4XFQA

Crystal structure basis for pedv 3c like protease
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
298
structure length
298
Chain Sequence
AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVLRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVVNTDCFSILAAKTGVDVQRLLASIQSLHKNFGGKQILGYTSLTDEFTTGEVIRQMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEDV main protease
publication title Structural basis for the dimerization and substrate recognition specificity of porcine epidemic diarrhea virus 3C-like protease.
pubmed doi rcsb
source organism Porcine epidemic diarrhea virus
molecule tags Hydrolase
total genus 85
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4xfqA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xfqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xfqA01
1F0SA 3M5LA 5FXLA 1MKWH 3SJIA 3ODFA 3TH2H 3VB6A 4AB9A 1UK2A 2V3OH 4TWWA 4B2AA 3RXFA 3MO3A 3O8CA 1LHEH 1VCQA 2Z3EA 2Y6TA 1LTOA 3BV9B 1GJBB 4AX9H 1ORFA 2HPQH 3ZVAA 3A7ZA 3D62A 1Y3UA 1C1SA 2AS9A 2C3SA 3DT0H 2FDAA 4JZ1A 1GG6B 1FPCH 2ZGJA 4H6SB 4AYVB 3RXGA 4ZKRU 5C2ZA 2ZDKA 3TJOA 1O2TA 4R8TB 2HVXA 1MH0A 3FP8E 4JCNA 5LH8A 3A7TA 4FUGA 3MNXA 3RDZA 3MH5A 1HIAA 2ZF0H 3A86A 3D65E 5K7RA 1BUIA 1O0DH 2B9LA 1CT0E 3BTDE 2OQUA 1J8AA 5GCHF 3SO3A 2WPMS 3MYWA 1SC8U 1ZTLA 3B23B 1TE0A 2VWNA 5GCHG 1QL7A 2RCEA 1RTLA 1AHTH 1ESBA 4JYVH 1IQIA 1ELCA 1Z6JH 3CS0A 1PPCE 1AUJA 1E0FD 1W14U 1GWAA 1OOKB 3PROA 2NU1E 1MTNC 4NIXA 3RMLH 1Q3XA 5C5OA 4Y8XA 3SU4A 4JZIA 1THSH 5IDKA 1K22H 1HLTH 1O38A 2ZWLH 3VFEA 1FY3A 1QJ7B 1YYY1 1MTUA 5EXLA 1DWBH 3SGQE 3ODDA 1UTMA 1BTPA 2GD4B 1HAHH 3HGNA 4WY3A 3BF6H 3PWBA 3RXJA 1C2LA 1P2JA 1MKXH 1RS0A 3MU8A 4B2BA 5EG4A 2BDGA 1A7SA 1P03A 5HYOA 1OWJA 1V2NT 2BHGA 3KL6A 3BN9A 2G52A 1UJ1A 4MNYA 2BY5X 1GI4A 1KY9A 4K3JA 3SUFA 4AORA 3E3TA 4OS2A 1EQ9A 1A5HA 1TOMH 2HNTE 1ZHRA 3VB7A 2F91A 1HAIH 2GV6A 2OCVB 1JMOH 2GV7A 3UR9A 3SHCH 1BJVA 2TGTA 3BG4B 2ANMH 3RXRA 3GCOA 3UFAA 1HJ9A 5L2YH 2OTVA 1AFEH 1L4ZA 1K1IA 4YOIA 1TIOA 2BTCE 1V2ST 1UTNA 3SU5A 3ZZ9A 4BXSA 1F0TA 2Q6DA 1CSOE 1XX9A 1V2MT 4X2XA 1OX1A 3A89A 1CE5A 3O8BA 4BTUB 1OS8A 1LPZB 1ANBA 1NFUA 3R3GB 1O3KA 4ABHA 1O2RA 2FPZA 3H7OA 1SQAA 1C2HA 2AGIX 4X1SU 4UEHH 1C2DA 1GJ4H 4CHAB 4B76A 3OY6U 2VGCB 2VNTA 1K1MA 1W12U 2O8LA 4MDSA 4ABAA 3M5OA 1QRXA 1HAXB 1YP9A 4Y79A 4MPVA 4K60A 3T26A 3P8OA 4DGJA 3RM2H 1MUEB 1G37A 1SQTA 3RXPA 1BT7A 5ETXA 2A45B 4NGAH 3VB5A 4BXWA 1O2OA 2G4UA 1EZUC 1E34B 1N8OC 2ZFTA 4Y10E 1LKBA 4WH8A 1KDQB 4NIVA 3LGUA 5DP4A 2IPHA 2FOBA 1DSUA 3PV4A 4INKA 2O8MA 1GI3A 4NCYA 4D8NA 1ZPZA 2PTCE 5JYIA 1AKSA 3H5CB 1ETSH 3I29A 4HFPB 2OBQA 1HPGA 2ALPA 4OS4A 1AB9B 1BZXE 3A87A 4ABFA 1OYTH 3GY3A 3SUEA 1F5RA 3S69A 1O3IA 4AFSA 4BTTB 3MI4A 5C20A 2VH0A 2V6NA 1V2UT 2XTTB 3S9CA 1Y59T 1UCYE 3DFLA 1GHWH 1O5DH 3KQDA 1BBRK 2G8TA 2VH6A 1HB0B 3SUDA 4D9RA 4NIYA 5AFZH 1J17T 1NFWA 1A0LA 1HNEE 2FX6A 2VVCA 1G2LA 3P6ZB 3TGIE 4HZHA 1O2PA 2FODA 2Z9LA 3R0FA 5LPEA 1EPTC 1LMWB 1O2HA 1V2LT 1CGHA 1SGTA 2V35A 4B1TA 1UHBB 3QZRA 2EI8A 6CHAC 4X8VH 4NFFA 1SLWB 3TH3H 4AOQA 1DY9A 1N6YA 1MQ6A 1LPGB 1O5GH 1SMFE 3D49H 3QO6A 1FPHH 1VITH 5I46H 2XXLA 4Q2KA 2Q6FA 1SGNE 2FOFA 1C1NA 1RFNA 1ZJKA 2B5TB 3I78A 1TGSZ 2PTNA 5T6DA 4GHTA 3G01A 1TMBH 2VVUA 1CQQA 1BTZA 4NIWA 4D7FA 1FLEE 3F9EA 2A4OA 2O8TA 1O33A 1S83A 1S0QA 1SBWA 1EZXC 5AVDA 3QUMP 1PQ8A 1XXFA 2WINI 2VU8E 1O5FH 3ENSB 3UIRA 2JETC 1C1VH 1ZHMA 3RXDA 3QDZB 3VXFH 2BX3A 5C1UA 1NT1A 3LJOA 2QYIA 1ZTJA 3BTME 1O3BA 1GGDC 1BRCE 1Z6EA 1P2MA 2FLBH 2AFQB 1QL8A 2B8OH 2V0BA 1A3BH 2O8UA 1O3HA 3M7UA 3QGNB 4DT7B 4H6TA 2ZDLA 3FFGA 5HM2A 1HV7A 4BANB 2QN5T 2IN2A 3BIVH 4E06H 1O2UA 2FS8A 3NWUA 3UNSA 2ZDAH 1O2WA 3LC3A 5T6FA 1MTNB 4MG3A 4U01A 1DY8A 1AD8H 4Y7BA 3RC4A 3ATMA 1TABE 1UVUH 2AGEX 1JXPA 1KIGH 2WUCA 1TLDA 1YKTA 3KQCA 4I7YH 3TK6A 2C8WB 1OSSA 1C2MA 2TPIZ 3FP6E 3GDUA 1ZPBA 1ETTH 2PUQH 4ZHAA 2BY7X 1TGTA 3A83A 4ISLA 5EOKA 1W13U 3MWIU 2SNWA 4DURA 3KQBA 1SGDE 4XBCA 4IMQA 3URCA 4UFGH 1P2OA 5L6NH 3M3VA 3RXCA 1HGTH 3NKKA 3L3TA 1LO6A 3SNBA 4B75A 3FP7E 5DG6A 1C2JA 1GVZA 1V2QT 1HCGA 1QFKH 1JWTA 4I8JA 1FAXA 2ZIQH 2UUYA 2JH5D 1LPKB 1NRRH 2QF0A 3GISB 5BPEA 4JK5A 2QA9E 4K5ZA 2PW8H 2FOEA 1KXCA 5JBTA 2P93A 1V2KT 1C9PA 1DITH 1A0HB 1HXEH 1J14A 2Z9GA 2ZFSA 1QGFA 2H5DA 1SGPE 2ILNA 4IMZA 1AWFH 2K1QA 2H1UA 1HAGE 1EZQA 1C2IA 1O3EA 1P09A 2BDCA 1B0FA 1SR5C 5AF9H 2LIZA 3FANA 1FN6A 5TCAA 1LHCH 1CHOF 5DP8A 2BD8A 5FX5A 3ZZ6A 3SQEE 3HATH 3AVZA 3RUOA 5PTPA 1F7ZA 1L2EA 1TPAE 2STAE 1C2EA 2WYJA 1CHOG 1ELGA 2V3HH 2VWOA 3BTGE 5DJ7A 3E1XB 5GIBA 1YPHC 1IQEA 3Q00A 4I31A 2GGVB 4WJG2 3LGIA 1QB9A 4GHQA 5EXMA 1GHBF 4ZXYH 1EB1H 1N8OB 1SB1H 2J4IA 2J95A 3RXUA 2F9UA 2SGFE 3ZVDA 4BAMB 1XUGA 1VJAU 1QQ4A 1GHBG 3TJNA 1O5AB 3A7VA 4AYYB 1EZSC 1T8LA 4FUFA 5SGAE 5JB9S 3C27B 1TNLA 2XBXA 1FN8A 3F1SB 4CRCA 2QIQA 3Q3KA 4WWYA 4X2YA 3EA7A 3UUZA 2VWMA 5AHGH 1J15A 1ELVA 5FBEA 2KAIA 3ZZ8A 2PKAA 1SPJA 1O2LA 1Z8GA 3MH7A 3LIWA 1YPMH 2XNIA 1C1WH 2FI4E 3LJJA 2PFEA 4THNH 3B9FH 3M7QA 1XXDA 4RKOB 4O3TA 2Z9IA 2W7UA 1O2ZA 2LNCA 1MBMA 1PPGE 3RLYH 4LZ4B 1P57B 1EOJA 1WOFA 2GT8A 2C8XB 1AY6H 4A92A 1UVPA 2Z3DA 2XWBI 3SUGA 2D26C 2O9QA 1DXWA 4B74A 3HK3B 4IS5A 2P3TB 2P8OC 3MU4A 2QAAA 1GBAA 2A32A 1TB6H 2ZG0H 5CMXH 4CR9A 3U98H 1IQKA 2GT7A 1QNJA 3ZZAA 1BTYA 2XW9A 6CHAB 4I33A 1S85A 2FWWA 1UTQA 1CT2E 1FXYA 1EKBB 2FP7B 5LGOA 2P94A 1C5YB 3NUMA 1QL9A 2JKHA 1GI0A 1ESAA 4CBOA 1ZLRA 1YPJH 1GCDA 1IQNA 3VPKA 2A4QA 2CF9H 3MOCA 2A4GA 2J38A 3UWJH 2Z6BD 1GCTC 1V2OT 2ZTXA 5DP7A 5DP3A 1PPBH 3OY5U 1XUIA 1KTTB 1LVYA 5DK1A 5EW2H 4XBBA 1K1LA 1CGJE 1EUFA 1QB1A 3AAVA 5F6MA 4X2VA 1C4U2 2A5KA 1XUHA 3QWCH 5FCKA 2M5TA 1ACBE 1FI8A 1O3MA 1AB9C 2PLXA 2VINA 3MH6A 1S6FA 2JETB 2UWLA 3V12A 1FY5A 1O2NA 4NSVA 1C1PA 1JRSA 1PPEE 5B6OA 2SGPE 3RC6A 4JYTA 1YCPM 1SLVB 4JZFH 4IN1A 3NCLA 1UTKA 1AIXH 4A1XA 1GGDB 1TGNA 2BYAX 4K1SA 1PPHE 1VCPA 3NZIA 3PM3A 1OXGA 3OU0A 1GDNA 1QBOA 1UK4A 1O3LA 2ANYA 3F68H 1WTGH 4X8SH 1Z8RA 2FZZA 1BDAA 2A2QH 2NU0E 2P16A 1P2QA 1GHZA 1GBTA 1WQSA 1HUTH 4Q80A 2SNVA 4MNXA 2ASUB 1ANCA 2VIOA 4FUIA 1ELEE 1NU7B 2BM2A 1MQ5A 3S9BA 2YNAA 3MO6A 2ZTZA 3SGBE 4F49A 4MPUA 2BOKA 1P3CA 2CMYA 1EX3A 3KHVA 1AVXA 1NRPH 3A82A 8KME2 1W0YH 3U69H 3GY5A 2EA3A 2A7JA 3TK9A 5C5NA 2OD3B 3KGPA 2STBE 1H9LB 1BITA 4RSPA 4NWLA 1GJ7B 3E16B 3ZZ7A 2AYWA 5C67A 2CXVA 4ZROA 4X6OA 3UR6A 1QB6A 3P8FA 4ISOA 1YCPK 1LHFH 1TRYA 3RXOA 4AFZA 2Y5GA 1P02A 4WMEA 1TQ0B 3EA8A 4YESB 1BTXA 1V2WT 1Z1IA 1MCTA 3AW0A 4KELA 2GKVE 3E0NB 3PLPA 2XCNA 9ESTA 1WQVH 1P2NA 1EPTA 2UUKB 2XBWA 1OWKA 1G3EA 2ANWA 3F9GA 2G5VA 1O3CA 1U6QA 3SN8A 3EE0B 4Y0YE 2NWNA 5GPIB 3RM0H 2R9PA 1DVAH 3F9FA 1FIWA 3BTHE 3K9XB 1TBRH 4X1NU 5BRRE 4YLUA 3SJOA 4XBDA 1FJSA 3RXSA 1O35A 3CP7A 3ZZ3A 1BMMH 5HM9A 1MU6B 1EJAA 3P95A 1C5QA 3UY9A 3A7YA 3VGCC 1EAXA 1C2KA 2FOAA 1NRQH 3RXEA 3L6PA 5T6GA 1ZRKA 4Y71A 4ZHLU 1UTOA 3SW2B 5EU8A 2BX4A 1ZMJA 1O3NA 1NM6A 5ESTE 1DWEH 2IOTA 2R0KA 3RXIA 3FAOA 1NC6A 3LH3A 3QZQA 4XDEA 1RXPA 1ZMLA 1GBMA 1S81A 2BOHB 1H1BA 1GHVH 3P70B 4Y76A 5F8ZA 1Z8IB 2C93B 4INLA 4IW4E 3KN2A 1C5ZB 4X6NA 1IAUA 1EP5A 4FUHA 4O9VA 3ATKA 1GBCA 2ZU2A 2GZ8A 2PHBA 2UUFB 4NFEA 1F5LA 2TBSA 1F0UA 4DG4A 3TIUA 2G55A 1AZZA 3MNCA 1EJNA 3LGWA 1DM4B 2VB0A 4J1YA 4X8UH 1DE7H 1J16A 1UK3A 1ZHPA 2PGQB 2ZPQA 3GY2A 4B73A 1QRWA 4Y8ZA 3ZZDA 2GZ7A 4YZUA 3TITA 1Y3WA 2P3UB 1GI5A 2Y5HA 1DANH 1A1RA 1P2KA 1CT4E 2ZTYA 1LQEA 1C5PA 2OC8A 1BMLA 1ARBA 2AIPA 4CR5A 1TONA 2VIPA 2WUBA 1AU8A 5AFYH 1LVMA 2QGRA 1W0ZU 1SSXA 4X0WU 1G32B 1AI8H 3A80A 2ZU4A 1O3FA 1BMAA 1GBLA 3PMJA 4ISIH 1QA7A 1RJXB 5JBBS 4B71A 2TRMA 2XC4A 4CH2B 1F5KU 3T29A 2TIOA 3A7WA 3MNBA 1INCA 2UUJB 1N6XA 2P8OB 3SV6A 2HNTC 3FZZA 1FONA 1T4UH 3RXAA 2QF3A 3PTBA 4LZ1H 1E38B 2ZFFH 3SU1A 2XC0A 1OKXA 2ZGBH 2Y81A 2Z94A 1NN6A 1TMUH 1TNHA 2WYGA 2R0LA 3RU4T 4DCDA 2FX4A 2OC0A 3GCNA 5FPSA 4UE7H 4K8BA 1GCTB 1DWDH 4UONA 3DUXH 2GDDA 1ELBA 3MHWU 3HGPA 2FOGA 2WPIS 2ALVA 2CHAC 3Q3YA 1KXFA 1HFDA 4AG2A 1H4WA 5I25A 4LOYH 5A0AE 1ETRH 1L1GA 1SFQB 1GJ6A 1SG8B 3PLBA 3VXEH 2OUAA 1G3BA 2FLRH 4TPYA 1EAWA 1KXAA 1MU8B 2BDBA 1UVSH 1MD8A 1L4DA 2HLCA 1IOEA 1DOJA 1P0SH 2WV4A 5ESBA 2BLWA 2PR3A 3K6YA 4TY7A 1Q31A 1CVWH 5DP9A 1PPZA 3PO1C 3SU0A 3SQHE 2ZNKH 1A0JA 1C4Y2 4I8KA 2F9OA 5GJ4B 2RA3A 1Z7KA 3D23A 1MKWK 1TFXA 2G51A 2Z9KA 1A5GH 4XFQA 3A85A 3STIA 1C1TA 3BTKE 4JZDH 4HI3A 1PYTD 2GVFA 4FUBA 1Y5AT 1LHGH 1PPFE 2SGAA 1YBWA 3GOVB 4AFUA 2AEIH 3GDVA 4SGBE 4FVDA 1SGQE 4JYUH 3UNRA 2J2UA 2F9NA 1HAVB 1F0RA 2TGDA 4HTCH 3TNSA 1D3DB 2W5EA 3QK1A 3RLWH 1NESE 3ZVFA 1XKAC 2NU4E 2BXUH 5E0GA 2A31A 4NWKA 1AE8H 3ELAH 1XVOA 3CS7A 3LH1A 1MCVA 1C5OH 1BBRE 2ANKH 7GCHF 1HAPH 1O3GA 4NZLA 2R2WU 1GI7B 1BMNH 7GCHG 3AAUA 2K7XA 3SJ9A 3PWCA 1YPKH 1FNIA 4FVBA 1HRTH 1KTSB 2RDLA 2UWPA 3GY7A 3RP2A 3NPSA 2ZCHP 5FCRA 3KNXA 2THFB 1WUNH 2EI7A 3RMMH 1QBNA 2Y7XA 1EXFA 2H9EH 3N7OA 3EAJA 4OS1A 1FY4A 1DLEA 1D9IA 3EQ0H 4TYDA 3SNCA 1K9OE 2F9PA 6GCHF 3RMOH 3VGCB 1S6HA 3T28A 1OYQA 1C1QA 3SU3A 1KDQA 6GCHG 1MKXK 8GCHF 2I6QA 1TRMA 1RTKA 4FUDA 4XE4A 4Y8YA 4SGAE 2EC9H 8GCHG 4X8TH 3LC5A 3SBKA 1SGIB 1C5TA 1YPEH 5DGJA 2Y7ZA 1EJMA 3NK8A 4GLYA 1ANDA 1RIWB 3BEFB 1GDUA 3A8AA 1JRTA 2QXHA 2I6SA 1S5SA 1H9HE 3SNDA 1CGIE 1A61H 4Y6DA 2BB4A 2B7DH 1C1RA 3LKWA 3ZV9A 2SGDE 3RXQA 3P8NA 1FV9A 1QJ1B 2VIVA 1GI6A 3MMGA 3T2NA 4QT8C 2P3FH 2FOCA 1UHBA 1G36A 1QRZA 5L2ZH 3SHAH 2QXIA 4ABJA 4NZQA 1V3XA 5DP6A 4D7GA 5A09A 2ZDVH 1L1NA 2HALA 3U1IB 1C4V2 4F4OC 2BD9A 1O3AA 2AMPA 3TU7H 2QC2A 4CH8B 3RU4D 1SGYE 1Z8JB 5J4SA 3MU1A 2Z7FE 4Y11E 3RXHA 5JBAS 1IQGA 1S84A 2FESH 2R3UA 1ZR0A 3M3TA 3UPEA 1YPHE 3Q77A 2DE8A 1GL1A 1BRBE 4A1TA 3ZZ4A 2BVRH 4AB8A 1KLTA 2XBYA 3O8DA 2FI3E 1SQOA 4YLQH 4Z6AH 1YPGH 2BDHA 2AGGX 1OWIA 1O2GH 2QXJA 1PQAA 3M5MA 3RXVA 1YC0A 1B5GH 1DXPA 5A0BA 1T8OA 5JPMH 2SGEE 4X2WA 1HXFH 3GY8A 4IC5A 3RC5A 2CJIA 2FM2A 1FUJA 1Y3VA 2BDAA 1WAYB 4D9QA 1W3CA 2R2MB 3OX7U 1P04A 4NA7A 1ZSKA 4U30A 1WYKA 1SOZA 2RG3A 5FBIA 1GPZA 1P12E 2CHAB 1O2VA 3A88A 1WV7H 1TMTH 4PROA 1T8NA 2HGTH 1A2CH 1TNIA 1PYTC 1NS3A 2SFAA 4O03A 1KSNA 1SVPA 4IBLH 5DO4H 4DY7B 4ABEA 4AGKA 1QY6A 1RRKA 1GBKA 2XC5A 4FUCA 1NFYA 4ISNA 3MFJA 3SV2H 3PO1B 1Z71A 1K1PA 2ZQ1A 5C3NA 4I8GA 1UTJA 4X1PU 4E7RG 5C1XA 1QTFA 4B2CA 2BMGB 1W8BH 4CRDA 1G9IE 1L0ZA 3VB3A 2BD2A 1FQ3A 5DP5A 1S82A 5HMAA 3UWIA 4O3UA 2ZFPH 1Q2WA 2J34A 2W26A 3M61U 3ZZCA 4CRAA 3H7TA 3Q76A 1UMAH 4YM9A 3ZZ5A 1TNKA 1XM1A 3A7XA 2W3KA 1AN1E 1TPOA 2A7CA 1AO5A 3LPRA 3T27A 1C5NH 2GMTC 3PB1E 3TLOA 4NSYA 3RXBA 1GI2A 1CU1A 4Y0ZE 1ZSLA 4K2YA 3U1JB 2GZ9A 1QHRB 2F9BH 1HIAB 2BQWB 3K6ZA 3SV7A 5A8ZA 3NXPA 3U8RH 2G5NA 2ZDNA 1O32A 4R0IA 1ARCA 1SI5H 4OGYA 1ZZZA 3UOUA 1ZGIA 1IQHA 2CF8H 4ABBA 1E36B 4VGCC 1KXDA 4MLFB 4M7GA 5TCCA 4A6LA 4O97A 1H8IH 4ZKNU 2OLGA 3K65B 4ZKSU 3GCTF 2ZKSA 1NU9A 1Y3YA 4Z0KA 2GTBA 3UQOA 1KYNA 2XBVA 1ZMNA 3IITA 3DD2H 4Q7XA 3GCTG 3LGTA 3RMNH 4OS7A 3UREA 5JDUB 4CBNA 2ULLA 1TX6A 2C8ZB 1IQJA 1DFPA 3MNSA 1G30B 4WF8A 3BEUA 1NROH 2J92A 4DJZB 1T7CA 3S0NA 4MPWA 1OWEA 4NA9H 1D3QB 1MTWA 5EGMA 3BSQA 1EAUA 5EQSA 4WXVA 4DIIH 3GYLB 1AMHA 3RU4E 3V0XA 4X6MA 2A4RA 2PSYA 2J9NA 1C1UH 4I8HA 1YM0A 3WY8A 1P05A 4FXGH 6ESTA 1WTHD 2BLOA 3BEIB 4IGDA 1HDTH 1HAYB 5CHAC 2FEQH 1ELFA 4TWYA 1C2FA 4YT7H 3KEEA 5C1YA 5DPAA 4KTSA 2XRCA 1BBRH 2GCTC 1QURH 3FVFB 1IQFA 2BY6X 2NU3E 1T8MA 2ZU1A 2ZGHA 1NY22 1GI8B 1A46H 3W94A 1O39A 2BQ7B 4KTUA 1VCWA 2FIRH 1V2RT 1TPPA 1P2IA 4ZKOU 4FUJA 3MU5A 1QR3E 1XVMA 4H4FA 1GJ5H 4GAWA 1A5IA 3M5NA 2A5IA 3EDXB 2BVSH 2BY8X 2DUCA 1C5UA 1VJ9U 1HJAB 2FO9A 1MBQA 1V2PT 3MTYA 3JZ2B 1Y3XA 3VEQB 4LXBH 1WCZA 3CENA 4I8LA 1QQUA 2CN0H 4TPIZ 4DOQA 1O36A 1BA8B 1XUFA 1MZDA 1GI9B 1K1JA 2ZFRH 1C5XB 2ODYB 1XUKA 3TGKE 2BVXH 1GHYH 4UFDH 1K2I1 2ZU3A 1C1OA 3ZVGA 3E8LA 1PQ7A 2YOLA 4ZXXH 4X1QU 1SGRE 2IJOB 1AVGH 1O2YA 3TH4H 2C8YB 1O2XA 1TA6A 1CBWC 4MTBA 1DSTA 1AKSB 1GBEA 1BRAA 3EGKH 3PMHB 5HGGA 3TPIZ 2AERH 3V13A 1MAXA 1GDQA 4UFFH 6LPRA 2ZECA 2GDEH 5EPNA 3BG8A 1SHYA 2OQ5A 1UVOA 1D3TB 1GI1A 1RIWC 1UVTH 1GBJA 5EXNA 2ODQA 3GICB 1EP6A 4WVPE 5H4IB 3QGJA 2SGQE 3A8DA 2PUXB 1N1LA 3TJVA 1ZSJA 1O2QA 1D4PB 1RTFB 1TA2A 1A3EH 4BNRA 4FUEA 4NA8A 2BD3A 2Q6GA 1DPOA 1GVKB 3ZVBA 3GY4A 1DX5M 1W10U 1BTWA 3V3MA 1DICA 5TJXA 1QCPA 1S0RA 1TBQH 4A1VA 1HJ8A 2VVVA 1LCYA 3V7TA 1GBBA 4JK6A 1GBIA 5E2OA 5JBCS 4ABIA 2BD4A 1V2VT 2DE9A 2OBOA 5T3HA 3SV8A 4ZMAH 3ATLA 2Y80A 4UD9H 1TNGA 4OS5A 3TK5A 1TX8A 2D1JA 2D2DA 2PKSB 2VWLA 1GBFA 1C5VA 1KXEA 3ATIA 1BTUA 3ESTA 3LGYA 3I77A 2OP9A 4FU7A 4GSOA 3QTOH 4BAKB 1D6WA 1NPMA 1XMNB 1P10A 1SLUB 2G00A 5F8XA 5FHTA 1EASA 3E90B 1FIZA 3STJA 1BTHH 1O5BB 3T5FH 1F92A 3VB4A 3MU0A 3SNEA 1WBGB 2GMTB 3SJ8A 3BTTE 1UCYK 1JIMA 2AMDA 1CO7E 3MO9A 3P92A 4BAOB 1D6RA 2QV1A 1F2SE 3K2UA 3M36A 1ELAA 4K69A 3OYPA 2F83A 2A7HA 4BTIB 2BLQA 3KQEA 3GCHC 2Q1JA 4AGJA 4CRGA 1TNJA 2YNBA 1HAOH 3BTWE 4WMFA 1BJUA 1TRNA 4VGCB 2ODPA 1C5LH 3ZYEA 1TGCA 3T62A 4OS6A 3AW1A 1V6DA 5FAHA 4TY6A 4XSKU 2H9HA 1FZZA 1EAIA 1GMCF 5CE1A 2PV9B 5LPRA 1LKAA 1P8VC 2VJ1A 2ZCKP 1VGCC 4MNWA 4HGCA 1TGBA 4ZHMU 4K1TA 5A8XA 2ZPRA 3TVJB 1GMCG 1VITF 8ESTE 2A2XH 5A8YA 3OSYA 1O2JA 1O3PB 2QCYA 1D3PB 1VITG 3SNAA 1L1JA 3UQVA 4INHA 1O5CB 1TX7A 1VR1H 1GJ9B 3TJUA 4AFQA 1BHXF 1TBZH 3TGJE 1ELTA 1PFXC 2G4TA 3TNTA 1XKBC 2VIWA 3PMAB 1KLIH 1BHXB 5JB8S 1ZTKA 2H2ZA 1TQ7B 4K8YA 1FY8E 2BZ6H 3SJKA 4BAQB 3BTQE 2VIDA 5CHAB 1AFQC 4K1EA 3MH4A 1IHTH 5GWZA 1G3DA 2RA0A 2GCTB 3LDXH 1UO6A 1C5WB 3IG6B 7LPRA 2JH6D 3PTNA 1UTLM 4Y7AA 1YLDA 3PLKA 2ZHDA 4H42U 1JBUH 1OP8A 5FPYA 2Z9JA 1GMDF 4CREA 3ITIA 3BTFE 4GVUA 1LDTT 2D8WA 2ZQ2A 2B0FA 1DUAA 1EOLA 2W3IA 1GMDG 2WPLS 2EI6A 5J4QA 4UDWH 3L33A 1P11E 2BY9X 1ZYOA 3HPTB 1O3DA 1QBVH 1X7AC 4BAHB 4X6PA 1TOCB 5A2MH 4X1RU 1TALA 2P95A 8LPRA 3SGAE 1Y5UT 1GL0E 1AVWA 3HK6B 2A5AA 1BQYA 3Q3XA 2GX4A 1O3JA 1WU1A 4YT6H 2NU2E 1T4VH 4CRFA 5E8EH 2G81E 4YTAA 4MPXA 2QXGA 3DHKH 1EATA 3RXLA 2ZEBA 3HKJB 1MAYA 2FS9A 2FOMB 1CBWB 1VZQH 1BRUP 3PMBB 2FMJA 4KGAA 2ZHWH 4E05H 2KAIB 1P9UA 3EBNA 1C2GA 2PKAB 1MTVA 1AWHB 2HPPH 2P59A 4ABGA 1K28D 4AZ2B 3SV9A 2ZA5A 3LOXA 5HXFA 3M37A 5EW1H 1THRH 1GJ8B 4WMDA 4KKDA 3GY6A 2QY0B 3SU2A 1UTPA 2BDYA 2TGAA 3PYHA 2Z3CA 1CA0C 5L30H 1T32A 2F9VA 1C1MA 2OXSA 3E91A 1NZQH 1HAZB 3KIDU 4DIHH 1GBDA 5GXPA 1SLXB 1C5SA 4IN2A 1BOQA 1GHXH 1LHDH 3BIUH 3F6UH 4A5TS 1O2KA 1P06A 4KP0A 5EQRA 2BXTH 3M3SA 1AZ8A 2ZU5A 1H8DH 5F8TA 2FXRA 1W11U 4YOJA 1JOUB 1OP0A 4U2WA 5G4BA 1HJAC 5F03A 4WH6A 3M35A 3OTJE 1IQMA 2XYAA 4ZAEA 1FAKH 1DDJA 1O2IA 2H9TH 1GG6C 4GUXA 3GYMA 1OP2A 2FTMA 1SGEE 1SOTA 4IC6A 1KLJH 1YF4A 2HNTF 1K1NA 4RKJB 1YCPH 2ZHQH 1PQ5A 1HAVA 4Q7ZA 3LU9B 5FX6A 3RXMA 1MD7A 3EYDA 4CRBA 4BOHA 5A0CA 1QJ6B 1NO9H 2BZAA 1TWXB 2Y5FA 1BCUH 1QIXB 3P17H 3LGVA 4GCHF 4ESTE 1H9IE 5GDSH 2ZC9H 2PGBB 3DFJA 4GCHG 5E2PA 1WSSH 1E37B 2LPRA 4JZEH 3RXTA 1SGFG 1O31A 3SORA 2R3YA 5EODA 2C4FH 1C5MD 2CGAA 7ESTE 1BB0B 4DVAU 2C90B 4I32A 3ZV8A 3LONA 5E0HA 4LK4A 1THPB 1C9TA 1DS2E 1GHAF 1O2MA 2AH4X 1LQDB 3E0PB 2A0QB 4FU8A 1FY1A 7KMEH 2OINA 3GCHB 2GCHF 4MQAA 1G2MA 1LVOA 1GHAG 1RD3B 1NFXA 2HOBA 2GCHG 2WPHS 3U8OH 3P8GA 3ZVEA 3F9HA 4ZH8A 1C5RA 2JH0D 4KTCA 3SU6A 3DA9B 2WPKS 3LT3A 1ZRBA 3QN7A 1E35B 5E0JA 3SI3H 3E6PH 1TYNA 1ABIH 1HYLA 1V2TT 2H6MA 3BTEE 1GJCB 4YO9A 1VGCB 1ABJH 1ZGVA 3M7TA 2VIQA 5DKMA 3W95A 1DLKB 4Q7YA 1TAWA 1ID5H 3QX5H 3U8TH 3BG4C 1GJDB 2ZGXH 3GDSA 1P9SA 1W2KH 3UTUH 2PKSC 1K1OA 1NTPA 1CHGA 4XOJA 1DWCH 2BD7A 4AN7A 3AASA 3S9AA 3ATWA 1ANEA 3SZNA 1XUJA 3HKIB 4NG9H 1QA0A 1HBTH 1FMGA 1O30A 1SL3A 1CA8B 5K0HA 1DT2A 4U32A 2EEKA 1EB2A 1ZJDA 4A7IB 2UWOA 3SOSA 1T31A 9LPRA 3ZYDA 1SHHB 1A4WH 4MNVA 1O3OA 1ELDE 4DW2U 1IQLA 2BD5A 1EPTB 2ZCLP 3KF2A 1O2SA 3S7HB 2FTLE 2ZHEH 1O34A 1AGJA 2PSXA 4CHAC 2BLVA 1AFQB 1GBHA 1NRNH 1OPHB 2TGPZ 2VGCC 1G3CA 3T25A 5EPYA 1O37A 2PWXA 1FDPA 2J94A 1AQ7A 5LPFA 2FYRA 1GJAB 2HWLB 3UNQA 2AIQA 3B8JA 1AE5A 4E7NA 1O5EH 3RXKA 3URDA 4JMYA 2W7SA 1P01A 4ABDA 2ESTE 4D76A 2FOHA 4WXIA 3S7KB 1Y5BT 3JZ1B 3A8BA 1K21H 1LVBA 1ZOMA 5FPTA 5EQQA 1Y8TA 3SI4H 1Z1JA 4OGXA 3ZVCA 3UOPA 4FU9A 2XCFA 1PJPA 2XWAA 1ZPCA 1MZAA 2ZZUH 1B7XB 3FZDA 1J9CH 4AG1A 2ZDMA 1SFIA 1RGQA 3QLPH 4UFEH 4ZUHA 1BIOA 1UCYH 1P3EA 4GPGA 2ZO3H 2WPJS 1YGCH 1OWHA 3KCGH 1MMJN 2ZI2H 1SGFA 2ZPSA 1KXBA 2FI5E 5ABWA 2Y82A 3ZZBA 2OC1A 3IWMA 1GMHF 3EA9A 2H5CA 5IYTA 1GVLA 2WV5A 2ZGCA 4MVNA 3U9AH 4ISHH 2GP9B 1GMHG 1OWDA 2CV3A 1MTSA 2O8WA 4YOGA 4RN6A 1W7XH 2OC7A 2ZHFH 2ZP0H 2F3CE 1YLCA 1DUEA 2A1DB 1TPSA 4J2YB 2BDIA 3C1KA 1AUTC 1SGCA 3QTVH 1M9UA 3O8RA 1YPLH 3A81A 1W7GH 1B0EA 1ESTA 2FYQA 1V2JT 1JIRA 2BQ6B 2ZFQH 3A8CA 1CA0B 3A84A 2HRVA 1NRSH 4ASHA 1IHSH 2AMQA
chains in the Genus database with same CATH superfamily
1F0SA 3M5LA 2V3MA 5FXLA 1MKWH 3SJIA 3ODFA 3TH2H 3VB6A 4AB9A 1UK2A 2V3OH 4TWWA 4B2AA 3RXFA 3MO3A 3O8CA 1LHEH 1VCQA 2Z3EA 2Y6TA 2JJ1D 1LTOA 3BV9B 1GJBB 4AX9H 1ORFA 2HPQH 3ZVAA 3A7ZA 3D62A 1Y3UA 1C1SA 2AS9A 2C3SA 3DT0H 2FDAA 4JZ1A 1GG6B 1FPCH 2ZGJA 4H6SB 4AYVB 3RXGA 4ZKRU 5C2ZA 2ZDKA 3TJOA 1O2TA 4R8TB 2HVXA 1MH0A 3FP8E 4JCNA 5LH8A 3A7TA 4FUGA 3MNXA 3RDZA 3MH5A 1HIAA 2ZF0H 3A86A 3D65E 5K7RA 1BUIA 1O0DH 3FN8A 2B9LA 1CT0E 3BTDE 2OQUA 1J8AA 5GCHF 3SO3A 2WPMS 3MYWA 1SC8U 1ZTLA 3B23B 1TE0A 2GJGA 1YY3A 2VWNA 5GCHG 1QL7A 2RCEA 1RTLA 1AHTH 1ESBA 4JYVH 1IQIA 1ELCA 1Z6JH 3CS0A 1PPCE 1AUJA 1E0FD 1W14U 1GWAA 1OOKB 3PROA 2NU1E 1MTNC 1BMFD 4TSFD 4NIXA 3RMLH 1Q3XA 5C5OA 4Y8XA 3SU4A 4JZIA 1THSH 5IDKA 1K22H 1HLTH 1O38A 2ZWLH 3VFEA 1FY3A 1QJ7B 1YYY1 1MTUA 5KECA 5EXLA 1DWBH 1E79D 3SGQE 3ODDA 1UTMA 1BTPA 2GD4B 1HAHH 2QE7D 3HGNA 4WY3A 3BF6H 3PWBA 3RXJA 1C2LA 1P2JA 1MKXH 1RS0A 3MU8A 4B2BA 5EG4A 2BDGA 1A7SA 1P03A 5HYOA 1OWJA 1V2NT 2BHGA 3KL6A 3BN9A 2G52A 1UJ1A 4MNYA 2BY5X 1GI4A 1KY9A 4K3JA 3SUFA 2J98A 3CNRA 4AORA 3E3TA 4OS2A 1EQ9A 1A5HA 1TOMH 2HNTE 1ZHRA 3VB7A 2F91A 1HAIH 2GV6A 2OCVB 1JMOH 2GV7A 3UR9A 3SHCH 1BJVA 2TGTA 3BG4B 2ANMH 3FO8D 3RXRA 3GCOA 3UFAA 1HJ9A 5L2YH 2OTVA 1AFEH 1L4ZA 1K1IA 4YOIA 3N7DA 1TIOA 2BTCE 1V2ST 1UTNA 3SU5A 3ZZ9A 4BXSA 1F0TA 2Q6DA 1CSOE 1XX9A 1V2MT 4X2XA 1OX1A 3A89A 1CE5A 3O8BA 4BTUB 1OS8A 1LPZB 1ANBA 1NFUA 3R3GB 1O3KA 4ABHA 1O2RA 2FPZA 3H7OA 1SQAA 1C2HA 2AGIX 4X1SU 4UEHH 1C2DA 1GJ4H 4CHAB 3MQKC 4B76A 3OY6U 2VGCB 2VNTA 1K1MA 1W12U 2O8LA 4MDSA 4ABAA 3M5OA 1QRXA 1HAXB 1YP9A 4Y79A 4MPVA 4K60A 3T26A 3P8OA 5HIZA 4DGJA 3RM2H 1MUEB 1G37A 1SQTA 3RXPA 1BT7A 5ETXA 2A45B 4NGAH 3VB5A 4BXWA 1O2OA 2G4UA 1EZUC 1E34B 1N8OC 2ZFTA 4Y10E 1LKBA 4WH8A 1KDQB 4NIVA 3LGUA 5DP4A 2IPHA 2FOBA 1DSUA 3PV4A 2JDID 4INKA 2O8MA 1GI3A 4NCYA 4D8NA 1ZPZA 2PTCE 5JYIA 1AKSA 3H5CB 1ETSH 3I29A 4HFPB 2OBQA 1HPGA 2ALPA 4OS4A 1AB9B 1BZXE 3A87A 4ABFA 1OYTH 3GY3A 3SUEA 1F5RA 3S69A 1O3IA 4AFSA 4BTTB 3MI4A 5C20A 2VH0A 2V6NA 1V2UT 2XTTB 3S9CA 1Y59T 1UCYE 3DFLA 1GHWH 1O5DH 3KQDA 3UAIC 1BBRK 2G8TA 2M2AA 2VH6A 1HB0B 3SUDA 4D9RA 4NIYA 5AFZH 1J17T 1NFWA 3GS9A 1A0LA 1HNEE 2FX6A 2VVCA 1G2LA 3P6ZB 3TGIE 3AK5A 4HZHA 1O2PA 2FODA 2Z9LA 3R0FA 5LPEA 1EPTC 1LMWB 1O2HA 1V2LT 1CGHA 1SGTA 2V35A 4B1TA 1UHBB 3QZRA 2EI8A 6CHAC 4X8VH 4NFFA 1SLWB 3TH3H 4AOQA 1DY9A 1N6YA 1MQ6A 1LPGB 1O5GH 3H09A 1SMFE 3D49H 3QO6A 1FPHH 1KMHB 1VITH 5I46H 2XXLA 4Q2KA 2Q6FA 1SGNE 2FOFA 1C1NA 1RFNA 1ZJKA 2B5TB 3I78A 1TGSZ 2PTNA 5T6DA 4GHTA 3G01A 1TMBH 2VVUA 1CQQA 1BTZA 4NIWA 4D7FA 1H8ED 1FLEE 3F9EA 2A4OA 2O8TA 1O33A 1S83A 1S0QA 1SBWA 1EZXC 5AVDA 3QUMP 1PQ8A 1XXFA 2WINI 2VU8E 1O5FH 3ENSB 3UIRA 2JETC 1C1VH 1ZHMA 3RXDA 3QDZB 3VXFH 2BX3A 5C1UA 1NT1A 3LJOA 2QYIA 1ZTJA 3BTME 4FOUC 1O3BA 1GGDC 1BRCE 1Z6EA 1P2MA 2FLBH 2AFQB 1QL8A 2B8OH 2V0BA 1A3BH 2O8UA 1O3HA 3M7UA 3QGNB 2KFWA 4DT7B 4H6TA 2ZDLA 3FFGA 5HM2A 1HV7A 4BANB 2QN5T 2IN2A 3BIVH 4E06H 1O2UA 2FS8A 3NWUA 3UNSA 2ZDAH 1O2WA 3LC3A 5T6FA 1MTNB 4MG3A 4U01A 1DY8A 1AD8H 4Y7BA 3RC4A 3ATMA 1TABE 3U28C 1UVUH 2AGEX 1JXPA 1KIGH 2WUCA 1TLDA 1YKTA 3KQCA 4I7YH 3TK6A 2C8WB 1OSSA 1C2MA 2TPIZ 3FP6E 4F48B 3GDUA 1ZPBA 1ETTH 2PUQH 4ZHAA 2BY7X 1TGTA 3A83A 4ISLA 5EOKA 1W13U 3MWIU 2SNWA 4DURA 3KQBA 1SGDE 4XBCA 4IMQA 3URCA 4UFGH 1P2OA 5L6NH 3M3VA 3RXCA 1HGTH 3F3BA 3NKKA 3L3TA 1LO6A 3SNBA 4B75A 3FP7E 5DG6A 3KYGA 1C2JA 1GVZA 1V2QT 1HCGA 1QFKH 1JWTA 4I8JA 1FAXA 2ZIQH 4P00A 2UUYA 2JH5D 1LPKB 2JJ2D 5DN6D 1NRRH 2QF0A 3GISB 5BPEA 4JK5A 2QA9E 4K5ZA 2PW8H 3OFND 2FOEA 1KXCA 5JBTA 2F43B 2P93A 1V2KT 1C9PA 1DITH 3ZIAD 1A0HB 1HXEH 1J14A 2Z9GA 2ZFSA 1QGFA 2H5DA 1SGPE 2ILNA 4IMZA 1AWFH 2K1QA 2H1UA 1HAGE 1EZQA 1C2IA 1O3EA 1P09A 2BDCA 1B0FA 1SR5C 5AF9H 3EE7A 2LIZA 3FANA 1FN6A 5TCAA 5KGOA 1LHCH 1CHOF 5DP8A 2BD8A 3PRDA 5FX5A 3ZZ6A 3SQEE 3HATH 3AVZA 3RUOA 5PTPA 1F7ZA 1L2EA 1TPAE 2STAE 1C2EA 2WYJA 1CHOG 1ELGA 2V3HH 2VWOA 3BTGE 2RDEA 5DJ7A 3E1XB 5GIBA 1YPHC 1IQEA 3Q00A 3N99A 2GGVB 4I31A 4WJG2 3LGIA 1QB9A 4GHQA 5EXMA 1GHBF 4ZXYH 1EB1H 1N8OB 1SB1H 2J4IA 2J95A 3RXUA 2F9UA 2SGFE 3ZVDA 4BAMB 1XUGA 4DT4A 1VJAU 1QQ4A 1GHBG 3TJNA 1O5AB 2IPQX 3A7VA 4AYYB 1EZSC 1T8LA 4FUFA 5SGAE 5JB9S 3C27B 1TNLA 2XBXA 1FN8A 3F1SB 4CRCA 2KX4A 2QIQA 3Q3KA 4WWYA 4X2YA 3EA7A 3UUZA 2VWMA 5AHGH 1J15A 1ELVA 5FBEA 2KAIA 2WHXA 2PKAA 3ZZ8A 3WWBA 3PRBA 1SPJA 1O2LA 5T1VA 1Z8GA 3MH7A 3LIWA 1YPMH 2XNIA 1C1WH 2FI4E 3LJJA 2PFEA 4THNH 3B9FH 3M7QA 1XXDA 5C0UA 4RKOB 5C0TA 4O3TA 2Z9IA 2W7UA 1O2ZA 2LNCA 1W0KD 1MBMA 1PPGE 3RLYH 4LZ4B 1P57B 1EOJA 1WOFA 2GT8A 2C8XB 1AY6H 3VG8A 1UVPA 4A92A 2Z3DA 2XWBI 3SUGA 2D26C 2O9QA 1DXWA 4B74A 3HK3B 4IS5A 2P3TB 2P8OC 3MU4A 2QAAA 1GBAA 2A32A 1TB6H 2ZG0H 5CMXH 4CR9A 3U98H 1IQKA 2GT7A 1QNJA 3ZZAA 1BTYA 2XW9A 6CHAB 4I33A 1S85A 2FWWA 1UTQA 1CT2E 1FXYA 1EKBB 2FP7B 5LGOA 1SKYE 2P94A 1C5YB 3NUMA 1QL9A 2JKHA 1GI0A 1ESAA 4CBOA 1ZLRA 2XOKD 1YPJH 1GCDA 1IQNA 3VPKA 2A4QA 2CF9H 3MOCA 2A4GA 2J38A 3UWJH 2Z6BD 1GCTC 1V2OT 2ZTXA 5DP7A 5DP3A 1PPBH 3OY5U 1XUIA 1KTTB 3F0OA 1LVYA 5DK1A 5EW2H 4XBBA 1K0HA 1K1LA 1CGJE 1EUFA 1QB1A 3AAVA 5F6MA 4X2VA 1C4U2 2A5KA 1XUHA 3QWCH 5FCKA 2M5TA 1ACBE 1FI8A 1O3MA 1AB9C 2PLXA 2VINA 3MH6A 1S6FA 2JETB 2UWLA 3V12A 1FY5A 1O2NA 4NSVA 1C1PA 1JRSA 1PPEE 5B6OA 2SGPE 3RC6A 4JYTA 1YCPM 1SLVB 4JZFH 4IN1A 3NCLA 1UTKA 1AIXH 2V7QD 1GGDB 4A1XA 1TGNA 2BYAX 4K1SA 1PPHE 1VCPA 3NZIA 3PM3A 1OXGA 3OU0A 1GDNA 1QBOA 1UK4A 1O3LA 2ANYA 3F68H 1WTGH 5B6LA 4X8SH 1Z8RA 2FZZA 1BDAA 2A2QH 2NU0E 2QF5A 2P16A 1P2QA 1GHZA 1GBTA 1WQSA 1HUTH 4Q80A 2SNVA 4MNXA 2ASUB 1ANCA 2VIOA 4FUIA 1ELEE 1NU7B 2BM2A 1MQ5A 3S9BA 2YNAA 3MO6A 2YMSB 2ZTZA 3SGBE 4F49A 4MPUA 2BOKA 1P3CA 3NRLA 2CMYA 1EX3A 3KHVA 4ZCNA 1AVXA 1NRPH 3A82A 8KME2 1W0YH 3U69H 3GY5A 2EA3A 2A7JA 3TK9A 5C5NA 2OD3B 3KGPA 2STBE 1H9LB 1BITA 4RSPA 4NWLA 1GJ7B 3E16B 3ZZ7A 5EJZA 2AYWA 5C67A 5IK2D 2CXVA 4ZROA 4X6OA 3UR6A 1QB6A 3P8FA 4ISOA 1YCPK 1LHFH 1TRYA 3RXOA 4AFZA 2Y5GA 1P02A 4WMEA 1TQ0B 3EA8A 2OK5A 4YESB 1BTXA 1V2WT 1Z1IA 1MCTA 2WSSD 3AW0A 4KELA 2GKVE 3E0NB 3PLPA 4ASUD 2XCNA 9ESTA 1WQVH 1P2NA 1EPTA 2UUKB 2XBWA 1OWKA 1G3EA 2ANWA 3F9GA 2G5VA 1O3CA 1U6QA 3SN8A 3EE0B 4Y0YE 2NWNA 5GPIB 3RM0H 2R9PA 1DVAH 3F9FA 1FIWA 3BTHE 3K9XB 1TBRH 4X1NU 5BRRE 4YLUA 3SJOA 4XBDA 1FJSA 3RXSA 4OM9A 1O35A 3CP7A 3ZZ3A 1BMMH 5HM9A 1MU6B 1EJAA 3P95A 1C5QA 3UY9A 3A7YA 3VGCC 1EAXA 1C2KA 2FOAA 1NRQH 3RXEA 3L6PA 5T6GA 1ZRKA 2KCOA 4Y71A 4ZHLU 1UTOA 3SW2B 5EU8A 2BX4A 1ZMJA 1O3NA 1NM6A 5ESTE 1DWEH 2IOTA 2R0KA 3RXIA 3FAOA 1NC6A 3LH3A 3QZQA 4XDEA 2KM0A 1RXPA 1ZMLA 1GBMA 1S81A 2BOHB 1H1BA 1GHVH 3P70B 4Y76A 5F8ZA 1Z8IB 2C93B 4INLA 4IW4E 3KN2A 2KCPA 1C5ZB 1WXRA 4X6NA 1IAUA 1EP5A 4FUHA 4O9VA 3ATKA 4B6FA 1GBCA 2ZU2A 2GZ8A 2PHBA 2UUFB 4NFEA 1F5LA 2TBSA 1F0UA 4DG4A 3TIUA 2G55A 3KQ5A 1AZZA 3MNCA 1EJNA 3LGWA 1DM4B 2VB0A 4J1YA 4X8UH 1DE7H 1J16A 1UK3A 1ZHPA 2PGQB 2ZPQA 3GY2A 4B73A 1QRWA 4Y8ZA 3ZZDA 2GZ7A 4YZUA 3TITA 1Y3WA 2P3UB 1GI5A 2Y5HA 1DANH 1A1RA 1P2KA 1CT4E 2ZTYA 1LQEA 1C5PA 2OC8A 1BMLA 1ARBA 2AIPA 4CR5A 1TONA 2VIPA 2WUBA 1AU8A 5AFYH 1LVMA 2QGRA 1W0ZU 1SSXA 2L74A 4X0WU 1G32B 1AI8H 3A80A 2ZU4A 1O3FA 1BMAA 5EIYA 1GBLA 1S6LA 3PMJA 4ISIH 1QA7A 1RJXB 5JBBS 4B71A 2TRMA 2XC4A 4CH2B 1F5KU 3T29A 2TIOA 3A7WA 3MNBA 1INCA 2UUJB 1N6XA 2P8OB 3SV6A 2HNTC 3FZZA 1FONA 1T4UH 3RXAA 2QF3A 3PTBA 1E1RD 1E38B 4LZ1H 2ZFFH 3SU1A 2XC0A 1OKXA 2ZGBH 2Y81A 2Z94A 1NN6A 1TMUH 1TNHA 2WYGA 2R0LA 3RU4T 4DCDA 2FX4A 2OC0A 3GCNA 5FPSA 4UE7H 4K8BA 1GCTB 1DWDH 4UONA 3DUXH 2GDDA 1ELBA 1NBMD 3MHWU 3HGPA 2FOGA 2WPIS 2ALVA 2CHAC 3Q3YA 1KXFA 1HFDA 4AG2A 1H4WA 3WWFA 1QZ8A 5I25A 4LOYH 5A0AE 1ETRH 1L1GA 1SFQB 1GJ6A 1SG8B 3PLBA 3VXEH 2OUAA 1G3BA 2FLRH 4TPYA 1EAWA 1KXAA 1MU8B 2BDBA 1UVSH 1MD8A 1L4DA 2HLCA 1IOEA 1DOJA 1P0SH 2WV4A 5ESBA 2BLWA 1FX0B 3DSGA 2J97A 2PR3A 3K6YA 4TY7A 1Q31A 1CVWH 2EQNA 5DP9A 1PPZA 3PO1C 3SU0A 3SQHE 2ZNKH 1A0JA 1C4Y2 4I8KA 2F9OA 5GJ4B 2RA3A 1Z7KA 3D23A 1MKWK 1TFXA 2G51A 5C17A 2Z9KA 1A5GH 4XFQA 3A85A 3STIA 1C1TA 3BTKE 4JZDH 4HI3A 1PYTD 2GVFA 5KEDA 4FUBA 1Y5AT 4TT3D 1LHGH 1PPFE 2SGAA 1YBWA 3GOVB 4AFUA 2AEIH 3GDVA 4SGBE 1SQRA 4FVDA 1SGQE 4JYUH 3UNRA 2J2UA 2F9NA 1HAVB 1F0RA 2TGDA 4HTCH 3TNSA 1D3DB 2W5EA 3QK1A 3RLWH 1NESE 3ZVFA 1XKAC 2NU4E 2BXUH 5E0GA 2A31A 4NWKA 1AE8H 3ELAH 1XVOA 3CS7A 3LH1A 1MCVA 1C5OH 1BBRE 2AHME 2ANKH 7GCHF 1HAPH 1O3GA 2IJD1 4NZLA 2EY4C 2R2WU 1GI7B 4RT1A 1BMNH 7GCHG 3AAUA 2K7XA 3SJ9A 3PWCA 1YPKH 1FNIA 4FVBA 1HRTH 1KTSB 2RDLA 2UWPA 3GY7A 3RP2A 3NPSA 2ZCHP 5FCRA 3KNXA 2THFB 1WUNH 2EI7A 3RMMH 1QBNA 2Y7XA 5EJ1A 1EXFA 2H9EH 3OAAD 3N7OA 3EAJA 4OS1A 1FY4A 1DLEA 1D9IA 3EQ0H 4TYDA 3SNCA 1K9OE 2F9PA 6GCHF 3RMOH 3VGCB 1S6HA 3T28A 1OYQA 2KZ4A 4FETA 1C1QA 3SU3A 1KDQA 6GCHG 1MKXK 8GCHF 2I6QA 1TRMA 1RTKA 4FUDA 4XE4A 4Y8YA 4SGAE 2EC9H 8GCHG 4X8TH 2YMSC 3LC5A 3SBKA 1SGIB 5HIYA 1C5TA 1YPEH 5DGJA 2Y7ZA 1EJMA 3NK8A 4GLYA 1ANDA 1RIWB 3BEFB 1GDUA 3A8AA 1JRTA 4F55A 2QXHA 2I6SA 1S5SA 1H9HE 3SNDA 1CGIE 1A61H 4Y6DA 2BB4A 2B7DH 1NBME 1C1RA 3LKWA 3ZV9A 2SGDE 3RXQA 3P8NA 1FV9A 1QJ1B 2VIVA 1GI6A 3MMGA 3T2NA 4QT8C 2P3FH 2FOCA 1UHBA 1G36A 1QRZA 5L2ZH 3SHAH 2QXIA 4ABJA 4NZQA 1V3XA 5DP6A 4D7GA 5A09A 2ZDVH 1L1NA 2HALA 3U1IB 1C4V2 4F4OC 2BD9A 1O3AA 2AMPA 3TU7H 2QC2A 4CH8B 3RU4D 1SGYE 1Z8JB 5J4SA 3MU1A 2Z7FE 4Y11E 3RXHA 5JBAS 1IQGA 3WW7A 1S84A 2FESH 2R3UA 1ZR0A 3M3TA 3UPEA 1YPHE 3Q77A 2DE8A 1GL1A 1BRBE 4A1TA 3ZZ4A 2BVRH 4AB8A 1KLTA 2XBYA 3O8DA 2FI3E 1SQOA 4YLQH 4Z6AH 1YPGH 2BDHA 2AGGX 3OEED 1OWIA 1O2GH 2QXJA 1PQAA 3M5MA 3RXVA 2L6OA 1YC0A 1B5GH 1DXPA 5A0BA 1T8OA 5JPMH 2SGEE 4X2WA 1HXFH 3GY8A 4IC5A 3RC5A 2CJIA 2FM2A 1FUJA 1Y3VA 2BDAA 1WAYB 4D9QA 1W3CA 2R2MB 3OX7U 1P04A 4NA7A 3FKSD 1ZSKA 4U30A 1WYKA 1SOZA 2RG3A 5FBIA 1GPZA 1P12E 2CHAB 3F2HA 1O2VA 3A88A 3DCLA 4Q63A 1WV7H 1TMTH 4PROA 5DSFA 1T8NA 2HGTH 1A2CH 2CK3D 1TNIA 1PYTC 1NS3A 2SFAA 4B6EA 4O03A 1KSNA 1SVPA 4IBLH 5DO4H 4DY7B 4Q4LA 4ABEA 4AGKA 1QY6A 1RRKA 1GBKA 2XC5A 4FUCA 1NFYA 4ISNA 3MFJA 3SV2H 4ACAA 3PO1B 1Z71A 1K1PA 2ZQ1A 5C3NA 4I8GA 1UTJA 4X1PU 4E7RG 5C1XA 1QTFA 4B2CA 2BMGB 1W8BH 4CRDA 1G9IE 1L0ZA 3VB3A 2BD2A 1FQ3A 5DP5A 1S82A 5HMAA 3UWIA 4O3UA 2ZFPH 1Q2WA 2J34A 2W26A 3M61U 3ZZCA 4CRAA 3H7TA 3Q76A 5CDFE 1UMAH 4YM9A 3ZZ5A 1TNKA 1XM1A 3A7XA 2W3KA 1AN1E 1TPOA 2A7CA 1AO5A 3LPRA 3T27A 1C5NH 2GMTC 3PB1E 3TLOA 1H8HD 4NSYA 3RXBA 1GI2A 1CU1A 4Y0ZE 1ZSLA 4K2YA 3U1JB 2GZ9A 1QHRB 2F9BH 1HIAB 2BQWB 3K6ZA 3SV7A 5A8ZA 3NXPA 3U8RH 2G5NA 2ZDNA 1O32A 4R0IA 1ARCA 1SI5H 4OGYA 5F53A 1ZZZA 3UOUA 1ZGIA 1IQHA 2CF8H 4ABBA 2WZQA 1E36B 4VGCC 2LP6A 1KXDA 1OHHD 4MLFB 4M7GA 5TCCA 4A6LA 4O97A 1H8IH 4ZKNU 2OLGA 3K65B 4ZKSU 3GCTF 2ZKSA 1NU9A 1Y3YA 2WV9A 4Z0KA 2GTBA 3UQOA 1KYNA 2XBVA 1ZMNA 3IITA 3DD2H 4Q7XA 3GCTG 3LGTA 3RMNH 4OS7A 3UREA 5JDUB 4CBNA 2ULLA 1TX6A 2C8ZB 1IQJA 1DFPA 3MNSA 1G30B 4WF8A 1YLNA 3BEUA 1NROH 2J92A 4DJZB 1T7CA 3S0NA 1EFRD 4MPWA 3F2FA 1OWEA 4NA9H 1D3QB 1MTWA 5EGMA 3BSQA 1EAUA 2JIZD 5EQSA 4WXVA 5HKKD 4DIIH 3GYLB 2HVYB 1AMHA 3RU4E 3V0XA 4X6MA 2J98B 2A4RA 2PSYA 2J9NA 1C1UH 4I8HA 1YM0A 3WY8A 1P05A 4FXGH 6ESTA 1WTHD 2BLOA 3BEIB 4IGDA 1COWD 1HDTH 1HAYB 5CHAC 2FEQH 1ELFA 4TWYA 1C2FA 4YT7H 3KEEA 5C1YA 5DPAA 4KTSA 2XRCA 1BBRH 2GCTC 1QURH 3FVFB 1IQFA 2BY6X 2K8IA 2NU3E 1T8MA 2ZU1A 2ZGHA 1NY22 1GI8B 1A46H 3W94A 1O39A 2BQ7B 4P02A 3OTPA 4KTUA 1VCWA 2FIRH 1V2RT 1TPPA 1P2IA 4ZKOU 4FUJA 5CHBA 3MU5A 1QR3E 1XVMA 4H4FA 1GJ5H 4GAWA 2HLDD 1A5IA 3M5NA 2A5IA 3EDXB 2BVSH 2BY8X 2DUCA 1C5UA 1VJ9U 1HJAB 2FO9A 1MBQA 4HG6A 1V2PT 3MTYA 3JZ2B 1Y3XA 3VEQB 4LXBH 1WCZA 3CENA 4I8LA 1QQUA 2CN0H 4TPIZ 4DOQA 1O36A 1BA8B 1XUFA 1MZDA 1GI9B 1K1JA 2ZFRH 1C5XB 2ODYB 1XUKA 1UW7A 2VBCA 3TGKE 2BVXH 1GHYH 4UFDH 1K2I1 2ZU3A 1C1OA 3ZVGA 3E8LA 1PQ7A 2YOLA 4ZXXH 4X1QU 1SGRE 2IJOB 1AVGH 1O2YA 3TH4H 2C8YB 4YXWD 1O2XA 1TA6A 1CBWC 4MTBA 1DSTA 3FOAA 1AKSB 1GBEA 1BRAA 3EGKH 3PMHB 5HGGA 3TPIZ 2AERH 3V13A 1MAXA 1GDQA 4UFFH 6LPRA 2ZECA 2GDEH 5EPNA 5FL7D 3BG8A 1SHYA 2OQ5A 1UVOA 1D3TB 1GI1A 1RIWC 1UVTH 1GBJA 5EXNA 2ODQA 3GICB 1EP6A 4WVPE 5H4IB 3QGJA 2SGQE 3A8DA 2PUXB 1N1LA 3TJVA 1ZSJA 1O2QA 1D4PB 1RTFB 1TA2A 1A3EH 2KCYA 4BNRA 4FUEA 4NA8A 2BD3A 2Q6GA 1DPOA 1GVKB 3ZVBA 2PP6A 3GY4A 1DX5M 1W10U 1BTWA 3V3MA 1DICA 5TJXA 1QCPA 1S0RA 1TBQH 4A1VA 1HJ8A 2VVVA 2YMSD 3UB0A 1LCYA 3V7TA 1GBBA 4JK6A 1GBIA 5E2OA 5JBCS 4ABIA 2BD4A 1V2VT 2DE9A 2OBOA 5T3HA 3SV8A 4ZMAH 3ATLA 2Y80A 4UD9H 1TNGA 4OS5A 3TK5A 1TX8A 2D1JA 2D2DA 2PKSB 2VWLA 1GBFA 1C5VA 1KXEA 3ATIA 1BTUA 2KCAA 3ESTA 3LGYA 4Z1MD 3I77A 2OP9A 4FU7A 4GSOA 3QTOH 4BAKB 3F2GA 1D6WA 1NPMA 1XMNB 1P10A 1SLUB 2G00A 5F8XA 5FHTA 1EASA 3E90B 1FIZA 3STJA 1BTHH 1O5BB 3T5FH 1F92A 3VB4A 3MU0A 3SNEA 1WBGB 2GMTB 1YWUA 3SJ8A 2K0QA 3BTTE 1UCYK 1JIMA 2AMDA 1CO7E 3MO9A 3P92A 4BAOB 1D6RA 2QV1A 1F2SE 3K2UA 3M36A 1ELAA 4K69A 3OYPA 2F83A 2A7HA 4BTIB 2BLQA 3KQEA 3GCHC 2Q1JA 4AGJA 4CRGA 1TNJA 2YNBA 1HAOH 3SYJA 3BTWE 4WMFA 1BJUA 1TRNA 4XD7D 4VGCB 2ODPA 1C5LH 3ZYEA 1TGCA 1VKYA 3T62A 4OS6A 3AW1A 1V6DA 5FAHA 4TY6A 4XSKU 2H9HA 1FZZA 1EAIA 1GMCF 5CE1A 2PV9B 5LPRA 1LKAA 1P8VC 2VJ1A 2ZCKP 1VGCC 3F0PA 4HGCA 1TGBA 4MNWA 4K1TA 4ZHMU 2ZPRA 3TVJB 5A8XA 1GMCG 1VITF 8ESTE 4RI0A 2A2XH 5A8YA 3OSYA 1O2JA 1O3PB 2QCYA 1D3PB 1VITG 3SNAA 1L1JA 3UQVA 4INHA 1O5CB 1TX7A 1VR1H 1GJ9B 4AC9A 3TJUA 4AFQA 1BHXF 1TBZH 3TGJE 1ELTA 1PFXC 2G4TA 3TNTA 1XKBC 2VIWA 3PMAB 1KLIH 1BHXB 5JB8S 1ZTKA 2H2ZA 1TQ7B 4K8YA 1FY8E 2BZ6H 3SJKA 4BAQB 3BTQE 2VIDA 5CHAB 1AFQC 4K1EA 3MH4A 1IHTH 5GWZA 1G3DA 2RA0A 2GCTB 3LDXH 1UO6A 1C5WB 3IG6B 7LPRA 2JH6D 3PTNA 1UTLM 4Y7AA 1YLDA 3PLKA 2ZHDA 3N7EA 4H42U 1JBUH 1OP8A 5FPYA 2Z9JA 1GMDF 4CREA 3ITIA 3BTFE 4GVUA 1LDTT 2D8WA 2ZQ2A 2B0FA 1DUAA 1EOLA 2W3IA 1GMDG 2WPLS 2EI6A 5J4QA 4UDWH 3L33A 2KR7A 1P11E 2BY9X 1ZYOA 3HPTB 1O3DA 1QBVH 1X7AC 4BAHB 4X6PA 1TOCB 5A2MH 4X1RU 1TALA 2P95A 8LPRA 3SGAE 1Y5UT 1GL0E 1AVWA 3HK6B 2A5AA 1BQYA 3Q3XA 1MABB 2GX4A 1O3JA 1WU1A 4YT6H 2NU2E 1T4VH 4CRFA 5E8EH 2G81E 1W0JD 4YTAA 4MPXA 2QXGA 3DHKH 5C94A 1EATA 4I86A 3RXLA 2ZEBA 3DSPA 3HKJB 1MAYA 2FS9A 2FOMB 1CBWB 1VZQH 1BRUP 3PMBB 2FMJA 4KGAA 2ZHWH 4E05H 2KAIB 1P9UA 3EBNA 1C2GA 2PKAB 1MTVA 1AWHB 2HPPH 2P59A 4ABGA 1K28D 4AZ2B 3SV9A 2ZA5A 3LOXA 5HXFA 3M37A 5EW1H 1THRH 1GJ8B 4WMDA 4KKDA 2XNDD 3GY6A 2QY0B 3SU2A 1UTPA 2BDYA 2TGAA 4RT0A 3PYHA 2Z3CA 1CA0C 5L30H 1T32A 2F9VA 1C1MA 2OXSA 3E91A 1NZQH 1HAZB 3KIDU 4DIHH 1GBDA 5GXPA 4ACBA 1SLXB 1C5SA 4IN2A 1BOQA 1GHXH 1LHDH 3BIUH 3F6UH 4A5TS 2QF4A 1O2KA 1P06A 4KP0A 5EQRA 2BXTH 3M3SA 1AZ8A 2ZU5A 1H8DH 5F8TA 2FXRA 1W11U 4YOJA 1JOUB 1OP0A 4U2WA 5G4BA 1HJAC 5F03A 4WH6A 3M35A 3OTJE 1IQMA 2XYAA 4ZAEA 1FAKH 1DDJA 1O2IA 2H9TH 2RFKC 1GG6C 4GUXA 3GYMA 1OP2A 2FTMA 1SGEE 1SOTA 4IC6A 1KLJH 1YF4A 2HNTF 1K1NA 4RKJB 1YCPH 2ZHQH 1PQ5A 1HAVA 4Q7ZA 4XRNA 3LU9B 5FX6A 3RXMA 1MD7A 3EYDA 4CRBA 4BOHA 5A0CA 1QJ6B 1NO9H 2BZAA 1TWXB 2Y5FA 1BCUH 1QIXB 3P17H 3LGVA 4GCHF 3KYFA 4ESTE 1H9IE 5GDSH 2ZC9H 3PV5A 2PGBB 3DFJA 4GCHG 5E2PA 1WSSH 1E37B 2LPRA 4JZEH 3RXTA 1SGFG 1O31A 3SORA 2R3YA 5EODA 2C4FH 1C5MD 2CGAA 7ESTE 3PV2A 1BB0B 4DVAU 2C90B 4I32A 3ZV8A 3LONA 5E0HA 4LK4A 1THPB 1C9TA 1DS2E 2W6JD 1GHAF 1O2MA 2AH4X 1LQDB 3E0PB 2A0QB 4FU8A 1FY1A 7KMEH 2OINA 3GCHB 2GCHF 4MQAA 1G2MA 1LVOA 1GHAG 1RD3B 1NFXA 2HOBA 2GCHG 2WPHS 3U8OH 3P8GA 3ZVEA 3F9HA 4ZH8A 1C5RA 2JH0D 4KTCA 3SU6A 3DA9B 2WPKS 3LT3A 1ZRBA 3QN7A 1E35B 5E0JA 3SI3H 3E6PH 1TYNA 1ABIH 1HYLA 1V2TT 2H6MA 3BTEE 1GJCB 4YO9A 1VGCB 1ABJH 1ZGVA 3M7TA 2VIQA 1WDIA 5DKMA 3W95A 1DLKB 4Q7YA 1TAWA 1ID5H 3QX5H 3U8TH 3BG4C 1GJDB 2ZGXH 3GDSA 1P9SA 1W2KH 3UTUH 2PKSC 1K1OA 1NTPA 1CHGA 4XOJA 1DWCH 2BD7A 4AN7A 3AASA 2LELA 3S9AA 3ATWA 1ANEA 3SZNA 1XUJA 2J5UA 3HKIB 4NG9H 1QA0A 1HBTH 1FMGA 1O30A 1SL3A 1CA8B 5K0HA 1DT2A 4U32A 2EEKA 1EB2A 1ZJDA 4A7IB 2UWOA 3SOSA 5GNDA 1T31A 9LPRA 3ZYDA 2WPDD 1SHHB 1A4WH 4MNVA 1O3OA 1ELDE 4DW2U 1IQLA 2BD5A 4M9FA 1EPTB 2ZCLP 3KF2A 2W6ID 5EJLA 1O2SA 3S7HB 2FTLE 2ZHEH 1O34A 1AGJA 2PSXA 4CHAC 2BLVA 1AFQB 1GBHA 1NRNH 1OPHB 2TGPZ 2VGCC 1G3CA 3T25A 5EPYA 1O37A 2PWXA 1FDPA 2J94A 1AQ7A 5LPFA 2FYRA 1GJAB 2HWLB 3UNQA 2AIQA 3B8JA 1AE5A 4E7NA 1O5EH 3RXKA 3URDA 4JMYA 2W7SA 1P01A 4ABDA 2ESTE 4D76A 2FOHA 4WXIA 3S7KB 1Y5BT 3JZ1B 3A8BA 1K21H 1LVBA 1ZOMA 5FPTA 5EQQA 1Y8TA 3SI4H 1Z1JA 2F4LA 4OGXA 3ZVCA 3UOPA 4FU9A 2XCFA 1PJPA 2XWAA 1ZPCA 1MZAA 2ZZUH 1B7XB 3FZDA 3DSOA 1J9CH 4AG1A 2ZDMA 1SFIA 1RGQA 3QLPH 4UFEH 4ZUHA 1BIOA 1UCYH 1P3EA 4GPGA 2ZO3H 2WPJS 1YGCH 1OWHA 3KCGH 1MMJN 2ZI2H 1SGFA 2ZPSA 1KXBA 3OE7D 2FI5E 3W1EA 5ABWA 2Y82A 3ZZBA 2OC1A 3IWMA 1GMHF 3EA9A 2H5CA 5IYTA 1GVLA 2WV5A 2ZGCA 4MVNA 3U9AH 4ISHH 2GP9B 1GMHG 1OWDA 2CV3A 1MTSA 2O8WA 4YOGA 3SZEA 4RN6A 1W7XH 2OC7A 2ZHFH 2ZP0H 2F3CE 1YLCA 1DUEA 2A1DB 1TPSA 4J2YB 2BDIA 3C1KA 1AUTC 1SGCA 3OEHD 1M9UA 3QTVH 1YPLH 3A81A 3O8RA 1W7GH 1B0EA 1ESTA 2FYQA 1V2JT 1JIRA 1E1QD 2BQ6B 2ZFQH 3A8CA 1CA0B 3A84A 2HRVA 1NRSH 4ASHA 1IHSH 2AMQA
chains in the Genus database with same CATH topology
1F0SA 3M5LA 5FXLA 1MKWH 3SJIA 3ODFA 3TH2H 3VB6A 4AB9A 1UK2A 2V3OH 4TWWA 4B2AA 3RXFA 3MO3A 3O8CA 1LHEH 1VCQA 2Z3EA 2Y6TA 1LTOA 3BV9B 1GJBB 4AX9H 1ORFA 2HPQH 3ZVAA 3A7ZA 3D62A 1Y3UA 1C1SA 2AS9A 2C3SA 3DT0H 2FDAA 4JZ1A 1GG6B 1FPCH 2ZGJA 4H6SB 4AYVB 3RXGA 4ZKRU 5C2ZA 2ZDKA 3TJOA 1O2TA 4R8TB 2HVXA 1MH0A 3FP8E 4JCNA 5LH8A 3A7TA 4FUGA 3MNXA 3RDZA 3MH5A 1HIAA 2ZF0H 3A86A 3D65E 5K7RA 1BUIA 1O0DH 2B9LA 1CT0E 3BTDE 2OQUA 1J8AA 5GCHF 3SO3A 2WPMS 3MYWA 1SC8U 1ZTLA 3B23B 1TE0A 2VWNA 5GCHG 1QL7A 2RCEA 1RTLA 1AHTH 1ESBA 4JYVH 1IQIA 1ELCA 1Z6JH 3CS0A 1PPCE 1AUJA 1E0FD 1W14U 1GWAA 1OOKB 3PROA 2NU1E 1MTNC 4NIXA 3RMLH 1Q3XA 5C5OA 4Y8XA 3SU4A 4JZIA 1THSH 5IDKA 1K22H 1HLTH 1O38A 2ZWLH 3VFEA 1FY3A 1QJ7B 1YYY1 1MTUA 5EXLA 1DWBH 3SGQE 3ODDA 1UTMA 1BTPA 2GD4B 1HAHH 3HGNA 4WY3A 3BF6H 3PWBA 3RXJA 1C2LA 1P2JA 1MKXH 1RS0A 3MU8A 4B2BA 5EG4A 2BDGA 1A7SA 1P03A 5HYOA 1OWJA 1V2NT 2BHGA 3KL6A 3BN9A 2G52A 1UJ1A 4MNYA 2BY5X 1GI4A 1KY9A 4K3JA 3SUFA 4AORA 3E3TA 4OS2A 1EQ9A 1A5HA 1TOMH 2HNTE 1ZHRA 3VB7A 2F91A 1HAIH 2GV6A 2OCVB 1JMOH 2GV7A 3UR9A 3SHCH 1BJVA 2TGTA 3BG4B 2ANMH 3RXRA 3GCOA 3UFAA 1HJ9A 5L2YH 2OTVA 1AFEH 1L4ZA 1K1IA 4YOIA 1TIOA 2BTCE 1V2ST 1UTNA 3SU5A 3ZZ9A 4BXSA 1F0TA 2Q6DA 1CSOE 1XX9A 1V2MT 4X2XA 1OX1A 3A89A 1CE5A 3O8BA 4BTUB 1OS8A 1LPZB 1ANBA 1NFUA 3R3GB 1O3KA 4ABHA 1O2RA 2FPZA 3H7OA 1SQAA 1C2HA 2AGIX 4X1SU 4UEHH 1C2DA 1GJ4H 4CHAB 4B76A 3OY6U 2VGCB 2VNTA 1K1MA 1W12U 2O8LA 4MDSA 4ABAA 3M5OA 1QRXA 1HAXB 1YP9A 4Y79A 4MPVA 4K60A 3T26A 3P8OA 4DGJA 3RM2H 1MUEB 1G37A 1SQTA 3RXPA 1BT7A 5ETXA 2A45B 4NGAH 3VB5A 4BXWA 1O2OA 2G4UA 1EZUC 1E34B 1N8OC 2ZFTA 4Y10E 1LKBA 4WH8A 1KDQB 4NIVA 3LGUA 5DP4A 2IPHA 2FOBA 1DSUA 3PV4A 4INKA 2O8MA 1GI3A 4NCYA 4D8NA 1ZPZA 2PTCE 5JYIA 1AKSA 3H5CB 1ETSH 3I29A 4HFPB 2OBQA 1HPGA 2ALPA 4OS4A 1AB9B 1BZXE 3A87A 4ABFA 1OYTH 3GY3A 3SUEA 1F5RA 3S69A 1O3IA 4AFSA 4BTTB 3MI4A 5C20A 2VH0A 2V6NA 1V2UT 2XTTB 3S9CA 1Y59T 1UCYE 3DFLA 1GHWH 1O5DH 3KQDA 1BBRK 2G8TA 2VH6A 1HB0B 3SUDA 4D9RA 4NIYA 5AFZH 1J17T 1NFWA 1A0LA 1HNEE 2FX6A 2VVCA 1G2LA 3P6ZB 3TGIE 4HZHA 1O2PA 2FODA 2Z9LA 3R0FA 5LPEA 1EPTC 1LMWB 1O2HA 1V2LT 1CGHA 1SGTA 2V35A 4B1TA 1UHBB 3QZRA 2EI8A 6CHAC 4X8VH 4NFFA 1SLWB 3TH3H 4AOQA 1DY9A 1N6YA 1MQ6A 1LPGB 1O5GH 1SMFE 3D49H 3QO6A 1FPHH 1VITH 5I46H 2XXLA 4Q2KA 2Q6FA 1SGNE 2FOFA 1C1NA 1RFNA 1ZJKA 2B5TB 3I78A 1TGSZ 2PTNA 5T6DA 4GHTA 3G01A 1TMBH 2VVUA 1CQQA 1BTZA 4NIWA 4D7FA 1FLEE 3F9EA 2A4OA 2O8TA 1O33A 1S83A 1S0QA 1SBWA 1EZXC 5AVDA 3QUMP 1PQ8A 1XXFA 2WINI 2VU8E 1O5FH 3ENSB 3UIRA 2JETC 1C1VH 1ZHMA 3RXDA 3QDZB 3VXFH 2BX3A 5C1UA 1NT1A 3LJOA 2QYIA 1ZTJA 3BTME 1O3BA 1GGDC 1BRCE 1Z6EA 1P2MA 2FLBH 2AFQB 1QL8A 2B8OH 2V0BA 1A3BH 2O8UA 1O3HA 3M7UA 3QGNB 4DT7B 4H6TA 2ZDLA 3FFGA 5HM2A 1HV7A 4BANB 2QN5T 2IN2A 3BIVH 4E06H 1O2UA 2FS8A 3NWUA 3UNSA 2ZDAH 1O2WA 3LC3A 5T6FA 1MTNB 4MG3A 4U01A 1DY8A 1AD8H 4Y7BA 3RC4A 3ATMA 1TABE 1UVUH 2AGEX 1JXPA 1KIGH 2WUCA 1TLDA 1YKTA 3KQCA 4I7YH 3TK6A 2C8WB 1OSSA 1C2MA 2TPIZ 3FP6E 3GDUA 1ZPBA 1ETTH 2PUQH 4ZHAA 2BY7X 1TGTA 3A83A 4ISLA 5EOKA 1W13U 3MWIU 2SNWA 4DURA 3KQBA 1SGDE 4XBCA 4IMQA 3URCA 4UFGH 1P2OA 5L6NH 3M3VA 3RXCA 1HGTH 3NKKA 3L3TA 1LO6A 3SNBA 4B75A 3FP7E 5DG6A 1C2JA 1GVZA 1V2QT 1HCGA 1QFKH 1JWTA 4I8JA 1FAXA 2ZIQH 2UUYA 2JH5D 1LPKB 1NRRH 2QF0A 3GISB 5BPEA 4JK5A 2QA9E 4K5ZA 2PW8H 2FOEA 1KXCA 5JBTA 2P93A 1V2KT 1C9PA 1DITH 1A0HB 1HXEH 1J14A 2Z9GA 2ZFSA 1QGFA 2H5DA 1SGPE 2ILNA 4IMZA 1AWFH 2K1QA 2H1UA 1HAGE 1EZQA 1C2IA 1O3EA 1P09A 2BDCA 1B0FA 1SR5C 5AF9H 2LIZA 3FANA 1FN6A 5TCAA 1LHCH 1CHOF 5DP8A 2BD8A 5FX5A 3ZZ6A 3SQEE 3HATH 3AVZA 3RUOA 5PTPA 1F7ZA 1L2EA 1TPAE 2STAE 1C2EA 2WYJA 1CHOG 1ELGA 2V3HH 2VWOA 3BTGE 5DJ7A 3E1XB 5GIBA 1YPHC 1IQEA 3Q00A 4I31A 2GGVB 4WJG2 3LGIA 1QB9A 4GHQA 5EXMA 1GHBF 4ZXYH 1EB1H 1N8OB 1SB1H 2J4IA 2J95A 3RXUA 2F9UA 2SGFE 3ZVDA 4BAMB 1XUGA 1VJAU 1QQ4A 1GHBG 3TJNA 1O5AB 3A7VA 4AYYB 1EZSC 1T8LA 4FUFA 5SGAE 5JB9S 3C27B 1TNLA 2XBXA 1FN8A 3F1SB 4CRCA 2QIQA 3Q3KA 4WWYA 4X2YA 3EA7A 3UUZA 2VWMA 5AHGH 1J15A 1ELVA 5FBEA 2KAIA 3ZZ8A 2PKAA 1SPJA 1O2LA 1Z8GA 3MH7A 3LIWA 1YPMH 2XNIA 1C1WH 2FI4E 3LJJA 2PFEA 4THNH 3B9FH 3M7QA 1XXDA 4RKOB 4O3TA 2Z9IA 2W7UA 1O2ZA 2LNCA 1MBMA 1PPGE 3RLYH 4LZ4B 1P57B 1EOJA 1WOFA 2GT8A 2C8XB 1AY6H 4A92A 1UVPA 2Z3DA 2XWBI 3SUGA 2D26C 2O9QA 1DXWA 4B74A 3HK3B 4IS5A 2P3TB 2P8OC 3MU4A 2QAAA 1GBAA 2A32A 1TB6H 2ZG0H 5CMXH 4CR9A 3U98H 1IQKA 2GT7A 1QNJA 3ZZAA 1BTYA 2XW9A 6CHAB 4I33A 1S85A 2FWWA 1UTQA 1CT2E 1FXYA 1EKBB 2FP7B 5LGOA 2P94A 1C5YB 3NUMA 1QL9A 2JKHA 1GI0A 1ESAA 4CBOA 1ZLRA 1YPJH 1GCDA 1IQNA 3VPKA 2A4QA 2CF9H 3MOCA 2A4GA 2J38A 3UWJH 2Z6BD 1GCTC 1V2OT 2ZTXA 5DP7A 5DP3A 1PPBH 3OY5U 1XUIA 1KTTB 1LVYA 5DK1A 5EW2H 4XBBA 1K1LA 1CGJE 1EUFA 1QB1A 3AAVA 5F6MA 4X2VA 1C4U2 2A5KA 1XUHA 3QWCH 5FCKA 2M5TA 1ACBE 1FI8A 1O3MA 1AB9C 2PLXA 2VINA 3MH6A 1S6FA 2JETB 2UWLA 3V12A 1FY5A 1O2NA 4NSVA 1C1PA 1JRSA 1PPEE 5B6OA 2SGPE 3RC6A 4JYTA 1YCPM 1SLVB 4JZFH 4IN1A 3NCLA 1UTKA 1AIXH 4A1XA 1GGDB 1TGNA 2BYAX 4K1SA 1PPHE 1VCPA 3NZIA 3PM3A 1OXGA 3OU0A 1GDNA 1QBOA 1UK4A 1O3LA 2ANYA 3F68H 1WTGH 4X8SH 1Z8RA 2FZZA 1BDAA 2A2QH 2NU0E 2P16A 1P2QA 1GHZA 1GBTA 1WQSA 1HUTH 4Q80A 2SNVA 4MNXA 2ASUB 1ANCA 2VIOA 4FUIA 1ELEE 1NU7B 2BM2A 1MQ5A 3S9BA 2YNAA 3MO6A 2ZTZA 3SGBE 4F49A 4MPUA 2BOKA 1P3CA 2CMYA 1EX3A 3KHVA 1AVXA 1NRPH 3A82A 8KME2 1W0YH 3U69H 3GY5A 2EA3A 2A7JA 3TK9A 5C5NA 2OD3B 3KGPA 2STBE 1H9LB 1BITA 4RSPA 4NWLA 1GJ7B 3E16B 3ZZ7A 2AYWA 5C67A 2CXVA 4ZROA 4X6OA 3UR6A 1QB6A 3P8FA 4ISOA 1YCPK 1LHFH 1TRYA 3RXOA 4AFZA 2Y5GA 1P02A 4WMEA 1TQ0B 3EA8A 4YESB 1BTXA 1V2WT 1Z1IA 1MCTA 3AW0A 4KELA 2GKVE 3E0NB 3PLPA 2XCNA 9ESTA 1WQVH 1P2NA 1EPTA 2UUKB 2XBWA 1OWKA 1G3EA 2ANWA 3F9GA 2G5VA 1O3CA 1U6QA 3SN8A 3EE0B 4Y0YE 2NWNA 5GPIB 3RM0H 2R9PA 1DVAH 3F9FA 1FIWA 3BTHE 3K9XB 1TBRH 4X1NU 5BRRE 4YLUA 3SJOA 4XBDA 1FJSA 3RXSA 1O35A 3CP7A 3ZZ3A 1BMMH 5HM9A 1MU6B 1EJAA 3P95A 1C5QA 3UY9A 3A7YA 3VGCC 1EAXA 1C2KA 2FOAA 1NRQH 3RXEA 3L6PA 5T6GA 1ZRKA 4Y71A 4ZHLU 1UTOA 3SW2B 5EU8A 2BX4A 1ZMJA 1O3NA 1NM6A 5ESTE 1DWEH 2IOTA 2R0KA 3RXIA 3FAOA 1NC6A 3LH3A 3QZQA 4XDEA 1RXPA 1ZMLA 1GBMA 1S81A 2BOHB 1H1BA 1GHVH 3P70B 4Y76A 5F8ZA 1Z8IB 2C93B 4INLA 4IW4E 3KN2A 1C5ZB 4X6NA 1IAUA 1EP5A 4FUHA 4O9VA 3ATKA 1GBCA 2ZU2A 2GZ8A 2PHBA 2UUFB 4NFEA 1F5LA 2TBSA 1F0UA 4DG4A 3TIUA 2G55A 1AZZA 3MNCA 1EJNA 3LGWA 1DM4B 2VB0A 4J1YA 4X8UH 1DE7H 1J16A 1UK3A 1ZHPA 2PGQB 2ZPQA 3GY2A 4B73A 1QRWA 4Y8ZA 3ZZDA 2GZ7A 4YZUA 3TITA 1Y3WA 2P3UB 1GI5A 2Y5HA 1DANH 1A1RA 1P2KA 1CT4E 2ZTYA 1LQEA 1C5PA 2OC8A 1BMLA 1ARBA 2AIPA 4CR5A 1TONA 2VIPA 2WUBA 1AU8A 5AFYH 1LVMA 2QGRA 1W0ZU 1SSXA 4X0WU 1G32B 1AI8H 3A80A 2ZU4A 1O3FA 1BMAA 1GBLA 3PMJA 4ISIH 1QA7A 1RJXB 5JBBS 4B71A 2TRMA 2XC4A 4CH2B 1F5KU 3T29A 2TIOA 3A7WA 3MNBA 1INCA 2UUJB 1N6XA 2P8OB 3SV6A 2HNTC 3FZZA 1FONA 1T4UH 3RXAA 2QF3A 3PTBA 4LZ1H 1E38B 2ZFFH 3SU1A 2XC0A 1OKXA 2ZGBH 2Y81A 2Z94A 1NN6A 1TMUH 1TNHA 2WYGA 2R0LA 3RU4T 4DCDA 2FX4A 2OC0A 3GCNA 5FPSA 4UE7H 4K8BA 1GCTB 1DWDH 4UONA 3DUXH 2GDDA 1ELBA 3MHWU 3HGPA 2FOGA 2WPIS 2ALVA 2CHAC 3Q3YA 1KXFA 1HFDA 4AG2A 1H4WA 5I25A 4LOYH 5A0AE 1ETRH 1L1GA 1SFQB 1GJ6A 1SG8B 3PLBA 3VXEH 2OUAA 1G3BA 2FLRH 4TPYA 1EAWA 1KXAA 1MU8B 2BDBA 1UVSH 1MD8A 1L4DA 2HLCA 1IOEA 1DOJA 1P0SH 2WV4A 5ESBA 2BLWA 2PR3A 3K6YA 4TY7A 1Q31A 1CVWH 5DP9A 1PPZA 3PO1C 3SU0A 3SQHE 2ZNKH 1A0JA 1C4Y2 4I8KA 2F9OA 5GJ4B 2RA3A 1Z7KA 3D23A 1MKWK 1TFXA 2G51A 2Z9KA 1A5GH 4XFQA 3A85A 3STIA 1C1TA 3BTKE 4JZDH 4HI3A 1PYTD 2GVFA 4FUBA 1Y5AT 1LHGH 1PPFE 2SGAA 1YBWA 3GOVB 4AFUA 2AEIH 3GDVA 4SGBE 4FVDA 1SGQE 4JYUH 3UNRA 2J2UA 2F9NA 1HAVB 1F0RA 2TGDA 4HTCH 3TNSA 1D3DB 2W5EA 3QK1A 3RLWH 1NESE 3ZVFA 1XKAC 2NU4E 2BXUH 5E0GA 2A31A 4NWKA 1AE8H 3ELAH 1XVOA 3CS7A 3LH1A 1MCVA 1C5OH 1BBRE 2ANKH 7GCHF 1HAPH 1O3GA 4NZLA 2R2WU 1GI7B 1BMNH 7GCHG 3AAUA 2K7XA 3SJ9A 3PWCA 1YPKH 1FNIA 4FVBA 1HRTH 1KTSB 2RDLA 2UWPA 3GY7A 3RP2A 3NPSA 2ZCHP 5FCRA 3KNXA 2THFB 1WUNH 2EI7A 3RMMH