1VJAU

Urokinase plasminogen activator b-chain-jt463 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords plasminogen activator, urokinase
publication title Design of novel and selective inhibitors of urokinase-type plasminogen activator with improved pharmacokinetic properties for use as antimetastatic agents
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vjaU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vjaU01
1MBQA 4F49A 1KLTA 1AFEH 2ZTXA 1L1JA 1V2QT 4CRCA 1O5BB 1G30B 1S82A 4YT6H 3ZVDA 1LQDB 1O2QA 1O38A 1DDJA 5GDSH 1SFIA 2FO9A 3SNCA 2BXUH 3QN7A 5C1XA 1GDUA 1TNJA 4TY7A 1ZJKA 4DJZB 1LMWB 2VGCB 4Y0ZE 1T7CA 4MQAA 3RC5A 1B0EA 2ZU1A 1PPBH 3TJUA 2K1QA 4NIYA 4RSPA 2STAE 1O5FH 1CGHA 2BOHB 1SGFG 2AIPA 3ENSB 1AVGH 3ZZBA 1DWCH 1FY1A 1ZSLA 1T4UH 1C2KA 2ZHEH 2PKSC 2IJOB 2Z9JA 2B5TB 5F8TA 1SLWB 4ABAA 5L2ZH 4FU8A 1OYTH 2GVFA 3SQEE 1RGQA 1TABE 5JBAS 1P3EA 4TPIZ 1ZMLA 1LVBA 1T8OA 4MVNA 3F6UH 4I8GA 1P2JA 2EI7A 1MAXA 2KAIB 4INKA 2TPIZ 4FUJA 2B9LA 1V2RT 1MCVA 2PR3A 1ZR0A 1FN6A 3SI3H 2HWLB 3BEIB 2R0KA 2VVUA 3PO1C 1MCTA 3M3VA 1UVOA 1ORFA 1VGCC 2PSYA 1VITH 4B75A 3F1SB 2HPQH 1QCPA 1PPFE 1SSXA 3MNXA 5EQRA 3GCOA 1ZJDA 3GCTG 4CRBA 1P06A 1TRNA 1KXBA 2P93A 4YOIA 3RXBA 1ACBE 1MKWK 1XVMA 3L33A 1NN6A 4Y10E 3BV9B 3ZZ9A 3GCHC 1PQ5A 4Y8YA 3RMMH 3ZVAA 1A2CH 2HNTE 4R0IA 1AI8H 3PWCA 1SVPA 5DP6A 1QQUA 1ANDA 2Y7ZA 3FFGA 3BG4B 1UJ1A 2A4RA 1J16A 2A5AA 1C5NH 4AG2A 3L6PA 1HAGE 1V2LT 1SFQB 1ESTA 1C2IA 4ABFA 2GV7A 1AN1E 4Q2KA 1VR1H 2HVXA 3STIA 1GHWH 1AZZA 1Q31A 2BVXH 2Y80A 1XX9A 4NFEA 2FIRH 2ZG0H 4GAWA 5A0BA 1PPCE 1C1QA 4YZUA 4SGBE 1VJ9U 3GCNA 2VIPA 4ZHLU 1O35A 2GT7A 4X1PU 4JZEH 2F9OA 1FY5A 1MD8A 2GD4B 3QLPH 5FCKA 1DXWA 1A7SA 1UK4A 2TGTA 3ODDA 1GDQA 3DFLA 1DSUA 5C5NA 4UFGH 1XMNB 2HGTH 3TNTA 3S7KB 3A86A 3FAOA 2A1DB 2BY7X 1GWAA 5EXLA 1P2MA 2P3FH 4F4OC 1EJNA 1ANBA 3SNDA 2BD9A 1E0FD 3GICB 1YF4A 4PROA 3S0NA 1UO6A 2ZPRA 2P3UB 3H5CB 1W10U 3P70B 1GG6B 2ASUB 1UVPA 2Z9IA 3TITA 4MNYA 2BY8X 3Q00A 4BAHB 1TLDA 4O3TA 4DVAU 1QL9A 2FI4E 2DE9A 3D49H 1FY3A 2FTLE 1QBNA 3GY2A 2YNBA 1QNJA 1KDQA 4E06H 2FOGA 1TA2A 4ISIH 4OGYA 1Z8IB 3MH5A 1ESAA 5H4IB 3SORA 3SV2H 3V7TA 3S69A 3RMNH 3MO9A 1ELBA 3DUXH 3T29A 1HJ8A 1WSSH 3KL6A 1QJ1B 3LONA 1N1LA 4NIWA 1C5TA 1C1SA 3PMJA 3B9FH 1F92A 3SO3A 4AFUA 1BT7A 5EPNA 1EB1H 4AORA 4O3UA 1ZSJA 1O2NA 1CT0E 1C2HA 7GCHG 1BBRK 2VWLA 4BOHA 3DD2H 3D62A 1DT2A 2UWLA 1G3EA 4Z6AH 4UFDH 1C2GA 4NZQA 1TRMA 2VNTA 3MU0A 1UCYH 2WPKS 1C1RA 2PGBB 8GCHG 3GY3A 3LT3A 4ZKRU 1IQKA 1KDQB 1GJ8B 4ISOA 2NU0E 1SGIB 1O5EH 1GJDB 2NWNA 1YKTA 2PTNA 1DX5M 2M5TA 1O2YA 1LHCH 4UDWH 1L0ZA 1QJ6B 3HKJB 4ZH8A 1FY4A 1ETRH 2F3CE 1TBRH 5J4QA 2W5EA 4CREA 1ZGIA 1AZ8A 4UEHH 2UWPA 1C1VH 1C5VA 5ABWA 1GHBG 1NU9A 1AKSA 3P95A 1X7AC 1A1RA 2VGCC 1GBJA 2G5VA 1O2IA 1W13U 3E16B 2B8OH 3EGKH 5A0CA 2BQ6B 2BD8A 1MQ6A 1GMHG 1IAUA 2ESTE 1S0QA 3PLBA 1C2LA 1O33A 2ZU3A 5E0GA 3LGVA 5EG4A 5A8ZA 3O8RA 1Y8TA 1XVOA 3LDXH 2ZGCA 3MYWA 4BXSA 1MKXK 1KLIH 1P12E 4H4FA 3PYHA 3RXGA 1Y3WA 3M35A 3ZZ7A 1QRZA 1GGDB 1MTWA 1JRTA 4WXVA 3P8FA 4DT7B 1Z7KA 1P57B 2PUXB 4SGAE 3N7OA 1P09A 5GJ4B 3QX5H 4WMFA 1QIXB 1Y3UA 2ODYB 1O3MA 2FS8A 2OQ5A 1PPGE 3RXQA 1D3TB 2FP7B 1MU8B 1BDAA 4GCHF 3JZ2B 1EASA 3CS7A 3UWIA 3RXDA 1YLDA 3K65B 2BMGB 1GBIA 2A32A 1Y3YA 1HBTH 1H9LB 1GCTB 2ZGHA 4VGCC 4XOJA 4AFSA 1SOTA 1P2NA 1PPZA 1BBRE 4DIIH 2VJ1A 1AE8H 2Q1JA 1OWIA 2SGAA 1FJSA 3VB5A 5LGOA 2VH0A 5DP9A 1AVWA 2BOKA 2D1JA 5T6FA 3BG4C 4ZHAA 4OS6A 3DA9B 2PW8H 3P92A 1YC0A 1KSNA 1F0UA 1WTHD 2Z9KA 1FLEE 4D7GA 4FUBA 1BTYA 1IQLA 1C5SA 1H8IH 1GVKB 3ATMA 1RJXB 4FVDA 4TY6A 1LHGH 1KYNA 1BTXA 1ZPZA 3BTKE 1O3CA 1CA0B 1GMDF 1Z1JA 3SUFA 2ZFFH 4XE4A 4E05H 2AMPA 1TGCA 2BLVA 2PKSB 1CU1A 2BY9X 4KTCA 4KP0A 5C20A 1LPKB 2ALVA 1FI8A 2C8WB 2XBXA 1HAXB 3C27B 1GHXH 3MWIU 1K1IA 1ZZZA 2XCFA 3RXUA 2D26C 5L2YH 2CF8H 4WH8A 4A7IB 2GCTB 2I6SA 1MH0A 1PQ7A 1TNGA 4IN1A 3M61U 3A84A 1O30A 1QA7A 1ZGVA 2ZHQH 3KHVA 1ANEA 1E35B 3A7XA 4BXWA 1XKBC 3LC5A 1S5SA 2BLOA 1YLCA 1GG6C 3MNBA 1C2MA 2WPLS 4JYVH 1FN8A 9LPRA 2P95A 3OY6U 2C8XB 4NWKA 1HJ9A 4UD9H 1C1TA 2P8OB 3CP7A 1CHOG 1TNKA 2C93B 5EU8A 3GCHB 2FOAA 2ZNKH 4MPVA 2PKAA 5CMXH 2QV1A 4NA9H 4JCNA 1CVWH 3RM2H 1Y59T 4BAQB 1S83A 3M7UA 2O8LA 2ANWA 4YLUA 1Z6JH 2FI3E 2H1UA 3V13A 3QZRA 2H9TH 1AD8H 1EKBB 2EC9H 4NZLA 4MLFB 3RLYH 2G00A 2F9VA 2UWOA 1SL3A 2PLXA 3QDZB 3T26A 2V35A 2NU4E 5JBBS 1TWXB 2UUYA 3BN9A 3TIUA 1FIZA 3VXFH 5FXLA 1SGQE 3M37A 2OINA 2AMQA 1H9HE 1C2EA 2OCVB 2Z6BD 3TJOA 1TNHA 5GWZA 1TBQH 1V2MT 4CHAB 1Z71A 1SQTA 1Y3VA 3MNCA 3UNQA 3FP7E 1FUJA 3SU4A 2CHAB 4GHQA 1P2KA 1AQ7A 1TPPA 4TPYA 3M7TA 4Y8ZA 1ZSKA 3TH4H 1OSSA 1ELTA 2PKAB 2O8UA 3HK3B 4INLA 1V2JT 2ILNA 4K1EA 4B76A 2ZDVH 4IBLH 1IQGA 2BZAA 1V2ST 2QIQA 5DO4H 2CN0H 1V2UT 1ELGA 1PFXC 2SGPE 1P02A 1F5LA 1QURH 4R8TB 5AHGH 1SGEE 2VINA 1K1MA 2FXRA 4XBDA 2RA0A 1OWJA 1TQ7B 1KTTB 5EW2H 3PV4A 5IDKA 2R2WU 3H7TA 1S6HA 1LHDH 3PMAB 4WXIA 3Q3YA 2A31A 1GMCF 3S7HB 1MZAA 4UONA 1HCGA 1UTOA 5L30H 5PTPA 2UUFB 1K9OE 1T4VH 2JKHA 1GJ6A 4AFZA 3M3SA 3RU4D 4GHTA 3CS0A 3M36A 4NA8A 1DM4B 1QA0A 1V2OT 5BRRE 2ZGJA 2ZQ2A 5GCHF 3IITA 1TGTA 2WUCA 1W7XH 1KXAA 3PM3A 1SGTA 1DANH 3U69H 2SGQE 1FONA 4MNVA 4WMEA 1BTPA 5LH8A 2O8TA 2G52A 1A0JA 2RA3A 3UWJH 2H5DA 1O3DA 2HLCA 1YPGH 1RFNA 1G36A 1NRQH 2PTCE 3BTTE 1BHXB 3LKWA 1LKAA 1C2FA 3RXMA 1PQAA 5T3HA 1QR3E 3GDSA 1GI6A 3RXLA 3O8BA 2XBYA 3M7QA 5FBEA 5A2MH 3ZVGA 1GI3A 1M9UA 1FQ3A 2SGDE 3URCA 6GCHG 1O3LA 2WYJA 4CR9A 3GY6A 1C5UA 1N8OB 1GCTC 1QL8A 3TGJE 1J8AA 1BZXE 1OWEA 2QAAA 2OC7A 4DW2U 1D6RA 3MH7A 1VCPA 3GCTF 3KN2A 1GBDA 2D8WA 4X1QU 2H6MA 2YOLA 1GJBB 1T8LA 2KAIA 1NRNH 3BTFE 2Z3DA 4DGJA 1BOQA 2ZGBH 1O2XA 1SGPE 2XXLA 4HGCA 1SGCA 2H9EH 1EUFA 2G4TA 1DY9A 1NESE 1OKXA 4OS2A 1TYNA 4E7RG 1RTLA 1P05A 1P9UA 3ZZDA 2V0BA 1CGJE 4XBCA 1O3PB 1DUAA 3STJA 1W3CA 1KIGH 1GJ4H 1ZHRA 1LVYA 3M5OA 4Q7ZA 2OC8A 1EJMA 3A89A 2ZP0H 1TOMH 3SOSA 3FZDA 4K3JA 2GCHG 5T6DA 1CA0C 6CHAB 1O2WA 2B0FA 5K0HA 1FAKH 2CF9H 5GIBA 3S9BA 1P8VC 4IMZA 4ABDA 1C5QA 1H1BA 5GXPA 1H9IE 2GDEH 1JMOH 1MQ5A 2AGIX 2VIQA 1C5RA 1P01A 2C90B 2GKVE 1EOJA 3PTNA 4U32A 5HMAA 1ELVA 3K6YA 5EXNA 3UOUA 1C5MD 2ZIQH 1GJ7B 1S6FA 1BB0B 1HAZB 1W7GH 1GHYH 2A5IA 2FOMB 1E37B 1EPTB 1EZSC 3MU1A 2GCTC 2WYGA 1O3NA 1O36A 3QGJA 3EA9A 1O37A 2XW9A 1TB6H 5F03A 4WJG2 5AFZH 4YOJA 1EZQA 3ZV9A 1NM6A 1O2MA 3A7YA 1SGRE 2BVRH 1D4PB 1MTSA 1AE5A 3LGUA 2ZKSA 1THRH 4VGCB 1JWTA 2P8OC 1B5GH 4X8TH 1BHXF 2FOHA 2QYIA 2F9PA 4Y7BA 3T25A 1NFUA 1HAHH 1CT4E 1TOCB 1GJCB 1P2IA 1SGDE 4X2YA 1TAWA 1GHVH 1DXPA 3RP2A 4NSYA 2V3OH 3QK1A 3TK5A 4OS5A 3BTGE 1TMBH 1UTMA 1DSTA 2GMTC 3BEUA 1ARCA 1GHZA 4JK6A 4NWLA 3Q77A 4IW4E 3PMHB 5DK1A 1HV7A 1G3CA 3TGKE 2BLWA 1UVTH 4UFEH 1XXDA 2BD5A 3PLPA 3PB1E 2IN2A 1V3XA 3SNEA 4AGJA 3RXPA 1FZZA 4H6SB 5B6OA 3UIRA 4AN7A 4E7NA 1DWDH 2Y5FA 3ZYEA 3AAUA 4XFQA 1O34A 1NS3A 4CHAC 3RXIA 1O3IA 1NZQH 3E0NB 1GBTA 2GV6A 3E1XB 2J4IA 3OX7U 7GCHF 2CHAC 3M5MA 1BMAA 1SGNE 3UOPA 1G32B 3NCLA 2OTVA 2C3SA 2VVVA 3URDA 2NU3E 1YPJH 3RC4A 1BMMH 5C67A 1AVXA 3VEQB 8GCHF 1LDTT 3MNSA 3Q3XA 5AVDA 4CRGA 1BA8B 4B2BA 3ELAH 1BITA 1EZUC 1V2NT 4TWYA 1IQJA 3U9AH 4X8VH 1GI4A 2VH6A 1VZQH 3F9FA 3LH3A 2WPMS 1KXDA 3AVZA 3HKIB 1GHBF 1YPHE 1J14A 1GBHA 2ZHDA 3E0PB 1RIWB 2FM2A 2FOCA 2R0LA 4K8BA 5HYOA 1EX3A 2W3IA 1TPSA 4FVBA 2Z9LA 4JYTA 1FDPA 1D9IA 3KCGH 2ZPSA 4D9RA 3HK6B 5L6NH 3UPEA 1MKWH 1JOUB 1OWHA 3PROA 4I8LA 4XDEA 1P04A 1BJVA 1ABJH 1NFYA 1F2SE 1T31A 1GI1A 1C2JA 1OWDA 3A8BA 3RXKA 2BM2A 1GI0A 1G37A 3QTVH 3RXOA 5DG6A 1O2GH 1V2TT 1ZOMA 1WQSA 9ESTA 1EP6A 1QTFA 5FPSA 4IN2A 4Y79A 2CJIA 1C1MA 1IHTH 4FU7A 1HJAC 4AZ2B 2VIDA 4X8SH 3VXEH 1K1LA 2O8MA 1DICA 1YCPM 1C9PA 1BTHH 1YPEH 1N8OC 2F9BH 3QGNB 3A7VA 5ETXA 1AUTC 3BTDE 2Q6DA 3F9HA 3ZYDA 3SNAA 3A7TA 3SZNA 2C8ZB 1GBKA 5JB9S 5C3NA 3EA7A 1FPCH 1D6WA 3ZZAA 2NU2E 1TPAE 4ZXXH 1C4Y2 4AGKA 4MTBA 4CBNA 1TPOA 1GBEA 1IQEA 2ANMH 2SFAA 1H4WA 3RXHA 3BSQA 2BVSH 2BDYA 2WV5A 4ZROA 4B2AA 1YCPH 2BY6X 1DFPA 4LK4A 1C1PA 2BLQA 1HAVB 1P03A 1AMHA 2FI5E 2AFQB 2C4FH 4ABBA 6CHAC 1C5WB 3ZV8A 3ZZ8A 5EODA 1Z6EA 5E2OA 5DP3A 3RU4T 1Z8RA 2GDDA 3B23B 3TGIE 3A85A 4UFFH 1XUFA 3FZZA 3A7WA 3LGIA 2TGDA 1O2LA 4I31A 2XCNA 5ESBA 1O2HA 1TNLA 1O3HA 1RXPA 1E34B 4MDSA 4AB8A 3LH1A 1J9CH 1IQFA 2XC0A 1EPTC 1TONA 1F0RA 2F91A 3SI4H 4ABHA 4DURA 1OXGA 2A4OA 2LPRA 1QGFA 1SLVB 5JDUB 2FEQH 1WYKA 4ZKOU 1O3JA 3P17H 1PJPA 1AY6H 1BIOA 4K8YA 3A88A 3DFJA 4YM9A 2P16A 2G5NA 1GHAF 4X8UH 1ZTLA 4IC6A 2D2DA 1ZHPA 1BTZA 1WV7H 1EJAA 2ZWLH 4JZDH 1Y5AT 1BBRH 3KGPA 3ITIA 1LPGB 1G2LA 4LXBH 5EOKA 3T28A 1SC8U 1TGNA 3RXRA 4UE7H 1G3BA 1WAYB 2A2QH 1CHGA 2J94A 1QRWA 1MD7A 3ZZCA 4DCDA 5DP5A 1CHOF 4YT7H 1O2VA 1AHTH 3NWUA 5GPIB 2ZFTA 2BTCE 3S9CA 1OP0A 4AFQA 2ZGXH 1EP5A 1SHHB 4ZXYH 2F9UA 1SGFA 5DGJA 1VITF 1F0SA 2J2UA 2BX3A 1VCWA 2P3TB 3D23A 1C5PA 1C5ZB 3E8LA 1GCDA 1O3KA 1RD3B 1JIMA 2G81E 1L2EA 4OS1A 2ANYA 2HOBA 1BCUH 4I7YH 2BD4A 3ZZ5A 3SU0A 1HB0B 1S81A 3NKKA 5HM2A 3A82A 3K2UA 4MPWA 4JYUH 4O97A 2FLRH 3VGCB 1DVAH 1O2UA 5E8EH 1KXCA 5IYTA 2Z9GA 3TNSA 1JRSA 1F0TA 3C1KA 4I33A 3SJIA 4LZ1H 1FNIA 1GJ5H 4M7GA 3V12A 2WPHS 2W7SA 3RXVA 2GP9B 2CMYA 4AX9H 1ZTJA 3SUGA 3GDUA 3LPRA 1W8BH 1HIAA 2QXIA 1O2KA 4NGAH 1HAIH 4ISLA 5JBCS 1CQQA 1SOZA 1ZHMA 2QXHA 1QHRB 3MO6A 2PV9B 2ODPA 1P9SA 1AFQB 1O3FA 2H9HA 3ZVBA 4B1TA 1O2PA 2A2XH 2QY0B 4Y0YE 1TQ0B 5CHAB 1TBZH 2ZHWH 5CE1A 2FYQA 1UTJA 4INHA 5A0AE 1RIWC 2Y82A 4RN6A 2BY5X 3E6PH 4NA7A 1H8DH 4Q7XA 1UK2A 2OP9A 1W0YH 3MH6A 5BPEA 3M5LA 2GMTB 2Z94A 3KQEA 4A92A 3A80A 5G4BA 2GT8A 3SUDA 3QUMP 4JK5A 1GL1A 1NT1A 1TIOA 2FTMA 5T6GA 1Z8JB 2EI8A 1A3EH 1BTWA 2WINI 5DP4A 2AGEX 4FUDA 1LCYA 1OP8A 2P94A 1HIAB 1ZMNA 1NC6A 2ZTZA 2QCYA 2ZA5A 3CENA 3AAVA 4FUCA 2XC4A 3B8JA 1BQYA 1C5XB 4O9VA 3S9AA 1ELEE 4KTSA 3UNRA 2OXSA 3FP8E 1BTUA 3TJVA 1A46H 1O3BA 1TX8A 1NY22 4D9QA 3EA8A 1CSOE 4NIVA 1HAYB 3D65E 4AOQA 3BG8A 1YPLH 3ODFA 1K28D 1QL7A 4NFFA 2ZF0H 4TWWA 1BMNH 3RMOH 2Y5HA 2XTTB 3MMGA 2UUJB 3H7OA 3OSYA 1AB9C 2HALA 2AIQA 3VB6A 2PHBA 3EQ0H 2GZ9A 4Y7AA 3LJJA 1JIRA 3KQBA 4U30A 1QRXA 1GPZA 4HTCH 3L3TA 2VIWA 1GJAB 3MOCA 3HPTB 2ZDKA 3MI4A 3KNXA 3LGTA 3GDVA 3NPSA 3MU4A 3RUOA 1QBOA 3SJOA 3SU1A 2B7DH 3O8DA 1OWKA 1UK3A 4AYVB 1YPKH 2W7UA 2OBOA 3EE0B 5HXFA 1PQ8A 1GBCA 1ZTKA 2GZ7A 4FXGH 2ZCLP 3VB3A 5I46H 2GZ8A 2FX6A 1DITH 2QN5T 5E0JA 2F83A 2J34A 3A8AA 2AYWA 2ZO3H 4I8KA 1FXYA 3P8NA 1GVLA 1K22H 2J38A 3ATIA 1IOEA 1O3GA 3UFAA 1SG8B 3SUEA 2FLBH 3FVFB 1WU1A 3LJOA 3E91A 1V2KT 1NRSH 1TALA 5JPMH 1ELDE 3SU5A 2BX4A 1VCQA 4WH6A 1TFXA 5HM9A 2BDHA 2W3KA 1GI9B 1UVSH 1HJAB 1C5YB 1CA8B 3AW0A 1L4DA 5F8ZA 4Z0KA 4I8JA 1A0LA 1TMTH 1O2RA 2RDLA 3MH4A 4B2CA 4GUXA 1IQNA 3BTWE 3MO3A 2BYAX 2BD2A 5TJXA 1W11U 1ID5H 3I77A 4FU9A 1Q2WA 1MTVA 2ANKH 3WY8A 1P10A 3T5FH 1TX7A 5LPEA 1EPTA 5FPTA 1SLUB 2A7CA 3QTOH 1C1UH 3SN8A 4CH8B 1AO5A 1ESBA 5I25A 1MTNB 4BTUB 1LHEH 1NRPH 2PUQH 4X0WU 1XKAC 1O5DH 3GY4A 2CV3A 3BTME 1THSH 5DP8A 3RXJA 2LNCA 3SHAH 2G4UA 1FV9A 1P2OA 4X6OA 3BEFB 1Z1IA 2CXVA 3TK6A 1GMCG 1FMGA 1K2I1 4DG4A 3SBKA 1SGYE 3HGPA 1CO7E 2A0QB 2TIOA 4XSKU 3TJNA 3NXPA 4FUFA 3MTYA 1UMAH 1ZPCA 4GSOA 1D3PB 4X1SU 1N6XA 2G8TA 2FZZA 2PSXA 2VIVA 3VGCC 1TE0A 2ZI2H 5C1YA 1XM1A 1KXFA 4DIHH 3T27A 4CRDA 4CBOA 4BAOB 2ZZUH 3LGYA 1EQ9A 5GCHG 1V2VT 2BQWB 1IQIA 1MTUA 3ZZ4A 3RM0H 1F7ZA 2FPZA 1V2WT 1SBWA 1EAIA 1YPMH 3HATH 1GI5A 2ZDLA 2SGEE 1J15A 4J1YA 1OX1A 4KKDA 3SNBA 2XWAA 4MNXA 1ETTH 3EAJA 5EPYA 4BAKB 1A5HA 2ZTYA 3E90B 2Q6GA 3JZ1B 4ABJA 3TVJB 3P8GA 1AFQC 1INCA 3SGAE 2FDAA 1MUEB 2ZDMA 2AEIH 3KQCA 5CHAC 4AG1A 3TH3H 2ZC9H 1PPEE 2Q6FA 3P6ZB 4B73A 3TPIZ 1ZRKA 4ZKNU 1L1GA 5EXMA 2F9NA 1TNIA 2ODQA 3Q3KA 4GPGA 5JYIA 1K1OA 2VVCA 1RS0A 2R3UA 3RU4E 4Y6DA 2Y7XA 1JBUH 2AMDA 4FUGA 1BRCE 3K9XB 2VWMA 3K6ZA 2ZFSA 1IQHA 4X6PA 5HGGA 2Z3EA 3LOXA 1HAOH 4K5ZA 2ZCHP 1O5AB 1FY8E 1CE5A 3BTQE 1KTSB 2ZFRH 3SV6A 1EAXA 4A1VA 1HDTH 2ZDNA 1GBFA 4THNH 2SNWA 1L1NA 3RXEA 5A8YA 2O9QA 1KLJH 1EB2A 2EI6A 2XC5A 2XNIA 2XWBI 2ZFQH 1DLEA 2ZHFH 1HUTH 1MU6B 1C9TA 1UTPA 1OYQA 2J92A 1ANCA 1GJ9B 4JZFH 2H5CA 1W14U 2DUCA 1AWHB 2AS9A 3IWMA 1NFWA 5A8XA 4NG9H 1UCYK 2FESH 5DJ7A 1A0HB 3T62A 3UREA 1NO9H 1LQEA 1HAPH 1DS2E 3U98H 3U8RH 1SI5H 1C4V2 1LHFH 2JH5D 5AF9H 4D7FA 1YP9A 1S0RA 1MZDA 1FPHH 1SQOA 1XXFA 5FX5A 1SPJA 1P11E 2XYAA 4LZ4B 3QZQA 1MAYA 4U01A 2RCEA 3P8OA 2TGAA 3R3GB 2HRVA 2BDIA 2R2MB 2BDCA 1GDNA 8KME2 1A5IA 2JETB 3OU0A 5FAHA 1CBWB 1W12U 1XUKA 1NROH 1A3BH 1TA6A 1YCPK 1OP2A 1A4WH 4OS7A 4D8NA 4TYDA 1QB9A 5AFYH 3A7ZA 1O2OA 3SU2A 5J4SA 4U2WA 1N6YA 2OQUA 1GMHF 2AGGX 4JMYA 1XUHA 2STBE 2SNVA 4X1RU 1K1PA 4ZMAH 1QFKH 2QF0A 3ATKA 4ABEA 2THFB 4MPUA 1LKBA 1T8NA 1GBMA 4AB9A 4CR5A 2FOBA 1E36B 1QBVH 4DY7B 2ZEBA 4X6NA 1DY8A 1NU7B 3ATLA 4ZKSU 3TU7H 4QT8C 3DT0H 6LPRA 1D3QB 1ETSH 1EZXC 5EW1H 3SV8A 1HAVA 3W95A 1AUJA 1HXFH 2OD3B 3OY5U 3A87A 1P0SH 1FIWA 3SJ8A 1O2TA 5LPFA 3GISB 1C5OH 3UR6A 3BTEE 3A83A 1EOLA 4LOYH 3R0FA 3M5NA 1WUNH 1RTKA 2FS9A 3RXAA 1Q3XA 1ZPBA 3HGNA 3UTUH 3LIWA 1HGTH 7LPRA 4K60A 4NSVA 3ZVCA 4ISHH 1O2ZA 1P2QA 1UVUH 2J9NA 3BIVH 1B0FA 3TH2H 1BRBE 1O2SA 4A1TA 1SLXB 4X2VA 5DPAA 1AB9B 4ISNA 2Y5GA 2Z3CA 4IGDA 3F68H 1UTLM 2HPPH 2C8YB 3RC6A 4X2WA 1C2DA 1HNEE 5C1UA 2FWWA 1K1JA 1NPMA 1MTNC 3AW1A 3F9EA 3LU9B 3O8CA 1UCYE 1PPHE 2O8WA 4WY3A 1GBAA 3V3MA 4FUHA 4Q7YA 2A45B 1O31A 4WF8A 5TCCA 4X1NU 1AU8A 3RMLH 2FOEA 4IS5A 1K21H 3I78A 1WTGH 1ZYOA 4WMDA 2G55A 3UUZA 2ZFPH 3F9GA 1QJ7B 3SV9A 3IG6B 2AH4X 3EDXB 1EXFA 2OUAA 4NCYA 3ZVFA 5F8XA 4YLQH 2FODA 1SR5C 1SHYA 2YNAA 3G01A 3SGBE 4KTUA 3ATWA 3RXSA 1DE7H 1K1NA 2TGPZ 4I8HA 3KF2A 8ESTE 5E0HA 1L4ZA 1HFDA 1G3DA 1SMFE 1AIXH 1B7XB 1CT2E 4A5TS 4YTAA 4J2YB 2A7HA 1UHBA 4BTTB 2EA3A 1FAXA 1D3DB 2QXGA 1UTQA 2FX4A 1GL0E 3QWCH 2BB4A 1A61H 1HYLA 1ZLRA 2VWOA 5FPYA 4RKOB 1Y5UT 3PTBA 2FYRA 1SB1H 3E3TA 4CRFA 4H42U 2I6QA 2QF3A 2FMJA 1EATA 4KELA 1QQ4A 5FX6A 3UY9A 2GX4A 4IC5A 1YM0A 3NUMA 1AKSB 1O32A 7ESTE 1O3EA 1LPZB 4HI3A 3A8DA 3W94A 1SQAA 2A7JA 2J95A 2TBSA 2QC2A 2WPIS 1T32A 4K1SA 5FHTA 3SJKA 1NTPA 4ZAEA 5JB8S 1HPGA 4YO9A 4A1XA 2BZ6H 5C5OA 1O0DH 1T8MA 1Y5BT 1S85A 4Y76A 3GYMA 1J17T 5EQSA 1UHBB 1HXEH 5FBIA 5DKMA 1C1OA 3SJ9A 2IPHA 2WV4A 4XBBA 2QGRA 4K69A 3PMBB 2BD3A 1C1WH 1TMUH 1AGJA 2BD7A 4WWYA 3VFEA 3U1JB 5TCAA 1Y3XA 8LPRA 1IQMA 1O3OA 1QY6A 2WPJS 4HZHA 5E2PA 2HNTF 1ABIH 3FP6E 1KXEA 1WQVH 2JH0D 3UQVA 3VB4A 2A4GA 3UR9A 2BQ7B 2TRMA 3ZZ6A 2W26A 1MKXH 1TGBA 3ZVEA 1GBBA 2PFEA 4GLYA 3MU8A 1BRUP 1GVZA 3T2NA 2WUBA 4BTIB 1ELCA 3KQDA 4A6LA 3OTJE 1DUEA 2QXJA 1O2JA 3SV7A 1ZRBA 2OBQA 1LO6A 1JXPA 4GCHG 4OS4A 2ZECA 2VIOA 2GTBA 2JETC 3MU5A 2BXTH 3PO1B 1CBWC 1MBMA 3PWBA 3VB7A 1LTOA 1GHAG 1VGCB 3RDZA 1TX6A 3LC3A 3GY7A 1XUJA 3MFJA 5ESTE 3SU6A 2XRCA 1BJUA 4CRAA 1GI2A 2Y81A 4KGAA 2V3HH 4MNWA 1NRRH 2BDGA 2JH6D 3GY8A 2Z7FE 3Q76A 4BAMB 4RKJB 3RXTA 5C2ZA 1EAWA 1THPB 1O39A 5DP7A 5A09A 2IOTA 1DLKB 2XBWA 4K2YA 4HFPB 2ZU5A 3UNSA 3SU3A 1ELAA 2OC0A 1GBLA 1VITG 1OS8A 4MG3A 4BNRA 4GVUA 3LGWA 2ZDAH 4Y8XA 4BANB 1GMDG 3VPKA 2BHGA 2PWXA 1BMLA 4FUIA 1DPOA 4ZHMU 1CGIE 1IHSH 1QB6A 4OGXA 3V0XA 3SQHE 4JZ1A 3SHCH 2PGQB 5FCRA 5SGAE 3KEEA 1V6DA 3AASA 1DOJA 2ZPQA 6GCHF 3UQOA 3ZZ3A 2Y6TA 4X6MA 3BF6H 2VU8E 1AWFH 1KY9A 1HLTH 2AERH 3BIUH 1C1NA 6ESTA 1ZMJA 3NK8A 4ASHA 1BUIA 2EEKA 2OC1A 2RG3A 4WVPE 4ESTE 4MPXA 4ZUHA 3U8OH 1C5LH 1DWBH 3FANA 1G2MA 1RTFB 1F5RA 7KMEH 2HNTC 4O03A 4ABGA 4Y71A 3SW2B 2ZU2A 3SGQE 1U6QA 3TK9A 1O3AA 4Q80A 3ESTA 1YYY1 1WBGB 5EQQA 3RLWH 2ZCKP 2GCHF 2P59A 1YGCH 3KIDU 3RXFA 4FUEA 1F5KU 2FOFA 1LVOA 1ARBA 1XUIA 4ABIA 1G9IE 2OLGA 1PYTC 1UTNA 3MHWU 4X2XA 1TGSZ 2BDBA 2R9PA 1DWEH 3BTHE 3QO6A 4CH2B 1P3CA 1QB1A 2SGFE 1W2KH 3GYLB 1UTKA 2NU1E 3DHKH 3I29A 2QA9E 4JZIA 1ELFA 1GI8B 4YESB 1GGDC 1VJAU 4H6TA 4AYYB 3GOVB 2CGAA 3NZIA 2XBVA 1LVMA 1YBWA 1A5GH 3U1IB 3A8CA 3A81A 4I32A 2A5KA 1OOKB 5EGMA 1C4U2 2DE8A 2ZQ1A 2UUKB 1PYTD 1S84A 2G51A 2H2ZA 4D76A 3PLKA 2A4QA 2V6NA 4IMQA 1O5CB 3U8TH 2R3YA 3GY5A 1OPHB 1HRTH 3TLOA 2GGVB 4Y11E 3RXCA 5F6MA 1O5GH 4B71A 2BDAA 2VB0A 4B74A 1EAUA 2ALPA 5JBTA 1GI7B 3OYPA 2VWNA 4K1TA 1E38B 1TRYA 1W0ZU 3M3TA 4YOGA 1NFXA 1V2PT 1WCZA 2ULLA 1YPHC 5LPRA 4DOQA 4NIXA 1MMJN 3EYDA 1Z8GA 1RRKA 1WOFA 1BRAA 2ZU4A 5K7RA 1XUGA
chains in the Genus database with same CATH superfamily
1MBQA 4F49A 1KLTA 1AFEH 2ZTXA 1L1JA 1V2QT 4ACBA 4CRCA 1O5BB 1G30B 1S82A 4YT6H 3ZVDA 1LQDB 1O2QA 1O38A 1DDJA 5GDSH 1SFIA 2FO9A 3SNCA 1VKYA 2BXUH 3QN7A 5C1XA 3N99A 1H8ED 1GDUA 1TNJA 4TY7A 1ZJKA 2QF5A 4DJZB 1LMWB 2VGCB 4Y0ZE 1T7CA 4MQAA 3RC5A 1B0EA 2ZU1A 1PPBH 3TJUA 2K1QA 4NIYA 4RSPA 2STAE 1O5FH 1CGHA 2BOHB 1SGFG 2AIPA 3ENSB 1AVGH 3ZZBA 1DWCH 1FY1A 1ZSLA 1T4UH 1C2KA 2ZHEH 2PKSC 2IJOB 2Z9JA 2B5TB 5F8TA 1SLWB 4ABAA 5L2ZH 4FU8A 1OYTH 2GVFA 3SQEE 1RGQA 1TABE 5JBAS 1P3EA 4TPIZ 1OHHD 1ZMLA 1LVBA 1T8OA 4MVNA 3F6UH 4I8GA 1P2JA 2EI7A 1MAXA 2KAIB 4INKA 2TPIZ 2KX4A 2KM0A 2J98A 4FUJA 1S6LA 2B9LA 1V2RT 1MCVA 2PR3A 1ZR0A 1FN6A 3SI3H 2HWLB 3BEIB 2R0KA 2VVUA 3PO1C 1MCTA 3M3VA 1UVOA 2WSSD 1ORFA 1VGCC 2PSYA 1VITH 4B75A 3F1SB 2HPQH 1QCPA 1PPFE 1SSXA 3MNXA 5EQRA 3GCOA 1ZJDA 3GCTG 4CRBA 1P06A 1TRNA 1KXBA 2P93A 4YOIA 3RXBA 4B6EA 1ACBE 1MKWK 1XVMA 3L33A 1NN6A 4AC9A 4Y10E 3BV9B 3ZZ9A 3GCHC 2GJGA 1PQ5A 4Y8YA 3RMMH 3ZVAA 1A2CH 2HNTE 4R0IA 1AI8H 3PWCA 1SVPA 5DP6A 1QQUA 1ANDA 2Y7ZA 3FFGA 3BG4B 1UJ1A 2A4RA 1J16A 2A5AA 2K8IA 1C5NH 4AG2A 3L6PA 1HAGE 1V2LT 1SFQB 1ESTA 1C2IA 4ABFA 2GV7A 1AN1E 4Q2KA 1VR1H 2HVXA 3STIA 1GHWH 1AZZA 1Q31A 2BVXH 2Y80A 1XX9A 4NFEA 2FIRH 2ZG0H 4GAWA 5A0BA 1PPCE 1C1QA 4YZUA 4SGBE 1VJ9U 3GCNA 2KCPA 2VIPA 4ZHLU 1O35A 2GT7A 4X1PU 4JZEH 2F9OA 1FY5A 1MD8A 2GD4B 3QLPH 5FCKA 1DXWA 1A7SA 1UK4A 2TGTA 3ODDA 1GDQA 3DFLA 1DSUA 5C5NA 4UFGH 1XMNB 2HGTH 3TNTA 3S7KB 3A86A 3FAOA 2A1DB 2BY7X 1GWAA 5EXLA 1P2MA 2P3FH 4F4OC 1EJNA 1ANBA 3SNDA 2BD9A 1E0FD 3GICB 1YF4A 4PROA 3S0NA 1UO6A 2ZPRA 2P3UB 3H5CB 1W10U 3P70B 2XOKD 1GG6B 2ASUB 1UVPA 2Z9IA 3TITA 4MNYA 2BY8X 3Q00A 4BAHB 1TLDA 4O3TA 4DVAU 1QL9A 3UAIC 3F2GA 2FI4E 2DE9A 3D49H 3F3BA 1FY3A 2FTLE 1QBNA 3GY2A 2YNBA 1QNJA 3FO8D 1KDQA 4E06H 2FOGA 1TA2A 4ISIH 4OGYA 1Z8IB 3MH5A 1ESAA 5H4IB 3SORA 3SV2H 3V7TA 3S69A 3RMNH 3MO9A 1ELBA 3DUXH 3T29A 1HJ8A 1WSSH 3KL6A 2OK5A 1QJ1B 3LONA 1N1LA 4NIWA 1C5TA 1C1SA 3PMJA 3B9FH 1F92A 3SO3A 4AFUA 1BT7A 5EPNA 1EB1H 4AORA 4O3UA 1ZSJA 1O2NA 1CT0E 1C2HA 7GCHG 1YWUA 3OEED 1WDIA 1BBRK 2VWLA 4BOHA 3DD2H 3FKSD 3D62A 1DT2A 2UWLA 1G3EA 4Z6AH 4UFDH 1C2GA 4NZQA 1TRMA 2VNTA 3MU0A 1UCYH 2WPKS 1C1RA 2PGBB 8GCHG 3GY3A 3LT3A 4ZKRU 1IQKA 1KDQB 1GJ8B 1MABB 4ISOA 2NU0E 1SGIB 2EQNA 2WHXA 1O5EH 1GJDB 2NWNA 1YKTA 2PTNA 1DX5M 2M5TA 1O2YA 1LHCH 4UDWH 1L0ZA 1QJ6B 3HKJB 4ZH8A 1FY4A 1ETRH 2F3CE 1TBRH 5J4QA 2W5EA 4CREA 1ZGIA 1AZ8A 4UEHH 2UWPA 1C1VH 1C5VA 5ABWA 1GHBG 1NU9A 1AKSA 3P95A 1X7AC 1A1RA 2VGCC 1GBJA 2G5VA 1O2IA 1W13U 3E16B 2B8OH 3EGKH 5A0CA 2BQ6B 2BD8A 1MQ6A 1GMHG 4I86A 1IAUA 2ESTE 1S0QA 3PLBA 1C2LA 1O33A 2ZU3A 5E0GA 3LGVA 4ASUD 5EG4A 5A8ZA 3O8RA 1Y8TA 1XVOA 3LDXH 2ZGCA 3MYWA 4BXSA 1MKXK 1KLIH 1P12E 4H4FA 3PYHA 3RXGA 1Y3WA 3M35A 3ZZ7A 1QRZA 1GGDB 1MTWA 1JRTA 4WXVA 3P8FA 4DT7B 1Z7KA 1P57B 2PUXB 4SGAE 3N7OA 1P09A 5GJ4B 3QX5H 4WMFA 1QIXB 1Y3UA 2ODYB 3DSOA 1O3MA 2FS8A 2OQ5A 1PPGE 3RXQA 1D3TB 2FP7B 1MU8B 4RT0A 1BDAA 4GCHF 3JZ2B 1EASA 3CS7A 3UWIA 3RXDA 1YLDA 3K65B 2BMGB 1GBIA 2A32A 1Y3YA 1HBTH 1H9LB 1GCTB 2ZGHA 4VGCC 4XOJA 4AFSA 1SOTA 1P2NA 1PPZA 1BBRE 4DIIH 2VJ1A 1AE8H 2Q1JA 1OWIA 2SGAA 1FJSA 3VB5A 5LGOA 2VH0A 5DP9A 2KCAA 1AVWA 2BOKA 2D1JA 1W0KD 5T6FA 3BG4C 4ZHAA 4OS6A 3DA9B 2PW8H 3P92A 1YC0A 1KSNA 1F0UA 2F43B 1WTHD 2Z9KA 1FLEE 4D7GA 4FUBA 1BTYA 1IQLA 1C5SA 1H8IH 1GVKB 3ATMA 1RJXB 4FVDA 4TY6A 1LHGH 1KYNA 1BTXA 1ZPZA 3BTKE 1O3CA 1CA0B 1GMDF 1Z1JA 3SUFA 2ZFFH 4XE4A 4E05H 2AMPA 1TGCA 1W0JD 2BLVA 2PKSB 1CU1A 2BY9X 4KTCA 4KP0A 5C20A 1LPKB 2ALVA 1FI8A 2C8WB 2XBXA 1HAXB 3C27B 1GHXH 5C0UA 3MWIU 1K1IA 1ZZZA 2XCFA 3RXUA 2D26C 5L2YH 2CF8H 4WH8A 4A7IB 2GCTB 2I6SA 1MH0A 1PQ7A 1TNGA 4IN1A 3M61U 3A84A 1O30A 1QA7A 1ZGVA 2ZHQH 3KHVA 1ANEA 1E35B 3A7XA 4BXWA 1XKBC 3LC5A 1S5SA 5T1VA 2BLOA 1YLCA 1GG6C 3MNBA 1C2MA 2WPLS 4JYVH 1FN8A 9LPRA 2P95A 3OY6U 2C8XB 4NWKA 1HJ9A 4UD9H 1C1TA 2P8OB 3CP7A 1CHOG 1TNKA 2C93B 5EU8A 3GS9A 3GCHB 2FOAA 2ZNKH 4MPVA 2PKAA 5CMXH 2WPDD 2QV1A 4NA9H 4JCNA 1CVWH 3RM2H 1Y59T 4BAQB 1S83A 3M7UA 2O8LA 2ANWA 4YLUA 1Z6JH 2FI3E 2H1UA 4P02A 3V13A 3QZRA 2H9TH 1AD8H 1EKBB 2EC9H 4NZLA 4MLFB 3RLYH 2G00A 2F9VA 2UWOA 1SL3A 2PLXA 3QDZB 3T26A 2V35A 2NU4E 2WV9A 5JBBS 1TWXB 2UUYA 3BN9A 3TIUA 1FIZA 3VXFH 5FXLA 1SGQE 3M37A 2OINA 2AMQA 1H9HE 1C2EA 2OCVB 2Z6BD 3TJOA 1TNHA 5GWZA 1TBQH 1V2MT 4CHAB 1Z71A 1SQTA 1Y3VA 3MNCA 3UNQA 3FP7E 1FUJA 3SU4A 2CHAB 4GHQA 1P2KA 1AQ7A 1TPPA 4TPYA 4B6FA 3M7TA 4Y8ZA 1ZSKA 3TH4H 3KYGA 1OSSA 1ELTA 2PKAB 2O8UA 3HK3B 4INLA 1V2JT 2ILNA 4K1EA 4B76A 2ZDVH 4IBLH 1IQGA 2BZAA 1V2ST 2QIQA 3F0PA 2CN0H 5DO4H 1V2UT 1ELGA 1PFXC 2SGPE 1P02A 1F5LA 1QURH 3PRBA 4R8TB 5AHGH 1SGEE 2VINA 1K1MA 2FXRA 4XBDA 2RA0A 1OWJA 1TQ7B 1KTTB 5EW2H 3F2FA 3PV4A 5IDKA 2R2WU 3H7TA 1S6HA 1LHDH 3PMAB 4WXIA 3Q3YA 2CK3D 2A31A 1GMCF 3S7HB 1MZAA 4UONA 1YLNA 1HCGA 1UTOA 5L30H 5PTPA 2UUFB 1K9OE 1T4VH 2JKHA 1GJ6A 4AFZA 3M3SA 3RU4D 1EFRD 3CS0A 3DSGA 4GHTA 3M36A 2LP6A 4NA8A 1DM4B 1QA0A 1V2OT 5BRRE 2ZGJA 2ZQ2A 5GCHF 3IITA 1TGTA 2WUCA 1W7XH 1KXAA 3PM3A 1SGTA 1DANH 3U69H 2SGQE 1FONA 4MNVA 4WMEA 1BTPA 5LH8A 2O8TA 2G52A 1A0JA 2RA3A 3UWJH 2H5DA 1O3DA 2HLCA 1YPGH 1RFNA 1G36A 1NRQH 2PTCE 3BTTE 1BHXB 3LKWA 1LKAA 1C2FA 3RXMA 1PQAA 5T3HA 1QR3E 3GDSA 1GI6A 3RXLA 3O8BA 2XBYA 3M7QA 5F53A 5FBEA 5A2MH 3ZVGA 1GI3A 1M9UA 1FQ3A 2SGDE 3URCA 6GCHG 1O3LA 2WYJA 4CR9A 3GY6A 1C5UA 1N8OB 1GCTC 1QL8A 3TGJE 1J8AA 1BZXE 1OWEA 2J97A 2QAAA 2OC7A 4DW2U 1SQRA 1D6RA 3MH7A 1UW7A 2KZ4A 1VCPA 3GCTF 3KN2A 1GBDA 2D8WA 4X1QU 2H6MA 2YOLA 1GJBB 1T8LA 2KAIA 1NRNH 3BTFE 2Z3DA 4DGJA 1BOQA 2ZGBH 1O2XA 1SGPE 2XXLA 4HGCA 1SGCA 2H9EH 1EUFA 2G4TA 1DY9A 1NESE 1OKXA 4FETA 4OS2A 1TYNA 4E7RG 1RTLA 1P05A 1P9UA 3ZZDA 2V0BA 1CGJE 4XBCA 1O3PB 1DUAA 3STJA 1W3CA 1KIGH 1GJ4H 1ZHRA 1LVYA 3M5OA 4Q7ZA 2OC8A 1EJMA 3A89A 2ZP0H 1TOMH 3SOSA 3FZDA 4K3JA 3OE7D 2GCHG 5T6DA 1CA0C 6CHAB 1O2WA 2B0FA 5K0HA 1FAKH 2CF9H 5GIBA 3S9BA 1P8VC 4IMZA 4ABDA 1C5QA 1H1BA 5GXPA 1H9IE 2GDEH 2QF4A 1JMOH 1MQ5A 2AGIX 2VIQA 1C5RA 1P01A 2C90B 2GKVE 1EOJA 3PTNA 4U32A 5HMAA 1ELVA 3K6YA 5EXNA 3UOUA 1C5MD 2ZIQH 1GJ7B 1S6FA 1NBME 1BB0B 1HAZB 3N7EA 1W7GH 3UB0A 1GHYH 2A5IA 2FOMB 1E37B 1EPTB 1EZSC 3MU1A 2GCTC 2WYGA 1O3NA 1O36A 3QGJA 3EA9A 1O37A 2XW9A 1TB6H 5F03A 4WJG2 5AFZH 2JJ2D 4YOJA 1EZQA 3ZV9A 1NM6A 1O2MA 3A7YA 1SGRE 2BVRH 1D4PB 1MTSA 1AE5A 3LGUA 2ZKSA 1THRH 4VGCB 1JWTA 4RI0A 2P8OC 1B5GH 4X8TH 1BHXF 2FOHA 2QYIA 2F9PA 4Y7BA 4ZCNA 3T25A 1NFUA 1HAHH 1CT4E 1TOCB 1GJCB 1P2IA 1SGDE 4X2YA 5KECA 1TAWA 1GHVH 1DXPA 3RP2A 4NSYA 2V3OH 3QK1A 3TK5A 4OS5A 3NRLA 3BTGE 2AHME 1TMBH 1UTMA 1DSTA 2GMTC 3BEUA 1ARCA 1GHZA 4JK6A 4NWLA 3Q77A 4IW4E 3PMHB 4OM9A 5DK1A 1HV7A 1G3CA 3TGKE 2BLWA 1UVTH 2JJ1D 4UFEH 1XXDA 2BD5A 3PLPA 3PB1E 2IN2A 5CDFE 1V3XA 3SNEA 4AGJA 3RXPA 1FZZA 4H6SB 5B6OA 3UIRA 4AN7A 4E7NA 1DWDH 2Y5FA 3U28C 3ZYEA 3AAUA 4XFQA 1O34A 1NS3A 3FN8A 4ACAA 4CHAC 3RXIA 1O3IA 1NZQH 3E0NB 1GBTA 2GV6A 3E1XB 2J4IA 3OX7U 7GCHF 2CHAC 3M5MA 1BMAA 3PRDA 1SGNE 3UOPA 1G32B 3NCLA 2OTVA 2C3SA 2VVVA 3URDA 2NU3E 1YPJH 3RC4A 1BMMH 5C67A 1AVXA 3VEQB 8GCHF 1LDTT 3MNSA 3Q3XA 5AVDA 4CRGA 1BA8B 4B2BA 3ELAH 1BITA 1EZUC 1V2NT 4TWYA 1IQJA 3U9AH 4X8VH 1GI4A 2VH6A 5FL7D 1VZQH 3F9FA 3LH3A 2WPMS 1KXDA 3AVZA 3HKIB 1GHBF 1YPHE 1J14A 1BMFD 1GBHA 2ZHDA 3E0PB 1RIWB 2FM2A 2FOCA 2R0LA 4K8BA 5HYOA 1EX3A 2W3IA 1TPSA 4FVBA 2Z9LA 4JYTA 1FDPA 1D9IA 3KCGH 2ZPSA 4D9RA 5B6LA 3HK6B 5L6NH 3UPEA 1K0HA 1MKWH 1JOUB 1OWHA 3PROA 2KCOA 4I8LA 4XDEA 1P04A 1BJVA 1ABJH 1NFYA 1F2SE 1T31A 1GI1A 1C2JA 1OWDA 3A8BA 3RXKA 2WZQA 2BM2A 1GI0A 1G37A 3QTVH 3RXOA 5DG6A 1O2GH 1V2TT 1ZOMA 1WQSA 9ESTA 1EP6A 5HIYA 1QTFA 5FPSA 4IN2A 4Y79A 2CJIA 1C1MA 1IHTH 4FU7A 1HJAC 4AZ2B 2VIDA 4X8SH 3VXEH 1K1LA 2PP6A 2O8MA 1DICA 1YCPM 1C9PA 1BTHH 1YPEH 1N8OC 2F9BH 3QGNB 2RFKC 3N7DA 3A7VA 5ETXA 1AUTC 3BTDE 2Q6DA 3F9HA 3ZYDA 3SNAA 3A7TA 3SZNA 2C8ZB 1GBKA 5JB9S 5C3NA 3EA7A 1FPCH 1D6WA 3ZZAA 2NU2E 1TPAE 4ZXXH 1C4Y2 4AGKA 4MTBA 4CBNA 1TPOA 1GBEA 1IQEA 2ANMH 2SFAA 1H4WA 3RXHA 3BSQA 2BVSH 2BDYA 2WV5A 4ZROA 4B2AA 1YY3A 1YCPH 2BY6X 1DFPA 4LK4A 1C1PA 2BLQA 1HAVB 1P03A 1AMHA 2FI5E 2AFQB 2C4FH 4ABBA 6CHAC 1C5WB 3ZV8A 3ZZ8A 5EODA 1Z6EA 5E2OA 5DP3A 3RU4T 1Z8RA 2GDDA 3B23B 3TGIE 3A85A 4UFFH 1XUFA 3FZZA 3A7WA 3LGIA 2TGDA 1O2LA 4I31A 2XCNA 5ESBA 1O2HA 1TNLA 1O3HA 1RXPA 2YMSD 1E34B 4MDSA 4AB8A 3LH1A 1J9CH 1IQFA 2XC0A 1EPTC 1TONA 1F0RA 2F91A 4YXWD 3SI4H 4ABHA 4DURA 1OXGA 2A4OA 2LPRA 1H8HD 1QGFA 1SLVB 5JDUB 2FEQH 1WYKA 4ZKOU 1O3JA 3P17H 1PJPA 1AY6H 1BIOA 4K8YA 3A88A 3DFJA 4YM9A 2P16A 2G5NA 1GHAF 4X8UH 1ZTLA 4IC6A 4F48B 5EIYA 2D2DA 1ZHPA 1BTZA 1WV7H 1EJAA 2ZWLH 4JZDH 1Y5AT 1BBRH 3KGPA 3ITIA 1LPGB 1G2LA 4LXBH 5EOKA 3T28A 1SC8U 1TGNA 3RXRA 4UE7H 1G3BA 1WAYB 2A2QH 1CHGA 2J94A 1QRWA 1MD7A 3ZZCA 4DCDA 5DP5A 1CHOF 4YT7H 1O2VA 1AHTH 3NWUA 5GPIB 2ZFTA 1SKYE 3OAAD 2BTCE 3S9CA 1OP0A 4AFQA 2ZGXH 1EP5A 1SHHB 4ZXYH 2F9UA 1SGFA 5DGJA 1VITF 1F0SA 2J2UA 2BX3A 1VCWA 5C94A 2P3TB 3D23A 1C5PA 1C5ZB 3E8LA 1GCDA 2K0QA 1O3KA 1RD3B 1JIMA 2G81E 1L2EA 4OS1A 3SZEA 2ANYA 2HOBA 1BCUH 4I7YH 2BD4A 3ZZ5A 3SU0A 4RT1A 1QZ8A 1HB0B 1S81A 3NKKA 5HM2A 3A82A 1COWD 3K2UA 4MPWA 4JYUH 4O97A 2FLRH 3VGCB 1DVAH 1O2UA 5E8EH 1KXCA 3DCLA 5IYTA 2Z9GA 3TNSA 2W6ID 1JRSA 1F0TA 3C1KA 4I33A 3SJIA 4LZ1H 1FNIA 1GJ5H 4M7GA 3V12A 2WPHS 2W7SA 3RXVA 2GP9B 2CMYA 4AX9H 1ZTJA 3SUGA 3GDUA 3AK5A 3LPRA 1W8BH 1HIAA 2QXIA 1O2KA 4NGAH 1HAIH 4ISLA 5JBCS 1CQQA 1SOZA 2HVYB 1ZHMA 2QXHA 1QHRB 3MO6A 2PV9B 2ODPA 1P9SA 1AFQB 1O3FA 2H9HA 3ZVBA 4B1TA 1O2PA 2A2XH 2QY0B 4Y0YE 1TQ0B 5CHAB 1TBZH 2ZHWH 5CE1A 2FYQA 1UTJA 4INHA 5A0AE 1RIWC 2Y82A 4RN6A 2BY5X 3E6PH 4NA7A 1H8DH 4Q7XA 1UK2A 2OP9A 1W0YH 3MH6A 5BPEA 3M5LA 2GMTB 2Z94A 3KQEA 4A92A 3A80A 5G4BA 2GT8A 3SUDA 3QUMP 4JK5A 1GL1A 1NT1A 1TIOA 2FTMA 5T6GA 1Z8JB 2EI8A 1A3EH 1BTWA 2WINI 5DP4A 2AGEX 4FUDA 1LCYA 1OP8A 2P94A 1HIAB 1ZMNA 1NC6A 2ZTZA 2QCYA 2ZA5A 3CENA 3AAVA 4FUCA 2XC4A 2M2AA 3B8JA 1BQYA 1C5XB 4O9VA 3S9AA 1ELEE 4KTSA 3UNRA 2OXSA 3FP8E 1BTUA 3TJVA 1A46H 1O3BA 2JDID 1TX8A 1NY22 4D9QA 3EA8A 1CSOE 4NIVA 1HAYB 3D65E 4AOQA 3BG8A 1YPLH 3ODFA 1K28D 1QL7A 4NFFA 1E1RD 2ZF0H 4TWWA 1BMNH 1E79D 4TT3D 3RMOH 2Y5HA 2XTTB 3MMGA 2UUJB 2VBCA 3H7OA 3OSYA 1AB9C 2HALA 2AIQA 3VB6A 2PHBA 3EQ0H 2GZ9A 4Y7AA 3LJJA 1JIRA 3KQBA 4U30A 1QRXA 1GPZA 4HTCH 3L3TA 2VIWA 1GJAB 2KR7A 3MOCA 3HPTB 2KCYA 2ZDKA 3MI4A 3KNXA 3LGTA 3GDVA 3NPSA 3MU4A 3RUOA 1QBOA 3SJOA 3SU1A 1E1QD 2B7DH 3O8DA 1OWKA 1UK3A 4AYVB 1YPKH 2W7UA 2OBOA 3EE0B 5HXFA 1PQ8A 1GBCA 1ZTKA 2GZ7A 4FXGH 2ZCLP 3VB3A 3ZIAD 2GZ8A 2FX6A 5I46H 1DITH 2IPQX 2QN5T 5E0JA 2F83A 2J34A 3A8AA 2AYWA 2ZO3H 4I8KA 1FXYA 3P8NA 5HIZA 1GVLA 1K22H 2J38A 3ATIA 1IOEA 1O3GA 3UFAA 1SG8B 3SUEA 2FLBH 3FVFB 1WU1A 3LJOA 3E91A 1V2KT 1NRSH 1TALA 5KGOA 2J5UA 5JPMH 1ELDE 3SU5A 2BX4A 1VCQA 4WH6A 1TFXA 5HM9A 2BDHA 2W3KA 1GI9B 1UVSH 1HJAB 1C5YB 1CA8B 3AW0A 1L4DA 5F8ZA 4Z0KA 4I8JA 1A0LA 1TMTH 1O2RA 2RDLA 3MH4A 4B2CA 4GUXA 1IQNA 3BTWE 3MO3A 5EJZA 2BYAX 5DSFA 4XD7D 2BD2A 5TJXA 1W11U 1ID5H 3I77A 4FU9A 1Q2WA 1MTVA 2ANKH 3WY8A 1P10A 2V3MA 3T5FH 1TX7A 5LPEA 1EPTA 5FPTA 1SLUB 2A7CA 3QTOH 1C1UH 3SN8A 4CH8B 1AO5A 1ESBA 5I25A 1MTNB 4BTUB 1LHEH 1NRPH 2PUQH 4X0WU 1XKAC 1O5DH 3GY4A 2CV3A 3BTME 3OTPA 1THSH 5DP8A 3RXJA 2LNCA 1KMHB 2YMSB 3SHAH 2G4UA 1FV9A 1P2OA 4X6OA 3BEFB 1Z1IA 2CXVA 3TK6A 1GMCG 1FMGA 1K2I1 4DG4A 3SBKA 1SGYE 3HGPA 1CO7E 2A0QB 2TIOA 4XSKU 3TJNA 3NXPA 4FUFA 3MTYA 1UMAH 1ZPCA 4GSOA 1D3PB 4X1SU 1N6XA 2G8TA 2FZZA 2PSXA 2VIVA 3VGCC 1TE0A 2ZI2H 5C1YA 1XM1A 1KXFA 4DIHH 3T27A 4CRDA 4CBOA 4BAOB 2ZZUH 3FOAA 1EQ9A 3LGYA 5GCHG 1V2VT 2BQWB 1IQIA 1MTUA 3ZZ4A 3RM0H 3EE7A 1F7ZA 2FPZA 1V2WT 1SBWA 1EAIA 1YPMH 5EJ1A 3HATH 1GI5A 2ZDLA 2SGEE 1J15A 4J1YA 1OX1A 4KKDA 3SNBA 2XWAA 4MNXA 1ETTH 3EAJA 5EPYA 4BAKB 1A5HA 2ZTYA 3E90B 2Q6GA 3JZ1B 4ABJA 2QE7D 3TVJB 3P8GA 1AFQC 1INCA 3SGAE 3F2HA 2FDAA 1MUEB 2ZDMA 3CNRA 2AEIH 3KQCA 5CHAC 4AG1A 3TH3H 2ZC9H 1PPEE 2Q6FA 3P6ZB 4B73A 3TPIZ 1ZRKA 4ZKNU 1L1GA 5EXMA 3WWFA 2F9NA 1TNIA 2ODQA 3Q3KA 4GPGA 5JYIA 1K1OA 2VVCA 1RS0A 2R3UA 3RU4E 4Y6DA 2Y7XA 1JBUH 2AMDA 4FUGA 1BRCE 3K9XB 2VWMA 3K6ZA 2ZFSA 1IQHA 4X6PA 5HGGA 5IK2D 2Z3EA 3LOXA 1HAOH 4K5ZA 2ZCHP 3PV5A 1O5AB 5C0TA 1FY8E 1CE5A 3BTQE 4M9FA 1KTSB 2ZFRH 3SV6A 1EAXA 4A1VA 1HDTH 2ZDNA 1GBFA 4THNH 2SNWA 1L1NA 2LELA 3RXEA 5A8YA 2W6JD 5HKKD 2O9QA 1KLJH 1EB2A 2EI6A 3F0OA 3H09A 2XC5A 2XNIA 2J98B 2XWBI 2ZFQH 1DLEA 2ZHFH 1HUTH 1MU6B 1C9TA 1UTPA 1OYQA 2J92A 1ANCA 1GJ9B 4JZFH 2H5CA 1W14U 2DUCA 1AWHB 2AS9A 3IWMA 1NFWA 5A8XA 4NG9H 1UCYK 2FESH 5DJ7A 1A0HB 5DN6D 3T62A 3UREA 1NO9H 1LQEA 1HAPH 2L6OA 1DS2E 3WW7A 3U98H 3U8RH 1SI5H 1C4V2 1LHFH 2JH5D 5AF9H 4D7FA 1YP9A 1S0RA 2IJD1 1MZDA 1FPHH 1SQOA 1XXFA 5FX5A 2L74A 1SPJA 1P11E 2XYAA 4LZ4B 3QZQA 1MAYA 4U01A 2RCEA 3P8OA 2TGAA 3R3GB 2HRVA 2BDIA 2R2MB 2BDCA 1GDNA 8KME2 1A5IA 2JETB 3OU0A 5FAHA 1CBWB 1W12U 1XUKA 5C17A 1NROH 1A3BH 1TA6A 1YCPK 2V7QD 1OP2A 1A4WH 4OS7A 4D8NA 4TYDA 1QB9A 5AFYH 3A7ZA 1O2OA 3SU2A 4Q4LA 5J4SA 4U2WA 1N6YA 2OQUA 1GMHF 2AGGX 4JMYA 1XUHA 2STBE 2SNVA 4FOUC 4X1RU 1K1PA 4ZMAH 1FX0B 1QFKH 2QF0A 3ATKA 4ABEA 2THFB 4MPUA 1LKBA 1T8NA 1GBMA 4AB9A 4CR5A 3SYJA 2FOBA 1E36B 1QBVH 4DY7B 2ZEBA 4X6NA 1DY8A 1NU7B 3ATLA 4ZKSU 3TU7H 4QT8C 3DT0H 3WWBA 6LPRA 1D3QB 1ETSH 1EZXC 5EW1H 3SV8A 1HAVA 3W95A 1AUJA 1HXFH 2OD3B 3OY5U 3A87A 1P0SH 1FIWA 3SJ8A 1O2TA 5LPFA 3GISB 1C5OH 3UR6A 3BTEE 3A83A 1EOLA 4LOYH 3R0FA 3M5NA 1WUNH 1RTKA 2FS9A 3RXAA 1Q3XA 1ZPBA 3HGNA 3UTUH 3LIWA 1HGTH 7LPRA 4K60A 4NSVA 3ZVCA 4ISHH 1O2ZA 1P2QA 1UVUH 2J9NA 3BIVH 1B0FA 3TH2H 1BRBE 1O2SA 5GNDA 4A1TA 1SLXB 4HG6A 4X2VA 5DPAA 1AB9B 4ISNA 2Y5GA 2Z3CA 4IGDA 3F68H 1UTLM 2HPPH 2C8YB 3RC6A 4X2WA 1C2DA 1HNEE 5C1UA 2FWWA 1K1JA 1NPMA 4TSFD 1MTNC 3AW1A 3F9EA 3LU9B 3O8CA 1UCYE 1PPHE 2O8WA 4WY3A 1GBAA 4P00A 3V3MA 4FUHA 4Q7YA 2A45B 1O31A 4WF8A 5TCCA 4X1NU 1AU8A 4XRNA 3RMLH 2YMSC 3PV2A 2FOEA 4IS5A 1K21H 3I78A 1WTGH 1ZYOA 4WMDA 5KEDA 2G55A 3UUZA 2ZFPH 3F9GA 1QJ7B 3VG8A 3SV9A 3IG6B 2AH4X 3EDXB 1EXFA 2OUAA 4NCYA 3ZVFA 5F8XA 4YLQH 2FODA 1SR5C 1SHYA 2YNAA 3G01A 3SGBE 4KTUA 3ATWA 3RXSA 1DE7H 1K1NA 2TGPZ 4I8HA 3KF2A 8ESTE 5E0HA 1L4ZA 1HFDA 1G3DA 1SMFE 1AIXH 1B7XB 1CT2E 4A5TS 4YTAA 3KQ5A 4J2YB 2A7HA 1UHBA 4BTTB 2EA3A 1FAXA 1D3DB 2QXGA 1UTQA 2FX4A 1GL0E 3QWCH 2BB4A 1A61H 1HYLA 1ZLRA 2VWOA 5FPYA 4RKOB 1Y5UT 2HLDD 3PTBA 2KFWA 2FYRA 1SB1H 3E3TA 4CRFA 4H42U 2I6QA 2QF3A 2FMJA 1EATA 4KELA 1QQ4A 5FX6A 3UY9A 2GX4A 4IC5A 1YM0A 3NUMA 1AKSB 1O32A 7ESTE 1O3EA 1LPZB 4HI3A 3A8DA 3W94A 1SQAA 2A7JA 2J95A 2TBSA 2QC2A 2WPIS 1T32A 4K1SA 5FHTA 3SJKA 1NTPA 4ZAEA 5JB8S 1HPGA 4YO9A 4A1XA 2BZ6H 5C5OA 1O0DH 1T8MA 1Y5BT 1S85A 4Y76A 3GYMA 1J17T 5EQSA 1UHBB 1HXEH 5FBIA 5DKMA 1C1OA 5CHBA 3SJ9A 2IPHA 2WV4A 4XBBA 2QGRA 4K69A 3PMBB 2BD3A 1C1WH 1TMUH 1AGJA 2BD7A 4WWYA 3VFEA 3U1JB 5TCAA 1Y3XA 8LPRA 1IQMA 1O3OA 1QY6A 2WPJS 4HZHA 5E2PA 2HNTF 1ABIH 3FP6E 1KXEA 1WQVH 2JH0D 1WXRA 3UQVA 3VB4A 2RDEA 2A4GA 4F55A 3UR9A 2BQ7B 2TRMA 3ZZ6A 2W26A 1MKXH 1TGBA 3ZVEA 1GBBA 2PFEA 4GLYA 3MU8A 1BRUP 1GVZA 3T2NA 2WUBA 4BTIB 1ELCA 3KQDA 4Q63A 4A6LA 3OTJE 1DUEA 2QXJA 1O2JA 3SV7A 1ZRBA 2OBQA 1LO6A 1JXPA 4GCHG 4OS4A 2ZECA 2VIOA 2GTBA 2JETC 3MU5A 2BXTH 3PO1B 1CBWC 1MBMA 3PWBA 3VB7A 1LTOA 1GHAG 3DSPA 1VGCB 3RDZA 1TX6A 3LC3A 3GY7A 1XUJA 3MFJA 5ESTE 3SU6A 2XRCA 1BJUA 4CRAA 1GI2A 2Y81A 4KGAA 2V3HH 4MNWA 1NRRH 2BDGA 2EY4C 2JH6D 3GY8A 2Z7FE 3Q76A 4BAMB 4RKJB 4Z1MD 3RXTA 5C2ZA 1EAWA 1THPB 1O39A 5DP7A 5A09A 2IOTA 1DLKB 2XBWA 4K2YA 4HFPB 2ZU5A 3UNSA 3SU3A 1ELAA 2OC0A 1GBLA 1VITG 1OS8A 4MG3A 4BNRA 4GVUA 3LGWA 2ZDAH 4Y8XA 4BANB 1GMDG 3VPKA 2BHGA 2PWXA 1BMLA 4FUIA 1DPOA 4ZHMU 1CGIE 1IHSH 1QB6A 4OGXA 3V0XA 3SQHE 4JZ1A 3SHCH 2PGQB 5FCRA 5SGAE 3KEEA 1V6DA 3AASA 1DOJA 2ZPQA 6GCHF 2F4LA 3UQOA 3OFND 3ZZ3A 2Y6TA 4X6MA 3BF6H 2VU8E 1AWFH 1KY9A 1HLTH 2AERH 1NBMD 1C1NA 3BIUH 6ESTA 1ZMJA 3NK8A 4ASHA 1BUIA 2EEKA 2OC1A 2RG3A 4WVPE 4ESTE 4MPXA 4ZUHA 3U8OH 1C5LH 1DWBH 3FANA 1G2MA 1RTFB 1F5RA 7KMEH 2HNTC 4O03A 4ABGA 4Y71A 3SW2B 3W1EA 2ZU2A 3SGQE 1U6QA 3TK9A 3KYFA 1O3AA 4Q80A 3ESTA 1YYY1 1WBGB 5EQQA 3RLWH 2ZCKP 2GCHF 2P59A 1YGCH 3KIDU 3RXFA 4FUEA 5EJLA 1F5KU 2JIZD 2FOFA 1LVOA 1ARBA 1XUIA 4ABIA 1G9IE 2OLGA 1PYTC 1UTNA 3MHWU 4X2XA 1TGSZ 2BDBA 2R9PA 1DWEH 3BTHE 3QO6A 4CH2B 1P3CA 1QB1A 2SGFE 1W2KH 3GYLB 1UTKA 2NU1E 3DHKH 3I29A 2QA9E 4JZIA 1ELFA 1GI8B 4YESB 1GGDC 1VJAU 4H6TA 4AYYB 3GOVB 2CGAA 3NZIA 2XBVA 1LVMA 1YBWA 1A5GH 3U1IB 3A8CA 3A81A 4I32A 2A5KA 1OOKB 3OEHD 5EGMA 1C4U2 2DE8A 2ZQ1A 2UUKB 1PYTD 1S84A 2G51A 2H2ZA 4D76A 3PLKA 2A4QA 2V6NA 4IMQA 1O5CB 3U8TH 2R3YA 3GY5A 1OPHB 1HRTH 3TLOA 2GGVB 4Y11E 3RXCA 5F6MA 1O5GH 4B71A 2BDAA 2VB0A 4B74A 3MQKC 1EAUA 2ALPA 5JBTA 1GI7B 3OYPA 2VWNA 4K1TA 2XNDD 1E38B 1TRYA 1W0ZU 3M3TA 4YOGA 1NFXA 1V2PT 1WCZA 2ULLA 1YPHC 5LPRA 4DOQA 4NIXA 1MMJN 3EYDA 1Z8GA 1RRKA 1WOFA 1BRAA 4DT4A 2ZU4A 5K7RA 1XUGA
chains in the Genus database with same CATH topology
1MBQA 4F49A 1KLTA 1AFEH 2ZTXA 1L1JA 1V2QT 4CRCA 1O5BB 1G30B 1S82A 4YT6H 3ZVDA 1LQDB 1O2QA 1O38A 1DDJA 5GDSH 1SFIA 2FO9A 3SNCA 2BXUH 3QN7A 5C1XA 1GDUA 1TNJA 4TY7A 1ZJKA 4DJZB 1LMWB 2VGCB 4Y0ZE 1T7CA 4MQAA 3RC5A 1B0EA 2ZU1A 1PPBH 3TJUA 2K1QA 4NIYA 4RSPA 2STAE 1O5FH 1CGHA 2BOHB 1SGFG 2AIPA 3ENSB 1AVGH 3ZZBA 1DWCH 1FY1A 1ZSLA 1T4UH 1C2KA 2ZHEH 2PKSC 2IJOB 2Z9JA 2B5TB 5F8TA 1SLWB 4ABAA 5L2ZH 4FU8A 1OYTH 2GVFA 3SQEE 1RGQA 1TABE 5JBAS 1P3EA 4TPIZ 1ZMLA 1LVBA 1T8OA 4MVNA 3F6UH 4I8GA 1P2JA 2EI7A 1MAXA 2KAIB 4INKA 2TPIZ 4FUJA 2B9LA 1V2RT 1MCVA 2PR3A 1ZR0A 1FN6A 3SI3H 2HWLB 3BEIB 2R0KA 2VVUA 3PO1C 1MCTA 3M3VA 1UVOA 1ORFA 1VGCC 2PSYA 1VITH 4B75A 3F1SB 2HPQH 1QCPA 1PPFE 1SSXA 3MNXA 5EQRA 3GCOA 1ZJDA 3GCTG 4CRBA 1P06A 1TRNA 1KXBA 2P93A 4YOIA 3RXBA 1ACBE 1MKWK 1XVMA 3L33A 1NN6A 4Y10E 3BV9B 3ZZ9A 3GCHC 1PQ5A 4Y8YA 3RMMH 3ZVAA 1A2CH 2HNTE 4R0IA 1AI8H 3PWCA 1SVPA 5DP6A 1QQUA 1ANDA 2Y7ZA 3FFGA 3BG4B 1UJ1A 2A4RA 1J16A 2A5AA 1C5NH 4AG2A 3L6PA 1HAGE 1V2LT 1SFQB 1ESTA 1C2IA 4ABFA 2GV7A 1AN1E 4Q2KA 1VR1H 2HVXA 3STIA 1GHWH 1AZZA 1Q31A 2BVXH 2Y80A 1XX9A 4NFEA 2FIRH 2ZG0H 4GAWA 5A0BA 1PPCE 1C1QA 4YZUA 4SGBE 1VJ9U 3GCNA 2VIPA 4ZHLU 1O35A 2GT7A 4X1PU 4JZEH 2F9OA 1FY5A 1MD8A 2GD4B 3QLPH 5FCKA 1DXWA 1A7SA 1UK4A 2TGTA 3ODDA 1GDQA 3DFLA 1DSUA 5C5NA 4UFGH 1XMNB 2HGTH 3TNTA 3S7KB 3A86A 3FAOA 2A1DB 2BY7X 1GWAA 5EXLA 1P2MA 2P3FH 4F4OC 1EJNA 1ANBA 3SNDA 2BD9A 1E0FD 3GICB 1YF4A 4PROA 3S0NA 1UO6A 2ZPRA 2P3UB 3H5CB 1W10U 3P70B 1GG6B 2ASUB 1UVPA 2Z9IA 3TITA 4MNYA 2BY8X 3Q00A 4BAHB 1TLDA 4O3TA 4DVAU 1QL9A 2FI4E 2DE9A 3D49H 1FY3A 2FTLE 1QBNA 3GY2A 2YNBA 1QNJA 1KDQA 4E06H 2FOGA 1TA2A 4ISIH 4OGYA 1Z8IB 3MH5A 1ESAA 5H4IB 3SORA 3SV2H 3V7TA 3S69A 3RMNH 3MO9A 1ELBA 3DUXH 3T29A 1HJ8A 1WSSH 3KL6A 1QJ1B 3LONA 1N1LA 4NIWA 1C5TA 1C1SA 3PMJA 3B9FH 1F92A 3SO3A 4AFUA 1BT7A 5EPNA 1EB1H 4AORA 4O3UA 1ZSJA 1O2NA 1CT0E 1C2HA 7GCHG 1BBRK 2VWLA 4BOHA 3DD2H 3D62A 1DT2A 2UWLA 1G3EA 4Z6AH 4UFDH 1C2GA 4NZQA 1TRMA 2VNTA 3MU0A 1UCYH 2WPKS 1C1RA 2PGBB 8GCHG 3GY3A 3LT3A 4ZKRU 1IQKA 1KDQB 1GJ8B 4ISOA 2NU0E 1SGIB 1O5EH 1GJDB 2NWNA 1YKTA 2PTNA 1DX5M 2M5TA 1O2YA 1LHCH 4UDWH 1L0ZA 1QJ6B 3HKJB 4ZH8A 1FY4A 1ETRH 2F3CE 1TBRH 5J4QA 2W5EA 4CREA 1ZGIA 1AZ8A 4UEHH 2UWPA 1C1VH 1C5VA 5ABWA 1GHBG 1NU9A 1AKSA 3P95A 1X7AC 1A1RA 2VGCC 1GBJA 2G5VA 1O2IA 1W13U 3E16B 2B8OH 3EGKH 5A0CA 2BQ6B 2BD8A 1MQ6A 1GMHG 1IAUA 2ESTE 1S0QA 3PLBA 1C2LA 1O33A 2ZU3A 5E0GA 3LGVA 5EG4A 5A8ZA 3O8RA 1Y8TA 1XVOA 3LDXH 2ZGCA 3MYWA 4BXSA 1MKXK 1KLIH 1P12E 4H4FA 3PYHA 3RXGA 1Y3WA 3M35A 3ZZ7A 1QRZA 1GGDB 1MTWA 1JRTA 4WXVA 3P8FA 4DT7B 1Z7KA 1P57B 2PUXB 4SGAE 3N7OA 1P09A 5GJ4B 3QX5H 4WMFA 1QIXB 1Y3UA 2ODYB 1O3MA 2FS8A 2OQ5A 1PPGE 3RXQA 1D3TB 2FP7B 1MU8B 1BDAA 4GCHF 3JZ2B 1EASA 3CS7A 3UWIA 3RXDA 1YLDA 3K65B 2BMGB 1GBIA 2A32A 1Y3YA 1HBTH 1H9LB 1GCTB 2ZGHA 4VGCC 4XOJA 4AFSA 1SOTA 1P2NA 1PPZA 1BBRE 4DIIH 2VJ1A 1AE8H 2Q1JA 1OWIA 2SGAA 1FJSA 3VB5A 5LGOA 2VH0A 5DP9A 1AVWA 2BOKA 2D1JA 5T6FA 3BG4C 4ZHAA 4OS6A 3DA9B 2PW8H 3P92A 1YC0A 1KSNA 1F0UA 1WTHD 2Z9KA 1FLEE 4D7GA 4FUBA 1BTYA 1IQLA 1C5SA 1H8IH 1GVKB 3ATMA 1RJXB 4FVDA 4TY6A 1LHGH 1KYNA 1BTXA 1ZPZA 3BTKE 1O3CA 1CA0B 1GMDF 1Z1JA 3SUFA 2ZFFH 4XE4A 4E05H 2AMPA 1TGCA 2BLVA 2PKSB 1CU1A 2BY9X 4KTCA 4KP0A 5C20A 1LPKB 2ALVA 1FI8A 2C8WB 2XBXA 1HAXB 3C27B 1GHXH 3MWIU 1K1IA 1ZZZA 2XCFA 3RXUA 2D26C 5L2YH 2CF8H 4WH8A 4A7IB 2GCTB 2I6SA 1MH0A 1PQ7A 1TNGA 4IN1A 3M61U 3A84A 1O30A 1QA7A 1ZGVA 2ZHQH 3KHVA 1ANEA 1E35B 3A7XA 4BXWA 1XKBC 3LC5A 1S5SA 2BLOA 1YLCA 1GG6C 3MNBA 1C2MA 2WPLS 4JYVH 1FN8A 9LPRA 2P95A 3OY6U 2C8XB 4NWKA 1HJ9A 4UD9H 1C1TA 2P8OB 3CP7A 1CHOG 1TNKA 2C93B 5EU8A 3GCHB 2FOAA 2ZNKH 4MPVA 2PKAA 5CMXH 2QV1A 4NA9H 4JCNA 1CVWH 3RM2H 1Y59T 4BAQB 1S83A 3M7UA 2O8LA 2ANWA 4YLUA 1Z6JH 2FI3E 2H1UA 3V13A 3QZRA 2H9TH 1AD8H 1EKBB 2EC9H 4NZLA 4MLFB 3RLYH 2G00A 2F9VA 2UWOA 1SL3A 2PLXA 3QDZB 3T26A 2V35A 2NU4E 5JBBS 1TWXB 2UUYA 3BN9A 3TIUA 1FIZA 3VXFH 5FXLA 1SGQE 3M37A 2OINA 2AMQA 1H9HE 1C2EA 2OCVB 2Z6BD 3TJOA 1TNHA 5GWZA 1TBQH 1V2MT 4CHAB 1Z71A 1SQTA 1Y3VA 3MNCA 3UNQA 3FP7E 1FUJA 3SU4A 2CHAB 4GHQA 1P2KA 1AQ7A 1TPPA 4TPYA 3M7TA 4Y8ZA 1ZSKA 3TH4H 1OSSA 1ELTA 2PKAB 2O8UA 3HK3B 4INLA 1V2JT 2ILNA 4K1EA 4B76A 2ZDVH 4IBLH 1IQGA 2BZAA 1V2ST 2QIQA 5DO4H 2CN0H 1V2UT 1ELGA 1PFXC 2SGPE 1P02A 1F5LA 1QURH 4R8TB 5AHGH 1SGEE 2VINA 1K1MA 2FXRA 4XBDA 2RA0A 1OWJA 1TQ7B 1KTTB 5EW2H 3PV4A 5IDKA 2R2WU 3H7TA 1S6HA 1LHDH 3PMAB 4WXIA 3Q3YA 2A31A 1GMCF 3S7HB 1MZAA 4UONA 1HCGA 1UTOA 5L30H 5PTPA 2UUFB 1K9OE 1T4VH 2JKHA 1GJ6A 4AFZA 3M3SA 3RU4D 4GHTA 3CS0A 3M36A 4NA8A 1DM4B 1QA0A 1V2OT 5BRRE 2ZGJA 2ZQ2A 5GCHF 3IITA 1TGTA 2WUCA 1W7XH 1KXAA 3PM3A 1SGTA 1DANH 3U69H 2SGQE 1FONA 4MNVA 4WMEA 1BTPA 5LH8A 2O8TA 2G52A 1A0JA 2RA3A 3UWJH 2H5DA 1O3DA 2HLCA 1YPGH 1RFNA 1G36A 1NRQH 2PTCE 3BTTE 1BHXB 3LKWA 1LKAA 1C2FA 3RXMA 1PQAA 5T3HA 1QR3E 3GDSA 1GI6A 3RXLA 3O8BA 2XBYA 3M7QA 5FBEA 5A2MH 3ZVGA 1GI3A 1M9UA 1FQ3A 2SGDE 3URCA 6GCHG 1O3LA 2WYJA 4CR9A 3GY6A 1C5UA 1N8OB 1GCTC 1QL8A 3TGJE 1J8AA 1BZXE 1OWEA 2QAAA 2OC7A 4DW2U 1D6RA 3MH7A 1VCPA 3GCTF 3KN2A 1GBDA 2D8WA 4X1QU 2H6MA 2YOLA 1GJBB 1T8LA 2KAIA 1NRNH 3BTFE 2Z3DA 4DGJA 1BOQA 2ZGBH 1O2XA 1SGPE 2XXLA 4HGCA 1SGCA 2H9EH 1EUFA 2G4TA 1DY9A 1NESE 1OKXA 4OS2A 1TYNA 4E7RG 1RTLA 1P05A 1P9UA 3ZZDA 2V0BA 1CGJE 4XBCA 1O3PB 1DUAA 3STJA 1W3CA 1KIGH 1GJ4H 1ZHRA 1LVYA 3M5OA 4Q7ZA 2OC8A 1EJMA 3A89A 2ZP0H 1TOMH 3SOSA 3FZDA 4K3JA 2GCHG 5T6DA 1CA0C 6CHAB 1O2WA 2B0FA 5K0HA 1FAKH 2CF9H 5GIBA 3S9BA 1P8VC 4IMZA 4ABDA 1C5QA 1H1BA 5GXPA 1H9IE 2GDEH 1JMOH 1MQ5A 2AGIX 2VIQA 1C5RA 1P01A 2C90B 2GKVE 1EOJA 3PTNA 4U32A 5HMAA 1ELVA 3K6YA 5EXNA 3UOUA 1C5MD 2ZIQH 1GJ7B 1S6FA 1BB0B 1HAZB 1W7GH 1GHYH 2A5IA 2FOMB 1E37B 1EPTB 1EZSC 3MU1A 2GCTC 2WYGA 1O3NA 1O36A 3QGJA 3EA9A 1O37A 2XW9A 1TB6H 5F03A 4WJG2 5AFZH 4YOJA 1EZQA 3ZV9A 1NM6A 1O2MA 3A7YA 1SGRE 2BVRH 1D4PB 1MTSA 1AE5A 3LGUA 2ZKSA 1THRH 4VGCB 1JWTA 2P8OC 1B5GH 4X8TH 1BHXF 2FOHA 2QYIA 2F9PA 4Y7BA 3T25A 1NFUA 1HAHH 1CT4E 1TOCB 1GJCB 1P2IA 1SGDE 4X2YA 1TAWA 1GHVH 1DXPA 3RP2A 4NSYA 2V3OH 3QK1A 3TK5A 4OS5A 3BTGE 1TMBH 1UTMA 1DSTA 2GMTC 3BEUA 1ARCA 1GHZA 4JK6A 4NWLA 3Q77A 4IW4E 3PMHB 5DK1A 1HV7A 1G3CA 3TGKE 2BLWA 1UVTH 4UFEH 1XXDA 2BD5A 3PLPA 3PB1E 2IN2A 1V3XA 3SNEA 4AGJA 3RXPA 1FZZA 4H6SB 5B6OA 3UIRA 4AN7A 4E7NA 1DWDH 2Y5FA 3ZYEA 3AAUA 4XFQA 1O34A 1NS3A 4CHAC 3RXIA 1O3IA 1NZQH 3E0NB 1GBTA 2GV6A 3E1XB 2J4IA 3OX7U 7GCHF 2CHAC 3M5MA 1BMAA 1SGNE 3UOPA 1G32B 3NCLA 2OTVA 2C3SA 2VVVA 3URDA 2NU3E 1YPJH 3RC4A 1BMMH 5C67A 1AVXA 3VEQB 8GCHF 1LDTT 3MNSA 3Q3XA 5AVDA 4CRGA 1BA8B 4B2BA 3ELAH 1BITA 1EZUC 1V2NT 4TWYA 1IQJA 3U9AH 4X8VH 1GI4A 2VH6A 1VZQH 3F9FA 3LH3A 2WPMS 1KXDA 3AVZA 3HKIB 1GHBF 1YPHE 1J14A 1GBHA 2ZHDA 3E0PB 1RIWB 2FM2A 2FOCA 2R0LA 4K8BA 5HYOA 1EX3A 2W3IA 1TPSA 4FVBA 2Z9LA 4JYTA 1FDPA 1D9IA 3KCGH 2ZPSA 4D9RA 3HK6B 5L6NH 3UPEA 1MKWH 1JOUB 1OWHA 3PROA 4I8LA 4XDEA 1P04A 1BJVA 1ABJH 1NFYA 1F2SE 1T31A 1GI1A 1C2JA 1OWDA 3A8BA 3RXKA 2BM2A 1GI0A 1G37A 3QTVH 3RXOA 5DG6A 1O2GH 1V2TT 1ZOMA 1WQSA 9ESTA 1EP6A 1QTFA 5FPSA 4IN2A 4Y79A 2CJIA 1C1MA 1IHTH 4FU7A 1HJAC 4AZ2B 2VIDA 4X8SH 3VXEH 1K1LA 2O8MA 1DICA 1YCPM 1C9PA 1BTHH 1YPEH 1N8OC 2F9BH 3QGNB 3A7VA 5ETXA 1AUTC 3BTDE 2Q6DA 3F9HA 3ZYDA 3SNAA 3A7TA 3SZNA 2C8ZB 1GBKA 5JB9S 5C3NA 3EA7A 1FPCH 1D6WA 3ZZAA 2NU2E 1TPAE 4ZXXH 1C4Y2 4AGKA 4MTBA 4CBNA 1TPOA 1GBEA 1IQEA 2ANMH 2SFAA 1H4WA 3RXHA 3BSQA 2BVSH 2BDYA 2WV5A 4ZROA 4B2AA 1YCPH 2BY6X 1DFPA 4LK4A 1C1PA 2BLQA 1HAVB 1P03A 1AMHA 2FI5E 2AFQB 2C4FH 4ABBA 6CHAC 1C5WB 3ZV8A 3ZZ8A 5EODA 1Z6EA 5E2OA 5DP3A 3RU4T 1Z8RA 2GDDA 3B23B 3TGIE 3A85A 4UFFH 1XUFA 3FZZA 3A7WA 3LGIA 2TGDA 1O2LA 4I31A 2XCNA 5ESBA 1O2HA 1TNLA 1O3HA 1RXPA 1E34B 4MDSA 4AB8A 3LH1A 1J9CH 1IQFA 2XC0A 1EPTC 1TONA 1F0RA 2F91A 3SI4H 4ABHA 4DURA 1OXGA 2A4OA 2LPRA 1QGFA 1SLVB 5JDUB 2FEQH 1WYKA 4ZKOU 1O3JA 3P17H 1PJPA 1AY6H 1BIOA 4K8YA 3A88A 3DFJA 4YM9A 2P16A 2G5NA 1GHAF 4X8UH 1ZTLA 4IC6A 2D2DA 1ZHPA