1VJAU

Urokinase plasminogen activator b-chain-jt463 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords plasminogen activator, urokinase
publication title Design of novel and selective inhibitors of urokinase-type plasminogen activator with improved pharmacokinetic properties for use as antimetastatic agents
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vjaU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vjaU01
4BTUB 4IN2A 2OBOA 1QJ7B 1O2LA 4J1YA 1S0RA 3SUDA 1TMTH 1GBAA 5F03A 1Z6EA 4A6LA 4Q2KA 1TGBA 1DT2A 1HRTH 1UTMA 1JXPA 4FUIA 3SNEA 1HAZB 2WYGA 2XC5A 1K21H 1BTWA 1GL0E 2GT8A 2J4IA 3A86A 2ZI2H 2GZ7A 1YYY1 2BM2A 3A8BA 4UFFH 5HYOA 4UE7H 2XC4A 2GMTB 3TH2H 4I32A 3NK8A 1TWXB 2Z9JA 2OC1A 1QR3E 1BRBE 4X1RU 1KLTA 1KLIH 1QHRB 3UUZA 3ZYDA 1FUJA 1CA0C 1DXPA 1WAYB 1ETRH 1IQLA 4HI3A 2BVRH 2FX6A 2PTCE 1BQYA 1GBMA 2QY0B 3DUXH 3RXVA 4F4OC 4B76A 3BTKE 5C5NA 1FQ3A 1T8LA 2ZDVH 3GY7A 1PQ8A 2A31A 4TPYA 2H5CA 5A8XA 1ZGVA 3K65B 1GCTC 4Y11E 4AFQA 1AUJA 1TLDA 2ZKSA 1QIXB 1O3PB 3Q77A 4CREA 2G5NA 2DE9A 2P8OC 4X6NA 4ZH8A 2AS9A 2ZU2A 5C3NA 4H42U 4FUBA 1FV9A 1SPJA 3EA9A 3P95A 3V12A 2Z6BD 2J2UA 2CXVA 2RG3A 1GBBA 1CGIE 3V0XA 1NU7B 2WPHS 5EGMA 1GI8B 3OYPA 2CF8H 3TK6A 3ZV8A 1HBTH 3V3MA 1G3EA 1HLTH 3OY6U 2J95A 5L2YH 4NA9H 2Z3CA 3MH4A 3SHAH 3EA8A 1V2MT 3E91A 3KQBA 3HATH 1G37A 1NY22 2BY7X 2RDLA 1HB0B 2AIPA 2WPKS 2C8XB 4I8JA 2H2ZA 2KAIB 3SN8A 5EQRA 1NM6A 4AFZA 3FVFB 4ABHA 2Y6TA 2D8WA 2UUJB 1FY4A 1YLCA 3L6PA 1O36A 3A8DA 1DY9A 2TIOA 4OS6A 4U2WA 2Z9KA 1NFYA 5EXMA 4UD9H 1DWCH 3BN9A 4X1PU 5ESTE 2BD5A 1AWFH 1VCPA 4NSVA 1GPZA 4Q80A 5J4QA 2XBYA 4BAHB 3Q3XA 1AE5A 4MDSA 1BMMH 1E0FD 1J15A 1C4U2 1XVMA 3RDZA 4AZ2B 1CT2E 1C2LA 2W26A 3VB4A 2GCTC 5DP9A 2P3TB 3LGUA 2ZTYA 3ZVCA 4X2YA 4LOYH 4MPUA 3EGKH 1KDQB 1BHXB 3URCA 4UDWH 5HM9A 1LVBA 2ZDLA 3M5LA 3TJVA 5FPYA 1KXAA 1GG6B 1Y3XA 4YZUA 1GBKA 3QX5H 8GCHG 5T6GA 1Y5BT 1W10U 1JBUH 2ZPQA 4ABBA 3SUGA 1Y5UT 5DKMA 4JZDH 1FLEE 1S84A 1MZAA 4CBNA 2STBE 1V6DA 1EJMA 1QNJA 1O3KA 2ZTZA 1O2SA 1BJVA 2Z3EA 1O31A 1K9OE 2ALVA 4DIIH 1OP0A 4NIXA 3SGAE 1K1LA 2ZFPH 4WH6A 3PTNA 3NPSA 1P2QA 5EW1H 4X6PA 3RMLH 3S7HB 2GMTC 3KQEA 1EZUC 1HAVA 2G55A 2QXHA 4YOGA 4R0IA 1BTHH 1Z8GA 5IDKA 2VU8E 1O5EH 5GDSH 4B1TA 4INLA 1DWEH 1TPAE 1ZPZA 1FN8A 3DA9B 1W13U 1V2RT 4XE4A 2BTCE 1TX7A 2J34A 1GBDA 2FLBH 3U1IB 1S0QA 3B9FH 1SBWA 2G00A 1A5GH 3SI3H 1AZZA 3M5MA 5DP4A 5E0HA 3ZVEA 2WPLS 2A7CA 1BJUA 2G8TA 4ABFA 2JH0D 1Y5AT 3T26A 3GCOA 4ISHH 2C90B 2SGEE 2JH6D 4RKOB 2H9EH 2YOLA 2QXIA 1QRXA 2D26C 3S69A 1TBQH 1C2DA 2P3UB 3PMAB 1O3IA 1NN6A 5EQQA 3U98H 1ESBA 1OOKB 3DHKH 3GCNA 5FCKA 4ZAEA 3UWIA 3PLPA 3PLBA 4ZHLU 4Z6AH 3GCHC 2OP9A 1U6QA 1ELAA 2PKAA 2AMPA 1G3BA 4MLFB 1K1MA 1T31A 2TBSA 1HAGE 1XUJA 3A82A 2OBQA 2FESH 4BTTB 3ATIA 2FOHA 1GMDG 3KCGH 2PR3A 4CRDA 3FZZA 3RUOA 3VB3A 1BTYA 1CGHA 4ZXXH 1O0DH 1O3MA 3KQCA 5K0HA 3RXSA 1GJCB 1OP2A 1O2OA 2SNWA 3A8AA 2ZDAH 5DG6A 1HAOH 2VVCA 4ABJA 4OS4A 5ESBA 1YPGH 1C9PA 4JZEH 2W7UA 4YESB 3TJUA 1DM4B 1OWKA 1CBWC 1RTLA 4GLYA 2GCHG 1F2SE 3SBKA 1G36A 1DDJA 2RA3A 3ZV9A 1GMCG 1O3FA 1XKBC 1KLJH 1ESAA 1WOFA 3LGWA 3VGCB 2FMJA 3AAVA 3LONA 4Y6DA 1A2CH 1GGDB 5FX6A 4INKA 1SGFA 3KIDU 1YPJH 1G32B 1UTPA 2AYWA 1ARBA 1GG6C 3RXIA 2Q6DA 1GVZA 2BX3A 3SV2H 3OSYA 1HIAA 3TH4H 7KMEH 1XM1A 1O5BB 1GJAB 2WV4A 3PWCA 1EOJA 2J9NA 1E34B 2D1JA 4GPGA 3MU8A 3SNDA 4CBOA 1FY1A 2ANWA 4B2BA 2ZZUH 1S5SA 2FTLE 1GI2A 3A85A 3ZZDA 3F68H 4GVUA 1GDUA 1O5AB 1GBFA 3I29A 4YOIA 1V2ST 2BVXH 2Y80A 1TX8A 1VITF 1A5IA 4ISOA 1HDTH 2OUAA 1GI3A 2FP7B 1UTLM 2GDDA 2FOAA 1OX1A 1ZZZA 4ABDA 4FUCA 1TNGA 1YPMH 2A4QA 2GTBA 1UHBA 1C5SA 2SNVA 3PM3A 3T25A 1RGQA 4GCHF 1OPHB 2VH0A 1NROH 1HXFH 3L33A 4NSYA 2B9LA 4Y8ZA 1XX9A 1MZDA 2ZECA 1P0SH 1ZGIA 3TPIZ 1FY5A 1THSH 3U9AH 1PPBH 1J9CH 1QY6A 3PMHB 1SHYA 1V2OT 1BMNH 1X7AC 3EYDA 5FXLA 1G30B 2Y7XA 3SU3A 3VXEH 2F9NA 4WWYA 2ANMH 1ACBE 1GL1A 3BSQA 3Q3YA 1UK3A 2VIOA 2ZCHP 2BY5X 2P16A 2PLXA 4IW4E 1GHBG 1C1RA 1W0ZU 5JB9S 3RXLA 1SFQB 3TLOA 4BTIB 4CRAA 1SGTA 2FOBA 1LHFH 1IAUA 2TGTA 4BAMB 5L6NH 1UK2A 1P01A 5DGJA 1QBOA 3RMOH 4ISNA 4TY6A 3Q76A 1Y3UA 2UUFB 5JBTA 2HNTC 2H9TH 1VITG 3HPTB 4X2VA 1T32A 5LH8A 1ZJDA 4OS5A 5DP5A 2Y5GA 7ESTE 3W95A 1TMBH 3EAJA 3SQEE 1C5TA 2R2MB 3E0PB 3O8CA 2BD8A 1XVOA 4GHTA 4H6SB 1O34A 3S9AA 1ZSLA 1TGNA 2M5TA 2CHAB 4BXSA 1TGTA 1EOLA 2TPIZ 1C4Y2 4YT6H 4X6MA 1TOMH 1C2EA 4CHAB 3JZ1B 4JYVH 3SU5A 1ANEA 4IBLH 5HGGA 2BX4A 3F1SB 1C2JA 5HXFA 2P3FH 1C1NA 2ZU5A 1ZHPA 4K8YA 1CA0B 2FOMB 1D9IA 1GI9B 1ETSH 2VWMA 1AHTH 4NFFA 1PPEE 2XNIA 1YM0A 2HGTH 3M37A 3TNTA 4DVAU 1DUAA 1V2QT 1H8IH 2QXJA 1EP5A 5EPNA 3QGJA 1L1GA 2Q6FA 1GGDC 1PPZA 2ZHWH 4CRCA 2OINA 1IQKA 2PGQB 1MQ5A 2IPHA 5GWZA 4I8KA 1KTTB 1WTHD 2P8OB 1EZXC 2ULLA 5A8YA 4Q7YA 1PPCE 3UY9A 1NRPH 1BITA 3UR6A 1VJ9U 2CN0H 1GVKB 1JOUB 2H5DA 3LT3A 1AUTC 3FANA 3NXPA 2ZU3A 1KSNA 2SGPE 4FUGA 1S6HA 4X0WU 5BRRE 1IQJA 1YPEH 3ESTA 3M36A 5FPSA 1GI5A 1NTPA 1XUGA 4BAQB 1THPB 2A5IA 1FI8A 3HKIB 2A32A 4K1SA 2EI7A 2A0QB 3ZZ6A 1V2UT 2ZGCA 1UVTH 1JWTA 1QA7A 4MPWA 2XCFA 1IQNA 1A7SA 4JYTA 1IQFA 1OWIA 3SJ8A 1NT1A 1MAXA 1GWAA 1V2PT 2F9OA 3LOXA 1V2NT 2J94A 3KGPA 1C5NH 4I8LA 4DT7B 1AVWA 1KXBA 1MKXK 1O38A 1C5XB 1EQ9A 1RS0A 1GBJA 3GDVA 2WUCA 4Q7XA 3QDZB 4E05H 3TVJB 4H6TA 4Y76A 3AW1A 1C5VA 1LPKB 2EI6A 1GI6A 3A7ZA 2GT7A 3MI4A 4YLQH 2ZG0H 3P8GA 2BZAA 1TABE 1C1VH 2CJIA 3G01A 3U69H 1LHCH 4CRGA 1HAYB 3TH3H 1OWHA 2ZC9H 3RU4D 2STAE 3KNXA 3RC6A 1LO6A 1OYQA 2VVUA 5JDUB 1MCTA 1TPOA 3BTHE 1KY9A 1HV7A 1UTOA 1WQVH 5DP7A 4LZ4B 1XXDA 1Z7KA 1HUTH 3FP8E 1QTFA 2TGPZ 3SUEA 1CT4E 2CHAC 1DS2E 2XRCA 5G4BA 3SNAA 3ZVDA 1PPGE 1UVPA 2ODPA 4IC5A 3TIUA 1DLEA 2Z9LA 4CHAC 1C2MA 5DP3A 1EAIA 1GBIA 2GV7A 1GI4A 3PROA 1KYNA 2CF9H 3BTWE 5H4IB 1L1JA 4K1EA 1ABIH 2FOCA 2WINI 1A1RA 2ZEBA 5EPYA 1PQ5A 1GHVH 3RMMH 2ZQ1A 1O3BA 1Z1JA 9ESTA 1D3DB 1O3HA 3CS0A 2A4OA 4OS1A 2VGCB 5TCCA 2G4TA 1SLVB 3FZDA 3RXPA 4X8VH 1WBGB 1GJ4H 2FI5E 1SGCA 4MNYA 4X8UH 4E7RG 3KF2A 3BTQE 2SGAA 5CMXH 3BG4B 5JB8S 4LK4A 1LHDH 2BLVA 3P8NA 3Q00A 1S82A 1SGPE 2PGBB 2QN5T 1QB1A 2PKAB 4BOHA 1P2IA 4NA7A 2BDGA 2BDAA 1GJ9B 4NG9H 2F9VA 3RXMA 1DPOA 1B7XB 2A2QH 2ZGHA 6LPRA 8GCHF 1QBVH 3GCHB 1NS3A 5C1YA 2A4RA 2ZPRA 3BF6H 2UWLA 2XBWA 1ZRBA 2VJ1A 2ZFQH 3LGVA 1EPTC 1TOCB 4INHA 5TCAA 1G3DA 1ANCA 2BXUH 1EZQA 1T4UH 8LPRA 1P3CA 4FU9A 1C2KA 1OP8A 1Z6JH 3U1JB 2AMQA 1UCYK 1QGFA 2VIPA 1L4DA 2OTVA 1H9HE 4UONA 1ANBA 4OGYA 1TYNA 1EPTA 1K22H 1SC8U 3R0FA 4WF8A 4D9RA 1UTQA 5GJ4B 3MHWU 1EJNA 1F0TA 1HAIH 1Z8RA 2A4GA 3LDXH 1ZSJA 4H4FA 1Z8JB 1C1TA 1CHGA 1YPHC 1ZSKA 4NA8A 3LC5A 1FJSA 1ELTA 3SNBA 1SOTA 1XKAC 2NWNA 3S0NA 1CBWB 1GHWH 2Y81A 1HIAB 2ALPA 3MU0A 1LKAA 2FWWA 3A7WA 1YPHE 4YT7H 3CS7A 4GUXA 3RXRA 1WCZA 1HJ8A 2NU3E 2VNTA 1A4WH 2EI8A 1Z71A 1AKSA 4CRFA 1O2WA 1CVWH 1P11E 1O39A 3SORA 1SLUB 1HAHH 4U32A 4HTCH 1QL8A 3DFJA 1S81A 4GAWA 1OS8A 2G81E 3CP7A 2FXRA 1YBWA 2BXTH 1O2NA 3E0NB 5J4SA 1NU9A 1BCUH 1NFWA 1QURH 2QF0A 1BTPA 5EODA 1ELBA 1UHBB 4AORA 1O2TA 1JRSA 3OU0A 5AFZH 2BLQA 3PLKA 3RXBA 3TK9A 1QQUA 1XXFA 1AMHA 2FM2A 3VEQB 4HFPB 1QJ6B 4MPXA 3MOCA 2PTNA 4ZMAH 5I46H 1SG8B 1G9IE 5DP6A 1O35A 3KL6A 5CHAB 1O5DH 1BUIA 2EA3A 2FIRH 1PJPA 1DLKB 4OGXA 1YLDA 1V2KT 3AASA 4TY7A 5FPTA 2PFEA 5F8TA 1O5GH 4SGBE 1GHAG 1MTSA 1GMDF 1V2TT 3M3TA 1P03A 2XC0A 1NO9H 3UOUA 3GY2A 1ELFA 4NFEA 1UCYE 3QTOH 1J17T 2BY8X 3M5NA 1O3AA 3ATLA 1NC6A 1WYKA 5E8EH 2CMYA 4I33A 2BQWB 2VGCC 1P05A 2VB0A 1BRCE 4Y7BA 1MBMA 3FFGA 1NFUA 3RMNH 2F9UA 4ASHA 1ELDE 1PPHE 1E36B 1T8OA 1ZHMA 3UQVA 1D6RA 1MTVA 2JKHA 3BG4C 3GY4A 1L4ZA 2OD3B 1BHXF 2ZHEH 1OWEA 4O9VA 2GCHF 4X1SU 3GYMA 1ELEE 3F9GA 5ETXA 3V7TA 3S9CA 3FP6E 2ZWLH 1UTNA 1GMCF 1O2QA 2K1QA 2PUQH 2QGRA 3MH5A 4NWLA 4TYDA 3RP2A 4A1XA 4K60A 3ZZ7A 3ZZBA 4WY3A 3S7KB 3O8BA 2C8WB 1A5HA 4THNH 2ZPSA 2ZFRH 1D3TB 2UWPA 1P04A 4AYYB 1Y59T 4X8TH 1AFQC 1ZOMA 1FXYA 1YC0A 1EATA 3H7OA 1MMJN 1ELGA 1CHOG 4FXGH 4BAOB 1P3EA 1TX6A 1G2LA 6GCHG 3PO1C 1C1MA 4WMDA 4K5ZA 1SQTA 1SGDE 1PFXC 3ELAH 1RXPA 1AU8A 2W3IA 1CGJE 1L1NA 1AB9B 2WYJA 2ZDNA 3I77A 4O3UA 2FDAA 4AG2A 1SB1H 5C67A 1AIXH 1C5WB 1EAUA 2VIQA 3UWJH 2XCNA 1D3QB 2G51A 4AGJA 4A92A 1SGFG 2P59A 4JZFH 4D76A 5LPRA 3PMJA 5AF9H 1AD8H 3VFEA 2AGIX 4KP0A 2ILNA 3RM0H 1XMNB 2Q1JA 4K2YA 1CT0E 5FAHA 1E38B 5AFYH 1EZSC 1C2IA 1QB9A 3P8FA 1MAYA 1BRAA 5A0CA 1Q3XA 1C2HA 4FU8A 5E2PA 4JZIA 1D6WA 3T5FH 3B23B 4M7GA 3D23A 1O3DA 1H9LB 1IQMA 1Z1IA 1N6XA 1UCYH 2FEQH 5C2ZA 1PPFE 1SFIA 1L2EA 5DJ7A 1ORFA 4YTAA 2NU4E 3NUMA 1V2WT 2YNBA 4HZHA 5T6FA 1C5OH 1T7CA 5GCHG 3O8DA 3A7VA 4JK6A 3TGKE 4FUEA 1GHBF 4B75A 4MNWA 2BY9X 3M61U 3IITA 3RXGA 3SQHE 1F5RA 4IMZA 3RXCA 4D7GA 1O2IA 1BTUA 1ELVA 1FY3A 2HNTF 2W3KA 1DFPA 1IQHA 3F9FA 4KTSA 1W2KH 3IG6B 1CU1A 2BLOA 1UJ1A 3RM2H 1DSUA 4FUJA 2AEIH 3UTUH 3A84A 2ZHQH 3LJOA 2D2DA 4GSOA 1O32A 1ZJKA 2VIWA 1W11U 4GHQA 5CHAC 1KDQA 1MTWA 3A80A 3SI4H 1RJXB 1TONA 4DY7B 1LPGB 1DOJA 2H1UA 4KELA 3GY3A 2G52A 2DUCA 3ZVBA 3LPRA 1BRUP 1TRYA 1S6FA 5C1XA 4B2AA 2FODA 3CENA 5E2OA 2F9BH 1C5MD 1KXEA 1YF4A 2ZU4A 4Z0KA 3T28A 1VGCB 2A45B 5A0BA 3UOPA 5SGAE 1AI8H 1CSOE 5DK1A 1UVUH 2C4FH 3H7TA 1QA0A 2BDBA 1GBHA 1GJ8B 3TITA 1ID5H 2WV5A 1C2GA 1C1QA 1W7GH 2ANYA 2ODQA 1IHSH 3F6UH 1S83A 4KKDA 2ZNKH 3D62A 2ZHFH 3MNXA 2WPJS 1Q31A 4Y8YA 2CGAA 1TQ0B 5JBCS 4WJG2 1B0FA 2GZ8A 1DY8A 2FTMA 4NZLA 2BHGA 9LPRA 3MNSA 1O2VA 2R9PA 4MNVA 1A0JA 1K1PA 2Z3DA 3P70B 1HAPH 3E90B 3M7TA 1SGNE 3BEFB 2C8YB 3K6YA 3SOSA 2QV1A 3RXDA 1LDTT 2IJOB 3A7XA 4Y71A 1RIWB 2BB4A 4ABIA 3EE0B 3Q3KA 2LPRA 3LGIA 2OQ5A 5L2ZH 3RU4E 4XFQA 2FO9A 1SGEE 2V3OH 5C5OA 3BTEE 1C1SA 4ISIH 1WQSA 3NCLA 2HNTE 1OKXA 3A7TA 3SV7A 4NWKA 3HGPA 3AVZA 4LZ1H 2G5VA 1TA6A 4HGCA 1BMLA 1ZRKA 3VPKA 3MWIU 2VWLA 1FDPA 1AB9C 1ELCA 2B5TB 4WMEA 1OXGA 1BMAA 1QCPA 1TB6H 3KN2A 1TBRH 4NZQA 3MU1A 2Q6GA 1ZTJA 1VR1H 2XTTB 4DIHH 3D49H 2I6SA 4AB9A 4AG1A 4X6OA 7LPRA 1SQAA 3SUFA 4YM9A 1GI7B 1P02A 2R3YA 3VB5A 1QQ4A 5JBBS 2O8TA 1LQEA 1TNLA 4ABAA 4CR5A 3RXJA 2FZZA 2AH4X 1TNIA 2OCVB 3MU4A 3A81A 1FY8E 3E1XB 1K1IA 3PTBA 3RXUA 1O2UA 2BDIA 4XBCA 1BBRK 1AE8H 1GBLA 1O2YA 2VWOA 2DE8A 4FVDA 3R3GB 1AFEH 3M3SA 2RA0A 1F92A 3UIRA 1MU8B 1DICA 1O30A 4XOJA 3M3VA 2BD2A 4CR9A 4ISLA 4NIVA 1OWJA 1TNHA 4VGCB 2A7JA 1O2ZA 3SJ9A 2ANKH 1TRNA 2R0KA 4I8GA 3TNSA 1DANH 1DVAH 1N6YA 4FUFA 1MKWK 5CE1A 3GDUA 2ZFSA 3M5OA 3ZVAA 1TAWA 3P17H 1DITH 4ABEA 1CA8B 4B71A 2ZGJA 4K1TA 1TMUH 3H5CB 2AMDA 4AB8A 3FAOA 2OC7A 2Y82A 1AWHB 1IQEA 1EPTB 1GJDB 1T8NA 4FUDA 4DJZB 1G2MA 3QK1A 3KHVA 1CO7E 1XUIA 2H6MA 2NU0E 1FAKH 3A8CA 5JBAS 3BTDE 3RXEA 3M35A 3BTME 1C1WH 3BIVH 1T8MA 1B5GH 1TPPA 5HM2A 2QYIA 1P2NA 1EB1H 1TRMA 1C2FA 4AFUA 4ZXYH 1ABJH 4I8HA 1VGCC 1SGRE 3URDA 4Y10E 3UNQA 3UR9A 3T29A 2PV9B 4X8SH 1AKSB 3MO6A 1MTNB 4JCNA 2TGAA 1FNIA 1TGSZ 1QBNA 3K2UA 1H4WA 4WVPE 3BEUA 3UPEA 1F0UA 1YPKH 1O2MA 2ZQ2A 2F83A 2F3CE 3SU1A 5LGOA 3ATWA 1GJ5H 2SFAA 3MTYA 3GY5A 4TWWA 5EXNA 1W0YH 2ZA5A 1NPMA 4ZKRU 1NRNH 3ATKA 3BV9B 1P8VC 1C5YB 4XSKU 3QN7A 1UMAH 4DW2U 3DT0H 3UREA 5C1UA 1BBRE 1LCYA 1O2GH 4E7NA 1RIWC 4UFDH 1GCDA 2FOGA 2SGFE 1QL9A 3GCTG 6CHAB 1BTXA 1HAVB 1WTGH 5F8XA 2O9QA 1W12U 1GMHG 1ETTH 1UK4A 1ZLRA 1C5LH 3PB1E 1ZTLA 4I7YH 3E8LA 3STIA 3LH3A 4U01A 4JZ1A 1UVSH 2BD3A 4MG3A 4O97A 3I78A 4CH8B 4BXWA 1S85A 1QFKH 1ZR0A 1WUNH 3ZZ5A 2BD9A 1BA8B 3QGNB 2BDCA 4IN1A 3SU0A 3ZYEA 1SMFE 3IWMA 3M7QA 2B0FA 2H9HA 3C27B 2C93B 3P92A 1D3PB 3ODFA 4YOJA 2HALA 2BQ7B 2FS8A 1QL7A 1TNJA 2XYAA 2OC8A 2BDYA 3M7UA 1RFNA 1JRTA 2FX4A 3EA7A 1O2HA 3L3TA 1Q2WA 1N8OB 1PYTD 4B73A 2BMGB 1VCQA 1ZMLA 5ABWA 3AAUA 2W7SA 3VB7A 4YLUA 2ZHDA 2ESTE 5A0AE 1INCA 2G4UA 3GYLB 2SGDE 1AN1E 1GJBB 1T4VH 2ZIQH 1SI5H 3B8JA 3U8TH 2AIQA 3LJJA 1ZYOA 4VGCC 4X2XA 2C3SA 2ODYB 1ANDA 4MQAA 2ZCLP 4IGDA 2Z9GA 1TNKA 4K8BA 4A5TS 3EQ0H 1LKBA 1O3EA 2J38A 1RRKA 3MU5A 1AFQB 2V6NA 3VXFH 1FIWA 4WXIA 4IMQA 4WMFA 2ZCKP 4Q7ZA 3SJOA 1MCVA 4X1NU 2R3UA 5F8ZA 3PO1B 1BBRH 3GY6A 3SNCA 2HOBA 3A83A 1BB0B 1WSSH 5LPEA 1XUKA 3DD2H 2UUKB 3OTJE 1AQ7A 1C5PA 2FYRA 2QCYA 1OSSA 2WPIS 3RLWH 4XDEA 2A5KA 1C9TA 4D9QA 1O2XA 4AN7A 1MKWH 5PTPA 3ZVFA 1JMOH 1NRSH 3K9XB 2F91A 2ZFFH 1C5RA 2CV3A 1MTNC 3HGNA 1GHAF 1A0HB 1O3JA 1HJAB 1GBEA 4UEHH 1Y3YA 2VVVA 3K6ZA 2QA9E 2P93A 2GDEH 5K7RA 2VH6A 3QLPH 3ENSB 3TGIE 3VB6A 1NESE 1FONA 1HCGA 1IQIA 1K1NA 4PROA 3ZZ4A 1ZPBA 2ZFTA 4Y79A 3RU4T 2AERH 2ZTXA 5GXPA 1NRRH 1A3EH 1M9UA 2XXLA 1A46H 3RLYH 3E6PH 1LHGH 1O33A 3SV6A 2BZ6H 4Y0ZE 2PUXB 2ZDKA 3EDXB 4AX9H 1MKXH 1Z8IB 3D65E 5EQSA 6CHAC 1A3BH 3LU9B 1MD7A 1FN6A 1O3LA 1ZTKA 1EAXA 3P6ZB 4ZROA 3TU7H 5AHGH 1C5ZB 2R2WU 2VINA 4FVBA 2ZGXH 1GHXH 1GDNA 1N1LA 1SQOA 1YCPK 1CHOF 3SU4A 5FCRA 2OXSA 3BEIB 1IOEA 1C5UA 6GCHF 2ASUB 1XUFA 1E35B 4B74A 1QRZA 1DWBH 3C1KA 4ZKNU 1TALA 3GDSA 4KTCA 2XW9A 2ZDMA 1Y3WA 1LPZB 1C4V2 1LHEH 1H9IE 1V2LT 1HAXB 2Y5HA 2XBVA 1O3NA 4ZHAA 1D4PB 3MMGA 1GDQA 1QJ1B 2Z9IA 1K1JA 2RCEA 2TRMA 1GHZA 4TPIZ 2YNAA 2A2XH 1WU1A 1C5QA 1N8OC 4JK5A 4DOQA 1LMWB 1AY6H 4NCYA 3TK5A 2OQUA 1TA2A 2PSYA 4AYVB 1J16A 3QZQA 4I31A 3ZZ9A 1EASA 1VJAU 1AO5A 4A1VA 2GX4A 1SSXA 3GY8A 1SR5C 4AFSA 4K3JA 2IOTA 1TFXA 1O2JA 1NZQH 3FP7E 2O8MA 5GCHF 1BTZA 1BZXE 2ZO3H 5A09A 2J92A 5EW2H 3RC5A 1EB2A 2A1DB 1SHHB 5F6MA 1YGCH 1ZMJA 4J2YB 2C8ZB 2QF3A 3T62A 3SV9A 3GOVB 2AFQB 2GGVB 1YKTA 3RXKA 2OC0A 3RXQA 1SL3A 3HK3B 2AGGX 1K1OA 1O2KA 4X2WA 5IYTA 5EOKA 1DUEA 2Z94A 4MNXA 4LXBH 3LH1A 1THRH 3ITIA 1MQ6A 1LVOA 2GV6A 3HK6B 3MH7A 3RC4A 3QWCH 1E37B 3F9EA 4FUHA 2BVSH 3P8OA 3QUMP 4ZHMU 5DO4H 1H8DH 4K69A 1Y3VA 5GPIB 1O3GA 2QIQA 4D7FA 3RXAA 5EG4A 2O8UA 4DCDA 4SGAE 1HJ9A 4IC6A 1HJAC 5DP8A 1SGYE 4TWYA 5A2MH 1F5LA 1NRQH 5FX5A 2QAAA 2GD4B 3SJIA 1TE0A 3JZ2B 4BANB 1CQQA 2FOFA 1P06A 1RTKA 2KAIA 1VZQH 1KTSB 1IQGA 1TGCA 4CRBA 2PKSB 2JETB 3E16B 4ZKSU 1V2JT 2FI4E 2PSXA 3U8OH 3V13A 3RXOA 3MO3A 1PQ7A 5BPEA 4WXVA 1HPGA 1P2JA 1GVLA 2BOHB 1W14U 1KIGH 2I6QA 4WH8A 4RSPA 4O03A 3A88A 1GJ6A 1K2I1 2P94A 1A0LA 5A8ZA 3SU6A 1F0RA 1LQDB 2UWOA 4YO9A 3AW0A 3RXHA 1F0SA 2R0LA 3BIUH 4NIYA 4BAKB 1TBZH 1P12E 2ZF0H 4ABGA 1UO6A 1EXFA 1JIMA 1LVYA 3MNCA 2Y5FA 1C1UH 7GCHF 3LIWA 1GBCA 5HMAA 2FYQA 2B7DH 1LVMA 1MH0A 4A1TA 1FPHH 4RN6A 1WV7H 1H1BA 2SGQE 3HKJB 4NGAH 1DXWA 2Y7ZA 1O3OA 1MTUA 3F9HA 1O2PA 3NKKA 3TJOA 2PWXA 1AVGH 1RD3B 1W3CA 2HPQH 3LC3A 4Y8XA 5C20A 1TPSA 2BOKA 1BDAA 1QB6A 4FU7A 3MH6A 4BNRA 2WUBA 4X1QU 3SGBE 2HVXA 4DURA 1YCPH 1HFDA 1Y8TA 1W8BH 3SW2B 3T2NA 3ZZ3A 5LPFA 3A87A 2FI3E 4QT8C 3QZRA 4KGAA 5B6OA 4DGJA 3S9BA 2HRVA 2VIVA 3PYHA 1MD8A 2BLWA 1V2VT 3E3TA 3RXFA 1GBTA 4D8NA 3BTGE 1AZ8A 1F7ZA 3BG8A 3SHCH 3QO6A 3ZVGA 1TIOA 3RXTA 1P2OA 5AVDA 1EAWA 2HPPH 2ZP0H 3SGQE 1G3CA 1JIRA 4NIWA 3MO9A 4O3TA 3OY5U 1FZZA 1SGIB 1OWDA 2EEKA 1P9SA 3SO3A 3ZZ8A 2XBXA 2BDHA 3MYWA 4E06H 2BD4A 7GCHG 1YP9A 2XWBI 5E0JA 1P09A 1EUFA 1UVOA 1A61H 4MTBA 3UQOA 4F49A 4UFGH 2QXGA 2NU1E 4Y0YE 1P10A 3BTFE 3LKWA 1EKBB 2HWLB 1P2KA 1FIZA 1IHTH 3MFJA 3O8RA 8ESTE 5JYIA 3DFLA 2O8WA 4ESTE 4MPVA 3W94A 4KTUA 3PV4A 1MUEB 4GCHG 2FS9A 1ZMNA 2A5AA 2V0BA 3KEEA 3LGYA 3NZIA 1GJ7B 2NU2E 3UNRA 3NWUA 1O2RA 4A7IB 1KXCA 4U30A 1HXEH 1LTOA 1SVPA 2QC2A 2HLCA 1P9UA 2LNCA 1PYTC 2F9PA 1C1OA 2ZU1A 2XWAA 2JH5D 3OX7U 3PWBA 1OYTH 4OS7A 1XUHA 2PKSC 5JPMH 1O37A 1BOQA 1SGQE 5E0GA 2FLRH 2JETC 1L0ZA 3MNBA 1HYLA 2GVFA 5L30H 1AVXA 3UFAA 2FOEA 4OS2A 5T3HA 1SLXB 1KXFA 1J8AA 2OLGA 3VGCC 1BIOA 2BQ6B 5T6DA 1F5KU 1SOZA 1HNEE 3SV8A 3N7OA 1J14A 1GCTB 1HGTH 4IS5A 4CH2B 4AOQA 3ZZAA 6ESTA 4Y7AA 5EU8A 3A89A 3QTVH 1PQAA 3KQDA 1KXDA 5FBEA 1EJAA 4R8TB 2BD7A 4MVNA 4ZUHA 1AGJA 1DSTA 2THFB 4XBDA 1SLWB 3TJNA 2W5EA 3BTTE 3GCTF 3SZNA 3GICB 2FPZA 1ZHRA 4ZKOU 1MU6B 1V3XA 2TGDA 5TJXA 1GMHF 1DE7H 8KME2 5FHTA 1UTJA 4JMYA 2O8LA 3A7YA 2GP9B 2PHBA 1BT7A 1GI0A 1EP6A 1O3CA 1NFXA 1CE5A 3STJA 1ZPCA 2AGEX 5GIBA 2BYAX 1O5CB 1FAXA 3ATMA 2IN2A 3GISB 4JYUH 1W7XH 1GI1A 1K28D 4XBBA 1B0EA 2VIDA 2PW8H 1YCPM 4B2CA 5FBIA 3SU2A 5DPAA 1P2MA 2V35A 1P57B 1ARCA 3PMBB 2VWNA 2B8OH 3ODDA 1VITH 1DWDH 2A7HA 1YPLH 2Z7FE 3ZZCA 1VCWA 2GKVE 1EX3A 1QRWA 1RTFB 5EXLA 1TQ7B 2GCTB 3T27A 1O5FH 2UUYA 3WY8A 1FMGA 2ZGBH 1UTKA 1DX5M 1FPCH 2V3HH 4DG4A 3SJKA 3TGJE 3LGTA 2P95A 4AGKA 1MBQA 5I25A 2EC9H 2BY6X 1GHYH 3U8RH 1C1PA 3UNSA 1ESTA 4UFEH 2WPMS 4RKJB 2GZ9A
chains in the Genus database with same CATH superfamily
4BTUB 4IN2A 2OBOA 1QJ7B 1O2LA 4J1YA 1S0RA 4F55A 3SUDA 1TMTH 1GBAA 5F03A 1Z6EA 4A6LA 4Q2KA 1TGBA 1DT2A 1HRTH 1UTMA 1JXPA 1E1QD 4FUIA 3SNEA 1HAZB 2WYGA 2XC5A 1K21H 1BTWA 1GL0E 2GT8A 2J4IA 3A86A 2J97A 2ZI2H 2GZ7A 1YYY1 2BM2A 3A8BA 1COWD 4UFFH 5HYOA 4ACAA 4UE7H 2XC4A 2GMTB 3TH2H 4I32A 3NK8A 1TWXB 2Z9JA 2OC1A 1QR3E 1BRBE 4X1RU 1KLTA 1KLIH 1QHRB 3UUZA 3ZYDA 1FUJA 1CA0C 1DXPA 1WAYB 1ETRH 1IQLA 4HI3A 2BVRH 2FX6A 2PTCE 1BQYA 1GBMA 2QY0B 3DUXH 3RXVA 4F4OC 3KYFA 4B76A 1VKYA 3BTKE 5C5NA 1FQ3A 3N7EA 1T8LA 2ZDVH 3GY7A 2RFKC 3F0PA 1PQ8A 2A31A 1W0JD 2H5CA 4TPYA 5A8XA 1ZGVA 3K65B 1GCTC 3FO8D 4Y11E 4AFQA 1AUJA 4OM9A 1TLDA 2ZKSA 1QIXB 1O3PB 3Q77A 4CREA 2G5NA 2DE9A 2P8OC 1H8HD 3KQ5A 4X6NA 4ZH8A 2AS9A 2ZU2A 5C3NA 4H42U 4FUBA 1FV9A 1SPJA 3EA9A 3P95A 3V12A 2Z6BD 4DT4A 2J2UA 2CXVA 2RG3A 1GBBA 1CGIE 3V0XA 1NU7B 2WPHS 5EGMA 1GI8B 3OYPA 2CF8H 2WV9A 3TK6A 3ZV8A 1HBTH 3PV2A 3V3MA 1G3EA 1HLTH 3OY6U 2J95A 5L2YH 2LP6A 4NA9H 2Z3CA 3MH4A 3SHAH 3EA8A 1V2MT 3E91A 3KQBA 3HATH 1G37A 1NY22 2BY7X 2RDLA 1HB0B 2AIPA 2WPKS 2C8XB 4I8JA 2H2ZA 2KAIB 3SN8A 5EQRA 5C0UA 1NM6A 4AFZA 3FVFB 4ABHA 2Y6TA 2D8WA 2UUJB 1FY4A 1YLCA 3L6PA 1O36A 3A8DA 1DY9A 2TIOA 4OS6A 4U2WA 2Z9KA 1NFYA 5EXMA 3F2FA 4UD9H 1DWCH 3BN9A 4X1PU 5ESTE 2BD5A 4P00A 3ZIAD 1AWFH 1VCPA 4NSVA 1GPZA 4Q80A 5J4QA 2XBYA 4BAHB 3Q3XA 1AE5A 4MDSA 1BMMH 1E0FD 1J15A 1C4U2 1XVMA 3RDZA 4AZ2B 1CT2E 1C2LA 2W26A 3VB4A 2GCTC 5DP9A 2P3TB 3LGUA 2ZTYA 3ZVCA 4X2YA 4LOYH 4MPUA 3EGKH 1KDQB 1BHXB 3URCA 4UDWH 5HM9A 1LVBA 2ZDLA 3M5LA 3TJVA 5FPYA 1KXAA 1GG6B 1Y3XA 4YZUA 5HIZA 1GBKA 3QX5H 8GCHG 5T6GA 5F53A 1Y5BT 1W10U 1JBUH 2ZPQA 4ABBA 3SUGA 5KEDA 1Y5UT 5DKMA 4JZDH 1FLEE 1S84A 1MZAA 4CBNA 2STBE 1V6DA 1EJMA 1QNJA 1O3KA 2ZTZA 1O2SA 1BJVA 2Z3EA 1O31A 1K9OE 2ALVA 4DIIH 2PP6A 1OP0A 2K8IA 4NIXA 3SGAE 1K1LA 2OK5A 2ZFPH 4WH6A 3PTNA 3NPSA 1P2QA 5EW1H 4X6PA 3RMLH 3S7HB 2GMTC 3KQEA 1EZUC 3U28C 1HAVA 2G55A 2QXHA 4YOGA 4R0IA 1BTHH 1Z8GA 5IDKA 2VU8E 1O5EH 2HLDD 5GDSH 4B1TA 4INLA 1DWEH 1TPAE 1ZPZA 1FN8A 3DA9B 1W13U 1V2RT 4XE4A 2BTCE 1TX7A 2J34A 2M2AA 1GBDA 2FLBH 3U1IB 1S0QA 3B9FH 1SBWA 2G00A 1A5GH 3SI3H 1AZZA 3M5MA 5DP4A 5E0HA 3ZVEA 2WPLS 2A7CA 1BJUA 2G8TA 4ABFA 2JH0D 1Y5AT 3T26A 3GCOA 4ISHH 2C90B 1K0HA 2SGEE 2JH6D 4RKOB 2H9EH 2YOLA 2QXIA 1QRXA 2D26C 3S69A 1TBQH 1C2DA 2P3UB 3PMAB 1O3IA 1NN6A 5EQQA 3U98H 5HIYA 1ESBA 1OOKB 1WXRA 3DHKH 3GCNA 5FCKA 4ZAEA 3UWIA 3PLPA 2WPDD 3PLBA 4ZHLU 2RDEA 4Z6AH 3GCHC 2OP9A 1U6QA 1ELAA 2PKAA 2AMPA 1G3BA 4MLFB 1K1MA 1T31A 2TBSA 1HAGE 1XUJA 3A82A 2OBQA 2FESH 4BTTB 3ATIA 2FOHA 1GMDG 3KCGH 2PR3A 4CRDA 3FZZA 3RUOA 3VB3A 1BTYA 1CGHA 4ZXXH 3CNRA 1O0DH 1O3MA 3KQCA 5K0HA 3RXSA 1GJCB 1OP2A 1O2OA 2SNWA 3A8AA 2ZDAH 5DG6A 1HAOH 2VVCA 4ABJA 4OS4A 5ESBA 1YPGH 1C9PA 4JZEH 2W7UA 4YESB 3TJUA 1DM4B 1OWKA 1CBWC 1RTLA 4GLYA 2GCHG 1F2SE 3SBKA 1G36A 1DDJA 2RA3A 3ZV9A 1GMCG 1O3FA 1XKBC 1KLJH 1ESAA 1WOFA 3LGWA 3VGCB 2FMJA 3AAVA 3LONA 4Y6DA 1A2CH 1GGDB 5FX6A 4INKA 1SGFA 3KIDU 1YPJH 2J98A 1G32B 1UTPA 2AYWA 5C0TA 1ARBA 1GG6C 3RXIA 2Q6DA 1GVZA 2BX3A 3SV2H 3OSYA 1HIAA 3TH4H 7KMEH 1XM1A 1O5BB 1GJAB 2WV4A 3PWCA 1EOJA 2J9NA 1E34B 2D1JA 4GPGA 3MU8A 3SNDA 4CBOA 1FY1A 2ANWA 4B2BA 2ZZUH 1S5SA 2FTLE 4ACBA 1GI2A 3A85A 3ZZDA 3F68H 4GVUA 1GDUA 1O5AB 1GBFA 3I29A 4YOIA 1V2ST 2BVXH 2Y80A 1TX8A 1VITF 1A5IA 4ISOA 1HDTH 2OUAA 1GI3A 2KCPA 2FP7B 1UTLM 2GDDA 2FOAA 1OX1A 1ZZZA 4ABDA 4FUCA 1TNGA 1YPMH 2A4QA 2GTBA 1UHBA 1C5SA 2SNVA 3PM3A 3T25A 1RGQA 4GCHF 1OPHB 2VH0A 1NROH 1HXFH 3L33A 4NSYA 2B9LA 3PRDA 4Y8ZA 1XX9A 1MZDA 2ZECA 1P0SH 1ZGIA 3TPIZ 1FY5A 1THSH 3U9AH 1PPBH 1J9CH 1QY6A 3PMHB 1SHYA 1V2OT 3WWBA 1BMNH 1X7AC 3EYDA 5FXLA 1G30B 2Y7XA 3SU3A 3VXEH 2F9NA 4WWYA 2ANMH 1ACBE 1GL1A 3BSQA 3Q3YA 1UK3A 2VIOA 2ZCHP 2BY5X 2P16A 2PLXA 4IW4E 1GHBG 1C1RA 1W0ZU 5JB9S 3RXLA 2HVYB 1SFQB 3TLOA 4BTIB 4CRAA 1SGTA 2FOBA 1LHFH 1IAUA 2TGTA 4BAMB 5L6NH 1UK2A 1P01A 3KYGA 5DGJA 1QBOA 3RMOH 4ISNA 4TY6A 3Q76A 1Y3UA 2UUFB 5JBTA 2HNTC 2H9TH 1VITG 3HPTB 4X2VA 1T32A 5LH8A 1ZJDA 4OS5A 5DP5A 2Y5GA 4TT3D 7ESTE 3W95A 1TMBH 3EAJA 3SQEE 1C5TA 2R2MB 3E0PB 3O8CA 2BD8A 1XVOA 4GHTA 4H6SB 1O34A 3S9AA 1ZSLA 1TGNA 2M5TA 2CHAB 4BXSA 1TGTA 1EOLA 2TPIZ 1C4Y2 4YT6H 4X6MA 1TOMH 1C2EA 4CHAB 3JZ1B 4JYVH 3SU5A 1ANEA 4IBLH 5HGGA 2BX4A 3F1SB 1C2JA 5HXFA 2P3FH 1C1NA 2ZU5A 3FOAA 1ZHPA 4K8YA 1CA0B 2QF5A 2FOMB 1D9IA 1GI9B 1ETSH 2VWMA 1AHTH 4NFFA 1PPEE 2XNIA 1YM0A 2HGTH 3M37A 3TNTA 4DVAU 1DUAA 1V2QT 1H8IH 2QXJA 2EQNA 1EP5A 5EPNA 4Z1MD 3QGJA 1L1GA 2Q6FA 1GGDC 1PPZA 2ZHWH 4CRCA 2OINA 1IQKA 2PGQB 1MQ5A 2IPHA 5GWZA 3N99A 4I8KA 1KTTB 1QZ8A 1WTHD 2P8OB 1EZXC 2ULLA 5A8YA 4Q7YA 1PPCE 3UY9A 1NRPH 1BITA 3UR6A 1VJ9U 2CN0H 1GVKB 1JOUB 2H5DA 3LT3A 1AUTC 3FANA 2WSSD 3NXPA 2ZU3A 1KSNA 2SGPE 4FUGA 1S6HA 4X0WU 5BRRE 5EJ1A 1IQJA 3GS9A 1YPEH 3ESTA 3M36A 5FPSA 1GI5A 1NTPA 1XUGA 4BAQB 1THPB 2A5IA 1FI8A 3HKIB 2A32A 4K1SA 2EI7A 2A0QB 3ZZ6A 1V2UT 2ZGCA 1UVTH 1JWTA 1QA7A 4MPWA 2XCFA 1IQNA 1A7SA 4JYTA 1IQFA 1OWIA 3SJ8A 1NT1A 1MAXA 1GWAA 1V2PT 2F9OA 3LOXA 1V2NT 2J94A 3KGPA 1C5NH 4I8LA 3DSOA 4DT7B 1AVWA 1KXBA 1MKXK 1O38A 1C5XB 1EQ9A 1RS0A 1GBJA 3GDVA 2WUCA 4Q7XA 3QDZB 4E05H 1NBMD 3TVJB 4H6TA 4Y76A 3AW1A 1C5VA 1LPKB 2EI6A 1GI6A 5B6LA 4ZCNA 3A7ZA 2GT7A 5FL7D 3MI4A 4YLQH 2ZG0H 3P8GA 2BZAA 1TABE 1C1VH 2CJIA 3G01A 3U69H 1LHCH 4CRGA 1HAYB 3TH3H 1OWHA 2ZC9H 3RU4D 2STAE 3KNXA 3RC6A 1LO6A 1OYQA 2VVUA 5JDUB 1MCTA 1TPOA 3BTHE 1KY9A 1HV7A 1UTOA 1WQVH 5DP7A 4LZ4B 1XXDA 1Z7KA 1HUTH 3FP8E 1QTFA 2TGPZ 3SUEA 1CT4E 2CHAC 1DS2E 2XRCA 5G4BA 3SNAA 3ZVDA 1PPGE 1UVPA 2ODPA 4IC5A 3TIUA 1DLEA 2Z9LA 4CHAC 1C2MA 5DP3A 1EAIA 1GBIA 2GV7A 1GI4A 3PROA 3OAAD 1KYNA 2CF9H 3BTWE 5H4IB 3OEHD 1L1JA 4K1EA 1ABIH 2FOCA 2WINI 1A1RA 2ZEBA 4TSFD 5EPYA 1PQ5A 1GHVH 3RMMH 2ZQ1A 1O3BA 1Z1JA 4ASUD 9ESTA 1D3DB 1O3HA 3CS0A 2A4OA 4OS1A 2VGCB 5TCCA 1E1RD 2G4TA 1SLVB 3FZDA 3RXPA 4X8VH 1WBGB 1GJ4H 2FI5E 1SGCA 4MNYA 4X8UH 4E7RG 3KF2A 3BTQE 2SGAA 5CMXH 3BG4B 5JB8S 4LK4A 1LHDH 2BLVA 3P8NA 3Q00A 2CK3D 1S82A 1SGPE 2PGBB 2QN5T 1QB1A 2PKAB 4BOHA 1P2IA 4NA7A 2J5UA 2BDGA 2BDAA 1GJ9B 4NG9H 2F9VA 3RXMA 1DPOA 1B7XB 2A2QH 2ZGHA 6LPRA 8GCHF 1QBVH 3GCHB 1NS3A 5C1YA 2A4RA 2ZPRA 3BF6H 2UWLA 2XBWA 1ZRBA 2VJ1A 2ZFQH 3LGVA 1EPTC 1TOCB 4INHA 5TCAA 1G3DA 1ANCA 2V7QD 2BXUH 1EZQA 3UB0A 1T4UH 8LPRA 1P3CA 4FU9A 1C2KA 1OP8A 1Z6JH 3U1JB 2AMQA 1UCYK 1QGFA 2VIPA 1L4DA 2OTVA 1H9HE 4UONA 1ANBA 4OGYA 1TYNA 1EPTA 1K22H 1SC8U 3R0FA 4WF8A 4D9RA 1UTQA 5GJ4B 1YWUA 3MHWU 1EJNA 1F0TA 1HAIH 1Z8RA 2A4GA 3DSGA 3LDXH 5DSFA 1ZSJA 2J98B 4H4FA 1Z8JB 1C1TA 1CHGA 1YPHC 1ZSKA 4NA8A 3LC5A 1FJSA 1ELTA 2VBCA 3SNBA 1SOTA 1XKAC 2NWNA 3S0NA 1CBWB 1GHWH 2Y81A 1HIAB 2ALPA 3F2HA 3MU0A 1SKYE 1LKAA 2FWWA 4Q4LA 3A7WA 1YPHE 4YT7H 3CS7A 4GUXA 3RXRA 1WCZA 4B6FA 1HJ8A 2NU3E 2VNTA 1A4WH 2EI8A 1Z71A 1AKSA 4CRFA 1O2WA 1CVWH 1P11E 1O39A 3SORA 1SLUB 1HAHH 4U32A 4HTCH 1QL8A 3DFJA 1S81A 4GAWA 1OS8A 2G81E 3CP7A 2FXRA 1YBWA 2BXTH 1O2NA 3E0NB 5J4SA 1NU9A 1BCUH 4M9FA 1NFWA 3FKSD 1QURH 2QF0A 1BTPA 4YXWD 5EODA 1ELBA 1UHBB 4AORA 1O2TA 1JRSA 3OU0A 5AFZH 2BLQA 3PLKA 3RXBA 3TK9A 1QQUA 1XXFA 1AMHA 2FM2A 3VEQB 4HFPB 1QJ6B 4MPXA 3MOCA 2PTNA 4ZMAH 3F0OA 5I46H 1SG8B 1G9IE 5DP6A 1O35A 3KL6A 5CHAB 1O5DH 1BUIA 2EA3A 2FIRH 1PJPA 1DLKB 4OGXA 1YLDA 1V2KT 3AASA 4TY7A 5FPTA 5T1VA 2PFEA 5F8TA 1O5GH 4SGBE 3EE7A 1GHAG 1MTSA 1GMDF 1V2TT 3M3TA 1P03A 2XC0A 1NO9H 3UOUA 3GY2A 1ELFA 4NFEA 1UCYE 3QTOH 1J17T 2BY8X 3M5NA 1O3AA 3ATLA 1NC6A 1WYKA 5E8EH 2CMYA 4I33A 2BQWB 2VGCC 1P05A 2VB0A 1BRCE 4Y7BA 1MBMA 3FFGA 1NFUA 3RMNH 2F9UA 4ASHA 1ELDE 1PPHE 1E36B 1T8OA 1ZHMA 3UQVA 1D6RA 1MTVA 2JKHA 5IK2D 3BG4C 3GY4A 1L4ZA 2OD3B 1BHXF 2ZHEH 1OWEA 4O9VA 2GCHF 4X1SU 3GYMA 1ELEE 3F9GA 5ETXA 3V7TA 3S9CA 3FP6E 2ZWLH 1UTNA 1GMCF 1O2QA 2K1QA 2PUQH 2QGRA 3MH5A 4NWLA 4TYDA 3RP2A 4A1XA 4K60A 3ZZ7A 3ZZBA 4WY3A 3S7KB 3O8BA 2C8WB 1A5HA 4THNH 2ZPSA 2ZFRH 1D3TB 2UWPA 1P04A 4AYYB 1Y59T 4X8TH 1AFQC 1ZOMA 1FXYA 2KCYA 1YC0A 1EATA 3H7OA 1MMJN 1ELGA 1CHOG 4FXGH 4BAOB 3F3BA 1P3EA 1TX6A 1G2LA 6GCHG 1FX0B 3PO1C 1C1MA 4WMDA 4K5ZA 1SQTA 1SGDE 3OEED 1PFXC 3ELAH 1RXPA 1AU8A 2W3IA 1CGJE 1L1NA 1AB9B 2WYJA 2ZDNA 3I77A 4O3UA 2FDAA 4AG2A 1SB1H 5C67A 1AIXH 1C5WB 1EAUA 2VIQA 3SZEA 3UWJH 2XCNA 1D3QB 2G51A 4AGJA 4A92A 1SGFG 2P59A 4JZFH 4D76A 5LPRA 3PMJA 5AF9H 1AD8H 3W1EA 3VFEA 2AGIX 4KP0A 2ILNA 3RM0H 1XMNB 2Q1JA 4K2YA 1CT0E 5FAHA 1E38B 5AFYH 1EZSC 1C2IA 1QB9A 3F2GA 3P8FA 5C17A 1MAYA 1BRAA 5A0CA 1Q3XA 1C2HA 4FU8A 5E2PA 4JZIA 1D6WA 3T5FH 3B23B 4M7GA 3D23A 1O3DA 1H9LB 1IQMA 1Z1IA 1N6XA 1UCYH 2FEQH 5C2ZA 1PPFE 1SFIA 1L2EA 5DJ7A 1ORFA 4YTAA 2NU4E 3NUMA 1V2WT 2YNBA 4HZHA 5T6FA 1C5OH 1T7CA 5GCHG 3O8DA 3A7VA 4JK6A 3TGKE 4FUEA 1GHBF 4B75A 4MNWA 2BY9X 3M61U 3IITA 3RXGA 3SQHE 1F5RA 4IMZA 4RT1A 3RXCA 4D7GA 1O2IA 1BTUA 1ELVA 1FY3A 2HNTF 2W3KA 1DFPA 1IQHA 3F9FA 4KTSA 1W2KH 3IG6B 1CU1A 2BLOA 1UJ1A 3RM2H 1DSUA 4FUJA 2AEIH 3UTUH 3A84A 2ZHQH 3LJOA 2D2DA 4GSOA 1O32A 1ZJKA 2VIWA 1W11U 4GHQA 5CHAC 1KDQA 1MTWA 3A80A 3SI4H 1RJXB 1TONA 4DY7B 1LPGB 1DOJA 2H1UA 4I86A 4KELA 1BMFD 3GY3A 2G52A 2DUCA 3ZVBA 3LPRA 1BRUP 1TRYA 1S6FA 5C1XA 4B2AA 4AC9A 2FODA 3CENA 5E2OA 2F9BH 1C5MD 1KXEA 1YF4A 2ZU4A 4Z0KA 3T28A 1VGCB 2A45B 5A0BA 3UOPA 5SGAE 1AI8H 1CSOE 5DK1A 1UVUH 2C4FH 2IPQX 3H7TA 1QA0A 2BDBA 1GBHA 1GJ8B 3TITA 1ID5H 2WV5A 1C2GA 1C1QA 1W7GH 2ANYA 2ODQA 1IHSH 3F6UH 1S83A 4KKDA 1W0KD 2ZNKH 3D62A 2ZHFH 3MNXA 2WPJS 1Q31A 4Y8YA 2CGAA 1NBME 1TQ0B 5JBCS 4WJG2 1B0FA 2GZ8A 1DY8A 2FTMA 4NZLA 2BHGA 9LPRA 3MNSA 1O2VA 2R9PA 4MNVA 1A0JA 1K1PA 2Z3DA 3P70B 1HAPH 5HKKD 3E90B 3M7TA 1SGNE 3BEFB 2C8YB 3K6YA 3SOSA 2QV1A 3RXDA 1LDTT 2IJOB 3A7XA 4Y71A 1RIWB 2BB4A 4ABIA 3EE0B 3Q3KA 2LPRA 3LGIA 2OQ5A 5L2ZH 5GNDA 3RU4E 4XFQA 2FO9A 1SGEE 2V3OH 5C5OA 3BTEE 1C1SA 4ISIH 1WQSA 3NCLA 2HNTE 1OKXA 3A7TA 3SV7A 4NWKA 3HGPA 3AVZA 4LZ1H 2G5VA 1TA6A 4HGCA 1BMLA 1ZRKA 3VPKA 3MWIU 2VWLA 1FDPA 1AB9C 1ELCA 2B5TB 4WMEA 1OXGA 1BMAA 5EIYA 1QCPA 1TB6H 3KN2A 5CHBA 1TBRH 4NZQA 2L74A 3MU1A 2Q6GA 1ZTJA 2IJD1 1VR1H 2XTTB 4DIHH 3D49H 2I6SA 4AB9A 4AG1A 4X6OA 7LPRA 1SQAA 3SUFA 4YM9A 1GI7B 1P02A 2R3YA 2EY4C 3VB5A 1QQ4A 5JBBS 2O8TA 1LQEA 1TNLA 4ABAA 4CR5A 3RXJA 2FZZA 2AH4X 1TNIA 2OCVB 3MU4A 2W6ID 1FY8E 3A81A 3E1XB 1K1IA 3N7DA 3PTBA 1O2UA 3RXUA 2BDIA 4XBCA 1BBRK 1AE8H 1GBLA 1O2YA 2VWOA 2DE8A 4FVDA 3R3GB 1AFEH 3M3SA 2RA0A 1F92A 3UIRA 1MU8B 1DICA 1O30A 4XOJA 3M3VA 2BD2A 4CR9A 4ISLA 4NIVA 1OWJA 1TNHA 4VGCB 2A7JA 1O2ZA 3SJ9A 2ANKH 1TRNA 2R0KA 3PV5A 4I8GA 3TNSA 1DANH 1DVAH 1N6YA 4FUFA 1MKWK 5CE1A 3GDUA 2ZFSA 3M5OA 3ZVAA 1TAWA 2KCAA 3P17H 1DITH 4ABEA 1CA8B 4B71A 2ZGJA 4K1TA 1TMUH 3H5CB 2AMDA 4AB8A 3FAOA 2OC7A 2Y82A 1AWHB 1IQEA 1EPTB 1GJDB 1T8NA 4FUDA 4DJZB 1G2MA 2GJGA 3KHVA 3QK1A 1CO7E 1XUIA 2H6MA 5EJZA 2NU0E 1FAKH 3A8CA 5JBAS 3BTDE 3RXEA 3AK5A 3M35A 3BTME 1C1WH 3BIVH 1T8MA 1B5GH 1TPPA 5HM2A 2QYIA 1P2NA 1EB1H 1TRMA 1C2FA 4RT0A 4AFUA 4ZXYH 1ABJH 4I8HA 2JIZD 1VGCC 1SGRE 3URDA 4Y10E 3UNQA 3UR9A 3T29A 2PV9B 4X8SH 1AKSB 3MO6A 1MTNB 4JCNA 2TGAA 1FNIA 1TGSZ 1QBNA 5KGOA 3K2UA 2AHME 1H4WA 4WVPE 3BEUA 3UPEA 1F0UA 1YPKH 1O2MA 2ZQ2A 3WWFA 1MABB 2KZ4A 2F83A 2F3CE 3SU1A 4FOUC 5LGOA 3ATWA 1GJ5H 2SFAA 3MTYA 3GY5A 4TWWA 5EXNA 1W0YH 2ZA5A 1NPMA 4ZKRU 1NRNH 3ATKA 3BV9B 1P8VC 1C5YB 4XSKU 3QN7A 4P02A 1UMAH 4DW2U 3DT0H 3UREA 5C1UA 1BBRE 1OHHD 1LCYA 1O2GH 4E7NA 1RIWC 2L6OA 4UFDH 2XNDD 1GCDA 2FOGA 2SGFE 1QL9A 3GCTG 6CHAB 2WZQA 1BTXA 1HAVB 1WTGH 5F8XA 1W12U 2O9QA 1GMHG 1ETTH 1UK4A 1ZLRA 1C5LH 3PB1E 1ZTLA 4I7YH 3E8LA 3STIA 3LH3A 4U01A 4JZ1A 1UVSH 2BD3A 4MG3A 4O97A 3I78A 4CH8B 4BXWA 1S85A 1QFKH 1ZR0A 1WUNH 3ZZ5A 3NRLA 2LELA 2BD9A 1BA8B 3QGNB 2BDCA 4IN1A 3SU0A 3ZYEA 2YMSD 3OFND 1SMFE 3IWMA 3M7QA 2B0FA 2H9HA 3C27B 2C93B 1E79D 3OE7D 3P92A 1D3PB 3ODFA 4YOJA 2HALA 2BQ7B 2FS8A 1QL7A 1TNJA 2XYAA 2OC8A 2BDYA 3M7UA 1RFNA 1JRTA 2FX4A 3EA7A 1O2HA 3L3TA 1Q2WA 5DN6D 1N8OB 1PYTD 2QF4A 4B73A 2BMGB 1VCQA 1ZMLA 5ABWA 3AAUA 2W7SA 3VB7A 4YLUA 2ZHDA 2ESTE 5A0AE 1INCA 2G4UA 3GYLB 2SGDE 1AN1E 1GJBB 1T4VH 2ZIQH 1SI5H 3B8JA 3U8TH 2AIQA 3LJJA 1ZYOA 4VGCC 4X2XA 2C3SA 2ODYB 1ANDA 4MQAA 2ZCLP 4IGDA 2Z9GA 1TNKA 4K8BA 4A5TS 3EQ0H 1LKBA 1O3EA 2J38A 1RRKA 3MU5A 1AFQB 2V6NA 3VXFH 1FIWA 4WXIA 4IMQA 4WMFA 2ZCKP 4Q7ZA 3SJOA 1MCVA 4X1NU 2R3UA 1WDIA 2V3MA 3PO1B 5F8ZA 1BBRH 3GY6A 3SNCA 2HOBA 3A83A 1BB0B 1WSSH 5LPEA 1XUKA 3DD2H 2UUKB 3OTJE 1AQ7A 1C5PA 2FYRA 2QCYA 1OSSA 2WPIS 3RLWH 4XDEA 2A5KA 1C9TA 4D9QA 1O2XA 4AN7A 1MKWH 5PTPA 3ZVFA 1JMOH 1KMHB 1NRSH 3K9XB 2F91A 2ZFFH 1C5RA 2CV3A 1MTNC 3HGNA 1GHAF 3DCLA 1A0HB 1O3JA 2F4LA 1HJAB 1GBEA 4UEHH 1Y3YA 2VVVA 3K6ZA 2QA9E 2P93A 2GDEH 5K7RA 2VH6A 3QLPH 3ENSB 3TGIE 3VB6A 1NESE 1FONA 1HCGA 1IQIA 1K1NA 3PRBA 4PROA 3ZZ4A 1ZPBA 2ZFTA 4Y79A 3RU4T 2AERH 2ZTXA 5GXPA 2KFWA 1NRRH 1A3EH 1M9UA 3VG8A 2XXLA 1A46H 3RLYH 3E6PH 1LHGH 1O33A 3SV6A 2BZ6H 4Y0ZE 2PUXB 2ZDKA 3EDXB 4AX9H 1MKXH 1Z8IB 3D65E 5EQSA 6CHAC 1A3BH 3LU9B 1MD7A 1FN6A 1O3LA 1ZTKA 1EAXA 3P6ZB 4ZROA 3TU7H 5AHGH 1C5ZB 2R2WU 2VINA 4Q63A 4FVBA 2ZGXH 1GHXH 1GDNA 2XOKD 1N1LA 1SQOA 1YCPK 1CHOF 3SU4A 2JJ2D 5FCRA 2OXSA 3BEIB 1IOEA 1C5UA 6GCHF 2ASUB 1XUFA 1E35B 4B74A 1QRZA 1DWBH 3C1KA 4ZKNU 1TALA 3GDSA 4KTCA 2XW9A 2ZDMA 1Y3WA 1LPZB 1C4V2 1LHEH 1H9IE 1V2LT 1HAXB 2Y5HA 2XBVA 1O3NA 2KR7A 4ZHAA 1D4PB 3MMGA 1GDQA 1QJ1B 2Z9IA 1K1JA 2RCEA 2TRMA 1GHZA 4TPIZ 2WHXA 2YNAA 2A2XH 1WU1A 1C5QA 1N8OC 4JK5A 4DOQA 1LMWB 1AY6H 4NCYA 3TK5A 2OQUA 1TA2A 2PSYA 4XD7D 4AYVB 1J16A 3QZQA 4FETA 4I31A 3ZZ9A 1EASA 1VJAU 4HG6A 1AO5A 2KX4A 4A1VA 2GX4A 1SSXA 3GY8A 1SR5C 5CDFE 4AFSA 4K3JA 2IOTA 1TFXA 1O2JA 1NZQH 3FP7E 2O8MA 5GCHF 1BTZA 1BZXE 2ZO3H 5A09A 2J92A 5EW2H 3RC5A 1EB2A 2A1DB 1SHHB 5F6MA 1YGCH 1ZMJA 4J2YB 2C8ZB 2QF3A 3T62A 3SV9A 3GOVB 2AFQB 2GGVB 1YKTA 3RXKA 2OC0A 3RXQA 1SL3A 3HK3B 2AGGX 1K1OA 1O2KA 3H09A 4X2WA 5IYTA 5EOKA 1DUEA 2Z94A 4MNXA 4LXBH 3LH1A 2YMSB 1THRH 3ITIA 1MQ6A 1LVOA 2GV6A 3HK6B 3MH7A 3RC4A 3QWCH 1E37B 3F9EA 4FUHA 2BVSH 3P8OA 3QUMP 4ZHMU 5DO4H 1H8DH 4K69A 3MQKC 1Y3VA 1H8ED 5GPIB 1O3GA 2QIQA 2W6JD 4D7FA 3RXAA 5EG4A 2O8UA 4DCDA 4SGAE 1HJ9A 4IC6A 1HJAC 5DP8A 1SGYE 4TWYA 5A2MH 1F5LA 1NRQH 5FX5A 2QAAA 2GD4B 3SJIA 2K0QA 1TE0A 3JZ2B 4BANB 1CQQA 3SYJA 2FOFA 1P06A 1RTKA 2KAIA 1VZQH 1KTSB 1IQGA 1TGCA 4CRBA 2PKSB 2JETB 3E16B 4ZKSU 1V2JT 2FI4E 2PSXA 3U8OH 3V13A 3RXOA 3MO3A 1PQ7A 5BPEA 4WXVA 1HPGA 1P2JA 1GVLA 2BOHB 1W14U 1KIGH 2I6QA 4WH8A 4RI0A 4RSPA 4O03A 3A88A 1GJ6A 1K2I1 2P94A 1A0LA 1S6LA 5A8ZA 3SU6A 1F0RA 1LQDB 2UWOA 4YO9A 3AW0A 3RXHA 1F0SA 2R0LA 3BIUH 4NIYA 4BAKB 1TBZH 1P12E 2ZF0H 4ABGA 2KCOA 1UO6A 1EXFA 1JIMA 1LVYA 2KM0A 3MNCA 2Y5FA 1C1UH 7GCHF 3LIWA 1GBCA 5HMAA 2FYQA 2B7DH 1LVMA 1MH0A 4A1TA 1FPHH 4RN6A 1WV7H 1H1BA 2SGQE 3HKJB 4NGAH 1DXWA 2Y7ZA 1O3OA 1MTUA 3F9HA 1O2PA 3NKKA 3TJOA 2PWXA 1AVGH 1RD3B 1W3CA 4XRNA 2HPQH 3LC3A 4Y8XA 5C20A 1TPSA 2BOKA 1BDAA 3UAIC 1QB6A 4FU7A 3MH6A 4BNRA 2WUBA 1EFRD 4X1QU 3SGBE 2HVXA 4DURA 1YCPH 1HFDA 1Y8TA 1W8BH 3SW2B 3T2NA 3ZZ3A 5LPFA 3A87A 2FI3E 4QT8C 3QZRA 4KGAA 5B6OA 4DGJA 3S9BA 2HRVA 2VIVA 3PYHA 1MD8A 2BLWA 1V2VT 3E3TA 3RXFA 1GBTA 4D8NA 3BTGE 2F43B 1AZ8A 1F7ZA 3BG8A 3SHCH 3QO6A 3ZVGA 1TIOA 3RXTA 1P2OA 5AVDA 1EAWA 2HPPH 2ZP0H 3SGQE 1G3CA 1JIRA 4NIWA 4F48B 3MO9A 4O3TA 3OY5U 1FZZA 1SGIB 1OWDA 2EEKA 1P9SA 3SO3A 3ZZ8A 2XBXA 2BDHA 3MYWA 4E06H 2BD4A 7GCHG 1YP9A 2XWBI 5E0JA 1P09A 5KECA 1EUFA 1UVOA 1A61H 4MTBA 3UQOA 4F49A 4UFGH 2QXGA 2NU1E 4Y0YE 1P10A 3BTFE 3LKWA 1EKBB 2HWLB 1P2KA 1FIZA 1IHTH 3MFJA 2YMSC 8ESTE 3O8RA 5JYIA 3DFLA 2O8WA 4ESTE 4MPVA 3W94A 4KTUA 3OTPA 1MUEB 3PV4A 4GCHG 2FS9A 1ZMNA 2A5AA 2V0BA 3KEEA 3LGYA 3NZIA 1GJ7B 2NU2E 3UNRA 3NWUA 1O2RA 4A7IB 1KXCA 4U30A 1HXEH 1LTOA 1SVPA 2QC2A 2HLCA 1P9UA 2LNCA 1PYTC 2F9PA 1C1OA 2ZU1A 1YLNA 2XWAA 2JH5D 3OX7U 3PWBA 1OYTH 4OS7A 1XUHA 2PKSC 5JPMH 1O37A 1BOQA 1SGQE 5E0GA 2FLRH 2JETC 1L0ZA 3MNBA 1HYLA 2QE7D 2GVFA 5L30H 1AVXA 3WW7A 3UFAA 2FOEA 4OS2A 5T3HA 1SLXB 1KXFA 1J8AA 2OLGA 3VGCC 1BIOA 2BQ6B 5T6DA 1F5KU 1SOZA 1HNEE 3SV8A 3N7OA 1J14A 1GCTB 1HGTH 4IS5A 4CH2B 4AOQA 3ZZAA 6ESTA 4Y7AA 5EU8A 3A89A 3QTVH 3FN8A 1PQAA 3KQDA 1KXDA 5FBEA 1EJAA 4R8TB 2BD7A 4MVNA 4ZUHA 1AGJA 1DSTA 2THFB 4XBDA 1SLWB 3TJNA 2W5EA 3BTTE 3GCTF 3SZNA 3GICB 2FPZA 1ZHRA 4ZKOU 1MU6B 1V3XA 2TGDA 5TJXA 1GMHF 1DE7H 8KME2 5FHTA 1UTJA 4JMYA 2O8LA 3A7YA 4B6EA 2GP9B 2PHBA 1BT7A 1GI0A 1EP6A 1O3CA 1NFXA 1CE5A 3STJA 1ZPCA 2AGEX 5GIBA 2BYAX 5EJLA 1O5CB 1FAXA 3ATMA 2IN2A 3GISB 4JYUH 3DSPA 1W7XH 1GI1A 1K28D 4XBBA 1B0EA 2VIDA 1SQRA 2PW8H 1YCPM 4B2CA 5FBIA 3SU2A 5DPAA 1P2MA 2V35A 1P57B 1ARCA 3PMBB 5C94A 2VWNA 2B8OH 3ODDA 1VITH 1DWDH 2A7HA 1YPLH 2Z7FE 3ZZCA 1VCWA 2JDID 2GKVE 1EX3A 1QRWA 1RTFB 5EXLA 1TQ7B 2GCTB 3T27A 1O5FH 2UUYA 3WY8A 1FMGA 2ZGBH 1UTKA 1DX5M 1FPCH 2V3HH 4DG4A 3SJKA 3TGJE 3LGTA 1UW7A 2P95A 4AGKA 1MBQA 5I25A 2EC9H 2BY6X 1GHYH 3U8RH 1C1PA 2JJ1D 3UNSA 1ESTA 1YY3A 4UFEH 2WPMS 4RKJB 2GZ9A
chains in the Genus database with same CATH topology
4BTUB 4IN2A 2OBOA 1QJ7B 1O2LA 4J1YA 1S0RA 3SUDA 1TMTH 1GBAA 5F03A 1Z6EA 4A6LA 4Q2KA 1TGBA 1DT2A 1HRTH 1UTMA 1JXPA 4FUIA 3SNEA 1HAZB 2WYGA 2XC5A 1K21H 1BTWA 1GL0E 2GT8A 2J4IA 3A86A 2ZI2H 2GZ7A 1YYY1 2BM2A 3A8BA 4UFFH 5HYOA 4UE7H 2XC4A 2GMTB 3TH2H 4I32A 3NK8A 1TWXB 2Z9JA 2OC1A 1QR3E 1BRBE 4X1RU 1KLTA 1KLIH 1QHRB 3UUZA 3ZYDA 1FUJA 1CA0C 1DXPA 1WAYB 1ETRH 1IQLA 4HI3A 2BVRH 2FX6A 2PTCE 1BQYA 1GBMA 2QY0B 3DUXH 3RXVA 4F4OC 4B76A 3BTKE 5C5NA 1FQ3A 1T8LA 2ZDVH 3GY7A 1PQ8A 2A31A 4TPYA 2H5CA 5A8XA 1ZGVA 3K65B 1GCTC 4Y11E 4AFQA 1AUJA 1TLDA 2ZKSA 1QIXB 1O3PB 3Q77A 4CREA 2G5NA 2DE9A 2P8OC 4X6NA 4ZH8A 2AS9A 2ZU2A 5C3NA 4H42U 4FUBA 1FV9A 1SPJA 3EA9A 3P95A 3V12A 2Z6BD 2J2UA 2CXVA 2RG3A 1GBBA 1CGIE 3V0XA 1NU7B 2WPHS 5EGMA 1GI8B 3OYPA 2CF8H 3TK6A 3ZV8A 1HBTH 3V3MA 1G3EA 1HLTH 3OY6U 2J95A 5L2YH 4NA9H 2Z3CA 3MH4A 3SHAH 3EA8A 1V2MT 3E91A 3KQBA 3HATH 1G37A 1NY22 2BY7X 2RDLA 1HB0B 2AIPA 2WPKS 2C8XB 4I8JA 2H2ZA 2KAIB 3SN8A 5EQRA 1NM6A 4AFZA 3FVFB 4ABHA 2Y6TA 2D8WA 2UUJB 1FY4A 1YLCA 3L6PA 1O36A 3A8DA 1DY9A 2TIOA 4OS6A 4U2WA 2Z9KA 1NFYA 5EXMA 4UD9H 1DWCH 3BN9A 4X1PU 5ESTE 2BD5A 1AWFH 1VCPA 4NSVA 1GPZA 4Q80A 5J4QA 2XBYA 4BAHB 3Q3XA 1AE5A 4MDSA 1BMMH 1E0FD 1J15A 1C4U2 1XVMA 3RDZA 4AZ2B 1CT2E 1C2LA 2W26A 3VB4A 2GCTC 5DP9A 2P3TB 3LGUA 2ZTYA 3ZVCA 4X2YA 4LOYH 4MPUA 3EGKH 1KDQB 1BHXB 3URCA 4UDWH 5HM9A 1LVBA 2ZDLA 3M5LA 3TJVA 5FPYA 1KXAA 1GG6B 1Y3XA 4YZUA 1GBKA 3QX5H 8GCHG 5T6GA 1Y5BT 1W10U 1JBUH 2ZPQA 4ABBA 3SUGA 1Y5UT 5DKMA 4JZDH 1FLEE 1S84A 1MZAA 4CBNA 2STBE 1V6DA 1EJMA 1QNJA 1O3KA 2ZTZA 1O2SA 1BJVA 2Z3EA 1O31A 1K9OE 2ALVA 4DIIH 1OP0A 4NIXA 3SGAE 1K1LA 2ZFPH 4WH6A 3PTNA 3NPSA 1P2QA 5EW1H 4X6PA 3RMLH 3S7HB 2GMTC 3KQEA 1EZUC 1HAVA 2G55A 2QXHA 4YOGA 4R0IA 1BTHH 1Z8GA 5IDKA 2VU8E 1O5EH 5GDSH 4B1TA 4INLA 1DWEH 1TPAE 1ZPZA 1FN8A 3DA9B 1W13U 1V2RT 4XE4A 2BTCE 1TX7A 2J34A 1GBDA 2FLBH 3U1IB 1S0QA 3B9FH 1SBWA 2G00A 1A5GH 3SI3H 1AZZA 3M5MA 5DP4A 5E0HA 3ZVEA 2WPLS 2A7CA 1BJUA 2G8TA 4ABFA 2JH0D 1Y5AT 3T26A 3GCOA 4ISHH 2C90B 2SGEE 2JH6D 4RKOB 2H9EH 2YOLA 2QXIA 1QRXA 2D26C 3S69A 1TBQH 1C2DA 2P3UB 3PMAB 1O3IA 1NN6A 5EQQA 3U98H 1ESBA 1OOKB 3DHKH 3GCNA 5FCKA 4ZAEA 3UWIA 3PLPA 3PLBA 4ZHLU 4Z6AH 3GCHC 2OP9A 1U6QA 1ELAA 2PKAA 2AMPA 1G3BA 4MLFB 1K1MA 1T31A 2TBSA 1HAGE 1XUJA 3A82A 2OBQA 2FESH 4BTTB 3ATIA 2FOHA 1GMDG 3KCGH 2PR3A 4CRDA 3FZZA 3RUOA 3VB3A 1BTYA 1CGHA 4ZXXH 1O0DH 1O3MA 3KQCA 5K0HA 3RXSA 1GJCB 1OP2A 1O2OA 2SNWA 3A8AA 2ZDAH 5DG6A 1HAOH 2VVCA 4ABJA 4OS4A 5ESBA 1YPGH 1C9PA 4JZEH 2W7UA 4YESB 3TJUA 1DM4B 1OWKA 1CBWC 1RTLA 4GLYA 2GCHG 1F2SE 3SBKA 1G36A 1DDJA 2RA3A 3ZV9A 1GMCG 1O3FA 1XKBC 1KLJH 1ESAA 1WOFA 3LGWA 3VGCB 2FMJA 3AAVA 3LONA 4Y6DA 1A2CH 1GGDB 5FX6A 4INKA 1SGFA 3KIDU 1YPJH 1G32B 1UTPA 2AYWA 1ARBA 1GG6C 3RXIA 2Q6DA 1GVZA 2BX3A 3SV2H 3OSYA 1HIAA 3TH4H 7KMEH 1XM1A 1O5BB 1GJAB 2WV4A 3PWCA 1EOJA 2J9NA 1E34B 2D1JA 4GPGA 3MU8A 3SNDA 4CBOA 1FY1A 2ANWA 4B2BA 2ZZUH 1S5SA 2FTLE 1GI2A 3A85A 3ZZDA 3F68H 4GVUA 1GDUA 1O5AB 1GBFA 3I29A 4YOIA 1V2ST 2BVXH 2Y80A 1TX8A 1VITF 1A5IA 4ISOA 1HDTH 2OUAA 1GI3A 2FP7B 1UTLM 2GDDA 2FOAA 1OX1A 1ZZZA 4ABDA 4FUCA 1TNGA 1YPMH 2A4QA 2GTBA 1UHBA 1C5SA 2SNVA 3PM3A 3T25A 1RGQA 4GCHF 1OPHB 2VH0A 1NROH 1HXFH 3L33A 4NSYA 2B9LA 4Y8ZA 1XX9A 1MZDA 2ZECA 1P0SH 1ZGIA 3TPIZ 1FY5A 1THSH 3U9AH 1PPBH 1J9CH 1QY6A 3PMHB 1SHYA 1V2OT 1BMNH 1X7AC 3EYDA 5FXLA 1G30B 2Y7XA 3SU3A 3VXEH 2F9NA 4WWYA 2ANMH 1ACBE 1GL1A 3BSQA 3Q3YA 1UK3A 2VIOA 2ZCHP 2BY5X 2P16A 2PLXA 4IW4E 1GHBG 1C1RA 1W0ZU 5JB9S 3RXLA 1SFQB 3TLOA 4BTIB 4CRAA 1SGTA 2FOBA 1LHFH 1IAUA 2TGTA 4BAMB 5L6NH 1UK2A 1P01A 5DGJA 1QBOA 3RMOH 4ISNA 4TY6A 3Q76A 1Y3UA 2UUFB 5JBTA 2HNTC 2H9TH 1VITG 3HPTB 4X2VA 1T32A 5LH8A 1ZJDA 4OS5A 5DP5A 2Y5GA 7ESTE 3W95A 1TMBH 3EAJA 3SQEE 1C5TA 2R2MB 3E0PB 3O8CA 2BD8A 1XVOA 4GHTA 4H6SB 1O34A 3S9AA 1ZSLA 1TGNA 2M5TA 2CHAB 4BXSA 1TGTA 1EOLA 2TPIZ 1C4Y2 4YT6H 4X6MA 1TOMH 1C2EA 4CHAB 3JZ1B 4JYVH 3SU5A 1ANEA 4IBLH 5HGGA 2BX4A 3F1SB 1C2JA 5HXFA 2P3FH 1C1NA 2ZU5A 1ZHPA 4K8YA 1CA0B 2FOMB 1D9IA 1GI9B 1ETSH 2VWMA 1AHTH 4NFFA 1PPEE 2XNIA 1YM0A 2HGTH 3M37A 3TNTA 4DVAU 1DUAA 1V2QT 1H8IH 2QXJA 1EP5A 5EPNA 3QGJA 1L1GA 2Q6FA 1GGDC 1PPZA 2ZHWH 4CRCA 2OINA 1IQKA 2PGQB 1MQ5A 2IPHA 5GWZA 4I8KA 1KTTB 1WTHD 2P8OB 1EZXC 2ULLA 5A8YA 4Q7YA 1PPCE 3UY9A 1NRPH 1BITA 3UR6A 1VJ9U 2CN0H 1GVKB 1JOUB 2H5DA 3LT3A 1AUTC 3FANA 3NXPA 2ZU3A 1KSNA 2SGPE 4FUGA 1S6HA 4X0WU 5BRRE 1IQJA 1YPEH 3ESTA 3M36A 5FPSA 1GI5A 1NTPA 1XUGA 4BAQB 1THPB 2A5IA 1FI8A 3HKIB 2A32A 4K1SA 2EI7A 2A0QB 3ZZ6A 1V2UT 2ZGCA 1UVTH 1JWTA 1QA7A 4MPWA 2XCFA 1IQNA 1A7SA 4JYTA 1IQFA 1OWIA 3SJ8A 1NT1A 1MAXA 1GWAA 1V2PT 2F9OA 3LOXA 1V2NT 2J94A 3KGPA 1C5NH 4I8LA 4DT7B 1AVWA 1KXBA 1MKXK 1O38A 1C5XB 1EQ9A 1RS0A 1GBJA 3GDVA 2WUCA 4Q7XA 3QDZB 4E05H 3TVJB 4H6TA 4Y76A 3AW1A 1C5VA 1LPKB 2EI6A 1GI6A 3A7ZA 2GT7A 3MI4A 4YLQH 2ZG0H 3P8GA 2BZAA 1TABE 1C1VH 2CJIA 3G01A 3U69H 1LHCH 4CRGA 1HAYB 3TH3H 1OWHA 2ZC9H 3RU4D 2STAE 3KNXA 3RC6A 1LO6A 1OYQA 2VVUA 5JDUB 1MCTA 1TPOA 3BTHE 1KY9A 1HV7A 1UTOA 1WQVH 5DP7A 4LZ4B 1XXDA 1Z7KA 1HUTH 3FP8E 1QTFA 2TGPZ 3SUEA 1CT4E 2CHAC 1DS2E 2XRCA 5G4BA 3SNAA 3ZVDA 1PPGE 1UVPA 2ODPA 4IC5A 3TIUA 1DLEA 2Z9LA 4CHAC 1C2MA 5DP3A 1EAIA 1GBIA 2GV7A 1GI4A 3PROA 1KYNA 2CF9H 3BTWE 5H4IB 1L1JA 4K1EA 1ABIH 2FOCA 2WINI 1A1RA 2ZEBA 5EPYA 1PQ5A 1GHVH 3RMMH 2ZQ1A 1O3BA 1Z1JA 9ESTA 1D3DB 1O3HA 3CS0A 2A4OA 4OS1A 2VGCB 5TCCA 2G4TA 1SLVB 3FZDA 3RXPA 4X8VH 1WBGB 1GJ4H 2FI5E 1SGCA 4MNYA 4X8UH 4E7RG 3KF2A 3BTQE 2SGAA 5CMXH 3BG4B 5JB8S 4LK4A 1LHDH 2BLVA 3P8NA 3Q00A 1S82A 1SGPE 2PGBB 2QN5T 1QB1A 2PKAB 4BOHA 1P2IA 4NA7A 2BDGA 2BDAA 1GJ9B 4NG9H 2F9VA 3RXMA 1DPOA 1B7XB 2A2QH 2ZGHA 6LPRA 8GCHF 1QBVH 3GCHB 1NS3A 5C1YA 2A4RA 2ZPRA 3BF6H 2UWLA 2XBWA 1ZRBA 2VJ1A 2ZFQH 3LGVA 1EPTC 1TOCB 4INHA 5TCAA 1G3DA 1ANCA 2BXUH 1EZQA 1T4UH 8LPRA 1P3CA 4FU9A 1C2KA 1OP8A 1Z6JH 3U1JB 2AMQA 1UCYK 1QGFA 2VIPA 1L4DA 2OTVA 1H9HE 4UONA 1ANBA 4OGYA 1TYNA 1EPTA 1K22H 1SC8U 3R0FA 4WF8A 4D9RA 1UTQA 5GJ4B 3MHWU 1EJNA 1F0TA 1HAIH 1Z8RA 2A4GA 3LDXH 1ZSJA 4H4FA 1Z8JB 1C1TA 1CHGA 1YPHC 1ZSKA 4NA8A 3LC5A 1FJSA 1ELTA 3SNBA 1SOTA 1XKAC 2NWNA 3S0NA 1CBWB 1GHWH 2Y81A 1HIAB 2ALPA 3MU0A 1LKAA 2FWWA 3A7WA 1YPHE 4YT7H 3CS7A 4GUXA 3RXRA 1WCZA 1HJ8A 2NU3E 2VNTA 1A4WH 2EI8A 1Z71A 1AKSA 4CRFA 1O2WA 1CVWH 1P11E 1O39A 3SORA 1SLUB 1HAHH 4U32A 4HTCH 1QL8A 3DFJA 1S81A 4GAWA 1OS8A 2G81E 3CP7A 2FXRA 1YBWA 2BXTH 1O2NA 3E0NB 5J4SA 1NU9A 1BCUH 1NFWA 1QURH 2QF0A 1BTPA 5EODA 1ELBA 1UHBB 4AORA 1O2TA 1JRSA 3OU0A 5AFZH 2BLQA 3PLKA 3RXBA 3TK9A 1QQUA 1XXFA 1AMHA 2FM2A 3VEQB 4HFPB 1QJ6B 4MPXA 3MOCA 2PTNA 4ZMAH 5I46H 1SG8B 1G9IE 5DP6A 1O35A 3KL6A 5CHAB 1O5DH 1BUIA 2EA3A 2FIRH 1PJPA 1DLKB 4OGXA 1YLDA 1V2KT 3AASA 4TY7A 5FPTA 2PFEA 5F8TA 1O5GH 4SGBE 1GHAG 1MTSA 1GMDF 1V2TT 3M3TA 1P03A 2XC0A 1NO9H 3UOUA 3GY2A 1ELFA 4NFEA 1UCYE 3QTOH 1J17T 2BY8X 3M5NA 1O3AA 3ATLA 1NC6A 1WYKA 5E8EH 2CMYA 4I33A 2BQWB 2VGCC 1P05A 2VB0A 1BRCE 4Y7BA 1MBMA 3FFGA 1NFUA 3RMNH 2F9UA 4ASHA 1ELDE 1PPHE 1E36B 1T8OA 1ZHMA 3UQVA 1D6RA 1MTVA 2JKHA 3BG4C 3GY4A 1L4ZA 2OD3B 1BHXF 2ZHEH 1OWEA 4O9VA 2GCHF 4X1SU 3GYMA 1ELEE 3F9GA 5ETXA 3V7TA 3S9CA 3FP6E 2ZWLH 1UTNA 1GMCF 1O2QA 2K1QA 2PUQH 2QGRA 3MH5A 4NWLA 4TYDA 3RP2A 4A1XA 4K60A 3ZZ7A 3ZZBA 4WY3A 3S7KB 3O8BA 2C8WB 1A5HA 4THNH 2ZPSA 2ZFRH 1D3TB 2UWPA 1P04A 4AYYB 1Y59T 4X8TH 1AFQC 1ZOMA 1FXYA 1YC0A 1EATA 3H7OA 1MMJN 1ELGA 1CHOG 4FXGH 4BAOB 1P3EA 1TX6A 1G2LA 6GCHG 3PO1C 1C1MA 4WMDA 4K5ZA 1SQTA 1SGDE 1PFXC 3ELAH 1RXPA 1AU8A 2W3IA 1CGJE 1L1NA 1AB9B 2WYJA 2ZDNA 3I77A 4O3UA 2FDAA 4AG2A 1SB1H 5C67A 1AIXH 1C5WB 1EAUA 2VIQA 3UWJH 2XCNA 1D3QB 2G51A 4AGJA 4A92A 1SGFG 2P59A 4JZFH 4D76A 5LPRA 3PMJA 5AF9H 1AD8H 3VFEA 2AGIX 4KP0A 2ILNA 3RM0H 1XMNB 2Q1JA 4K2YA 1CT0E 5FAHA 1E38B 5AFYH 1EZSC 1C2IA 1QB9A 3P8FA 1MAYA 1BRAA 5A0CA 1Q3XA 1C2HA 4FU8A 5E2PA 4JZIA 1D6WA 3T5FH 3B23B 4M7GA 3D23A 1O3DA 1H9LB 1IQMA 1Z1IA 1N6XA 1UCYH 2FEQH 5C2ZA 1PPFE 1SFIA 1L2EA 5DJ7A 1ORFA 4YTAA 2NU4E