4XFQA

Crystal structure basis for pedv 3c like protease
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
298
structure length
298
Chain Sequence
b'AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVLRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVVNTDCFSILAAKTGVDVQRLLASIQSLHKNFGGKQILGYTSLTDEFTTGEVIRQMYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEDV main protease
publication title Structural basis for the dimerization and substrate recognition specificity of porcine epidemic diarrhea virus 3C-like protease.
pubmed doi rcsb
source organism Porcine epidemic diarrhea virus
molecule tags Hydrolase
total genus 85
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4xfqA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xfqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xfqA01
1W13U 4ZROA 1YLCA 1SR5C 2H9HA 2THFB 1DUEA 2ZP0H 3DA9B 2OBOA 1SL3A 1MD8A 1ZPCA 2BOHB 4AFZA 2ZEBA 3E3TA 2A4GA 2A5AA 1O2SA 2Y7XA 4FUFA 5L30H 1S6HA 1YPMH 3HK3B 2BM2A 3LDXH 3PROA 1TNIA 2AMPA 1HDTH 2Z9LA 3LJOA 1DX5M 2V6NA 2Y81A 2YOLA 3SV8A 3ZVAA 2Q6DA 1GI4A 3Q3XA 2R2WU 3LH3A 1V2RT 1FY4A 3GYMA 2OC7A 4ABHA 4JYVH 2ZFRH 1AU8A 1O2MA 1AVWA 2SNWA 1MBQA 4DT7B 2ZDMA 1Y5UT 3SU4A 1KTTB 1AZZA 1SGFG 1CE5A 3NCLA 1SVPA 1PQ8A 2J38A 4MLFB 4CRBA 2OLGA 2XNIA 1X7AC 2W3IA 4AGKA 1H8DH 1LKBA 1VJ9U 1ESBA 3BEIB 1C5WB 1QB1A 2LPRA 2VH0A 4H6TA 1A46H 2QGRA 2QXHA 1C5VA 3MNXA 4TYDA 1Y3YA 1F5KU 4B2BA 4O3UA 1UK4A 1JRSA 1NU9A 2R2MB 4IS5A 1O2KA 5C1XA 2IOTA 2FOGA 3E0PB 4B76A 2V35A 3A7YA 5F03A 1P2MA 1TBZH 3A88A 4FUEA 2CGAA 1O3DA 1CT2E 2FM2A 3VXEH 4ISIH 1L1NA 1NS3A 1OXGA 3GY4A 4LZ1H 4I7YH 3Q00A 2BDHA 1J15A 1O5BB 4KP0A 2WPHS 1YC0A 2BDGA 1PPZA 2ZPQA 1O35A 1UO6A 2GP9B 2J92A 2ZFTA 2STAE 1L1JA 1PQAA 2A7JA 5HGGA 1WQVH 1QL8A 1P12E 4BNRA 4CR9A 3SHCH 1ZHRA 1Y3UA 1O2OA 1TPOA 4K60A 1TGTA 2WUBA 4I31A 4B74A 2P8OB 4AG2A 3R0FA 9ESTA 2VIPA 3ODDA 4WMEA 2O8MA 3U8OH 1THPB 3A8BA 3KN2A 2VNTA 3LGIA 8GCHG 3QGJA 5EXNA 2P3UB 2SGQE 4SGAE 2QAAA 1CT4E 4BOHA 1XVOA 1TQ7B 1QNJA 2O8LA 2WINI 1MZDA 1CU1A 2OQ5A 1Z1IA 5C5OA 1C1SA 3C27B 3EA9A 1K2I1 1SBWA 1GJBB 1FAXA 1BBRE 1B7XB 2A0QB 4RN6A 1NRSH 5C5NA 1VITF 4JK5A 2NWNA 4CRCA 1HAYB 1TNGA 4WF8A 4A92A 1TLDA 4BTUB 3URCA 2VVUA 3UUZA 1EAIA 1NM6A 4KGAA 1ID5H 3ENSB 1TQ0B 1V2QT 1ZTKA 1GBCA 1TONA 4B1TA 4NG9H 1FY3A 1NFXA 1ZGVA 1KXDA 2HNTF 1E34B 1KXBA 4I8HA 1TMUH 3LGWA 5DO4H 1N6YA 1N8OB 8ESTE 3FP7E 2ZECA 1AD8H 3A87A 3KGPA 1K22H 1P8VC 4YO9A 1DDJA 4B2AA 2H2ZA 1VZQH 1Q2WA 1SSXA 1C2DA 1HBTH 1FV9A 2ZU5A 4CRGA 1G3BA 4AB8A 1QURH 4X2WA 1A0HB 1O39A 4AX9H 4MTBA 5FBEA 1YPHC 3QDZB 2W7UA 2BD4A 3SW2B 1IQNA 2BZ6H 3OX7U 4TY6A 2DE8A 1C5ZB 2VIVA 1QRXA 4X2YA 3UWIA 2WUCA 2ALPA 1GJAB 2NU3E 2FOMB 1DE7H 1GBJA 3BEFB 3ZVGA 1PJPA 4UFDH 4X6MA 1SQTA 1JOUB 3OSYA 5HYOA 1GMHF 4B75A 1WSSH 1LHCH 4B73A 2PFEA 2ZKSA 1GCTB 1ZZZA 1P0SH 1QJ7B 3KQDA 3MO6A 5GXPA 1Z8GA 2ZC9H 4X2XA 1HAOH 1C1VH 1K1IA 3E6PH 1GHYH 4O9VA 1SG8B 1U6QA 2QXGA 4BANB 2GVFA 1SC8U 1O2TA 1VR1H 2ZFPH 5G4BA 6GCHG 2ZWLH 1XKBC 2RDLA 1O3PB 1ELAA 4A1TA 3CP7A 2ZCKP 2O8WA 2PHBA 4AB9A 1HUTH 3F9HA 5LGOA 1L4DA 2P8OC 5LPRA 2ZHQH 2QF0A 1HXEH 3MTYA 4BXSA 2FOHA 2ANWA 1GL0E 2JH0D 4MQAA 1GJ9B 3RUOA 1YPEH 1TBRH 2A45B 1MTNC 4Q80A 3RXQA 1O2XA 4NFEA 1A1RA 3ZZ9A 3MNBA 2A1DB 4AFQA 1C5UA 1EZUC 1SLXB 1OKXA 1ELVA 1PFXC 3P8OA 2K7XA 2ZGBH 1T7CA 3GYLB 7GCHG 1G3DA 4JCNA 1KXCA 2J2UA 1ACBE 1C2EA 3RMOH 2PR3A 4YLQH 1MQ5A 1WBGB 4X6OA 3T2NA 2ZDVH 2SGAA 1AKSA 2BDBA 1O3EA 7LPRA 1SGNE 2FOFA 3D65E 3VB4A 1YM0A 4NIYA 1BRCE 4CR5A 1KY9A 2BD5A 2CXVA 1DLEA 3HGPA 4OGXA 1HAXB 4JZDH 1RXPA 2OD3B 2FDAA 2BB4A 1E0FD 2VWLA 3RXBA 4Y8ZA 3SU0A 5T6GA 1AMHA 1UVTH 2ZQ1A 3E91A 2UUYA 1C4U2 2PLXA 5LPFA 3T26A 1DPOA 1ESTA 1KXFA 4K2YA 1OWIA 3GDUA 1C2FA 1EPTB 5DJ7A 1BHXF 1IQIA 1K1PA 2PSYA 4H6SB 2JH6D 2W3KA 1N8OC 2ZCLP 1O2VA 1O3OA 3VEQB 1A3BH 1W14U 1L1GA 3VGCC 1NROH 4NA7A 3S9AA 1IQMA 1D3TB 1YCPK 2C4FH 2CHAC 5DP6A 2AMQA 3H7TA 1TX8A 5BPEA 3F9FA 3QTVH 1BTWA 2HGTH 4U2WA 1O3KA 3P6ZB 2F9OA 2ZDLA 3BTWE 1TMBH 1QTFA 4OS2A 3D49H 4MDSA 5C2ZA 4ASHA 3CS7A 3ODFA 3RXTA 5DG6A 3N7OA 1GHAF 2NU1E 3ESTA 1HIAB 2VWNA 4LOYH 2QIQA 4ABIA 1Z6JH 5EXMA 2O8TA 3GCTF 3TK6A 2AYWA 1C5RA 1FQ3A 1FXYA 1WV7H 3AAVA 1SLWB 1W2KH 4CRAA 4DVAU 1QB6A 1TX7A 4Q7XA 1GCTC 3P8NA 2C8XB 4MPVA 4MPWA 2PGQB 1PPFE 4ZMAH 3Q76A 4JK6A 1ETRH 3A83A 4BTIB 3AVZA 3PO1B 2HALA 3SQHE 4D76A 4FUJA 3BF6H 4FUCA 4K8YA 1ZGIA 3M7UA 2J94A 5JBTA 1RTLA 1V6DA 4Y79A 3V13A 1GJ4H 1B0EA 1NESE 2G00A 3M35A 1CHOG 1D4PB 2V3HH 2YNBA 1GBIA 5FX5A 4LZ4B 2GCHF 2EEKA 1ORFA 4U01A 1K1NA 2QCYA 4BAHB 3SU1A 1MMJN 1SGEE 3EDXB 2GD4B 3EYDA 5HMAA 4CBOA 1VITH 2BY8X 1ZR0A 2G5VA 5JBBS 3SJ9A 1ABIH 1RGQA 4FU8A 1EUFA 3ZVEA 5F8ZA 3RXDA 3PTNA 1TRNA 4A1VA 1Z7KA 3AW0A 1HJ8A 2FMJA 1ZMNA 4I8KA 2VVVA 3EAJA 3ZZCA 3KF2A 1F0SA 3UOUA 3GY8A 1T31A 1EZSC 1EJNA 3MU8A 2FOBA 1GJ8B 2H9EH 3T5FH 1BMMH 1DICA 4Q7YA 3STJA 1OP8A 1G32B 5AVDA 2A7CA 4WMDA 1ZJKA 3MU0A 2F9UA 4FU7A 3LJJA 1YPHE 4XBDA 3U8TH 4Y7BA 3L6PA 3EQ0H 4ZXYH 3H7OA 1C4V2 2FI5E 2VGCB 3FP8E 1S0RA 2DE9A 2VIWA 1G3EA 1KYNA 5K0HA 2G4UA 3GDSA 3TJVA 3I77A 1JXPA 2G52A 2HPQH 2PSXA 3SNDA 1BRBE 2OC1A 5I46H 1P2JA 2Y5HA 1C1MA 2FODA 1S83A 2BLOA 2ANMH 1JBUH 1KTSB 2BVRH 1O2UA 2GZ9A 3SV7A 3VFEA 3BTTE 1O3GA 3RP2A 1BCUH 1LVMA 3ATMA 1RRKA 1ELFA 3RC4A 2F9NA 1C5NH 2Z3CA 1TNJA 1BMLA 2XCFA 1GBFA 1V2NT 1LPZB 3RU4E 2QC2A 8GCHF 4E06H 4X1QU 1TMTH 3BTME 1S81A 1YCPH 1XX9A 5GDSH 1ARBA 1C5MD 1G36A 1J9CH 2QXJA 5F6MA 1A3EH 5FXLA 1Y59T 3S7HB 1C9TA 1W8BH 4UDWH 1DS2E 2XW9A 4SGBE 1ELCA 4LXBH 2ZFSA 1FNIA 3HPTB 5GWZA 3GCOA 1HPGA 1SGRE 1UCYE 2ZGXH 1QRZA 2EA3A 2V3OH 2FESH 4DIHH 1XXDA 1GBMA 2GT8A 1JMOH 3LC3A 3PO1C 4NSYA 3FAOA 2BQ6B 2TGPZ 1A7SA 3ZV9A 5L6NH 3SZNA 4K69A 1F0TA 3F9EA 1N1LA 1P3CA 5JBAS 3UREA 3QGNB 1ZTJA 1YCPM 1SQOA 1QHRB 1H9IE 1SGDE 6LPRA 5EXLA 3A86A 2GDEH 2KAIB 4FUIA 4GVUA 4ZKRU 1GBLA 5ETXA 2P3FH 3M3VA 4B71A 3RXEA 1P9SA 1FI8A 7ESTE 2J9NA 5FPTA 5GJ4B 1S85A 1TWXB 2BLWA 2Z6BD 1ETSH 3M36A 4YTAA 1C5QA 1D3PB 1TB6H 1O5EH 4XE4A 1GGDB 3P70B 1HAIH 2WPMS 2AIQA 1GDNA 4INLA 1C1OA 3D62A 5JPMH 4CH2B 2TGDA 1LVBA 2QXIA 1GPZA 3P17H 4U30A 1GHBG 1C5TA 1A2CH 3RXKA 1V2MT 3LGYA 1GHWH 2R3YA 5EG4A 4UFFH 2ZFFH 2QF3A 1RFNA 3VXFH 3PLBA 1E35B 5AFZH 1CT0E 3AW1A 5JB8S 3S7KB 4GCHG 1O31A 3TPIZ 3GISB 5AF9H 5L2YH 1C5YB 1GHXH 5E0JA 1UJ1A 3SHAH 3ATKA 4DY7B 1ZJDA 3P92A 1SOZA 2ZI2H 3FANA 1AFEH 3ATWA 3E90B 1C5XB 1EPTA 2WYGA 2VGCC 2OC8A 4X0WU 3F6UH 2AH4X 3MHWU 3AAUA 4AZ2B 1O2PA 1MU8B 2R3UA 1C2GA 3ZYEA 2FLBH 1O5AB 2FWWA 4I8GA 3BEUA 3LIWA 4LK4A 3TITA 3VB6A 3TVJB 4FUDA 2ZU4A 2FI3E 3RXUA 3B8JA 4UEHH 1DITH 1EB2A 4O97A 1EAWA 4AFUA 2FEQH 1V2JT 2LIZA 1AI8H 4TWWA 1A5HA 2RA0A 3EBNA 1PYTD 3MH6A 2HWLB 1CA8B 2ZO3H 1IHTH 2VVCA 1VCPA 2Y80A 1N6XA 2SGPE 5GCHG 3C1KA 3LOXA 2G55A 1O36A 2FP7B 1K1LA 1BTYA 3EGKH 3GY3A 1BTZA 1HIAA 3ELAH 1FN8A 1QB9A 7GCHF 1MTUA 1L2EA 3SUGA 4YLUA 1HRTH 4D9RA 1CGHA 4AOQA 1O0DH 2BY7X 5B6OA 3A8DA 3GY5A 1C2LA 3A7ZA 1MCTA 2EC9H 3SU6A 5T6DA 3ZV8A 3STIA 1G30B 1QL9A 1MTNB 2Q6FA 1MU6B 4J1YA 3BTDE 1GHVH 4DG4A 1PPEE 4I8LA 3KIDU 2GMTC 1UTNA 4X6NA 2ZDKA 1DWCH 2SFAA 3RXFA 3KHVA 4IBLH 4Q2KA 1KIGH 2ZHWH 3M7QA 3UY9A 3P8FA 1LVOA 3PMBB 1O37A 3SJIA 2BY6X 1Z8RA 1XUFA 4INKA 3K2UA 2A31A 3GOVB 1P9UA 3UPEA 4HFPB 4GHTA 5CE1A 3Q77A 2FTLE 1RTFB 1GJ5H 2WYJA 2ZTYA 3RXMA 1OYQA 2PUXB 1Z1JA 1GGDC 2HNTC 4A1XA 1EP5A 2ZZUH 4ISNA 1BHXB 2A7HA 3PYHA 1HAVB 1T4UH 4Y8XA 1ZSJA 3HKJB 4Y0YE 1DM4B 2GGVB 4DW2U 2GZ7A 4BXWA 2D1JA 1J8AA 2BY5X 3F68H 3SNCA 1C2JA 3UFAA 4D9QA 4XDEA 4MVNA 3VGCB 3LGVA 1BB0B 1ZMLA 2BDYA 1LDTT 2WV5A 1W3CA 2B5TB 2CHAB 1H1BA 2TGAA 3MMGA 5E0HA 2ANYA 1QY6A 1GMCG 1BITA 1BOQA 4Q7ZA 4WY3A 1GBBA 1CGJE 5E2OA 4ABJA 4NIVA 3HGNA 1C1UH 1AWHB 4YOGA 3DHKH 3TGJE 1P2NA 2ZIQH 5ESTE 2PKSB 1V2ST 4DCDA 3PLKA 3QO6A 1EX3A 6ESTA 3UNQA 1SFQB 5DP5A 1DWBH 4A6LA 1Z6EA 1GI5A 3RXSA 2Z94A 1O2WA 3FZZA 4XSKU 2BMGB 2XBWA 5EODA 1TA2A 4HGCA 1GVLA 1AIXH 1Z71A 1WCZA 1QJ1B 2B8OH 1CHOF 1CGIE 1HAZB 2VIDA 3DFJA 4X1PU 4OS6A 1Y3WA 3F1SB 1ELTA 3W94A 2ZGHA 1PPBH 4CHAC 3P8GA 4MPUA 3ZZ4A 1ANBA 1EKBB 1KXEA 3PMAB 4QT8C 4ABFA 5A8YA 1TGNA 2OCVB 1HAHH 1DLKB 3MNCA 1CHGA 1D9IA 1BMNH 2C8WB 4WXVA 4ZHAA 2Z3DA 1A5GH 4Y8YA 4ZKNU 1H9LB 1O5GH 1FY1A 3EA8A 4ABEA 2UUFB 4I33A 4H4FA 1HB0B 3E1XB 5H4IB 1SGYE 2GV7A 6CHAB 2B9LA 1OWHA 1OWKA 3UNRA 1W0ZU 4NIXA 3DT0H 3BTGE 2QV1A 3RXAA 4MNVA 4MG3A 3TU7H 2O8UA 2FYRA 3O8RA 1QA0A 3KL6A 5JB9S 3ZZDA 3SGAE 2FIRH 2ALVA 1GI7B 3RMMH 1OS8A 5A8XA 1DFPA 1O2QA 3S9CA 1DSTA 4YOJA 4Y76A 3EA7A 1GVZA 5C20A 2Z3EA 1E37B 2KAIA 2VINA 4IGDA 1GHZA 1LTOA 1SB1H 1AB9B 1NRRH 1A4WH 4K3JA 1ABJH 1C4Y2 1MBMA 1UTJA 1XUHA 2CMYA 2TIOA 3K6YA 4O3TA 3BV9B 3BIUH 1TPSA 4IMZA 3LKWA 3NZIA 3SUEA 1EJMA 1HNEE 1FJSA 4XBCA 2G8TA 5EPYA 2Y82A 4K5ZA 1O3NA 3Q3KA 1P3EA 3R3GB 3ZZBA 3URDA 3V7TA 2AGEX 2GZ8A 3RC5A 1GMDG 3A80A 1EZXC 1MD7A 3SGBE 1W0YH 4XFQA 3U1JB 1IQJA 1TGCA 1F5RA 3RXHA 3SU5A 1BRUP 2JETB 3GY6A 1GJ6A 1RTKA 1FAKH 4Y6DA 2OC0A 3MH4A 4HZHA 3SUFA 2XXLA 4JZEH 1LQEA 3TH2H 2H5CA 3NWUA 3KQCA 1LVYA 1EOLA 3MNSA 3SV2H 4X8UH 3VPKA 1DANH 2OBQA 1VITG 1YGCH 1UTPA 1ZRKA 3VB7A 1C1RA 2XWBI 1O3HA 1PQ7A 1ELGA 4BAKB 2BXTH 2ESTE 2PKSC 2Z7FE 1SGPE 1GDUA 1O2JA 3MU1A 5FPYA 4NZQA 1LHDH 1ELBA 1TIOA 2CF8H 1OOKB 4FUHA 1YPGH 2BX3A 1SI5H 1G2MA 2TBSA 2RCEA 3PWBA 2FOCA 4YESB 2G5NA 4TPIZ 2CV3A 3AASA 2VWOA 2F91A 4BAMB 1GJDB 2B7DH 1MAYA 4OS5A 1O33A 3WY8A 2ZHDA 1BIOA 1XVMA 3PM3A 4GPGA 1AY6H 3Q3YA 1Y5AT 2Z9KA 1HGTH 4ISHH 1P06A 1O38A 1TPAE 4B2CA 1PPHE 3PLPA 3TJUA 2XRCA 2OINA 3ATIA 1DWEH 2BY9X 4ISOA 1SGCA 2ZA5A 1FDPA 1ELDE 3BN9A 4TWYA 4GHQA 2BOKA 2BD3A 2H5DA 3A85A 4DURA 3D23A 1V2PT 1VGCC 4OS7A 1GHBF 6CHAC 1GI1A 3MFJA 3V3MA 5F8XA 2A4RA 1ZSKA 2VWMA 3SNAA 2F9VA 1AVGH 3BTEE 1YPLH 2ZHFH 2Y6TA 5DP3A 1LPKB 5DP8A 2FXRA 1UHBB 1KDQB 2HNTE 3BTFE 1DXWA 4Y0ZE 1VCWA 1PYTC 1KXAA 2WV4A 5HM9A 4AFSA 2Z9IA 1QGFA 3FP6E 1C9PA 5T3HA 1QFKH 1V2OT 4ZH8A 5A0CA 4JYTA 1OP2A 5J4SA 3GDVA 4TY7A 5LH8A 4IW4E 3OTJE 1CSOE 1GCDA 3RXPA 4WVPE 2BVSH 2SGFE 1AB9C 1F0UA 1EJAA 1O2LA 1TBQH 4NA9H 5JYIA 1YPJH 1GI6A 3TK5A 3LGTA 1UTLM 1ZRBA 3ZZ3A 1ZYOA 2CJIA 3GY7A 1NRNH 3SV6A 1GBTA 4BAOB 4FUBA 1EASA 2BZAA 1SHHB 1OYTH 1FPCH 1J16A 3MH5A 1RD3B 2Z9GA 1YP9A 1C2MA 5EQRA 1MQ6A 4KKDA 1C2HA 1LPGB 1MTSA 2JETC 2A4OA 2AGGX 2H6MA 2IN2A 1GI9B 2G4TA 4F49A 2EI7A 3HK6B 1TGBA 4MNWA 1XUJA 5GCHF 2OXSA 1OWEA 1L4ZA 2BD8A 1GJ7B 2PV9B 2W5EA 2CF9H 3S9BA 1DXPA 3TLOA 3FZDA 2D8WA 3SBKA 2GTBA 4ABBA 3E0NB 1LHFH 1O5FH 4FVDA 1BA8B 4X2VA 1BRAA 1BTUA 2BX4A 1P57B 1INCA 2CN0H 4NWLA 3KEEA 1V2UT 4JMYA 1BQYA 1MAXA 2OTVA 2JH5D 1QL7A 1ZOMA 5EW1H 2NU2E 3EE0B 4ZHLU 1W7XH 2LNCA 4X1RU 3SU2A 1OSSA 2PW8H 4Y10E 2W26A 3RXIA 1GL1A 2XBVA 3SNEA 1P2IA 2HLCA 5I25A 2FS8A 1MH0A 1T8NA 4I8JA 2ZPRA 5PTPA 3RU4T 1DOJA 1XUGA 1EAUA 4AYYB 1CA0C 1SGQE 1C2IA 1KLTA 3W95A 4IC6A 3PB1E 1TNKA 3IWMA 2A2XH 2F9BH 1K1OA 1HJAB 1TRMA 1AE5A 3M37A 4AG1A 1IAUA 4O03A 1LHGH 1K21H 1NFUA 2TGTA 4YT6H 1C1TA 4RKOB 3RM2H 4X1SU 5E8EH 2GMTB 2ZG0H 3GCHC 3IG6B 4WWYA 2PTNA 3U69H 3DD2H 3RXVA 3KQEA 3LC5A 2VU8E 2A2QH 1QBOA 4X8VH 2ZTXA 3L3TA 2BD7A 3DUXH 1SQAA 4WH6A 3ZVDA 2DUCA 1GHAG 3M7TA 3SN8A 4UONA 1NRPH 1TPPA 1GJCB 1OWDA 3FVFB 1A0JA 3GCNA 1WTGH 1WU1A 2FOAA 3ZZ8A 2BTCE 5A0AE 3GCTG 2VJ1A 2Q1JA 3PMHB 1BBRK 3TNSA 3K6ZA 4IC5A 1GI3A 1GMCF 3P95A 1IQHA 3TH3H 2AEIH 1O2YA 1NT1A 2G81E 1T8LA 3A7WA 2XC4A 5FCKA 2R0KA 1O3LA 1P01A 2UWPA 3QUMP 1QR3E 2A5IA 1AVXA 2WPIS 4ABAA 1AO5A 1NO9H 1HLTH 1SLVB 1A5IA 1LMWB 2R9PA 2WPJS 5FPSA 1QRWA 3UOPA 1BZXE 2AFQB 5CHAB 2HVXA 4HI3A 1GI8B 1IHSH 1Z8IB 2GCHG 2BHGA 1BT7A 1B5GH 2PWXA 1T4VH 3QX5H 3UWJH 1HYLA 1AN1E 1J14A 5C3NA 1XM1A 4X6PA 2ZFQH 2BQ7B 5IDKA 5IYTA 2RG3A 2UWOA 3LONA 1UTQA 3RDZA 1YPKH 4Y71A 2C90B 1UTMA 4GAWA 1DY9A 3BTHE 3QK1A 3PWCA 1PPGE 1GDQA 3L33A 2A32A 1GBEA 4KTSA 1Q3XA 4Z6AH 1PQ5A 5E0GA 5DP7A 1E38B 1NFWA 1TNLA 2D2DA 1UVSH 1G9IE 1EP6A 3T28A 6GCHF 4A7IB 2Z9JA 2H9TH 1THRH 3MI4A 2ZDAH 5GIBA 5A0BA 1HCGA 5C1YA 3TK9A 2XBXA 1EZQA 1C5PA 4YT7H 4CHAB 8KME2 1ZHPA 3ZVBA 2GCTB 1MCVA 1BDAA 1D3DB 1M9UA 3MU4A 1IQGA 3SGQE 1W10U 2P3TB 4AGJA 4CH8B 1QIXB 3M5MA 2TRMA 3K65B 4ZKSU 3RXRA 2AIPA 5K7RA 4R8TB 4M7GA 1P11E 4OS4A 3FFGA 1YBWA 3MO9A 3ZYDA 2ZGCA 1P04A 3B23B 3NK8A 1BUIA 1QA7A 1DWDH 1O3MA 1AFQB 4UFEH 3TGKE 3PTBA 1H8IH 1HJAC 4FU9A 2BQWB 1XUKA 1JIRA 1GBHA 1O5DH 1AZ8A 2BDCA 5EGMA 4TPYA 1UK3A 1ZSLA 2XC0A 1AGJA 4DOQA 5E2PA 1ETTH 3UQOA 1P2KA 3M5OA 4E05H 4H42U 1YLDA 1QQUA 2ZU3A 1GWAA 2ULLA 4D7GA 1CQQA 1YYY1 1GMDF 1TA6A 2SNVA 2RA3A 1EOJA 1RIWC 2EI8A 2C8ZB 1GG6B 2FX4A 2V0BA 3MO3A 4IN2A 1DUAA 2FS9A 3U8RH 1ZTLA 1V2KT 3ITIA 3U98H 7KMEH 1O2HA 1UHBA 1KDQA 2AERH 1HJ9A 5J4QA 1AE8H 1V2WT 5FHTA 1QQ4A 2B0FA 4JYUH 4UFGH 1QBNA 1AQ7A 4NGAH 3V0XA 3VB3A 1O2NA 3O8CA 3SO3A 1O5CB 2WPKS 5GPIB 4DGJA 2AMDA 1EATA 5L2ZH 1OX1A 2PUQH 1SGTA 4YOIA 3QLPH 1GBDA 5FX6A 1TALA 4BAQB 1OWJA 3TNTA 5AHGH 1IOEA 3CENA 1OPHB 2ZNKH 1KSNA 1BBRH 5CHAC 1VJAU 3SORA 2BXUH 2Y5GA 1O3JA 1V2LT 1SGIB 3DFLA 2UUJB 3TGIE 1O2GH 2FTMA 1SPJA 2BDAA 5DP4A 3SV9A 3NUMA 1F92A 2GT7A 3JZ1B 3UIRA 4GUXA 5HM2A 2ASUB 4Y11E 3QTOH 3BIVH 4GSOA 1QCPA 3ZZAA 2GDDA 2D26C 2QN5T 4YZUA 3M3TA 2HPPH 1GI0A 3A89A 4RSPA 4XBBA 3OU0A 1RJXB 1ZPZA 1G3CA 1TAWA 3U1IB 1BTXA 1NRQH 2HRVA 4DIIH 5EU8A 3MWIU 2P93A 3UR6A 1FLEE 1FY5A 2AS9A 1BTPA 1Z8JB 3LGUA 3T27A 3RXCA 4U32A 2Q6GA 5TCAA 2ZU2A 1TE0A 2QY0B 4DJZB 1DSUA 4X1NU 3HATH 4X8SH 2GCTC 2GKVE 3OY6U 4JZIA 1O3IA 5SGAE 1B0FA 3GY2A 1PPCE 4A5TS 1CBWB 2P16A 4AN7A 4CREA 5BRRE 4X8TH 2NU4E 4ISLA 1NY22 2PKAB 1T8OA 2XYAA 3VB5A 1WUNH 1SHYA 3SU3A 1VGCB 1AFQC 5DK1A 3G01A 5F8TA 3NXPA 3U9AH 4Y7AA 1F2SE 1MUEB 1K28D 3UNSA 5DKMA 5ESBA 1J17T 1F7ZA 1V2TT 1FONA 1WTHD 5EQQA 2ZTZA 1T32A 3S69A 2IJOB 1O2RA 1GVKB 2NU0E 3SUDA 2BLQA 1LHEH 1EXFA 1P02A 1HFDA 3BG4B 1UVOA 1O3AA 2FOEA 2FZZA 4D8NA 4XOJA 3LT3A 5EQSA 1GG6C 1SFIA 2XCNA 2WPLS 3LPRA 1S6FA 4GLYA 1D3QB 1BJVA 2PGBB 1NU7B 3A81A 3MOCA 2SGEE 2ILNA 1MTVA 3T25A 3V12A 1XXFA 2Y5FA 4BTTB 4E7RG 3BSQA 1UTKA 1W12U 1XMNB 1EQ9A 1QBVH 2C8YB 2BDIA 1NTPA 1O32A 3SI4H 2HOBA 2VIQA 2ZDNA 4ZXXH 1S82A 4HTCH 2J4IA 3NPSA 4I32A 3SQEE 1Y3XA 1IQKA 1TNHA 2J34A 1UTOA 4ZKOU 2IPHA 1JWTA 4K1SA 3BTKE 5JDUB 3NKKA 4WXIA 4D7FA 1ZPBA 1ELEE 1O2IA 2ODPA 1NZQH 2ZQ2A 1H9HE 2ZPSA 3S0NA 1W11U 2BD2A 4CRDA 3KCGH 3LU9B 2SGDE 3KNXA 5TJXA 4JZ1A 4MPXA 4ABDA 2ZF0H 1ESAA 4F4OC 2ODQA 4IN1A 1MZAA 4OS1A 1S5SA 1SMFE 2VB0A 1UK2A 1K1MA 3E8LA 3PMJA 2ZU1A 1ANDA 3E16B 1XKAC 3H5CB 5CMXH 3T29A 3O8BA 1C5OH 1LKAA 4FUGA 2BVXH 5EOKA 2A5KA 4ZAEA 8LPRA 1HAGE 1V3XA 1ZLRA 3MU5A 4AORA 3ZZ7A 2EI6A 1FIZA 2OUAA 5DP9A 1YKTA 2XC5A 1G37A 1AHTH 1O2ZA 1P03A 1LO6A 2G51A 1Y5BT 1CA0B 2M5TA 1S0QA 9LPRA 2P94A 1MKXK 1TX6A 1P10A 4NSVA 1TABE 2FO9A 1NFYA 4UD9H 4WMFA 1MKWK 4IMQA 2BYAX 1DY8A 1JIMA 2OP9A 1FZZA 4VGCB 4WH8A 1SOTA 1A0LA 3A7XA 4Z0KA 1CBWC 1UCYK 3TH4H 2BLVA 3A82A 4JZFH 3QN7A 3RC6A 3GCHB 2F9PA 4PROA 4KELA 3JZ2B 1UVUH 1WYKA 2PTCE 1P09A 4E7NA 1S84A 1O3CA 2VIOA 2ANKH 3I29A 4J2YB 5T6FA 3MH7A 3T62A 1YF4A 1AUTC 1P2QA 3A84A 1HXFH 1DVAH 1ANEA 5A8ZA 1Q31A 1THSH 3HKIB 1NN6A 3PV4A 3TJOA 2H1UA 1MTWA 1H4WA 1IQEA 4RKJB 3RM0H 3SNBA 4GCHF 1EAXA 1GMHG 1ARCA 3UTUH 1F0RA 3QZRA 2FPZA 1L0ZA 1C1QA 3IITA 1JRTA 1GBAA 5EPNA 1FUJA 1ANCA 1T8MA 4MNXA 2A4QA 3RLWH 1BJUA 4NCYA 1TYNA 3BG4C 3GICB 4K8BA 1GI2A 1C1NA 1WOFA 2STBE 1KLJH 1C1PA 1K1JA 5C1UA 3RMLH 1FPHH 3RMNH 1W7GH 3A7TA 3TJNA 3BG8A 2FI4E 3ATLA 2QYIA 1TFXA 1HV7A 1HAPH 4NWKA 2O9QA 4KTCA 1G2LA 2C3SA 3I78A 3RXLA 3ZZ5A 1O30A 4ZUHA 1UVPA 2C93B 4K1TA 1CO7E 1HAVA 1O3FA 1A61H 1IQLA 1ZMJA 3M5NA 3LH1A 1K9OE 1AUJA 3MYWA 5FAHA 1UMAH 5LPEA 2XTTB 1BTHH 1P2OA 2I6QA 1RS0A 5EW2H 3QZQA 1TOCB 3B9FH 5FCRA 5A09A 1WAYB 2I6SA 3RXGA 4CBNA 3RU4D 1LQDB 2P59A 2UUKB 1EPTC 2R0LA 4R0IA 2K1QA 3BTQE 4ESTE 4KTUA 3F9GA 1LCYA 3RXJA 2ZGJA 5AFYH 1SLUB 3SOSA 2OQUA 2VH6A 4NZLA 5A2MH 1FN6A 1EB1H 1KLIH 1XUIA 3SJOA 1O34A 1D6WA 1Y3VA 5JBCS 4ABGA 1TOMH 3TIUA 3UQVA 4AYVB 4CRFA 1GBKA 5DGJA 3RXOA 2F83A 1F5LA 2TPIZ 3UR9A 3A7VA 5FBIA 2FX6A 3O8DA 3RLYH 2F3CE 5TCCA 3ZZ6A 3OYPA 1FY8E 2ZCHP 2J95A 2AGIX 2Y7ZA 3A8AA 3CS0A 1O3BA 1NC6A 4VGCC 4WJG2 4FVBA 1FMGA 4OGYA 1WQSA 1DT2A 3ZVFA 4YM9A 2ODYB 3ZVCA 3K9XB 3OY5U 3M3SA 1C5SA 1OP0A 1Y8TA 3QWCH 1V2VT 5C67A 2PKAA 4NA8A 3SJ8A 3M61U 2FYQA 1MKXH 3SJKA 5HXFA 4K1EA 5DPAA 2XBYA 4FXGH 1E36B 1RIWB 2W7SA 1C2KA 2UWLA 1MKWH 4INHA 2XWAA 3SI3H 3M5LA 4NFFA 2BD9A 1UCYH 1BMAA 1TGSZ 2YNAA 1TRYA 2JKHA 1SGFA 1IQFA 4MNYA 1NPMA 1QJ6B 4NIWA 1AWFH 2P95A 1AKSB 3KQBA 4THNH 2QA9E 4ZHMU 1C5LH 1ZHMA 4UE7H 3A8CA 2GX4A 2FLRH 2ZHEH 2GV6A 5ABWA 1CVWH 1FIWA 1C1WH 1P05A 1VCQA 1D6RA
chains in the Genus database with same CATH superfamily
1W13U 4ZROA 1YLCA 1SR5C 2H9HA 2THFB 1DUEA 2ZP0H 3DA9B 2OBOA 1SL3A 1MD8A 1ZPCA 2BOHB 4AFZA 2ZEBA 3E3TA 2A4GA 2A5AA 1O2SA 2Y7XA 4FUFA 5L30H 1S6HA 1YPMH 3HK3B 2BM2A 4YXWD 3LDXH 3PROA 1TNIA 2AMPA 1HDTH 2Z9LA 3LJOA 1DX5M 2V6NA 2Y81A 2V3MA 2YOLA 1H8ED 3SV8A 3ZVAA 2Q6DA 1GI4A 3Q3XA 2R2WU 3LH3A 1V2RT 1FY4A 3GYMA 2OC7A 4ABHA 4JYVH 2ZFRH 1AU8A 1O2MA 1AVWA 2SNWA 1MBQA 4DT7B 2ZDMA 1Y5UT 3SU4A 1KTTB 1AZZA 1SGFG 1CE5A 3NCLA 1SVPA 1PQ8A 2J38A 4MLFB 4CRBA 2OLGA 2XNIA 1X7AC 2W3IA 4AGKA 3OAAD 1YY3A 1H8DH 1LKBA 1VJ9U 1ESBA 3BEIB 1C5WB 1QB1A 2LPRA 2VH0A 4H6TA 1A46H 2QGRA 2QXHA 1C5VA 3MNXA 4TYDA 1Y3YA 1F5KU 4B2BA 4O3UA 5FL7D 1UK4A 1JRSA 3SYJA 1NU9A 2R2MB 4IS5A 1O2KA 5C1XA 2IOTA 2FOGA 3E0PB 4B76A 2V35A 3A7YA 5F03A 1P2MA 1TBZH 3A88A 4FUEA 2CGAA 1O3DA 2OK5A 1FX0B 1S6LA 1CT2E 2FM2A 3VXEH 4ISIH 1L1NA 1NS3A 1OXGA 3GY4A 4LZ1H 4I7YH 3Q00A 2BDHA 1J15A 1O5BB 4KP0A 2WPHS 1YC0A 2BDGA 1PPZA 2ZPQA 1O35A 4I86A 1UO6A 2GP9B 2J92A 2ZFTA 2STAE 1L1JA 1PQAA 2A7JA 5HGGA 1WQVH 1QL8A 2KCYA 1P12E 2WHXA 4BNRA 4CR9A 3SHCH 1ZHRA 1Y3UA 1O2OA 1TPOA 4K60A 1TGTA 2WUBA 4I31A 4B74A 2P8OB 4AG2A 3R0FA 9ESTA 2VIPA 3ODDA 4WMEA 3CNRA 2O8MA 3U8OH 1THPB 3A8BA 3KN2A 2CK3D 2VNTA 3LGIA 8GCHG 3QGJA 5EXNA 2P3UB 2SGQE 4SGAE 2QAAA 1CT4E 4BOHA 1XVOA 1TQ7B 1QNJA 2O8LA 2WINI 1MZDA 1CU1A 2OQ5A 1Z1IA 5C5OA 1C1SA 3C27B 3EA9A 1K2I1 1SBWA 1GJBB 1FAXA 3DSGA 5F53A 1BBRE 1B7XB 2A0QB 4RN6A 1NRSH 5C5NA 1VITF 4JK5A 2NWNA 4CRCA 1HAYB 1TNGA 4WF8A 1NBMD 4A92A 1TLDA 5GNDA 4BTUB 3URCA 2VVUA 3UUZA 1EAIA 1NM6A 2YMSD 4KGAA 1ID5H 3ENSB 1TQ0B 1V2QT 1ZTKA 1GBCA 1TONA 4B1TA 4NG9H 1FY3A 1NFXA 1ZGVA 1KXDA 2HNTF 1E34B 1KXBA 4I8HA 4TSFD 1TMUH 3LGWA 5DO4H 1N6YA 1N8OB 8ESTE 4ASUD 3FP7E 2ZECA 1AD8H 3A87A 3KGPA 1K22H 1P8VC 4YO9A 1DDJA 4B2AA 2H2ZA 1VZQH 1Q2WA 1SSXA 1C2DA 1HBTH 1FV9A 2ZU5A 4CRGA 1G3BA 4AB8A 1QURH 4X2WA 1A0HB 1O39A 4AX9H 4MTBA 5FBEA 1YPHC 3QDZB 2W7UA 2BD4A 3SW2B 1IQNA 2BZ6H 3OX7U 4TY6A 2DE8A 5HKKD 1C5ZB 2VIVA 1QRXA 4X2YA 3UWIA 2WUCA 2ALPA 1GJAB 2NU3E 2FOMB 1DE7H 1GBJA 3BEFB 3ZVGA 1PJPA 4UFDH 4X6MA 1SQTA 1JOUB 3OSYA 5HYOA 1GMHF 4B75A 1WSSH 1LHCH 4B73A 2PFEA 2ZKSA 1GCTB 1ZZZA 1P0SH 1QJ7B 3KQDA 3MO6A 5GXPA 1Z8GA 2ZC9H 4X2XA 1HAOH 1C1VH 1K1IA 3E6PH 1GHYH 4O9VA 1SG8B 1U6QA 2QXGA 4BANB 2GVFA 1SC8U 1O2TA 1VR1H 2ZFPH 5G4BA 6GCHG 2ZWLH 1XKBC 2RDLA 1O3PB 1ELAA 4A1TA 3CP7A 2ZCKP 2O8WA 2PHBA 4AB9A 1HUTH 3F9HA 5LGOA 1L4DA 2P8OC 5LPRA 2ZHQH 2QF0A 1HXEH 3MTYA 4BXSA 2FOHA 2ANWA 1GL0E 2JH0D 4MQAA 1GJ9B 3RUOA 1YPEH 1TBRH 2A45B 1MTNC 4Q80A 3RXQA 1O2XA 4NFEA 1A1RA 3ZZ9A 3MNBA 2A1DB 4AFQA 1C5UA 1EZUC 1SLXB 1OKXA 1ELVA 1PFXC 3P8OA 2K7XA 2ZGBH 1T7CA 3GYLB 7GCHG 1G3DA 3FO8D 4JCNA 1KXCA 2J2UA 1ACBE 1C2EA 3RMOH 2PR3A 4YLQH 1MQ5A 1WBGB 4X6OA 3T2NA 2ZDVH 2SGAA 1AKSA 2BDBA 1O3EA 7LPRA 1SGNE 2FOFA 3D65E 3VB4A 1YM0A 4NIYA 1BRCE 4CR5A 1KY9A 2BD5A 2CXVA 1DLEA 3HGPA 4OGXA 1HAXB 4JZDH 1RXPA 2OD3B 2FDAA 2BB4A 1E0FD 2VWLA 3RXBA 4Y8ZA 3SU0A 3N7DA 5T6GA 1AMHA 1UVTH 2ZQ1A 4DT4A 3E91A 2UUYA 1C4U2 2PLXA 5LPFA 3T26A 1DPOA 2XOKD 1ESTA 3KQ5A 1KXFA 4K2YA 1OWIA 3GDUA 1C2FA 1EPTB 5DJ7A 1BHXF 1IQIA 1K1PA 2PSYA 4H6SB 2JH6D 2W3KA 1N8OC 2ZCLP 1O2VA 1O3OA 3VEQB 1A3BH 1W14U 1L1GA 3VGCC 1NROH 4NA7A 3S9AA 1IQMA 1D3TB 1YCPK 2C4FH 2CHAC 5DP6A 2AMQA 3H7TA 1TX8A 5BPEA 4FETA 2JIZD 3F9FA 3QTVH 1BTWA 2HGTH 4U2WA 1O3KA 3P6ZB 2F9OA 2ZDLA 3BTWE 1TMBH 1QTFA 4OS2A 2YMSB 3D49H 2KCPA 4MDSA 5C2ZA 4ASHA 4F55A 3CS7A 3ODFA 3RXTA 5DG6A 3N7OA 1GHAF 2NU1E 3ESTA 1HIAB 2VWNA 4LOYH 2QIQA 4ABIA 1Z6JH 5EXMA 2O8TA 3GCTF 3TK6A 2AYWA 1C5RA 1FQ3A 1FXYA 1WV7H 3AAVA 1SLWB 1W2KH 4CRAA 4DVAU 1QB6A 1TX7A 4Q7XA 1GCTC 3P8NA 2C8XB 4MPVA 4MPWA 2PGQB 1PPFE 4ZMAH 3Q76A 4JK6A 3PRBA 3KYGA 1ETRH 3A83A 4BTIB 3AVZA 3PO1B 2HALA 3SQHE 4D76A 4FUJA 3BF6H 4FUCA 2K8IA 4K8YA 1ZGIA 3M7UA 2J94A 5JBTA 3DCLA 1RTLA 1V6DA 4Y79A 3V13A 1GJ4H 1B0EA 1NESE 2G00A 3M35A 1CHOG 1D4PB 2V3HH 2YNBA 1GBIA 3OE7D 5FX5A 4LZ4B 2GCHF 2EEKA 2WPDD 1ORFA 5KGOA 4U01A 1K1NA 2QCYA 4BAHB 3F2HA 3SU1A 1MMJN 1SGEE 3EDXB 5C0TA 2GD4B 3EYDA 5HMAA 4CBOA 1VITH 2BY8X 1ZR0A 2G5VA 5JBBS 3SJ9A 1ABIH 1RGQA 4FU8A 1EUFA 3ZVEA 5F8ZA 3RXDA 2J98A 3F3BA 3PTNA 1TRNA 4A1VA 1Z7KA 3AW0A 1HJ8A 4P02A 2FMJA 1ZMNA 4I8KA 2VVVA 5EIYA 3EAJA 3ZZCA 3KF2A 1F0SA 3UOUA 3GY8A 1T31A 1EZSC 1EJNA 3MU8A 2FOBA 1GJ8B 2H9EH 3T5FH 1BMMH 1DICA 3NRLA 4Q7YA 3STJA 1OP8A 1G32B 5AVDA 2A7CA 4WMDA 1ZJKA 3MU0A 2F9UA 3OEED 3LJJA 1YPHE 4FU7A 4XBDA 3U8TH 4Y7BA 3L6PA 3EQ0H 4ZXYH 2KFWA 3H7OA 1C4V2 2FI5E 2VGCB 3FP8E 4FOUC 1S0RA 2DE9A 2VIWA 1G3EA 1KYNA 5K0HA 1EFRD 2G4UA 3GDSA 3TJVA 3I77A 1JXPA 2G52A 2HPQH 2PSXA 3SNDA 1BRBE 2OC1A 5I46H 1P2JA 2Y5HA 1C1MA 2FODA 1S83A 2BLOA 2ANMH 1JBUH 1KTSB 2BVRH 1O2UA 2GZ9A 3SV7A 3VFEA 3BTTE 1O3GA 3RP2A 1BCUH 1LVMA 3ATMA 1RRKA 1ELFA 3RC4A 2F9NA 1C5NH 2Z3CA 1TNJA 1BMLA 2XCFA 1GBFA 2YMSC 1V2NT 1LPZB 3RU4E 2QC2A 8GCHF 4E06H 4X1QU 1TMTH 3BTME 1S81A 2EQNA 1YCPH 1XX9A 5GDSH 1ARBA 1C5MD 1G36A 1J9CH 2QXJA 5F6MA 1A3EH 5FXLA 1Y59T 2K0QA 3S7HB 1C9TA 1W8BH 4UDWH 1DS2E 2XW9A 4SGBE 1ELCA 4LXBH 2ZFSA 1FNIA 3HPTB 5GWZA 3GCOA 1HPGA 1SGRE 1UCYE 2ZGXH 1QRZA 2EA3A 2V3OH 2FESH 4DIHH 1XXDA 1GBMA 2GT8A 1JMOH 3LC3A 3PO1C 4NSYA 3FAOA 2BQ6B 2TGPZ 1A7SA 3ZV9A 5L6NH 3SZNA 4K69A 1F0TA 3F9EA 1N1LA 2QF4A 1P3CA 5JBAS 3UREA 3QGNB 1ZTJA 1YCPM 3EE7A 1SQOA 1QHRB 3DSOA 1H9IE 1SGDE 6LPRA 5EXLA 3A86A 2GDEH 2KAIB 4FUIA 4GVUA 4ZKRU 1GBLA 5ETXA 2P3FH 3M3VA 4B71A 3RXEA 1P9SA 1FI8A 7ESTE 3FN8A 2J9NA 5FPTA 5GJ4B 1S85A 1TWXB 2BLWA 2Z6BD 1ETSH 3M36A 4YTAA 1C5QA 1D3PB 1TB6H 1O5EH 4XE4A 1GGDB 3P70B 1HAIH 2WPMS 2AIQA 1GDNA 4INLA 1C1OA 3D62A 5JPMH 4CH2B 2TGDA 1LVBA 2QXIA 1GPZA 3P17H 4U30A 1GHBG 1C5TA 1A2CH 3RXKA 1V2MT 3LGYA 1GHWH 2R3YA 5EG4A 4UFFH 2ZFFH 2QF3A 1RFNA 3VXFH 3PLBA 1E35B 5AFZH 4RI0A 1CT0E 3AW1A 5JB8S 3S7KB 4XRNA 4GCHG 1O31A 3TPIZ 3GISB 5AF9H 5L2YH 4Z1MD 1C5YB 1GHXH 5E0JA 1UJ1A 2WSSD 3SHAH 3ATKA 4DY7B 1ZJDA 3P92A 1SOZA 4ACBA 2ZI2H 3FANA 1AFEH 3ATWA 3E90B 1C5XB 1EPTA 2WYGA 2VGCC 2OC8A 4X0WU 3F6UH 2AH4X 3MHWU 3AAUA 4AZ2B 1O2PA 1MU8B 2R3UA 1C2GA 3ZYEA 4B6EA 2FLBH 1O5AB 2FWWA 4I8GA 3BEUA 3LIWA 4LK4A 3TITA 3VB6A 3TVJB 4FUDA 2ZU4A 1MABB 2FI3E 3RXUA 3B8JA 4UEHH 1DITH 1EB2A 4O97A 1EAWA 3OEHD 2FEQH 4AFUA 1V2JT 2LIZA 1AI8H 4TWWA 1A5HA 2RA0A 3EBNA 2KCOA 1PYTD 3MH6A 2HWLB 1CA8B 2ZO3H 3F2FA 1IHTH 2VVCA 1VCPA 2Y80A 1N6XA 2SGPE 5GCHG 3C1KA 1WXRA 3LOXA 2G55A 1O36A 2FP7B 1K1LA 1BTYA 3EGKH 3GY3A 1BTZA 1HIAA 2V7QD 3ELAH 1FN8A 1QB9A 7GCHF 1MTUA 1L2EA 3SUGA 5KECA 4YLUA 1HRTH 4D9RA 1CGHA 4AOQA 1O0DH 2BY7X 4XD7D 5B6OA 3A8DA 3GY5A 1C2LA 3A7ZA 1MCTA 2EC9H 3SU6A 5T6DA 3ZV8A 3STIA 1G30B 1QL9A 1MTNB 2Q6FA 1MU6B 2J97A 4J1YA 3BTDE 1GHVH 4DG4A 1PPEE 4I8LA 3KIDU 2GMTC 1UTNA 4X6NA 2ZDKA 1DWCH 2SFAA 3RXFA 3KHVA 4IBLH 4Q2KA 1OHHD 1KIGH 1BMFD 2ZHWH 3M7QA 3UY9A 3P8FA 1LVOA 3PMBB 1O37A 3SJIA 2BY6X 1Z8RA 1UW7A 1XUFA 4INKA 3K2UA 2EY4C 2A31A 3DSPA 3GOVB 1P9UA 3UPEA 4HFPB 4GHTA 5CE1A 3Q77A 2FTLE 1RTFB 1GJ5H 2L6OA 2WYJA 2ZTYA 3RXMA 1OYQA 2PUXB 1Z1JA 1GGDC 2HNTC 5CDFE 4A1XA 1EP5A 2ZZUH 4ISNA 1BHXB 2A7HA 3PYHA 1HAVB 1T4UH 4Y8XA 1ZSJA 3HKJB 4Y0YE 1DM4B 2GGVB 4DW2U 3KYFA 2GZ7A 4BXWA 2D1JA 1J8AA 2BY5X 3F68H 3SNCA 1C2JA 3UFAA 4D9QA 4XDEA 4MVNA 3VGCB 4HG6A 3LGVA 1BB0B 1ZMLA 2BDYA 1LDTT 2WV5A 1W3CA 2B5TB 2CHAB 1H1BA 2TGAA 3MMGA 1W0KD 1NBME 2ANYA 5E0HA 1QY6A 1GMCG 1SQRA 1BITA 1BOQA 4Q7ZA 4WY3A 1GBBA 1CGJE 4ACAA 5E2OA 4ABJA 4NIVA 4B6FA 3HGNA 1C1UH 1AWHB 4YOGA 3DHKH 3TGJE 1P2NA 2ZIQH 5ESTE 2PKSB 1V2ST 4DCDA 3PLKA 3QO6A 1EX3A 6ESTA 3UNQA 1SFQB 5DP5A 1DWBH 4A6LA 1Z6EA 1GI5A 3RXSA 2Z94A 1O2WA 3FZZA 4XSKU 2BMGB 2XBWA 5EODA 1TA2A 4HGCA 1GVLA 1AIXH 1Z71A 1WCZA 1QJ1B 2B8OH 1CHOF 1CGIE 1HAZB 2VIDA 3DFJA 4X1PU 4OS6A 1Y3WA 3F1SB 1ELTA 3W94A 2ZGHA 1PPBH 2WZQA 4CHAC 3P8GA 4MPUA 3ZZ4A 1ANBA 1EKBB 1KXEA 3PMAB 4QT8C 4ABFA 5A8YA 1TGNA 2OCVB 1HAHH 1DLKB 3MNCA 1CHGA 1D9IA 1BMNH 2C8WB 4WXVA 4ZHAA 2Z3DA 1A5GH 4Y8YA 4ZKNU 1H9LB 1O5GH 2IPQX 1FY1A 3EA8A 4ABEA 2UUFB 2PP6A 4I33A 4H4FA 1HB0B 3E1XB 5H4IB 1SGYE 2GV7A 6CHAB 2B9LA 1OWHA 2RFKC 1OWKA 3UNRA 1W0ZU 4NIXA 3DT0H 3BTGE 5C0UA 2QV1A 3RXAA 4MNVA 4MG3A 2RDEA 3TU7H 2O8UA 2FYRA 3VG8A 3O8RA 1QA0A 3KL6A 5JB9S 5CHBA 3ZZDA 3SGAE 3W1EA 2FIRH 2ALVA 1GI7B 3RMMH 1OS8A 5A8XA 1DFPA 1KMHB 1O2QA 3S9CA 1DSTA 4YOJA 4Y76A 3EA7A 1GVZA 5C20A 2Z3EA 1E37B 2KAIA 2VINA 4IGDA 1GHZA 1LTOA 1SB1H 1AB9B 1NRRH 1A4WH 4K3JA 1ABJH 1C4Y2 1MBMA 1UTJA 1XUHA 2CMYA 2TIOA 3K6YA 4O3TA 3BV9B 3BIUH 1TPSA 4IMZA 3LKWA 3NZIA 3SUEA 3UAIC 1EJMA 1HNEE 1FJSA 4XBCA 2G8TA 5EPYA 2Y82A 4K5ZA 2GJGA 1O3NA 3Q3KA 1E1QD 1P3EA 3FKSD 3R3GB 3ZZBA 3URDA 3V7TA 2AGEX 2GZ8A 1WDIA 3RC5A 1GMDG 3A80A 1EZXC 1MD7A 3SGBE 1W0YH 4XFQA 3U1JB 1IQJA 1TGCA 1F5RA 3RXHA 3SU5A 1BRUP 2JETB 3GY6A 1GJ6A 1RTKA 1FAKH 4Y6DA 2OC0A 3MH4A 4HZHA 3SUFA 2XXLA 4JZEH 1LQEA 3TH2H 2H5CA 3NWUA 3OTPA 3KQCA 1LVYA 1EOLA 3MNSA 3SV2H 4X8UH 3VPKA 1DANH 2OBQA 1VITG 1YGCH 1UTPA 1ZRKA 3VB7A 1C1RA 2XWBI 1O3HA 1PQ7A 1ELGA 4BAKB 2BXTH 2ESTE 2PKSC 2Z7FE 1SGPE 4Q4LA 1GDUA 1O2JA 3MU1A 5FPYA 4NZQA 1LHDH 1ELBA 1TIOA 2CF8H 2LELA 1OOKB 4FUHA 1YPGH 2BX3A 1SI5H 1G2MA 2TBSA 2RCEA 3PWBA 2FOCA 4YESB 2G5NA 4TPIZ 2CV3A 3AASA 2VWOA 2F91A 4BAMB 1GJDB 2B7DH 1MAYA 4OS5A 1O33A 3WY8A 2ZHDA 1BIOA 1XVMA 3PM3A 4GPGA 1AY6H 3Q3YA 1Y5AT 2Z9KA 1HGTH 4ISHH 1P06A 1O38A 1TPAE 4B2CA 1PPHE 3PLPA 3TJUA 2XRCA 2OINA 3ATIA 1DWEH 2BY9X 2XNDD 4ISOA 1SGCA 2ZA5A 1FDPA 1ELDE 3BN9A 4TWYA 4GHQA 2BOKA 2BD3A 2H5DA 3A85A 4DURA 3D23A 4RT0A 1V2PT 1VGCC 4OS7A 1GHBF 6CHAC 1GI1A 3MFJA 3V3MA 5F8XA 2A4RA 1ZSKA 2VWMA 3SNAA 2F9VA 1AVGH 3BTEE 1YPLH 2ZHFH 2Y6TA 5DP3A 1LPKB 5DP8A 2FXRA 1UHBB 1KDQB 2HNTE 3BTFE 1DXWA 4Y0ZE 1VCWA 1PYTC 1KXAA 2WV4A 5HM9A 4AFSA 2Z9IA 1QGFA 3FP6E 1C9PA 5T3HA 2W6ID 1QFKH 1V2OT 4ZH8A 5A0CA 4JYTA 1OP2A 5J4SA 3GDVA 4TY7A 5LH8A 4IW4E 4OM9A 3OTJE 1CSOE 1GCDA 3RXPA 4WVPE 2BVSH 2SGFE 1AB9C 1F0UA 1EJAA 1O2LA 1TBQH 4NA9H 5JYIA 1YPJH 1GI6A 3TK5A 3LGTA 1UTLM 1ZRBA 3ZZ3A 1ZYOA 2KZ4A 2CJIA 3GY7A 1NRNH 3SV6A 1GBTA 4BAOB 4FUBA 1EASA 2BZAA 1SHHB 1OYTH 5B6LA 2KR7A 1FPCH 1J16A 3MH5A 1RD3B 2Z9GA 1YP9A 1C2MA 5EQRA 5EJZA 1MQ6A 4KKDA 1C2HA 1LPGB 1MTSA 2JETC 2A4OA 2AGGX 2H6MA 2IN2A 1GI9B 2G4TA 4F49A 2EI7A 3N7EA 3HK6B 1TGBA 4MNWA 1XUJA 5GCHF 2OXSA 1OWEA 1L4ZA 2BD8A 1GJ7B 2PV9B 2W5EA 2CF9H 3S9BA 1DXPA 3TLOA 3FZDA 2D8WA 3SBKA 2JJ1D 2GTBA 4ABBA 3UB0A 3E0NB 1LHFH 1O5FH 4FVDA 1BA8B 4X2VA 1BRAA 1BTUA 2BX4A 1P57B 1INCA 2CN0H 4NWLA 3KEEA 1V2UT 4JMYA 1BQYA 1MAXA 2OTVA 2JH5D 1QL7A 1ZOMA 5EW1H 2NU2E 3EE0B 4ZHLU 1W7XH 2LNCA 4X1RU 3SU2A 1OSSA 2PW8H 4Y10E 2W26A 3RXIA 1GL1A 2VBCA 2XBVA 3SNEA 1P2IA 2HLCA 5I25A 2FS8A 1MH0A 1T8NA 4I8JA 2ZPRA 5PTPA 3RU4T 1DOJA 1XUGA 1EAUA 4AYYB 1CA0C 1SGQE 1C2IA 1KLTA 3W95A 4IC6A 3PB1E 1TNKA 3IWMA 2A2XH 2F9BH 3WWFA 1K1OA 1HJAB 1TRMA 1AE5A 3M37A 4AG1A 1IAUA 4O03A 1LHGH 1K21H 1NFUA 2TGTA 2W6JD 4YT6H 1C1TA 4RKOB 3RM2H 4X1SU 5E8EH 2GMTB 2ZG0H 3GCHC 3IG6B 4WWYA 2PTNA 3U69H 3DD2H 3RXVA 3KQEA 3LC5A 2VU8E 2A2QH 1QBOA 4X8VH 2L74A 2ZTXA 3L3TA 2BD7A 3DUXH 1SQAA 4WH6A 3ZVDA 2DUCA 1GHAG 3M7TA 3SN8A 4UONA 1NRPH 1TPPA 1GJCB 1YWUA 1OWDA 3FVFB 1A0JA 3GCNA 1WTGH 1WU1A 2FOAA 3ZZ8A 2BTCE 5A0AE 2J5UA 3GCTG 2VJ1A 2Q1JA 3PMHB 1BBRK 3TNSA 3K6ZA 4IC5A 1GI3A 1GMCF 3P95A 2JJ2D 1IQHA 3TH3H 2AEIH 1O2YA 1NT1A 2G81E 1T8LA 3A7WA 2XC4A 5FCKA 2R0KA 1O3LA 1P01A 2UWPA 3QUMP 1QR3E 2A5IA 1AVXA 2WPIS 4ABAA 1AO5A 1NO9H 1HLTH 1SLVB 2QF5A 3H09A 1A5IA 1LMWB 2R9PA 2WPJS 1W0JD 1H8HD 5FPSA 1QRWA 3UOPA 1BZXE 2AFQB 5CHAB 2HVXA 4HI3A 1GI8B 1IHSH 1Z8IB 2GCHG 2BHGA 1BT7A 1B5GH 2PWXA 1T4VH 3QX5H 3UWJH 1HYLA 1AN1E 1J14A 5C3NA 1XM1A 4X6PA 2ZFQH 2BQ7B 5IDKA 5IYTA 2RG3A 2UWOA 3LONA 1UTQA 3RDZA 1YPKH 4Y71A 2C90B 1UTMA 4GAWA 1DY9A 3BTHE 3QK1A 3PWCA 1PPGE 1GDQA 3L33A 2A32A 1GBEA 4KTSA 1Q3XA 4Z6AH 1PQ5A 5E0GA 5DP7A 1E38B 1NFWA 1TNLA 2D2DA 1UVSH 1G9IE 1EP6A 2M2AA 3T28A 6GCHF 4A7IB 2Z9JA 2H9TH 1THRH 3MI4A 2ZDAH 5GIBA 5A0BA 3PV5A 1HCGA 5C1YA 3TK9A 2XBXA 1EZQA 1C5PA 4YT7H 4CHAB 8KME2 1ZHPA 3ZVBA 2GCTB 1MCVA 1BDAA 1D3DB 1M9UA 3MU4A 1E1RD 1IQGA 3SGQE 1W10U 2P3TB 4AGJA 4CH8B 1QIXB 3M5MA 2TRMA 3K65B 4ZKSU 3RXRA 2AIPA 5K7RA 4R8TB 4M7GA 1P11E 4OS4A 3FFGA 1YBWA 3MO9A 3ZYDA 2ZGCA 1P04A 3B23B 3NK8A 1BUIA 3WWBA 1QA7A 1DWDH 1O3MA 1AFQB 5IK2D 4UFEH 3TGKE 3PTBA 1H8IH 1HJAC 4FU9A 2BQWB 3MQKC 1XUKA 1JIRA 1GBHA 1O5DH 1AZ8A 2BDCA 5EGMA 4TPYA 1UK3A 1ZSLA 2XC0A 1AGJA 4DOQA 5E2PA 1ETTH 3UQOA 1P2KA 3M5OA 4E05H 2KM0A 1YLDA 4H42U 4M9FA 1QQUA 2ZU3A 1GWAA 2ULLA 4D7GA 1CQQA 1YYY1 1GMDF 1TA6A 2SNVA 2RA3A 1EOJA 1RIWC 2EI8A 2C8ZB 1GG6B 2FX4A 2V0BA 3MO3A 4IN2A 1DUAA 2FS9A 3U8RH 1ZTLA 2J98B 1V2KT 3ITIA 3U98H 7KMEH 1O2HA 1UHBA 1KDQA 2AERH 1HJ9A 5J4QA 1AE8H 1V2WT 5FHTA 1QQ4A 2B0FA 4JYUH 4UFGH 1QBNA 1AQ7A 4NGAH 3V0XA 3VB3A 1O2NA 3O8CA 3SO3A 1O5CB 2WPKS 4TT3D 5GPIB 4DGJA 2AMDA 1EATA 5L2ZH 1OX1A 2PUQH 1SGTA 4YOIA 1SKYE 3QLPH 3SZEA 1GBDA 5FX6A 1TALA 4BAQB 1OWJA 3TNTA 5AHGH 1IOEA 5DN6D 2JDID 3CENA 1OPHB 2ZNKH 1KSNA 1BBRH 5CHAC 1VJAU 3SORA 2BXUH 2Y5GA 1O3JA 1V2LT 1SGIB 3DFLA 2UUJB 3TGIE 1O2GH 2FTMA 1SPJA 2BDAA 5DP4A 3SV9A 3NUMA 1F92A 2GT7A 3JZ1B 3UIRA 4GUXA 4Q63A 5HM2A 2ASUB 4Y11E 3QTOH 3BIVH 4GSOA 1QCPA 3ZZAA 2GDDA 2D26C 2QN5T 4YZUA 3M3TA 2HPPH 1GI0A 3A89A 4RSPA 4XBBA 3OU0A 1RJXB 1ZPZA 1G3CA 1TAWA 3F0OA 1BTXA 3U1IB 1NRQH 2HRVA 4DIIH 5EU8A 3MWIU 2P93A 3UR6A 1FLEE 1FY5A 2AS9A 1BTPA 1Z8JB 2F4LA 3LGUA 3T27A 3RXCA 4U32A 2Q6GA 5TCAA 3FOAA 2ZU2A 1TE0A 2QY0B 4DJZB 1DSUA 2IJD1 4X1NU 3HATH 4X8SH 2GCTC 2GKVE 3OY6U 4JZIA 2KCAA 1O3IA 5SGAE 1B0FA 3GY2A 1PPCE 4A5TS 3PV2A 1CBWB 2P16A 4AN7A 4CREA 5BRRE 1E79D 4X8TH 2NU4E 4ISLA 1NY22 2AHME 2PKAB 1T8OA 3F0PA 2XYAA 3VB5A 1WUNH 1SHYA 3SU3A 3WW7A 1VGCB 1AFQC 5DK1A 3G01A 5F8TA 3NXPA 3U9AH 4Y7AA 1F2SE 1MUEB 1K28D 3UNSA 5DKMA 3OFND 5ESBA 1J17T 1F7ZA 1V2TT 1FONA 1WTHD 5EQQA 2ZTZA 1T32A 3S69A 2IJOB 1O2RA 1GVKB 2NU0E 3SUDA 2BLQA 4AC9A 1LHEH 3AK5A 1EXFA 1P02A 1HFDA 3BG4B 1UVOA 1O3AA 2FOEA 2FZZA 4D8NA 1COWD 3LT3A 4XOJA 5EQSA 1GG6C 1SFIA 2XCNA 2WPLS 3LPRA 1S6FA 4GLYA 1D3QB 1BJVA 2PGBB 1NU7B 3A81A 3MOCA 2SGEE 2ILNA 1MTVA 3T25A 3V12A 1XXFA 2Y5FA 4BTTB 4E7RG 3BSQA 1UTKA 1W12U 1XMNB 1EQ9A 1QBVH 2C8YB 2BDIA 1NTPA 1O32A 3SI4H 2HOBA 2VIQA 2ZDNA 4ZXXH 1S82A 4HTCH 2J4IA 3NPSA 4I32A 3SQEE 1Y3XA 1IQKA 1TNHA 2J34A 1UTOA 4ZKOU 2IPHA 1JWTA 4K1SA 4F48B 3BTKE 3N99A 5JDUB 3NKKA 4WXIA 4D7FA 1ZPBA 1ELEE 1O2IA 2ODPA 1NZQH 2ZQ2A 1H9HE 2ZPSA 2WV9A 3S0NA 1W11U 2BD2A 4CRDA 3KCGH 3LU9B 2SGDE 3KNXA 5TJXA 4JZ1A 4MPXA 4ABDA 2ZF0H 1ESAA 4F4OC 2ODQA 4IN1A 1MZAA 4OS1A 1S5SA 1SMFE 2VB0A 5HIZA 1UK2A 1K1MA 3E8LA 3PMJA 2ZU1A 1ANDA 3E16B 1XKAC 3H5CB 5CMXH 3T29A 1YLNA 3O8BA 1C5OH 1LKAA 4FUGA 2BVXH 5EOKA 2A5KA 4ZAEA 8LPRA 1HAGE 1V3XA 1ZLRA 3MU5A 4AORA 3ZZ7A 2EI6A 1FIZA 2OUAA 5DP9A 1YKTA 2XC5A 1G37A 1AHTH 1O2ZA 1P03A 1LO6A 2G51A 1Y5BT 1CA0B 2M5TA 1S0QA 9LPRA 2P94A 1MKXK 1TX6A 1P10A 4NSVA 1TABE 2FO9A 1NFYA 4UD9H 4WMFA 1MKWK 4IMQA 2BYAX 1DY8A 1JIMA 2OP9A 1FZZA 4VGCB 4WH8A 1SOTA 1A0LA 3A7XA 4Z0KA 1CBWC 1UCYK 3TH4H 2BLVA 3A82A 4JZFH 3QN7A 3RC6A 3ZIAD 3GCHB 2F9PA 4PROA 4KELA 3JZ2B 2LP6A 1UVUH 3U28C 1WYKA 2PTCE 1P09A 4E7NA 1S84A 1O3CA 2VIOA 2ANKH 3I29A 4J2YB 5T6FA 3MH7A 3T62A 1YF4A 1AUTC 1P2QA 3A84A 1QZ8A 1HXFH 1DVAH 1ANEA 5A8ZA 1Q31A 1THSH 3HKIB 1NN6A 3PV4A 3TJOA 2H1UA 1MTWA 1H4WA 1IQEA 4RKJB 3RM0H 3SNBA 4GCHF 1EAXA 1GMHG 3PRDA 1ARCA 3UTUH 1F0RA 2QE7D 3QZRA 2FPZA 1L0ZA 1C1QA 3IITA 1JRTA 1GBAA 5EPNA 1FUJA 1ANCA 1T8MA 4MNXA 2A4QA 3RLWH 1BJUA 4NCYA 1TYNA 3BG4C 3GICB 4K8BA 1GI2A 1C1NA 1WOFA 1VKYA 2STBE 1KLJH 1C1PA 1K1JA 5C1UA 3RMLH 1FPHH 3RMNH 1W7GH 3A7TA 3TJNA 3BG8A 2FI4E 3ATLA 2QYIA 1TFXA 1HV7A 1HAPH 4NWKA 2O9QA 4KTCA 1G2LA 2C3SA 3I78A 3RXLA 3ZZ5A 1O30A 4ZUHA 1UVPA 2C93B 4K1TA 1CO7E 1HAVA 1O3FA 3F2GA 1A61H 1IQLA 1ZMJA 3M5NA 3LH1A 1K9OE 1AUJA 3MYWA 5FAHA 1UMAH 5LPEA 2XTTB 1BTHH 1P2OA 2I6QA 1RS0A 5EW2H 4RT1A 3QZQA 1TOCB 3B9FH 5EJLA 5FCRA 1WAYB 5A09A 2I6SA 3RXGA 4CBNA 3RU4D 1LQDB 2P59A 2UUKB 1EPTC 2R0LA 4R0IA 2K1QA 3BTQE 4ESTE 4KTUA 3F9GA 1K0HA 1LCYA 3RXJA 2ZGJA 5AFYH 1SLUB 3SOSA 2OQUA 2VH6A 4NZLA 4ZCNA 5A2MH 1FN6A 1EB1H 1KLIH 1XUIA 3SJOA 1O34A 1D6WA 1Y3VA 5JBCS 5HIYA 4ABGA 1TOMH 5C94A 3TIUA 5EJ1A 3UQVA 4AYVB 4CRFA 1GBKA 5DGJA 3RXOA 2F83A 1F5LA 2TPIZ 3UR9A 3A7VA 5FBIA 2FX6A 3O8DA 2HLDD 5DSFA 3RLYH 2F3CE 5TCCA 3ZZ6A 3OYPA 1FY8E 2ZCHP 2J95A 5C17A 2AGIX 2Y7ZA 3A8AA 3CS0A 1O3BA 1NC6A 4VGCC 4WJG2 4FVBA 1FMGA 4OGYA 1WQSA 1DT2A 3ZVFA 4YM9A 2ODYB 3ZVCA 3K9XB 3OY5U 3M3SA 1C5SA 1OP0A 1Y8TA 3QWCH 1V2VT 5C67A 2PKAA 4NA8A 3SJ8A 3M61U 2FYQA 1MKXH 3SJKA 5HXFA 4K1EA 5DPAA 2XBYA 4FXGH 1E36B 1RIWB 2W7SA 1C2KA 2UWLA 1MKWH 4INHA 2XWAA 5T1VA 3SI3H 3M5LA 4NFFA 2HVYB 2BD9A 2F43B 4P00A 1UCYH 1BMAA 1TGSZ 5KEDA 2YNAA 1TRYA 2JKHA 1SGFA 1IQFA 4MNYA 1NPMA 1QJ6B 3GS9A 4NIWA 1AWFH 2KX4A 1AKSB 2P95A 3KQBA 4THNH 2QA9E 4ZHMU 1C5LH 1ZHMA 4UE7H 3A8CA 2GX4A 2FLRH 2ZHEH 2GV6A 5ABWA 1CVWH 1FIWA 1C1WH 1P05A 1VCQA 1D6RA
chains in the Genus database with same CATH topology
1W13U 4ZROA 1YLCA 1SR5C 2H9HA 2THFB 1DUEA 2ZP0H 3DA9B 2OBOA 1SL3A 1MD8A 1ZPCA 2BOHB 4AFZA 2ZEBA 3E3TA 2A4GA 2A5AA 1O2SA 2Y7XA 4FUFA 5L30H 1S6HA 1YPMH 3HK3B 2BM2A 3LDXH 3PROA 1TNIA 2AMPA 1HDTH 2Z9LA 3LJOA 1DX5M 2V6NA 2Y81A 2YOLA 3SV8A 3ZVAA 2Q6DA 1GI4A 3Q3XA 2R2WU 3LH3A 1V2RT 1FY4A 3GYMA 2OC7A 4ABHA 4JYVH 2ZFRH 1AU8A 1O2MA 1AVWA 2SNWA 1MBQA 4DT7B 2ZDMA 1Y5UT 3SU4A 1KTTB 1AZZA 1SGFG 1CE5A 3NCLA 1SVPA 1PQ8A 2J38A 4MLFB 4CRBA 2OLGA 2XNIA 1X7AC 2W3IA 4AGKA 1H8DH 1LKBA 1VJ9U 1ESBA 3BEIB 1C5WB 1QB1A 2LPRA 2VH0A 4H6TA 1A46H 2QGRA 2QXHA 1C5VA 3MNXA 4TYDA 1Y3YA 1F5KU 4B2BA 4O3UA 1UK4A 1JRSA 1NU9A 2R2MB 4IS5A 1O2KA 5C1XA 2IOTA 2FOGA 3E0PB 4B76A 2V35A 3A7YA 5F03A 1P2MA 1TBZH 3A88A 4FUEA 2CGAA 1O3DA 1CT2E 2FM2A 3VXEH 4ISIH 1L1NA 1NS3A 1OXGA 3GY4A 4LZ1H 4I7YH 3Q00A 2BDHA 1J15A 1O5BB 4KP0A 2WPHS 1YC0A 2BDGA 1PPZA 2ZPQA 1O35A 1UO6A 2GP9B 2J92A 2ZFTA 2STAE 1L1JA 1PQAA 2A7JA 5HGGA 1WQVH 1QL8A 1P12E 4BNRA 4CR9A 3SHCH 1ZHRA 1Y3UA 1O2OA 1TPOA 4K60A 1TGTA 2WUBA 4I31A 4B74A 2P8OB 4AG2A 3R0FA 9ESTA 2VIPA 3ODDA 4WMEA 2O8MA 3U8OH 1THPB 3A8BA 3KN2A 2VNTA 3LGIA 8GCHG 3QGJA 5EXNA 2P3UB 2SGQE 4SGAE 2QAAA 1CT4E 4BOHA 1XVOA 1TQ7B 1QNJA 2O8LA 2WINI 1MZDA 1CU1A 2OQ5A 1Z1IA 5C5OA 1C1SA 3C27B 3EA9A 1K2I1 1SBWA 1GJBB 1FAXA 1BBRE 1B7XB 2A0QB 4RN6A 1NRSH 5C5NA 1VITF 4JK5A 2NWNA 4CRCA 1HAYB 1TNGA 4WF8A 4A92A 1TLDA 4BTUB 3URCA 2VVUA 3UUZA 1EAIA 1NM6A 4KGAA 1ID5H 3ENSB 1TQ0B 1V2QT 1ZTKA 1GBCA 1TONA 4B1TA 4NG9H 1FY3A 1NFXA 1ZGVA 1KXDA 2HNTF 1E34B 1KXBA 4I8HA 1TMUH 3LGWA 5DO4H 1N6YA 1N8OB 8ESTE 3FP7E 2ZECA 1AD8H 3A87A 3KGPA 1K22H 1P8VC 4YO9A 1DDJA 4B2AA 2H2ZA 1VZQH 1Q2WA 1SSXA 1C2DA 1HBTH 1FV9A 2ZU5A 4CRGA 1G3BA 4AB8A 1QURH 4X2WA 1A0HB 1O39A 4AX9H 4MTBA 5FBEA 1YPHC 3QDZB 2W7UA 2BD4A 3SW2B 1IQNA 2BZ6H 3OX7U 4TY6A 2DE8A 1C5ZB 2VIVA 1QRXA 4X2YA 3UWIA 2WUCA 2ALPA 1GJAB 2NU3E 2FOMB 1DE7H 1GBJA 3BEFB 3ZVGA 1PJPA 4UFDH 4X6MA 1SQTA 1JOUB 3OSYA 5HYOA 1GMHF 4B75A 1WSSH 1LHCH 4B73A 2PFEA 2ZKSA 1GCTB 1ZZZA 1P0SH 1QJ7B 3KQDA 3MO6A 5GXPA 1Z8GA 2ZC9H 4X2XA 1HAOH 1C1VH 1K1IA 3E6PH 1GHYH 4O9VA 1SG8B 1U6QA 2QXGA 4BANB 2GVFA 1SC8U 1O2TA 1VR1H 2ZFPH 5G4BA 6GCHG 2ZWLH 1XKBC 2RDLA 1O3PB 1ELAA 4A1TA 3CP7A 2ZCKP 2O8WA 2PHBA 4AB9A 1HUTH 3F9HA 5LGOA 1L4DA 2P8OC 5LPRA 2ZHQH 2QF0A 1HXEH 3MTYA 4BXSA 2FOHA 2ANWA 1GL0E 2JH0D 4MQAA 1GJ9B 3RUOA 1YPEH 1TBRH 2A45B 1MTNC 4Q80A 3RXQA 1O2XA 4NFEA 1A1RA 3ZZ9A 3MNBA 2A1DB 4AFQA 1C5UA 1EZUC 1SLXB 1OKXA 1ELVA 1PFXC 3P8OA 2K7XA 2ZGBH 1T7CA 3GYLB 7GCHG 1G3DA 4JCNA 1KXCA 2J2UA 1ACBE 1C2EA 3RMOH 2PR3A 4YLQH 1MQ5A 1WBGB 4X6OA 3T2NA 2ZDVH 2SGAA 1AKSA 2BDBA 1O3EA 7LPRA 1SGNE 2FOFA 3D65E 3VB4A 1YM0A 4NIYA 1BRCE 4CR5A 1KY9A 2BD5A 2CXVA 1DLEA 3HGPA 4OGXA 1HAXB 4JZDH 1RXPA 2OD3B 2FDAA 2BB4A 1E0FD 2VWLA 3RXBA 4Y8ZA 3SU0A 5T6GA 1AMHA 1UVTH 2ZQ1A 3E91A 2UUYA 1C4U2 2PLXA 5LPFA 3T26A 1DPOA 1ESTA 1KXFA 4K2YA 1OWIA 3GDUA 1C2FA 1EPTB 5DJ7A 1BHXF 1IQIA 1K1PA 2PSYA 4H6SB 2JH6D 2W3KA 1N8OC 2ZCLP 1O2VA 1O3OA 3VEQB 1A3BH 1W14U 1L1GA 3VGCC 1NROH 4NA7A 3S9AA 1IQMA 1D3TB 1YCPK 2C4FH 2CHAC 5DP6A 2AMQA 3H7TA 1TX8A 5BPEA 3F9FA 3QTVH 1BTWA 2HGTH 4U2WA 1O3KA 3P6ZB 2F9OA 2ZDLA 3BTWE 1TMBH 1QTFA 4OS2A 3D49H 4MDSA 5C2ZA 4ASHA 3CS7A 3ODFA 3RXTA 5DG6A 3N7OA 1GHAF 2NU1E 3ESTA 1HIAB 2VWNA 4LOYH 2QIQA 4ABIA 1Z6JH 5EXMA 2O8TA 3GCTF 3TK6A 2AYWA 1C5RA 1FQ3A 1FXYA 1WV7H 3AAVA 1SLWB 1W2KH 4CRAA 4DVAU 1QB6A 1TX7A 4Q7XA 1GCTC 3P8NA 2C8XB 4MPVA 4MPWA 2PGQB 1PPFE 4ZMAH 3Q76A 4JK6A 1ETRH 3A83A 4BTIB 3AVZA 3PO1B 2HALA 3SQHE 4D76A 4FUJA 3BF6H 4FUCA 4K8YA 1ZGIA 3M7UA 2J94A 5JBTA 1RTLA 1V6DA 4Y79A 3V13A 1GJ4H 1B0EA 1NESE 2G00A 3M35A 1CHOG 1D4PB 2V3HH 2YNBA 1GBIA 5FX5A 4LZ4B 2GCHF 2EEKA 1ORFA 4U01A 1K1NA 2QCYA 4BAHB 3SU1A 1MMJN 1SGEE 3EDXB 2GD4B 3EYDA 5HMAA 4CBOA 1VITH 2BY8X 1ZR0A 2G5VA 5JBBS 3SJ9A 1ABIH 1RGQA 4FU8A 1EUFA 3ZVEA 5F8ZA 3RXDA 3PTNA 1TRNA 4A1VA 1Z7KA 3AW0A 1HJ8A 2FMJA 1ZMNA 4I8KA 2VVVA 3EAJA 3ZZCA 3KF2A 1F0SA 3UOUA 3GY8A 1T31A 1EZSC 1EJNA 3MU8A 2FOBA 1GJ8B 2H9EH 3T5FH 1BMMH 1DICA 4Q7YA 3STJA 1OP8A 1G32B 5AVDA 2A7CA 4WMDA 1ZJKA 3MU0A 2F9UA 4FU7A 3LJJA 1YPHE 4XBDA 3U8TH 4Y7BA 3L6PA 3EQ0H 4ZXYH 3H7OA 1C4V2 2FI5E 2VGCB 3FP8E 1S0RA 2DE9A 2VIWA 1G3EA 1KYNA 5K0HA 2G4UA 3GDSA 3TJVA 3I77A 1JXPA 2G52A 2HPQH 2PSXA 3SNDA 1BRBE 2OC1A 5I46H 1P2JA 2Y5HA 1C1MA 2FODA 1S83A 2BLOA 2ANMH 1JBUH 1KTSB 2BVRH 1O2UA 2GZ9A 3SV7A 3VFEA 3BTTE 1O3GA 3RP2A 1BCUH 1LVMA 3ATMA 1RRKA 1ELFA 3RC4A 2F9NA 1C5NH 2Z3CA 1TNJA 1BMLA 2XCFA 1GBFA 1V2NT 1LPZB 3RU4E 2QC2A 8GCHF 4E06H 4X1QU 1TMTH 3BTME 1S81A 1YCPH 1XX9A 5GDSH 1ARBA 1C5MD 1G36A 1J9CH 2QXJA 5F6MA 1A3EH 5FXLA 1Y59T 3S7HB 1C9TA 1W8BH 4UDWH 1DS2E 2XW9A 4SGBE 1ELCA 4LXBH 2ZFSA 1FNIA 3HPTB 5GWZA 3GCOA 1HPGA 1SGRE 1UCYE 2ZGXH 1QRZA 2EA3A 2V3OH 2FESH 4DIHH 1XXDA 1GBMA 2GT8A 1JMOH 3LC3A 3PO1C 4NSYA 3FAOA 2BQ6B 2TGPZ 1A7SA 3ZV9A 5L6NH 3SZNA 4K69A 1F0TA 3F9EA 1N1LA 1P3CA 5JBAS 3UREA 3QGNB 1ZTJA 1YCPM 1SQOA 1QHRB 1H9IE 1SGDE 6LPRA 5EXLA 3A86A 2GDEH 2KAIB 4FUIA 4GVUA 4ZKRU 1GBLA 5ETXA 2P3FH 3M3VA 4B71A 3RXEA 1P9SA 1FI8A 7ESTE 2J9NA 5FPTA 5GJ4B 1S85A 1TWXB 2BLWA 2Z6BD 1ETSH 3M36A 4YTAA 1C5QA 1D3PB 1TB6H 1O5EH 4XE4A 1GGDB 3P70B 1HAIH 2WPMS 2AIQA 1GDNA 4INLA 1C1OA 3D62A 5JPMH 4CH2B 2TGDA 1LVBA 2QXIA 1GPZA 3P17H 4U30A 1GHBG 1C5TA 1A2CH 3RXKA 1V2MT 3LGYA 1GHWH 2R3YA 5EG4A 4UFFH 2ZFFH 2QF3A 1RFNA 3VXFH 3PLBA 1E35B 5AFZH 1CT0E 3AW1A 5JB8S 3S7KB 4GCHG 1O31A 3TPIZ 3GISB 5AF9H 5L2YH 1C5YB 1GHXH 5E0JA 1UJ1A 3SHAH 3ATKA 4DY7B 1ZJDA 3P92A 1SOZA 2ZI2H 3FANA 1AFEH 3ATWA 3E90B 1C5XB 1EPTA 2WYGA 2VGCC 2OC8A 4X0WU 3F6UH 2AH4X 3MHWU 3AAUA 4AZ2B 1O2PA 1MU8B 2R3UA 1C2GA 3ZYEA 2FLBH 1O5AB 2FWWA 4I8GA 3BEUA 3LIWA 4LK4A 3TITA 3VB6A 3TVJB 4FUDA 2ZU4A 2FI3E 3RXUA 3B8JA 4UEHH 1DITH 1EB2A 4O97A 1EAWA 4AFUA 2FEQH 1V2JT 2LIZA 1AI8H 4TWWA 1A5HA 2RA0A 3EBNA 1PYTD 3MH6A 2HWLB 1CA8B 2ZO3H 1IHTH 2VVCA 1VCPA 2Y80A 1N6XA 2SGPE 5GCHG 3C1KA 3LOXA 2G55A 1O36A 2FP7B 1K1LA 1BTYA 3EGKH 3GY3A 1BTZA 1HIAA 3ELAH 1FN8A 1QB9A 7GCHF 1MTUA 1L2EA 3SUGA 4YLUA 1HRTH 4D9RA 1CGHA 4AOQA 1O0DH 2BY7X 5B6OA 3A8DA 3GY5A 1C2LA 3A7ZA 1MCTA 2EC9H 3SU6A 5T6DA 3ZV8A 3STIA 1G30B 1QL9A 1MTNB 2Q6FA 1MU6B 4J1YA 3BTDE 1GHVH 4DG4A 1PPEE 4I8LA 3KIDU 2GMTC 1UTNA 4X6NA 2ZDKA 1DWCH 2SFAA 3RXFA 3KHVA 4IBLH 4Q2KA 1KIGH 2ZHWH 3M7QA 3UY9A 3P8FA 1LVOA 3PMBB 1O37A 3SJIA 2BY6X 1Z8RA 1XUFA 4INKA 3K2UA 2A31A 3GOVB 1P9UA 3UPEA 4HFPB 4GHTA 5CE1A 3Q77A 2FTLE 1RTFB 1GJ5H 2WYJA 2ZTYA 3RXMA 1OYQA 2PUXB 1Z1JA 1GGDC 2HNTC 4A1XA 1EP5A 2ZZUH 4ISNA 1BHXB 2A7HA 3PYHA 1HAVB 1T4UH 4Y8XA 1ZSJA 3HKJB 4Y0YE 1DM4B 2GGVB 4DW2U 2GZ7A 4BXWA 2D1JA 1J8AA 2BY5X 3F68H 3SNCA 1C2JA 3UFAA 4D9QA 4XDEA 4MVNA 3VGCB 3LGVA 1BB0B 1ZMLA 2BDYA 1LDTT 2WV5A 1W3CA 2B5TB 2CHAB 1H1BA 2TGAA 3MMGA 5E0HA 2ANYA 1QY6A 1GMCG 1BITA 1BOQA 4Q7ZA 4WY3A 1GBBA 1CGJE 5E2OA 4ABJA 4NIVA 3HGNA 1C1UH 1AWHB 4YOGA 3DHKH 3TGJE 1P2NA 2ZIQH 5ESTE 2PKSB 1V2ST 4DCDA 3PLKA 3QO6A 1EX3A 6ESTA 3UNQA 1SFQB 5DP5A 1DWBH 4A6LA 1Z6EA 1GI5A 3RXSA 2Z94A 1O2WA 3FZZA 4XSKU 2BMGB 2XBWA 5EODA 1TA2A 4HGCA 1GVLA 1AIXH 1Z71A 1WCZA 1QJ1B 2B8OH 1CHOF 1CGIE 1HAZB 2VIDA 3DFJA 4X1PU 4OS6A 1Y3WA 3F1SB 1ELTA 3W94A 2ZGHA 1PPBH 4CHAC 3P8GA 4MPUA 3ZZ4A 1ANBA 1EKBB 1KXEA 3PMAB 4QT8C 4ABFA 5A8YA 1TGNA 2OCVB 1HAHH 1DLKB 3MNCA 1CHGA 1D9IA 1BMNH 2C8WB 4WXVA 4ZHAA 2Z3DA 1A5GH 4Y8YA 4ZKNU 1H9LB 1O5GH 1FY1A 3EA8A 4ABEA 2UUFB 4I33A 4H4FA 1HB0B 3E1XB 5H4IB 1SGYE 2GV7A 6CHAB 2B9LA 1OWHA 1OWKA 3UNRA 1W0ZU 4NIXA 3DT0H 3BTGE 2QV1A 3RXAA 4MNVA 4MG3A 3TU7H 2O8UA 2FYRA 3O8RA 1QA0A 3KL6A 5JB9S 3ZZDA 3SGAE 2FIRH 2ALVA 1GI7B 3RMMH 1OS8A 5A8XA 1DFPA 1O2QA 3S9CA 1DSTA 4YOJA 4Y76A 3EA7A 1GVZA 5C20A 2Z3EA 1E37B 2KAIA 2VINA 4IGDA 1GHZA 1LTOA 1SB1H 1AB9B 1NRRH 1A4WH 4K3JA 1ABJH 1C4Y2 1MBMA 1UTJA 1XUHA 2CMYA 2TIOA 3K6YA 4O3TA 3BV9B 3BIUH 1TPSA 4IMZA 3LKWA 3NZIA 3SUEA 1EJMA 1HNEE 1FJSA 4XBCA 2G8TA 5EPYA 2Y82A 4K5ZA 1O3NA 3Q3KA 1P3EA 3R3GB 3ZZBA 3URDA 3V7TA 2AGEX 2GZ8A 3RC5A 1GMDG