1VJAU

Urokinase plasminogen activator b-chain-jt463 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of novel and selective inhibitors of urokinase-type plasminogen activator with improved pharmacokinetic properties for use as antimetastatic agents
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords plasminogen activator, urokinase
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vjaU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vjaU01
2CF9H 4CRCA 1O3GA 3M5NA 4JK5A 1DDJA 1CGJE 1LHDH 3EA9A 1OS8A 3DFJA 2ZTXA 5L6NH 1UTNA 1SB1H 3S0NA 1IQJA 2BVSH 1MU8B 1TNGA 1EATA 1J16A 1HAIH 3LJJA 4MNWA 2CHAC 3QZQA 4FUHA 3U1JB 4THNH 1AQ7A 1Q2WA 2QXGA 1A2CH 3ENSB 5JPMH 1BTZA 1CBWC 2TGPZ 1XUIA 1SBWA 1W11U 3GY7A 2BD3A 3Q3KA 1TNKA 2WV4A 2GTBA 2FO9A 2ZQ2A 1GJ6A 1KSNA 3RXCA 4Y0YE 1AB9B 3DHKH 2WYGA 1GMDG 1KXAA 2ULLA 4K1EA 3MOCA 4ZKSU 4BTTB 1C5SA 2YNBA 2QN5T 1AHTH 1HFDA 1TFXA 5C1YA 2ZHQH 3M7QA 1G36A 3D62A 1QL7A 1XVOA 2FPZA 1OOKB 8GCHG 1P2NA 1T8LA 3OSYA 1UTJA 2G4TA 3A86A 1HAOH 3K9XB 1BMNH 1EUFA 4Z0KA 2XWBI 2HGTH 3ZZ5A 1YYY1 2IPHA 3DFLA 1P09A 2ZDNA 3CS7A 4X2VA 1TNIA 1DE7H 4AORA 2H9HA 1C1RA 1O31A 2Y6TA 5EPYA 1ARBA 1O2YA 2GVFA 1GI8B 4NWKA 1HCGA 3RUOA 4AFZA 1OYQA 1INCA 1GPZA 1Q3XA 4JZ1A 2BD2A 1TBZH 4DT7B 4Z6AH 4WH6A 1IOEA 1F7ZA 3NK8A 1TWXB 1IQLA 1XX9A 2Z3EA 5F8ZA 1GI3A 4HGCA 5DJ7A 4BOHA 1NFYA 6ESTA 2KAIA 2PUQH 3MNSA 5ESTE 3Q76A 1NFWA 4ABHA 1W7XH 1GHBF 1QGFA 1LHFH 3M3TA 1TA6A 4MVNA 1M9UA 1GBTA 3RM0H 1DITH 2ZNKH 3ZV9A 3A87A 1KYNA 2GT7A 3UOUA 4HFPB 2VIDA 3GCTG 4O3UA 1O0DH 4KP0A 4NCYA 3BEFB 2BD7A 1HAXB 4UFFH 3U8RH 2ZP0H 1UVPA 3BTEE 1GI6A 3UREA 2QGRA 1A4WH 1DICA 5EOKA 4DGJA 3Q3XA 3KQEA 2RA0A 3T5FH 1HXEH 1C5WB 5GIBA 1FLEE 3AW1A 3F6UH 2P93A 1CHOG 4A5TS 1P11E 2GCHG 4LOYH 2FOCA 2CF8H 1JRSA 3GICB 1KY9A 1MKWK 1C2JA 2UWOA 1NRNH 1TPPA 2D1JA 4U2WA 2ZF0H 2FX4A 1P02A 2LPRA 2Z9GA 2F9PA 1AIXH 1ETTH 1UJ1A 1K2I1 1OWHA 2P16A 1SHHB 1O2GH 2OQ5A 2P3UB 4X8SH 4M7GA 1A5HA 1J9CH 1GVLA 1MBQA 1NM6A 1GMDF 1TONA 1V2ST 1ZGVA 2OXSA 7GCHG 3S7HB 2VH0A 1NO9H 4LXBH 1QA0A 4MDSA 3T26A 2BY5X 3RDZA 5T6GA 3RXGA 3STJA 2FI3E 1A0HB 2BB4A 5JYIA 5FCRA 2XBXA 4A7IB 3PLKA 1J15A 1A0LA 1SQOA 5C2ZA 1O2OA 1BBRK 1L1JA 3FP7E 2JETC 2AFQB 4IBLH 3T29A 1EZSC 2BD5A 1ZPCA 3UQVA 2AMDA 1FY8E 1O2UA 2FIRH 1EASA 3O8DA 4H42U 2A32A 3RU4T 1NTPA 1KXBA 5F03A 1TGTA 4Y79A 1AU8A 1SGEE 4JMYA 3EQ0H 3O8BA 4I8KA 1YLCA 2XBYA 1HPGA 4YOJA 4TWWA 1T8MA 1O5CB 4XBDA 5C20A 1VGCB 2GV6A 2EI8A 2GMTC 3SU5A 1FNIA 4YTAA 2FWWA 3M35A 1BB0B 2GDDA 2C8ZB 2R2MB 3A89A 2XCNA 4CH8B 1O5BB 2XNIA 2D26C 2ZGJA 3KEEA 3RXRA 3SU3A 5I25A 3PV4A 2Y5HA 4IW4E 1S6HA 3LIWA 3D49H 4NSVA 2UUJB 1FIWA 1O2LA 3P8NA 4JZIA 3ZVFA 1GDNA 2Y81A 3NUMA 2HVXA 5FCKA 3H7TA 1XVMA 1RTLA 3M37A 2QV1A 5JDUB 2Y82A 2PFEA 4CBOA 3BTDE 2BY6X 3ZVGA 1B7XB 4UONA 3LKWA 4RKOB 4FUJA 3SUFA 4D9RA 2BM2A 4CRGA 2ZDMA 3V13A 3UTUH 3SBKA 2A7CA 4O9VA 1W14U 3LGUA 1HJ8A 1TPOA 1AFEH 2FZZA 4OS4A 3LGVA 2XCFA 2A2XH 1NZQH 3CP7A 3K65B 3VB3A 3VB7A 2BLQA 4ISOA 4K3JA 5FX5A 1C4U2 2SGPE 2W3IA 1YP9A 4Y8ZA 5F8TA 5DG6A 2A5IA 4ZKRU 1SGFA 3UNRA 2PLXA 4Y8XA 5LGOA 4UFDH 4I32A 1XMNB 2FOFA 2QF3A 1F0SA 1D3DB 3BG8A 4OS5A 4A1XA 3VB4A 1SFQB 3A81A 2Y7ZA 2B5TB 1SMFE 5CHAC 1A3EH 2EI7A 4BXSA 4I7YH 1H8IH 2Z3CA 2GV7A 1QHRB 2QXIA 1F2SE 3PB1E 2VWNA 5SGAE 1GL1A 1WUNH 4U30A 4ZHLU 1NROH 2FLRH 1GI9B 4XDEA 1WV7H 3M5LA 3ZZ9A 4X2YA 2NU1E 1HAVB 1H9HE 4JYUH 1UK4A 2FLBH 1ELGA 2KAIB 1TPSA 2UUKB 5GJ4B 1O3NA 3IITA 2B9LA 4YOGA 3WY8A 3VEQB 4VGCB 3TGKE 3T27A 4MPXA 2A4OA 3K6ZA 3MMGA 1DLEA 1S0QA 2UWLA 4SGAE 1O2TA 3BF6H 1C5TA 4D9QA 2XBVA 3C27B 5C5OA 1YLDA 1IHSH 1NRQH 4Y0ZE 3V0XA 1ABJH 1TGBA 1RS0A 1LHGH 2A5KA 1XUFA 1N8OB 1O2ZA 2BY8X 1K1JA 1DSTA 3UR6A 3SJKA 5DO4H 1SFIA 5DKMA 1ETRH 2J94A 3B9FH 3F9HA 4ABBA 1ANDA 2RDLA 2G4UA 1GHYH 1WTHD 4XBCA 1O5GH 3JZ2B 1RIWB 1FPCH 1C5OH 3MNBA 1OWKA 1G3DA 1FAKH 1PYTC 2OLGA 4BTIB 4YLUA 3TVJB 1CBWB 2ZHDA 3LGIA 1MTWA 1EOJA 1ACBE 1O5EH 3F9GA 3SNAA 1SGRE 2AGIX 1O3MA 4D76A 7GCHF 4NA8A 1C1OA 1HGTH 3P8FA 1GVKB 3E16B 4AFQA 1GCTB 3ZVBA 1BT7A 2XYAA 1MMJN 1DS2E 1SGYE 2A7HA 3SQHE 4BAMB 1MZAA 1GMCF 5EPNA 4GSOA 4I33A 1ELEE 1KDQA 2ZPSA 2ALVA 1GI0A 2DUCA 2J92A 2B0FA 1TX6A 3EA8A 2CXVA 1ZMJA 1HJAC 1LTOA 4K2YA 4DIHH 1V2LT 2ZHFH 4OS1A 3BEUA 1TQ7B 4JZFH 4TY7A 1EJMA 1GBLA 2AEIH 3A8AA 1J14A 4WMDA 1YCPK 2J4IA 2BOHB 1C1VH 3PMBB 3U8TH 1MKXH 2HNTE 4K60A 3Q00A 5GWZA 4KGAA 3RXJA 4YM9A 4LZ1H 1HUTH 2B8OH 2ANWA 4IS5A 3SV2H 2VIOA 3RXTA 1TNHA 2SGDE 4B2BA 2A0QB 1LCYA 1QBOA 4X6MA 4X2XA 1DY9A 3PYHA 2BDGA 1ORFA 3RMOH 1SOZA 4BAKB 4D8NA 2QXHA 3ODDA 6CHAB 4OS7A 1C5NH 4IMZA 6GCHF 2G8TA 5LPEA 1SGDE 4INLA 4NFEA 1GBDA 1BRBE 4WXVA 1EAUA 2Z6BD 3RMLH 5GPIB 2ESTE 3SUEA 1LMWB 1PPGE 1NRPH 1SVPA 1WQSA 1SQAA 1NT1A 1CSOE 2FOEA 3P92A 1DFPA 1O2JA 2P3FH 1GGDC 1WYKA 4J2YB 3LGWA 2FI5E 5E0JA 4E7NA 5K7RA 2TBSA 2SFAA 1MCVA 3RXMA 1H4WA 2ZFRH 5H4IB 1YPGH 1V2UT 1O2QA 2F83A 4Q7XA 1DWDH 1P2JA 3UNQA 1PQ8A 1RRKA 4CR5A 4ISHH 3OTJE 1VITF 1C5XB 2GX4A 3TGJE 4VGCC 1C1SA 3SNBA 4MLFB 1NU7B 2WYJA 1CA0C 1TMTH 3ZVCA 4FUGA 4X1SU 1LVBA 2Z7FE 4BAQB 4KTCA 2FOMB 1G32B 1HLTH 1BHXF 3QGJA 1OXGA 2A1DB 1VZQH 3H7OA 2M5TA 1TNJA 2WPLS 1ARCA 5L30H 1O3EA 1C2KA 2Q6GA 2GZ9A 4Y7BA 5DP5A 2W7SA 1Z6EA 4RN6A 3MTYA 1LVOA 2ZGHA 1MBMA 1C2MA 2PV9B 1QB6A 3HKIB 4MNXA 5EXNA 3IG6B 2Z9JA 3QX5H 1NU9A 1FY5A 3U98H 1DX5M 3A8BA 2Z9KA 4WH8A 2ZPQA 2ZU2A 4KKDA 4AX9H 3C1KA 3TITA 3P17H 3H5CB 3FP8E 3G01A 4X6PA 1G9IE 4DG4A 1YPLH 1H9IE 5DP7A 1MH0A 1G3BA 3RC6A 3MWIU 1BMLA 3QTOH 2ZGXH 1LKAA 1RGQA 4ZHAA 3Q77A 1OKXA 4RKJB 3VGCB 4X1NU 4MNYA 5A8ZA 1QL8A 1GBAA 2J38A 5JB9S 5C1UA 1BTPA 5E0HA 1QB9A 5A0CA 3QZRA 2GCHF 5FXLA 1PFXC 4IMQA 3SV9A 3LGTA 1VR1H 1AUTC 3ZYDA 3UFAA 4B71A 3DT0H 1C1MA 4IGDA 4NSYA 3BTWE 3BG4C 2C93B 1VJAU 1O2HA 1RD3B 4QT8C 3A8DA 1CO7E 5FHTA 4BAOB 3M5OA 1S82A 1W0ZU 3QK1A 5DP4A 1C2LA 3SGQE 1LPZB 1BRUP 3TK6A 1D3TB 1QL9A 3GY4A 2DE8A 1NRRH 4DURA 1FY1A 5CE1A 1V2PT 1IAUA 2BDAA 1Z6JH 1GBBA 1E38B 5BPEA 4TY6A 1C2GA 1LO6A 3BTQE 1ZSJA 3DD2H 1FPHH 3LJOA 1ZLRA 3OX7U 1L2EA 1H8DH 1GBJA 1OX1A 1IQMA 1K1IA 1O2WA 5HM2A 5HXFA 3E1XB 2CN0H 3RU4D 1D4PB 1GMHF 2VGCB 1LQEA 4D7FA 1S5SA 4F4OC 2ZFFH 5C3NA 5FPTA 2H5CA 1O3HA 4X8UH 5EQSA 1ZPZA 2TRMA 3A7XA 1PJPA 2HWLB 2V6NA 1HRTH 3U9AH 3PMAB 4H6SB 2HOBA 3SORA 3B23B 2NU3E 1V2JT 1O30A 4AZ2B 2A31A 4NGAH 2Y7XA 3GCNA 1IQGA 4Y6DA 1H1BA 3A8CA 1EZUC 1ZMNA 3SJ9A 2AIQA 1W0YH 1XUHA 1ZZZA 1E37B 3TH3H 1ESTA 2O8TA 1TMBH 4B74A 2HLCA 3F9FA 1QFKH 1FDPA 3KNXA 3UNSA 1AKSB 4DIIH 1AFQB 3FVFB 5GCHF 3E90B 5GDSH 1O2XA 4Y11E 1UCYE 5B6OA 3U1IB 1Y8TA 3E8LA 3OYPA 1K21H 4ASHA 1TPAE 4FVBA 2OBQA 4D7GA 1F5LA 1Q31A 1O32A 3LH1A 1DUAA 1ELCA 1THRH 1N6YA 1GBHA 2TGAA 5EQRA 4AG1A 1TOMH 1HAVA 2FMJA 2B7DH 1B0EA 5A0BA 1BDAA 1FMGA 5EU8A 3KGPA 1DXPA 3VB5A 2WPIS 1J17T 1AE5A 4YLQH 1C1NA 1G37A 1PPZA 3KF2A 5A8YA 3RXBA 3TJVA 4AFUA 3KCGH 1SOTA 5EQQA 2I6QA 4YOIA 1ABIH 2C8XB 1NY22 3F68H 2WPHS 3UOPA 1C2IA 4H6TA 1BUIA 1UTMA 2VIVA 2ZFQH 3T28A 1C5PA 4WJG2 8LPRA 3A7TA 1UTOA 1ID5H 4JZEH 3LT3A 2HNTC 1EXFA 1P2MA 5DP8A 1UCYH 1HV7A 1GHAG 1GI1A 3SNCA 3SV6A 1TGNA 2V3HH 2A7JA 1O2SA 4FUEA 1K1NA 3GCHC 3GCOA 2BY9X 3KL6A 2VGCC 7KMEH 3RMNH 1GJ9B 1D6WA 1MAYA 1OWJA 2J34A 4DVAU 1GBCA 3ZVEA 3SNEA 1QJ7B 3SGBE 2BD9A 2R3UA 1XXDA 3R0FA 2BMGB 4CRBA 1C1UH 3ZVDA 2JH6D 2VIQA 3LPRA 2SNWA 2F9VA 1JMOH 2AIPA 3GDVA 2BTCE 2G00A 2PUXB 4OS2A 1NS3A 3RXAA 1P05A 1EB2A 1V2NT 1GHVH 1UK2A 1G30B 1THSH 2FODA 2HPPH 4CRFA 1UTPA 1AD8H 5JBBS 1A7SA 1FY3A 1GJ7B 3K6YA 1AWFH 8GCHF 1C5LH 1FV9A 2AS9A 2ZO3H 1O2NA 4CBNA 4WMFA 1JOUB 2FDAA 3S9CA 2PGQB 2A4RA 4GHTA 2ZDVH 3SUDA 2D8WA 5CMXH 3P8OA 3SN8A 4FU7A 1KXEA 3ATKA 1IQIA 4X0WU 3L3TA 1BJUA 1P2KA 2H9TH 4BNRA 2FOGA 2C8YB 1Z7KA 3GISB 3DA9B 4AB9A 1YKTA 3MO3A 3HPTB 1E36B 4TPIZ 2NU2E 1HIAB 2IJOB 4UE7H 4FVDA 1N6XA 1W2KH 3HK6B 5EXLA 3RM2H 1QB1A 4UD9H 1C5ZB 2PTCE 1YPMH 2P3TB 4WY3A 1GI5A 1RFNA 2ZC9H 1ZTJA 1QJ1B 5AFZH 6CHAC 2YNAA 4LK4A 1C2FA 2ZCKP 1ESBA 2G55A 3TU7H 3A82A 1BOQA 2XRCA 1NN6A 1LKBA 1BTYA 1TQ0B 3A88A 1LVMA 1K22H 3ZZAA 2WUBA 1FUJA 4XBBA 2VINA 3PO1B 2BY7X 1PPFE 2SNVA 4GVUA 1ANBA 1MTVA 1WQVH 1FAXA 4JCNA 1P2QA 2VH6A 4FU8A 1XUGA 5IYTA 1S0RA 1D6RA 1UTQA 1TX7A 1AGJA 3MFJA 2ZECA 4B1TA 2A5AA 4IC5A 2BDIA 3FZZA 1GJAB 3GYLB 5ESBA 4A6LA 4MG3A 1GGDB 1O2IA 1YBWA 1CA8B 3M5MA 1K1MA 3QWCH 4OGXA 1V2KT 3SU1A 3FZDA 1IQEA 3JZ1B 1BTHH 2VVCA 1O5AB 1AMHA 4UEHH 5C1XA 1O34A 1Y5AT 2EC9H 3QN7A 4TPYA 1C4V2 2P8OC 4BAHB 2R9PA 3RXKA 1P10A 2RA3A 1GWAA 1CGIE 1CT2E 1GBFA 1HB0B 2BQWB 1CT0E 4WXIA 4B2CA 1O36A 1UVTH 3SGAE 2BXTH 4B2AA 4CRAA 1IHTH 2O9QA 3VFEA 1UTKA 1FIZA 1O3FA 2OINA 3E0PB 4B75A 3ATWA 1TRYA 2CMYA 1KTSB 2BDBA 2GT8A 2HRVA 2O8MA 1SGQE 3PLPA 1DPOA 4FUIA 2SGQE 2BLVA 4ISIH 3BTKE 5C5NA 3ZZ6A 1O2PA 3AAUA 4NZQA 2AMQA 3NXPA 1CHGA 1SQTA 2QCYA 1KLIH 2GZ7A 1AO5A 1ZRBA 2ZQ1A 3A84A 1AI8H 3R3GB 2XC0A 1KIGH 5T3HA 2VJ1A 1RTKA 4UFEH 4GUXA 1AWHB 3E0NB 1OWEA 1GMCG 1EP6A 2OTVA 3CS0A 2PHBA 1GMHG 5HYOA 1F0UA 1TA2A 3VGCC 5LPRA 4SGBE 1X7AC 1W13U 3ZYEA 3SHAH 1N8OC 4FU9A 4RSPA 3UPEA 3UIRA 1GG6B 5EG4A 3TNSA 5A2MH 5FBIA 3A7WA 1BRCE 1PPEE 4FUDA 1EAWA 2YOLA 3PWBA 1O2MA 2Q1JA 1WSSH 3TJNA 4ISLA 1DUEA 1S84A 1Z8RA 1EPTA 3FANA 3UQOA 4I8LA 3EDXB 4MQAA 2VIPA 5G4BA 1RXPA 1ZOMA 4XOJA 1TYNA 4UDWH 1FI8A 4ZXYH 4AOQA 1ELBA 2JH0D 1HNEE 1XKAC 2FYRA 2PKSC 3S69A 1XKBC 1AZZA 3SQEE 1UTLM 1U6QA 3A85A 1F5KU 3PROA 3D65E 9ESTA 3TPIZ 1A0JA 3MH4A 2OP9A 2ODPA 1V2WT 4X1PU 1Z8IB 1S81A 1GJ5H 3BTFE 4GAWA 3MNCA 4B73A 2ANYA 2PW8H 1GHAF 1IQHA 3HK3B 1OP0A 4A1VA 1O5DH 1BTXA 2W5EA 1HJAB 1W8BH 5I46H 3W95A 3SU2A 1AVWA 3RXHA 3S9BA 3QO6A 2ZG0H 1TBQH 3SU0A 2LNCA 3SI3H 1SSXA 4BXWA 1SLUB 1WBGB 1Z8GA 1EP5A 1ELVA 1IQFA 3V3MA 1O3CA 3QUMP 3SJ8A 2FEQH 1Y5UT 1FY4A 1QBNA 5PTPA 2ZDAH 1QIXB 1A3BH 3OU0A 4CREA 1OWDA 3GY2A 1TGCA 2J2UA 2Z94A 4YT6H 1C1TA 4HZHA 4O03A 4WWYA 2THFB 4ABDA 2ZEBA 4FUCA 2ANKH 3N7OA 2P59A 2K1QA 4Y8YA 1DOJA 1V2VT 2BD8A 1MCTA 5ETXA 2VWMA 1C2EA 1B5GH 3V7TA 3ZZDA 1W7GH 4E05H 3RMMH 1XUJA 2CV3A 2DE9A 1XXFA 1DY8A 4AN7A 1S6FA 1K1OA 1P2OA 1O3IA 4AG2A 1ZGIA 4ZUHA 2A45B 2G5NA 1PQAA 1MAXA 2UUYA 2R2WU 4ISNA 1TABE 3M36A 8ESTE 2IN2A 5DP3A 1KXDA 1YGCH 3UR9A 1RTFB 4I8GA 2HALA 4F49A 3A80A 1VGCC 2FS9A 2ZZUH 5L2ZH 1YPJH 4ABJA 3HATH 4WVPE 3E6PH 2H6MA 4JK6A 3MH5A 1KLJH 1FJSA 1AY6H 1O35A 1QRXA 3KN2A 3SU4A 1C1PA 4ZROA 1DM4B 1V2OT 1CA0B 1ZTKA 3BIVH 2F9BH 3MH7A 5F8XA 1CE5A 1Y3WA 1UK3A 5FX6A 3LU9B 5JBCS 1PQ5A 1MKWH 4NZLA 3VB6A 2WINI 1YM0A 1IQNA 2XBWA 3KHVA 1V3XA 1DLKB 3NZIA 1C9PA 1ESAA 1BZXE 1QA7A 3SOSA 3MU0A 1L0ZA 2VWOA 1LPKB 1GVZA 4WF8A 1NFUA 1Y5BT 5JBTA 2ZKSA 3PLBA 2BVRH 2R0KA 1Y59T 1MTSA 3BTGE 4LZ4B 1L1GA 1A5GH 1Z71A 1GBIA 2R3YA 2BQ7B 2XC4A 1P3EA 1F92A 2C3SA 3MU8A 5FAHA 1P12E 3GCHB 1GI4A 1QRWA 1SGNE 1UVUH 3RXDA 1EQ9A 1H9LB 3MH6A 3MNXA 1K1PA 2ZU1A 2XW9A 3P8GA 2BOKA 2ZCLP 3BEIB 2OC1A 1O2VA 3MO6A 2XC5A 4IN1A 1L4ZA 4IC6A 2Z3DA 4Y76A 4Q2KA 1ELAA 5L2YH 1MTNC 1KLTA 4B76A 3GY3A 3I78A 1BIOA 4NG9H 1O37A 1ZSLA 2W7UA 4GCHF 3LDXH 1MD8A 1QNJA 4FUBA 2VVUA 4GPGA 1QQ4A 5ABWA 2GP9B 7ESTE 1AUJA 1JIRA 2VU8E 3M7TA 2ZFTA 3O8RA 1DSUA 3MI4A 4FUFA 2NWNA 1GJCB 1AKSA 3GYMA 2JH5D 3BG4B 4X8TH 5DGJA 2ZWLH 4DOQA 1CGHA 1QQUA 3TH4H 4YESB 5C67A 3DUXH 3SI4H 1DWEH 2Q6DA 2ZI2H 1NESE 4NIVA 5IDKA 3GY8A 2GZ8A 1ZPBA 2BXUH 2OQUA 1V2QT 3SZNA 3VXEH 4K69A 4ESTE 4K8YA 2WPMS 1CU1A 1BQYA 2BQ6B 1EJNA 3TK9A 1P9SA 2ZTZA 5A09A 1EX3A 3T62A 3GOVB 1SHYA 3PO1C 2C4FH 2UWPA 1CT4E 1O3OA 2PKAB 1THPB 1ZRKA 2Y80A 1S83A 1BTWA 2Q6FA 2XXLA 2ZGCA 2WPKS 2ZA5A 4ZH8A 1P57B 1V2MT 3RXUA 4O97A 4CH2B 1GJBB 1PQ7A 1ZHRA 1WU1A 1P8VC 3M61U 4INKA 3GY5A 2VNTA 3TK5A 1WAYB 5T6DA 1FN6A 3A7ZA 5BRRE 1O3DA 1JXPA 2V35A 1O3AA 1RJXB 2BLWA 1BTUA 3MO9A 1OPHB 1OP2A 1T4UH 5EODA 1VJ9U 1PYTD 5HGGA 2QA9E 2PSYA 1DT2A 1SGCA 3ITIA 4KTSA 2VIWA 1YF4A 3M3SA 3TJOA 1GBEA 3RLWH 3BTHE 3LC5A 4Y7AA 1GCTC 2AERH 1T32A 1SLWB 1PPBH 2HPQH 3NCLA 1AVXA 2G52A 4H4FA 4KELA 6GCHG 2FS8A 1O3LA 1L1NA 3UY9A 4CRDA 4KTUA 1LPGB 5E2OA 1GJDB 1MZDA 1AFQC 1HAHH 4TWYA 5TCAA 3NPSA 3QDZB 3CENA 5EXMA 3L6PA 2BX4A 2EI6A 3BSQA 1VITH 4Q7YA 2BDCA 4CHAC 4YZUA 4ZKOU 3KQCA 4ABAA 4I8HA 5GXPA 3ZV8A 2A4QA 2FOBA 1C4Y2 2FTLE 5AF9H 1MU6B 1T8NA 1P04A 3FAOA 2ZHWH 2EEKA 1FN8A 3SO3A 2BLOA 2ZIQH 1BBRE 3MHWU 3E91A 2ANMH 3UWJH 3TGIE 4JZDH 3T2NA 2Y5GA 3BIUH 4MPWA 2AH4X 1FXYA 2AGGX 5JB8S 1QTFA 2BZ6H 5J4SA 1SGFG 5DPAA 5LPFA 4ABGA 5DP9A 1TAWA 1A1RA 1JBUH 2SGEE 1C2HA 4ABIA 1Y3VA 2QXJA 3STIA 3VPKA 2I6SA 4MPVA 5A0AE 1N1LA 2AYWA 1A46H 3RXPA 5T6FA 1W3CA 3QTVH 2PR3A 3ZZ3A 2JKHA 2QY0B 1T31A 1XUKA 2ZGBH 1C2DA 1TMUH 1D3PB 3M7UA 1C5MD 1HAGE 2ZFSA 2G51A 1TGSZ 2BHGA 3AW0A 1WTGH 3ZVAA 1C1QA 1ZMLA 3PTNA 4BTUB 3PMHB 1G2LA 5DP6A 1KXFA 3B8JA 2ODYB 2PKSB 1HJ9A 1YPHC 2A2QH 3L33A 3P70B 3HGNA 4X1QU 1TIOA 4GLYA 4GHQA 3LOXA 2AMPA 2BDYA 5J4QA 1O3PB 2JETB 2PKAA 5E0GA 1EZQA 3MYWA 1O38A 4NA7A 3EA7A 1SLVB 1HIAA 3TJUA 2OC8A 1TRMA 4NIYA 1F0TA 5K0HA 1E34B 1YCPH 2CGAA 1EAXA 1UHBA 1GG6C 3GDUA 3SJIA 1P3CA 1MKXK 1TOCB 2O8LA 2XWAA 1T4VH 1ZHPA 2ZDKA 4Y10E 4NWLA 1GHWH 2H2ZA 2FESH 4MPUA 4R0IA 3SU6A 5HM9A 2O8WA 1Y3UA 1ZJDA 1GL0E 1L4DA 3ATMA 5AHGH 4TYDA 1K1LA 2WUCA 1EB1H 1GCDA 1MQ6A 1HAZB 2BX3A 3QLPH 1Y3YA 3MU5A 4YO9A 1QY6A 1AB9C 4XE4A 1TB6H 1FONA 4ABFA 4DCDA 1J8AA 1YPEH 4X6NA 3URDA 3EGKH 2A4GA 1AE8H 3PMJA 1O3JA 3FFGA 2OCVB 1QRZA 1SL3A 2QAAA 3Q3YA 2TGTA 5EGMA 4Q7ZA 1V2TT 2AGEX 3RXLA 5LH8A 3V12A 3RXIA 1ZSKA 4OGYA 2ODQA 4NIWA 2GD4B 3BTTE 2BD4A 2NU4E 5DK1A 1O2KA 3W94A 1QJ6B 1V6DA 1C1WH 2UUFB 2V0BA 1ETSH 3NWUA 4DJZB 1TNLA 4JYVH 3BTME 1V2RT 1C5VA 3T25A 1GBKA 2OUAA 3EAJA 3RXOA 3SV8A 1DWCH 1NFXA 1O39A 5E2PA 4BANB 1WOFA 1LHCH 3I29A 1QBVH 3VXFH 2P8OB 3AASA 2C90B 2OD3B 1GHZA 1QCPA 4E06H 1PPCE 4OS6A 1BJVA 1O3BA 2IOTA 2QYIA 4R8TB 3ZZBA 3KIDU 1GDQA 3LH3A 1D9IA 3ESTA 5A8XA 5EW2H 3FP6E 1GI2A 3RXVA 4U32A 5FPSA 3TNTA 2EA3A 3P95A 1T7CA 4A1TA 4ABEA 3RXEA 1O3KA 3ZZ7A 4ZHMU 1YPHE 2ZPRA 1W10U 1TRNA 1JWTA 2WPJS 1P03A 4ZXXH 1GHXH 2NU0E 1RIWC 1SC8U 3ZZ4A 1TLDA 1NC6A 4AYYB 1KDQB 4NA9H 1SG8B 1EPTC 1HXFH 1OP8A 2VVVA 1ZYOA 2FYQA 3PWCA 1KTTB 3HKJB 2WV5A 2ZCHP 8KME2 2GDEH 3ATIA 4MTBA 4ZKNU 3NKKA 1LQDB 2W3KA 2PWXA 4AGKA 1DVAH 1K9OE 1SGIB 2ZU5A 1C5YB 5AFYH 2Z9IA 4JYTA 3RU4E 2FOHA 3URCA 1XM1A 2FTMA 1T8OA 2GCTC 3IWMA 1GDUA 1TBRH 1ANEA 2Y5FA 3MU4A 1ANCA 7LPRA 3PTBA 1ZTLA 4ZMAH 5TCCA 2FOAA 3RXFA 5AVDA 2ZHEH 1IQKA 3D23A 1AN1E 1ZHMA 2FM2A 1E35B 1HDTH 4X2WA 2RG3A 2QF0A 2TPIZ 4DW2U 2BZAA 2P94A 4K5ZA 4XFQA 2OC0A 1G2MA 3O8CA 2HNTF 1UVSH 2ZFPH 1O33A 2RCEA 3ZZ8A 1GJ4H 4AB8A 2D2DA 1P9UA 4NFFA 2F9NA 1UCYK 1G3EA 2BVXH 2F9OA 2FI4E 3SNDA 2FX6A 4PROA 3SV7A 1F0RA 1A5IA 1TALA 3A7YA 1KXCA 2ZTYA 2P95A 1ELTA 2QIQA 1ZJKA 1EJAA 1QR3E 3GY6A 2PGBB 3OY5U 3PM3A 1SGTA 1D3QB 3P6ZB 1DXWA 2GKVE 3KQDA 5JBAS 4AYVB 2STAE 1E0FD 5HMAA 1TE0A 3RP2A 3F1SB 3S9AA 1UHBB 2VWLA 1HBTH 1P01A 4IN2A 1LVYA 2ASUB 5EW1H 1A61H 1FQ3A 1F5RA 1QURH 3U8OH 1SI5H 1ZR0A 4I31A 1BCUH 1BITA 2GGVB 1NPMA 2V3OH 2H9EH 1UMAH 1OYTH 3LONA 2H5DA 1ELFA 2GMTB 4UFGH 1HAPH 2CHAB 1P0SH 4AFSA 1JIMA 2F3CE 1W12U 1Z1JA 3ATLA 4INHA 1EPTB 1B0FA 3MU1A 4WMEA 3A7VA 1YPKH 3SW2B 1G3CA 2J9NA 2OC7A 1EAIA 1BMAA 4DY7B 1BRAA 2STBE 4O3TA 1O5FH 3UUZA 1P2IA 4HI3A 1YCPM 1AVGH 1CQQA 3RXSA 3RC5A 5FPYA 3TLOA 4K8BA 3BV9B 1YC0A 2ALPA 2GCTB 1GI7B 4U01A 1C5UA 1HAYB 4XSKU 2ZU3A 3UWIA 2OBOA 1C5RA 1GJ8B 4X8VH 2FP7B 1SPJA 4X6OA 4CHAB 3LC3A 1PPHE 1VCPA 2G81E 2Z9LA 1LDTT 1Z8JB 3OY6U 1GHBG 1C5QA 1DANH 1EKBB 3GDSA 3RC4A 1K28D 1CHOF 3BN9A 1BMMH 3ZZCA 1VCWA 4E7RG 2W26A 1TX8A 1NRSH 4A92A 1EOLA 3SUGA 3SJOA 3QGNB 1CVWH 1GBMA 3ELAH 2F91A 3EYDA 3S7KB 3AVZA 3LGYA 3RLYH 1O2RA 2C8WB 1FZZA 5GCHG 1MQ5A 1C9TA 4Q80A 4GCHG 2ILNA 4FXGH 4Y71A 3U69H 1SR5C 2PTNA 3I77A 2XTTB 4CR9A 2ZU4A 3ODFA 4YT7H 2R0LA 1BBRH 2F9UA 4I8JA 1Z1IA 3GCTF 2BYAX 1BHXB 1DWBH 1MTUA 5TJXA 4MNVA 1AZ8A 5CHAB 1S85A 2TIOA 1JRTA 1OWIA 3AAVA 1VITG 3A83A 5FBEA 5F6MA 4K1TA 3EE0B 3RXQA 3KQBA 2H1UA 2ZDLA 2PSXA 3HGPA 2CJIA 1WCZA 2VB0A 4J1YA 2TGDA 1VCQA 1P06A 4ZAEA 1HYLA 2J95A 9LPRA 4NIXA 3F9EA 1UO6A 1MD7A 1EZXC 4HTCH 3M3VA 2SGAA 3K2UA 1UVOA 4K1SA 6LPRA 4AGJA 2QC2A 2BDHA 1LHEH 1SGPE 1BA8B 2O8UA 1MUEB 4X1RU 2SGFE 1MTNB 3SHCH 1OSSA 1SLXB 2FXRA 3TH2H 2G5VA 3E3TA 3TIUA 5E8EH 1ELDE 1Y3XA
chains in the Genus database with same CATH superfamily
3F2FA 2CF9H 4CRCA 1O3GA 3M5NA 4JK5A 1DDJA 1CGJE 1LHDH 3EA9A 1OS8A 3DFJA 2ZTXA 3W1EA 5L6NH 1UTNA 1SB1H 3S0NA 1IQJA 2BVSH 1MU8B 1TNGA 1EATA 1J16A 1HAIH 3LJJA 4MNWA 2CHAC 4Z1MD 3QZQA 3FN8A 4FUHA 4I86A 3U1JB 4THNH 1AQ7A 1Q2WA 2QXGA 1A2CH 3ENSB 5JPMH 1BTZA 1CBWC 2TGPZ 1XUIA 3CNRA 1SBWA 1W11U 3GY7A 2BD3A 3Q3KA 1TNKA 2WV4A 2GTBA 2FO9A 2ZQ2A 1GJ6A 1KSNA 3RXCA 4Y0YE 1AB9B 3DHKH 2WYGA 1GMDG 1KXAA 2ULLA 4K1EA 3MOCA 4ZKSU 4BTTB 1C5SA 2YNBA 2QN5T 1AHTH 1HFDA 1TFXA 5C1YA 2ZHQH 3M7QA 1G36A 3D62A 1QL7A 1XVOA 2FPZA 1OOKB 8GCHG 1P2NA 1T8LA 3OSYA 1UTJA 2G4TA 3A86A 2YMSC 1HAOH 3K9XB 1BMNH 1EUFA 4Z0KA 2XWBI 2HGTH 2OK5A 3ZZ5A 1YYY1 2IPHA 3DFLA 1P09A 2ZDNA 3CS7A 4X2VA 1TNIA 1DE7H 4AORA 2H9HA 1C1RA 3N99A 1O31A 2Y6TA 5EPYA 1ARBA 1O2YA 2GVFA 1GI8B 4NWKA 1HCGA 3RUOA 4AFZA 1OYQA 1INCA 1GPZA 1Q3XA 4JZ1A 2BD2A 1TBZH 4DT7B 4Z6AH 4WH6A 1IOEA 1F7ZA 3NK8A 1TWXB 1IQLA 1XX9A 2Z3EA 5F8ZA 1GI3A 4HGCA 5DJ7A 4BOHA 1NFYA 6ESTA 2KAIA 2PUQH 3MNSA 5ESTE 3Q76A 1NFWA 4ABHA 1W7XH 1GHBF 3UAIC 1QGFA 3SYJA 1LHFH 3M3TA 2M2AA 1TA6A 4MVNA 1M9UA 1GBTA 3RM0H 1DITH 2ZNKH 3ZV9A 3A87A 1KYNA 2GT7A 3UOUA 5IK2D 4HFPB 2VIDA 3GCTG 4O3UA 1O0DH 4KP0A 4NCYA 3BEFB 2BD7A 1HAXB 4UFFH 3U8RH 2ZP0H 1UVPA 3BTEE 1GI6A 3UREA 2QGRA 1A4WH 1DICA 5EOKA 4XD7D 4DGJA 3Q3XA 3KQEA 2RA0A 3EE7A 3T5FH 1HXEH 1C5WB 5GIBA 1FLEE 3AW1A 3F6UH 2P93A 1CHOG 4A5TS 1P11E 2GCHG 4LOYH 2FOCA 2CF8H 1JRSA 3GICB 1KY9A 1MKWK 1C2JA 2UWOA 1NRNH 1TPPA 2D1JA 4U2WA 2ZF0H 2FX4A 1P02A 2LPRA 2Z9GA 2F9PA 1AIXH 1ETTH 1UJ1A 1K2I1 2QF4A 1OWHA 2P16A 1SHHB 1O2GH 2OQ5A 2P3UB 4X8SH 4M7GA 1A5HA 1J9CH 1GVLA 1MBQA 1NM6A 1GMDF 1TONA 1V2ST 1ZGVA 2OXSA 7GCHG 3S7HB 2VH0A 1NO9H 4LXBH 1QA0A 4MDSA 3T26A 2BY5X 3RDZA 5T6GA 3RXGA 3STJA 2FI3E 1A0HB 2BB4A 5JYIA 5FCRA 2XBXA 4A7IB 3PLKA 1J15A 1A0LA 1SQOA 5B6LA 5C2ZA 1O2OA 1BBRK 1L1JA 3FP7E 2JETC 2AFQB 4IBLH 3T29A 1EZSC 2BD5A 1ZPCA 3UQVA 2AMDA 1FY8E 1O2UA 2FIRH 1EASA 3O8DA 4H42U 2A32A 3WW7A 3RU4T 2RFKC 1NTPA 1KXBA 5F03A 1TGTA 4Y79A 2L74A 1AU8A 1COWD 1SGEE 4JMYA 3EQ0H 3O8BA 4I8KA 4ZCNA 1YLCA 5EJLA 2XBYA 1HPGA 4YOJA 4TWWA 1T8MA 1O5CB 4XBDA 5C20A 1VGCB 2GV6A 2EI8A 2GMTC 3SU5A 1FNIA 4YTAA 2FWWA 3M35A 1BB0B 2GDDA 2C8ZB 2R2MB 3A89A 2XCNA 4CH8B 1O5BB 2XNIA 2D26C 2ZGJA 3KEEA 3RXRA 1H8ED 3SU3A 5I25A 3PV4A 2Y5HA 4IW4E 1S6HA 3LIWA 3D49H 4NSVA 2UUJB 1FIWA 1O2LA 3P8NA 4JZIA 3ZVFA 1GDNA 2WPDD 2Y81A 3NUMA 2HVXA 5FCKA 3H7TA 1XVMA 1RTLA 3M37A 2QV1A 5JDUB 2Y82A 2PFEA 4CBOA 3BTDE 2BY6X 3ZVGA 1B7XB 4UONA 2WSSD 3LKWA 3GS9A 4RKOB 4FUJA 3SUFA 4D9RA 2BM2A 4CRGA 2ZDMA 3V13A 3UTUH 3SBKA 2A7CA 4O9VA 1W14U 3LGUA 1HJ8A 1TPOA 1AFEH 2FZZA 4OS4A 3LGVA 2XCFA 2A2XH 1NZQH 3CP7A 3K65B 3VB3A 3VB7A 2BLQA 4ISOA 4K3JA 5FX5A 1C4U2 2SGPE 2W3IA 1YP9A 4Y8ZA 5F8TA 5DG6A 2A5IA 4ZKRU 1SGFA 3UNRA 2PLXA 4Y8XA 5LGOA 4UFDH 4I32A 1XMNB 2XOKD 2FOFA 2QF3A 1F0SA 1D3DB 3BG8A 4OS5A 4A1XA 3VB4A 1SFQB 2IPQX 3A81A 2Y7ZA 2B5TB 1SMFE 5CHAC 2V7QD 1A3EH 2EI7A 4BXSA 4I7YH 1H8IH 2Z3CA 2GV7A 1QHRB 2QXIA 1F2SE 3PB1E 2VWNA 5SGAE 1GL1A 1WUNH 4U30A 4ZHLU 1NROH 2FLRH 1GI9B 1H8HD 4XDEA 1WV7H 3M5LA 3ZZ9A 4X2YA 2NU1E 1HAVB 1H9HE 4JYUH 1UK4A 2FLBH 1ELGA 2KAIB 1TPSA 2UUKB 5GJ4B 1O3NA 3IITA 2B9LA 4YOGA 4P00A 3WY8A 3VEQB 4VGCB 3TGKE 3T27A 4MPXA 2A4OA 3K6ZA 3MMGA 1DLEA 1S0QA 2UWLA 4SGAE 1O2TA 3BF6H 1C5TA 4D9QA 2XBVA 3C27B 5C5OA 1YLDA 1IHSH 1NRQH 4Y0ZE 3V0XA 1ABJH 1TGBA 1RS0A 1LHGH 2A5KA 1XUFA 1N8OB 1O2ZA 2BY8X 1K1JA 1DSTA 3UR6A 3SJKA 5DO4H 1SFIA 5DKMA 1ETRH 2J94A 3B9FH 3F9HA 4ABBA 1ANDA 2RDLA 2G4UA 1GHYH 1WTHD 4XBCA 3OE7D 1O5GH 3JZ2B 1RIWB 1FPCH 2GJGA 1C5OH 3MNBA 1OWKA 1G3DA 1FAKH 1PYTC 2WV9A 2OLGA 4BTIB 4YLUA 3TVJB 1CBWB 2ZHDA 3LGIA 1MTWA 1EOJA 1ACBE 1O5EH 3F9GA 3SNAA 1SGRE 2AGIX 1O3MA 4D76A 7GCHF 4NA8A 1C1OA 1HGTH 3P8FA 1GVKB 3E16B 4AFQA 1GCTB 3ZVBA 1BT7A 2XYAA 1MMJN 2KCPA 1DS2E 1SGYE 2A7HA 3SQHE 4BAMB 1MZAA 1GMCF 2L6OA 5EPNA 4GSOA 2CK3D 4I33A 1ELEE 1KDQA 2ZPSA 2ALVA 1GI0A 2DUCA 1S6LA 2J92A 2B0FA 1TX6A 3EA8A 2CXVA 1ZMJA 1HJAC 1LTOA 4K2YA 4DIHH 1V2LT 2ZHFH 4OS1A 3BEUA 1TQ7B 4JZFH 1BMFD 4TY7A 1EJMA 1GBLA 2AEIH 3A8AA 1J14A 4WMDA 1YCPK 2J4IA 2BOHB 1C1VH 5GNDA 3PMBB 3U8TH 3WWBA 1MKXH 2HNTE 4K60A 3Q00A 5GWZA 4KGAA 3RXJA 4YM9A 4LZ1H 1HUTH 2B8OH 2ANWA 4IS5A 3SV2H 2VIOA 3RXTA 1TNHA 2SGDE 4B2BA 2A0QB 1LCYA 1QBOA 4X6MA 4X2XA 1DY9A 3PYHA 2BDGA 1ORFA 3RMOH 1SOZA 4BAKB 4D8NA 2QXHA 3ODDA 6CHAB 4OS7A 1C5NH 4IMZA 6GCHF 2G8TA 5LPEA 1SGDE 4INLA 4NFEA 1GBDA 1BRBE 4WXVA 1EAUA 4ASUD 2Z6BD 3RMLH 5GPIB 2ESTE 3SUEA 1LMWB 1PPGE 1NRPH 1SVPA 1WQSA 1SQAA 1NT1A 2WHXA 3KYFA 1CSOE 4TSFD 2FOEA 3P92A 1DFPA 1O2JA 2P3FH 1GGDC 1WYKA 4J2YB 3LGWA 2FI5E 5E0JA 4E7NA 5K7RA 2TBSA 2SFAA 1MCVA 3RXMA 1H4WA 2ZFRH 5H4IB 1YPGH 1V2UT 1O2QA 2F83A 4Q7XA 1DWDH 1P2JA 3UNQA 1PQ8A 1RRKA 4CR5A 4ISHH 3OTJE 1VITF 1C5XB 2GX4A 3TGJE 4VGCC 1C1SA 3SNBA 4MLFB 1NU7B 2WYJA 1CA0C 1TMTH 3ZVCA 4FUGA 4X1SU 1LVBA 2Z7FE 4BAQB 4KTCA 2FOMB 1G32B 1HLTH 1BHXF 1SQRA 3QGJA 1OXGA 2A1DB 1VZQH 3H7OA 2M5TA 1TNJA 2WPLS 1FX0B 1ARCA 5L30H 1O3EA 1C2KA 2Q6GA 2GZ9A 4Y7BA 5DP5A 5KECA 2W7SA 1Z6EA 4RN6A 3MTYA 1LVOA 2ZGHA 1MBMA 1WDIA 1C2MA 2PV9B 1QB6A 3HKIB 4MNXA 5EXNA 3IG6B 2PP6A 2Z9JA 3QX5H 1NU9A 1FY5A 3U98H 1DX5M 3A8BA 2Z9KA 4WH8A 2ZPQA 2ZU2A 4KKDA 4AX9H 2KCAA 3C1KA 3TITA 2J97A 3P17H 3H5CB 3FP8E 3G01A 4X6PA 1G9IE 4DG4A 1YPLH 1H9IE 5DP7A 1MH0A 1G3BA 3RC6A 3MWIU 1BMLA 3OTPA 3QTOH 2ZGXH 1LKAA 1RGQA 4ZHAA 3Q77A 1OKXA 4RKJB 3VGCB 4X1NU 4MNYA 5A8ZA 1QL8A 1GBAA 2J38A 5JB9S 5C1UA 1BTPA 5E0HA 1QB9A 2WZQA 5A0CA 3QZRA 2GCHF 5FXLA 1PFXC 4IMQA 3SV9A 3LGTA 1VR1H 1AUTC 3ZYDA 3UFAA 4B71A 3DT0H 1C1MA 4IGDA 4NSYA 3BTWE 1K0HA 3BG4C 2C93B 1VJAU 1O2HA 1RD3B 4QT8C 3A8DA 1CO7E 5FHTA 4BAOB 3M5OA 1S82A 1W0ZU 3QK1A 5DP4A 1C2LA 3SGQE 1LPZB 1BRUP 3TK6A 1D3TB 1QL9A 3GY4A 2DE8A 1NRRH 4DURA 1FY1A 5CE1A 1V2PT 1IAUA 2BDAA 1Z6JH 1GBBA 1E38B 3UB0A 5BPEA 4TY6A 1C2GA 1LO6A 2LP6A 3BTQE 1ZSJA 3DD2H 1FPHH 3LJOA 1ZLRA 3OX7U 1L2EA 1H8DH 3OEED 1GBJA 2JJ1D 1OX1A 1IQMA 1K1IA 1O2WA 5HM2A 5HXFA 3E1XB 2CN0H 3RU4D 1D4PB 1GMHF 2VGCB 1LQEA 4D7FA 1S5SA 4F4OC 2ZFFH 5C3NA 5FPTA 2H5CA 1O3HA 4X8UH 5EQSA 1MABB 1ZPZA 2TRMA 3A7XA 1PJPA 2HWLB 2V6NA 1HRTH 3U9AH 3PMAB 4H6SB 2HOBA 3SORA 3B23B 2NU3E 1V2JT 1O30A 4AZ2B 2A31A 4NGAH 2Y7XA 3GCNA 1IQGA 1YWUA 4Y6DA 1H1BA 3A8CA 1EZUC 1ZMNA 3VG8A 3SJ9A 2RDEA 2AIQA 5DSFA 1W0YH 1XUHA 1ZZZA 1E37B 5HIYA 3TH3H 1ESTA 2O8TA 1TMBH 4B74A 3PRBA 2HLCA 3F9FA 1QFKH 1FDPA 3KNXA 3UNSA 1AKSB 4DIIH 1AFQB 3FVFB 5GCHF 3E90B 1W0KD 2VBCA 5GDSH 1O2XA 4Y11E 1UCYE 5B6OA 3U1IB 1Y8TA 3E8LA 3OYPA 1K21H 4ASHA 1TPAE 4FVBA 2OBQA 4D7GA 1F5LA 1Q31A 1O32A 3LH1A 1DUAA 1ELCA 1THRH 1N6YA 1GBHA 2TGAA 5EQRA 4F55A 4AG1A 1TOMH 1HAVA 2FMJA 2B7DH 1B0EA 5A0BA 1BDAA 1FMGA 5EU8A 3KGPA 1DXPA 3VB5A 2WPIS 1J17T 1AE5A 4YLQH 1C1NA 1G37A 1PPZA 3KF2A 5A8YA 3RXBA 3TJVA 4AFUA 4ACAA 3KCGH 1SOTA 5EQQA 2I6QA 4YOIA 1ABIH 2C8XB 1NY22 3F68H 2WPHS 3UOPA 1C2IA 4H6TA 1BUIA 1UTMA 2VIVA 2ZFQH 3T28A 1C5PA 4WJG2 8LPRA 3A7TA 1UTOA 1ID5H 4JZEH 3LT3A 2HNTC 1EXFA 1P2MA 5DP8A 1UCYH 1HV7A 1QZ8A 1GHAG 1GI1A 3SNCA 3SV6A 1TGNA 2V3HH 2A7JA 4ACBA 1O2SA 4FUEA 2J98A 1K1NA 3GCHC 3GCOA 2BY9X 3KL6A 2VGCC 7KMEH 3RMNH 1GJ9B 1D6WA 1MAYA 1OWJA 2J34A 2QF5A 1E79D 4DVAU 1GBCA 3WWFA 3PRDA 3ZVEA 3SNEA 1QJ7B 3SGBE 2BD9A 2R3UA 1XXDA 3R0FA 2BMGB 4CRBA 1C1UH 3ZVDA 2JH6D 2VIQA 3LPRA 2SNWA 2F9VA 1JMOH 2AIPA 3GDVA 2BTCE 2G00A 2PUXB 4OS2A 1NS3A 3RXAA 2LELA 1P05A 1EB2A 1V2NT 1GHVH 1UK2A 1G30B 1THSH 2FODA 2HPPH 4CRFA 1UTPA 1AD8H 5JBBS 1A7SA 1FY3A 1GJ7B 4RI0A 3K6YA 1AWFH 8GCHF 3DSGA 1C5LH 1FV9A 2AS9A 2ZO3H 1O2NA 4CBNA 4WMFA 1JOUB 2FDAA 3S9CA 2PGQB 2A4RA 4GHTA 2ZDVH 3SUDA 2D8WA 5CMXH 3P8OA 1KMHB 3SN8A 4FU7A 1KXEA 3ATKA 1IQIA 4X0WU 3L3TA 1BJUA 1P2KA 2H9TH 4BNRA 2FOGA 2C8YB 1Z7KA 3GISB 3DA9B 4AB9A 1YKTA 3MO3A 3HPTB 1E36B 4TPIZ 2NU2E 2IJOB 1HIAB 4UE7H 4FVDA 1N6XA 1W2KH 3HK6B 5EXLA 3RM2H 3PV2A 1QB1A 4UD9H 1C5ZB 2PTCE 1YPMH 2P3TB 4WY3A 1GI5A 1RFNA 2ZC9H 5CHBA 1ZTJA 1QJ1B 5AFZH 6CHAC 2YNAA 4LK4A 1C2FA 2ZCKP 1ESBA 2G55A 3TU7H 3A82A 1BOQA 2XRCA 1NN6A 1LKBA 1BTYA 1TQ0B 3A88A 1LVMA 1K22H 3ZZAA 2WUBA 1FUJA 4XBBA 2VINA 3PO1B 2BY7X 1PPFE 2SNVA 4GVUA 1ANBA 1MTVA 1WQVH 1FAXA 4JCNA 1P2QA 2VH6A 4FU8A 1XUGA 5IYTA 1S0RA 1D6RA 1UTQA 1TX7A 1AGJA 3MFJA 2ZECA 4B1TA 2A5AA 4IC5A 2BDIA 3FZZA 1GJAB 3GYLB 5ESBA 4A6LA 4MG3A 1GGDB 1O2IA 1YBWA 1CA8B 3M5MA 1K1MA 3QWCH 4OGXA 1V2KT 3SU1A 3FZDA 1IQEA 4Q63A 3JZ1B 1BTHH 2VVCA 1O5AB 1AMHA 4UEHH 5C1XA 1O34A 1Y5AT 2EC9H 3QN7A 4TPYA 1C4V2 2P8OC 4M9FA 2R9PA 4BAHB 2AHME 3RXKA 1P10A 2RA3A 1GWAA 1EFRD 1CGIE 1CT2E 1GBFA 1HB0B 2BQWB 1CT0E 4WXIA 4B2CA 1O36A 1UVTH 3SGAE 2BXTH 4B2AA 4CRAA 1IHTH 2O9QA 3VFEA 5HIZA 4FOUC 1NBME 1FIZA 1O3FA 1UTKA 2OINA 3E0PB 4B75A 3ATWA 1TRYA 2CMYA 1KTSB 2BDBA 2GT8A 2HRVA 2O8MA 1SGQE 3PLPA 1DPOA 4FUIA 2SGQE 2BLVA 4ISIH 3BTKE 5C5NA 3ZZ6A 1O2PA 3AAUA 4NZQA 2AMQA 3NXPA 1CHGA 1SQTA 2QCYA 1KLIH 2GZ7A 1AO5A 1ZRBA 2ZQ1A 3A84A 1AI8H 3R3GB 2XC0A 1KIGH 5T3HA 2VJ1A 1RTKA 4UFEH 4GUXA 1AWHB 3E0NB 1OWEA 1GMCG 1EP6A 2OTVA 3CS0A 2PHBA 1GMHG 5HYOA 1F0UA 1TA2A 3VGCC 5LPRA 4SGBE 1X7AC 1W13U 3ZYEA 5C17A 3SHAH 1N8OC 3NRLA 4FU9A 4RSPA 3UPEA 3UIRA 1GG6B 5EG4A 3TNSA 5A2MH 5FBIA 3A7WA 1BRCE 1PPEE 4FUDA 1EAWA 2YOLA 1E1RD 3PWBA 1O2MA 2Q1JA 1WSSH 3TJNA 4ISLA 1DUEA 1S84A 1Z8RA 1EPTA 3FANA 3UQOA 4I8LA 3EDXB 4MQAA 2VIPA 5G4BA 5EJZA 1RXPA 1ZOMA 4XOJA 1TYNA 4UDWH 1FI8A 4ZXYH 4AOQA 1ELBA 2JH0D 1HNEE 1XKAC 2KCOA 2FYRA 2W6ID 2KX4A 2PKSC 1YLNA 3OAAD 3S69A 1XKBC 1AZZA 3SQEE 1UTLM 1U6QA 3A85A 1W0JD 1F5KU 3PROA 3D65E 9ESTA 3TPIZ 1A0JA 3MH4A 2OP9A 2ODPA 1V2WT 4X1PU 1Z8IB 1S81A 1GJ5H 3BTFE 4GAWA 3MNCA 4B73A 2ANYA 2PW8H 3FKSD 1GHAF 1IQHA 3HK3B 1OP0A 4A1VA 1O5DH 1BTXA 2W5EA 3U28C 1HJAB 1W8BH 5I46H 3W95A 3SU2A 1AVWA 3RXHA 3S9BA 3QO6A 2ZG0H 1TBQH 3SU0A 2LNCA 3SI3H 1SSXA 4BXWA 1SLUB 1WBGB 1Z8GA 1EP5A 1ELVA 1IQFA 3V3MA 1O3CA 3QUMP 3SJ8A 2FEQH 1Y5UT 1FY4A 1QBNA 5PTPA 2ZDAH 1QIXB 1A3BH 3OU0A 4CREA 1OWDA 3GY2A 1TGCA 2J2UA 2Z94A 4YT6H 1C1TA 4AC9A 4HZHA 4O03A 4WWYA 2THFB 4ABDA 2ZEBA 4FUCA 2ANKH 3N7OA 2P59A 2K1QA 4Y8YA 1DOJA 1V2VT 2BD8A 1MCTA 5ETXA 2VWMA 1C2EA 1B5GH 3V7TA 3ZZDA 2F4LA 1W7GH 4E05H 3RMMH 1XUJA 2CV3A 2DE9A 1XXFA 1DY8A 4AN7A 1S6FA 2XNDD 1K1OA 1P2OA 1O3IA 4AG2A 1ZGIA 4ZUHA 2A45B 2JJ2D 2G5NA 1PQAA 1MAXA 2UUYA 2R2WU 4ISNA 1TABE 3M36A 8ESTE 2IN2A 5DP3A 1KXDA 1YGCH 3UR9A 2JIZD 1RTFB 4I8GA 4HG6A 2HALA 4F49A 3A80A 1VGCC 2FS9A 2ZZUH 5L2ZH 1YPJH 4ABJA 3HATH 4WVPE 3E6PH 2H6MA 4JK6A 3MH5A 1KLJH 1FJSA 1AY6H 1O35A 1QRXA 3F3BA 3KN2A 3MQKC 3SU4A 1C1PA 4ZROA 1DM4B 1V2OT 1CA0B 1ZTKA 3BIVH 2F9BH 3MH7A 5F8XA 1CE5A 1Y3WA 1UK3A 5FX6A 3LU9B 5JBCS 1PQ5A 1MKWH 4NZLA 3VB6A 2WINI 1YM0A 1IQNA 2XBWA 3KHVA 4F48B 1V3XA 1DLKB 3NZIA 1C9PA 1ESAA 1BZXE 1QA7A 3SOSA 3MU0A 1L0ZA 2VWOA 1LPKB 5T1VA 1GVZA 4WF8A 1NFUA 1Y5BT 3OEHD 5JBTA 2ZKSA 3PLBA 5C0TA 2BVRH 2R0KA 1Y59T 1MTSA 3BTGE 4LZ4B 1L1GA 1A5GH 1Z71A 1GBIA 2R3YA 2BQ7B 2XC4A 1P3EA 1F92A 2C3SA 3MU8A 5FAHA 1P12E 3GCHB 1GI4A 1QRWA 1SGNE 1UVUH 4RT0A 1NBMD 3RXDA 1EQ9A 1H9LB 3MH6A 3MNXA 1K1PA 2ZU1A 2XW9A 3P8GA 2BOKA 2ZCLP 3BEIB 2OC1A 1O2VA 3MO6A 2XC5A 4IN1A 1L4ZA 4IC6A 2Z3DA 4Y76A 4Q2KA 1ELAA 5L2YH 1MTNC 1KLTA 4B76A 3GY3A 3I78A 1BIOA 4NG9H 1O37A 5EIYA 1ZSLA 2W7UA 5F53A 4GCHF 3LDXH 1MD8A 1QNJA 4FUBA 2VVUA 4GPGA 2K0QA 1QQ4A 5ABWA 2GP9B 7ESTE 1AUJA 1JIRA 2VU8E 3M7TA 2ZFTA 3O8RA 1DSUA 3MI4A 4FUFA 2KR7A 2NWNA 1GJCB 1AKSA 3GYMA 2JH5D 3BG4B 4X8TH 5DGJA 2ZWLH 4DOQA 1CGHA 1QQUA 3TH4H 4YESB 5C67A 1E1QD 3DUXH 3SI4H 3F0PA 1DWEH 2Q6DA 2ZI2H 1NESE 4NIVA 5IDKA 3GY8A 2GZ8A 1ZPBA 2BXUH 2OQUA 1V2QT 3SZNA 3VXEH 4K69A 4ESTE 4K8YA 2WPMS 1CU1A 1BQYA 2BQ6B 1EJNA 3TK9A 1P9SA 2ZTZA 5A09A 1EX3A 3T62A 3GOVB 1SHYA 3PO1C 2C4FH 2UWPA 1CT4E 1O3OA 2PKAB 1THPB 5CDFE 1ZRKA 2Y80A 1S83A 2QE7D 1BTWA 2Q6FA 2XXLA 2ZGCA 2WPKS 2ZA5A 4ZH8A 1P57B 1V2MT 2YMSB 3RXUA 4O97A 4CH2B 1GJBB 1PQ7A 1ZHRA 1WU1A 1P8VC 3M61U 4INKA 2JDID 3GY5A 2VNTA 3TK5A 1WAYB 5T6DA 1FN6A 3A7ZA 2K8IA 1O3DA 5BRRE 1JXPA 2V35A 1O3AA 1RJXB 2BLWA 3FOAA 1BTUA 3MO9A 1OPHB 1OP2A 4RT1A 1T4UH 5EODA 1VJ9U 1PYTD 5HGGA 2QA9E 2PSYA 1DT2A 1SGCA 3ITIA 4KTSA 2VIWA 1YF4A 3M3SA 3TJOA 1GBEA 3RLWH 3BTHE 3LC5A 4Y7AA 1GCTC 2AERH 4B6FA 1T32A 1SLWB 1PPBH 2HPQH 3NCLA 1AVXA 2G52A 4H4FA 4KELA 6GCHG 2FS8A 1O3LA 1L1NA 3UY9A 4CRDA 4KTUA 1LPGB 5E2OA 1GJDB 1MZDA 1AFQC 1HAHH 4TWYA 5TCAA 4P02A 4YXWD 3NPSA 3QDZB 3CENA 5EXMA 3L6PA 2BX4A 2EI6A 3BSQA 1VITH 4Q7YA 2BDCA 4CHAC 4YZUA 4ZKOU 3KQCA 4ABAA 4I8HA 5GXPA 3ZV8A 2A4QA 2FOBA 1C4Y2 2FTLE 5AF9H 1MU6B 1T8NA 1P04A 3FAOA 2ZHWH 3SZEA 2EEKA 1FN8A 3SO3A 2BLOA 2ZIQH 1BBRE 3MHWU 3E91A 2ANMH 3UWJH 3TGIE 4JZDH 3T2NA 2Y5GA 3BIUH 4MPWA 2AH4X 1FXYA 2AGGX 5JB8S 1QTFA 2BZ6H 5J4SA 1SGFG 5DPAA 5LPFA 4ABGA 5DP9A 1TAWA 1A1RA 1JBUH 3DSPA 2SGEE 1C2HA 4ABIA 1Y3VA 2QXJA 3STIA 3KQ5A 3VPKA 2I6SA 4MPVA 5A0AE 1N1LA 2AYWA 1A46H 2KCYA 3RXPA 5T6FA 1W3CA 3H09A 3QTVH 2PR3A 3ZZ3A 2JKHA 2QY0B 1T31A 1XUKA 2J98B 1C2DA 2ZGBH 1TMUH 1D3PB 3M7UA 1C5MD 1HAGE 2ZFSA 2G51A 1TGSZ 2BHGA 3AW0A 1WTGH 3ZVAA 4B6EA 3DSOA 1C1QA 1ZMLA 3PTNA 4BTUB 3PMHB 1G2LA 5DP6A 1KXFA 3B8JA 2ODYB 2PKSB 1HJ9A 1YPHC 4DT4A 2A2QH 3L33A 3P70B 3HGNA 3FO8D 4X1QU 1TIOA 4GLYA 4GHQA 3LOXA 2AMPA 2BDYA 5J4QA 2KZ4A 1O3PB 2JETB 2PKAA 5E0GA 1EZQA 3MYWA 1O38A 4NA7A 3EA7A 1SLVB 1HIAA 3TJUA 2OC8A 1TRMA 4NIYA 1F0TA 5K0HA 1E34B 1YCPH 2CGAA 1EAXA 1UHBA 3F0OA 1GG6C 3GDUA 3SJIA 1P3CA 1MKXK 1TOCB 2O8LA 2XWAA 1T4VH 1ZHPA 2ZDKA 4Y10E 4NWLA 1GHWH 2H2ZA 2FESH 4MPUA 4R0IA 3SU6A 5HM9A 2O8WA 4FETA 1Y3UA 1ZJDA 1GL0E 2W6JD 1L4DA 3ATMA 5AHGH 1UW7A 4TYDA 1K1LA 2WUCA 1EB1H 1GCDA 1MQ6A 1HAZB 2BX3A 3QLPH 1Y3YA 3MU5A 4YO9A 1QY6A 1AB9C 4XE4A 1TB6H 2KFWA 1FONA 4ABFA 4DCDA 1J8AA 1YPEH 4X6NA 3URDA 3EGKH 2A4GA 1AE8H 3PMJA 1O3JA 3FFGA 2IJD1 1QRZA 2OCVB 5EJ1A 1SL3A 2QAAA 3Q3YA 3F2GA 2TGTA 5EGMA 4Q7ZA 1V2TT 2AGEX 3RXLA 5LH8A 3V12A 3RXIA 1ZSKA 4OGYA 5HKKD 2ODQA 4NIWA 2GD4B 3BTTE 2BD4A 2NU4E 5DK1A 1O2KA 3W94A 1QJ6B 1V6DA 1C1WH 2UUFB 2V0BA 2V3MA 1ETSH 3NWUA 4DJZB 1TNLA 4JYVH 3BTME 1V2RT 1C5VA 3T25A 1GBKA 2OUAA 3EAJA 3RXOA 3SV8A 1DWCH 1NFXA 1O39A 5E2PA 4BANB 1WOFA 1LHCH 3I29A 1QBVH 3VXFH 2P8OB 3AASA 2HVYB 2C90B 2OD3B 1GHZA 1QCPA 4TT3D 4E06H 1PPCE 3N7EA 4OS6A 1BJVA 1O3BA 2IOTA 2QYIA 4R8TB 3ZZBA 3KIDU 1GDQA 2F43B 3LH3A 1D9IA 3ESTA 5A8XA 5EW2H 3FP6E 1GI2A 4Q4LA 3RXVA 4U32A 5FPSA 3TNTA 2EA3A 3P95A 1T7CA 4A1TA 4ABEA 3RXEA 1O3KA 3ZZ7A 4ZHMU 2EQNA 1YPHE 2ZPRA 1W10U 1TRNA 1JWTA 2WPJS 1P03A 4ZXXH 1GHXH 2NU0E 1RIWC 1SC8U 3ZZ4A 1TLDA 1NC6A 4AYYB 1KDQB 4NA9H 1SG8B 1EPTC 1HXFH 1OP8A 2VVVA 3KYGA 1ZYOA 2FYQA 3PWCA 1KTTB 3HKJB 2WV5A 2ZCHP 8KME2 2GDEH 3ATIA 4MTBA 4ZKNU 3NKKA 1LQDB 2W3KA 2HLDD 2PWXA 4AGKA 1DVAH 1K9OE 1SGIB 2ZU5A 1C5YB 5AFYH 2Z9IA 4JYTA 3RU4E 2FOHA 4OM9A 1XM1A 3URCA 2FTMA 1T8OA 2GCTC 3IWMA 1GDUA 1TBRH 2J5UA 1ANEA 2Y5FA 3MU4A 1ANCA 7LPRA 3PTBA 1ZTLA 3ZIAD 4ZMAH 5TCCA 2FOAA 3RXFA 5AVDA 2ZHEH 1IQKA 3D23A 1AN1E 1ZHMA 2FM2A 1E35B 1HDTH 4X2WA 2RG3A 2QF0A 2TPIZ 4DW2U 2BZAA 2P94A 4K5ZA 4XFQA 2OC0A 1G2MA 3O8CA 2HNTF 1UVSH 2ZFPH 1O33A 2RCEA 3ZZ8A 1GJ4H 4AB8A 2D2DA 1P9UA 4NFFA 2F9NA 1UCYK 1G3EA 2BVXH 2F9OA 2FI4E 3SNDA 2FX6A 4PROA 5DN6D 1VKYA 3SV7A 1F0RA 1A5IA 1TALA 3A7YA 1KXCA 2ZTYA 2P95A 1ELTA 2QIQA 1ZJKA 1EJAA 1SKYE 1QR3E 3GY6A 2PGBB 3OY5U 3PM3A 1SGTA 1D3QB 1WXRA 3P6ZB 1DXWA 2GKVE 2YMSD 3KQDA 4AYVB 5JBAS 2STAE 1E0FD 5HMAA 1TE0A 3RP2A 3F1SB 3S9AA 1UHBB 2VWLA 1HBTH 1P01A 4IN2A 1LVYA 2ASUB 5KEDA 5EW1H 1A61H 1FQ3A 1F5RA 1QURH 3U8OH 1SI5H 1ZR0A 4I31A 1BCUH 1BITA 2GGVB 1NPMA 2V3OH 2H9EH 3N7DA 1UMAH 1OYTH 3LONA 2H5DA 1ELFA 2GMTB 4UFGH 1HAPH 2CHAB 1P0SH 4AFSA 1JIMA 3OFND 2F3CE 1W12U 1Z1JA 3ATLA 4INHA 1EPTB 1B0FA 3MU1A 4WMEA 3A7VA 1YPKH 3SW2B 1G3CA 2J9NA 2OC7A 1EAIA 1BMAA 4DY7B 1BRAA 2STBE 4O3TA 1O5FH 3UUZA 1P2IA 4HI3A 1YCPM 1AVGH 1CQQA 3RXSA 3RC5A 5FPYA 3TLOA 4K8BA 3BV9B 5C94A 1YC0A 2ALPA 2GCTB 1GI7B 4U01A 1C5UA 1HAYB 4XSKU 2ZU3A 3UWIA 2OBOA 1C5RA 1YY3A 1GJ8B 4X8VH 2FP7B 1SPJA 4X6OA 3AK5A 4CHAB 3LC3A 1PPHE 1VCPA 2G81E 2Z9LA 1LDTT 1Z8JB 3OY6U 1GHBG 1C5QA 1DANH 2EY4C 1EKBB 3GDSA 3RC4A 1K28D 1CHOF 3BN9A 1BMMH 3DCLA 3ZZCA 1VCWA 4E7RG 2W26A 1TX8A 1NRSH 4XRNA 4A92A 1EOLA 5KGOA 3SJOA 3QGNB 3SUGA 1CVWH 1GBMA 3ELAH 2F91A 3EYDA 3S7KB 3AVZA 3LGYA 3RLYH 1O2RA 2C8WB 1FZZA 5GCHG 1MQ5A 1C9TA 4Q80A 4GCHG 2ILNA 4FXGH 3F2HA 4Y71A 3U69H 1SR5C 2PTNA 3I77A 2XTTB 4CR9A 2ZU4A 3ODFA 4YT7H 2R0LA 1BBRH 2F9UA 4I8JA 5C0UA 1Z1IA 3GCTF 2BYAX 1BHXB 1DWBH 1MTUA 5TJXA 4MNVA 1AZ8A 5CHAB 1S85A 2KM0A 2TIOA 1JRTA 1OWIA 3AAVA 1VITG 3A83A 5FBEA 5F6MA 4K1TA 3EE0B 3RXQA 3KQBA 2H1UA 2ZDLA 2PSXA 3HGPA 2CJIA 1WCZA 2VB0A 4J1YA 2TGDA 1VCQA 1P06A 4ZAEA 1HYLA 2J95A 9LPRA 4NIXA 3F9EA 1UO6A 1MD7A 1EZXC 4HTCH 3M3VA 3PV5A 2SGAA 3K2UA 1UVOA 4K1SA 6LPRA 4AGJA 2QC2A 2BDHA 1LHEH 1SGPE 1BA8B 2O8UA 1MUEB 4X1RU 2SGFE 1MTNB 3SHCH 1OSSA 1SLXB 2FXRA 3TH2H 2G5VA 3E3TA 5FL7D 3TIUA 5E8EH 1OHHD 1ELDE 1Y3XA
chains in the Genus database with same CATH topology
2CF9H 4CRCA 1O3GA 3M5NA 4JK5A 1DDJA 1CGJE 1LHDH 3EA9A 1OS8A 3DFJA 2ZTXA 5L6NH 1UTNA 1SB1H 3S0NA 1IQJA 2BVSH 1MU8B 1TNGA 1EATA 1J16A 1HAIH 3LJJA 4MNWA 2CHAC 3QZQA 4FUHA 3U1JB 4THNH 1AQ7A 1Q2WA 2QXGA 1A2CH 3ENSB 5JPMH 1BTZA 1CBWC 2TGPZ 1XUIA 1SBWA 1W11U 3GY7A 2BD3A 3Q3KA 1TNKA 2WV4A 2GTBA 2FO9A 2ZQ2A 1GJ6A 1KSNA 3RXCA 4Y0YE 1AB9B 3DHKH 2WYGA 1GMDG 1KXAA 2ULLA 4K1EA 3MOCA 4ZKSU 4BTTB 1C5SA 2YNBA 2QN5T 1AHTH 1HFDA 1TFXA 5C1YA 2ZHQH 3M7QA 1G36A 3D62A 1QL7A 1XVOA 2FPZA 1OOKB 8GCHG 1P2NA 1T8LA 3OSYA 1UTJA 2G4TA 3A86A 1HAOH 3K9XB 1BMNH 1EUFA 4Z0KA 2XWBI 2HGTH 3ZZ5A 1YYY1 2IPHA 3DFLA 1P09A 2ZDNA 3CS7A 4X2VA 1TNIA 1DE7H 4AORA 2H9HA 1C1RA 1O31A 2Y6TA 5EPYA 1ARBA 1O2YA 2GVFA 1GI8B 4NWKA 1HCGA 3RUOA 4AFZA 1OYQA 1INCA 1GPZA 1Q3XA 4JZ1A 2BD2A 1TBZH 4DT7B 4Z6AH 4WH6A 1IOEA 1F7ZA 3NK8A 1TWXB 1IQLA 1XX9A 2Z3EA 5F8ZA 1GI3A 4HGCA 5DJ7A 4BOHA 1NFYA 6ESTA 2KAIA 2PUQH 3MNSA 5ESTE 3Q76A 1NFWA 4ABHA 1W7XH 1GHBF 1QGFA 1LHFH 3M3TA 1TA6A 4MVNA 1M9UA 1GBTA 3RM0H 1DITH 2ZNKH 3ZV9A 3A87A 1KYNA 2GT7A 3UOUA 4HFPB 2VIDA 3GCTG 4O3UA 1O0DH 4KP0A 4NCYA 3BEFB 2BD7A 1HAXB 4UFFH 3U8RH 2ZP0H 1UVPA 3BTEE 1GI6A 3UREA 2QGRA 1A4WH 1DICA 5EOKA 4DGJA 3Q3XA 3KQEA 2RA0A 3T5FH 1HXEH 1C5WB 5GIBA 1FLEE 3AW1A 3F6UH 2P93A 1CHOG 4A5TS 1P11E 2GCHG 4LOYH 2FOCA 2CF8H 1JRSA 3GICB 1KY9A 1MKWK 1C2JA 2UWOA 1NRNH 1TPPA 2D1JA 4U2WA 2ZF0H 2FX4A 1P02A 2LPRA 2Z9GA 2F9PA 1AIXH 1ETTH 1UJ1A 1K2I1 1OWHA 2P16A 1SHHB 1O2GH 2OQ5A 2P3UB 4X8SH 4M7GA 1A5HA 1J9CH 1GVLA 1MBQA 1NM6A 1GMDF 1TONA 1V2ST 1ZGVA 2OXSA 7GCHG 3S7HB 2VH0A 1NO9H 4LXBH 1QA0A 4MDSA 3T26A 2BY5X 3RDZA 5T6GA 3RXGA 3STJA 2FI3E 1A0HB 2BB4A 5JYIA 5FCRA 2XBXA 4A7IB 3PLKA 1J15A 1A0LA 1SQOA 5C2ZA 1O2OA 1BBRK 1L1JA 3FP7E 2JETC 2AFQB 4IBLH 3T29A 1EZSC 2BD5A 1ZPCA 3UQVA 2AMDA 1FY8E 1O2UA 2FIRH 1EASA 3O8DA 4H42U 2A32A 3RU4T 1NTPA 1KXBA 5F03A 1TGTA 4Y79A 1AU8A 1SGEE 4JMYA 3EQ0H 3O8BA 4I8KA 1YLCA 2XBYA 1HPGA 4YOJA 4TWWA 1T8MA 1O5CB 4XBDA 5C20A 1VGCB 2GV6A 2EI8A 2GMTC 3SU5A 1FNIA 4YTAA 2FWWA 3M35A 1BB0B 2GDDA 2C8ZB 2R2MB 3A89A 2XCNA 4CH8B 1O5BB 2XNIA 2D26C 2ZGJA 3KEEA 3RXRA 3SU3A 5I25A 3PV4A 2Y5HA 4IW4E 1S6HA 3LIWA 3D49H 4NSVA 2UUJB 1FIWA 1O2LA 3P8NA 4JZIA 3ZVFA 1GDNA 2Y81A 3NUMA 2HVXA 5FCKA 3H7TA 1XVMA 1RTLA 3M37A 2QV1A 5JDUB 2Y82A 2PFEA 4CBOA 3BTDE 2BY6X 3ZVGA 1B7XB 4UONA 3LKWA 4RKOB 4FUJA 3SUFA 4D9RA 2BM2A 4CRGA 2ZDMA 3V13A 3UTUH 3SBKA 2A7CA 4O9VA 1W14U 3LGUA 1HJ8A 1TPOA 1AFEH 2FZZA 4OS4A 3LGVA 2XCFA 2A2XH 1NZQH 3CP7A 3K65B 3VB3A 3VB7A 2BLQA 4ISOA 4K3JA 5FX5A 1C4U2 2SGPE 2W3IA 1YP9A 4Y8ZA 5F8TA 5DG6A 2A5IA 4ZKRU 1SGFA 3UNRA 2PLXA 4Y8XA 5LGOA 4UFDH 4I32A 1XMNB 2FOFA 2QF3A 1F0SA 1D3DB 3BG8A 4OS5A 4A1XA 3VB4A 1SFQB 3A81A 2Y7ZA 2B5TB 1SMFE 5CHAC 1A3EH 2EI7A 4BXSA 4I7YH 1H8IH 2Z3CA 2GV7A 1QHRB 2QXIA 1F2SE 3PB1E 2VWNA 5SGAE 1GL1A 1WUNH 4U30A 4ZHLU 1NROH 2FLRH 1GI9B 4XDEA 1WV7H 3M5LA 3ZZ9A 4X2YA 2NU1E 1HAVB 1H9HE 4JYUH 1UK4A 2FLBH 1ELGA 2KAIB 1TPSA 2UUKB 5GJ4B 1O3NA 3IITA 2B9LA 4YOGA 3WY8A 3VEQB 4VGCB 3TGKE 3T27A 4MPXA 2A4OA 3K6ZA 3MMGA 1DLEA 1S0QA 2UWLA 4SGAE 1O2TA 3BF6H 1C5TA 4D9QA 2XBVA 3C27B 5C5OA 1YLDA 1IHSH 1NRQH 4Y0ZE 3V0XA 1ABJH 1TGBA 1RS0A 1LHGH 2A5KA 1XUFA 1N8OB 1O2ZA 2BY8X 1K1JA 1DSTA 3UR6A 3SJKA 5DO4H 1SFIA 5DKMA 1ETRH 2J94A 3B9FH 3F9HA 4ABBA 1ANDA 2RDLA 2G4UA 1GHYH 1WTHD 4XBCA 1O5GH 3JZ2B 1RIWB 1FPCH 1C5OH 3MNBA 1OWKA 1G3DA 1FAKH 1PYTC 2OLGA 4BTIB 4YLUA 3TVJB 1CBWB 2ZHDA 3LGIA 1MTWA 1EOJA 1ACBE 1O5EH 3F9GA 3SNAA 1SGRE 2AGIX 1O3MA 4D76A 7GCHF 4NA8A 1C1OA 1HGTH 3P8FA 1GVKB 3E16B 4AFQA 1GCTB 3ZVBA 1BT7A 2XYAA 1MMJN 1DS2E 1SGYE 2A7HA 3SQHE 4BAMB 1MZAA 1GMCF 5EPNA 4GSOA 4I33A 1ELEE 1KDQA 2ZPSA 2ALVA 1GI0A 2DUCA 2J92A 2B0FA 1TX6A 3EA8A 2CXVA 1ZMJA 1HJAC 1LTOA 4K2YA 4DIHH 1V2LT 2ZHFH 4OS1A 3BEUA 1TQ7B 4JZFH 4TY7A 1EJMA 1GBLA 2AEIH 3A8AA 1J14A 4WMDA 1YCPK 2J4IA 2BOHB 1C1VH 3PMBB 3U8TH 1MKXH 2HNTE 4K60A 3Q00A 5GWZA 4KGAA 3RXJA 4YM9A 4LZ1H 1HUTH 2B8OH 2ANWA 4IS5A 3SV2H 2VIOA 3RXTA 1TNHA 2SGDE 4B2BA 2A0QB 1LCYA 1QBOA 4X6MA 4X2XA 1DY9A 3PYHA 2BDGA 1ORFA 3RMOH 1SOZA 4BAKB 4D8NA 2QXHA 3ODDA 6CHAB 4OS7A 1C5NH 4IMZA 6GCHF 2G8TA 5LPEA 1SGDE 4INLA 4NFEA 1GBDA 1BRBE 4WXVA 1EAUA 2Z6BD 3RMLH 5GPIB 2ESTE 3SUEA 1LMWB 1PPGE 1NRPH 1SVPA 1WQSA 1SQAA 1NT1A 1CSOE 2FOEA 3P92A 1DFPA 1O2JA 2P3FH 1GGDC 1WYKA 4J2YB 3LGWA 2FI5E 5E0JA 4E7NA 5K7RA 2TBSA 2SFAA 1MCVA 3RXMA 1H4WA 2ZFRH 5H4IB 1YPGH 1V2UT 1O2QA 2F83A 4Q7XA 1DWDH 1P2JA 3UNQA 1PQ8A 1RRKA 4CR5A 4ISHH 3OTJE 1VITF 1C5XB 2GX4A 3TGJE 4VGCC 1C1SA 3SNBA 4MLFB 1NU7B 2WYJA 1CA0C 1TMTH 3ZVCA 4FUGA 4X1SU 1LVBA 2Z7FE 4BAQB 4KTCA 2FOMB 1G32B 1HLTH 1BHXF 3QGJA 1OXGA 2A1DB 1VZQH 3H7OA 2M5TA 1TNJA 2WPLS 1ARCA 5L30H 1O3EA 1C2KA 2Q6GA 2GZ9A 4Y7BA 5DP5A 2W7SA 1Z6EA 4RN6A 3MTYA 1LVOA 2ZGHA 1MBMA 1C2MA 2PV9B 1QB6A 3HKIB 4MNXA 5EXNA 3IG6B 2Z9JA 3QX5H 1NU9A 1FY5A 3U98H 1DX5M 3A8BA 2Z9KA 4WH8A 2ZPQA 2ZU2A 4KKDA 4AX9H 3C1KA 3TITA 3P17H 3H5CB 3FP8E 3G01A 4X6PA 1G9IE 4DG4A 1YPLH 1H9IE 5DP7A 1MH0A 1G3BA 3RC6A 3MWIU 1BMLA 3QTOH 2ZGXH 1LKAA 1RGQA 4ZHAA 3Q77A 1OKXA 4RKJB 3VGCB 4X1NU 4MNYA 5A8ZA 1QL8A 1GBAA 2J38A 5JB9S 5C1UA 1BTPA 5E0HA 1QB9A 5A0CA 3QZRA 2GCHF 5FXLA 1PFXC 4IMQA 3SV9A 3LGTA 1VR1H 1AUTC 3ZYDA 3UFAA 4B71A 3DT0H 1C1MA 4IGDA 4NSYA 3BTWE 3BG4C 2C93B 1VJAU 1O2HA 1RD3B 4QT8C 3A8DA 1CO7E 5FHTA 4BAOB 3M5OA 1S82A 1W0ZU 3QK1A 5DP4A 1C2LA 3SGQE 1LPZB 1BRUP 3TK6A 1D3TB 1QL9A 3GY4A 2DE8A 1NRRH 4DURA 1FY1A 5CE1A 1V2PT 1IAUA 2BDAA 1Z6JH 1GBBA 1E38B 5BPEA 4TY6A 1C2GA 1LO6A 3BTQE 1ZSJA 3DD2H 1FPHH 3LJOA 1ZLRA 3OX7U 1L2EA 1H8DH 1GBJA 1OX1A 1IQMA 1K1IA 1O2WA 5HM2A 5HXFA 3E1XB 2CN0H 3RU4D 1D4PB 1GMHF 2VGCB 1LQEA 4D7FA 1S5SA 4F4OC 2ZFFH 5C3NA 5FPTA 2H5CA 1O3HA 4X8UH 5EQSA 1ZPZA 2TRMA 3A7XA 1PJPA 2HWLB 2V6NA 1HRTH 3U9AH 3PMAB 4H6SB 2HOBA 3SORA 3B23B 2NU3E 1V2JT 1O30A 4AZ2B 2A31A 4NGAH 2Y7XA 3GCNA 1IQGA 4Y6DA 1H1BA 3A8CA 1EZUC 1ZMNA 3SJ9A 2AIQA 1W0YH 1XUHA 1ZZZA 1E37B 3TH3H 1ESTA 2O8TA 1TMBH 4B74A 2HLCA 3F9FA 1QFKH 1FDPA 3KNXA 3UNSA 1AKSB 4DIIH 1AFQB 3FVFB 5GCHF 3E90B 5GDSH 1O2XA 4Y11E 1UCYE 5B6OA 3U1IB 1Y8TA 3E8LA 3OYPA 1K21H 4ASHA 1TPAE 4FVBA 2OBQA 4D7GA 1F5LA 1Q31A 1O32A 3LH1A 1DUAA 1ELCA 1THRH 1N6YA 1GBHA 2TGAA 5EQRA 4AG1A 1TOMH 1HAVA 2FMJA 2B7DH 1B0EA 5A0BA 1BDAA 1FMGA 5EU8A 3KGPA 1DXPA 3VB5A 2WPIS 1J17T 1AE5A 4YLQH 1C1NA 1G37A 1PPZA 3KF2A 5A8YA 3RXBA 3TJVA 4AFUA 3KCGH 1SOTA 5EQQA 2I6QA 4YOIA 1ABIH 2C8XB 1NY22 3F68H 2WPHS 3UOPA 1C2IA 4H6TA 1BUIA 1UTMA 2VIVA 2ZFQH 3T28A 1C5PA 4WJG2 8LPRA 3A7TA 1UTOA 1ID5H 4JZEH 3LT3A 2HNTC 1EXFA 1P2MA 5DP8A 1UCYH 1HV7A 1GHAG 1GI1A 3SNCA 3SV6A 1TGNA 2V3HH 2A7JA 1O2SA 4FUEA 1K1NA 3GCHC 3GCOA 2BY9X 3KL6A 2VGCC 7KMEH 3RMNH 1GJ9B 1D6WA 1MAYA 1OWJA 2J34A 4DVAU 1GBCA 3ZVEA 3SNEA 1QJ7B 3SGBE 2BD9A 2R3UA 1XXDA 3R0FA 2BMGB 4CRBA 1C1UH 3ZVDA 2JH6D 2VIQA 3LPRA 2SNWA 2F9VA 1JMOH 2AIPA 3GDVA 2BTCE 2G00A 2PUXB 4OS2A 1NS3A 3RXAA 1P05A 1EB2A 1V2NT 1GHVH 1UK2A 1G30B 1THSH 2FODA 2HPPH 4CRFA 1UTPA 1AD8H 5JBBS 1A7SA 1FY3A 1GJ7B 3K6YA 1AWFH 8GCHF 1C5LH 1FV9A 2AS9A 2ZO3H 1O2NA 4CBNA 4WMFA 1JOUB 2FDAA 3S9CA 2PGQB 2A4RA 4GHTA 2ZDVH 3SUDA 2D8WA 5CMXH 3P8OA 3SN8A 4FU7A 1KXEA 3ATKA 1IQIA 4X0WU 3L3TA 1BJUA 1P2KA 2H9TH 4BNRA 2FOGA 2C8YB 1Z7KA 3GISB 3DA9B 4AB9A 1YKTA 3MO3A 3HPTB 1E36B 4TPIZ 2NU2E 1HIAB 2IJOB 4UE7H 4FVDA 1N6XA 1W2KH 3HK6B 5EXLA 3RM2H 1QB1A 4UD9H 1C5ZB 2PTCE 1YPMH 2P3TB 4WY3A 1GI5A 1RFNA 2ZC9H 1ZTJA 1QJ1B 5AFZH 6CHAC 2YNAA 4LK4A 1C2FA 2ZCKP 1ESBA 2G55A 3TU7H 3A82A 1BOQA 2XRCA 1NN6A 1LKBA 1BTYA 1TQ0B 3A88A 1LVMA 1K22H 3ZZAA 2WUBA 1FUJA 4XBBA 2VINA 3PO1B 2BY7X 1PPFE 2SNVA 4GVUA 1ANBA 1MTVA 1WQVH 1FAXA 4JCNA 1P2QA 2VH6A 4FU8A 1XUGA 5IYTA 1S0RA 1D6RA 1UTQA 1TX7A 1AGJA 3MFJA 2ZECA 4B1TA 2A5AA 4IC5A 2BDIA 3FZZA 1GJAB 3GYLB 5ESBA 4A6LA 4MG3A 1GGDB 1O2IA 1YBWA 1CA8B 3M5MA 1K1MA 3QWCH 4OGXA 1V2KT 3SU1A 3FZDA 1IQEA 3JZ1B 1BTHH 2VVCA 1O5AB 1AMHA 4UEHH 5C1XA 1O34A 1Y5AT 2EC9H 3QN7A 4TPYA 1C4V2 2P8OC 4BAHB 2R9PA 3RXKA 1P10A 2RA3A 1GWAA 1CGIE 1CT2E 1GBFA 1HB0B 2BQWB