4XFQA

Crystal structure basis for pedv 3c like protease
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
298
structure length
298
Chain Sequence
AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVLRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVVNTDCFSILAAKTGVDVQRLLASIQSLHKNFGGKQILGYTSLTDEFTTGEVIRQMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the dimerization and substrate recognition specificity of porcine epidemic diarrhea virus 3C-like protease.
pubmed doi rcsb
source organism Porcine epidemic diarrhea virus
molecule tags Hydrolase
molecule keywords PEDV main protease
total genus 85
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4xfqA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xfqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xfqA01
3T62A 3DFJA 3P8GA 3A7YA 2J92A 4Y0YE 3RLWH 2J9NA 4FUDA 1OYQA 3CENA 5ESBA 4M7GA 2F9OA 2K1QA 2FS8A 2J94A 3DUXH 7GCHG 2W3KA 1DANH 2GKVE 2ZKSA 1C4Y2 3IITA 2NU0E 3ZYEA 4FUJA 3VXEH 1GBTA 3ZVDA 1EASA 5LPEA 2XNIA 2B9LA 4X8VH 1KLIH 4AG1A 1AO5A 3MU4A 1NFUA 2BDHA 4Y8YA 1SQAA 3FVFB 2ZPRA 1IQEA 2QYIA 1QB1A 2BD5A 1K22H 4R8TB 4GVUA 2BLVA 4TWWA 2ODQA 2Z9GA 1MZAA 1BJVA 4KTUA 1HAVB 4B2CA 3RMOH 1IQHA 1GI0A 3RLYH 3LJJA 2WUCA 1O32A 1QRZA 1UVUH 7KMEH 3SU5A 2NU4E 6CHAC 4DCDA 3QTOH 2ZA5A 1QIXB 3T26A 4X2VA 3A80A 1AB9B 1PQ5A 1GJ9B 2XWBI 2BY7X 2ZHEH 3RXTA 1WOFA 1NO9H 3U1JB 1HUTH 1EZQA 1VGCC 1V2QT 1P01A 3QK1A 1Y3YA 2GZ9A 1GMHG 4YZUA 2B0FA 2J95A 1TWXB 4INLA 1P10A 1T4VH 1TA6A 4Y8XA 3ZZCA 2M5TA 3ELAH 3GCHC 1ELAA 5GCHF 1VITG 3MWIU 2LPRA 3R0FA 2OQUA 2FOFA 3MNSA 3RU4T 4ISIH 1P0SH 3BIUH 4X6MA 1SLUB 3FZDA 2Q1JA 4K5ZA 4AOQA 1DWEH 3ZZ3A 1SLWB 3Q00A 1GI7B 3RMMH 4ABFA 1EAWA 1THRH 1YPKH 1YCPM 4QT8C 4LZ4B 3ZVGA 1KXEA 1CA0B 4J2YB 2PGBB 4NIYA 1JRSA 3TNTA 4GHTA 1QJ1B 2PLXA 1ZMJA 4YOGA 2AGEX 1V6DA 1UK4A 5FPTA 1OYTH 1NC6A 2C8YB 1ABIH 5IYTA 1ANBA 1WBGB 3S0NA 5FX6A 2V3HH 3RXDA 3ATIA 2ZDKA 1EQ9A 1YPJH 1BIOA 5BRRE 2BXTH 1CT2E 3NKKA 1DFPA 2O8MA 4K60A 3Q3XA 1ZHRA 1HXEH 1HIAA 2QAAA 4DT7B 1TX8A 5DP8A 1K1PA 4NZQA 1O31A 1XUFA 1W14U 4IC6A 3SV6A 3P8NA 1QGFA 1HFDA 2H6MA 3M7TA 3RXQA 3KQDA 1O3PB 1G3BA 5FBIA 2QC2A 3KN2A 1O2GH 2QXGA 3SNCA 4MDSA 4I8GA 1KXBA 3TH3H 4YLUA 1THPB 4X1NU 3RMLH 4CREA 4MNVA 2XRCA 1HJ8A 1MTNC 2XCFA 1J8AA 3UNRA 1GL1A 3HK3B 1XVMA 3TLOA 2FXRA 1O5FH 3EDXB 3GDUA 1SG8B 1C5LH 2SGAA 1TOMH 1TNJA 1JOUB 2VVUA 4BNRA 4BAMB 1G3EA 3UY9A 4F49A 1GJ8B 1TONA 1IHSH 3A7WA 1C5YB 2TGAA 3QTVH 1YBWA 1V2OT 3NK8A 4A7IB 2P16A 3RXKA 3ZZ5A 2A45B 4INHA 4CBOA 2NWNA 1XKAC 1F0RA 5DPAA 1AN1E 2F9BH 1GJ6A 4DURA 3CS7A 2BOKA 4NZLA 4X1RU 1GBKA 5HMAA 2AS9A 2A31A 3EE0B 2PKAA 1C9TA 3GYMA 1HRTH 2Z9KA 1UCYH 3Q3YA 1O5BB 2CF9H 3UPEA 1LVOA 1O2WA 2PWXA 1LO6A 1FAKH 1UVSH 1P04A 2GT7A 1YKTA 1C1VH 3OY5U 3A86A 1O2XA 1DY8A 3CP7A 1NRPH 3LC3A 1GI4A 3SU3A 4FUEA 3T29A 2FLRH 1QHRB 1GI6A 1NT1A 1C2DA 1MTVA 1L1JA 3GYLB 3SJ8A 3MH4A 4A92A 4YT6H 4E7NA 1O38A 2UUYA 2BQWB 5F6MA 2IOTA 4WMEA 2BZ6H 1CHGA 2AIQA 8ESTE 2CXVA 1K28D 4B1TA 3PMBB 1ZMNA 4ABGA 1Z6EA 2H9HA 1C5OH 1FNIA 1GVZA 9ESTA 5DP6A 3ZVBA 5AFZH 4MG3A 1Y5BT 3OU0A 2ZGHA 1S82A 3HKJB 3I29A 4YESB 3TGKE 2G51A 2HPPH 5K0HA 5DO4H 1N8OB 1BTWA 1BMLA 3RXLA 3ZYDA 1ELVA 1DSUA 2FODA 2O8UA 2FLBH 1TOCB 4Y79A 2H9EH 3VB3A 1GBFA 1GJBB 2FI5E 2STAE 2VH6A 1P2KA 3QO6A 1JBUH 3ESTA 3O8BA 4ZHLU 1KXDA 5EU8A 1GHVH 4XE4A 1H8DH 3TJNA 3Q77A 1C5UA 2GCHG 4IMQA 3T5FH 3O8CA 1L1GA 5A8XA 4NA7A 4I8LA 1TQ0B 3A8CA 3H5CB 4D9QA 1YCPK 2YOLA 4JZEH 1BTUA 1TE0A 2GZ8A 2BYAX 1L4DA 1TX6A 4IW4E 2HLCA 3AVZA 1LVBA 2FOAA 2FOEA 3FAOA 4O3UA 1THSH 5GPIB 3V12A 2XWAA 1HB0B 1TNHA 1FLEE 1C5RA 1ZGIA 2F9VA 3FP6E 4CHAB 4YTAA 2JETC 1E34B 3D49H 2XTTB 1GMDF 1GJ7B 3A7TA 1Y3VA 4UFEH 3EAJA 2ZF0H 1S83A 5EXNA 5FHTA 1W0ZU 1MAXA 2P8OB 4I8HA 1MMJN 2EI6A 1G2LA 2IN2A 2VIPA 1C5SA 2WV5A 1KLTA 3A84A 4Y71A 1TQ7B 3MNXA 2Y6TA 1ESBA 1EKBB 1TRMA 4BAOB 4Q7ZA 2FESH 3TGIE 2GDEH 1AMHA 2BQ7B 4Q7YA 2K7XA 1HV7A 4OS6A 4KKDA 2A4GA 1NFYA 1QNJA 4FUFA 5C1UA 4OGYA 1V2TT 1FPCH 1TFXA 2HWLB 4Q80A 3RXFA 1VGCB 5JB9S 2BDGA 5F03A 3MU8A 1X7AC 2BLWA 5FBEA 2VVCA 3QGJA 4TPYA 1G32B 2F91A 3R3GB 1BMNH 1UTNA 4Q7XA 1ANDA 1C1RA 1W12U 5C20A 3E8LA 1GHBG 1BBRH 1NRSH 3A7VA 1OP0A 4D7FA 3FANA 1QQUA 3EYDA 3GICB 1O2VA 3GY5A 2A32A 1GJDB 2ASUB 1H9HE 1OSSA 3P92A 1GHXH 1EJMA 2JH6D 3AAVA 3FZZA 3VB5A 1P2JA 1DS2E 1V3XA 5C5NA 2A2XH 3SI3H 4IMZA 1CBWC 5DG6A 3OY6U 1W7XH 4ZKOU 3ZV8A 2A0QB 1GJ5H 3GY4A 1GDQA 1C5WB 1ZSJA 5L30H 3S7HB 2BX3A 4HFPB 3RXUA 1H4WA 4TPIZ 1SL3A 1T32A 2OLGA 2ZHQH 5G4BA 1HPGA 2XBWA 1AZ8A 1QB9A 3MNBA 2BDYA 5DJ7A 1H8IH 4FVBA 2HALA 1BTXA 3ATWA 1G3CA 4FUBA 3BIVH 1O3DA 1PQAA 2TGPZ 4LK4A 2V6NA 1MU6B 1BTPA 1O33A 1BA8B 3FFGA 3BTQE 1BOQA 4K3JA 6ESTA 4D76A 1L1NA 1SGIB 1PFXC 4NSVA 3STJA 1DITH 3MMGA 4X1SU 4MPUA 1XUHA 2J34A 4ZKSU 1ETTH 2JETB 1V2LT 3LGUA 3P8OA 1UO6A 1MCVA 1TLDA 5EPNA 1GBLA 3S9CA 1CU1A 1VITH 3HATH 1GCTB 3I77A 3SQEE 4WMFA 3LH3A 3UQVA 3EA9A 2B5TB 2PUQH 1KTSB 1W11U 3EGKH 1HXFH 2G4UA 2V0BA 1LCYA 1MBMA 5CMXH 1AWFH 2BY5X 3BF6H 4HI3A 4H6TA 5E2PA 1G9IE 2R2MB 2Z94A 1VR1H 3LU9B 2V3OH 2HPQH 3BTTE 2Y81A 1O3JA 4A1VA 5LPFA 3GCOA 1CSOE 2WV4A 2F9PA 5TCCA 1K1MA 1V2MT 1XVOA 2QY0B 4CRCA 1ABJH 1F0SA 2FOGA 2ZCLP 3RU4D 2ANYA 5JPMH 5A0AE 2PTCE 2ZGCA 1RTKA 3JZ2B 2UWLA 1TPAE 1GI5A 2ANWA 3PLPA 1UTQA 5C1YA 1AE5A 2ZU3A 1F92A 4XBBA 1Y59T 3KGPA 1GI9B 1A7SA 4FUGA 1QL9A 2ZPQA 1PQ8A 3LC5A 4BXWA 1XUGA 1XXFA 2TGTA 1OXGA 3PMJA 1QA7A 4KTSA 1AIXH 1GBEA 2ZFRH 5J4QA 3SV2H 2BY6X 3SQHE 1SGRE 4K8YA 1GI2A 5E0GA 1C1OA 3V3MA 4CR9A 1F2SE 1XUIA 3TK5A 5DKMA 2WPKS 2ZTXA 1RTFB 1J14A 1LHEH 3MO6A 1FY4A 1HNEE 3E16B 4UFGH 2NU3E 3NPSA 4KGAA 1SGQE 3LDXH 1XXDA 4CRAA 1XKBC 1O36A 1C1QA 2BOHB 1V2WT 5F8TA 1HJ9A 3TK6A 3QZRA 4ZUHA 1FONA 1TGNA 3ZZ9A 2BD3A 3SN8A 1ZOMA 4I33A 2FO9A 1RRKA 3M3SA 5C1XA 1Z8JB 1O3KA 1ID5H 2TBSA 2FWWA 3BEIB 4GCHG 4MPXA 5JBTA 1MKWK 1QRWA 1NFWA 3A82A 1UK3A 3TITA 3GISB 1O3AA 4CHAC 4H42U 1TMBH 3SNBA 3M3TA 2QXIA 1HIAB 4RKOB 3PLKA 1E0FD 4SGAE 1EOJA 3TGJE 1SSXA 2ZG0H 1G36A 1ZLRA 3BEUA 1PPBH 3RC6A 3EBNA 4WH6A 1GBBA 2ZZUH 4BOHA 4Y10E 1TGTA 5H4IB 1BRAA 2ZEBA 1KIGH 1SOZA 3UUZA 4GSOA 1LHFH 1S0QA 5A0BA 1MQ6A 1B0EA 4FXGH 1J16A 5EGMA 1D3PB 5T6DA 1ZTKA 1TIOA 5ABWA 1BBRE 4NSYA 4XBDA 4NWKA 1BB0B 3LOXA 1Y5AT 2PKSB 1GBDA 1PPZA 1NFXA 1P02A 1BRBE 1C5NH 4K2YA 1DWCH 1DICA 4X6OA 1EOLA 1O3BA 1P12E 2Q6FA 3SJ9A 1UJ1A 1DOJA 2EA3A 3P95A 1TB6H 4JZIA 1SGFG 4FVDA 1O2PA 3VB7A 2VWLA 5CHAB 2HNTF 2VH0A 1BJUA 1V2VT 1O3MA 7LPRA 1YCPH 3VB4A 1YPGH 2AGGX 2FM2A 3BG4B 4GHQA 1JXPA 1RIWC 1MTNB 2ZDNA 1EZXC 1ZRBA 3T27A 3M5OA 3B9FH 2PKAB 1O2QA 5A8ZA 4K1EA 1C1MA 1Z71A 1C5VA 3OYPA 1SFIA 1K1LA 3LGYA 2EEKA 2GMTC 1P3EA 2ODPA 1XX9A 4DVAU 1TPPA 4ZXYH 4NIVA 2G5VA 4O9VA 1TMTH 4XOJA 4O3TA 3AAUA 2XC0A 1RXPA 2Y82A 1S84A 5GIBA 3VPKA 2CF8H 2YNAA 2VINA 3UOPA 1OP2A 1FMGA 4I32A 2AMDA 4A1TA 4JZDH 1T8NA 1XMNB 3C1KA 1YGCH 1KSNA 4H4FA 1VCQA 2Q6DA 1SGEE 4ZXXH 1OS8A 3NWUA 1C4U2 2FI3E 4DJZB 5IDKA 4B73A 3EA7A 5LGOA 1DE7H 2ZNKH 1SGCA 2Z3CA 1P06A 4IGDA 1O3CA 5EODA 2Y5HA 3TNSA 5EOKA 1TBRH 2PV9B 1G37A 4H6SB 1GG6C 1B5GH 5EW1H 1W8BH 2ULLA 2XC5A 5AFYH 5AF9H 4AZ2B 1D6WA 2R3UA 4RSPA 2QXHA 2R9PA 3BG8A 3ZZAA 1C2MA 1DWDH 4BAKB 4U01A 7ESTE 3GDSA 1Q2WA 1ORFA 2ZHDA 2Z9LA 5DP5A 1BQYA 1NU7B 2A7JA 4MNYA 1ESAA 2WPLS 2AFQB 4X1PU 1IAUA 5JBBS 1QB6A 3E3TA 5FCRA 4NA9H 1V2UT 2C8ZB 2A7HA 4X8SH 4WF8A 1MU8B 1OWEA 2HNTE 4KELA 2OC8A 2J4IA 2ZFSA 4ZROA 1WQVH 1QJ6B 3U98H 3RXPA 1O2OA 1FV9A 4ZH8A 2P59A 5T6GA 2PSYA 2BY9X 2A5AA 3SNEA 1ARCA 2ZCKP 2ZWLH 3FP7E 1Z1JA 1O2RA 1K21H 1MUEB 3IWMA 1A0JA 1DPOA 5AHGH 1IQLA 2H5CA 1BRCE 3QX5H 2TPIZ 3MU0A 5CHAC 1BZXE 4JCNA 3MH7A 1WCZA 3MNCA 5TJXA 4BXSA 1QQ4A 4OGXA 3BG4C 3KNXA 5EPYA 1HAIH 1GHBF 1RIWB 1SGDE 2QCYA 1AVGH 1FZZA 1NN6A 1O34A 1ELTA 5ESTE 4BAHB 4JZ1A 1OX1A 4JK6A 3RMNH 1Y3XA 3SHCH 3G01A 1PYTC 3BTWE 1WTHD 1MTUA 4A5TS 3SUEA 3RC5A 1F5KU 1C2HA 4YO9A 2GZ7A 1J9CH 1W0YH 3ZZ8A 1S6FA 1P05A 1GBJA 3SO3A 1ANCA 3SJIA 3MH6A 1EZSC 3NZIA 1ELBA 1GI8B 1HJAC 2G8TA 1V2ST 3PWCA 4D7GA 3BTEE 4ISOA 2WYJA 3RXRA 2OP9A 1IQKA 2EI7A 2XW9A 3TVJB 1YYY1 2VIDA 3P8FA 1MCTA 3GY8A 3MU5A 1C5QA 5L6NH 4YOJA 1QBVH 1FDPA 2XBYA 4Z6AH 1LQDB 4IN2A 2VWNA 4X6NA 1E36B 1LPZB 2A2QH 4RN6A 4YT7H 2SGPE 2VWMA 2P95A 1HBTH 2OTVA 1KXAA 1V2JT 2RA0A 1OOKB 1EB2A 1SMFE 3T28A 1HJAB 1S85A 2VVVA 1SB1H 1P09A 2ZHWH 4AGKA 1IQFA 1Z8GA 3MI4A 3F68H 1LMWB 1HAPH 2V35A 3P6ZB 1DLEA 2BQ6B 3SI4H 3I78A 1QR3E 2ZI2H 3RM2H 3ZZDA 4X2YA 1P8VC 2BMGB 3KL6A 1TGCA 2NU1E 3MHWU 1VJAU 2CGAA 3ZZ6A 3M3VA 1C1SA 1WV7H 4I7YH 1HAXB 1O0DH 2SNWA 1JMOH 3GOVB 3M37A 4CH8B 3KHVA 4JYUH 5C67A 3D62A 1G30B 4BTUB 3SU2A 1SOTA 2ZPSA 5HGGA 1NU9A 4B71A 2GD4B 2GDDA 3MH5A 1UCYK 6LPRA 1SGPE 3UREA 3KF2A 4X1QU 2Y7XA 1ZTJA 1RS0A 2OC7A 5DP9A 4JMYA 5FPSA 1CT0E 3A8DA 1C2KA 2FMJA 1EAUA 3M5MA 4ISNA 2QF0A 1SGNE 1ZJDA 1HAZB 2CHAC 1BTZA 3SU0A 1JWTA 4XSKU 1AVWA 8KME2 1C1WH 4MPVA 3A83A 3WY8A 1T8OA 1O2YA 1P11E 4A6LA 1O35A 1YPEH 1EP5A 3RXCA 1CE5A 1QURH 2GCHF 1IQIA 1EP6A 2GX4A 2F9NA 3U9AH 2VIWA 4AFSA 3QZQA 1T7CA 1ELDE 2VWOA 5E0JA 4NFFA 4ZAEA 1P2MA 2PTNA 2DE9A 1ELGA 2FOHA 1AE8H 3MTYA 2HNTC 4GPGA 1JRTA 1KXFA 3U8TH 1C2EA 1ZPCA 1CA8B 2UUFB 1KY9A 1HAOH 1TNGA 3AW1A 1AB9C 2AMPA 2FOMB 1J17T 2A7CA 2ESTE 4U30A 3W95A 2THFB 5L2YH 5EQQA 6CHAB 2R0LA 2ZDAH 2BM2A 1IQJA 1RTLA 2GV6A 5L2ZH 4VGCC 3V0XA 1GJ4H 1O2HA 2BDCA 1E37B 3KQBA 3ZVEA 3ITIA 3HPTB 2A1DB 2ZGJA 1WUNH 1C1TA 2ZFFH 4GUXA 2FIRH 2IJOB 2ZQ1A 3F9GA 1PYTD 5LPRA 1T8MA 2FTLE 1IQGA 1QFKH 1C5ZB 4B76A 3MO3A 2KAIB 1GHAG 3OSYA 2Z7FE 1A5IA 1GI3A 3RXHA 1A46H 1EJAA 4AYYB 1N1LA 4HGCA 3F9HA 3P70B 1DM4B 3ZV9A 1Y3WA 4IN1A 3GDVA 1YLDA 4UE7H 4TWYA 1IHTH 1FUJA 1O5DH 1Z6JH 2FYQA 3PYHA 4CR5A 1GHZA 4BTTB 1O5GH 1AI8H 1XM1A 1ZHMA 3E0NB 1O3NA 2CV3A 1DVAH 2TRMA 1OKXA 4NIXA 2BDIA 3B8JA 1A3BH 3BTHE 3PO1C 4XFQA 2EI8A 4D8NA 3SU4A 1YM0A 1EB1H 2UUKB 2XC4A 1GG6B 3RXEA 3M61U 8LPRA 3K65B 1ZGVA 1IOEA 3A7ZA 1W13U 2P3FH 1L2EA 1LKAA 2G52A 2H1UA 2FEQH 3MFJA 4GAWA 1TNKA 1PPFE 1C4V2 4NGAH 3P17H 1LHGH 4ABJA 3D65E 1DX5M 1FN8A 2ZTZA 4GCHF 1UTJA 4I31A 1EAIA 1ETSH 3UIRA 1YF4A 2FZZA 4K8BA 1O3HA 2G81E 1VITF 2VNTA 1LPKB 2BZAA 2STBE 1F5LA 1HAHH 3F1SB 3S69A 3PB1E 3W94A 4WXVA 4CRFA 1FY5A 2A5KA 1LPGB 2C90B 2CMYA 1Q31A 6GCHF 1OPHB 1LHCH 1GBMA 2UWPA 3PLBA 1O30A 2O9QA 2KAIA 1P2IA 3L33A 1O3OA 2OC0A 3RUOA 1F0TA 1O2TA 1BBRK 3RXOA 1EPTA 4MPWA 3L3TA 3IG6B 1WU1A 1AFQB 5SGAE 1MTWA 2ODYB 2BVXH 4B2BA 4IS5A 1FPHH 1DXWA 2DUCA 2YNBA 3SZNA 1CGIE 2P3UB 4INKA 3VXFH 4YLQH 2C8WB 4FUIA 3KQCA 1SFQB 4KTCA 2XBXA 4MLFB 1VCWA 1CQQA 2OQ5A 2W7SA 5ETXA 4OS4A 3SORA 2WPHS 1QL8A 3TU7H 5JBCS 3QN7A 2QIQA 1GBCA 2AEIH 2CJIA 4ABHA 4X2XA 4MNWA 1XUKA 3D23A 1JIMA 1QJ7B 1UTKA 1O39A 3U8RH 5A0CA 1C9PA 1ELEE 2FX6A 2XYAA 2H5DA 1TMUH 1UMAH 1L0ZA 4J1YA 2TIOA 1SBWA 1D3DB 1GDNA 5EQRA 1O37A 1YP9A 1ZRKA 1ZJKA 2ZU5A 3UR9A 3K6ZA 1SHYA 4TY6A 3RM0H 5A09A 3PO1B 4ASHA 6GCHG 1FIWA 1CVWH 1YPMH 1K1IA 2SGFE 4HZHA 1O3GA 2BDBA 4THNH 1FJSA 3SUDA 2ZU2A 4MNXA 4KP0A 1ARBA 1KDQB 1YC0A 4Y76A 1C5XB 1D3TB 2VGCB 1W7GH 3T2NA 1O2JA 2PR3A 1IQNA 1IQMA 2RDLA 1OWHA 1Z7KA 3ZZ4A 1F0UA 1CGHA 2P3TB 3A8AA 1O3LA 2ZGBH 4ZKNU 1EAXA 3V7TA 2EC9H 2AIPA 1O2LA 1CA0C 3BSQA 2VIVA 1UVTH 2ZDLA 4X8UH 3SUFA 2HVXA 4AORA 1LVYA 2FS9A 1V2PT 3RXMA 3VFEA 3Q76A 1TNIA 3GY2A 1W2KH 2P93A 4OS2A 3F9FA 2A4QA 2GT8A 1AQ7A 2F83A 3ZVCA 2AMQA 5T6FA 1P9UA 3ZVAA 1SC8U 2Q6GA 5DP3A 5BPEA 3BTFE 1MD8A 4LOYH 3S9BA 2PHBA 2FX4A 3SNDA 2GCTC 1C2IA 4O97A 2ZC9H 1O2SA 2FDAA 2JH5D 4ISLA 1DT2A 2SGDE 2WPJS 4DIIH 2C93B 2G00A 5DP7A 5JYIA 4AYVB 1AKSB 4R0IA 1O2KA 2AYWA 1TBQH 5EXLA 1SPJA 1ZPBA 4WH8A 1DUEA 1NESE 2VIQA 1PPCE 3SGAE 1FAXA 4BANB 2H9TH 1TA2A 4Y11E 1A1RA 5LH8A 2QGRA 3K2UA 1K9OE 3LH1A 2R2WU 3ZZ7A 2BX4A 1FN6A 1TBZH 1ZR0A 4TYDA 1NRRH 4AGJA 2GCTB 4E06H 1UK2A 1NRQH 3LGVA 3RDZA 3NCLA 3KQEA 4Y0ZE 3QUMP 1MAYA 2ZFTA 3EA8A 3SHAH 4ABIA 3ZZBA 2HOBA 1HDTH 1KDQA 1VCPA 3SV9A 1AGJA 2Y5GA 5T3HA 2ZU4A 2ZDVH 2A4RA 2F9UA 1EX3A 1O2NA 1UHBB 3ODFA 3AASA 1BHXB 1AZZA 9LPRA 1H1BA 3RXSA 3QWCH 2IPHA 2O8LA 3E91A 2VIOA 4X8TH 3TJOA 2BD8A 3SGQE 3UQOA 5F8XA 1C5TA 2WPIS 1GGDC 3TIUA 5FXLA 2OBQA 3BTDE 3VGCC 2W26A 5GDSH 2VGCC 4WY3A 3PTNA 4AB8A 3ENSB 1JIRA 1VJ9U 4UFDH 4ABDA 5EXMA 3U1IB 2ZCHP 4I8KA 1UTMA 4B75A 4ABAA 1HGTH 2QV1A 1AFEH 3MYWA 2FTMA 1TALA 2VJ1A 3KEEA 3DHKH 1P57B 5AVDA 2D2DA 2HGTH 5E8EH 3UR6A 4E7RG 4MTBA 3ODDA 4ZKRU 2SGQE 1GBAA 2ALVA 2FI4E 2ZHFH 4WJG2 3K9XB 1O5EH 4ZHMU 1TABE 2UWOA 1WYKA 3LGIA 1SHHB 1A3EH 3LONA 3STIA 4CRDA 1HYLA 2ZIQH 1BITA 2C4FH 3RXJA 4NIWA 3OX7U 4MVNA 4JYTA 1MD7A 1GJAB 4X0WU 2BD9A 1AHTH 1ZYOA 8GCHF 1ZTLA 2QA9E 2BLOA 1WTGH 1TGBA 1A5HA 1AVXA 1Z8RA 3RXBA 1O5CB 1FY3A 2AH4X 3SUGA 2A4OA 4OS7A 1LTOA 1O3IA 2FOCA 1B7XB 3ATMA 1WSSH 3LT3A 2ANKH 1A61H 1SGFA 2PFEA 1Y8TA 2BY8X 1UTPA 4O03A 5I25A 5FX5A 1EXFA 2ZP0H 1HAGE 1HLTH 4UDWH 4UEHH 2O8WA 1CT4E 1K1OA 3L6PA 1AD8H 3LPRA 2FYRA 2PW8H 4BAQB 1ESTA 1V2NT 4AFUA 1OWIA 2I6QA 1ZHPA 2WUBA 5HXFA 4DGJA 1SI5H 2OC1A 2B7DH 1GMHF 3RXIA 1OP8A 4B2AA 2AGIX 1GHWH 3LKWA 4ZHAA 1DWBH 1AWHB 4Y7AA 4WWYA 1A2CH 3SW2B 2PSXA 1Y3UA 1BT7A 2BD7A 3A88A 1V2KT 1CO7E 3RXGA 1FI8A 1SGYE 2LIZA 5GCHG 1DUAA 5B6OA 1HAYB 1GHAF 3GCTF 3UTUH 4JK5A 4TY7A 5J4SA 1ZSLA 3BV9B 3PM3A 1GVKB 4FUHA 3T25A 4DIHH 1OWJA 3SNAA 5C2ZA 3SU1A 1GGDB 1NY22 2A5IA 1W3CA 1C1PA 1GPZA 3A85A 3GY3A 1O2ZA 4DOQA 1Y5UT 3SU6A 4Y6DA 8GCHG 4NCYA 1O2MA 2O8TA 4B74A 1U6QA 5EQSA 2D1JA 3SJOA 1O5AB 4LXBH 1BHXF 3QLPH 3E1XB 4I8JA 2BD4A 4CRBA 3TK9A 1GHYH 1QL7A 1A4WH 5A2MH 1MZDA 3E90B 1HAVA 4K1TA 2ZFQH 4VGCB 3M36A 3VEQB 5FAHA 2HRVA 1BRUP 2Z6BD 4K69A 1YLCA 2OINA 1RD3B 1P3CA 3NUMA 1D3QB 1BMMH 3HGNA 3H7OA 1ZMLA 1T8LA 2Z3DA 1EPTC 2SNVA 3BEFB 1S6HA 1FIZA 3DD2H 1MKXH 3M35A 3MOCA 1SVPA 3KIDU 2B8OH 1C2FA 2NU2E 3DA9B 2F3CE 4X2WA 3TH4H 4AFQA 2UUJB 1T31A 4SGBE 1K2I1 1BMAA 4IBLH 1QA0A 1SGTA 2OBOA 3E0PB 1DDJA 3RXAA 5JBAS 2R0KA 1S5SA 5DGJA 3UNSA 3A8BA 3TJVA 2ZFPH 5HYOA 3PMAB 5EG4A 1RGQA 2RA3A 1EZUC 1ZPZA 3A87A 4NFEA 1F7ZA 4F4OC 3RC4A 3A7XA 2W7UA 1TPSA 1YPHE 2ZO3H 1BCUH 1AU8A 2J2UA 1KLJH 3F9EA 1FY1A 3PWBA 1PQ7A 1UVOA 1SLVB 1O2UA 5FPYA 3KCGH 2JKHA 2C8XB 4PROA 1EUFA 1MBQA 2OCVB 2BDAA 3VB6A 1FQ3A 1NPMA 4DY7B 2ZGXH 4WMDA 5HM2A 5JDUB 1A0HB 5E0HA 1BDAA 2D26C 1GBIA 2QXJA 3PTBA 3SBKA 1QBNA 3RU4E 3O8DA 3RXVA 1NZQH 1NROH 5A8YA 2QN5T 5HM9A 1ELCA 1T4UH 2QF3A 3E6PH 1C2GA 1C5MD 2BB4A 3M7UA 1RFNA 1TX7A 3LIWA 5PTPA 2H2ZA 1K1NA 4K1SA 1O2IA 1QBOA 2BVSH 2XBVA 1YPLH 1A0LA 2WINI 3S9AA 1UCYE 2SGEE 3M5LA 2AERH 2BXUH 1VZQH 4HTCH 5DP4A 2Z9JA 2ILNA 2VB0A 2GMTB 1K1JA 4MQAA 1KXCA 2Y7ZA 2CN0H 3GY6A 1GMDG 1BUIA 2GV7A 2BD2A 4CH2B 1AFQC 3HGPA 3JZ1B 4Y8ZA 3URDA 1C2LA 1Z1IA 2DE8A 1G2MA 3RP2A 4ABBA 4ESTE 1GJCB 4YM9A 4DG4A 1QY6A 1UVPA 5CE1A 3PROA 2VU8E 3GCTG 4NG9H 5FCKA 4OS1A 1N6YA 1C5PA 3DT0H 3M5NA 3O8RA 1H9LB 1ETRH 2FP7B 1EPTB 1LDTT 1CHOF 1D9IA 1GDUA 2G55A 2XXLA 4AN7A 1L4ZA 2Z9IA 4OS5A 2ZECA 2GTBA 3K6YA 2I6SA 4XBCA 5E2OA 4CRGA 5TCAA 1MKWH 2TGDA 3BN9A 4AFZA 2Z3EA 1D6RA 1TGSZ 3UOUA 1WAYB 1SR5C 3LGWA 1TPOA 4Z0KA 4E05H 5JB8S 4IC5A 3ZVFA 2RCEA 2W5EA 3UWIA 3A81A 1BTYA 4FU7A 4UD9H 4AX9H 1EATA 1Z8IB 1F5RA 3N7OA 2ALPA 4DW2U 1KYNA 4LZ1H 1D4PB 2CHAB 1EJNA 3URCA 2ZTYA 1MH0A 3S7KB 1ZZZA 2D8WA 5GXPA 4JZFH 5GWZA 3PMHB 4AB9A 2ZDMA 1O3FA 1A5GH 1OWDA 3MO9A 3NXPA 1V2RT 1S0RA 3MU1A 1QCPA 1ZSKA 1RJXB 1FXYA 1XUJA 3Q3KA 1WQSA 1HCGA 4AG2A 1UTLM 3UFAA 1NM6A 3SV7A 2BHGA 3OTJE 1GCDA 1LQEA 1QRXA 1DXPA 4BTIB 1AKSA 1TYNA 3QGNB 1PPEE 3UWJH 7GCHF 1QTFA 1NRNH 1FY8E 1ANEA 2PGQB 2P8OC 2ZU1A 2WYGA 3C27B 3FP8E 4CBNA 4UONA 5EW2H 1S81A 2Y80A 1C2JA 1W10U 1G3DA 2GVFA 4RKJB 3GY7A 4A1XA 2BVRH 1P03A 4NA8A 4WVPE 1CGJE 1MTSA 2GP9B 3QDZB 1E38B 2PKSC 1PPGE 1DLKB 3U8OH 3HK6B 2RG3A 2P94A 2BLQA 2GGVB 1C1UH 2LNCA 1GWAA 1GMCG 4X6PA 1O3EA 1P2NA 5F8ZA 2OXSA 4ZMAH 5C5OA 3HKIB 5K7RA 1LVMA 1GVLA 3H7TA 1DSTA 5GJ4B 1AY6H 3AW0A 1TNLA 1GI1A 1GMCF 3BTKE 4Y7BA 2J38A 3LGTA 3TH2H 4UFFH 4YOIA 1SQOA 1AUJA 1NS3A 3GCNA 2FOBA 2WPMS 1ACBE 1DY9A 2SFAA 3ATKA 3F6UH 4Q2KA 3LJOA 2G4TA 1OWKA 3ATLA 4U2WA 1GL0E 1J15A 1SLXB 3A89A 2G5NA 4FU9A 1CBWB 2OD3B 3CS0A 1PPHE 2C3SA 4FUCA 4GLYA 1B0FA 3EQ0H 3SOSA 3GCHB 1Q3XA 4NWLA 3PV4A 1H9IE 2PUXB 2Y5FA 2ANMH 3TJUA 1NTPA 1KTTB 1BTHH 1N6XA 4U32A 4ABEA 1GCTC 3BTGE 1YPHC 1TAWA 2OUAA 3U69H 1GBHA 1ELFA 4ISHH 5DK1A 1P9SA 2FPZA 1SQTA 1UTOA 2W3IA 3UNQA 1LHDH 1UHBA 3B23B 4FU8A 4D9RA 2R3YA 3SGBE 1MQ5A 5I46H 1C1NA 3BTME 3VGCB 1P2QA 1N8OC 3SJKA 1TRYA 1E35B 1CHOG 1MKXK 5C3NA 4JYVH 1P2OA 2XCNA 3TPIZ 2BTCE 3V13A 1M9UA 1AUTC 1TRNA 4XDEA 4WXIA 1LKBA 3DFLA 3M7QA 1PJPA 2ZQ2A 3SV8A 2JH0D 1INCA
chains in the Genus database with same CATH superfamily
3T62A 3DFJA 3P8GA 5EJZA 3A7YA 2J92A 4Y0YE 3RLWH 2J9NA 4FUDA 1OYQA 3CENA 5ESBA 4M7GA 2F9OA 2K1QA 2FS8A 2J94A 3DUXH 7GCHG 2W3KA 1DANH 2GKVE 2ZKSA 1C4Y2 3IITA 2NU0E 3ZYEA 4FUJA 3VXEH 2WHXA 1GBTA 3ZVDA 2LP6A 1EASA 5LPEA 2XNIA 2B9LA 4X8VH 1KLIH 4AG1A 3F2GA 1AO5A 3MU4A 1NFUA 2BDHA 4Y8YA 1SQAA 3FVFB 2ZPRA 1K0HA 1IQEA 2QYIA 1QB1A 2BD5A 1K22H 4R8TB 4GVUA 2BLVA 4TWWA 2ODQA 2Z9GA 1MZAA 1BJVA 4KTUA 1HAVB 4B2CA 3RMOH 1IQHA 1GI0A 3RLYH 3LJJA 2WUCA 1O32A 1QRZA 1UVUH 7KMEH 3SU5A 4B6FA 2NU4E 6CHAC 4DCDA 3QTOH 2ZA5A 1QIXB 3T26A 4X2VA 3A80A 1AB9B 1PQ5A 1GJ9B 2XWBI 2BY7X 2ZHEH 3RXTA 1YWUA 4AC9A 1WOFA 1NO9H 3U1JB 1HUTH 1EZQA 1VGCC 2QE7D 1V2QT 1P01A 3QK1A 1Y3YA 2GZ9A 1GMHG 4YZUA 2B0FA 2J95A 1TWXB 4INLA 1P10A 1T4VH 1TA6A 4Y8XA 3ZZCA 2M5TA 3ELAH 3GCHC 1ELAA 5GCHF 1VITG 3MWIU 2LPRA 3R0FA 2OQUA 2FOFA 3MNSA 3RU4T 4ISIH 1P0SH 2HLDD 3BIUH 4X6MA 1SLUB 3FZDA 1E1QD 2Q1JA 3DSOA 4K5ZA 4AOQA 1DWEH 3ZZ3A 1SLWB 3Q00A 1GI7B 3RMMH 4ABFA 1EAWA 1THRH 1YPKH 1YCPM 2VBCA 4QT8C 4LZ4B 3ZVGA 1KXEA 1CA0B 4J2YB 2PGBB 4NIYA 1JRSA 5KECA 3TNTA 4GHTA 1QJ1B 2PLXA 1ZMJA 4YOGA 2AGEX 1V6DA 1UK4A 5FPTA 2WZQA 1OYTH 1NC6A 2C8YB 1ABIH 5IYTA 1ANBA 1WBGB 3S0NA 5FX6A 2V3HH 3RXDA 3ATIA 2ZDKA 1EQ9A 1YPJH 1BIOA 5BRRE 2BXTH 1CT2E 3NKKA 1DFPA 3WWBA 2O8MA 4K60A 2YMSB 3Q3XA 1ZHRA 1HXEH 1HIAA 2QAAA 4DT7B 1TX8A 5DP8A 1K1PA 4NZQA 1O31A 1XUFA 1W14U 4IC6A 3SV6A 3P8NA 1QGFA 1HFDA 2H6MA 3M7TA 3RXQA 3KQDA 1O3PB 1G3BA 5FBIA 2QC2A 3KN2A 1O2GH 2QXGA 3SNCA 4MDSA 4I8GA 1KXBA 3TH3H 4YLUA 1THPB 4X1NU 3RMLH 4CREA 2J98A 4MNVA 2XRCA 1HJ8A 4ACBA 1MTNC 2XCFA 1J8AA 3UNRA 1GL1A 3HK3B 1XVMA 3TLOA 2FXRA 1O5FH 3EDXB 3GDUA 1SG8B 1C5LH 2SGAA 1TOMH 2WV9A 1TNJA 1JOUB 2VVUA 4BNRA 4BAMB 1G3EA 3UY9A 4F49A 1GJ8B 1TONA 1IHSH 3A7WA 1C5YB 2TGAA 4P00A 3QTVH 1YBWA 1V2OT 3NK8A 4A7IB 2P16A 3RXKA 3ZZ5A 2A45B 4INHA 4CBOA 2NWNA 1XKAC 1F0RA 5DPAA 1AN1E 2F9BH 1GJ6A 4DURA 3CS7A 2BOKA 4NZLA 4X1RU 1GBKA 5HMAA 2AS9A 2A31A 3EE0B 2PKAA 1C9TA 3GYMA 1HRTH 2Z9KA 1UCYH 3Q3YA 1O5BB 2CF9H 3UPEA 1LVOA 1O2WA 2PWXA 1LO6A 1FAKH 1UVSH 1P04A 2GT7A 1YKTA 1C1VH 3OY5U 3A86A 1O2XA 1DY8A 3CP7A 1NRPH 3LC3A 1GI4A 3SU3A 4FUEA 3T29A 2FLRH 1QHRB 1GI6A 1NT1A 1C2DA 1MTVA 1L1JA 3GYLB 3SJ8A 3MH4A 4A92A 2HVYB 4YT6H 4E7NA 1O38A 2UUYA 2BQWB 5F6MA 2IOTA 4WMEA 2BZ6H 1CHGA 2AIQA 8ESTE 2CXVA 1K28D 4B1TA 3PMBB 2WSSD 1ZMNA 4ABGA 1Z6EA 2H9HA 1C5OH 1FNIA 1GVZA 9ESTA 5DP6A 3ZVBA 5AFZH 4MG3A 1Y5BT 3EE7A 3OU0A 2ZGHA 1S82A 3HKJB 3I29A 4YESB 3TGKE 2G51A 2HPPH 5K0HA 5DO4H 1N8OB 1BTWA 1BMLA 3RXLA 3ZYDA 1ELVA 1DSUA 2FODA 2O8UA 5HIYA 2FLBH 1TOCB 4Y79A 2H9EH 3VB3A 1GBFA 1GJBB 2FI5E 2STAE 2VH6A 1P2KA 3QO6A 1JBUH 3ESTA 3O8BA 4ZHLU 1KXDA 5EU8A 1GHVH 4XE4A 1H8DH 3TJNA 2KFWA 3Q77A 1C5UA 2GCHG 4IMQA 3DCLA 3T5FH 5HKKD 1NBMD 3O8CA 1L1GA 5A8XA 4NA7A 4I8LA 1TQ0B 3A8CA 3H5CB 4D9QA 1YCPK 2YOLA 4JZEH 1BTUA 1TE0A 2GZ8A 2BYAX 4P02A 1L4DA 1TX6A 4IW4E 4ASUD 2HLCA 3AVZA 1LVBA 2FOAA 2FOEA 3FAOA 4O3UA 1THSH 5GPIB 3V12A 2XWAA 1HB0B 1TNHA 1FLEE 1C5RA 1ZGIA 2F9VA 3FP6E 4CHAB 4YTAA 2JETC 1E34B 3D49H 2XTTB 5C0TA 2OK5A 1GMDF 1GJ7B 3A7TA 1Y3VA 4UFEH 3EAJA 2ZF0H 1S83A 5EXNA 5FHTA 1W0ZU 1MAXA 2P8OB 4I8HA 1MMJN 2EI6A 1G2LA 2IN2A 2VIPA 1C5SA 2WV5A 1KLTA 3A84A 4Y71A 1TQ7B 3MNXA 2Y6TA 1ESBA 1EKBB 1TRMA 3PRBA 4BAOB 4Q7ZA 2FESH 3TGIE 2GDEH 1AMHA 2BQ7B 4Q7YA 2K7XA 1HV7A 4OS6A 4KKDA 2A4GA 1NFYA 1QNJA 4FUFA 5C1UA 4OGYA 1V2TT 1FPCH 1TFXA 2HWLB 4Q80A 3RXFA 1VGCB 5JB9S 2BDGA 5F03A 3MU8A 1X7AC 2BLWA 5FBEA 2VVCA 3QGJA 4TPYA 1OHHD 1G32B 2F91A 3WW7A 3R3GB 1BMNH 1UTNA 4Q7XA 1ANDA 1C1RA 1W12U 5C20A 3E8LA 1GHBG 1BBRH 1NRSH 3A7VA 1OP0A 4D7FA 3FANA 1QQUA 3EYDA 3GICB 2PP6A 1O2VA 3GY5A 2A32A 1GJDB 2ASUB 1H9HE 1OSSA 3P92A 1GHXH 1EJMA 2JH6D 3AAVA 3FZZA 3VB5A 1P2JA 1DS2E 1V3XA 5C5NA 2A2XH 3SI3H 4IMZA 1CBWC 5DG6A 3OY6U 1W7XH 4ZKOU 4ACAA 3ZV8A 2A0QB 1GJ5H 3GY4A 1GDQA 1C5WB 1ZSJA 5L30H 3S7HB 2BX3A 4HFPB 3RXUA 1H4WA 4TPIZ 1SL3A 1T32A 2OLGA 2ZHQH 5G4BA 1HPGA 2XBWA 1AZ8A 1QB9A 3MNBA 2BDYA 5DJ7A 1H8IH 4FETA 4FVBA 5EIYA 2HALA 1BTXA 3ATWA 1G3CA 4FUBA 3BIVH 1O3DA 5CDFE 1PQAA 2TGPZ 4LK4A 4Z1MD 2V6NA 1MU6B 1BTPA 1O33A 1BA8B 3FFGA 3BTQE 1BOQA 4K3JA 6ESTA 4D76A 1L1NA 1SGIB 1PFXC 4NSVA 3STJA 1DITH 3MMGA 4X1SU 1W0JD 4MPUA 1XUHA 2J34A 4ZKSU 1ETTH 2JETB 1V2LT 3LGUA 3F0OA 3P8OA 1UO6A 1MCVA 1TLDA 5EPNA 1GBLA 3S9CA 1CU1A 1VITH 3HATH 1GCTB 3I77A 3SQEE 4WMFA 3LH3A 3UQVA 3EA9A 2B5TB 2RDEA 2PUQH 1KTSB 1W11U 3EGKH 1HXFH 2G4UA 2V0BA 1LCYA 1MBMA 5CMXH 1AWFH 2BY5X 3BF6H 4HI3A 4H6TA 5E2PA 1G9IE 2R2MB 2Z94A 1VR1H 3LU9B 2V3OH 3F3BA 2HPQH 3BTTE 2Y81A 1O3JA 4A1VA 5LPFA 3GCOA 1CSOE 2WV4A 2F9PA 5TCCA 1K1MA 1V2MT 1XVOA 2QY0B 4CRCA 1ABJH 1F0SA 1E79D 2FOGA 2ZCLP 3RU4D 2ANYA 5JPMH 5A0AE 2PTCE 2ZGCA 1RTKA 3JZ2B 2UWLA 1TPAE 1GI5A 2ANWA 3KYGA 3PLPA 1UTQA 5C1YA 1AE5A 2K0QA 2ZU3A 1F92A 4XBBA 1Y59T 3KGPA 1GI9B 1A7SA 4FUGA 1QL9A 2ZPQA 1PQ8A 3LC5A 4BXWA 1XUGA 1XXFA 2TGTA 1OXGA 3PMJA 1QA7A 4KTSA 1AIXH 1GBEA 2ZFRH 5J4QA 3SV2H 2BY6X 3SQHE 1SGRE 4K8YA 1GI2A 5E0GA 5FL7D 1C1OA 3V3MA 4CR9A 1F2SE 1XUIA 3TK5A 5DKMA 2WPKS 2ZTXA 1RTFB 1J14A 1LHEH 3MO6A 1WDIA 1FY4A 5EJ1A 1HNEE 3E16B 4UFGH 2NU3E 3NPSA 4KGAA 1SGQE 3LDXH 1XXDA 4CRAA 1XKBC 1O36A 1C1QA 2BOHB 1V2WT 5F8TA 1HJ9A 3TK6A 3QZRA 4ZUHA 1FONA 1TGNA 3ZZ9A 2BD3A 3SN8A 1ZOMA 4I33A 2FO9A 1RRKA 3M3SA 5C1XA 1Z8JB 1O3KA 1ID5H 2TBSA 2FWWA 3BEIB 4GCHG 4MPXA 5JBTA 1MKWK 1QRWA 1NFWA 3A82A 1UK3A 3TITA 3GISB 3FOAA 2RFKC 1O3AA 4CHAC 4H42U 1TMBH 1YY3A 3SNBA 3M3TA 2QXIA 1HIAB 2J97A 4RKOB 3PLKA 1E0FD 4SGAE 1EOJA 3TGJE 1SSXA 2ZG0H 2V3MA 1G36A 1ZLRA 3BEUA 1PPBH 3RC6A 3EBNA 4WH6A 1GBBA 2ZZUH 4BOHA 4Y10E 1TGTA 5H4IB 1BRAA 2ZEBA 1KIGH 1SOZA 3UUZA 4GSOA 1LHFH 3SZEA 1S0QA 5A0BA 1MQ6A 1B0EA 4FXGH 1J16A 5EGMA 1D3PB 5T6DA 1ZTKA 1TIOA 5ABWA 1BBRE 4NSYA 4XBDA 4NWKA 1BB0B 3LOXA 1Y5AT 2PKSB 1GBDA 1PPZA 1NFXA 1P02A 1BRBE 1C5NH 4K2YA 1DWCH 1DICA 4X6OA 1EOLA 1O3BA 1P12E 2Q6FA 3SJ9A 1UJ1A 1DOJA 2EA3A 3P95A 1E1RD 1TB6H 4JZIA 1SGFG 4FVDA 1O2PA 3VB7A 2VWLA 2KX4A 5CHAB 2HNTF 5HIZA 2VH0A 1BJUA 1V2VT 4XD7D 1O3MA 7LPRA 1YCPH 2IPQX 3VB4A 1YPGH 1H8ED 2AGGX 2FM2A 3BG4B 4GHQA 1JXPA 1RIWC 1MTNB 2ZDNA 1EZXC 1ZRBA 3T27A 3M5OA 3B9FH 2PKAB 1O2QA 5A8ZA 4K1EA 1C1MA 1Z71A 1C5VA 3OYPA 1SFIA 1K1LA 3LGYA 2EEKA 3CNRA 2GMTC 1P3EA 2ODPA 1XX9A 4DVAU 1TPPA 4ZXYH 4NIVA 2G5VA 4O9VA 1TMTH 4XOJA 4O3TA 3AAUA 2XC0A 1RXPA 2Y82A 1S84A 5GIBA 3VPKA 2CF8H 2YNAA 2VINA 3UOPA 1OP2A 1FMGA 4I32A 4YXWD 2AMDA 4A1TA 4JZDH 3F2FA 1T8NA 1XMNB 3C1KA 1YGCH 1KSNA 4H4FA 1VCQA 2Q6DA 1SGEE 4ZXXH 2IJD1 1OS8A 3NWUA 1C4U2 2FI3E 4DJZB 5IDKA 4B73A 3EA7A 5LGOA 1DE7H 2ZNKH 1SGCA 2Z3CA 1P06A 4IGDA 1O3CA 5EODA 2Y5HA 3TNSA 5EOKA 1TBRH 2KZ4A 2PV9B 1G37A 4H6SB 1GG6C 1B5GH 5EW1H 1W8BH 2ULLA 2XC5A 5AFYH 5AF9H 4AZ2B 1D6WA 2R3UA 4RSPA 2QXHA 2R9PA 3BG8A 3ZZAA 1C2MA 3UAIC 1DWDH 4BAKB 4U01A 7ESTE 3GDSA 1Q2WA 1ORFA 2ZHDA 2Z9LA 5DP5A 1BQYA 1NU7B 2A7JA 4MNYA 1ESAA 2WPLS 2AFQB 4X1PU 1IAUA 5JBBS 3ZIAD 1QB6A 3E3TA 5FCRA 4NA9H 1V2UT 2C8ZB 2A7HA 4X8SH 4WF8A 1MU8B 1OWEA 2HNTE 4KELA 2OC8A 2J4IA 2ZFSA 1YLNA 4ZROA 1WQVH 1QJ6B 2JJ1D 3U98H 3RXPA 1O2OA 1FV9A 4ZH8A 2P59A 5T6GA 2PSYA 2BY9X 2A5AA 3SNEA 1ARCA 2ZCKP 2ZWLH 3FP7E 1Z1JA 1O2RA 1K21H 1MUEB 3IWMA 1A0JA 1DPOA 5AHGH 1IQLA 2H5CA 1BRCE 3QX5H 2TPIZ 3MU0A 5CHAC 1BZXE 4JCNA 3MH7A 2GJGA 1WCZA 3MNCA 4XRNA 5TJXA 4BXSA 1QQ4A 4OGXA 5F53A 3BG4C 3KNXA 5EPYA 1HAIH 1GHBF 1RIWB 1SGDE 2QCYA 1AVGH 1FZZA 1NN6A 1O34A 1ELTA 5ESTE 4BAHB 4JZ1A 1OX1A 4JK6A 3RMNH 1Y3XA 3SHCH 3G01A 1PYTC 3BTWE 1WTHD 1MTUA 4A5TS 3SUEA 3RC5A 1F5KU 1W0KD 1C2HA 4YO9A 2GZ7A 1J9CH 1W0YH 3ZZ8A 1S6FA 1P05A 1GBJA 3SO3A 1ANCA 3SJIA 3MH6A 1EZSC 3NZIA 1ELBA 1GI8B 1HJAC 2G8TA 1V2ST 3PWCA 4D7GA 3BTEE 4ISOA 2WYJA 3RXRA 2OP9A 1IQKA 2EI7A 4B6EA 2KCOA 2XW9A 3TVJB 1YYY1 2VIDA 3P8FA 1MCTA 3GY8A 3MU5A 1C5QA 5L6NH 4YOJA 1QBVH 1FDPA 2XBYA 4Z6AH 1LQDB 4IN2A 2VWNA 4X6NA 1E36B 1LPZB 2A2QH 4RN6A 4YT7H 2SGPE 2VWMA 2P95A 1HBTH 2OTVA 1KXAA 1V2JT 2RA0A 1OOKB 1EB2A 5DSFA 1SMFE 3T28A 1HJAB 1S85A 2VVVA 1SB1H 1P09A 2ZHWH 4AGKA 4TT3D 1IQFA 1Z8GA 3MI4A 3F68H 1LMWB 1HAPH 2QF5A 2V35A 3P6ZB 1DLEA 2BQ6B 3SI4H 3I78A 1QR3E 2ZI2H 3RM2H 3ZZDA 4X2YA 1P8VC 2BMGB 3KL6A 1TGCA 2NU1E 3MHWU 5KGOA 1VJAU 2CGAA 5EJLA 3OTPA 3ZZ6A 3M3VA 1C1SA 1WV7H 4I7YH 1HAXB 1O0DH 2SNWA 1JMOH 3GOVB 3M37A 4CH8B 4M9FA 3KHVA 4JYUH 1NBME 5C67A 3D62A 1G30B 3UB0A 4BTUB 3SU2A 1SOTA 2ZPSA 5HGGA 1NU9A 4B71A 2GD4B 2GDDA 3MH5A 2KR7A 1UCYK 6LPRA 1SGPE 3UREA 3KF2A 4X1QU 2Y7XA 1ZTJA 3PV2A 1RS0A 2OC7A 5DP9A 4JMYA 5FPSA 1CT0E 3A8DA 1C2KA 2FMJA 1EAUA 3M5MA 4ISNA 2QF0A 1SGNE 1ZJDA 3FO8D 1HAZB 2CHAC 1BTZA 3SU0A 1JWTA 4XSKU 1AVWA 8KME2 1C1WH 4MPVA 3A83A 3WY8A 1T8OA 1O2YA 1P11E 4A6LA 1O35A 1YPEH 1EP5A 3RXCA 1CE5A 1QURH 2GCHF 1IQIA 1EP6A 2GX4A 2F9NA 3U9AH 2VIWA 4AFSA 3QZQA 1T7CA 1ELDE 2VWOA 5E0JA 4NFFA 4ZAEA 1P2MA 2PTNA 2DE9A 1ELGA 2FOHA 1AE8H 3MTYA 2HNTC 4GPGA 1JRTA 2JDID 1KXFA 3U8TH 1C2EA 1ZPCA 1CA8B 2UUFB 1KY9A 1HAOH 1TNGA 3AW1A 1AB9C 2AMPA 2FOMB 1J17T 2A7CA 2ESTE 4U30A 3W95A 2THFB 5L2YH 5EQQA 6CHAB 2R0LA 2ZDAH 1SKYE 2BM2A 1IQJA 1RTLA 2GV6A 5L2ZH 4VGCC 3V0XA 1GJ4H 1O2HA 2BDCA 1E37B 3KQBA 3ZVEA 3ITIA 3HPTB 2A1DB 2ZGJA 1WUNH 1C1TA 2ZFFH 2V7QD 4GUXA 2FIRH 2IJOB 2ZQ1A 3F9GA 1PYTD 3NRLA 4ZCNA 5LPRA 1T8MA 2FTLE 1IQGA 1QFKH 1C5ZB 4B76A 3MO3A 2KAIB 1GHAG 3OSYA 2Z7FE 1A5IA 1FX0B 1GI3A 3RXHA 1A46H 1EJAA 4AYYB 3DSPA 1N1LA 4HGCA 3F9HA 3P70B 1DM4B 3ZV9A 1Y3WA 4IN1A 3GDVA 1YLDA 4UE7H 4TWYA 1IHTH 1FUJA 1O5DH 1Z6JH 2FYQA 3PYHA 4CR5A 1GHZA 4BTTB 1O5GH 1AI8H 1XM1A 1ZHMA 3E0NB 1O3NA 2CV3A 1DVAH 2TRMA 1OKXA 4NIXA 2BDIA 3B8JA 1A3BH 3BTHE 3PO1C 4XFQA 2EI8A 4D8NA 3SU4A 1YM0A 1EB1H 2UUKB 2XC4A 1GG6B 3RXEA 3M61U 8LPRA 1WXRA 3K65B 1ZGVA 1IOEA 3A7ZA 1W13U 2P3FH 1L2EA 1LKAA 5GNDA 2G52A 2H1UA 2QF4A 2FEQH 3MFJA 4GAWA 1TNKA 1PPFE 1C4V2 4NGAH 3P17H 1LHGH 3DSGA 3H09A 4ABJA 3D65E 1DX5M 1FN8A 2ZTZA 4GCHF 1UTJA 4I31A 1VKYA 1EAIA 1ETSH 3UIRA 1YF4A 2FZZA 4K8BA 1O3HA 2G81E 1VITF 2VNTA 1LPKB 2BZAA 2STBE 1F5LA 1HAHH 3F1SB 3S69A 3PB1E 3W94A 4WXVA 4CRFA 1FY5A 3OFND 2A5KA 1LPGB 2C90B 2CMYA 1Q31A 6GCHF 1OPHB 1LHCH 1GBMA 2UWPA 3PLBA 1O30A 2O9QA 2KAIA 1P2IA 3L33A 1O3OA 2OC0A 3RUOA 1F0TA 1O2TA 1BBRK 3RXOA 5KEDA 1EPTA 4MPWA 3L3TA 3IG6B 1WU1A 1AFQB 5SGAE 1MTWA 2ODYB 2BVXH 4B2BA 4IS5A 4F48B 1FPHH 1DXWA 2DUCA 2YNBA 3SZNA 1CGIE 2P3UB 4INKA 3VXFH 4YLQH 2C8WB 4FUIA 3KQCA 3N7EA 1SFQB 4KTCA 2XBXA 4MLFB 1VCWA 1CQQA 2OQ5A 2W7SA 5ETXA 4OS4A 3SORA 3VG8A 2JIZD 2WPHS 4RT1A 1QL8A 3TU7H 5JBCS 3QN7A 2QIQA 1GBCA 2AEIH 2CJIA 4ABHA 4X2XA 4MNWA 3PRDA 1XUKA 3D23A 2W6JD 1JIMA 1QJ7B 1UTKA 1O39A 3U8RH 5A0CA 1C9PA 1ELEE 2FX6A 2XYAA 2H5DA 1TMUH 1UMAH 1L0ZA 4J1YA 2TIOA 1SBWA 1D3DB 1GDNA 5EQRA 1O37A 1YP9A 1ZRKA 1ZJKA 3U28C 2ZU5A 3UR9A 3K6ZA 3OEHD 1SHYA 1QZ8A 4TY6A 3RM0H 5A09A 3PO1B 4ASHA 6GCHG 1FIWA 1CVWH 1YPMH 1K1IA 2SGFE 4HZHA 1O3GA 2BDBA 4THNH 1FJSA 3SUDA 2ZU2A 4MNXA 4KP0A 1ARBA 1KDQB 1YC0A 4Y76A 1C5XB 1D3TB 2VGCB 1W7GH 3T2NA 1O2JA 4DT4A 2PR3A 1IQNA 1IQMA 2RDLA 1OWHA 1Z7KA 3ZZ4A 1F0UA 1CGHA 2P3TB 3A8AA 1O3LA 2ZGBH 4ZKNU 1EAXA 3V7TA 2EC9H 2AIPA 1O2LA 1CA0C 3BSQA 2VIVA 1UVTH 2ZDLA 4X8UH 3SUFA 2HVXA 4AORA 1LVYA 2FS9A 1V2PT 3RXMA 3VFEA 3Q76A 1TNIA 3GY2A 1W2KH 2P93A 4OS2A 3F9FA 2A4QA 2GT8A 1AQ7A 2F83A 3ZVCA 2AMQA 5T6FA 1P9UA 2AHME 3ZVAA 1SC8U 2Q6GA 3OAAD 5DP3A 5BPEA 3BTFE 1MD8A 4LOYH 3S9BA 2PHBA 2FX4A 3SNDA 2GCTC 1C2IA 4O97A 1MABB 2ZC9H 1O2SA 2FDAA 2L74A 5C0UA 2JH5D 4ISLA 1DT2A 2SGDE 2WPJS 4DIIH 2C93B 5B6LA 2G00A 2JJ2D 5DP7A 5JYIA 4AYVB 1AKSB 4R0IA 1O2KA 2AYWA 1TBQH 5EXLA 1SPJA 1ZPBA 4WH8A 1DUEA 1NESE 2VIQA 1PPCE 3SGAE 1FAXA 4BANB 2H9TH 1TA2A 4Y11E 1A1RA 5LH8A 2QGRA 3K2UA 1K9OE 3LH1A 2R2WU 3ZZ7A 2BX4A 1FN6A 1TBZH 1ZR0A 4TYDA 4OM9A 1NRRH 4AGJA 2GCTB 4E06H 1UK2A 1NRQH 3LGVA 3RDZA 3NCLA 2XOKD 3KQEA 4Y0ZE 2F4LA 3QUMP 1MAYA 2EY4C 2ZFTA 3EA8A 3SHAH 4ABIA 3ZZBA 2HOBA 1HDTH 1KDQA 1VCPA 3SV9A 1AGJA 2Y5GA 5T3HA 2ZU4A 2ZDVH 2A4RA 2F9UA 2F43B 1EX3A 1O2NA 5C94A 1UHBB 3ODFA 3AASA 1BHXB 1AZZA 9LPRA 1H1BA 3RXSA 3QWCH 2IPHA 2O8LA 3E91A 2VIOA 4X8TH 3TJOA 2BD8A 3SGQE 3UQOA 5F8XA 1C5TA 2WPIS 1GGDC 3TIUA 5FXLA 2OBQA 3BTDE 3VGCC 2W26A 5GDSH 2VGCC 4WY3A 3PTNA 4AB8A 3ENSB 1JIRA 1VJ9U 4UFDH 4ABDA 5EXMA 3U1IB 2ZCHP 4I8KA 1UTMA 4B75A 4ABAA 1HGTH 2QV1A 1AFEH 3MYWA 2FTMA 1TALA 2LELA 2VJ1A 3KEEA 3DHKH 1P57B 5AVDA 2D2DA 2HGTH 3N7DA 5E8EH 3UR6A 4E7RG 4MTBA 3ODDA 4ZKRU 1GBAA 2SGQE 2ALVA 2FI4E 2ZHFH 4WJG2 3K9XB 1O5EH 4ZHMU 1TABE 2UWOA 1WYKA 3LGIA 1SHHB 1A3EH 3LONA 3STIA 4CRDA 1HYLA 2ZIQH 1BITA 2C4FH 3RXJA 3SYJA 4NIWA 3OX7U 4MVNA 4JYTA 1MD7A 1GJAB 4X0WU 2BD9A 1AHTH 1ZYOA 8GCHF 1ZTLA 2QA9E 2BLOA 1WTGH 1TGBA 1A5HA 1AVXA 1Z8RA 2YMSD 1O5CB 1FY3A 2AH4X 3RXBA 3SUGA 2A4OA 4OS7A 1LTOA 1O3IA 2FOCA 1B7XB 3ATMA 1WSSH 3LT3A 2ANKH 1A61H 5T1VA 1SGFA 2PFEA 1Y8TA 2BY8X 2K8IA 1UTPA 4O03A 5I25A 5FX5A 1EXFA 2ZP0H 1HAGE 1HLTH 4UDWH 4UEHH 2O8WA 1CT4E 1K1OA 3L6PA 1AD8H 3LPRA 2FYRA 2PW8H 4BAQB 1ESTA 1V2NT 4AFUA 1EFRD 1OWIA 2I6QA 1ZHPA 2WUBA 5HXFA 4DGJA 1SI5H 2OC1A 2B7DH 2J5UA 1GMHF 3RXIA 1OP8A 4B2AA 2AGIX 1GHWH 1BMFD 3LKWA 4ZHAA 1DWBH 1AWHB 4Y7AA 4WWYA 1A2CH 3SW2B 2PSXA 1Y3UA 4FOUC 1BT7A 2BD7A 3A88A 3GS9A 1V2KT 1CO7E 3RXGA 1FI8A 1SGYE 2LIZA 5GCHG 1DUAA 5B6OA 1HAYB 1GHAF 3GCTF 3UTUH 4JK5A 4TY7A 5J4SA 1ZSLA 4I86A 3BV9B 3PM3A 1GVKB 4FUHA 3T25A 3PV5A 4DIHH 1OWJA 3SNAA 5C2ZA 3SU1A 1GGDB 1NY22 2A5IA 1W3CA 1C1PA 1GPZA 3A85A 3GY3A 1O2ZA 4RT0A 1Y5UT 3SU6A 4Y6DA 4DOQA 4NCYA 1O2MA 8GCHG 2O8TA 4B74A 1U6QA 5EQSA 5C17A 3N99A 2D1JA 3SJOA 1O5AB 4LXBH 1BHXF 3QLPH 3E1XB 4I8JA 2BD4A 4CRBA 3TK9A 1GHYH 1QL7A 1A4WH 5A2MH 1MZDA 3E90B 1HAVA 4K1TA 2ZFQH 3OE7D 4VGCB 3M36A 3VEQB 5FAHA 2HRVA 1BRUP 2Z6BD 4K69A 1YLCA 2OINA 1RD3B 1P3CA 3NUMA 1D3QB 1BMMH 3HGNA 3H7OA 1ZMLA 1T8LA 2Z3DA 1EPTC 2SNVA 3BEFB 1S6HA 2M2AA 1FIZA 3DD2H 1MKXH 3M35A 3MOCA 1SVPA 3KIDU 2B8OH 1COWD 1C2FA 2NU2E 3DA9B 2F3CE 4X2WA 3TH4H 4AFQA 2UUJB 1T31A 4SGBE 1K2I1 1BMAA 4IBLH 1QA0A 1SGTA 2OBOA 3E0PB 1DDJA 3RXAA 5JBAS 2KCPA 2R0KA 1S5SA 5DGJA 3UNSA 3A8BA 4Q63A 3TJVA 2WPDD 2ZFPH 5HYOA 3PMAB 5EG4A 1RGQA 2KCAA 2RA3A 1EZUC 1ZPZA 3A87A 4NFEA 1F7ZA 4F4OC 3RC4A 3A7XA 2W7UA 2EQNA 3FKSD 1TPSA 1YPHE 2ZO3H 1BCUH 1AU8A 2J2UA 1KLJH 3F9EA 1FY1A 3PWBA 1PQ7A 1UVOA 1SLVB 2XNDD 1O2UA 5FPYA 3KCGH 2JKHA 2C8XB 4PROA 1EUFA 1MBQA 2OCVB 2BDAA 3VB6A 1FQ3A 1NPMA 3F0PA 4DY7B 2ZGXH 4WMDA 5HM2A 5JDUB 1A0HB 5E0HA 1BDAA 2D26C 1GBIA 2QXJA 3PTBA 2W6ID 3SBKA 1QBNA 3RU4E 3O8DA 3RXVA 1NZQH 1NROH 5A8YA 2QN5T 5HM9A 1ELCA 1T4UH 2QF3A 3E6PH 1C2GA 1C5MD 2BB4A 3M7UA 1RFNA 1TX7A 3LIWA 5PTPA 2H2ZA 1K1NA 4K1SA 1O2IA 1QBOA 2BVSH 2XBVA 1YPLH 1A0LA 2WINI 3S9AA 1UCYE 2SGEE 3M5LA 2AERH 2BXUH 1VZQH 4HTCH 5DP4A 2Z9JA 2ILNA 2VB0A 2GMTB 1K1JA 4MQAA 1KXCA 2Y7ZA 2CN0H 3GY6A 1GMDG 1BUIA 2GV7A 2BD2A 4CH2B 1AFQC 3HGPA 3JZ1B 4Y8ZA 3URDA 1C2LA 1Z1IA 2DE8A 1G2MA 3RP2A 4ABBA 4ESTE 4F55A 1GJCB 4YM9A 4DG4A 1QY6A 1UVPA 5CE1A 3PROA 2VU8E 3GCTG 4NG9H 5FCKA 4OS1A 1N6YA 1C5PA 3DT0H 3M5NA 3O8RA 1H9LB 1ETRH 2FP7B 1EPTB 1LDTT 1CHOF 1H8HD 1D9IA 1GDUA 2G55A 2XXLA 4AN7A 1L4ZA 2Z9IA 4OS5A 2ZECA 2GTBA 3K6YA 2I6SA 4XBCA 5E2OA 4CRGA 5TCAA 1MKWH 2TGDA 3BN9A 4AFZA 3KYFA 2Z3EA 1D6RA 1TGSZ 3UOUA 1WAYB 1SR5C 3LGWA 1TPOA 4Z0KA 4E05H 5JB8S 1SQRA 4IC5A 3ZVFA 2RCEA 3F2HA 2YMSC 3KQ5A 2W5EA 4RI0A 3UWIA 3A81A 1BTYA 2KM0A 4FU7A 4UD9H 4AX9H 1EATA 1Z8IB 1F5RA 3N7OA 2ALPA 4DW2U 1KYNA 4LZ1H 1D4PB 2CHAB 1EJNA 3URCA 2ZTYA 4HG6A 1MH0A 3S7KB 1ZZZA 2D8WA 5GXPA 4JZFH 5GWZA 3PMHB 4AB9A 2ZDMA 1O3FA 1A5GH 1OWDA 5DN6D 3MO9A 3NXPA 1V2RT 1S0RA 3MU1A 1QCPA 1ZSKA 1RJXB 1FXYA 1XUJA 3Q3KA 1WQSA 5CHBA 1HCGA 4AG2A 1UTLM 3UFAA 1NM6A 3SV7A 2BHGA 3OTJE 1GCDA 1LQEA 1QRXA 1DXPA 3W1EA 4BTIB 1AKSA 1TYNA 3QGNB 1PPEE 3UWJH 7GCHF 1QTFA 1NRNH 1FY8E 1ANEA 2PGQB 2P8OC 2ZU1A 2WYGA 3C27B 3FP8E 4CBNA 4UONA 5EW2H 1S81A 2Y80A 1C2JA 1W10U 1G3DA 2GVFA 4RKJB 3GY7A 4A1XA 2BVRH 1P03A 3AK5A 4NA8A 4WVPE 1CGJE 1MTSA 2GP9B 3QDZB 1E38B 2PKSC 1PPGE 1DLKB 3U8OH 3HK6B 3MQKC 2RG3A 2P94A 2BLQA 2GGVB 4TSFD 1C1UH 2LNCA 1GWAA 1GMCG 4X6PA 1O3EA 1P2NA 5F8ZA 2OXSA 4ZMAH 5C5OA 1KMHB 3HKIB 5K7RA 1LVMA 1GVLA 3H7TA 1DSTA 5GJ4B 1AY6H 2L6OA 3AW0A 1TNLA 1GI1A 1GMCF 3BTKE 4Y7BA 2J38A 3LGTA 3TH2H 4UFFH 4YOIA 1SQOA 1AUJA 1NS3A 3GCNA 2FOBA 2WPMS 1ACBE 1DY9A 2SFAA 3ATKA 3F6UH 2CK3D 4Q2KA 3LJOA 2G4TA 1OWKA 3ATLA 4U2WA 1GL0E 1J15A 1SLXB 3A89A 2G5NA 1S6LA 4FU9A 1CBWB 2OD3B 3CS0A 1PPHE 2C3SA 4FUCA 4Q4LA 4GLYA 1B0FA 3EQ0H 3SOSA 3GCHB 1Q3XA 4NWLA 3PV4A 1H9IE 2PUXB 2Y5FA 2ANMH 3TJUA 1NTPA 1KTTB 1BTHH 1N6XA 4U32A 2KCYA 4ABEA 1GCTC 3BTGE 1YPHC 1TAWA 5IK2D 2OUAA 3U69H 1GBHA 3FN8A 1ELFA 4ISHH 5DK1A 1P9SA 1UW7A 2FPZA 1SQTA 1UTOA 2W3IA 3UNQA 1LHDH 1UHBA 3B23B 4FU8A 4D9RA 2R3YA 3SGBE 1MQ5A 5I46H 2J98B 1C1NA 3BTME 3OEED 1P2QA 3VGCB 1N8OC 3SJKA 1TRYA 1E35B 1CHOG 1MKXK 5C3NA 4JYVH 1P2OA 2XCNA 3TPIZ 3WWFA 2BTCE 3V13A 1M9UA 1AUTC 1TRNA 4XDEA 4WXIA 1LKBA 3DFLA 3M7QA 1PJPA 2ZQ2A 3SV8A 2JH0D 1INCA
chains in the Genus database with same CATH topology
3T62A 3DFJA 3P8GA 3A7YA 2J92A 4Y0YE 3RLWH 2J9NA 4FUDA 1OYQA 3CENA 5ESBA 4M7GA 2F9OA 2K1QA 2FS8A 2J94A 3DUXH 7GCHG 2W3KA 1DANH 2GKVE 2ZKSA 1C4Y2 3IITA 2NU0E 3ZYEA 4FUJA 3VXEH 1GBTA 3ZVDA 1EASA 5LPEA 2XNIA 2B9LA 4X8VH 1KLIH 4AG1A 1AO5A 3MU4A 1NFUA 2BDHA 4Y8YA 1SQAA 3FVFB 2ZPRA 1IQEA 2QYIA 1QB1A 2BD5A 1K22H 4R8TB 4GVUA 2BLVA 4TWWA 2ODQA 2Z9GA 1MZAA 1BJVA 4KTUA 1HAVB 4B2CA 3RMOH 1IQHA 1GI0A 3RLYH 3LJJA 2WUCA 1O32A 1QRZA 1UVUH 7KMEH 3SU5A 2NU4E 6CHAC 4DCDA 3QTOH 2ZA5A 1QIXB 3T26A 4X2VA 3A80A 1AB9B 1PQ5A 1GJ9B 2XWBI 2BY7X 2ZHEH 3RXTA 1WOFA 1NO9H 3U1JB 1HUTH 1EZQA 1VGCC 1V2QT 1P01A 3QK1A 1Y3YA 2GZ9A 1GMHG 4YZUA 2B0FA 2J95A 1TWXB 4INLA 1P10A 1T4VH 1TA6A 4Y8XA 3ZZCA 2M5TA 3ELAH 3GCHC 1ELAA 5GCHF 1VITG 3MWIU 2LPRA 3R0FA 2OQUA 2FOFA 3MNSA 3RU4T 4ISIH 1P0SH 3BIUH 4X6MA 1SLUB 3FZDA 2Q1JA 4K5ZA 4AOQA 1DWEH 3ZZ3A 1SLWB 3Q00A 1GI7B 3RMMH 4ABFA 1EAWA 1THRH 1YPKH 1YCPM 4QT8C 4LZ4B 3ZVGA 1KXEA 1CA0B 4J2YB 2PGBB 4NIYA 1JRSA 3TNTA 4GHTA 1QJ1B 2PLXA 1ZMJA 4YOGA 2AGEX 1V6DA 1UK4A 5FPTA 1OYTH 1NC6A 2C8YB 1ABIH 5IYTA 1ANBA 1WBGB 3S0NA 5FX6A 2V3HH 3RXDA 3ATIA 2ZDKA 1EQ9A 1YPJH 1BIOA 5BRRE 2BXTH 1CT2E 3NKKA 1DFPA 2O8MA 4K60A 3Q3XA 1ZHRA 1HXEH 1HIAA 2QAAA 4DT7B 1TX8A 5DP8A 1K1PA 4NZQA 1O31A 1XUFA 1W14U 4IC6A 3SV6A 3P8NA 1QGFA 1HFDA 2H6MA 3M7TA 3RXQA 3KQDA 1O3PB 1G3BA 5FBIA 2QC2A 3KN2A 1O2GH 2QXGA 3SNCA 4MDSA 4I8GA 1KXBA 3TH3H 4YLUA 1THPB 4X1NU 3RMLH 4CREA 4MNVA 2XRCA 1HJ8A 1MTNC 2XCFA 1J8AA 3UNRA 1GL1A 3HK3B 1XVMA 3TLOA 2FXRA 1O5FH 3EDXB 3GDUA 1SG8B 1C5LH 2SGAA 1TOMH 1TNJA 1JOUB 2VVUA 4BNRA 4BAMB 1G3EA 3UY9A 4F49A 1GJ8B 1TONA 1IHSH 3A7WA 1C5YB 2TGAA 3QTVH 1YBWA 1V2OT 3NK8A 4A7IB 2P16A 3RXKA 3ZZ5A 2A45B 4INHA 4CBOA 2NWNA 1XKAC 1F0RA 5DPAA 1AN1E 2F9BH 1GJ6A 4DURA 3CS7A 2BOKA 4NZLA 4X1RU 1GBKA 5HMAA 2AS9A 2A31A 3EE0B 2PKAA 1C9TA 3GYMA 1HRTH 2Z9KA 1UCYH 3Q3YA 1O5BB 2CF9H 3UPEA 1LVOA 1O2WA 2PWXA 1LO6A 1FAKH 1UVSH 1P04A 2GT7A 1YKTA 1C1VH 3OY5U 3A86A 1O2XA 1DY8A 3CP7A 1NRPH 3LC3A 1GI4A 3SU3A 4FUEA 3T29A 2FLRH 1QHRB 1GI6A 1NT1A 1C2DA 1MTVA 1L1JA 3GYLB 3SJ8A 3MH4A 4A92A 4YT6H 4E7NA 1O38A 2UUYA 2BQWB 5F6MA 2IOTA 4WMEA 2BZ6H 1CHGA 2AIQA 8ESTE 2CXVA 1K28D 4B1TA 3PMBB 1ZMNA 4ABGA 1Z6EA 2H9HA 1C5OH 1FNIA 1GVZA 9ESTA 5DP6A 3ZVBA 5AFZH 4MG3A 1Y5BT 3OU0A 2ZGHA 1S82A 3HKJB 3I29A 4YESB 3TGKE 2G51A 2HPPH 5K0HA 5DO4H 1N8OB 1BTWA 1BMLA 3RXLA 3ZYDA 1ELVA 1DSUA 2FODA 2O8UA 2FLBH 1TOCB 4Y79A 2H9EH 3VB3A 1GBFA 1GJBB 2FI5E 2STAE 2VH6A 1P2KA 3QO6A 1JBUH 3ESTA 3O8BA 4ZHLU 1KXDA 5EU8A 1GHVH 4XE4A 1H8DH 3TJNA 3Q77A 1C5UA 2GCHG 4IMQA 3T5FH 3O8CA 1L1GA 5A8XA 4NA7A 4I8LA 1TQ0B 3A8CA 3H5CB 4D9QA 1YCPK 2YOLA 4JZEH 1BTUA 1TE0A 2GZ8A 2BYAX 1L4DA 1TX6A 4IW4E 2HLCA 3AVZA 1LVBA 2FOAA 2FOEA 3FAOA 4O3UA 1THSH 5GPIB 3V12A 2XWAA 1HB0B 1TNHA 1FLEE 1C5RA 1ZGIA 2F9VA 3FP6E 4CHAB 4YTAA 2JETC 1E34B 3D49H 2XTTB 1GMDF 1GJ7B 3A7TA 1Y3VA 4UFEH 3EAJA 2ZF0H 1S83A 5EXNA 5FHTA 1W0ZU 1MAXA 2P8OB 4I8HA 1MMJN 2EI6A 1G2LA 2IN2A 2VIPA 1C5SA 2WV5A 1KLTA 3A84A 4Y71A 1TQ7B 3MNXA 2Y6TA 1ESBA 1EKBB 1TRMA 4BAOB 4Q7ZA 2FESH 3TGIE 2GDEH 1AMHA 2BQ7B 4Q7YA 2K7XA 1HV7A 4OS6A 4KKDA 2A4GA 1NFYA 1QNJA 4FUFA 5C1UA 4OGYA 1V2TT 1FPCH 1TFXA 2HWLB 4Q80A 3RXFA 1VGCB 5JB9S 2BDGA 5F03A 3MU8A 1X7AC 2BLWA 5FBEA 2VVCA 3QGJA 4TPYA 1G32B 2F91A 3R3GB 1BMNH 1UTNA 4Q7XA 1ANDA 1C1RA 1W12U 5C20A 3E8LA 1GHBG 1BBRH 1NRSH 3A7VA 1OP0A 4D7FA 3FANA 1QQUA 3EYDA 3GICB 1O2VA 3GY5A 2A32A 1GJDB 2ASUB 1H9HE 1OSSA 3P92A 1GHXH 1EJMA 2JH6D 3AAVA 3FZZA 3VB5A 1P2JA 1DS2E 1V3XA 5C5NA 2A2XH 3SI3H 4IMZA 1CBWC 5DG6A 3OY6U 1W7XH 4ZKOU 3ZV8A 2A0QB 1GJ5H 3GY4A 1GDQA 1C5WB 1ZSJA 5L30H 3S7HB 2BX3A 4HFPB 3RXUA 1H4WA 4TPIZ 1SL3A 1T32A 2OLGA 2ZHQH 5G4BA 1HPGA 2XBWA 1AZ8A 1QB9A 3MNBA 2BDYA 5DJ7A 1H8IH 4FVBA 2HALA 1BTXA 3ATWA 1G3CA 4FUBA 3BIVH 1O3DA 1PQAA 2TGPZ 4LK4A 2V6NA 1MU6B 1BTPA 1O33A 1BA8B 3FFGA 3BTQE 1BOQA 4K3JA 6ESTA 4D76A 1L1NA 1SGIB 1PFXC 4NSVA 3STJA 1DITH 3MMGA 4X1SU 4MPUA 1XUHA 2J34A 4ZKSU 1ETTH 2JETB 1V2LT 3LGUA 3P8OA 1UO6A 1MCVA 1TLDA 5EPNA 1GBLA 3S9CA 1CU1A 1VITH 3HATH 1GCTB 3I77A 3SQEE 4WMFA 3LH3A 3UQVA 3EA9A 2B5TB 2PUQH 1KTSB 1W11U 3EGKH 1HXFH 2G4UA 2V0BA 1LCYA 1MBMA 5CMXH 1AWFH 2BY5X 3BF6H 4HI3A 4H6TA 5E2PA 1G9IE 2R2MB 2Z94A 1VR1H 3LU9B 2V3OH 2HPQH 3BTTE 2Y81A 1O3JA 4A1VA 5LPFA 3GCOA 1CSOE 2WV4A 2F9PA 5TCCA 1K1MA 1V2MT 1XVOA 2QY0B 4CRCA 1ABJH 1F0SA 2FOGA 2ZCLP 3RU4D 2ANYA 5JPMH 5A0AE 2PTCE 2ZGCA 1RTKA 3JZ2B 2UWLA 1TPAE 1GI5A 2ANWA 3PLPA 1UTQA 5C1YA 1AE5A 2ZU3A 1F92A 4XBBA 1Y59T 3KGPA 1GI9B 1A7SA 4FUGA 1QL9A 2ZPQA 1PQ8A 3LC5A 4BXWA 1XUGA 1XXFA 2TGTA 1OXGA 3PMJA 1QA7A 4KTSA 1AIXH 1GBEA 2ZFRH 5J4QA 3SV2H 2BY6X 3SQHE 1SGRE 4K8YA 1GI2A 5E0GA 1C1OA 3V3MA 4CR9A 1F2SE 1XUIA 3TK5A 5DKMA 2WPKS 2ZTXA 1RTFB 1J14A 1LHEH 3MO6A 1FY4A 1HNEE 3E16B 4UFGH 2NU3E 3NPSA 4KGAA 1SGQE 3LDXH 1XXDA 4CRAA 1XKBC 1O36A 1C1QA 2BOHB 1V2WT 5F8TA 1HJ9A 3TK6A 3QZRA 4ZUHA 1FONA 1TGNA 3ZZ9A 2BD3A 3SN8A 1ZOMA 4I33A 2FO9A 1RRKA 3M3SA 5C1XA 1Z8JB 1O3KA 1ID5H 2TBSA 2FWWA 3BEIB 4GCHG 4MPXA 5JBTA 1MKWK 1QRWA 1NFWA 3A82A 1UK3A 3TITA 3GISB 1O3AA 4CHAC 4H42U 1TMBH 3SNBA 3M3TA 2QXIA 1HIAB 4RKOB 3PLKA 1E0FD 4SGAE 1EOJA 3TGJE 1SSXA 2ZG0H 1G36A 1ZLRA 3BEUA 1PPBH 3RC6A 3EBNA 4WH6A 1GBBA 2ZZUH 4BOHA 4Y10E 1TGTA 5H4IB 1BRAA 2ZEBA 1KIGH 1SOZA 3UUZA 4GSOA 1LHFH 1S0QA 5A0BA 1MQ6A 1B0EA 4FXGH 1J16A 5EGMA 1D3PB 5T6DA 1ZTKA 1TIOA 5ABWA 1BBRE 4NSYA 4XBDA 4NWKA 1BB0B 3LOXA 1Y5AT 2PKSB 1GBDA 1PPZA 1NFXA 1P02A 1BRBE 1C5NH 4K2YA 1DWCH 1DICA 4X6OA 1EOLA 1O3BA 1P12E 2Q6FA 3SJ9A 1UJ1A 1DOJA 2EA3A 3P95A 1TB6H 4JZIA 1SGFG 4FVDA 1O2PA 3VB7A 2VWLA 5CHAB 2HNTF 2VH0A 1BJUA 1V2VT 1O3MA 7LPRA 1YCPH 3VB4A 1YPGH 2AGGX 2FM2A 3BG4B 4GHQA 1JXPA 1RIWC 1MTNB 2ZDNA 1EZXC 1ZRBA 3T27A 3M5OA 3B9FH 2PKAB 1O2QA 5A8ZA 4K1EA 1C1MA 1Z71A 1C5VA 3OYPA 1SFIA 1K1LA 3LGYA 2EEKA 2GMTC 1P3EA 2ODPA 1XX9A 4DVAU 1TPPA 4ZXYH 4NIVA 2G5VA 4O9VA 1TMTH 4XOJA 4O3TA 3AAUA 2XC0A 1RXPA 2Y82A 1S84A 5GIBA 3VPKA 2CF8H 2YNAA 2VINA 3UOPA 1OP2A 1FMGA 4I32A 2AMDA 4A1TA 4JZDH 1T8NA 1XMNB 3C1KA 1YGCH 1KSNA 4H4FA 1VCQA 2Q6DA 1SGEE 4ZXXH 1OS8A 3NWUA 1C4U2 2FI3E 4DJZB 5IDKA 4B73A 3EA7A 5LGOA 1DE7H 2ZNKH 1SGCA 2Z3CA 1P06A 4IGDA 1O3CA 5EODA 2Y5HA 3TNSA 5EOKA 1TBRH 2PV9B 1G37A 4H6SB 1GG6C 1B5GH 5EW1H 1W8BH 2ULLA 2XC5A 5AFYH 5AF9H 4AZ2B 1D6WA 2R3UA 4RSPA 2QXHA 2R9PA 3BG8A 3ZZAA 1C2MA 1DWDH 4BAKB 4U01A 7ESTE 3GDSA 1Q2WA 1ORFA 2ZHDA 2Z9LA 5DP5A 1BQYA 1NU7B 2A7JA 4MNYA 1ESAA 2WPLS 2AFQB 4X1PU 1IAUA 5JBBS 1QB6A 3E3TA 5FCRA 4NA9H 1V2UT 2C8ZB 2A7HA 4X8SH 4WF8A 1MU8B 1OWEA 2HNTE 4KELA 2OC8A 2J4IA 2ZFSA 4ZROA 1WQVH 1QJ6B 3U98H 3RXPA 1O2OA 1FV9A 4ZH8A 2P59A 5T6GA 2PSYA 2BY9X 2A5AA 3SNEA 1ARCA 2ZCKP 2ZWLH 3FP7E 1Z1JA 1O2RA 1K21H 1MUEB 3IWMA 1A0JA 1DPOA 5AHGH 1IQLA 2H5CA 1BRCE 3QX5H 2TPIZ 3MU0A 5CHAC 1BZXE 4JCNA 3MH7A 1WCZA 3MNCA 5TJXA 4BXSA 1QQ4A 4OGXA 3BG4C 3KNXA 5EPYA 1HAIH 1GHBF 1RIWB 1SGDE 2QCYA 1AVGH 1FZZA 1NN6A 1O34A 1ELTA 5ESTE 4BAHB 4JZ1A 1OX1A 4JK6A 3RMNH 1Y3XA 3SHCH 3G01A 1PYTC 3BTWE 1WTHD 1MTUA 4A5TS 3SUEA 3RC5A 1F5KU 1C2HA 4YO9A 2GZ7A 1J9CH 1W0YH 3ZZ8A 1S6FA 1P05A 1GBJA 3SO3A 1ANCA 3SJIA 3MH6A 1EZSC 3NZIA 1ELBA 1GI8B 1HJAC 2G8TA 1V2ST 3PWCA 4D7GA 3BTEE 4ISOA 2WYJA 3RXRA 2OP9A 1IQKA 2EI7A 2XW9A 3TVJB 1YYY1 2VIDA 3P8FA 1MCTA 3GY8A 3MU5A 1C5QA 5L6NH 4YOJA 1QBVH 1FDPA 2XBYA 4Z6AH 1LQDB 4IN2A 2VWNA 4X6NA 1E36B 1LPZB 2A2QH 4RN6A 4YT7H 2SGPE 2VWMA 2P95A 1HBTH 2OTVA 1KXAA 1V2JT 2RA0A 1OOKB 1EB2A 1SMFE 3T28A 1HJAB 1S85A 2VVVA 1SB1H 1P09A 2ZHWH 4AGKA 1IQFA 1Z8GA 3MI4A 3F68H 1LMWB 1HAPH 2V35A 3P6ZB 1DLEA 2BQ6B 3SI4H 3I78A 1QR3E 2ZI2H 3RM2H 3ZZDA 4X2YA 1P8VC 2BMGB 3KL6A 1TGCA 2NU1E 3MHWU 1VJAU 2CGAA 3ZZ6A 3M3VA 1C1SA 1WV7H 4I7YH 1HAXB 1O0DH 2SNWA 1JMOH 3GOVB 3M37A 4CH8B 3KHVA 4JYUH 5C67A 3D62A 1G30B 4BTUB 3SU2A 1SOTA 2ZPSA 5HGGA 1NU9A 4B71A 2GD4B 2GDDA 3MH5A 1UCYK 6LPRA 1SGPE 3UREA 3KF2A 4X1QU 2Y7XA 1ZTJA 1RS0A 2OC7A 5DP9A 4JMYA 5FPSA 1CT0E 3A8DA 1C2KA 2FMJA 1EAUA 3M5MA 4ISNA