 5EG4A 4K1TA 1TGBA 5EOKA 3FZZA 1FN6A 2GZ7A 2UWLA 5C5OA 1IQLA 4INKA 3QDZB 1DVAH 1JBUH 1C1WH 1TQ0B 1HPGA 2A5KA 2OC1A 3LC3A 1J17T 1ZLRA 2H2ZA 2VVCA 1C4Y2 5EQRA 3Q00A 1C1PA 2AMQA 3B8JA 4H4FA 1GJ8B 2LPRA 2OQ5A 1MTNC 1FDPA 3VB7A 1GI0A 1RD3B 1RIWC 4NIWA 3MTYA 1EB2A 4NA8A 3VFEA 3LGWA 2VWLA 3AASA 2BD8A 5CMXH 1MKWK 1BTUA 4AX9H 1P12E 1YLDA 2YNBA 2ZDMA 2SGPE 3SJIA 3O8RA 3FAOA 1Z8JB 1Z6JH 3SOSA 4KELA 1O2WA 5T6DA 2QF3A 8LPRA 4ZKOU 2G81E 1QY6A 1BIOA 3MI4A 1ZOMA 1YC0A 4ISLA 4TY7A 3UOPA 4ABAA 1H8IH 2HPQH 1W7GH 2FTLE 2BM2A 3HPTB 3NXPA 4LOYH 3SU4A 2XC5A 2SGEE 5AF9H 4MDSA 1OWJA 3E90B 1OYTH 1UTOA 1OSSA 1T7CA 1XKAC 4CRAA 2J95A 4VGCB 2JETB 1V2ST 1KSNA 4OS5A 1HIAB 2ZDAH 3S69A 4A7IB 3UPEA 1OP2A 3TPIZ 2EI7A 4F49A 1NRNH 3G01A 3BEFB 4XBCA 1J14A 2A4GA 1O2QA 1WQSA 4MPWA 1ARCA 4ZAEA 5HM2A 3TITA 1EOJA 4WF8A 3RM0H 1HXFH 1BHXF 3ATKA 3SU5A 1E34B 2A4RA 5FPSA 3HKJB 2BOKA 1MU6B 4BAMB 1INCA 1FQ3A 3QZRA 5LPFA 1DFPA 1TRMA 1FI8A 1Y8TA 3ZZ7A 2CXVA 1S6HA 3TJOA 1GHWH 3QGNB 4CR9A 4Y0ZE 2Y80A 3NUMA 4I33A 1GDUA 5A2MH 2FIRH 2O8MA 3U8TH 1YKTA 4NZLA 5HYOA 2W3KA 4YOJA 3D49H 4ZHMU 2VU8E 1IQKA 2FOMB 1C1VH 4ZKSU 1BTHH 1PYTD 1MD8A 4E7RG 1EZXC 3TLOA 1O0DH 2VIOA 2ZHWH 4I8GA 2GCTB 2Z9GA 4MNVA 3K65B 1YLCA 1MKWH 1O3AA 1TOMH 2A7CA 3A8BA 1D3PB 1HFDA 1DDJA 4KTUA 1NU7B 1Y3XA 3ZVBA 1GJ6A 1N8OB 1C4V2 1O2UA 1YPLH 5DK1A 1C5SA 1BBRK 2XYAA 4FUHA 4E05H 4WY3A 3TK6A 4Y79A 2TRMA 3DT0H 1AI8H 1BA8B 4Y76A 4YOIA 1AUJA 1Y3VA 4X0WU 1U6QA 2F3CE 4I32A 2DE9A 1SHYA 1VR1H 3E0PB 4YLUA 4ABIA 1HYLA 5C2ZA 2C3SA 1Z6EA 3OSYA 3MH4A 4IN2A 3UQVA 1LKBA 3F9GA 2WPJS 3RXMA 8ESTE 1WCZA 3A88A 4Q7YA 1PPFE 1C2LA 2Z7FE 3NZIA 2JH0D 3GDUA 1BZXE 5LPEA 3SN8A 1C1TA 4ISOA 5E2OA 1E37B 1QBOA 3VB5A 4ABBA 4K5ZA 1LVMA 1SGEE 2FDAA 1F0TA 1ZTJA 1ZSLA 2GT8A 3BIVH 3GYLB 1MAYA 2BY7X 3BSQA 4GSOA 3SNAA 4YT7H 2ZGXH 2F9VA 3GDVA 2OQUA 1S0QA 2BQ6B 2ZFSA 2ZTYA 1TMUH 2ZA5A 2D8WA 4OS6A 4D76A 1YP9A 1L0ZA 4IGDA 4AB8A 3MH6A 1HJAB 2BQ7B 1N8OC 3BG4B 1DE7H 1SSXA 1ZMJA 2BX3A 2CV3A 1QL7A 3MNXA 3TJUA 4VGCC 1K21H 2P8OC 1HUTH 1SGIB 1ZPZA 1NO9H 1RFNA 2Z3CA 3MHWU 1GMCF 2BD7A 4X1QU 1DUAA 2OTVA 3SZNA 1C9TA 1XVOA 3SV9A 1NM6A 1YPHE 3CP7A 3A83A 1ZHRA 3SJOA 2THFB 1A0HB 4TWWA 1QGFA 3BN9A 1E38B 3NWUA 1UTKA 3JZ1B 4XBDA 1A5HA 3ATWA 1O3OA 2QA9E 3VXFH 4U32A 2G55A 2VIVA 4ZKRU 2R0KA 1RTFB 2ZCKP 4IS5A 1TPOA 3UFAA 3KQEA 2WINI 5DP4A 1BQYA 1GDQA 4X2XA 2G5NA 1C2GA 5JB9S 4DIIH 1B5GH 1O2OA 4CRFA 1GI1A 1PQAA 3TK9A 2FYRA 5C1YA 1THRH 1GJBB 2VJ1A 1D3DB 2J38A 3RXGA 4JZ1A 1C1NA 2BMGB 2ZC9H 1CO7E 5T3HA 1IOEA 1GMDF 1GBTA 4ABGA 1QQUA 4MQAA 2AMDA 2BD9A 1L4DA 3HK3B 1IQJA 3LJOA 2GZ8A 3DD2H 4K1EA 2Z9LA 1CGJE 2A4QA 2BY9X 1OWEA 1KLIH 1YCPK 4R8TB 4Z0KA 1H9IE 1S5SA 3RXHA 2GGVB 1GBEA 4AFQA 4ZMAH 1PPGE 1FN8A 5ESBA 3P17H 3RXJA 3GY8A 1C9PA 4LK4A 2HNTE 2XWBI 3M3SA 1VCWA 1SQTA 1NC6A 1T8OA 3UQOA 2VH6A 1EUFA 5LGOA 2BY6X 3NK8A 3RC4A 3T2NA 3UNQA 1PPEE 3RXIA 1Q3XA 1P3EA 1QJ6B 2CGAA 1PQ5A 5A8XA 1O2NA 2ANWA 2AFQB 1AMHA 3KQBA 1AD8H 5C20A 4ZKNU 1FY3A 1O31A 3QO6A 4CHAC 6GCHF 1G3EA 1K1OA 2VIWA 3OX7U 5FPYA 2A0QB 1GHAG 1C1UH 2RDLA 4NFEA 4XDEA 4D7GA 2CN0H 1ZJKA 2G5VA 5DP6A 1ANBA 2UUJB 3SUDA 1NT1A 4ISHH 3PROA 2RCEA 2BHGA 1AE5A 3MOCA 4X2YA 1AVXA 1P2MA 4UFGH 1TNJA 1UCYE 4UE7H 4JZFH 2WUBA 4WJG2 1MTWA 2ODYB 1GHXH 1VGCB 1UVSH 4ESTE 3BIUH 2EC9H 1AFQB 5F6MA 2NU4E 3BV9B 2QY0B 1BRCE 2C8WB 5AFZH 5L2YH 4DW2U 5TCAA 3V3MA 1ZJDA 1H9LB 2BDIA 1MU8B 2BOHB 1AN1E 4JK6A 3FP8E 2BX4A 3LGIA 1NRRH 1PYTC 3VB4A 1GBCA 2BDGA 1W7XH 2ZFPH 5C1UA 1HAYB 1C5PA 2FS8A 1P57B 1WTGH 3VB6A 3E3TA 4OS4A 5EXNA 2BD5A 4ABEA 3QTVH 1IQFA 3ZVAA 1G36A 1NFWA 4GUXA 3GY6A 5GDSH 4AYVB 4GVUA 1V2MT 2QXHA 1T4VH 3OYPA 3RC5A 1GJAB 2BLQA 2SGFE 1XKBC 3SNDA 1UVUH 1NTPA 1O5FH 4TYDA 4X6OA 1W10U 1YBWA 1MCVA 2JETC 3EA7A 3KL6A 1UTLM 3T62A 1AHTH 3M7TA 1ZRKA 3R3GB 3A7VA 3BEIB 1AKSA 1V2KT 5GCHF 1KIGH 1CGIE 3RXDA 3P95A 2XC4A 3O8DA 4LZ1H 5EPYA 1XM1A 1TAWA 1TALA 2D26C 3K6ZA 2ZQ1A 1IHSH 2SNVA 1GHYH 1BUIA 3MNCA 4AFUA 1C1QA 2QF0A 2A5AA 1EAIA 4ISNA 3SNEA 4GHTA 1Q31A 2P16A 1PPCE 1BMLA 3DUXH 3Q76A 1S84A 5AHGH 3LKWA 9ESTA 1HB0B 4ZXXH 1PPHE 2ZGBH 2BDBA 4LXBH 4NWKA 1BTWA 2FI5E 1GL1A 1KDQA 1TNLA 1VITF 4AGJA 4FU8A 1EKBB 2ALVA 3BEUA 1AO5A 2D1JA 2GV7A 4AORA 1C5ZB 1OWIA 1YPJH 1DICA 2A7HA 1V2OT 1FY4A 5A0CA 1L2EA 1QCPA 4JMYA 2PUQH 4X1NU 1SMFE 2WV4A 3VB3A 4H6SB 3FZDA 3RU4D 3U98H 1QNJA 5L2ZH 2AGGX 1OP0A 1TRYA 1BTXA 4YM9A 1LHGH 2GMTB 4Y6DA 4YO9A 4SGBE 3VGCC 2I6QA 3BTTE 5HM9A 1NN6A 1ELAA 4WH6A 1AB9B 2B7DH 2PW8H 1O3NA 2V3OH 4QT8C 1O33A 1EZQA 2ZF0H 4HFPB 1TPSA 4MVNA 2BD3A 1EQ9A 1SFQB 4BNRA 2B9LA 3ZZ3A 1OWKA 9LPRA 1XVMA 3SGBE 4YLQH 3KCGH 1MBMA 3GCHB 4DVAU 1FIWA 1XMNB 1IQGA 1AE8H 1O5DH 1UTQA 2FESH 2Y81A 1A7SA 2FOHA 1ID5H 4R0IA 3ZZCA 1WOFA 1KXEA 1UK3A 2O8WA 3PTNA 4X1SU 1DX5M 2FZZA 3LPRA 3SU6A 2ANYA 3I29A 3TJNA 4KKDA 3A7YA 1F0RA 1GDNA 1TPPA 1WAYB 1HIAA 1LVYA 1AFEH 4X2VA 1MQ5A 1C5NH 1OPHB 3KN2A 1O3PB 3UNRA 2F9NA 3RXLA 3LDXH 4XSKU 5JPMH 2ODPA 1TX6A 3TGKE 1NFXA 1P8VC 3MYWA 1TA2A 2Z9IA 1C2DA 4GLYA 1GMHG 1Z8RA 2NWNA 3A84A 3SJ9A 1FAKH 1P9UA 1TBRH 1W0ZU 1ZMNA 2AGEX 5F8TA 2P59A 4GPGA 4I8KA 1TBZH 3BTQE 4WXVA 4BAOB 1TX8A 2FOCA 4THNH 1OP8A 1KLTA 1JRTA 3OY6U 1C5XB 2QXIA 3A87A 3ZZ8A 4UFEH 5A0BA 5JBAS 1GBIA 3WY8A 3SUGA 2ANKH 1KTSB 3ATLA 2PTNA 3KHVA 3SI3H 6ESTA 1HCGA 4DOQA 2EI6A 1BTPA 1VCPA 2FWWA 4AZ2B 3A8CA 2F9PA 3OTJE 2PV9B 1EPTB 1MBQA 3RXCA 1A61H 1BT7A 2BXUH 1ZZZA 3DFLA 1RGQA 1YPKH 4INLA 1V2WT 3F9FA 1DWDH 3EQ0H 4PROA 1J8AA 2IJOB 1S81A 1WSSH 3SO3A 1BMMH 1V2VT 4MPXA 4B74A 3E91A 1SOTA 1BTYA 4Q7XA 1GI2A 3FFGA 1TIOA 4ABFA 1LVBA 3F6UH 4MPUA 3ZZDA 1SVPA 3ZZ9A 4NA9H 3SNCA 5DPAA 1E36B 2GD4B 1P04A 4K1SA 3ZZ5A 1TMBH 1GJDB 3KQCA 2F91A 3RXUA 4IBLH 1A4WH 1MKXH 1GG6B 4RN6A 1V2JT 2ZDKA 2PLXA 2ZCLP 4A6LA 1LTOA 1BOQA 4CRDA 5I25A 3ZZ4A 2IOTA 4DJZB 2V6NA 5E8EH 1VITG 3D62A 1P11E 1BITA 3MMGA 1X7AC 3TNTA 1O3IA 1Z1IA 1B7XB 4I31A 4I8HA 2OBQA 3P8FA 2PKSB 2XCNA 4DY7B 2AYWA 2TGTA 1HJAC 1W12U 4FUCA 2B5TB 3KGPA 3UREA 1CQQA 1QBNA 3SHCH 3TJVA 2ZHDA 4K8BA 1O3JA 1QR3E 3AVZA 5C67A 1P10A 2BVRH 3SU1A 1AWFH 1D6RA 1UTNA 1FPHH 3BTDE 3A7XA 8GCHF 3NPSA 1OX1A 2A45B 1TNGA 4OGYA 1K1JA 1BDAA 1TQ7B 4FU7A 2ZFTA 4NZQA 1Y59T 4ZXYH 3H7TA 1ORFA 3SGQE 2AS9A 1W13U 1N6XA 3LH3A 4DIHH 4O97A 5DP7A 1GBHA 1MUEB 1F5LA 1O2MA 1FY8E 5JBTA 4Q7ZA 2W7UA 1NESE 1Z8GA 3Q3KA 1MH0A 3SNBA 1QIXB 2PKSC 4ZHAA 4BTIB 3C1KA 1KXBA 1T8MA 4A1XA 3LGYA 1C2IA 2R3YA 1OOKB 3GOVB 3S9BA 2WV5A 1L4ZA 2ZKSA 1ANCA 1CHOG 2H5CA 2ZI2H 2FOBA 1HAOH 3I77A 1JWTA 1FUJA 1DSTA 1FZZA 1KDQB 4TPYA 2F9UA 1YPMH 3E1XB 4MTBA 1GBDA 1E0FD 2W26A 3TIUA 1S82A 2B8OH 2FTMA 4O3TA 5DJ7A 1WYKA 3QZQA 1RIWB 3ATIA 1C4U2 1TB6H 1GBKA 3U69H 4DGJA 4ZUHA 2Q6DA 1RTKA 3TK5A 1CT0E 4I8JA 3SJKA 3SI4H 1PPBH 2J34A 3VPKA 3GY3A 2ZGHA 1SGNE 2ALPA 3K6YA 1VITH 2A7JA 2G4UA 4X6NA 8GCHG 3BTFE 2Y5GA 1O2IA 3RXEA 4ABHA 1DT2A 1TFXA 4GAWA 1K1PA 3SU0A 1PQ8A 1O3CA 2JH6D 1GJ9B 1V6DA 2VWMA 1V2QT 3PYHA 3TNSA 6CHAC 2OD3B 2BD4A 1GGDC 1ZGIA 3LGUA 3QX5H 3ZZAA 1TABE 4ABDA 2VVVA 1SHHB 1V2NT 2C8YB 2FEQH 2GP9B 2STAE 1SQAA 4MG3A 2HRVA 3PMJA 1NRQH 2PGQB 2BQWB 5BPEA 1LDTT 1ZYOA 2GCTC 5EXMA 4U2WA 2BDCA 1P02A 1CHOF 1V2TT 4X8SH 5AVDA 1TA6A 3NKKA 1DOJA 2ZTZA 2G52A 2QC2A 3U1JB 3W95A 2GCHG 5SGAE 1MKXK 1GBLA 1ETRH 2ZCHP 3P6ZB 4B76A 2EEKA 1GJ5H 3ATMA 1KXCA 2HPPH 4BXWA 1AGJA 1A3BH 1VJ9U 2TPIZ 4ABJA 1W8BH 3F1SB 2ZZUH 4XOJA 3T5FH 2ZWLH 1EPTC 2A2XH 3TU7H 3PWCA 4BAHB 3LGTA 3MO6A 1ZGVA 1ELEE 1M9UA 2R0LA 2UWPA 1EOLA 2I6SA 3V12A 2F9BH 3JZ2B 2FI3E 1F7ZA 1ZTLA 2HOBA 3UUZA 1UK2A 3V7TA 1CGHA 7LPRA 4F4OC 5JDUB 4TPIZ 2SFAA 3ZVEA 1T32A 1LPGB 3SV8A 1O3FA 3IITA 2Y6TA 1S6FA 1EASA 1AIXH 1OWDA 2FYQA 4CBNA 1WUNH 1G2MA 1OWHA 2A32A 3T28A 2GKVE 2XBYA 4M7GA 2ULLA 3Q77A 3RXRA 3ZV9A 3SV6A 3QGJA 2OC7A 3P92A 4GHQA 4CR5A 2BLOA 5LPRA 4AYYB 1O2SA 5DP3A 1G3BA 3EA8A 2OLGA 3SW2B 3FVFB 3UOUA 2ZECA 1MAXA 3M5MA 3SGAE 3SUEA 2FLBH 3BG4C 1K9OE 2YNAA 2ZP0H 1HXEH 1SQOA 1UTPA 1P2QA 2HALA 1UCYK 2XCFA 1GHVH 3R0FA 1E35B 1HAVA 2ZPQA 5K0HA 2B0FA 2OXSA 4UFDH 1UMAH 3F68H 4Y8XA 1WBGB 1O39A 2H1UA 5DGJA 2STBE 1G2LA
chains in the Genus database with same CATH superfamily
2ZQ2A 1FY1A 1K1LA 1F5RA 1O2YA 1P03A 5HIZA 3W94A 1XUHA 4H42U 1HRTH 4SGAE 4U01A 1HV7A 1O3LA 4AG1A 4XFQA 1O2TA 4CRCA 3PLKA 1HAIH 3RLYH 3H7OA 3ZVDA 5GXPA 2NU3E 4Y10E 2CHAC 5G4BA 2VGCC 1CE5A 1EXFA 1K28D 1Y3WA 4JYUH 4IMQA 6LPRA 5TJXA 3M3TA 3M36A 1JIRA 2XBVA 2A31A 5FXLA 5T6FA 4GCHG 5EJZA 1Y3YA 1AUTC 5F8ZA 3M61U 1C5UA 3N7OA 3PV2A 5GJ4B 4NIYA 1BJUA 1K2I1 4X1PU 1EFRD 1GI9B 4FU9A 3SU3A 3N7DA 1AZ8A 1QTFA 2KM0A 2PTCE 4MNYA 3RU4T 5L30H 2C8XB 1DWEH 2BDYA 2GZ9A 5KEDA 1MTSA 4CH2B 1V2UT 5EQQA 2AGIX 2BZ6H 2H9TH 4X6PA 3S7KB 1SGYE 1SLXB 3ZYEA 2QYIA 3PV5A 2VWOA 3LU9B 3V0XA 4WH8A 1GMCG 4MNXA 2KFWA 2WYJA 2FI4E 3S9AA 3QK1A 1MTVA 4XD7D 1SLUB 1AY6H 3LOXA 1QBVH 5T1VA 2ZHFH 1KLJH 4NCYA 2J94A 4HGCA 1O30A 5E0HA 3KEEA 5FCKA 3F0PA 1O34A 1O2HA 4FUGA 1GBBA 3LIWA 1C5MD 2XTTB 1W0YH 4NIXA 1IQHA 2ZFQH 5DP8A 1WQVH 5EW1H 1YM0A 1HDTH 1EP6A 3SQHE 1H4WA 3UAIC 5CHAB 4B71A 2Y7ZA 4Q80A 5PTPA 2KCYA 3PO1B 1HGTH 4E7NA 1F0SA 1TGTA 2WPHS 3QLPH 3M5NA 5EPNA 4AG2A 1ZPBA 2V3HH 1SLVB 2HLDD 1GMDG 1GCTB 2KAIA 5ESTE 1DY9A 1C5OH 4X6MA 4IW4E 4GCHF 4Y7BA 4DT7B 2BZAA 1TPAE 2RA3A 4RSPA 3SU2A 1AWHB 1G30B 1BMNH 3PM3A 5FX6A 3RXVA 1CA0B 1W14U 3T27A 2QXGA 2A5IA 8KME2 1UVOA 5J4SA 1HJ9A 1Y5AT 1CBWC 1W0KD 3MWIU 3A7WA 5A09A 1H8DH 1WTHD 2P8OB 1THSH 1MZAA 2FOFA 3VGCB 4B73A 5DO4H 1EZUC 2GMTC 3GY5A 3M7UA 3OU0A 4BTUB 1XUJA 1K1IA 1LHDH 3SHAH 3F2FA 1QA0A 2FO9A 1BBRH 2R2MB 1UTMA 1GI7B 3PV4A 1ELCA 1BCUH 1DXWA 2ZFRH 1J16A 1KTTB 2PR3A 4K3JA 2VIDA 1NU9A 4FUIA 2OK5A 2TIOA 1DWCH 2O9QA 3E0NB 1CT4E 3LONA 3U9AH 1GHZA 5HIYA 3SJ8A 1GHAF 1O2XA 2ESTE 3Q3XA 2WZQA 3LH1A 3BTKE 4KGAA 1EJNA 2H9EH 5F03A 1TRNA 2VVUA 4A5TS 2P95A 1UVPA 3RXFA 1TWXB 2IPQX 3RXSA 2ZU1A 3PO1C 3ZYDA 1V2LT 2Q6FA 2A1DB 1D9IA 2J92A 2PSYA 3ESTA 1P01A 3OEHD 4DURA 4IMZA 1D6WA 4D9RA 3VXEH 1SL3A 4HI3A 1G32B 5CE1A 1FLEE 4CH8B 3FN8A 3S9CA 2ZG0H 1HAHH 2R9PA 1JOUB 1SGQE 1TBQH 4UD9H 1WV7H 1GCDA 1P2JA 1O2ZA 4DG4A 1SI5H 1EX3A 3M5LA 1C2KA 2PUXB 3UR6A 1GI3A 3ITIA 1D3QB 1EATA 1N6YA 1NROH 1O5AB 2XOKD 1O3EA 1PPZA 2AEIH 1YGCH 1RTLA 4CRGA 3L6PA 1QHRB 1K0HA 1CBWB 1O2LA 2ZEBA 1C1MA 4ZH8A 4BAQB 1ZTKA 4TWYA 4DCDA 3ENSB 5A8ZA 1RJXB 2GTBA 2CF9H 1THPB 1MCTA 2ZHEH 1SOZA 1OYQA 1AVGH 3PMBB 4YTAA 3ZVFA 4H6TA 1O32A 1C2HA 1Y3UA 3MU1A 3HGPA 1Z8IB 2DE8A 2XBXA 1T4UH 2HVYB 4B1TA 1HAVB 2G00A 3AAVA 2OP9A 4JZEH 4WWYA 3F9HA 1C2JA 4YZUA 1VJAU 2ZU2A 2YOLA 3RXBA 1GHBG 1P9SA 5C17A 2Q6GA 3A85A 3E6PH 3MNSA 5CHAC 4Q2KA 3TGJE 4RKOB 1GVKB 2ZGCA 2Z9KA 2PKAA 1GG6C 1S0RA 2BLWA 4CREA 3GISB 1ELVA 1UW7A 2F9OA 4B6FA 5DG6A 4D7FA 5LH8A 4O9VA 2P3TB 3N7EA 1SFIA 4Y7AA 2WPMS 4WMFA 3RC6A 2Y5FA 3ZVGA 1O37A 3E16B 1WU1A 3GCNA 3MU8A 2GJGA 2FMJA 1MQ6A 1ZHPA 3AAUA 3PLBA 1GBJA 4FUDA 4IC6A 3TVJB 2QF5A 1GJ4H 2Z3DA 5C3NA 4P00A 5EXLA 5EODA 2KAIB 4BOHA 2J98A 4IC5A 2BD2A 1C2EA 4JYVH 2ZU3A 3FP6E 3PLPA 1HAPH 2JH5D 4NA7A 1EAUA 5E0GA 1EZSC 2VNTA 2ZPRA 5FBEA 1BBRE 3RXTA 1P2NA 1HAXB 2Y5HA 1ACBE 3MNBA 5JBBS 1IQIA 1O3BA 4ASHA 3MH5A 1IAUA 2ILNA 1C1OA 2BVXH 1RRKA 1O3MA 4OS7A 6CHAB 2J9NA 1EP5A 3LC5A 3M7QA 1Z7KA 4AN7A 1SGCA 4JZIA 5EW2H 2V35A 2FOGA 4ISIH 2NU2E 3ODDA 3BTEE 4UFFH 1ZMLA 5GNDA 5T6GA 1O35A 1DSUA 5A0AE 1A1RA 5JYIA 2FP7B 1GJ7B 1PQ7A 4UDWH 3SUFA 3MU5A 3EA9A 1CVWH 2K1QA 1RXPA 2TGDA 5EJ1A 4JCNA 1ELGA 1C2FA 4IN1A 1SB1H 2SGDE 2RG3A 3RU4E 3S0NA 2GDEH 2VINA 2VIPA 4XE4A 2Z6BD 1P09A 1GJCB 1O3GA 3RMMH 1HNEE 1QB1A 1YPHC 2UUYA 1ABJH 1SGFG 2OBOA 1CA8B 1HJ8A 1MTNB 3SV7A 2ANMH 4INHA 5GWZA 3RXOA 1KYNA 2GDDA 1UTJA 3PMAB 4CBOA 4E06H 5EQSA 4J2YB 1A46H 3PB1E 3K2UA 1MTUA 1BMFD 2KX4A 5ABWA 2BY5X 1QL8A 3FANA 3FKSD 5F8XA 1DITH 1K1NA 1AU8A 4Y8YA 2P93A 1C5RA 4I8LA 2VIQA 1H8HD 2ODQA 3T29A 3GCHC 1IQEA 1A2CH 1V2PT 3LT3A 1GVZA 4BXSA 1AZZA 2GX4A 2JKHA 2TGPZ 3P8NA 3P70B 4ACBA 3A86A 1A5IA 1LKAA 3RMLH 2QXJA 1C1RA 2Y82A 5GPIB 1SC8U 1SGTA 5JBCS 5FBIA 5ETXA 3EE7A 1K1MA 1TE0A 1A5GH 2H5DA 1EAXA 1EB1H 1XXFA 4YESB 3BTWE 3F3BA 3KF2A 1BRUP 1H1BA 2D2DA 1QQ4A 1QB9A 1FXYA 1OXGA 2NU0E 3UNSA 3RP2A 3KNXA 3URDA 4FVBA 4BTTB 1DPOA 4WMEA 1G9IE 1LQEA 3RXKA 4X8TH 1G3DA 1P06A 1UO6A 3K9XB 1SGRE 3TGIE 2Y7XA 3EAJA 2G4TA 2PWXA 1DLKB 2IN2A 1YF4A 1IHTH 5FCRA 3UWIA 2KCOA 3ZV8A 5B6LA 1GVLA 2BDHA 2ZIQH 1NPMA 2OC8A 2C4FH 1GBFA 7KMEH 2CK3D 1GGDB 3GCTF 5GIBA 2ASUB 1DS2E 1QA7A 1DANH 5TCCA 1DM4B 3MO3A 2FLRH 2WUCA 1UHBA 3QN7A 3U8RH 3UY9A 2CF8H 2SNWA 4AOQA 1QFKH 2WPKS 3O8CA 2C90B 2PSXA 2ZU4A 1ZSKA 2TGAA 1TLDA 2G51A 4NSVA 1GL0E 1QRXA 1VCQA 4HTCH 4WMDA 2F83A 3RMNH 4YXWD 3M37A 5C1XA 2W5EA 1ELDE 1LPZB 1F2SE 1W2KH 1O3KA 5FAHA 1L1JA 4O3UA 1S6LA 4CRBA 3GCOA 1CA0C 5DKMA 3H5CB 1DWBH 1GI6A 4WXIA 3EGKH 2O8UA 3BTME 1TMTH 2IJD1 3ELAH 2Q1JA 1S85A 4FVDA 5CDFE 1A0JA 2FODA 2RA0A 1O36A 3Q3YA 4UEHH 3DA9B 1ZR0A 2XW9A 1UJ1A 1XUIA 2PGBB 3L3TA 4XBBA 3CENA 3RDZA 2OC0A 2BVSH 3QUMP 1KXDA 5H4IB 2UWOA 1FONA 3HATH 1F92A 3DCLA 1SLWB 3C27B 2Z3EA 3STIA 1QURH 2Z94A 1QJ1B 1OHHD 2JJ1D 1GI5A 2WYGA 1C5TA 2QCYA 4K2YA 1LHFH 3GICB 2HGTH 4Y11E 3B9FH 2ZDLA 1JXPA 1SQRA 1NRSH 3KYGA 1C5YB 3FP7E 1NS3A 2GCHF 4D8NA 3QWCH 2VWNA 4KP0A 2SGQE 1ETSH 1EAWA 1DY8A 3DHKH 1OKXA 3RXQA 1SGFA 3D65E 2W3IA 3P8GA 1F5KU 3BTHE 4TY6A 4B75A 2ZGJA 2A4OA 1P2KA 2HWLB 4FUJA 4Z6AH 1ESBA 2H6MA 2CHAB 1JMOH 3A8AA 3GY4A 7GCHG 3EE0B 2ZO3H 2QGRA 1P0SH 1RS0A 3UTUH 2K8IA 4NWLA 3U8OH 5C5NA 3I78A 1T31A 1HAGE 2HVXA 3U1IB 2V3MA 4X8UH 4KTCA 1JIMA 1D4PB 1QJ7B 3MFJA 1LHEH 1VZQH 2V0BA 3PTBA 1AFQC 1KMHB 3E8LA 1G3CA 2L74A 2WPIS 1ANDA 1Y5BT 1CT2E 2FX6A 3SQEE 5E2PA 2HNTF 1CSOE 1GBMA 1DXPA 3SORA 3W1EA 2VGCB 1LO6A 1TGSZ 2QN5T 3HKIB 1ESAA 1TNIA 4FUEA 3H09A 1VKYA 5EGMA 1NFUA 4BAKB 1FY5A 4M9FA 1BRAA 4I86A 4A92A 1GWAA 1XUFA 3BF6H 1O2GH 2H9HA 3L33A 2AIQA 6GCHG 1C5WB 5GCHG 1ANEA 2WPLS 2AH4X 4JYTA 2BB4A 1SG8B 1JRSA 2J5UA 3EYDA 4KTSA 3ZZBA 3KYFA 4X1RU 3M3VA 2ZU5A 2OCVB 2HNTC 1P3CA 5HXFA 3BG8A 2AERH 1AKSB 1DUEA 2CJIA 3GY2A 1C5VA 4K69A 1GI4A 1TGCA 3NCLA 2P3FH 1LQDB 1BJVA 1FAXA 3F9EA 1O5BB 4UONA 3RXPA 2ZNKH 1FNIA 1ABIH 4RKJB 3RUOA 3T25A 4OS1A 1S83A 4D9QA 5HMAA 2VH0A 2IPHA 3STJA 3PRBA 1T8LA 1AQ7A 3V13A 4MNWA 4RI0A 3KQ5A 1EJAA 3TH3H 3RM2H 1XUKA 4YOGA 1KY9A 1AB9C 2BDAA 2Z9JA 3MH7A 5C0UA 1QL9A 2PFEA 2FM2A 1L1NA 2BY8X 2AMPA 3A81A 1ELFA 5HGGA 2ZDVH 2HLCA 4HZHA 1YPEH 4NIVA 2FXRA 1O2KA 3KIDU 1BTZA 2EQNA 3PWBA 3LJJA 3UWJH 2VBCA 1C5LH 1O5CB 1V3XA 4X8VH 4AGKA 2P94A 1PJPA 5FPTA 4AFSA 3BTGE 1T8NA 2O8LA 4Y8ZA 1FPCH 5HKKD 2R2WU 3LGVA 3TH2H 1H9HE 2CMYA 1IQNA 1W11U 1Z71A 1P2IA 3GY7A 1IQMA 1ESTA 2M5TA 5JB8S 4Y0YE 1MD7A 3A80A 1CHGA 3SV2H 2EA3A 1P05A 1SBWA 4B2CA 4CHAB 1UHBB 1W3CA 4A1TA 4AB9A 1LMWB 1K22H 1TGNA 1ELTA 2F43B 5E0JA 2R3UA 2XRCA 1QB6A 3ZZ6A 1O2PA 3IG6B 2ZDNA 1A0LA 3A8DA 1UCYH 4FUFA 1LHCH 2FPZA 5CHBA 1YPGH 2JJ2D 1WXRA 4ZHLU 2C8ZB 1QRZA 4OGXA 3SBKA 2UUFB 1KXFA 3UR9A 3TH4H 4A1VA 3SZEA 4X2WA 3KQDA 1YYY1 2L6OA 1G37A 1OS8A 5EU8A 2FOAA 3N99A 3OTPA 4Y71A 1AVWA 2PKAB 4MPVA 5B6OA 5I46H 4FXGH 1NY22 1XUGA 1TONA 1FMGA 1V2RT 2C93B 2J2UA 2P3UB 1PFXC 5K7RA 1C1SA 1UVTH 3GCTG 2RDEA 3VEQB 3GYMA 7GCHF 2AIPA 2TBSA 1J9CH 2BLVA 3HK6B 3MO9A 1O3DA 1B0EA 4BANB 3OY5U 1TNHA 1O5GH 5BRRE 2OUAA 3WW7A 1Q2WA 1B0FA 1HLTH 4WVPE 3U28C 1F0UA 1ZHMA 4K8YA 4LZ4B 2OINA 1C5QA 1GHBF 3P8OA 4AFZA 3MU0A 1NZQH 1O38A 1XX9A 1C2MA 5DP5A 3UIRA 3A7ZA 1MZDA 1NFYA 1YCPM 2ZPSA 3AW0A 4J1YA 4NFFA 4OS2A 5AFYH 3ODFA 4TT3D 3AW1A 4I7YH 2G8TA 2ZHQH 3DSGA 1GCTC 5IDKA 2XXLA 1EJMA 2DUCA 3T26A 2FX4A 2SGAA 5A8YA 1ARBA 2J97A 5DP9A 2GT7A 3A7TA 1TX7A 1GPZA 1KXAA 1BRBE 1HBTH 3DSOA 3IWMA 1BHXB 1UK4A 3GDSA 4NG9H 3WWFA 2ZTXA 1O2VA 3EDXB 2XWAA 1GBAA 4B2AA 1MMJN 2GVFA 1O3HA 4F48B 1LPKB 1LVOA 4K60A 1LCYA 3QTOH 2LNCA 4B2BA 1Y5UT 2EI8A 2XC0A 1EPTA 1DLEA 3RLWH 4NGAH 2BYAX 2J4IA 3CS7A 1FIZA 2V7QD 2ZFFH 5IYTA 1FJSA 3URCA 1O5EH 1VGCC 2NU1E 1SR5C 4FUBA 3A82A 4MLFB 1D3TB 4YT6H 3CS0A 1ZRBA 2QV1A 3D23A 1ELBA 2UUKB 1CU1A 1SGDE 3PMHB 7ESTE 3A89A 1ETTH 1O2JA 1TNKA 3RXAA 1J15A 1HAZB 3ZVCA 2BTCE 2BXTH 4U30A 5EJLA 1BMAA 1GMHF 1QRWA 3O8BA 2A2QH 3MU4A 3M5OA 4JZDH 3M35A 1GI8B 1TYNA 4JK5A 2VB0A 4ZROA 2FOEA 1A3EH 2XBWA 4NSYA 1O2RA 2PP6A 2GV6A 5FX5A 5L6NH 1YCPH 2PHBA 3B23B 5J4QA 1SGPE 2QIQA 1N1LA 2FS9A 1FV9A 1Z1JA 1L1GA 2QAAA 4O03A 1ZPCA 3DFJA 2O8TA 2XNIA 3RMOH 2W7SA 1BB0B 1SPJA 3S7HB 3HGNA 5FHTA 1NRPH 1ZSJA 1TOCB 1XXDA 1P2OA 5EG4A 4K1TA 1TGBA 5EOKA 3FZZA 1FN6A 2GZ7A 2UWLA 5C5OA 1IQLA 4INKA 3QDZB 1DVAH 1JBUH 1C1WH 1TQ0B 1HPGA 2A5KA 2OC1A 3LC3A 1J17T 1ZLRA 2H2ZA 2VVCA 1C4Y2 5EQRA 3Q00A 1C1PA 2AMQA 3B8JA 4H4FA 1GJ8B 2LPRA 2OQ5A 1MTNC 2KCAA 1FDPA 3VB7A 1GI0A 1RD3B 1RIWC 4NIWA 3MTYA 2KR7A 1EB2A 4NA8A 3VFEA 3LGWA 2VWLA 3AASA 2BD8A 1SKYE 5CMXH 1MKWK 1BTUA 4AX9H 1P12E 1YLDA 2YNBA 2ZDMA 2SGPE 3SJIA 3O8RA 3FAOA 1Z8JB 1Z6JH 3SOSA 4KELA 3F0OA 1O2WA 5T6DA 2QF3A 8LPRA 4ZKOU 2G81E 1QY6A 1BIOA 3MI4A 1ZOMA 1YC0A 4ISLA 4TY7A 3UOPA 4ABAA 1H8IH 2HPQH 1W7GH 2FTLE 2BM2A 3HPTB 3NXPA 4LOYH 3SU4A 2XC5A 2SGEE 5AF9H 4MDSA 1OWJA 3E90B 1OYTH 1UTOA 1OSSA 1T7CA 1XKAC 4CRAA 2J95A 4VGCB 2JETB 1V2ST 1KSNA 4OS5A 1HIAB 2ZDAH 3S69A 4A7IB 3UPEA 1OP2A 3TPIZ 2EI7A 4F49A 1NRNH 3G01A 3BEFB 4XBCA 1J14A 2A4GA 1O2QA 1WQSA 4MPWA 1ARCA 4ZAEA 5HM2A 3TITA 1EOJA 4WF8A 3RM0H 1HXFH 1BHXF 3ATKA 3SU5A 1E34B 2A4RA 5FPSA 3HKJB 2BOKA 1MU6B 4BAMB 1INCA 1FQ3A 3QZRA 5LPFA 1DFPA 1TRMA 1FI8A 1Y8TA 3ZZ7A 2CXVA 1S6HA 3TJOA 5KGOA 1GHWH 3QGNB 4CR9A 3MQKC 4Y0ZE 2Y80A 3NUMA 4I33A 1GDUA 5A2MH 2FIRH 2O8MA 3U8TH 1YKTA 4NZLA 5HYOA 4F55A 2W3KA 4YOJA 3D49H 4ZHMU 2VU8E 5F53A 1IQKA 2FOMB 1C1VH 4ZKSU 1BTHH 1PYTD 1MD8A 4E7RG 1EZXC 3TLOA 1O0DH 2VIOA 2ZHWH 4I8GA 2GCTB 2Z9GA 4MNVA 3K65B 1YLCA 1MKWH 1O3AA 1TOMH 2A7CA 3A8BA 1COWD 1D3PB 5C0TA 1HFDA 1DDJA 4KTUA 1NU7B 1Y3XA 3ZVBA 4RT1A 1GJ6A 1N8OB 1C4V2 1O2UA 1YPLH 5DK1A 5IK2D 1C5SA 1BBRK 2XYAA 4FUHA 4E05H 4WY3A 3TK6A 4Y79A 2TRMA 3DT0H 1AI8H 1BA8B 4Y76A 4YOIA 1AUJA 1Y3VA 4X0WU 1U6QA 2F3CE 4I32A 2DE9A 1QZ8A 1SHYA 4Z1MD 5C94A 1VR1H 3E0PB 4YLUA 4ABIA 1HYLA 5C2ZA 2C3SA 1Z6EA 3OSYA 3MH4A 4IN2A 2YMSC 3UQVA 1LKBA 3F9GA 2WPJS 3RXMA 8ESTE 1WCZA 3A88A 4Q7YA 1PPFE 1C2LA 2Z7FE 3NZIA 2JH0D 3GDUA 1BZXE 5LPEA 3SN8A 1C1TA 4ISOA 5E2OA 1E37B 1QBOA 3VB5A 4ABBA 4K5ZA 1LVMA 1SGEE 2FDAA 1F0TA 1ZTJA 1ZSLA 2GT8A 3BIVH 3GYLB 1MAYA 2BY7X 3BSQA 4GSOA 3SNAA 4YT7H 2ZGXH 2F9VA 3GDVA 2OQUA 1S0QA 2BQ6B 2ZFSA 2ZTYA 1TMUH 2ZA5A 2D8WA 4OS6A 4D76A 1YP9A 1L0ZA 4IGDA 4AB8A 3MH6A 1HJAB 2LELA 2BQ7B 4Q63A 1N8OC 3BG4B 1DE7H 1SSXA 1ZMJA 2BX3A 2CV3A 1QL7A 3MNXA 3TJUA 4FOUC 4VGCC 1K21H 2P8OC 1HUTH 1SGIB 3SYJA 1ZPZA 1NO9H 1RFNA 2Z3CA 3MHWU 4ASUD 1GMCF 2BD7A 4X1QU 1DUAA 2OTVA 3SZNA 1C9TA 1XVOA 3SV9A 1NM6A 1YPHE 3CP7A 1YLNA 3A83A 1ZHRA 3SJOA 2THFB 1A0HB 4TWWA 1QGFA 3BN9A 1E38B 3NWUA 1UTKA 3JZ1B 4XBDA 1A5HA 3ATWA 1O3OA 2QA9E 3VXFH 4U32A 2G55A 2VIVA 4ZKRU 2R0KA 1RTFB 2ZCKP 4IS5A 1TPOA 3UFAA 3KQEA 2WINI 5DP4A 1BQYA 1GDQA 4X2XA 2G5NA 1C2GA 5JB9S 4DIIH 1B5GH 1O2OA 4CRFA 1GI1A 1PQAA 3OEED 3TK9A 2FYRA 5C1YA 1THRH 1GJBB 3CNRA 2VJ1A 1D3DB 2J38A 3OAAD 3RXGA 4JZ1A 1C1NA 2BMGB 2ZC9H 1CO7E 5T3HA 1IOEA 1GMDF 1GBTA 4ABGA 1QQUA 4MQAA 2AMDA 2BD9A 1L4DA 3HK3B 1IQJA 3LJOA 2GZ8A 3DD2H 4K1EA 2Z9LA 1CGJE 2A4QA 2BY9X 1OWEA 1KLIH 1YCPK 4R8TB 4Z0KA 2JDID 1H9IE 1S5SA 3RXHA 2GGVB 2WV9A 1GBEA 4AFQA 4ZMAH 1PPGE 1FN8A 5ESBA 3P17H 3RXJA 3GY8A 1C9PA 4LK4A 2HNTE 2XWBI 3M3SA 1VCWA 1SQTA 1NC6A 5FL7D 1T8OA 3UQOA 2VH6A 1EUFA 5LGOA 2BY6X 3NK8A 3RC4A 3T2NA 3UNQA 1PPEE 2YMSB 3RXIA 2EY4C 1Q3XA 1P3EA 1QJ6B 2CGAA 1PQ5A 5A8XA 2WPDD 1O2NA 2ANWA 2AFQB 1AMHA 3KQBA 2JIZD 1AD8H 5C20A 4ZKNU 1FY3A 1O31A 3QO6A 4CHAC 6GCHF 1G3EA 1K1OA 2VIWA 3OX7U 5FPYA 2A0QB 1GHAG 1C1UH 2RDLA 4NFEA 4XDEA 4D7GA 2CN0H 1ZJKA 2G5VA 5DP6A 1ANBA 2UUJB 4OM9A 1NT1A 4ISHH 3PROA 3SUDA 2RCEA 2BHGA 1AE5A 3MOCA 4X2YA 1AVXA 1P2MA 4UFGH 1TNJA 1UCYE 4UE7H 4JZFH 2WUBA 4WJG2 3OE7D 1MTWA 2ODYB 1GHXH 1VGCB 1UVSH 4ESTE 3BIUH 2EC9H 1AFQB 5F6MA 2NU4E 3BV9B 2QY0B 1BRCE 2C8WB 5AFZH 5L2YH 4DW2U 5TCAA 3V3MA 1ZJDA 1H9LB 2BDIA 1MU8B 2BOHB 1AN1E 4JK6A 3FP8E 2BX4A 3LGIA 1NRRH 1PYTC 3VB4A 1GBCA 2BDGA 1W7XH 2ZFPH 5C1UA 1HAYB 1C5PA 2FS8A 1P57B 1WTGH 3VB6A 3E3TA 4OS4A 5EXNA 2BD5A 4ABEA 3QTVH 1IQFA 3ZVAA 1G36A 1NFWA 4GUXA 3GY6A 5GDSH 4AYVB 4GVUA 1V2MT 2QXHA 1T4VH 4ACAA 3OYPA 3RC5A 1GJAB 3FOAA 2BLQA 2SGFE 1XKBC 3SNDA 1UVUH 1NTPA 1O5FH 4TYDA 4X6OA 1W10U 1YBWA 1MCVA 2JETC 3EA7A 3KL6A 1UTLM 3T62A 1AHTH 3M7TA 2YMSD 1ZRKA 3R3GB 3A7VA 2KCPA 3BEIB 1AKSA 1V2KT 5GCHF 1KIGH 1CGIE 4DT4A 3RXDA 3P95A 2XC4A 3O8DA 4Q4LA 4LZ1H 5EPYA 1XM1A 1TAWA 1TALA 2D26C 3K6ZA 2ZQ1A 5DN6D 1IHSH 2SNVA 1GHYH 1BUIA 4TSFD 3MNCA 4AFUA 1C1QA 2QF0A 2A5AA 1EAIA 4ISNA 3SNEA 4GHTA 1Q31A 2P16A 1PPCE 1BMLA 3DUXH 3Q76A 1S84A 5AHGH 3LKWA 9ESTA 1HB0B 4ZXXH 1PPHE 2ZGBH 2BDBA 4LXBH 4NWKA 1BTWA 2FI5E 1GL1A 1KDQA 1TNLA 1VITF 4AGJA 4FU8A 1EKBB 2ALVA 3BEUA 1AO5A 2D1JA 2GV7A 4AORA 1C5ZB 1OWIA 1YPJH 1DICA 2A7HA 1V2OT 1FY4A 5A0CA 3PRDA 4RT0A 3ZIAD 2M2AA 1L2EA 1QCPA 1E79D 4JMYA 2PUQH 4X1NU 1SMFE 2WV4A 3VB3A 4H6SB 3FZDA 3UB0A 3RU4D 3U98H 1QNJA 5L2ZH 2AGGX 1OP0A 1TRYA 1BTXA 4YM9A 1LHGH 2GMTB 4Y6DA 4YO9A 4SGBE 3VGCC 2I6QA 3BTTE 5HM9A 1NN6A 1ELAA 4WH6A 1AB9B 2B7DH 2PW8H 1O3NA 3VG8A 1YY3A 2V3OH 4QT8C 1O33A 1EZQA 2ZF0H 4HFPB 1TPSA 4MVNA 2BD3A 1EQ9A 2LP6A 1SFQB 4BNRA 2B9LA 3ZZ3A 1OWKA 9LPRA 1XVMA 3SGBE 4YLQH 3KCGH 1MBMA 3GCHB 4DVAU 1FIWA 1XMNB 1IQGA 1AE8H 1O5DH 1UTQA 2FESH 2Y81A 3F2HA 1E1QD 1A7SA 2FOHA 1ID5H 4R0IA 3ZZCA 1WOFA 5DSFA 1KXEA 1UK3A 2O8WA 3PTNA 4X1SU 1DX5M 2FZZA 3LPRA 3SU6A 2ANYA 3I29A 3TJNA 4KKDA 3A7YA 1F0RA 1GDNA 1TPPA 1WAYB 1HIAA 1LVYA 1AFEH 4X2VA 1MQ5A 1C5NH 1OPHB 3KN2A 1O3PB 3UNRA 2F9NA 3RXLA 3LDXH 4XSKU 5JPMH 2ODPA 1TX6A 3TGKE 2AHME 1NFXA 1P8VC 3MYWA 1TA2A 2Z9IA 1C2DA 4GLYA 1GMHG 1Z8RA 2NWNA 3A84A 3SJ9A 1FAKH 1P9UA 1TBRH 1W0ZU 1ZMNA 2AGEX 5F8TA 2P59A 4GPGA 4I8KA 1TBZH 3BTQE 4WXVA 4BAOB 1TX8A 2FOCA 4THNH 1OP8A 1KLTA 1JRTA 1NBME 3OY6U 1C5XB 2QXIA 3A87A 3ZZ8A 4UFEH 2RFKC 5A0BA 5JBAS 1GBIA 3WY8A 3SUGA 2ANKH 1KTSB 3ATLA 2PTNA 3KHVA 3SI3H 6ESTA 1HCGA 4DOQA 2F4LA 2EI6A 1BTPA 1VCPA 2FWWA 4AZ2B 3A8CA 2F9PA 3OTJE 2PV9B 1EPTB 1MBQA 2W6JD 1A61H 3RXCA 3OFND 2WSSD 1BT7A 2BXUH 1ZZZA 3DFLA 1RGQA 1YPKH 4INLA 1V2WT 3F9FA 1DWDH 4AC9A 3EQ0H 3NRLA 4PROA 1J8AA 2IJOB 1S81A 1WSSH 3SO3A 1BMMH 1V2VT 1WDIA 4MPXA 4B74A 3E91A 1SOTA 2K0QA 1BTYA 4FETA 4Q7XA 1GI2A 3FFGA 1TIOA 4ABFA 1LVBA 3F6UH 4MPUA 3ZZDA 1SVPA 3ZZ9A 4NA9H 3GS9A 3SNCA 5DPAA 1E36B 2GD4B 1P04A 4K1SA 3ZZ5A 1TMBH 1NBMD 1GJDB 3KQCA 2F91A 3RXUA 4IBLH 1A4WH 1MKXH 1GG6B 4RN6A 1V2JT 2ZDKA 2PLXA 2ZCLP 4A6LA 1LTOA 1BOQA 4CRDA 5I25A 3ZZ4A 2IOTA 4DJZB 2V6NA 5E8EH 1VITG 3D62A 1P11E 1BITA 3MMGA 1X7AC 3TNTA 1O3IA 1Z1IA 3FO8D 1B7XB 4I31A 2J98B 2OBQA 4I8HA 3P8FA 2PKSB 2XCNA 4DY7B 2AYWA 2TGTA 1HJAC 1W12U 4FUCA 2B5TB 3KGPA 3UREA 1CQQA 1QBNA 3SHCH 3TJVA 2ZHDA 4K8BA 1O3JA 1QR3E 3AVZA 5C67A 1P10A 2BVRH 3SU1A 1AWFH 4B6EA 1D6RA 1UTNA 4XRNA 1FPHH 3BTDE 3A7XA 8GCHF 4HG6A 3NPSA 1OX1A 2A45B 1TNGA 4OGYA 1K1JA 1BDAA 1TQ7B 4FU7A 2ZFTA 4NZQA 1Y59T 4ZXYH 3H7TA 1ORFA 3SGQE 2AS9A 1W13U 1N6XA 3LH3A 4DIHH 5EIYA 4O97A 5DP7A 1GBHA 1MUEB 1F5LA 1O2MA 1FY8E 5JBTA 4Q7ZA 2W7UA 1NESE 1Z8GA 3Q3KA 1MH0A 3SNBA 1QIXB 2PKSC 4ZHAA 4BTIB 3C1KA 1KXBA 1T8MA 4A1XA 3LGYA 1C2IA 2R3YA 1OOKB 3GOVB 3S9BA 2WV5A 3WWBA 1L4ZA 2ZKSA 1ANCA 1CHOG 2H5CA 2ZI2H 2FOBA 1HAOH 1E1RD 3I77A 1JWTA 1FUJA 1DSTA 1FZZA 1KDQB 4TPYA 2F9UA 1YPMH 3E1XB 4MTBA 1GBDA 1E0FD 2W26A 3TIUA 4ZCNA 1S82A 2B8OH 2XNDD 2FTMA 4O3TA 5DJ7A 2KZ4A 1WYKA 3QZQA 1RIWB 3ATIA 1C4U2 1TB6H 1GBKA 3U69H 4DGJA 5KECA 4ZUHA 2Q6DA 1RTKA 3TK5A 1CT0E 4I8JA 3SJKA 3SI4H 1PPBH 2J34A 3VPKA 3GY3A 2ZGHA 1SGNE 2ALPA 3K6YA 1VITH 2A7JA 2G4UA 4X6NA 8GCHG 3BTFE 2Y5GA 1O2IA 3RXEA 4ABHA 1DT2A 1TFXA 4GAWA 1K1PA 3SU0A 1PQ8A 1O3CA 2JH6D 1GJ9B 1V6DA 2VWMA 1V2QT 3PYHA 3TNSA 6CHAC 2OD3B 2BD4A 1GGDC 1ZGIA 3LGUA 3QX5H 3ZZAA 1TABE 4ABDA 2VVVA 1SHHB 1V2NT 2C8YB 2FEQH 2GP9B 2STAE 1SQAA 4MG3A 2HRVA 3PMJA 1NRQH 2PGQB 2BQWB 5BPEA 1LDTT 1ZYOA 2GCTC 5EXMA 4U2WA 2BDCA 1P02A 3F2GA 1CHOF 1V2TT 4X8SH 5AVDA 1TA6A 3NKKA 1DOJA 2ZTZA 2G52A 2QC2A 3U1JB 3W95A 2GCHG 5SGAE 1MKXK 1GBLA 1ETRH 2ZCHP 3P6ZB 4B76A 2EEKA 1GJ5H 3ATMA 1KXCA 2HPPH 4BXWA 1AGJA 1A3BH 1VJ9U 2TPIZ 4ABJA 2QE7D 1W8BH 3F1SB 2ZZUH 4XOJA 3T5FH 1W0JD 2ZWLH 1EPTC 2A2XH 3TU7H 3PWCA 4BAHB 3LGTA 3MO6A 1ZGVA 2UWPA 1ELEE 1M9UA 2R0LA 1EOLA 2I6SA 3V12A 2F9BH 3JZ2B 2FI3E 1F7ZA 1ZTLA 2HOBA 3UUZA 1UK2A 3V7TA 1CGHA 7LPRA 4F4OC 5JDUB 4TPIZ 2SFAA 1FX0B 3ZVEA 1T32A 1LPGB 3SV8A 2QF4A 4P02A 1O3FA 3IITA 2Y6TA 1S6FA 2WHXA 1EASA 1AIXH 1OWDA 1H8ED 2FYQA 4CBNA 1WUNH 1G2MA 1OWHA 2A32A 3T28A 2GKVE 2XBYA 4M7GA 2ULLA 3Q77A 3RXRA 3ZV9A 3SV6A 3QGJA 2OC7A 3P92A 4GHQA 4CR5A 2BLOA 5LPRA 4AYYB 1O2SA 5DP3A 1G3BA 3EA8A 2OLGA 3SW2B 3FVFB 3UOUA 2ZECA 1MAXA 3M5MA 3SGAE 3SUEA 2W6ID 2FLBH 1YWUA 3BG4C 3DSPA 1MABB 1K9OE 2YNAA 2ZP0H 1HXEH 1SQOA 1UTPA 1P2QA 2HALA 1UCYK 2XCFA 1GHVH 3R0FA 1E35B 1HAVA 2ZPQA 5K0HA 2B0FA 2OXSA 4UFDH 1UMAH 3F68H 4Y8XA 1WBGB 1O39A 2H1UA 5DGJA 3AK5A 2STBE 1G2LA
chains in the Genus database with same CATH topology
2ZQ2A 1FY1A 1K1LA 1F5RA 1O2YA 1P03A 3W94A 1XUHA 4H42U 1HRTH 4SGAE 4U01A 1HV7A 1O3LA 4AG1A 4XFQA 1O2TA 4CRCA 3PLKA 1HAIH 3RLYH 3H7OA 3ZVDA 5GXPA 2NU3E 4Y10E 2CHAC 5G4BA 2VGCC 1CE5A 1EXFA 1K28D 1Y3WA 4JYUH 4IMQA 6LPRA 5TJXA 3M3TA 3M36A 1JIRA 2XBVA 2A31A 5FXLA 5T6FA 4GCHG 1Y3YA 1AUTC 5F8ZA 3M61U 1C5UA 3N7OA 5GJ4B 4NIYA 1BJUA 1K2I1 4X1PU 1GI9B 4FU9A 3SU3A 1AZ8A 1QTFA 2PTCE 4MNYA 3RU4T 5L30H 2C8XB 1DWEH 2BDYA 2GZ9A 1MTSA 4CH2B 1V2UT 5EQQA 2AGIX 2BZ6H 2H9TH 4X6PA 3S7KB 1SGYE 1SLXB 3ZYEA 2QYIA 2VWOA 3LU9B 3V0XA 4WH8A 1GMCG 4MNXA 2WYJA 2FI4E 3S9AA 3QK1A 1MTVA 1SLUB 1AY6H 3LOXA 1QBVH 2ZHFH 1KLJH 4NCYA 2J94A 4HGCA 1O30A 5E0HA 3KEEA 5FCKA 1O34A 1O2HA 4FUGA 1GBBA 3LIWA 1C5MD 2XTTB 1W0YH 4NIXA 1IQHA 2ZFQH 5DP8A 1WQVH 5EW1H 1YM0A 1HDTH 1EP6A 3SQHE 1H4WA 4B71A 5CHAB 2Y7ZA 4Q80A 5PTPA 3PO1B 1HGTH 4E7NA 1F0SA 1TGTA 2WPHS 3QLPH 3M5NA 5EPNA 4AG2A 1ZPBA 2V3HH 1SLVB 1GMDG 1GCTB 2KAIA 5ESTE 1DY9A 1C5OH 4X6MA 4IW4E 4GCHF 4Y7BA 4DT7B 2BZAA 1TPAE 2RA3A 4RSPA 3SU2A 1AWHB 1G30B 1BMNH 3PM3A 5FX6A 3RXVA 1CA0B 1W14U 3T27A 2QXGA 2A5IA 8KME2 1UVOA 5J4SA 1HJ9A 1CBWC 1Y5AT 3MWIU 3A7WA 5A09A 1H8DH 1WTHD 2P8OB 1THSH 1MZAA 2FOFA 3VGCB 4B73A 5DO4H 1EZUC 2GMTC 3GY5A 3M7UA 3OU0A 4BTUB 1XUJA 1K1IA 1LHDH 3SHAH 1QA0A 2FO9A 1BBRH 2R2MB 1UTMA 1GI7B 3PV4A 1ELCA 1BCUH 1DXWA 2ZFRH 1J16A 1KTTB 2PR3A 4K3JA 2VIDA 1NU9A 4FUIA 2TIOA 1DWCH 2O9QA 3E0NB 1CT4E 3LONA 3U9AH 1GHZA 3SJ8A 1GHAF 1O2XA 2ESTE 3Q3XA 3LH1A 3BTKE 4KGAA 1EJNA 2H9EH 5F03A 1TRNA 2VVUA 4A5TS 2P95A 1UVPA 3RXFA 1TWXB 3RXSA 2ZU1A 3PO1C 3ZYDA 1V2LT 2Q6FA 2A1DB 1D9IA 2J92A 2PSYA 3ESTA 1P01A 4DURA 4IMZA 1D6WA 4D9RA 3VXEH 1SL3A 4HI3A 1G32B 5CE1A 1FLEE 4CH8B 3S9CA 2ZG0H 1HAHH 2R9PA 1JOUB 1SGQE 1TBQH 4UD9H 1WV7H 1GCDA 1P2JA 1O2ZA 4DG4A 1SI5H 1EX3A 3M5LA 1C2KA 2PUXB 3UR6A 1GI3A 3ITIA 1D3QB 1EATA 1N6YA 1NROH 1O5AB 1O3EA 1PPZA 2AEIH 1YGCH 1RTLA 4CRGA 3L6PA 1QHRB 1CBWB 1O2LA 2ZEBA 1C1MA 4ZH8A 4BAQB 1ZTKA 4TWYA 4DCDA 3ENSB 5A8ZA 1RJXB 2GTBA 2CF9H 1THPB 1MCTA 2ZHEH 1SOZA 1OYQA 1AVGH 3PMBB 4YTAA 3ZVFA 4H6TA 1O32A 1C2HA 1Y3UA 3MU1A 3HGPA 1Z8IB 2DE8A 2XBXA 1T4UH 4B1TA 1HAVB 2G00A 3AAVA 2OP9A 4JZEH 4WWYA 3F9HA 1C2JA 4YZUA 1VJAU 2ZU2A 2YOLA 3RXBA 1GHBG 1P9SA 2Q6GA 3A85A 3E6PH 3MNSA 5CHAC 4Q2KA 3TGJE 4RKOB 1GVKB 2ZGCA 2Z9KA 2PKAA 1GG6C 1S0RA 2BLWA 4CREA 3GISB 1ELVA 2F9OA 5DG6A 4D7FA 5LH8A 4O9VA 2P3TB 1SFIA 4Y7AA 2WPMS 4WMFA 3RC6A 2Y5FA 3ZVGA 1O37A 3E16B 1WU1A 3GCNA 3MU8A 2FMJA 1MQ6A 1ZHPA 3AAUA 3PLBA 1GBJA 4FUDA 4IC6A 3TVJB 1GJ4H 2Z3DA 5C3NA 5EXLA 5EODA 2KAIB 4BOHA 4IC5A 2BD2A 1C2EA 4JYVH 2ZU3A 3FP6E 3PLPA 1HAPH 2JH5D 4NA7A 1EAUA 5E0GA 1EZSC 2VNTA 2ZPRA 5FBEA 1BBRE 3RXTA 1P2NA 1HAXB 2Y5HA 1ACBE 3MNBA 5JBBS 1IQIA 1O3BA 4ASHA 3MH5A 1IAUA 2ILNA 1C1OA 2BVXH 1RRKA 1O3MA 4OS7A 6CHAB 2J9NA 1EP5A 3LC5A 3M7QA 1Z7KA 4AN7A 1SGCA 4JZIA 5EW2H 2V35A 2FOGA 4ISIH 2NU2E 3ODDA 3BTEE 4UFFH 1ZMLA 5T6GA 1O35A 1DSUA 5A0AE 1A1RA 5JYIA 2FP7B 1GJ7B 1PQ7A 4UDWH 3SUFA 3MU5A 3EA9A 1CVWH 2K1QA 1RXPA 2TGDA 4JCNA 1ELGA 1C2FA 4IN1A 1SB1H 2SGDE 2RG3A 3RU4E 3S0NA 2GDEH 2VINA 2VIPA 4XE4A 2Z6BD 1P09A 1GJCB 1O3GA 3RMMH 1HNEE 1QB1A 1YPHC 2UUYA 1ABJH 1SGFG 2OBOA 1CA8B 1HJ8A 1MTNB 3SV7A 2ANMH 4INHA 5GWZA 3RXOA 1KYNA 2GDDA 1UTJA 3PMAB 4CBOA 4E06H 5EQSA 4J2YB 1A46H 3PB1E 3K2UA 1MTUA 5ABWA 2BY5X 1QL8A 3FANA 5F8XA 1DITH 1K1NA 1AU8A 4Y8YA 2P93A 1C5RA 4I8LA 2VIQA 3T29A 2ODQA 3GCHC 1IQEA 1A2CH 1V2PT 3LT3A 1GVZA 4BXSA 1AZZA 2GX4A 2JKHA 2TGPZ 3P8NA 3P70B 3A86A 1A5IA 1LKAA 3RMLH 2QXJA 1C1RA 2Y82A 5GPIB 1SC8U 1SGTA 5JBCS 5FBIA 5ETXA 1K1MA 1TE0A 1A5GH 2H5DA 1EAXA 1EB1H 1XXFA 4YESB 3BTWE 3KF2A 1BRUP 1H1BA 2D2DA 1QQ4A 1QB9A 1FXYA 1OXGA 2NU0E 3UNSA 3RP2A 3KNXA 3URDA 4FVBA 4BTTB 1DPOA 4WMEA 1G9IE 1LQEA 3RXKA 4X8TH 1G3DA 1P06A 1UO6A 3K9XB 1SGRE 3TGIE 2Y7XA 3EAJA 2G4TA 2PWXA 1DLKB 2IN2A 1YF4A 1IHTH 5FCRA 3UWIA 3ZV8A 1GVLA 2BDHA 2ZIQH 1NPMA 2OC8A 2C4FH 1GBFA 7KMEH 1GGDB 3GCTF 5GIBA 2ASUB 1DS2E 1QA7A 1DANH 5TCCA 1DM4B 3MO3A 2FLRH 2WUCA 1UHBA 3QN7A 3U8RH 3UY9A 2CF8H 2SNWA 4AOQA 1QFKH 2WPKS 3O8CA 2C90B 2PSXA 2ZU4A 1ZSKA 2TGAA 1TLDA 2G51A 4NSVA 1GL0E 1QRXA 1VCQA 4HTCH 4WMDA 2F83A 3RMNH 3M37A 5C1XA 2W5EA 1ELDE 1LPZB 1F2SE 1W2KH 1O3KA 5FAHA 1L1JA 4O3UA 4CRBA 3GCOA 1CA0C 5DKMA 3H5CB 1DWBH 1GI6A 4WXIA 3EGKH 2O8UA 3BTME 1TMTH 3ELAH 2Q1JA 1S85A 4FVDA 1A0JA 2FODA 2RA0A 1O36A 3Q3YA 4UEHH 3DA9B 1ZR0A 2XW9A 1UJ1A 1XUIA 2PGBB 3L3TA 4XBBA 3CENA 3RDZA 2OC0A 2BVSH 3QUMP 1KXDA 5H4IB 2UWOA 1FONA 3HATH 1F92A 1SLWB 3C27B 2Z3EA 3STIA 1QURH 2Z94A 1QJ1B 1GI5A 2WYGA 1C5TA 2QCYA 4K2YA 1LHFH 3GICB 2HGTH 4Y11E 3B9FH 2ZDLA 1JXPA 1NRSH 1C5YB 3FP7E 1NS3A 2GCHF 4D8NA 3QWCH 2VWNA 4KP0A 2SGQE 1ETSH 1EAWA 1DY8A 3DHKH 1OKXA 3RXQA 1SGFA 3D65E 2W3IA 3P8GA 1F5KU 3BTHE 4TY6A 4B75A 2ZGJA 2A4OA 1P2KA 2HWLB 4FUJA 4Z6AH 1ESBA 2H6MA 2CHAB 1JMOH 3A8AA 3GY4A 7GCHG 3EE0B 2ZO3H 2QGRA 1P0SH 1RS0A 3UTUH 4NWLA 3U8OH 5C5NA 3I78A 1T31A 1HAGE 2HVXA 3U1IB 4X8UH 4KTCA 1JIMA 1D4PB 1QJ7B 3MFJA 1LHEH 1VZQH 2V0BA 3PTBA 1AFQC 3E8LA 1G3CA 2WPIS 1ANDA 1Y5BT 1CT2E 2FX6A 3SQEE 5E2PA 2HNTF 1CSOE 1GBMA 1DXPA 3SORA 2VGCB 1LO6A 1TGSZ 2QN5T 3HKIB 1ESAA 1TNIA 4FUEA 5EGMA 1NFUA 4BAKB 1FY5A 1BRAA 4A92A 1GWAA 1XUFA 3BF6H 1O2GH 2H9HA 3L33A 2AIQA 6GCHG 1C5WB 5GCHG 1ANEA 2WPLS 2AH4X 4JYTA 2BB4A 1SG8B 1JRSA 3EYDA 4KTSA 3ZZBA 4X1RU 3M3VA 2ZU5A 2OCVB 2HNTC 1P3CA 5HXFA 3BG8A 2AERH 1AKSB 1DUEA 2CJIA 3GY2A 1C5VA 4K69A 1GI4A 1TGCA 3NCLA 2P3FH 1LQDB 1BJVA 1FAXA 3F9EA 1O5BB 4UONA 3RXPA 2ZNKH 1FNIA 1ABIH 4RKJB 3RUOA 3T25A 4OS1A 1S83A 4D9QA 5HMAA 2VH0A 2IPHA 3STJA 1T8LA 1AQ7A 3V13A 4MNWA 1EJAA 3TH3H 3RM2H 1XUKA 4YOGA 1KY9A 1AB9C 2BDAA 2Z9JA 3MH7A 1QL9A 2PFEA 2FM2A 1L1NA 2BY8X 2AMPA 3A81A 1ELFA 5HGGA 2ZDVH 2HLCA 4HZHA 1YPEH 4NIVA 2FXRA 1O2KA 3KIDU 1BTZA 3PWBA 3LJJA 3UWJH 1C5LH 1O5CB 1V3XA 4X8VH 4AGKA 2P94A 1PJPA 5FPTA 4AFSA 3BTGE 1T8NA 2O8LA 4Y8ZA 1FPCH 2R2WU 3LGVA 3TH2H 1H9HE 2CMYA 1IQNA 1W11U 1Z71A 1P2IA 3GY7A 1IQMA 1ESTA 2M5TA 5JB8S 4Y0YE 1MD7A 3A80A 1CHGA 3SV2H 2EA3A 1P05A 1SBWA 4B2CA 4CHAB 1UHBB 1W3CA 4A1TA 4AB9A 1LMWB 1K22H 1TGNA 1ELTA 5E0JA 2R3UA 2XRCA 1QB6A 3ZZ6A 1O2PA 3IG6B 2ZDNA 1A0LA 3A8DA 1UCYH 4FUFA 1LHCH 2FPZA 1YPGH 4ZHLU 2C8ZB 1QRZA 4OGXA 3SBKA 2UUFB 1KXFA 3UR9A 3TH4H 4A1VA 4X2WA 3KQDA 1YYY1 1G37A 1OS8A 5EU8A 2FOAA 4Y71A 1AVWA 2PKAB 4MPVA 5B6OA 5I46H 4FXGH 1NY22 1XUGA 1TONA 1FMGA 1V2RT 2C93B 2J2UA 2P3UB 1PFXC 5K7RA 1C1SA 1UVTH 3GCTG 3VEQB 3GYMA 7GCHF 2AIPA 2TBSA 1J9CH 2BLVA 3HK6B 3MO9A 1O3DA 1B0EA 4BANB 3OY5U 1TNHA 1O5GH 5BRRE 2OUAA 1Q2WA 1B0FA 1HLTH 4WVPE 1F0UA 1ZHMA 4K8YA 4LZ4B 2OINA 1C5QA 1GHBF 3P8OA 4AFZA 3MU0A 1NZQH 1O38A 1XX9A 1C2MA 5DP5A 3UIRA 3A7ZA 1MZDA 1NFYA 1YCPM 2ZPSA 3AW0A 4J1YA 4NFFA 4OS2A 5AFYH 3ODFA 3AW1A 4I7YH 2G8TA 2ZHQH 1GCTC 5IDKA 2XXLA 1EJMA 2DUCA 3T26A 2FX4A 2SGAA 5A8YA 1ARBA 5DP9A 2GT7A 3A7TA 1TX7A 1GPZA 1KXAA 1BRBE 1HBTH 3IWMA 1BHXB 1UK4A 3GDSA 4NG9H 2ZTXA 1O2VA 3EDXB 2XWAA 1GBAA 4B2AA 1MMJN 2GVFA 1O3HA 1LPKB 1LVOA 4K60A 1LCYA 3QTOH 2LNCA 4B2BA 1Y5UT 2EI8A 2XC0A 1EPTA 1DLEA 3RLWH 4NGAH 2BYAX 2J4IA 3CS7A 1FIZA 2ZFFH 5IYTA 1FJSA 3URCA 1O5EH 1VGCC 2NU1E 1SR5C 4FUBA 3A82A 4MLFB 1D3TB 4YT6H 3CS0A 1ZRBA 2QV1A 3D23A 1ELBA 2UUKB 1CU1A 1SGDE 3PMHB 7ESTE 3A89A 1ETTH 1O2JA 1TNKA 3RXAA 1J15A 1HAZB 3ZVCA 2BTCE 2BXTH 4U30A 1BMAA 1GMHF 1QRWA 3O8BA 2A2QH 3MU4A 3M5OA 4JZDH 3M35A 1GI8B 1TYNA 4JK5A 2VB0A 4ZROA 2FOEA 1A3EH 2XBWA 4NSYA 1O2RA 5FX5A 2GV6A 5L6NH 1YCPH 2PHBA 3B23B 5J4QA 1SGPE 2QIQA 1N1LA 2FS9A 1FV9A 1Z1JA 1L1GA 2QAAA 4O03A 1ZPCA 3DFJA 2O8TA 2XNIA 3RMOH 2W7SA 1BB0B 1SPJA 3S7HB 3HGNA 5FHTA 1NRPH 1ZSJA 1TOCB 1XXDA 1P2OA 5EG4A 4K1TA 1TGBA 5EOKA 3FZZA 1FN6A 2GZ7A 2UWLA 5C5OA 1IQLA 4INKA 3QDZB 1DVAH 1JBUH 1C1WH 1TQ0B 1HPGA 2A5KA 2OC1A 3LC3A 1J17T 1ZLRA 2H2ZA 2VVCA 1C4Y2 5EQRA 3Q00A 1C1PA 2AMQA 3B8JA 4H4FA 1GJ8B 2LPRA 2OQ5A 1MTNC 1FDPA 3VB7A 1GI0A 1RD3B 1RIWC 4NIWA 3MTYA 1EB2A 4NA8A 3VFEA 3LGWA 2VWLA 3AASA 2BD8A 5CMXH 1MKWK 1BTUA 4AX9H 1P12E 1YLDA 2YNBA 2ZDMA 2SGPE 3SJIA 3O8RA