1VJAU

Urokinase plasminogen activator b-chain-jt463 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of novel and selective inhibitors of urokinase-type plasminogen activator with improved pharmacokinetic properties for use as antimetastatic agents
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords plasminogen activator, urokinase
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vjaU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vjaU01
2SGPE 4NFFA 4KELA 1D6RA 4Y79A 4ABHA 1KYNA 1L4DA 1EZXC 2Z6BD 1TGSZ 2P3UB 1YPMH 1IHSH 3PV4A 4DJZB 1EZQA 3M7UA 1K1JA 4TYDA 3MU4A 2FOMB 4X6PA 2R0KA 1XKBC 1W12U 1AUJA 1RIWB 1TBZH 1QJ6B 1AIXH 1GI1A 4FUHA 1ZTJA 1V3XA 2STBE 1DWDH 1HFDA 2GX4A 2A5KA 3SORA 1ZHPA 2ZG0H 4WWYA 1P10A 1CGHA 2VWLA 4DG4A 2ANKH 1KDQB 3CS7A 2ZF0H 3BTTE 1P2KA 3ENSB 3QZRA 1MCVA 1Y5BT 2VWNA 1TWXB 3T27A 3TIUA 2ANYA 1L0ZA 3QDZB 1TAWA 2CJIA 1J16A 3T29A 2A5AA 1QRZA 1OKXA 5A0BA 3KEEA 1PQAA 5FX5A 2A45B 1GGDB 3A85A 3EA8A 3ZZ8A 1AUTC 1EPTA 1MMJN 1UK2A 1BBRH 2BY6X 1OWEA 1O2VA 1ZYOA 1VITG 1VR1H 4OGYA 1GJ5H 3MO9A 1X7AC 1O39A 1HB0B 3NKKA 2D26C 3OSYA 4HGCA 1C4V2 2ZFQH 1G3BA 3QN7A 4GAWA 1KXEA 2XWBI 4JZIA 3NWUA 1SC8U 1BIOA 2OBQA 4JK5A 5T3HA 3MNXA 1EASA 2W26A 4B2BA 3VEQB 3LJJA 1K9OE 3SJIA 2TGTA 1C2FA 2ALPA 1MZAA 1EATA 2NU2E 2FM2A 1A0LA 3EA9A 4Y8XA 1C1QA 1S85A 1E38B 2ZDVH 5CMXH 3IG6B 1O35A 2TBSA 1TNIA 1GBAA 2C8ZB 4GPGA 1UCYE 5FPSA 3SNAA 2Y5HA 2AMPA 3NK8A 3STIA 1IQIA 1P01A 3UFAA 1FI8A 1DANH 4X1RU 2JH0D 4FVDA 2LNCA 4OS5A 1Y3YA 1Y5UT 1UHBA 1GBDA 1YPLH 2F9VA 1DVAH 3HPTB 2PGQB 3GCNA 4ISOA 2TGPZ 2I6QA 3P95A 4MNVA 4FXGH 4DURA 1EB1H 1XMNB 1A1RA 4MQAA 2FYRA 4GHQA 4JZEH 3SNEA 1XXDA 3TPIZ 2WUCA 1QA0A 1UK3A 4Y7BA 1V2JT 4BXSA 1DWEH 3GY5A 2V6NA 3HKJB 1TNLA 1ZMLA 1DWCH 2XC5A 1QTFA 1GI5A 2P8OC 1UTPA 1GHVH 3ZZAA 1C1OA 3BTKE 2GT7A 1JXPA 1HJAC 2H9EH 3KQBA 3MMGA 4GSOA 2A32A 2P59A 2QF3A 3RXAA 1DSUA 1C5QA 1MH0A 1V2QT 4IS5A 1RXPA 3RXQA 3M36A 1P0SH 4MNWA 1SLUB 1E35B 3N7OA 2VWOA 2ZZUH 2ZP0H 4O9VA 4TY7A 1FAKH 2PKSC 1P04A 4AGJA 3TH4H 1QL7A 1OP0A 3MU0A 3K2UA 3RXOA 3SQEE 2RA3A 1E37B 3PB1E 1GBMA 4NIWA 3H7TA 5LPEA 3BV9B 2QIQA 5AHGH 1L4ZA 1H8DH 5JBBS 1L2EA 2QXIA 3ZVDA 1DT2A 2HGTH 1HV7A 3PMJA 3VFEA 3VXEH 1SR5C 2BY5X 1PPFE 4AFUA 1C5XB 1A3BH 1C2EA 1O2UA 3PMBB 4K1TA 3GY6A 4MLFB 3M7TA 5C5OA 3E0PB 2WPHS 3RLWH 4JZ1A 5HGGA 2QC2A 2A31A 2A4RA 1FNIA 5DGJA 1PJPA 1MTUA 2C4FH 3V0XA 1FUJA 2BD4A 3BTDE 2QGRA 2XW9A 1GBLA 1QCPA 2VB0A 1ETRH 1O3NA 1D9IA 2J92A 4UFEH 5ETXA 4IMZA 1O2QA 4NG9H 2PTCE 2TGAA 1V6DA 1HRTH 4AZ2B 1TONA 3Q3KA 2G4TA 1H9LB 1LPKB 1C2GA 3QGJA 3RXSA 3TU7H 1ESAA 4INKA 4WMEA 2SGAA 1XUHA 1GI0A 1GI2A 1AGJA 3MWIU 2F91A 3KQEA 4XBBA 5HM9A 4WY3A 4ISIH 2G4UA 4MPUA 5TCAA 2Q6GA 1A0HB 3RXPA 5GWZA 1VZQH 2CXVA 2FOEA 1INCA 1AE5A 4U2WA 3STJA 4JYUH 2RCEA 1HPGA 4H6SB 2A2QH 1S6HA 3KF2A 4WVPE 4CREA 1IQFA 1T7CA 1Y3XA 2R9PA 3BG4B 3HATH 2ZCLP 1GMDG 1KY9A 3RMNH 1NRPH 1GHWH 2O8WA 4CHAB 5ABWA 3A8AA 1BBRK 3RC4A 5JB8S 2G00A 2HALA 4UFFH 1K2I1 3RU4D 1TNHA 2ZFPH 4X0WU 3OYPA 2BHGA 1LHEH 4Y0YE 3R3GB 1O5EH 2B7DH 4BAHB 4NCYA 1SGPE 3U9AH 2FX6A 5CE1A 1OOKB 4FUEA 2ZHFH 1O34A 3DD2H 3P92A 4GUXA 4I32A 1C5NH 3P6ZB 1AO5A 1XUKA 3RXEA 1YKTA 2Q6FA 1PPHE 3SV8A 1ZPBA 2VGCC 7GCHF 4D8NA 1VCWA 4K1SA 1PPBH 2TGDA 4WJG2 3E16B 4ISLA 4K8BA 1H9HE 1HDTH 4YLQH 3A81A 2F9UA 2UUKB 2VVCA 1EKBB 1V2WT 3RXBA 2GVFA 2BVSH 4U32A 2SFAA 1B0EA 2NU3E 3P8NA 4HFPB 1EQ9A 3OY6U 2J95A 3R0FA 4ABIA 3D62A 1C5VA 2W3IA 1QIXB 1O2OA 1Z6EA 3W94A 3M5OA 3MO6A 1BTYA 5C1YA 4JZFH 1EJAA 1ETSH 1GBJA 3S9BA 1GJ6A 1K1MA 1MBQA 1MU6B 2ZU4A 2ZPQA 3LGWA 2GKVE 1LVOA 3UPEA 3RXIA 3FP6E 1MZDA 3DFLA 2QF0A 2QY0B 1IQJA 3NPSA 2O9QA 4CBOA 2VWMA 1SLVB 1BDAA 3V12A 1ZMJA 4K2YA 1QQUA 1THPB 1BTHH 1C5MD 2OQ5A 4D76A 3FAOA 3RP2A 1F2SE 4LZ1H 4X2VA 2C93B 4X8TH 2XNIA 2DE8A 2ALVA 2BD5A 2EI8A 1O32A 1W7XH 3PWBA 3OU0A 4CRGA 4NSVA 2VH0A 2ZPRA 1FY5A 4NGAH 1NT1A 2FYQA 2Z3CA 1PQ8A 4AB9A 1FQ3A 3ATLA 2F9OA 5FCKA 1AFEH 2GGVB 1ZJDA 3S9CA 1CVWH 2D8WA 3T5FH 1FY1A 3EAJA 1T31A 3E91A 1C5UA 7ESTE 1GVKB 5FXLA 4YT6H 4KTSA 1PPCE 4Q80A 2ZFSA 3RXUA 3NXPA 1O31A 4K60A 4CBNA 1NN6A 3BTQE 4OS4A 2ZHEH 1O2WA 3ZVFA 1TNKA 1CSOE 4E05H 3OTJE 1UTKA 3QTVH 1DPOA 3AASA 3T26A 2BX3A 1WBGB 2BLOA 2W3KA 1KXAA 2GZ7A 2OCVB 2BVXH 1SMFE 2JETB 4QT8C 1C1SA 4ASHA 1D6WA 1ZRBA 2SGDE 1O3BA 3QX5H 5LPRA 1MTWA 1C1PA 1YP9A 1TGCA 2VIQA 2QYIA 1QHRB 1O2YA 4X1NU 1O3KA 2BLVA 4FUDA 4BNRA 4B71A 2OC8A 1YPHC 1HCGA 1A5GH 1AVGH 1T8LA 2AGGX 2WPKS 3RXJA 5EW2H 5JPMH 5C2ZA 4B2AA 1MD7A 3GCHC 1DWBH 1N6YA 4TY6A 2EI6A 4AG1A 1KLIH 1NC6A 2WPMS 1GL0E 1YPJH 1MCTA 3P8GA 1DSTA 4INHA 3OX7U 2GDDA 1RJXB 2VIWA 1P2QA 3E0NB 4X1QU 1QL8A 3MH4A 1YCPH 4D9QA 1SL3A 1GDUA 5T6DA 1MTNB 5JBTA 3MI4A 1UTLM 2ZWLH 1OPHB 4AYYB 3LJOA 1MBMA 3WY8A 6CHAB 3ATMA 2OINA 4YO9A 2PFEA 2OBOA 1A4WH 2WV4A 3M5NA 2PUXB 3ATKA 2V35A 1OP2A 1GMCF 3CENA 5FBIA 4Y71A 1SBWA 1HYLA 3RMMH 4NFEA 2HPQH 2PLXA 3LC5A 4H4FA 3D65E 3A7TA 2EEKA 5EU8A 1SGCA 4BAOB 1QA7A 1NO9H 1AKSA 5C5NA 2PKSB 2VIDA 1OWJA 2Z9GA 4NZLA 2CMYA 3ZVCA 2QXGA 3AW0A 5EXNA 1BT7A 1KLTA 1ABIH 2ZU1A 2ZO3H 1LPZB 1ZR0A 1EJNA 4DT7B 1AN1E 2A2XH 1HXEH 2H1UA 3MH7A 1YLCA 2BLQA 3GICB 1B0FA 1P03A 5A8ZA 1O38A 1GHXH 5HM2A 1RFNA 1FPHH 2SGQE 3Q76A 2Z9IA 3VB4A 1V2LT 3LDXH 2YNAA 2ZDNA 3M37A 2ULLA 2R2WU 1SOZA 3UR6A 1FIZA 1V2VT 3FP7E 1GJ9B 1M9UA 4ZH8A 1BTPA 3QTOH 4LOYH 5E8EH 1ZTLA 1KLJH 1BB0B 1UK4A 4BTTB 1V2KT 1CT4E 1C4U2 2FOGA 1DXWA 2ZHDA 1JIMA 2XBYA 1PQ7A 3MTYA 2PSYA 2AYWA 5HXFA 1TRNA 1C2LA 2Y80A 1ESBA 1P12E 2BTCE 1DUEA 3RXTA 2PWXA 5C1XA 2ODQA 4NIXA 3M35A 1UJ1A 4H42U 1XUGA 5T6FA 2FTLE 3BG8A 3ELAH 1ELEE 1GJ8B 3E1XB 2AEIH 5C1UA 1ELVA 3PYHA 1ZGIA 4A1XA 4YOIA 1CHOG 5GJ4B 3VGCC 1CU1A 4FU8A 4HI3A 3E8LA 2FESH 1DS2E 4X8VH 2ODPA 5IYTA 1HUTH 1AB9B 4KGAA 4MPVA 1TB6H 5JB9S 1UTNA 1QB1A 3BEUA 3AW1A 1TGBA 4E7NA 2FS8A 3ZVBA 1Z8IB 5LGOA 1EP6A 2F3CE 3GDVA 2BD8A 2BMGB 3TNSA 5A8YA 1FPCH 3PWCA 4I7YH 1SSXA 1TALA 1DICA 1EXFA 4YOGA 2VU8E 1RTFB 1J17T 3G01A 1J14A 1OP8A 4X1SU 3MHWU 7GCHG 1FMGA 1J15A 1O0DH 3LONA 3OY5U 1WAYB 2R0LA 3SV2H 2BDBA 4PROA 3T2NA 1HJAB 1GI3A 2XBWA 2FX4A 1GJCB 1V2UT 2QCYA 1GPZA 3LT3A 1C5YB 1LHGH 5FCRA 3RXRA 4R0IA 1B7XB 1OYQA 2SNVA 3RMLH 5L30H 3M5MA 4Q7XA 4GCHG 3Q00A 1KXFA 4BAMB 1IOEA 4KP0A 3SU6A 2BDHA 3SU1A 1H4WA 1NESE 3NUMA 3S7KB 1O3AA 1CA0B 1KDQA 1Q3XA 3UNSA 4ZXXH 1GBFA 1JMOH 1AE8H 5CHAC 1TPAE 2WPIS 1ID5H 2RA0A 2BQWB 1C1RA 5A0AE 3DFJA 1GGDC 5ESTE 2NWNA 5A0CA 1Z8JB 4DIIH 1SGFA 1A5HA 1TA6A 4AOQA 1NFYA 1P8VC 4ZHMU 3E3TA 2FO9A 3H5CB 8LPRA 1HIAB 1PPEE 4ABEA 1XUJA 1JIRA 1T8MA 1P9SA 2J38A 2H2ZA 3EA7A 2H5CA 5EQQA 5J4SA 1GHYH 2PUQH 1IQNA 1BBRE 2PGBB 1K1OA 3SI3H 1UO6A 3EQ0H 1C1MA 1GG6C 1T8OA 4OGXA 1SGNE 2R2MB 2P95A 2UWOA 4DGJA 2GP9B 1IQGA 2GT8A 4D7GA 1ELAA 1ELGA 1TX6A 4MNYA 5PTPA 2ANWA 1ZRKA 2ZKSA 5EQSA 1A3EH 3O8RA 1YM0A 1AI8H 4AX9H 3P70B 1UCYH 3ZVGA 1EPTC 2ZC9H 3KL6A 2BOKA 1D4PB 1HNEE 5F03A 2AGIX 3TK9A 3BIUH 2XC0A 1GJBB 3ODDA 4JMYA 4B1TA 2AGEX 2BDCA 2Y6TA 2ZA5A 3LIWA 1QB9A 1XUFA 5L6NH 2BX4A 2FOAA 1BA8B 5ESBA 4NWLA 1O33A 5LPFA 1KXBA 1SHHB 2FS9A 2AIPA 3MYWA 4O3TA 2IPHA 4AFQA 4UEHH 4B73A 4AFZA 1QGFA 5DP4A 1C5WB 3UQOA 1F0SA 3B23B 4OS1A 4FUGA 3TVJB 2G52A 3VB5A 3H7OA 1GBTA 1WOFA 4BANB 5EPYA 1QL9A 2BD9A 1H9IE 1YCPM 1HJ9A 1GDNA 1O2SA 3L6PA 4NIYA 1O3DA 1P02A 5L2ZH 1Z71A 1EZSC 5AF9H 2PHBA 1SGYE 3SHCH 3SU5A 2G55A 2ZQ2A 3HKIB 1C5OH 1GJ7B 1SFIA 3SO3A 1VCPA 5DO4H 2G81E 1CQQA 4GHTA 1QBVH 1TMBH 1VITF 2FI3E 1HAGE 1FN8A 1MTSA 2ANMH 3NCLA 2C8XB 5T6GA 2GZ8A 1XX9A 1TA2A 2Z9KA 5SGAE 1ELFA 1W13U 1GI6A 5EQRA 1MKXH 1O5DH 5H4IB 3F1SB 3S69A 4U01A 3F9FA 3LU9B 1WQSA 1HGTH 4UD9H 4WMDA 2F9NA 2ZFTA 3UREA 3ESTA 3T62A 1AZZA 1XKAC 1O3HA 4K5ZA 1A46H 4K69A 3RXKA 4CR5A 4KTCA 5K7RA 1CGIE 3TH3H 3URDA 3RMOH 2XXLA 2Q1JA 4MVNA 4BAKB 2OC1A 2AMQA 2UUYA 4TWYA 4JCNA 1P2OA 3SUDA 1MQ6A 1DLKB 2CF9H 3BTWE 3GY3A 2WPLS 1S0RA 4AN7A 2ZTXA 1W0ZU 5DK1A 4IMQA 1F5RA 3A7ZA 3FP8E 3U1IB 4FUCA 1N8OC 2XC4A 1TQ0B 4NA8A 4WXVA 2CHAB 2FOBA 4CRBA 2WPJS 3A7VA 3GYMA 2A1DB 3PMAB 4IN2A 5IDKA 1OWKA 1ANCA 1BITA 1GBHA 1O2GH 1SHYA 1TGNA 1V2OT 4LK4A 3DT0H 3K6ZA 1N8OB 2PR3A 4YT7H 1LHCH 1O3OA 8KME2 4YM9A 2BDGA 3NZIA 2XYAA 1CA0C 4AFSA 1UTMA 2RG3A 3HK6B 2Y5GA 1YPGH 1SOTA 1TOCB 2OP9A 4ZKRU 1GHBG 1JRTA 2C8WB 1Y3VA 3A80A 1QJ7B 8ESTE 3KN2A 1Y5AT 1PYTC 1DFPA 3EDXB 3O8CA 1Y8TA 3BTHE 5GDSH 1F0TA 2IN2A 2CV3A 3QZQA 3UNRA 3SJ9A 4ZROA 1QJ1B 1P05A 2AS9A 2G8TA 1P3CA 1FIWA 3PTNA 3TJOA 1NPMA 3C1KA 3ZZ4A 1BMAA 3ZVEA 1CGJE 3M5LA 3SOSA 2XCNA 5AFZH 2LPRA 3ZYDA 1NS3A 1O2IA 1HLTH 1CT2E 1F7ZA 1U6QA 4X6OA 1SGEE 1XVOA 3TGIE 1GCDA 4A1VA 3SHAH 3BF6H 5BRRE 2XBXA 1Q2WA 1C2HA 4FUFA 1AFQC 1MD8A 1NZQH 1GBCA 1SGFG 1OSSA 5CHAB 1S81A 4Y6DA 1WQVH 1BMLA 1FXYA 1SG8B 1HAXB 3UNQA 3RXLA 2P3FH 3GY8A 2ZDMA 1LVMA 3VGCB 4DW2U 2WV5A 3BTEE 4CRCA 2J2UA 5EODA 1S83A 1Q31A 4IGDA 2STAE 1G36A 2ZTYA 1G30B 1T4UH 1LHDH 5E0HA 2BDIA 2BM2A 1QQ4A 2FZZA 2ZDLA 2FWWA 1BRAA 2AERH 4MPWA 4YESB 2ZGCA 3SU2A 3JZ1B 3LGIA 3BEIB 5GPIB 1TRYA 1WTGH 2OD3B 3K6YA 1C1TA 4H6TA 1TPPA 1Z8GA 2FI4E 1GVZA 1IAUA 2FPZA 3MNSA 4IC6A 4OS6A 3VPKA 1VITH 8GCHF 4A92A 2Z9JA 2OLGA 4RKJB 1FJSA 1SQTA 1O3JA 3KNXA 2ZU3A 1CHGA 3SGQE 2XTTB 1BTZA 5I25A 1G2MA 2BB4A 1THRH 3LPRA 1MAYA 5DP5A 1MUEB 3F68H 2Y81A 4GVUA 2FLRH 2FOCA 5F6MA 2AMDA 1YBWA 3BTME 1NFWA 3MH5A 3V3MA 4ISNA 3KGPA 4JYTA 1QNJA 1YC0A 3A86A 3P8OA 4YOJA 5HYOA 4CR9A 1Z8RA 2PV9B 4F4OC 1T8NA 1AU8A 1K22H 3U8TH 1SGIB 2QAAA 3O8BA 2Y82A 3Q3XA 3UOUA 1FV9A 1O3MA 3A7YA 4UE7H 5GXPA 9LPRA 1RD3B 1BMNH 3MU8A 2QV1A 3RDZA 2OUAA 4NZQA 2V0BA 1SVPA 2QN5T 2G5NA 3HK3B 1S82A 4ZKSU 1P06A 1Z7KA 4K3JA 5DG6A 1RTKA 2D2DA 5JYIA 3DUXH 1JBUH 1TBQH 3RXVA 4FVBA 2Y7XA 2BY8X 1G3DA 3MFJA 3U69H 4IN1A 1CBWB 1AVWA 3QGNB 2VIPA 3RC5A 3PTBA 2OTVA 2CN0H 1V2NT 3V13A 5FBEA 3AAVA 2A4QA 1MKXK 6GCHG 1TX8A 1YPHE 1N6XA 1ELCA 3TLOA 1GL1A 4ABAA 3RM2H 1FLEE 1LVBA 1EUFA 3F9HA 2AIQA 2Y7ZA 5L2YH 3LGVA 5E0GA 3GYLB 1ETTH 1L1NA 3D23A 4AYVB 1G37A 1IQEA 3FFGA 1TNJA 3TJVA 3GCTG 3ZZBA 1HAHH 2CGAA 2GTBA 3TK6A 2FMJA 1A2CH 1NM6A 1C1NA 2A4GA 2G5VA 3ZZ6A 1LKAA 2NU1E 3EGKH 1HJ8A 1UVTH 2FLBH 3LGTA 2ZQ1A 1HBTH 1FY3A 4GLYA 2ZCKP 1EOJA 3O8DA 1XUIA 2O8UA 1GI9B 4X1PU 3Q77A 1GI4A 4BXWA 1FDPA 6GCHF 1TRMA 1TPOA 1CE5A 3M61U 4I8HA 1O2LA 2ZEBA 2IJOB 1MTVA 1BZXE 1DDJA 1TMUH 4OS7A 4BOHA 3CP7A 1OXGA 4FU7A 1EAUA 1C5TA 1DX5M 2F9BH 2SGEE 1TLDA 5EXLA 2GCHG 5EPNA 4KKDA 5JBAS 4UONA 4I33A 2HNTC 1BRBE 4K1EA 2P94A 5TCCA 3RUOA 1VCQA 2A7JA 1Z1IA 4CRFA 1SQAA 3QWCH 1PQ5A 1EAIA 4MDSA 2ODYB 4ZAEA 5DP7A 4Z6AH 1H1BA 4CRDA 1TYNA 3UWJH 1C9PA 1ARBA 1CA8B 1KTSB 1PYTD 2QA9E 2J94A 4X2WA 3SW2B 5FHTA 1P2JA 2R3YA 2VIVA 2JH6D 3TK5A 3S7HB 1K28D 3VB3A 1IQKA 1TGTA 4IBLH 5E2OA 1TPSA 1PPGE 1SFQB 2QXJA 1YYY1 1AVXA 4IW4E 1F0UA 1G2LA 3L33A 2F9PA 2H6MA 2ZHQH 3PLBA 2JH5D 3FZZA 1BMMH 1GJAB 7LPRA 4B74A 3EE0B 1ACBE 1C5ZB 3JZ2B 3BTFE 1WSSH 1QB6A 3FVFB 3SJKA 1G3EA 3GDUA 3A83A 3F9GA 2PKAB 1IQMA 3TNTA 4Q2KA 2DE9A 2UWLA 1NU9A 2BZAA 3MH6A 1O2RA 3PLKA 2ZU2A 4Y7AA 3RLYH 2Z9LA 1BTXA 1UTQA 1FAXA 1BUIA 1FZZA 1GMHG 1GMCG 4Y76A 3VB6A 2VVVA 2Q6DA 3URCA 1Z6JH 2FI5E 4I8JA 4CH2B 1GHAF 1KSNA 1BCUH 1EX3A 2WYJA 3HGPA 1DLEA 5JDUB 3E6PH 2ZFRH 2A7HA 1K1LA 2ZDKA 3BTGE 1GJ4H 1AFQB 1C9TA 3ZYEA 1O2ZA 1V2TT 3GY7A 2XWAA 1ANBA 2HNTF 1EZUC 3KIDU 2ZFFH 1O2TA 2G51A 1V2RT 4ABJA 1TMTH 1A0JA 1EPTB 3LGYA 2WYGA 5C67A 1MKWK 2JKHA 2TRMA 4A5TS 1Y59T 1Y3WA 2P93A 1NROH 1C5LH 1P2NA 2C90B 4ZHAA 1XVMA 3SUEA 3BN9A 4D9RA 4DCDA 4F49A 1GMDF 3ODFA 4Y8YA 2H9HA 1O3FA 2AH4X 1F0RA 1BQYA 2J4IA 3RXFA 1TNGA 1P57B 2FDAA 1S84A 1YGCH 4LZ4B 2FODA 4WMFA 3ATWA 5J4QA 4E7RG 1C2JA 3GDSA 1O30A 4AB8A 3RXDA 1GWAA 2ZPSA 3LKWA 1MQ5A 3TJUA 1E36B 2VIOA 2ZGJA 1NRNH 4OS2A 3SNDA 2M5TA 1ZHMA 2PW8H 1L1GA 2FOHA 5DJ7A 1BJUA 1C5SA 1WCZA 3RXMA 3B8JA 1DM4B 3GOVB 1D3PB 3DHKH 4X2YA 1CHOF 4TPIZ 1CO7E 3SJOA 1Z1JA 2ESTE 3MO3A 3UIRA 1BOQA 1QBNA 3AVZA 4Q7YA 3SUFA 4DVAU 5EXMA 1GDQA 3SV6A 4INLA 1ZSJA 4LXBH 2YNBA 2V3HH 3B9FH 5F8ZA 2W7SA 1A61H 1EOLA 2C3SA 3QLPH 4O03A 3RC6A 2HLCA 2Z3DA 4X6MA 1A7SA 3M3VA 3TH2H 4CRAA 2BDYA 1TOMH 5GCHG 3MOCA 1HIAA 2IOTA 3KCGH 4XFQA 4ABFA 3PLPA 2H9TH 4A1TA 1ANEA 1D3DB 2O8MA 4RSPA 4I8LA 1O37A 3UTUH 1LQDB 4XBCA 3BSQA 1P09A 1RS0A 4O3UA 3GY2A 1WV7H 2O8TA 1LMWB 1K21H 2GCTC 3SV9A 1AD8H 1S6FA 5AVDA 4FUIA 1TFXA 4ABDA 4SGBE 1HAZB 4WXIA 1VJ9U 1GBBA 5E2PA 3TJNA 1FY8E 3ZZCA 2H5DA 1W2KH 1KTTB 4HTCH 4RKOB 3RU4T 2P16A 1LDTT 3SU3A 5EGMA 2FIRH 1CBWC 2BD3A 3ATIA 1P3EA 1KIGH 1TABE 3GCOA 4Y8ZA 1GI8B 5EOKA 1V2ST 1VJAU 1KXCA 1IQHA 4VGCB 1ELDE 5GCHF 4DY7B 1G32B 3A87A 4AGKA 1OWHA 3UY9A 1AY6H 1J8AA 1DUAA 1JOUB 1GCTC 5K0HA 4TWWA 4JZDH 1DITH 1K1PA 2BVRH 4Q7ZA 2GMTB 2W7UA 1GBKA 4JK6A 2HPPH 1BHXF 2B5TB 3UWIA 5DPAA 3T28A 2BQ7B 1ARCA 1IQLA 1O2XA 4HZHA 4DOQA 1LPGB 1ELBA 3DA9B 3ZZ7A 1S0QA 2FTMA 3Q3YA 2ZGHA 2ZTZA 1DY8A 1THSH 1BHXB 1P2MA 1P2IA 2GZ9A 1BJVA 1O5FH 2ZU5A 3V7TA 4XDEA 4YTAA 1SGTA 3F9EA 4JYVH 3PMHB 1SGRE 4CHAC 5EG4A 3K65B 4NWKA 7KMEH 1VGCC 1ZJKA 2FEQH 5FAHA 3MU1A 1GI7B 3LC3A 1NRQH 3GISB 1QRWA 2C8YB 2HRVA 4UFDH 1BTUA 2YOLA 3L3TA 3LH1A 4X2XA 5DP6A 5EW1H 2GCHF 4UDWH 1UVOA 1W14U 5C3NA 3U8OH 1E0FD 1C5RA 4K8YA 1ORFA 1TIOA 1WU1A 1W0YH 2Y5FA 3FZDA 5BPEA 1JRSA 5DP3A 1LQEA 2BD2A 3TGJE 1HAOH 1O2MA 3BEFB 1MAXA 1EAXA 3ZZDA 5FX6A 3VB7A 3A8BA 1W10U 2BQ6B 1O3LA 1TQ7B 1S5SA 1O5CB 1EAWA 2R3UA 1FN6A 1TX7A 4X6NA 1C1UH 4TPYA 1O2JA 1O2PA 2A0QB 2ZNKH 2GMTC 4D7FA 1ESTA 2HVXA 1SGDE 3SI4H 3SJ8A 1Y3UA 2A5IA 1UVUH 1V2MT 2RDLA 2ZGBH 1W8BH 4XOJA 4ZHLU 4ZMAH 2UWPA 1T4VH 1AHTH 4WF8A 4ZUHA 3A82A 3UQVA 3UR9A 1O3EA 2J34A 1CT0E 3ZV8A 1TBRH 1NY22 1PFXC 5A09A 5A2MH 1GVLA 4UFGH 3KHVA 3BG4C 2DUCA 1ZOMA 1O3PB 1SI5H 1ZHRA 2AFQB 4A7IB 4M7GA 1UTJA 3SN8A 4XSKU 2W5EA 3TGKE 1FY4A 3KQCA 1BTWA 1WYKA 5LH8A 3ITIA 3M3SA 5C20A 5B6OA 4AG2A 1LTOA 1C5PA 4X8UH 1AKSB 1XM1A 3MNCA 2Z3EA 1LHFH 1QR3E 1EJMA 4SGAE 1SLWB 2ZIQH 1LKBA 4THNH 1K1NA 1GMHF 1C1VH 2HWLB 5I46H 4ISHH 4MPXA 2UUFB 2BOHB 9ESTA 2EA3A 4R8TB 2ZECA 1ZSLA 1SB1H 4I8KA 1GHAG 3U98H 4A6LA 1O3IA 1NTPA 1AWFH 1QFKH 3ZZ5A 2BZ6H 2O8LA 2P8OB 2VH6A 1EP5A 1ZTKA 2THFB 4J2YB 2SNWA 1DXPA 1O2KA 1HXFH 2FXRA 1T32A 1OWIA 4XBDA 3RM0H 3HGNA 2BYAX 1GG6B 3BIVH 1L1JA 1QRXA 3PO1C 3QUMP 1C1WH 3ZVAA 2OC7A 4U30A 3SGBE 1F5LA 4Y10E 1TE0A 1J9CH 3PM3A 1GHZA 4B76A 1P9UA 3QK1A 2WINI 4NIVA 2QXHA 1NFUA 1V2PT 2XCFA 4O97A 1RGQA 1HAPH 2BXUH 1O3GA 2CHAC 2ILNA 3P8FA 5A8XA 3SUGA 3S0NA 3MNBA 1C2MA 1WTHD 2GCTB 5FPYA 1UVSH 1IHTH 3A8CA 1QY6A 3C27B 2OQUA 4Y0ZE 3S9AA 5F8TA 2TPIZ 1FONA 3SV7A 2P3TB 4WH8A 2PTNA 1GBIA 2SGFE 1WUNH 4Y11E 3IITA 1G9IE 5HMAA 3A89A 4B2CA 1UVPA 4MNXA 1ANDA 1A5IA 4VGCC 1DE7H 1DY9A 1F5KU 1B5GH 1ZMNA 4FUJA 2HNTE 2ZHWH 3I78A 3SZNA 4CH8B 2XRCA 4E06H 1AB9C 4ABGA 1BRUP 2OC0A 1O5BB 1YCPK 3LOXA 3SNBA 3TITA 2ZCHP 1SQOA 4WH6A 1YPKH 1LO6A 1AWHB 3I29A 5DKMA 5DP8A 1UCYK 1UMAH 2Z94A 4MG3A 2TIOA 2B9LA 1JWTA 4BAQB 2K1QA 1RTLA 1HAIH 4KTUA 2NU0E 1UHBB 2FP7B 1O2NA 1C2IA 2GDEH 3D49H 4NA9H 4NSYA 6ESTA 3LGUA 2B8OH 3E90B 1NRSH 5G4BA 1C4Y2 3UUZA 1OS8A 2HOBA 3T25A 4YLUA 2BXTH 2ZDAH 4NA7A 1ZLRA 3RU4E 6LPRA 1OX1A 2EI7A 2VNTA 2FOFA 1G3CA 4MTBA 4B75A 1HAYB 2KAIA 2BDAA 4BTIB 1UTOA 1D3TB 3A8DA 2GV6A 2ZI2H 4J1YA 4XE4A 2GV7A 1GBEA 1OYTH 1GHBF 1BRCE 3SGAE 1GJDB 1W11U 2BLWA 3W95A 1C2DA 1QURH 3A84A 1SLXB 2EC9H 3QO6A 4X8SH 4ZXYH 2F83A 1O2HA 2Z7FE 1E34B 2UUJB 2KAIB 1O36A 3RXHA 3ZV9A 1EB2A 8GCHG 2CF8H 1MU8B 3GY4A 2ASUB 2XBVA 1C2KA 2B0FA 4RN6A 1LVYA 2ZGXH 1AZ8A 4BTUB 1AQ7A 3SQHE 3UOPA 2VGCB 6CHAC 1ZZZA 4FU9A 1SGQE 3FANA 1DOJA 1HAVA 1P11E 3A7WA 3SU4A 3I77A 1ELTA 1ZGVA 3P17H 3SU0A 1RRKA 2WUBA 3RXGA 3U8RH 3MU5A 3U1JB 1ZPCA 2I6SA 4YZUA 1YLDA 1VGCB 1KXDA 1LCYA 1GCTB 1N1LA 1NU7B 4GCHF 1H8IH 1YF4A 3M7QA 4FUBA 5F8XA 5FPTA 3IWMA 5GIBA 2VVUA 2NU4E 1RIWC 2PSXA 3KQDA 3K9XB 3VXFH 1MKWH 1ABJH 1K1IA 1O5AB 3LH3A 1MTNC 5TJXA 5JBCS 1NFXA 1D3QB 3A88A 5AFYH 3A7XA 4Z0KA 1O3CA 1SPJA 3PROA 1OWDA 4IC5A 5E0JA 3ZZ9A 2VINA 2BD7A 2VJ1A 1NRRH 3RXCA 2PKAA 3F6UH 3ZZ3A 3CS0A 5DP9A 1HAVB 1ZPZA 2BY9X 4ESTE 3GCHB 2OXSA 2JETC 3EYDA 3SNCA 2BY7X 4I31A 1O5GH 2GD4B 3M3TA 1ZSKA 1PPZA 3SBKA 4DIHH 4ABBA 1W3CA 1QBOA 4ZKOU 4I8GA 1F92A 2A7CA 1YPEH 2A4OA 1XXFA 4ZKNU 4AORA 2V3OH 1W7GH 3GCTF 1AMHA 2J9NA 3AAUA 2D1JA 3PO1B
chains in the Genus database with same CATH superfamily
2SGPE 3CNRA 4NFFA 4KELA 1D6RA 4Y79A 4ABHA 1KYNA 1L4DA 1EZXC 2Z6BD 1TGSZ 2P3UB 1YPMH 1IHSH 3PV4A 4DJZB 1EZQA 3M7UA 1K1JA 4TYDA 3MU4A 2FOMB 4X6PA 2R0KA 5KECA 1XKBC 1W12U 1AUJA 1RIWB 1TBZH 1QJ6B 1AIXH 1GI1A 4FUHA 1ZTJA 1V3XA 2STBE 1DWDH 1HFDA 2GX4A 2A5KA 3SORA 1ZHPA 2ZG0H 3WWBA 2KCAA 4WWYA 1P10A 1CGHA 2VWLA 4DG4A 2ANKH 1KDQB 3CS7A 2ZF0H 3BTTE 1P2KA 3ENSB 3QZRA 1MCVA 1MABB 1Y5BT 2VWNA 1TWXB 3T27A 3TIUA 2ANYA 1L0ZA 3QDZB 1TAWA 2CJIA 1J16A 3T29A 2A5AA 1QRZA 1OKXA 5A0BA 3KEEA 1PQAA 5FX5A 2A45B 1GGDB 3A85A 3EA8A 3ZZ8A 1AUTC 1EPTA 1MMJN 1UK2A 1BBRH 2BY6X 1OWEA 1O2VA 1ZYOA 1VITG 1VR1H 4OGYA 1GJ5H 3MO9A 1X7AC 1O39A 1HB0B 3NKKA 2D26C 5DSFA 3OSYA 4HGCA 1C4V2 2ZFQH 1G3BA 3QN7A 3FKSD 4GAWA 1KXEA 2XWBI 4JZIA 3NWUA 1SC8U 1BIOA 2OBQA 4JK5A 5T3HA 3MNXA 1EASA 2W26A 4B2BA 3VEQB 3SYJA 3LJJA 1K9OE 3SJIA 2TGTA 1C2FA 2ALPA 1MZAA 1EATA 2NU2E 2FM2A 1A0LA 3EA9A 4Y8XA 1C1QA 1S85A 1E38B 2J98B 2ZDVH 5CMXH 3IG6B 1O35A 2TBSA 1TNIA 1GBAA 2C8ZB 4GPGA 1UCYE 5FPSA 3SNAA 2Y5HA 2AMPA 5EJZA 3NK8A 3STIA 1H8ED 1IQIA 1P01A 3UFAA 1FI8A 1DANH 4X1RU 2JH0D 4FVDA 2LNCA 4OS5A 1Y3YA 1Y5UT 1UHBA 1GBDA 1YPLH 1W0KD 1DVAH 2F9VA 2JJ1D 3HPTB 2PGQB 3GCNA 4ISOA 2TGPZ 2I6QA 3P95A 4MNVA 4FXGH 4DURA 1EB1H 1XMNB 1A1RA 4MQAA 2FYRA 4GHQA 4JZEH 3SNEA 1XXDA 3TPIZ 2WUCA 1QA0A 1UK3A 4Y7BA 1V2JT 4BXSA 1DWEH 3GY5A 2V6NA 3HKJB 1TNLA 1ZMLA 1DWCH 2XC5A 1QTFA 1GI5A 2P8OC 1UTPA 1GHVH 3ZZAA 1C1OA 3BTKE 2GT7A 1JXPA 1HJAC 2H9EH 3KQBA 3MMGA 4GSOA 2A32A 2P59A 2QF3A 3RXAA 1DSUA 1C5QA 1MH0A 1V2QT 3FO8D 4IS5A 1RXPA 3RXQA 3M36A 1P0SH 4MNWA 1SLUB 1E35B 1W0JD 3N7OA 2VWOA 2ZZUH 2ZP0H 4O9VA 4TY7A 1FAKH 2PKSC 1P04A 4AGJA 3TH4H 1QL7A 1OP0A 3MU0A 3K2UA 3RXOA 3SQEE 2RA3A 1E37B 3PB1E 1GBMA 4NIWA 3H7TA 5LPEA 3BV9B 2QIQA 5AHGH 1L4ZA 1H8DH 5JBBS 1L2EA 2QXIA 3ZVDA 1DT2A 2HGTH 1HV7A 3PMJA 3VFEA 5F53A 3VXEH 1SR5C 2BY5X 1PPFE 5CHBA 4AFUA 1C5XB 1A3BH 1C2EA 1O2UA 3PMBB 4K1TA 3GY6A 4MLFB 3M7TA 5C5OA 3E0PB 2WPHS 3RLWH 4JZ1A 5HGGA 2QC2A 2A31A 2A4RA 1FNIA 5DGJA 1PJPA 1MTUA 1S6LA 2C4FH 3V0XA 1FUJA 2BD4A 3BTDE 2QGRA 2XW9A 1GBLA 1QCPA 1ETRH 1O3NA 2VB0A 1D9IA 2J92A 4UFEH 5ETXA 4IMZA 1O2QA 4NG9H 3FN8A 2PTCE 2TGAA 1V6DA 1HRTH 4AZ2B 1TONA 3Q3KA 2G4TA 2EY4C 1H9LB 1LPKB 1C2GA 3QGJA 3RXSA 3TU7H 1ESAA 4INKA 4WMEA 2SGAA 1XUHA 1GI0A 1GI2A 1AGJA 3MWIU 2F91A 3KQEA 4XBBA 5HM9A 4WY3A 4ISIH 2G4UA 4MPUA 5TCAA 2Q6GA 1A0HB 4ACBA 3RXPA 5GWZA 1VZQH 2CXVA 2FOEA 1INCA 1AE5A 4U2WA 3STJA 4JYUH 2RCEA 1HPGA 4H6SB 2A2QH 1S6HA 3KF2A 4WVPE 4CREA 1IQFA 1T7CA 1Y3XA 2R9PA 3BG4B 3HATH 2ZCLP 2YMSD 1GMDG 1KY9A 3RMNH 1NRPH 1GHWH 2O8WA 4CHAB 5ABWA 3A8AA 1BBRK 3RC4A 5JB8S 2G00A 2HALA 2RFKC 4UFFH 1K2I1 3RU4D 1TNHA 2ZFPH 4X0WU 3OYPA 2BHGA 1LHEH 3UB0A 2IJD1 4Y0YE 3WWFA 3R3GB 1O5EH 2B7DH 4BAHB 4NCYA 1SGPE 3U9AH 2FX6A 5CE1A 1OOKB 4FUEA 2ZHFH 1O34A 3DD2H 3P92A 4GUXA 4I32A 1C5NH 3P6ZB 1AO5A 1XUKA 3RXEA 1YKTA 2Q6FA 1PPHE 3DCLA 1ZPBA 2VGCC 3SV8A 3SZEA 4D8NA 1VCWA 4K1SA 1PPBH 2TGDA 7GCHF 4WJG2 3E16B 4ISLA 4K8BA 1H9HE 1HDTH 4YLQH 3A81A 2F9UA 2UUKB 2VVCA 1EKBB 1V2WT 3RXBA 2GVFA 2BVSH 3F0OA 4U32A 2SFAA 1B0EA 2NU3E 3P8NA 4HFPB 1EQ9A 3OY6U 2J95A 3R0FA 4ABIA 3D62A 1C5VA 2W3IA 1QIXB 1O2OA 1Z6EA 3W94A 3M5OA 3MO6A 1BTYA 5C1YA 4JZFH 1EJAA 1ETSH 1GBJA 3S9BA 1GJ6A 1K1MA 1MBQA 1MU6B 2ZU4A 2ZPQA 3LGWA 2GKVE 1LVOA 3UPEA 3RXIA 3FP6E 1MZDA 3DFLA 2QF0A 5EJLA 2QY0B 1IQJA 3NPSA 2O9QA 4CBOA 2VWMA 1SLVB 1BDAA 5FL7D 3V12A 1ZMJA 4K2YA 1QQUA 1THPB 1BTHH 1C5MD 2OQ5A 4D76A 3FAOA 3RP2A 1F2SE 4LZ1H 4X2VA 2C93B 4X8TH 2XNIA 2DE8A 2ALVA 2BD5A 2EI8A 1O32A 1W7XH 3PWBA 3OU0A 4CRGA 4NSVA 2VH0A 2ZPRA 1FY5A 4NGAH 1NT1A 2FYQA 2Z3CA 1PQ8A 4AB9A 1FQ3A 2J97A 3ATLA 2F9OA 5FCKA 1AFEH 1E1QD 1ZJDA 2GGVB 4ZCNA 2J5UA 3S9CA 1CVWH 2D8WA 3T5FH 1FY1A 3EAJA 1T31A 3E91A 1C5UA 7ESTE 1GVKB 5FXLA 4YT6H 4KTSA 1PPCE 4Q80A 2ZFSA 3RXUA 3NXPA 1O31A 4K60A 4CBNA 1NN6A 3BTQE 4OS4A 2ZHEH 1O2WA 1WXRA 3ZVFA 1TNKA 1CSOE 4E05H 3OTJE 1UTKA 3QTVH 1DPOA 3OFND 3AASA 3T26A 2BX3A 1WBGB 2BLOA 2W3KA 1KXAA 2GZ7A 2OCVB 2GJGA 2BVXH 1SMFE 2JETB 4QT8C 1C1SA 4ASHA 1D6WA 1ZRBA 2SGDE 1O3BA 3QX5H 5LPRA 1COWD 1MTWA 1C1PA 1YP9A 1TGCA 2VIQA 2QYIA 1QHRB 1O2YA 1NBMD 4X1NU 1O3KA 2BLVA 4FUDA 4BNRA 4B71A 2OC8A 1YPHC 1HCGA 1A5GH 1AVGH 3F2FA 1T8LA 2AGGX 2WPKS 3RXJA 5EW2H 5JPMH 5C2ZA 4B2AA 1MD7A 3GCHC 1DWBH 1N6YA 4TY6A 5C0UA 2EI6A 4AG1A 1KLIH 1NC6A 2WPMS 1GL0E 1YPJH 1MCTA 3P8GA 1DSTA 4INHA 2CK3D 3OX7U 2GDDA 1RJXB 2VIWA 1P2QA 2KR7A 3E0NB 4X1QU 1QL8A 3MH4A 1YCPH 4D9QA 1FX0B 1SL3A 1GDUA 5T6DA 1MTNB 5JBTA 3MI4A 1UTLM 2ZWLH 1OPHB 4AYYB 3LJOA 1MBMA 3WY8A 6CHAB 3ATMA 2OINA 4ASUD 4YO9A 2PFEA 2OBOA 1A4WH 2WV4A 3M5NA 2PUXB 3ATKA 2V35A 1OP2A 1BMFD 1GMCF 3CENA 5FBIA 4Y71A 1SBWA 4B6EA 1HYLA 3RMMH 4NFEA 2HPQH 2PLXA 3LC5A 4H4FA 3D65E 3A7TA 2EEKA 5EU8A 1SGCA 4BAOB 1QA7A 1NO9H 1AKSA 5C5NA 2PKSB 2VIDA 1OWJA 1NBME 2Z9GA 4NZLA 2CMYA 3ZVCA 2QXGA 3AW0A 5EXNA 1BT7A 1KLTA 1ABIH 2ZU1A 3OEED 2ZO3H 1LPZB 1ZR0A 1EJNA 4DT7B 1AN1E 2A2XH 1HXEH 2H1UA 3MH7A 1YLCA 2BLQA 3GICB 1B0FA 1P03A 5A8ZA 1O38A 1GHXH 5HM2A 1RFNA 1FPHH 2SGQE 3Q76A 2Z9IA 3VB4A 1V2LT 3LDXH 2YNAA 2ZDNA 3M37A 2ULLA 3OEHD 2R2WU 1SOZA 3UR6A 1FIZA 2PP6A 1V2VT 1SQRA 3FP7E 1GJ9B 1M9UA 4ZH8A 1BTPA 3QTOH 4LOYH 5E8EH 1ZTLA 1KLJH 1BB0B 1UK4A 2QF4A 4BTTB 1V2KT 1CT4E 1C4U2 2FOGA 3KYFA 1DXWA 2ZHDA 1JIMA 2XBYA 1PQ7A 3MTYA 2PSYA 2AYWA 5HXFA 1TRNA 1C2LA 2Y80A 1ESBA 1P12E 2BTCE 1K0HA 4P02A 1DUEA 3RXTA 2PWXA 5C1XA 2ODQA 4NIXA 3M35A 1UJ1A 4H42U 1XUGA 5T6FA 2FTLE 4XD7D 3BG8A 3ELAH 1ELEE 1GJ8B 3E1XB 2WZQA 2AEIH 5C1UA 1ELVA 3PYHA 1ZGIA 4A1XA 4YOIA 1CHOG 5GJ4B 5IK2D 3VGCC 1CU1A 4FU8A 4HI3A 3E8LA 2FESH 3NRLA 1DS2E 4X8VH 2ODPA 5IYTA 1HUTH 1AB9B 4KGAA 4MPVA 1TB6H 5JB9S 1UTNA 1QB1A 3BEUA 3AW1A 1TGBA 4E7NA 2FS8A 3ZVBA 1Z8IB 5LGOA 3VG8A 1EP6A 2F3CE 3GDVA 2BD8A 2BMGB 3TNSA 5A8YA 1FPCH 3PWCA 4I7YH 4ACAA 1SSXA 1TALA 1DICA 1EXFA 4YOGA 2VU8E 1RTFB 1J17T 3G01A 1J14A 1OP8A 4X1SU 3MHWU 7GCHG 1FMGA 1J15A 1O0DH 3LONA 3OY5U 1WAYB 2R0LA 3SV2H 2BDBA 4PROA 3T2NA 1HJAB 1GI3A 2XBWA 2FX4A 3PV5A 1GJCB 1V2UT 2QCYA 1GPZA 3LT3A 1C5YB 1LHGH 5FCRA 3RXRA 4R0IA 1B7XB 1OYQA 2SNVA 3RMLH 5L30H 3M5MA 4Q7XA 4GCHG 3Q00A 1KXFA 4BAMB 1IOEA 4KP0A 3SU6A 2BDHA 3SU1A 1H4WA 3F2HA 1NESE 3NUMA 3S7KB 1O3AA 1CA0B 1KDQA 1Q3XA 3UNSA 4ZXXH 2IPQX 1GBFA 1JMOH 1AE8H 5CHAC 1TPAE 2WPIS 2KX4A 1ID5H 2RA0A 2BQWB 1C1RA 4P00A 3DFJA 5A0AE 1GGDC 4F55A 5ESTE 2NWNA 5A0CA 1Z8JB 4DIIH 4XRNA 1SGFA 1A5HA 1TA6A 4AOQA 1NFYA 1P8VC 4ZHMU 3E3TA 2FO9A 3H5CB 4M9FA 8LPRA 2LP6A 1HIAB 1PPEE 4ABEA 1XUJA 1JIRA 1T8MA 1P9SA 2J38A 2H2ZA 3EA7A 2H5CA 1H8HD 5EQQA 5J4SA 1GHYH 2PUQH 1IQNA 1BBRE 2PGBB 1K1OA 3SI3H 1UO6A 3EQ0H 1C1MA 1GG6C 1T8OA 4OGXA 1SGNE 2R2MB 2P95A 2UWOA 4DGJA 2GP9B 1IQGA 2GT8A 4D7GA 1ELAA 1ELGA 1TX6A 3DSGA 3N7DA 2QF5A 3KQ5A 4MNYA 5PTPA 2ANWA 3N7EA 1ZRKA 2ZKSA 5EQSA 1A3EH 3O8RA 1YM0A 1AI8H 4AX9H 3P70B 1UCYH 3ZVGA 1EPTC 2ZC9H 3KL6A 2BOKA 1D4PB 1HNEE 5F03A 2AGIX 3TK9A 3BIUH 2XC0A 1GJBB 3ODDA 4JMYA 4B1TA 2AGEX 2BDCA 2Y6TA 2ZA5A 3LIWA 1QB9A 1XUFA 5L6NH 2BX4A 2FOAA 1BA8B 5ESBA 4NWLA 1O33A 5LPFA 1KXBA 1SHHB 2FS9A 2AIPA 3MYWA 2KM0A 4O3TA 2IPHA 4AFQA 4UEHH 4B73A 2J98A 4AFZA 1QGFA 5DP4A 1C5WB 3UQOA 1F0SA 3B23B 4OS1A 4FUGA 3TVJB 5GNDA 4FETA 2G52A 3VB5A 3H7OA 1GBTA 1WOFA 4BANB 5EPYA 1QL9A 2BD9A 1H9IE 1YCPM 1HJ9A 1GDNA 1O2SA 3L6PA 4NIYA 1O3DA 1P02A 5L2ZH 1Z71A 1EZSC 5AF9H 2PHBA 1SGYE 3SHCH 3SU5A 2G55A 2ZQ2A 3HKIB 1C5OH 1GJ7B 1SFIA 4TSFD 3SO3A 1VCPA 5DO4H 2G81E 1CQQA 2V7QD 4GHTA 1QBVH 1TMBH 1VITF 2FI3E 1HAGE 1FN8A 1MTSA 2ANMH 3NCLA 2C8XB 5T6GA 2GZ8A 1XX9A 1TA2A 2Z9KA 5SGAE 1ELFA 1W13U 1GI6A 5EQRA 1MKXH 1O5DH 5H4IB 3F1SB 3S69A 4U01A 3F9FA 5HIZA 3LU9B 1WQSA 1HGTH 4UD9H 4WMDA 2F9NA 2ZFTA 3UREA 3ESTA 3T62A 1AZZA 1XKAC 1O3HA 4K5ZA 1A46H 4K69A 3RXKA 4CR5A 4KTCA 5K7RA 1CGIE 3TH3H 3URDA 3RMOH 2XXLA 2Q1JA 4MVNA 4BAKB 3UAIC 2OC1A 2AMQA 2UUYA 4TWYA 4JCNA 1P2OA 3SUDA 1MQ6A 1DLKB 2CF9H 3BTWE 3GY3A 2WPLS 1S0RA 4AN7A 5DN6D 2ZTXA 1W0ZU 5DK1A 4IMQA 1F5RA 3A7ZA 3FP8E 3U1IB 4FUCA 4FOUC 1N8OC 2XC4A 1TQ0B 4NA8A 4WXVA 2CHAB 2FOBA 4CRBA 2WPJS 3A7VA 3GYMA 2A1DB 3PMAB 4IN2A 5IDKA 1OWKA 1ANCA 1BITA 1GBHA 1O2GH 1SHYA 2WSSD 1TGNA 1V2OT 4LK4A 3DT0H 3K6ZA 1N8OB 3WW7A 1EFRD 2PR3A 4YT7H 1LHCH 1O3OA 8KME2 4YM9A 2BDGA 3NZIA 2XYAA 1CA0C 4AFSA 1UTMA 2RG3A 3HK6B 2Y5GA 1YPGH 1SOTA 1TOCB 2OP9A 4ZKRU 1GHBG 1JRTA 2C8WB 1Y3VA 3A80A 1QJ7B 8ESTE 3KN2A 1Y5AT 1PYTC 1DFPA 3EDXB 3O8CA 1Y8TA 5HIYA 3BTHE 5GDSH 2HLDD 1F0TA 5CDFE 2IN2A 2CV3A 3QZQA 3UNRA 3SJ9A 4ZROA 1UW7A 1QJ1B 1P05A 2AS9A 2G8TA 1P3CA 1FIWA 3PTNA 3TJOA 1NPMA 3C1KA 3ZZ4A 1BMAA 3ZVEA 1CGJE 3M5LA 3SOSA 2XCNA 5AFZH 2LPRA 3ZYDA 1NS3A 3GS9A 1O2IA 1HLTH 1CT2E 1F7ZA 1U6QA 4X6OA 5HKKD 1SGEE 1XVOA 3TGIE 1GCDA 4A1VA 3SHAH 3BF6H 5BRRE 2XBXA 1Q2WA 1C2HA 4FUFA 1AFQC 1MD8A 1NZQH 1GBCA 1SGFG 3H09A 1OSSA 5KEDA 5CHAB 1S81A 4Y6DA 1WQVH 2QE7D 1BMLA 1FXYA 1SG8B 1HAXB 1YWUA 3UNQA 3RXLA 2P3FH 3GY8A 2ZDMA 1LVMA 3VGCB 4DW2U 2WV5A 3BTEE 4CRCA 1E79D 2J2UA 5EODA 1S83A 1Q31A 4IGDA 2STAE 1G36A 4I86A 2ZTYA 1G30B 1T4UH 1LHDH 5E0HA 2BDIA 2BM2A 1QQ4A 2FZZA 2ZDLA 2FWWA 1BRAA 2AERH 4MPWA 4YESB 2ZGCA 3SU2A 3JZ1B 2F43B 3LGIA 3BEIB 5GPIB 1TRYA 1WTGH 2OD3B 3K6YA 3OAAD 1C1TA 4H6TA 1TPPA 1Z8GA 2FI4E 1GVZA 1IAUA 2FPZA 3MNSA 4IC6A 4OS6A 3VPKA 1VITH 8GCHF 2W6ID 4A92A 2Z9JA 2OLGA 4RKJB 1FJSA 1SQTA 1O3JA 3KNXA 2ZU3A 1CHGA 3SGQE 2XTTB 1BTZA 5I25A 1G2MA 2BB4A 1THRH 3LPRA 1MAYA 4HG6A 1MUEB 5DP5A 3F68H 2Y81A 4GVUA 3W1EA 2FLRH 2FOCA 5F6MA 2AMDA 1YBWA 3BTME 1NFWA 3MH5A 3V3MA 3ZIAD 5C94A 4ISNA 3KGPA 4JYTA 1QNJA 1YC0A 3F0PA 3A86A 3P8OA 4YOJA 5HYOA 4CR9A 1Z8RA 2PV9B 4F4OC 1T8NA 1AU8A 1K22H 3U8TH 1SGIB 5EIYA 2QAAA 3O8BA 2Y82A 3Q3XA 3UOUA 1FV9A 1O3MA 3A7YA 4UE7H 5GXPA 9LPRA 1RD3B 1BMNH 3MU8A 2QV1A 3RDZA 2OUAA 4NZQA 2V0BA 1SVPA 2QN5T 2G5NA 3HK3B 1S82A 4ZKSU 1P06A 1Z7KA 4K3JA 5DG6A 1RTKA 2D2DA 5JYIA 3DUXH 1JBUH 1TBQH 3RXVA 4FVBA 2Y7XA 2BY8X 3MQKC 1G3DA 2V3MA 3MFJA 3U69H 4IN1A 1CBWB 1AVWA 3QGNB 2VIPA 3RC5A 3PTBA 2OTVA 2CN0H 1V2NT 3V13A 5FBEA 3AAVA 2A4QA 1MKXK 6GCHG 3EE7A 1TX8A 1YPHE 1N6XA 1ELCA 3TLOA 1GL1A 4ABAA 3RM2H 1FLEE 1LVBA 1EUFA 3F9HA 2AIQA 2Y7ZA 5L2YH 1YLNA 3LGVA 2KCPA 1E1RD 5E0GA 3GYLB 1ETTH 1L1NA 2JIZD 3D23A 4AYVB 1G37A 1IQEA 3FFGA 1TNJA 3TJVA 3GCTG 3ZZBA 1HAHH 2CGAA 2GTBA 3TK6A 2FMJA 1A2CH 1NM6A 1C1NA 2A4GA 2G5VA 3ZZ6A 1LKAA 2NU1E 3EGKH 1HJ8A 1UVTH 2FLBH 3LGTA 4OM9A 2ZQ1A 1HBTH 1FY3A 4GLYA 2ZCKP 1EOJA 3O8DA 1XUIA 2O8UA 1GI9B 2L74A 4X1PU 3Q77A 1GI4A 4BXWA 1FDPA 6GCHF 1TRMA 1TPOA 1CE5A 3M61U 4I8HA 1O2LA 2ZEBA 2IJOB 1MTVA 1BZXE 1DDJA 1TMUH 4OS7A 4BOHA 3CP7A 1OXGA 4FU7A 2EQNA 1EAUA 1C5TA 1DX5M 2F9BH 2SGEE 1TLDA 5EXLA 2GCHG 5EPNA 4KKDA 5JBAS 4UONA 4I33A 2HNTC 1BRBE 3FOAA 4K1EA 2P94A 5TCCA 3RUOA 1VCQA 2A7JA 1Z1IA 4CRFA 1SQAA 3QWCH 1PQ5A 1EAIA 4MDSA 2ODYB 4ZAEA 5DP7A 4Z6AH 1H1BA 4CRDA 1TYNA 3UWJH 1C9PA 1ARBA 1CA8B 1KTSB 1PYTD 2QA9E 2J94A 4X2WA 3SW2B 5FHTA 1P2JA 2R3YA 3F2GA 2VIVA 2JH6D 3TK5A 3S7HB 1K28D 3VB3A 1IQKA 2L6OA 1TGTA 4IBLH 5E2OA 1TPSA 1PPGE 1SFQB 2QXJA 1YYY1 1AVXA 4IW4E 1F0UA 1G2LA 3L33A 2F9PA 2H6MA 2ZHQH 3PLBA 2JH5D 3FZZA 1BMMH 1GJAB 7LPRA 4B74A 3EE0B 1ACBE 1C5ZB 3JZ2B 3BTFE 1WSSH 1QB6A 3FVFB 3SJKA 1G3EA 3GDUA 3A83A 3F9GA 2PKAB 1IQMA 3TNTA 4Q2KA 2DE9A 2UWLA 1NU9A 2BZAA 3MH6A 3OTPA 1O2RA 3PLKA 2ZU2A 4Y7AA 3RLYH 2Z9LA 1BTXA 2KZ4A 1UTQA 1FAXA 1BUIA 1FZZA 1GMHG 1GMCG 4Y76A 3VB6A 2VVVA 2Q6DA 3URCA 1Z6JH 2FI5E 4I8JA 4CH2B 1GHAF 1KSNA 1BCUH 1EX3A 2WYJA 3HGPA 1DLEA 4RT1A 5JDUB 3E6PH 2ZFRH 2A7HA 1K1LA 2ZDKA 3BTGE 1GJ4H 1AFQB 1C9TA 3ZYEA 1O2ZA 1V2TT 3GY7A 2XWAA 1ANBA 2HNTF 1EZUC 3KIDU 2ZFFH 1O2TA 2G51A 1V2RT 4ABJA 1TMTH 1A0JA 1EPTB 3LGYA 2WYGA 5C67A 1MKWK 4AC9A 2JKHA 2TRMA 4A5TS 1Y59T 1Y3WA 2P93A 1NROH 3F3BA 1C5LH 1P2NA 2C90B 3PRBA 4ZHAA 1XVMA 3SUEA 3BN9A 4D9RA 4DCDA 4F49A 1GMDF 1OHHD 3ODFA 4Y8YA 2H9HA 1O3FA 2AH4X 1F0RA 1BQYA 2J4IA 3RXFA 1TNGA 1P57B 2FDAA 1S84A 1YGCH 4LZ4B 2FODA 4TT3D 4WMFA 3ATWA 5J4QA 4E7RG 1C2JA 3GDSA 1O30A 4AB8A 3RXDA 1GWAA 2ZPSA 2WV9A 3LKWA 1MQ5A 3TJUA 1E36B 2VIOA 2ZGJA 1NRNH 4OS2A 3SNDA 2M5TA 1ZHMA 2PW8H 4DT4A 1L1GA 2FOHA 5DJ7A 1BJUA 1C5SA 1WCZA 3RXMA 3B8JA 1DM4B 3GOVB 1D3PB 3DHKH 4X2YA 1CHOF 4TPIZ 1CO7E 3SJOA 1Z1JA 2ESTE 3MO3A 3UIRA 1BOQA 1QBNA 3AVZA 4Q7YA 3SUFA 4DVAU 5EXMA 1GDQA 3SV6A 4INLA 1ZSJA 4LXBH 2YNBA 2V3HH 3B9FH 5F8ZA 2W7SA 1A61H 1EOLA 2C3SA 2WPDD 4O03A 3QLPH 3RC6A 2HLCA 2Z3DA 4X6MA 1A7SA 3M3VA 3TH2H 4CRAA 2BDYA 1TOMH 5GCHG 2KCOA 3MOCA 1HIAA 2IOTA 3KCGH 4XFQA 4ABFA 3PLPA 2H9TH 4A1TA 1ANEA 1D3DB 2O8MA 4RSPA 4I8LA 1O37A 3UTUH 5EJ1A 1LQDB 4XBCA 3BSQA 1P09A 1RS0A 1YY3A 3GY2A 4O3UA 1WV7H 2O8TA 1LMWB 1K21H 2GCTC 3SV9A 1AD8H 1S6FA 5AVDA 4FUIA 1TFXA 4ABDA 4SGBE 1HAZB 4WXIA 1VJ9U 1GBBA 5E2PA 3TJNA 1FY8E 3ZZCA 2H5DA 1W2KH 1KTTB 4HTCH 4RKOB 3RU4T 2P16A 1LDTT 3SU3A 5EGMA 2FIRH 1CBWC 2BD3A 3ATIA 1P3EA 1KIGH 1TABE 3GCOA 4Y8ZA 1GI8B 5EOKA 1V2ST 1VJAU 1KXCA 1IQHA 4VGCB 1ELDE 5GCHF 4DY7B 1G32B 3A87A 4AGKA 1OWHA 3UY9A 1AY6H 1J8AA 1DUAA 1JOUB 1GCTC 5K0HA 4TWWA 4JZDH 1DITH 1K1PA 2BVRH 2KCYA 4Q7ZA 2GMTB 5C0TA 2W7UA 1GBKA 4JK6A 2HPPH 1BHXF 2B5TB 3UWIA 5DPAA 3T28A 2BQ7B 1ARCA 1IQLA 1O2XA 4HZHA 1QZ8A 4DOQA 1LPGB 1ELBA 3DA9B 3ZZ7A 1S0QA 2FTMA 3Q3YA 2ZGHA 2ZTZA 1DY8A 1THSH 1BHXB 1P2MA 3OE7D 1P2IA 2GZ9A 1BJVA 1O5FH 2ZU5A 3V7TA 2JDID 4XDEA 4YTAA 1SGTA 3F9EA 4JYVH 3PMHB 1SGRE 4CHAC 5EG4A 3K65B 4NWKA 7KMEH 1VGCC 1ZJKA 2FEQH 5FAHA 3MU1A 1GI7B 3LC3A 1NRQH 3GISB 1QRWA 2C8YB 2HRVA 4UFDH 1BTUA 2YOLA 3L3TA 3LH1A 4X2XA 5DP6A 5EW1H 2GCHF 1SKYE 4UDWH 1UVOA 1W14U 5C3NA 3U8OH 1E0FD 1C5RA 4K8YA 1ORFA 1TIOA 1WU1A 1W0YH 2Y5FA 3FZDA 5BPEA 1JRSA 5DP3A 1LQEA 2BD2A 3TGJE 1HAOH 1O2MA 3BEFB 2W6JD 1MAXA 1EAXA 3ZZDA 5FX6A 3VB7A 3A8BA 1W10U 2BQ6B 1O3LA 1TQ7B 1S5SA 1O5CB 1EAWA 2R3UA 1FN6A 1TX7A 4X6NA 1C1UH 4TPYA 2XNDD 1O2JA 1O2PA 2A0QB 2ZNKH 2GMTC 4D7FA 1ESTA 2HVXA 1SGDE 3SI4H 3SJ8A 1Y3UA 2A5IA 1UVUH 1V2MT 2RDLA 2ZGBH 1W8BH 4XOJA 4ZHLU 4ZMAH 2UWPA 4Q4LA 1T4VH 1AHTH 4WF8A 4ZUHA 3A82A 3UQVA 3UR9A 1O3EA 2J34A 1CT0E 3ZV8A 1TBRH 1NY22 1PFXC 5A09A 5A2MH 5B6LA 1GVLA 4UFGH 3KHVA 3BG4C 2DUCA 1ZOMA 1O3PB 1SI5H 1ZHRA 2AFQB 4A7IB 4M7GA 1UTJA 3SN8A 4XSKU 2W5EA 3TGKE 1FY4A 3KQCA 1BTWA 1WYKA 5LH8A 3ITIA 3M3SA 5C20A 5B6OA 4AG2A 1LTOA 1C5PA 4X8UH 1AKSB 4B6FA 1XM1A 3MNCA 2Z3EA 1LHFH 1QR3E 1EJMA 4SGAE 1SLWB 2ZIQH 1LKBA 4THNH 1K1NA 1GMHF 1C1VH 2HWLB 5I46H 4ISHH 4MPXA 2UUFB 2BOHB 9ESTA 2EA3A 4R8TB 2ZECA 4F48B 1ZSLA 1SB1H 4I8KA 1GHAG 2XOKD 3U98H 1O3IA 1NTPA 1AWFH 1QFKH 4A6LA 3ZZ5A 2BZ6H 2O8LA 2P8OB 2VH6A 1EP5A 1ZTKA 2THFB 4J2YB 3U28C 2SNWA 1DXPA 1O2KA 1HXFH 2FXRA 1T32A 1OWIA 4XBDA 3RM0H 3HGNA 3PRDA 1VKYA 2BYAX 1GG6B 3BIVH 1L1JA 1QRXA 3PO1C 2JJ2D 3QUMP 1C1WH 3ZVAA 2OC7A 4U30A 3SGBE 1F5LA 4Y10E 1TE0A 1J9CH 3PM3A 1GHZA 4B76A 2VBCA 1P9UA 3QK1A 2WINI 4NIVA 2QXHA 1NFUA 1V2PT 2XCFA 4O97A 1RGQA 1HAPH 2YMSC 3AK5A 2BXUH 2K0QA 1O3GA 2CHAC 2ILNA 3P8FA 5A8XA 3SUGA 3S0NA 2YMSB 5KGOA 3MNBA 1C2MA 2LELA 1WTHD 2GCTB 5FPYA 1UVSH 1IHTH 3A8CA 1QY6A 3C27B 2OQUA 4Y0ZE 3S9AA 5F8TA 2TPIZ 1FONA 3SV7A 2P3TB 4WH8A 2PTNA 1GBIA 2SGFE 1WUNH 4Y11E 3IITA 1G9IE 5HMAA 4RI0A 3A89A 4B2CA 1UVPA 4MNXA 1ANDA 1A5IA 4VGCC 1DE7H 1DY9A 1F5KU 1B5GH 1ZMNA 4FUJA 2HNTE 2ZHWH 3I78A 3SZNA 4YXWD 4CH8B 2XRCA 4E06H 1AB9C 4ABGA 2M2AA 1BRUP 2OC0A 2F4LA 5T1VA 1O5BB 1YCPK 3LOXA 3SNBA 3TITA 3DSPA 2ZCHP 1SQOA 4WH6A 1YPKH 1LO6A 1AWHB 3I29A 5DKMA 5DP8A 1UCYK 1UMAH 2Z94A 4MG3A 2TIOA 2B9LA 2RDEA 1JWTA 4BAQB 2K1QA 1RTLA 1HAIH 4KTUA 2NU0E 1UHBB 2FP7B 1O2NA 1C2IA 2GDEH 3D49H 4NA9H 4NSYA 6ESTA 3LGUA 2B8OH 3E90B 1NRSH 5G4BA 1C4Y2 3KYGA 1OS8A 2HOBA 3T25A 3UUZA 4YLUA 2BXTH 2ZDAH 4NA7A 1ZLRA 3RU4E 6LPRA 1OX1A 2EI7A 2VNTA 5C17A 2FOFA 1G3CA 4MTBA 4B75A 1HAYB 2KAIA 2BDAA 4BTIB 1UTOA 1D3TB 3A8DA 2GV6A 2ZI2H 4J1YA 4XE4A 2GV7A 1GBEA 1OYTH 1GHBF 1BRCE 3N99A 3SGAE 1GJDB 1W11U 2BLWA 3W95A 1C2DA 1QURH 3A84A 1SLXB 2EC9H 3QO6A 4X8SH 4ZXYH 1KMHB 2F83A 1O2HA 2Z7FE 1E34B 2UUJB 2KAIB 1O36A 3RXHA 3ZV9A 1EB2A 8GCHG 2CF8H 1MU8B 3GY4A 2ASUB 2XBVA 1C2KA 3DSOA 2B0FA 4RN6A 2OK5A 1LVYA 2ZGXH 1AZ8A 4BTUB 1AQ7A 3SQHE 3UOPA 2KFWA 2VGCB 6CHAC 1ZZZA 4Z1MD 4FU9A 1SGQE 3FANA 1DOJA 1HAVA 1P11E 3A7WA 3SU4A 3I77A 1ELTA 1ZGVA 3P17H 3SU0A 1RRKA 2WUBA 3RXGA 3U8RH 3MU5A 3U1JB 1ZPCA 4Q63A 2I6SA 4YZUA 1YLDA 1VGCB 1KXDA 1LCYA 2WHXA 1GCTB 1N1LA 1NU7B 4GCHF 2K8IA 1H8IH 1YF4A 3M7QA 4FUBA 2HVYB 5F8XA 5FPTA 3IWMA 5GIBA 2VVUA 2NU4E 1RIWC 2PSXA 3KQDA 3K9XB 3VXFH 1MKWH 1ABJH 1K1IA 1O5AB 3LH3A 1MTNC 5TJXA 5JBCS 1NFXA 1D3QB 3A88A 5AFYH 3A7XA 4Z0KA 1O3CA 1SPJA 3PROA 1OWDA 4IC5A 5E0JA 3ZZ9A 2VINA 2BD7A 2VJ1A 1NRRH 3RXCA 3PV2A 1WDIA 2PKAA 3F6UH 3ZZ3A 3CS0A 5DP9A 1HAVB 1ZPZA 2BY9X 4ESTE 3GCHB 2OXSA 2JETC 3EYDA 3SNCA 2BY7X 4I31A 1O5GH 2AHME 2GD4B 3M3TA 1ZSKA 1PPZA 3SBKA 4DIHH 4ABBA 1W3CA 1QBOA 4ZKOU 4I8GA 1F92A 2A7CA 4RT0A 1YPEH 2A4OA 1XXFA 4ZKNU 4AORA 2V3OH 1W7GH 3GCTF 1AMHA 2J9NA 3AAUA 2D1JA 3PO1B
chains in the Genus database with same CATH topology
2SGPE 4NFFA 4KELA 1D6RA 4Y79A 4ABHA 1KYNA 1L4DA 1EZXC 2Z6BD 1TGSZ 2P3UB 1YPMH 1IHSH 3PV4A 4DJZB 1EZQA 3M7UA 1K1JA 4TYDA 3MU4A 2FOMB 4X6PA 2R0KA 1XKBC 1W12U 1AUJA 1RIWB 1TBZH 1QJ6B 1AIXH 1GI1A 4FUHA 1ZTJA 1V3XA 2STBE 1DWDH 1HFDA 2GX4A 2A5KA 3SORA 1ZHPA 2ZG0H 4WWYA 1P10A 1CGHA 2VWLA 4DG4A 2ANKH 1KDQB 3CS7A 2ZF0H 3BTTE 1P2KA 3ENSB 3QZRA 1MCVA 1Y5BT 2VWNA 1TWXB 3T27A 3TIUA 2ANYA 1L0ZA 3QDZB 1TAWA 2CJIA 1J16A 3T29A 2A5AA 1QRZA 1OKXA 5A0BA 3KEEA 1PQAA 5FX5A 2A45B 1GGDB 3A85A 3EA8A 3ZZ8A 1AUTC 1EPTA 1MMJN 1UK2A 1BBRH 2BY6X 1OWEA 1O2VA 1ZYOA 1VITG 1VR1H 4OGYA 1GJ5H 3MO9A 1X7AC 1O39A 1HB0B 3NKKA 2D26C 3OSYA 4HGCA 1C4V2 2ZFQH 1G3BA 3QN7A 4GAWA 1KXEA 2XWBI 4JZIA 3NWUA 1SC8U 1BIOA 2OBQA 4JK5A 5T3HA 3MNXA 1EASA 2W26A 4B2BA 3VEQB 3LJJA 1K9OE 3SJIA 2TGTA 1C2FA 2ALPA 1MZAA 1EATA 2NU2E 2FM2A 1A0LA 3EA9A 4Y8XA 1C1QA 1S85A 1E38B 2ZDVH 5CMXH 3IG6B 1O35A 2TBSA 1TNIA 1GBAA 2C8ZB 4GPGA 1UCYE 5FPSA 3SNAA 2Y5HA 2AMPA 3NK8A 3STIA 1IQIA 1P01A 3UFAA 1FI8A 1DANH 4X1RU 2JH0D 4FVDA 2LNCA 4OS5A 1Y3YA 1Y5UT 1UHBA 1GBDA 1YPLH 2F9VA 1DVAH 3HPTB 2PGQB 3GCNA 4ISOA 2TGPZ 2I6QA 3P95A 4MNVA 4FXGH 4DURA 1EB1H 1XMNB 1A1RA 4MQAA 2FYRA 4GHQA 4JZEH 3SNEA 1XXDA 3TPIZ 2WUCA 1QA0A 1UK3A 4Y7BA 1V2JT 4BXSA 1DWEH 3GY5A 2V6NA 3HKJB 1TNLA 1ZMLA 1DWCH 2XC5A 1QTFA 1GI5A 2P8OC 1UTPA 1GHVH 3ZZAA 1C1OA 3BTKE 2GT7A 1JXPA 1HJAC 2H9EH 3KQBA 3MMGA 4GSOA 2A32A 2P59A 2QF3A 3RXAA 1DSUA 1C5QA 1MH0A 1V2QT 4IS5A 1RXPA 3RXQA 3M36A 1P0SH 4MNWA 1SLUB 1E35B 3N7OA 2VWOA 2ZZUH 2ZP0H 4O9VA 4TY7A 1FAKH 2PKSC 1P04A 4AGJA 3TH4H 1QL7A 1OP0A 3MU0A 3K2UA 3RXOA 3SQEE 2RA3A 1E37B 3PB1E 1GBMA 4NIWA 3H7TA 5LPEA 3BV9B 2QIQA 5AHGH 1L4ZA 1H8DH 5JBBS 1L2EA 2QXIA 3ZVDA 1DT2A 2HGTH 1HV7A 3PMJA 3VFEA 3VXEH 1SR5C 2BY5X 1PPFE 4AFUA 1C5XB 1A3BH 1C2EA 1O2UA 3PMBB 4K1TA 3GY6A 4MLFB 3M7TA 5C5OA 3E0PB 2WPHS 3RLWH 4JZ1A 5HGGA 2QC2A 2A31A 2A4RA 1FNIA 5DGJA 1PJPA 1MTUA 2C4FH 3V0XA 1FUJA 2BD4A 3BTDE 2QGRA 2XW9A 1GBLA 1QCPA 2VB0A 1ETRH 1O3NA 1D9IA 2J92A 4UFEH 5ETXA 4IMZA 1O2QA 4NG9H 2PTCE 2TGAA 1V6DA 1HRTH 4AZ2B 1TONA 3Q3KA 2G4TA 1H9LB 1LPKB 1C2GA 3QGJA 3RXSA 3TU7H 1ESAA 4INKA 4WMEA 2SGAA 1XUHA 1GI0A 1GI2A 1AGJA 3MWIU 2F91A 3KQEA 4XBBA 5HM9A 4WY3A 4ISIH 2G4UA 4MPUA 5TCAA 2Q6GA 1A0HB 3RXPA 5GWZA 1VZQH 2CXVA 2FOEA 1INCA 1AE5A 4U2WA 3STJA 4JYUH 2RCEA 1HPGA 4H6SB 2A2QH 1S6HA 3KF2A 4WVPE 4CREA 1IQFA 1T7CA 1Y3XA 2R9PA 3BG4B 3HATH 2ZCLP 1GMDG 1KY9A 3RMNH 1NRPH 1GHWH 2O8WA 4CHAB 5ABWA 3A8AA 1BBRK 3RC4A 5JB8S 2G00A 2HALA 4UFFH 1K2I1 3RU4D 1TNHA 2ZFPH 4X0WU 3OYPA 2BHGA 1LHEH 4Y0YE 3R3GB 1O5EH 2B7DH 4BAHB 4NCYA 1SGPE 3U9AH 2FX6A 5CE1A 1OOKB 4FUEA 2ZHFH 1O34A 3DD2H 3P92A 4GUXA 4I32A 1C5NH 3P6ZB 1AO5A 1XUKA 3RXEA 1YKTA 2Q6FA 1PPHE 3SV8A 1ZPBA 2VGCC 7GCHF 4D8NA 1VCWA 4K1SA 1PPBH 2TGDA 4WJG2 3E16B 4ISLA 4K8BA 1H9HE 1HDTH 4YLQH 3A81A 2F9UA 2UUKB 2VVCA 1EKBB 1V2WT 3RXBA 2GVFA 2BVSH 4U32A 2SFAA 1B0EA 2NU3E 3P8NA 4HFPB 1EQ9A 3OY6U 2J95A 3R0FA 4ABIA 3D62A 1C5VA 2W3IA 1QIXB 1O2OA 1Z6EA 3W94A 3M5OA 3MO6A 1BTYA 5C1YA 4JZFH 1EJAA 1ETSH 1GBJA 3S9BA 1GJ6A 1K1MA 1MBQA 1MU6B 2ZU4A 2ZPQA 3LGWA 2GKVE 1LVOA 3UPEA 3RXIA 3FP6E 1MZDA 3DFLA 2QF0A 2QY0B 1IQJA 3NPSA 2O9QA 4CBOA 2VWMA 1SLVB 1BDAA 3V12A 1ZMJA 4K2YA 1QQUA 1THPB 1BTHH 1C5MD 2OQ5A 4D76A 3FAOA 3RP2A 1F2SE 4LZ1H 4X2VA 2C93B 4X8TH 2XNIA 2DE8A 2ALVA 2BD5A 2EI8A 1O32A 1W7XH 3PWBA 3OU0A 4CRGA 4NSVA 2VH0A 2ZPRA 1FY5A 4NGAH 1NT1A 2FYQA 2Z3CA 1PQ8A 4AB9A 1FQ3A 3ATLA 2F9OA 5FCKA 1AFEH 2GGVB 1ZJDA 3S9CA 1CVWH 2D8WA 3T5FH 1FY1A 3EAJA 1T31A 3E91A 1C5UA 7ESTE 1GVKB 5FXLA 4YT6H 4KTSA 1PPCE 4Q80A 2ZFSA 3RXUA 3NXPA 1O31A 4K60A 4CBNA 1NN6A 3BTQE 4OS4A 2ZHEH 1O2WA 3ZVFA 1TNKA 1CSOE 4E05H 3OTJE 1UTKA 3QTVH 1DPOA 3AASA 3T26A 2BX3A 1WBGB 2BLOA 2W3KA 1KXAA 2GZ7A 2OCVB 2BVXH 1SMFE 2JETB 4QT8C 1C1SA 4ASHA 1D6WA 1ZRBA 2SGDE 1O3BA 3QX5H 5LPRA 1MTWA 1C1PA 1YP9A 1TGCA 2VIQA 2QYIA 1QHRB 1O2YA 4X1NU 1O3KA 2BLVA 4FUDA 4BNRA 4B71A 2OC8A 1YPHC 1HCGA 1A5GH 1AVGH 1T8LA 2AGGX 2WPKS 3RXJA 5EW2H 5JPMH 5C2ZA 4B2AA 1MD7A 3GCHC 1DWBH 1N6YA 4TY6A 2EI6A 4AG1A 1KLIH 1NC6A 2WPMS 1GL0E 1YPJH 1MCTA 3P8GA 1DSTA 4INHA 3OX7U 2GDDA 1RJXB 2VIWA 1P2QA 3E0NB 4X1QU 1QL8A 3MH4A 1YCPH 4D9QA 1SL3A 1GDUA 5T6DA 1MTNB 5JBTA 3MI4A 1UTLM 2ZWLH 1OPHB 4AYYB 3LJOA 1MBMA 3WY8A 6CHAB 3ATMA 2OINA 4YO9A 2PFEA 2OBOA 1A4WH 2WV4A 3M5NA 2PUXB 3ATKA 2V35A 1OP2A 1GMCF 3CENA 5FBIA 4Y71A 1SBWA 1HYLA 3RMMH 4NFEA 2HPQH 2PLXA 3LC5A 4H4FA 3D65E 3A7TA 2EEKA 5EU8A 1SGCA 4BAOB 1QA7A 1NO9H 1AKSA 5C5NA 2PKSB 2VIDA 1OWJA 2Z9GA 4NZLA 2CMYA 3ZVCA 2QXGA 3AW0A 5EXNA 1BT7A 1KLTA 1ABIH 2ZU1A 2ZO3H 1LPZB 1ZR0A 1EJNA 4DT7B 1AN1E 2A2XH 1HXEH 2H1UA 3MH7A 1YLCA 2BLQA 3GICB 1B0FA 1P03A 5A8ZA 1O38A 1GHXH 5HM2A 1RFNA 1FPHH 2SGQE 3Q76A 2Z9IA 3VB4A 1V2LT 3LDXH 2YNAA 2ZDNA 3M37A 2ULLA 2R2WU 1SOZA 3UR6A 1FIZA 1V2VT 3FP7E 1GJ9B 1M9UA 4ZH8A 1BTPA 3QTOH 4LOYH 5E8EH 1ZTLA 1KLJH 1BB0B 1UK4A 4BTTB 1V2KT 1CT4E 1C4U2 2FOGA 1DXWA 2ZHDA 1JIMA 2XBYA 1PQ7A 3MTYA 2PSYA 2AYWA 5HXFA 1TRNA 1C2LA 2Y80A 1ESBA 1P12E 2BTCE 1DUEA 3RXTA 2PWXA 5C1XA 2ODQA 4NIXA 3M35A 1UJ1A 4H42U 1XUGA 5T6FA 2FTLE 3BG8A 3ELAH 1ELEE 1GJ8B 3E1XB 2AEIH 5C1UA 1ELVA 3PYHA 1ZGIA 4A1XA 4YOIA 1CHOG 5GJ4B 3VGCC 1CU1A 4FU8A 4HI3A 3E8LA 2FESH 1DS2E 4X8VH 2ODPA 5IYTA 1HUTH 1AB9B 4KGAA 4MPVA 1TB6H 5JB9S 1UTNA 1QB1A 3BEUA 3AW1A 1TGBA 4E7NA 2FS8A 3ZVBA 1Z8IB 5LGOA 1EP6A 2F3CE 3GDVA 2BD8A 2BMGB 3TNSA 5A8YA 1FPCH 3PWCA 4I7YH 1SSXA 1TALA 1DICA 1EXFA 4YOGA 2VU8E 1RTFB 1J17T 3G01A 1J14A 1OP8A 4X1SU 3MHWU 7GCHG 1FMGA 1J15A 1O0DH 3LONA 3OY5U 1WAYB 2R0LA 3SV2H 2BDBA 4PROA 3T2NA 1HJAB 1GI3A 2XBWA 2FX4A 1GJCB 1V2UT 2QCYA 1GPZA 3LT3A 1C5YB 1LHGH 5FCRA 3RXRA 4R0IA 1B7XB 1OYQA 2SNVA 3RMLH 5L30H 3M5MA 4Q7XA 4GCHG 3Q00A 1KXFA 4BAMB 1IOEA 4KP0A 3SU6A 2BDHA 3SU1A 1H4WA 1NESE 3NUMA 3S7KB 1O3AA 1CA0B 1KDQA 1Q3XA 3UNSA 4ZXXH 1GBFA 1JMOH 1AE8H 5CHAC 1TPAE 2WPIS 1ID5H 2RA0A 2BQWB 1C1RA 5A0AE 3DFJA 1GGDC 5ESTE 2NWNA 5A0CA 1Z8JB 4DIIH 1SGFA 1A5HA 1TA6A 4AOQA 1NFYA 1P8VC 4ZHMU 3E3TA 2FO9A 3H5CB 8LPRA 1HIAB 1PPEE 4ABEA 1XUJA 1JIRA 1T8MA 1P9SA 2J38A 2H2ZA 3EA7A 2H5CA 5EQQA 5J4SA 1GHYH 2PUQH 1IQNA 1BBRE 2PGBB 1K1OA 3SI3H 1UO6A 3EQ0H 1C1MA 1GG6C 1T8OA 4OGXA 1SGNE 2R2MB 2P95A 2UWOA 4DGJA 2GP9B 1IQGA 2GT8A 4D7GA 1ELAA 1ELGA 1TX6A 4MNYA 5PTPA 2ANWA 1ZRKA 2ZKSA 5EQSA 1A3EH 3O8RA 1YM0A 1AI8H 4AX9H 3P70B 1UCYH 3ZVGA 1EPTC 2ZC9H 3KL6A 2BOKA 1D4PB 1HNEE 5F03A 2AGIX 3TK9A 3BIUH 2XC0A 1GJBB 3ODDA 4JMYA 4B1TA 2AGEX 2BDCA 2Y6TA 2ZA5A 3LIWA 1QB9A 1XUFA 5L6NH 2BX4A 2FOAA 1BA8B 5ESBA 4NWLA 1O33A 5LPFA 1KXBA 1SHHB 2FS9A 2AIPA 3MYWA 4O3TA 2IPHA 4AFQA 4UEHH 4B73A 4AFZA 1QGFA 5DP4A 1C5WB 3UQOA 1F0SA 3B23B 4OS1A 4FUGA 3TVJB 2G52A 3VB5A 3H7OA 1GBTA 1WOFA 4BANB 5EPYA 1QL9A 2BD9A 1H9IE 1YCPM 1HJ9A 1GDNA 1O2SA 3L6PA 4NIYA 1O3DA 1P02A 5L2ZH 1Z71A 1EZSC 5AF9H 2PHBA 1SGYE 3SHCH 3SU5A 2G55A 2ZQ2A 3HKIB 1C5OH 1GJ7B 1SFIA 3SO3A 1VCPA 5DO4H 2G81E 1CQQA 4GHTA 1QBVH 1TMBH 1VITF 2FI3E 1HAGE 1FN8A 1MTSA 2ANMH 3NCLA 2C8XB 5T6GA 2GZ8A 1XX9A 1TA2A 2Z9KA 5SGAE 1ELFA 1W13U 1GI6A 5EQRA 1MKXH 1O5DH 5H4IB 3F1SB 3S69A 4U01A 3F9FA 3LU9B 1WQSA 1HGTH 4UD9H 4WMDA 2F9NA 2ZFTA 3UREA 3ESTA 3T62A 1AZZA 1XKAC 1O3HA 4K5ZA 1A46H 4K69A 3RXKA 4CR5A 4KTCA 5K7RA 1CGIE 3TH3H 3URDA 3RMOH 2XXLA 2Q1JA 4MVNA 4BAKB 2OC1A 2AMQA 2UUYA 4TWYA 4JCNA 1P2OA 3SUDA 1MQ6A 1DLKB 2CF9H 3BTWE 3GY3A 2WPLS 1S0RA 4AN7A 2ZTXA 1W0ZU 5DK1A 4IMQA 1F5RA 3A7ZA 3FP8E 3U1IB 4FUCA 1N8OC 2XC4A 1TQ0B 4NA8A 4WXVA 2CHAB 2FOBA 4CRBA 2WPJS 3A7VA 3GYMA 2A1DB 3PMAB 4IN2A 5IDKA 1OWKA 1ANCA 1BITA 1GBHA 1O2GH 1SHYA 1TGNA 1V2OT 4LK4A 3DT0H 3K6ZA 1N8OB 2PR3A 4YT7H 1LHCH 1O3OA 8KME2 4YM9A 2BDGA 3NZIA 2XYAA 1CA0C 4AFSA 1UTMA 2RG3A 3HK6B 2Y5GA 1YPGH 1SOTA 1TOCB 2OP9A 4ZKRU 1GHBG 1JRTA 2C8WB 1Y3VA 3A80A 1QJ7B 8ESTE 3KN2A 1Y5AT 1PYTC 1DFPA 3EDXB 3O8CA 1Y8TA 3BTHE 5GDSH 1F0TA 2IN2A 2CV3A 3QZQA 3UNRA 3SJ9A 4ZROA 1QJ1B 1P05A 2AS9A 2G8TA 1P3CA 1FIWA 3PTNA 3TJOA 1NPMA 3C1KA 3ZZ4A 1BMAA 3ZVEA 1CGJE 3M5LA 3SOSA 2XCNA 5AFZH