4XFQA

Crystal structure basis for pedv 3c like protease
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
298
structure length
298
Chain Sequence
AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIASSTTSTIDYDYALSVLRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVVNTDCFSILAAKTGVDVQRLLASIQSLHKNFGGKQILGYTSLTDEFTTGEVIRQMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PEDV main protease
publication title Structural basis for the dimerization and substrate recognition specificity of porcine epidemic diarrhea virus 3C-like protease.
pubmed doi rcsb
source organism Porcine epidemic diarrhea virus
total genus 85
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4xfqA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xfqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xfqA01
1HBTH 1CA0C 1S85A 1AN1E 1GHVH 1GI2A 2EC9H 2ANWA 1UVSH 1ZZZA 5LH8A 1NRNH 1K1MA 1T8OA 2ANMH 5F8ZA 3A85A 3BTTE 2PTNA 4ABJA 3AASA 3LJJA 3V12A 1V3XA 4Y7BA 4OS6A 1OS8A 1NN6A 4MTBA 1IQLA 2CHAC 2ZGCA 2YNAA 2K1QA 2QCYA 4IC6A 2XBVA 4ISOA 2FM2A 2ZO3H 2JH0D 3GOVB 3ITIA 1A2CH 4WY3A 3VFEA 4KKDA 5AFZH 3UWJH 1QQUA 1G2MA 1EZQA 3U1JB 4NFEA 4R8TB 2CV3A 1SQAA 2FESH 1P2NA 2A7CA 1DM4B 1MTNB 4JZIA 2UUYA 4ZXXH 3WY8A 3GYLB 4YTAA 4DVAU 2FX6A 1FUJA 2VIDA 1YF4A 3NXPA 1G37A 1O3BA 2FO9A 5E0HA 3SU3A 1OWKA 1THPB 2IPHA 2Z9LA 3GISB 3SOSA 5C1XA 3QDZB 4K5ZA 7GCHF 3ATLA 3RC6A 1E34B 2HRVA 4F4OC 1B0FA 2AIQA 5A0AE 1ANEA 1ZJDA 1CT4E 1MTUA 1MU8B 1C5XB 1QB9A 4MNVA 1TYNA 4D7GA 1WOFA 5JB9S 2DE8A 4CR5A 1XUJA 1BRBE 4TYDA 1OYQA 3RXTA 2FI4E 5A2MH 1V2QT 1ZSKA 3UWIA 4GPGA 2FYQA 1AY6H 5CHAC 3UNRA 3ZVGA 1G3EA 2FWWA 2UUFB 1CA8B 4ZKOU 2PUXB 2A2QH 2A4GA 4IN2A 1XKAC 2QF3A 5DGJA 1KY9A 2FOMB 4BAKB 2AMPA 2FS9A 3LKWA 1LPGB 3SJ8A 3TVJB 4ABIA 2H5DA 1ANCA 2C8ZB 1GHWH 5L6NH 3BTME 2CGAA 1KXEA 2AERH 2D2DA 3FVFB 5HYOA 1DX5M 5CMXH 1D9IA 2XRCA 2FOEA 3GY3A 2XYAA 4Q7ZA 8GCHG 1SBWA 4YOIA 5E0GA 2FOFA 4ZMAH 1FIWA 6ESTA 2Z9GA 3FANA 1TNHA 3OTJE 5IDKA 2Z9IA 1KYNA 5E0JA 1ELGA 1ZHRA 2OD3B 1ELEE 4DOQA 1IQJA 1H9IE 2PHBA 1LTOA 3BTQE 4OGYA 1ELDE 3MI4A 1S84A 2ZHFH 1TFXA 2TGDA 1GCTC 5JBBS 3EQ0H 4ISIH 1O3IA 2DUCA 4MPUA 2AGGX 4IBLH 1C1VH 1Z1JA 1P2OA 2ZFPH 1FAXA 3TJVA 3EDXB 4R0IA 1HYLA 1E0FD 2HNTE 3PMHB 3LC3A 1AO5A 1QRWA 1YPEH 4AORA 1T8MA 1EPTA 1YC0A 4F49A 1C9TA 1EX3A 2GZ7A 1GVZA 1P3CA 3RXKA 1VCPA 1AB9C 2FP7B 1SC8U 2ZIQH 4JK6A 3M5NA 2BZAA 1SI5H 4YOGA 2XC5A 1NFXA 1LHFH 4X1QU 4TY6A 2BLWA 2TPIZ 4A1XA 3TH3H 1XKBC 1ABJH 1MUEB 1YKTA 2ASUB 1ESTA 3NPSA 1M9UA 1EPTC 4BTIB 1C2JA 4M7GA 1N6XA 3LPRA 2FXRA 3QZQA 1BHXB 2BTCE 1PYTC 1D3PB 3F9EA 1C5WB 3ODDA 4B2CA 2J95A 1UTNA 1HLTH 2XCNA 4GLYA 6GCHG 2V35A 1FLEE 1WAYB 2O9QA 1A0JA 3A80A 3SGQE 3SU1A 2GCHG 1AMHA 1XX9A 1L1NA 1YPJH 2BDBA 1QJ1B 1ZTLA 1IQFA 1O31A 1BRUP 1Z71A 3SQEE 2ZDMA 1UK2A 2F9PA 3OY5U 4ZKSU 1DITH 1V2VT 3LGTA 2ANYA 2ZFQH 1GJBB 4YLUA 4AFSA 2RCEA 5EOKA 5SGAE 1UCYH 4UONA 4AX9H 1A5HA 1QA0A 1KTSB 4H6TA 1TA6A 5JBTA 4UFFH 2J92A 3BG4C 5JB8S 1N6YA 2ZTYA 1CGJE 5ABWA 2GP9B 1SOTA 1CSOE 1DSUA 3VGCB 1T32A 2ZA5A 1ELVA 1Y3YA 4IW4E 3BIVH 4Y79A 1NU7B 1PQ8A 1YPLH 2O8MA 3M3TA 1TMBH 4ABDA 2FLRH 1ZMNA 2BLOA 3SNBA 1UK3A 3RXRA 2Y81A 3MO9A 3OY6U 1OKXA 4Q2KA 1AIXH 1N8OC 3VPKA 4FUDA 3M7UA 4UFDH 4I8GA 1O2HA 1GHAG 1RGQA 3TJOA 3MU5A 4TPYA 1OP0A 1DY9A 4CH8B 3A8AA 1C2IA 1OWDA 4O97A 3NCLA 2GGVB 1O3FA 5DP4A 5EW1H 4GCHG 2LNCA 1QRXA 1PPGE 3FP8E 1MBMA 2BQWB 2P8OC 4UEHH 3KQEA 4XBBA 1V6DA 1RTLA 4NA9H 1XM1A 1MTVA 2BDCA 2H6MA 4INHA 5I25A 2HALA 1W10U 2G4UA 4CR9A 3T28A 1PFXC 2BDAA 2RDLA 3FAOA 3A7VA 3I78A 3LJOA 1C1NA 4ZKRU 4X8TH 1E37B 4ABAA 4X6PA 3TJNA 2ZHDA 4WXVA 1LQEA 2FTMA 2ODYB 2VH0A 1O2NA 5DP7A 5DK1A 1V2KT 2UUJB 1HV7A 1DXWA 2OINA 1MH0A 3E90B 2A4RA 2ZTXA 1W0ZU 4DURA 1H8IH 2ESTE 1K22H 1BTYA 4FUGA 1SGRE 3M36A 1HAZB 1O3DA 1DWEH 3RMMH 1GBEA 1INCA 3NZIA 3KHVA 2BDGA 4FUIA 4NWLA 1SG8B 4IS5A 2FODA 1Q2WA 1ETRH 2OBOA 1GI6A 1O39A 3ZZBA 1GJ7B 3SUEA 2R9PA 3M35A 1O2ZA 3B9FH 1RS0A 1TBZH 3AAUA 1GJDB 4AFZA 4AG2A 1LVBA 2A2XH 1GGDB 1KLJH 2V0BA 4VGCC 3S7HB 2O8LA 4TY7A 4NFFA 3ATKA 2FTLE 1ELCA 4X1RU 3UUZA 2Z9JA 1P2JA 3DHKH 4WXIA 5GPIB 3RU4E 1MD8A 3SUDA 4ZAEA 3BTWE 1Z8GA 1GMHG 1ZTJA 2C4FH 3ZVFA 1TONA 3ZZ5A 2C93B 2BD9A 5JDUB 1O30A 1HB0B 1LKAA 2F9BH 2A5IA 4Y0ZE 3ZZAA 3PMBB 3MFJA 2P3FH 2GMTC 1ZPZA 1GDUA 4BTUB 3VB6A 4FUCA 5FBIA 5HXFA 3F9GA 1DLEA 2WV4A 1BZXE 2WYGA 9LPRA 3A83A 4FU9A 1P09A 3PLPA 2HLCA 3BTEE 3S9BA 1O0DH 5A0CA 3V0XA 2A45B 4GHTA 4YOJA 1QNJA 4AG1A 3P8GA 1O3NA 1BTXA 3RMLH 3SBKA 3D23A 5DPAA 2BVRH 3PM3A 1SGPE 3N7OA 5FPTA 1HUTH 4Y10E 1XUHA 1BJUA 3FFGA 2BY8X 2H1UA 5C5OA 1EP6A 2ZP0H 1XXFA 5AVDA 4DIHH 2ZNKH 5E8EH 3TLOA 1F0UA 1BRCE 1TX8A 1F5RA 1QRZA 5G4BA 1HJ8A 3K2UA 1LCYA 4Y6DA 1HIAB 2ZDVH 3QWCH 1LDTT 4J1YA 1O3AA 1BBRE 2G00A 2SNWA 1BMMH 3RU4T 4AYVB 5EXMA 1WYKA 4ABBA 5C3NA 2ALPA 2G51A 1CGIE 4FUEA 3S9CA 1AE5A 4ZHAA 1ZYOA 4NG9H 2ZU5A 5K0HA 2STAE 1AFQC 1W0YH 2GCTB 4I8LA 3RXLA 4DW2U 4H4FA 2NU4E 2G5NA 1EAWA 3PMAB 1O2KA 2V6NA 2BXTH 2STBE 1IQMA 5EG4A 3SI3H 2OTVA 1CHOG 1H9HE 5TCAA 3QX5H 3FZZA 3MH4A 1S83A 1EKBB 1L4ZA 1CHGA 1W3CA 3A7ZA 1G3DA 1BBRK 2THFB 2ZU1A 1TPAE 1C5VA 3QTOH 4BOHA 1WQSA 1P0SH 3S69A 3S0NA 4CHAB 2WV5A 1HAVA 5EGMA 4BXWA 2JH5D 1GVKB 1UVTH 3E16B 4E06H 1TRMA 1YBWA 2WPKS 2OXSA 3TK9A 3QGJA 4AGKA 1UTJA 1XXDA 3P92A 4Z6AH 2EEKA 1MU6B 4K1EA 4X1NU 3ZV9A 1S6HA 3KQCA 4ISLA 4GVUA 4FUHA 4X0WU 1HCGA 4K69A 1KXCA 1B5GH 3TGKE 1TB6H 1MKWH 1NRRH 3ZZCA 4KP0A 1LVOA 1THRH 2W3KA 3E1XB 3GCTG 3P17H 4PROA 1KDQA 2FMJA 2PKAB 3SJIA 1LHDH 1O5AB 5GCHG 4NWKA 2A5KA 2WPMS 2QIQA 1EJNA 4RKJB 1OPHB 4GUXA 2Z3EA 1A0HB 1W11U 3TIUA 1ID5H 1J14A 4NSYA 3F68H 1AWHB 2AFQB 4XFQA 3D65E 1W13U 1O3CA 3ATIA 2P3TB 2HPQH 5C5NA 1KTTB 3I29A 2PTCE 1JIMA 1GBHA 2FOGA 2QAAA 4O9VA 2HNTC 3A8BA 2OC8A 3F6UH 1BMNH 2H9EH 4MPXA 4K8BA 3T29A 2QF0A 2WPIS 1FY3A 3ZZ9A 1IQNA 1TPPA 1EUFA 1AKSB 2ZQ2A 1Y5AT 3A87A 4I31A 4HZHA 4NIVA 1C2MA 5FHTA 3ESTA 1B7XB 3FZDA 3BV9B 4XSKU 3A7WA 5FBEA 3UIRA 4UFGH 4CRBA 2PSXA 4B74A 4B75A 2HNTF 4O3TA 4Z0KA 2GT7A 1D3QB 4QT8C 1Y3VA 1BT7A 4MPVA 2AIPA 2PGQB 2PWXA 4BAQB 1MTNC 3ELAH 3SHCH 1UK4A 2Z7FE 1ZR0A 3A81A 1Y59T 2O8WA 1DS2E 3BN9A 1F5LA 4MLFB 3K65B 1GMDG 1KDQB 3A7XA 4K1SA 2CN0H 5FX6A 4TPIZ 3K6ZA 2VIOA 3HK6B 4JZ1A 4XDEA 4X1PU 1UJ1A 1C1QA 3O8BA 2P93A 1L0ZA 1VR1H 2GKVE 2Q6GA 2G52A 1GBBA 1C5RA 1EB1H 5AF9H 1QHRB 1T31A 1NROH 1JRTA 3LH1A 3KQBA 3MOCA 1C1RA 3U69H 5A0BA 1QJ6B 1ZHPA 1GHZA 3ZZ6A 2Y7ZA 2RG3A 4OS5A 2KAIB 1YPGH 1ARBA 2Z6BD 2ZHEH 3GCHB 1CA0B 3T25A 2I6SA 5DP5A 4Y8ZA 4ZH8A 1ZTKA 2ZHWH 3RLYH 5JPMH 1T7CA 3MNSA 4Y8YA 1DWCH 3OSYA 1P2MA 3RDZA 1GBFA 1NFWA 1FIZA 1DPOA 1OX1A 3RXAA 3EA7A 5PTPA 2ZI2H 3TU7H 1P9SA 4UDWH 1RTKA 1TGSZ 1U6QA 2F83A 1K1OA 3GCNA 4MNWA 3M7QA 1OWHA 1YPMH 1O2IA 1O3HA 3QLPH 3PYHA 1UTQA 1V2ST 3LH3A 1P10A 3SHAH 2BD8A 3SO3A 2SFAA 2J34A 2BX4A 1AWFH 2J2UA 2AGEX 2ZPRA 3ZYDA 1LHGH 2OBQA 2VNTA 3T62A 4AN7A 1J16A 2B7DH 3BTHE 1MZDA 1J9CH 2Y5HA 3TGJE 4D76A 1O2WA 3HATH 1BJVA 1GVLA 2J9NA 3EAJA 2FX4A 5EW2H 2NU2E 1ELTA 1ZPBA 4H6SB 4Y8XA 1TOCB 4AB9A 7GCHG 7KMEH 2JETC 2V3OH 1TPSA 3H5CB 1ZRKA 4X8SH 1UHBA 5LPFA 1YCPH 1RIWC 3PMJA 3GY8A 1AGJA 5EODA 2G5VA 4B2AA 1S81A 1C5SA 2YNBA 1BTHH 3ZZDA 3RXPA 1JBUH 1F7ZA 5JYIA 1AZZA 4XOJA 3TNSA 1F0RA 1JRSA 5BPEA 1D6RA 3NKKA 1WV7H 2BD2A 2XBYA 1IAUA 2PKSB 1UTKA 4U2WA 1UVOA 2GD4B 3ZVEA 3SJOA 4IMZA 4NZQA 3SNCA 3H7TA 1KLIH 1NU9A 1YM0A 1GHBF 1ETTH 2J38A 1TNIA 3LGUA 2OC1A 1C5MD 3MHWU 3L33A 2AH4X 3O8CA 3SORA 2GX4A 2H2ZA 2FDAA 2OUAA 1EQ9A 5HMAA 1D3TB 2H9HA 4DT7B 2XXLA 1O2QA 4B76A 2ANKH 2Y7XA 4WJG2 4HFPB 4ZXYH 4AB8A 4CRFA 3UTUH 1C5NH 3A8DA 4KTCA 3F9FA 3A84A 1O37A 2ZGJA 2BVXH 3AW0A 3Q3YA 3BEUA 2AMQA 3QK1A 2ZKSA 1AZ8A 3A82A 1XUGA 3VB7A 1Q3XA 3TH2H 3U9AH 3P8FA 3SU5A 1O5DH 4K1TA 2VWNA 5HM2A 4WH6A 1C4Y2 2VB0A 3SV7A 1P02A 1L2EA 1UHBB 2DE9A 1AE8H 3ZZ7A 1BCUH 1O2OA 2G81E 1P9UA 3HKIB 1P12E 2UWPA 2K7XA 1F5KU 4D7FA 2F91A 2PSYA 1GCTB 2QYIA 3MH6A 2FOAA 1Y3UA 1SGYE 2BXUH 5EU8A 2FEQH 3SV2H 4FU7A 3GDUA 3OU0A 1FQ3A 1V2LT 3VGCC 4I8HA 2ZFTA 5ETXA 3TNTA 1W7GH 2BDIA 3BIUH 1K2I1 1NFUA 1A7SA 6LPRA 4JZFH 1ZSLA 1AFEH 1CBWC 3DT0H 1ANDA 4NGAH 1GJAB 3KL6A 1MAXA 1W14U 1W7XH 4ISNA 1GBLA 4H42U 3UQVA 1ACBE 6CHAB 1XVMA 1ANBA 2W5EA 3M61U 2GDDA 4DY7B 1GHAF 2FZZA 3URDA 1EPTB 1ZMLA 1OYTH 4RSPA 4E7NA 5HGGA 3D49H 3K6YA 2W7SA 1C2EA 2BQ7B 1RJXB 1DVAH 1PQ5A 2TRMA 1L1JA 3Q76A 2ZDNA 4WVPE 1TRNA 1C1WH 3MH5A 1VGCC 3RC4A 5EPYA 3BSQA 1C1SA 3CP7A 4Q7YA 1GL0E 2AS9A 2R2WU 1DSTA 3LGVA 5F03A 3C27B 3F1SB 2BX3A 2W26A 2B9LA 2PFEA 4NIYA 2VIPA 1ETSH 4O3UA 1EOJA 1P01A 2I6QA 1GDQA 3T27A 1WTGH 3P8OA 3AVZA 1D6WA 1W2KH 4GAWA 5A09A 3RXVA 1BTWA 1BOQA 1HXEH 1V2PT 4ISHH 1RRKA 3A89A 2VIVA 1UCYK 2ZPQA 3DFJA 1H8DH 4JYTA 2LPRA 2ZG0H 1P11E 4ABGA 4YT7H 1DDJA 2ZDLA 4WMEA 2FI3E 1QY6A 3DFLA 1QIXB 3BG4B 2C8WB 2Z3CA 2BOHB 2JH6D 2TIOA 5DJ7A 4MNYA 1ZGVA 8KME2 2A31A 3PTNA 2SGAA 2F9OA 3SV8A 4MVNA 4YM9A 1HAGE 4A7IB 1SVPA 2W3IA 3NUMA 2WPJS 1HXFH 3S7KB 1BTPA 1OWJA 1GCDA 1K1PA 5DO4H 1TLDA 4X8UH 1IQHA 1YCPM 1BUIA 1N8OB 4FVDA 4K2YA 1O2XA 2ZWLH 2O8UA 1DUAA 1GGDC 4I8JA 1HJAC 3BTGE 1D3DB 5IYTA 1OWEA 3OYPA 1AU8A 2C8XB 5E2OA 1AQ7A 5EXLA 4AOQA 1B0EA 4E05H 3GY5A 1G36A 1FY5A 1WCZA 4IN1A 1C5OH 4Q80A 4B1TA 2ZU2A 3SGAE 2ZPSA 2BZ6H 3HGPA 1MQ5A 3GY2A 2TGTA 3UNSA 3PWBA 3T26A 2BD4A 1F0SA 1GMHF 1QB1A 1VITF 1MCVA 2VIWA 2A5AA 2XW9A 5J4SA 2SGPE 1Y8TA 2EI7A 1G3BA 1WBGB 3GY4A 1PPEE 2TGPZ 1D4PB 2XNIA 3A86A 1NO9H 1PYTD 2WPLS 1XUIA 4JYUH 3Q3KA 2XBWA 4ASHA 2SGFE 4K8YA 2WUBA 1EB2A 2BVSH 1SQTA 1QB6A 1V2WT 4CRDA 8LPRA 3PROA 1BQYA 3MO3A 2ZHQH 3U8OH 4SGBE 3P8NA 1KLTA 1C5QA 4IMQA 1LPZB 4NZLA 5A8ZA 3CS0A 1UTPA 1GMCF 1V2MT 1HGTH 3GICB 5T6DA 1GJ4H 1FDPA 1G2LA 3I77A 2XWBI 3UR6A 1H4WA 1TQ0B 2J4IA 5LPEA 1GJ6A 1C9PA 3STIA 2UWOA 3ODFA 4DCDA 1P05A 5TJXA 4MQAA 4VGCB 3U1IB 1JXPA 5LPRA 1IQIA 4FUJA 1SHHB 2PV9B 1FXYA 2FPZA 3A8CA 2BMGB 1O2GH 2R3UA 2GTBA 4MPWA 4X6MA 3KNXA 1UTMA 2A7JA 2A0QB 3KCGH 1BBRH 3JZ2B 4X6NA 1UTOA 3PWCA 2VWMA 5C67A 1QCPA 2LIZA 1Z7KA 4OS7A 3ZVBA 2GMTB 1IOEA 3MU4A 1TMTH 1EJMA 4MDSA 2AMDA 3SZNA 1SL3A 2BD7A 1EJAA 4INKA 1MCTA 1PQ7A 2D1JA 4RN6A 3LGWA 5B6OA 1K1NA 5H4IB 3UY9A 1O3EA 2ZU3A 1IQKA 3LGIA 1FY8E 3HPTB 3V7TA 3RXUA 4HGCA 1A5IA 1PPHE 4LOYH 2A4QA 4A5TS 2B0FA 3VB4A 2ZFFH 2BY9X 2TBSA 2IOTA 5FPYA 4YESB 1TGBA 1XMNB 1QURH 3RXSA 2GV7A 4CREA 3RMOH 4ZKNU 2WINI 1SGEE 4JZDH 1TOMH 3SJKA 4AYYB 3TGIE 1MTWA 1MKXH 1QBOA 1W12U 2ZCLP 5GDSH 3PB1E 1GG6B 1C5YB 1RD3B 2QXIA 3PO1C 1SLWB 4FU8A 2BYAX 3A7YA 1GI1A 3IITA 4A1VA 1A4WH 1O2RA 2ZGBH 2P94A 3FP6E 4I7YH 1DWBH 4JK5A 4DGJA 1CGHA 3UR9A 2H9TH 4X2WA 1BB0B 1O32A 1S6FA 3SU4A 3RXFA 2BY7X 1MD7A 3K9XB 4GSOA 5LGOA 1C5PA 2C8YB 4NSVA 1SGIB 3RM2H 3T5FH 3GCOA 3AW1A 5DP6A 2OCVB 2ZDAH 1C5ZB 2FYRA 3EE0B 4XBDA 5EPNA 3RC5A 1A61H 2A1DB 4B71A 2IJOB 3RUOA 2BM2A 3SJ9A 5FPSA 1YLDA 1QBNA 2G55A 1JOUB 1A3EH 1TE0A 3GDVA 2VIQA 1EP5A 1GI3A 1SMFE 3ATMA 3MMGA 3L6PA 3QTVH 5GXPA 1HAOH 1FY4A 2CF8H 2AYWA 1O2TA 1JMOH 1NZQH 1HAVB 2ZDKA 4KELA 1ZGIA 3B23B 1C1MA 1GMDF 1TBRH 3QUMP 4U30A 1SQOA 3UREA 1LQDB 2HGTH 2P3UB 3VB5A 7LPRA 1YYY1 2QA9E 1QBVH 2H5CA 4CRCA 2BLQA 4A92A 1LO6A 1ZRBA 1RTFB 1CT2E 3GY6A 1SSXA 1LPKB 1TNJA 1J17T 1QR3E 3RXCA 1O2SA 5F8XA 2SNVA 2OQ5A 3KN2A 2R3YA 1O33A 4SGAE 1SB1H 5ESTE 3GCHC 3M3VA 1JWTA 1SLUB 2FLBH 3P6ZB 1HAXB 1YLCA 3DUXH 3BG8A 5ESBA 1FZZA 5I46H 1SHYA 3SN8A 3RXHA 1Z1IA 3M5MA 3UOUA 2HVXA 1C2FA 1TGCA 1PPBH 3NK8A 5JBAS 1ZLRA 2VU8E 2HPPH 3TK5A 2VGCB 2A4OA 1NFYA 3DA9B 1NS3A 1O38A 3ZVCA 1A0LA 3MH7A 3LDXH 4X2XA 2ALVA 1GI8B 1P2IA 1GBTA 3F9HA 1THSH 2FIRH 1P04A 2R0KA 1Z8JB 1DWDH 2F9UA 1HJ9A 1EZUC 4BANB 3PTBA 4CBNA 1MMJN 2XC0A 5EXNA 2EI8A 2D26C 5DG6A 1TWXB 5A8YA 1XUFA 1PPFE 1TX6A 4CH2B 5EQRA 5GWZA 1Q31A 2CHAB 2B8OH 2NU0E 2ODPA 4K60A 4X6OA 1EATA 1DICA 4TWYA 1F92A 2GVFA 2OLGA 1A5GH 3ZVDA 3ZYEA 3U8RH 2CJIA 1C5TA 4Y0YE 1S82A 1TIOA 2VH6A 1YGCH 1FPCH 4WMDA 1UTLM 2FOBA 1O35A 1NRQH 2O8TA 4WMFA 8GCHF 4Y11E 5A8XA 2FS8A 1DLKB 1WUNH 4FUFA 2D8WA 4ZROA 1V2UT 2SGDE 1FNIA 1P03A 5BRRE 1O5FH 2PKSC 2OQUA 1MBQA 1WU1A 2BLVA 2WYJA 3SV9A 1SGTA 1VCQA 1H9LB 4NIXA 2XBXA 3ZV8A 4BNRA 3RM0H 1TMUH 1QA7A 1C1PA 3MU1A 2GDEH 5T3HA 3A7TA 4Y71A 1LKBA 3RXBA 4BTTB 1QTFA 3D62A 1ZHMA 2Y5GA 3MYWA 3RP2A 2BY5X 1LHEH 5C1UA 2YOLA 1GBMA 2BD3A 3LOXA 1IHTH 5CHAB 2FOCA 1ELBA 1WQVH 3ATWA 2AEIH 1O3LA 2UUKB 2Y80A 4JMYA 1TALA 4IGDA 3HGNA 4NA7A 1HAHH 1K21H 1SPJA 1HRTH 3Q77A 1KXDA 3E0NB 1O3OA 4DIIH 1UVUH 2VVCA 3SU0A 1QGFA 1DANH 1XVOA 1BA8B 1UO6A 4J2YB 4A1TA 1C5UA 1V2TT 2JETB 2Q1JA 2ZEBA 5FCKA 1YCPK 2BQ6B 4RKOB 1RIWB 1O2PA 1EAIA 4NA8A 3S9AA 2QXJA 4KTSA 4HI3A 1SGNE 1RFNA 1G32B 4NCYA 1KIGH 5EQSA 3BEFB 4MNXA 2W7UA 4YO9A 1AUTC 9ESTA 1EASA 2G4TA 2Q6FA 2J94A 2NWNA 1O2LA 1Z6EA 1Z8IB 2ODQA 1EZXC 6GCHF 1YP9A 2ZGHA 1WTHD 1TQ7B 2GCHF 2VJ1A 1O2UA 1MZAA 2PR3A 4JCNA 1C2HA 4CRGA 2XTTB 4D9QA 3M3SA 1TABE 1ZJKA 1GHBG 1FI8A 1NT1A 4WF8A 4X2VA 1BHXF 1HNEE 1T4UH 3QO6A 1O2VA 1QL8A 1O3JA 6CHAC 3MU8A 2RA0A 3LONA 1AI8H 4ZHLU 2Y6TA 4NIWA 1SOZA 1C5LH 1OWIA 2BDHA 5DP8A 4X2YA 3SNDA 1CE5A 1SFIA 5GIBA 4UE7H 3T2NA 5F6MA 3SNEA 1YPHC 3ZZ4A 1OP2A 4YT6H 1BITA 2C3SA 4UD9H 3UNQA 1X7AC 1AB9B 2VVUA 4X8VH 1ZPCA 3GY7A 1BDAA 4XE4A 4THNH 2ZC9H 4WWYA 1ELAA 1TNLA 2Z94A 1S5SA 2ZZUH 2Q6DA 2A32A 1SGFA 1UVPA 3VB3A 3BEIB 3TJUA 3M5LA 2BDYA 2QXHA 1WSSH 1O36A 1VZQH 2ZTZA 3MNXA 3RXGA 1UCYE 1O3PB 1C1UH 1TA2A 2OC0A 4ABFA 2R2MB 1T4VH 1P2QA 1T8LA 1V2RT 1P57B 3UPEA 1C1OA 3CENA 1EAXA 1SGQE 2ZFRH 4GCHF 1A46H 1ABIH 3A88A 4D8NA 2QY0B 3M7TA 3E3TA 4YLQH 3LGYA 1AVGH 1CU1A 1Z8RA 2QV1A 5C20A 3UOPA 3SW2B 2F3CE 1FAKH 1PPZA 4D9RA 2C90B 4LZ4B 3KQDA 4ZUHA 1O5GH 1O2JA 3SV6A 1VCWA 3SQHE 1J8AA 2GZ9A 1OXGA 4UFEH 5FXLA 1AVWA 1CBWB 1KXBA 3GYMA 1PJPA 2CMYA 2QGRA 4KTUA 1S0QA 2BD5A 4JZEH 1LVMA 3O8DA 2HOBA 1HAIH 1K28D 1DUEA 2ZF0H 4ABEA 3RLWH 2BHGA 1O5EH 2Z3DA 1P2KA 3P95A 1GDNA 1EXFA 1GI7B 3IWMA 3CS7A 2WUCA 3VEQB 1C4V2 1TAWA 3ZZ8A 1GJ9B 1A3BH 1E38B 1NRSH 2ZU4A 3PLBA 3UQOA 1ELFA 2CXVA 1KXFA 1E36B 1FN6A 2B5TB 2A7HA 3KF2A 1F2SE 1VGCB 4BXSA 2PGBB 3QN7A 5K7RA 4AZ2B 1SR5C 4XBCA 4B73A 1MQ6A 3SU6A 1BMLA 1Y3XA 3RXEA 3E6PH 5DP3A 1LMWB 3RXQA 1F0TA 1OOKB 2Z9KA 4OGXA 3RXDA 4U01A 1ZSJA 1BTZA 4AFQA 3RU4D 3RXMA 2GT8A 3JZ1B 3G01A 3L3TA 1K1LA 2QC2A 1ARCA 2P8OB 3LT3A 4HTCH 3V13A 1SGFG 2OC7A 1ZMJA 2PUQH 3MU0A 3U8TH 2ZECA 1NRPH 3P70B 1TNGA 1BMAA 1BTUA 3BTKE 1GBKA 4A6LA 5EQQA 2CF9H 3RMNH 4AFUA 1NM6A 1P06A 1MAYA 4ZHMU 3EBNA 1HIAA 4OS4A 4AGJA 1CT0E 3KEEA 3EA9A 4JYVH 2F9NA 5GJ4B 1NY22 1TGTA 3DD2H 1ESBA 1V2NT 1GJ8B 3KGPA 3IG6B 1G30B 3GDSA 1GJ5H 1K1JA 3E91A 2QXGA 2WPHS 1QL9A 3EYDA 5HM9A 1DOJA 1E35B 1ORFA 1HJAB 2VVVA 1NPMA 1EAUA 4OS1A 4IC5A 4K3JA 1BRAA 1V2JT 5L30H 3SUGA 1C2KA 5AHGH 1TGNA 3SUFA 3R3GB 1YPKH 1FJSA 2XWAA 1IHSH 1XUKA 3KIDU 4KGAA 3EA8A 1FY1A 1TBQH 3QGNB 1J15A 1L4DA 5FX5A 1Y5UT 7ESTE 1H1BA 1VITG 1PPCE 2EI6A 2IN2A 3HK3B 3U98H 1QQ4A 1K9OE 3BTFE 1P8VC 1OSSA 2XCFA 5T6GA 3RXOA 2SGQE 2ULLA 1BIOA 1NESE 1OP8A 3MTYA 2GV6A 1DE7H 1YPHE 1HDTH 2GCTC 4BAOB 2QN5T 1K1IA 1Z6JH 2NU3E 3SGBE 3MWIU 2NU1E 1DXPA 3M37A 4O03A 1CHOF 2SGEE 3MO6A 3SU2A 5AFYH 1C2DA 1QJ7B 1SGCA 1RXPA 1GI5A 1ZOMA 1CO7E 1JIRA 2VINA 1AUJA 2VWLA 1GMCG 4CHAC 1DFPA 2FOHA 3SNAA 3BTDE 1NTPA 3SI4H 2PKAA 4U32A 2JKHA 1GBCA 1CQQA 3OX7U 1GI4A 5TCCA 1L1GA 1GJCB 3C1KA 4FVBA 1UMAH 3ZVAA 5DKMA 5C1YA 1O34A 4CRAA 4DJZB 5J4QA 5JBCS 1C4U2 1DY8A 1GG6C 1SFQB 1GBAA 1GWAA 1TRYA 1V2OT 4WH8A 1AD8H 1IQEA 3PLKA 5T6FA 1Y5BT 2HWLB 1FONA 4I8KA 4X1SU 4Q7XA 4B2BA 3QZRA 3PV4A 3GCTF 2AGIX 2F9VA 2M5TA 5GCHF 2V3HH 3ENSB 3W94A 2ZFSA 3HKJB 1EZSC 5F8TA 5C2ZA 3STJA 1AKSA 1IQGA 1SGDE 2P16A 1O3MA 4OS2A 2ZGXH 1AVXA 5E2PA 1O2YA 4INLA 3V3MA 4LK4A 2TGAA 2UWLA 1GPZA 3LU9B 3AAVA 3UFAA 1HAPH 1A1RA 3TH4H 1GBJA 1CVWH 3URCA 2PLXA 2BB4A 1AFQB 1TX7A 4FUBA 1PQAA 1TNKA 3RXJA 3TK6A 4ABHA 2PW8H 1HPGA 4TWWA 3E0PB 1FN8A 1HAYB 4BAMB 2FI5E 3B8JA 2RA3A 1QFKH 1N1LA 3W95A 2VWOA 4FXGH 1LHCH 1MTSA 3TPIZ 4MG3A 3TITA 2OP9A 1O2MA 3NWUA 2Y5FA 1O3KA 1O5BB 1GI0A 1S0RA 1VITH 4GHQA 3O8RA 1ESAA 1SLXB 2ILNA 3MNBA 3VXEH 4LXBH 1FPHH 4YZUA 1C2LA 4E7RG 5L2YH 1DT2A 1Y3WA 2EA3A 1C2GA 2ZCHP 4Y7AA 2P95A 3ZZ3A 3FP7E 1QL7A 3BF6H 4CBOA 1MKXK 1NC6A 3R0FA 5FCRA 3RXIA 2GZ8A 4I33A 4BAHB 2BOKA 1SLVB 1AHTH 1GHXH 3M5OA 1GBDA 1GBIA 1MKWK 3PO1B 5CE1A 8ESTE 3MNCA 3Q00A 4LZ1H 1FV9A 2KAIA 5FAHA 1GHYH 3LC5A 1T8NA 3E8LA 2G8TA 1EOLA 1HFDA 3LIWA 4DG4A 3Q3XA 1C1TA 1FMGA 2ZCKP 2XC4A 1GL1A 2Y82A 1O5CB 5L2ZH 1G9IE 5DP9A 2BY6X 3H7OA 1KXAA 4I32A 3EGKH 1GI9B 1KSNA 1VJAU 1P3EA 2VGCC 1G3CA 2ZQ1A 1VJ9U 1LVYA 1O3GA 1TPOA 4Y76A 3VXFH 4ESTE 2R0LA 2P59A 1W8BH
chains in the Genus database with same CATH superfamily
1HBTH 1CA0C 1S85A 1AN1E 3WWBA 1GHVH 1GI2A 2EC9H 2ANWA 1UVSH 1ZZZA 5LH8A 1NRNH 1K1MA 1T8OA 2ANMH 5F8ZA 3A85A 3BTTE 2PTNA 4ABJA 3AASA 3LJJA 3V12A 1V3XA 4Y7BA 4OS6A 1OS8A 1NN6A 4MTBA 1IQLA 2CHAC 2ZGCA 2YNAA 2K1QA 2QCYA 4IC6A 2XBVA 4ISOA 2FM2A 2ZO3H 2JH0D 3GOVB 3ITIA 1A2CH 4WY3A 3VFEA 4KKDA 5AFZH 3UWJH 1QQUA 1G2MA 1EZQA 3U1JB 4NFEA 4R8TB 2CV3A 2WSSD 1SQAA 2FESH 1P2NA 2A7CA 1DM4B 1MTNB 4JZIA 2UUYA 4ZXXH 3WY8A 3GYLB 4YTAA 4DVAU 2FX6A 1FUJA 2VIDA 1YF4A 3NXPA 1G37A 1O3BA 2FO9A 5E0HA 3SU3A 1OWKA 1THPB 2IPHA 2Z9LA 3GISB 3SOSA 5C1XA 3QDZB 4K5ZA 2LP6A 7GCHF 3ATLA 3RC6A 1E34B 2HRVA 4F4OC 3OE7D 1B0FA 4DT4A 2AIQA 5A0AE 1ANEA 1ZJDA 1CT4E 1MTUA 1MU8B 1C5XB 1QB9A 2M2AA 4MNVA 1TYNA 4D7GA 3GS9A 1WOFA 5EIYA 5JB9S 2DE8A 4CR5A 3DSOA 1XUJA 1BRBE 4TYDA 1OYQA 3RXTA 2FI4E 5A2MH 1V2QT 1ZSKA 3UWIA 4GPGA 2FYQA 1AY6H 5CHAC 3UNRA 2KCOA 3ZVGA 1G3EA 2FWWA 2UUFB 1CA8B 4ZKOU 2PUXB 2A2QH 2A4GA 3F3BA 4IN2A 1XKAC 2QF3A 5DGJA 1KY9A 2FOMB 4BAKB 2AMPA 2FS9A 3LKWA 1LPGB 3SJ8A 3TVJB 4ABIA 3WW7A 2H5DA 1ANCA 2C8ZB 1GHWH 5L6NH 3BTME 2CGAA 1KXEA 2AERH 3VG8A 2D2DA 3FVFB 5HYOA 1DX5M 5CMXH 1D9IA 2XRCA 2FOEA 3GY3A 2XYAA 4Q7ZA 8GCHG 1SBWA 2KX4A 4YOIA 5E0GA 2FOFA 4ZMAH 1FIWA 3OEED 6ESTA 2Z9GA 3FANA 1TNHA 3OTJE 5IDKA 2Z9IA 1KYNA 5E0JA 1ELGA 1ZHRA 2OD3B 5T1VA 1ELEE 4DOQA 1IQJA 1H9IE 2PHBA 1LTOA 3BTQE 4OGYA 1ELDE 3MI4A 1S84A 2ZHFH 1TFXA 2TGDA 1GCTC 5JBBS 3EQ0H 4ISIH 1O3IA 2DUCA 4MPUA 2AGGX 4IBLH 1C1VH 1Z1JA 1P2OA 2ZFPH 1FAXA 3TJVA 3EDXB 4R0IA 1HYLA 1E0FD 2HNTE 3PMHB 3LC3A 1AO5A 1QRWA 1E79D 1YPEH 4AORA 1T8MA 1EPTA 1YC0A 1W0JD 4F49A 1C9TA 1EX3A 2GZ7A 1GVZA 1P3CA 3RXKA 1VCPA 4RI0A 1AB9C 2FP7B 1SC8U 2ZIQH 2JJ2D 4JK6A 3M5NA 2BZAA 1SI5H 4YOGA 2XC5A 1NFXA 1LHFH 4X1QU 4TY6A 2BLWA 2TPIZ 4A1XA 3TH3H 1XKBC 1ABJH 1MUEB 1YKTA 2ASUB 1ESTA 3NPSA 1M9UA 1EPTC 3PV5A 4BTIB 1C2JA 4M7GA 1N6XA 3LPRA 2FXRA 3QZQA 1BHXB 2BTCE 1PYTC 1D3PB 3F9EA 1C5WB 3ODDA 4B2CA 2J95A 1UTNA 1HLTH 2XCNA 4GLYA 6GCHG 2V35A 1FLEE 1NBMD 1WAYB 2O9QA 1A0JA 3A80A 3SGQE 3SU1A 2GCHG 1AMHA 1XX9A 1L1NA 1YPJH 2BDBA 1QJ1B 1ZTLA 1IQFA 1O31A 1BRUP 2KCYA 1Z71A 3SQEE 2ZDMA 4B6EA 1UK2A 2F9PA 3OY5U 4ZKSU 1DITH 1V2VT 3LGTA 2ANYA 2ZFQH 1GJBB 4YLUA 4AFSA 1FX0B 2RCEA 5EOKA 5SGAE 1UCYH 4UONA 4AX9H 1A5HA 1QA0A 1KTSB 4H6TA 1TA6A 5JBTA 4UFFH 2J92A 3BG4C 5JB8S 1N6YA 2ZTYA 1CGJE 5ABWA 2GP9B 5CHBA 1SOTA 1CSOE 1DSUA 3VGCB 1T32A 2ZA5A 1ELVA 4M9FA 1Y3YA 4IW4E 3BIVH 4Y79A 1NU7B 1PQ8A 1YPLH 2O8MA 3M3TA 1TMBH 4ABDA 2FLRH 1ZMNA 2BLOA 3SNBA 1UK3A 3RXRA 2Y81A 3MO9A 3OY6U 1OKXA 4Q2KA 1AIXH 1N8OC 1NBME 3VPKA 4FUDA 2YMSB 3M7UA 4UFDH 4I8GA 1O2HA 1GHAG 1RGQA 3TJOA 3MU5A 4TPYA 1OP0A 1DY9A 3U28C 4CH8B 3A8AA 1C2IA 1OWDA 4O97A 3NCLA 2GGVB 1O3FA 5DP4A 5EW1H 4GCHG 2LNCA 1QRXA 1PPGE 3FP8E 1MBMA 2BQWB 2P8OC 4UEHH 3KQEA 4XBBA 1V6DA 1RTLA 4NA9H 1XM1A 1MTVA 2BDCA 2H6MA 4INHA 5I25A 2HALA 1W10U 2G4UA 4CR9A 5EJ1A 3T28A 1PFXC 2BDAA 2RDLA 3KQ5A 3FAOA 3A7VA 3I78A 4Z1MD 3LJOA 1C1NA 4ZKRU 4X8TH 1E37B 4ABAA 4X6PA 3TJNA 2ZHDA 4WXVA 1LQEA 2FTMA 2ODYB 2VH0A 1O2NA 5DP7A 1QZ8A 5DK1A 1V2KT 2UUJB 1HV7A 1DXWA 2OINA 1MH0A 2QF4A 3E90B 2A4RA 2ZTXA 1W0ZU 4DURA 1H8IH 2ESTE 1K22H 1BTYA 4FUGA 1SGRE 3M36A 1HAZB 2VBCA 1O3DA 1DWEH 3RMMH 1GBEA 1INCA 3NZIA 3KHVA 2BDGA 4FUIA 4NWLA 1SG8B 4IS5A 2FODA 1Q2WA 1ETRH 2OBOA 1GI6A 1O39A 3ZZBA 1GJ7B 3SUEA 2R9PA 3M35A 1O2ZA 3B9FH 1RS0A 1TBZH 3AAUA 1GJDB 4AFZA 4AG2A 1LVBA 2A2XH 1GGDB 1KLJH 2V0BA 4VGCC 3S7HB 2O8LA 4TY7A 4NFFA 3ATKA 2FTLE 1ELCA 4X1RU 5GNDA 3UUZA 2Z9JA 1P2JA 3DHKH 4WXIA 5GPIB 3RU4E 1MD8A 3SUDA 4ZAEA 2YMSD 3BTWE 1Z8GA 1GMHG 1ZTJA 2C4FH 3ZVFA 1TONA 3ZZ5A 2C93B 2BD9A 5JDUB 1O30A 1HB0B 1LKAA 2F9BH 2A5IA 4Y0ZE 3ZZAA 3PMBB 3MFJA 2P3FH 2XOKD 2GMTC 2KFWA 1ZPZA 1GDUA 4BTUB 3VB6A 4FUCA 5FBIA 5HXFA 3F9GA 1DLEA 2WV4A 1BZXE 2WYGA 9LPRA 3A83A 4FU9A 1P09A 3PLPA 2HLCA 3BTEE 3S9BA 1O0DH 1KMHB 3V0XA 5A0CA 2A45B 4GHTA 4YOJA 1QNJA 4AG1A 3P8GA 1O3NA 1BTXA 3RMLH 1YY3A 3SBKA 3D23A 5DPAA 2BVRH 3PM3A 1SGPE 3N7OA 5FPTA 1HUTH 4Y10E 1XUHA 5DN6D 1BJUA 3FFGA 2BY8X 2H1UA 5C5OA 1EP6A 2ZP0H 1XXFA 5AVDA 4DIHH 2ZNKH 5E8EH 3TLOA 1F0UA 1BRCE 1TX8A 2AHME 1F5RA 1QRZA 5G4BA 1HJ8A 3K2UA 1LCYA 4Y6DA 1HIAB 2ZDVH 3QWCH 1LDTT 4J1YA 1O3AA 1BBRE 2G00A 2SNWA 1BMMH 3RU4T 4AYVB 5EXMA 1WYKA 4ABBA 5C3NA 2ALPA 2G51A 1CGIE 4FUEA 3S9CA 1AE5A 4ZHAA 1ZYOA 4NG9H 2ZU5A 5K0HA 2STAE 1AFQC 1W0YH 2GCTB 4I8LA 3RXLA 4DW2U 4H4FA 2NU4E 2G5NA 1EAWA 3PMAB 1O2KA 2V6NA 2BXTH 2STBE 1IQMA 5EG4A 3SI3H 2OTVA 1CHOG 1H9HE 5TCAA 3QX5H 3FZZA 3MH4A 1S83A 1EKBB 1L4ZA 1CHGA 1W3CA 2F43B 3A7ZA 1G3DA 1BBRK 2THFB 2ZU1A 1TPAE 1C5VA 1OHHD 3QTOH 4BOHA 1WQSA 1P0SH 3S69A 3S0NA 4CHAB 2WV5A 1HAVA 5EGMA 4BXWA 2JH5D 4ASUD 1GVKB 1UVTH 3CNRA 3E16B 4E06H 1TRMA 1YBWA 2WPKS 2OXSA 2KZ4A 3TK9A 3QGJA 4AGKA 1UTJA 1XXDA 3P92A 4Z6AH 2EEKA 1MU6B 4K1EA 4X1NU 3ZV9A 1S6HA 3KQCA 4ISLA 4GVUA 4FUHA 4X0WU 1HCGA 4K69A 1KXCA 1B5GH 3TGKE 1TB6H 1MKWH 1NRRH 3ZZCA 4KP0A 1LVOA 1THRH 2W3KA 3E1XB 3GCTG 3P17H 4PROA 2WZQA 1KDQA 2FMJA 2PKAB 3SJIA 1LHDH 1O5AB 5GCHG 4NWKA 2A5KA 2WPMS 2QIQA 1EJNA 4RKJB 1OPHB 1VKYA 4GUXA 2Z3EA 1A0HB 1W11U 3TIUA 1ID5H 1J14A 4NSYA 3F68H 1AWHB 2AFQB 4XFQA 3D65E 1W13U 1O3CA 3ATIA 2P3TB 2HPQH 5C5NA 1KTTB 3I29A 2PTCE 1JIMA 1SKYE 1GBHA 2FOGA 2QAAA 4O9VA 2HNTC 3A8BA 2OC8A 3F6UH 1BMNH 2H9EH 4MPXA 4K8BA 3T29A 3UAIC 2QF0A 2WPIS 1FY3A 3ZZ9A 1IQNA 1TPPA 1EUFA 1AKSB 2ZQ2A 1Y5AT 3A87A 4I31A 4HZHA 4NIVA 1C2MA 5FHTA 3ESTA 1B7XB 3FZDA 3BV9B 4XSKU 3A7WA 5FBEA 3UIRA 2F4LA 4UFGH 4CRBA 2PSXA 4B74A 4B75A 3WWFA 2HNTF 4O3TA 4Z0KA 2GT7A 1D3QB 4QT8C 1Y3VA 1BT7A 4I86A 4MPVA 2AIPA 2PGQB 2PWXA 4BAQB 1MTNC 3ELAH 3SHCH 3FN8A 1UK4A 2Z7FE 1ZR0A 3A81A 1Y59T 2O8WA 1DS2E 3BN9A 1F5LA 4MLFB 3K65B 1GMDG 1KDQB 3A7XA 4K1SA 2CN0H 5FX6A 4TPIZ 3K6ZA 2VIOA 3HK6B 4JZ1A 4XDEA 4X1PU 1UJ1A 1C1QA 3O8BA 2P93A 1L0ZA 1VR1H 2GKVE 3EE7A 2Q6GA 2G52A 2HLDD 2WV9A 1GBBA 1C5RA 1EB1H 5AF9H 1QHRB 1T31A 1NROH 1JRTA 2JDID 3LH1A 3KQBA 3MOCA 1C1RA 3U69H 5A0BA 1QJ6B 1ZHPA 3N99A 1GHZA 3ZZ6A 2Y7ZA 2RG3A 4OS5A 2KAIB 1YPGH 1ARBA 2Z6BD 2ZHEH 3GCHB 1CA0B 3T25A 2I6SA 5DP5A 4Y8ZA 4ZH8A 1ZTKA 2ZHWH 3RLYH 5JPMH 1T7CA 3MNSA 4Y8YA 1DWCH 3OSYA 1P2MA 3RDZA 1GBFA 1NFWA 1FIZA 1DPOA 1OX1A 3RXAA 3EA7A 3MQKC 5PTPA 3OFND 2ZI2H 2EQNA 3TU7H 1P9SA 4UDWH 1RTKA 1TGSZ 1U6QA 2F83A 1K1OA 3GCNA 4MNWA 3M7QA 1OWHA 1YPMH 1O2IA 1O3HA 3QLPH 3PYHA 1UTQA 1V2ST 3LH3A 3OAAD 1P10A 3SHAH 2BD8A 3SO3A 2SFAA 2J34A 2BX4A 1AWFH 2J2UA 2AGEX 2ZPRA 3ZYDA 1LHGH 2OBQA 2VNTA 3T62A 4AN7A 1J16A 2B7DH 3BTHE 1MZDA 1J9CH 2Y5HA 3TGJE 4D76A 1O2WA 3HATH 4TT3D 1BJVA 1GVLA 2J9NA 3EAJA 2FX4A 5EW2H 2NU2E 1ELTA 1ZPBA 4H6SB 4Y8XA 1TOCB 4AB9A 7GCHG 7KMEH 2JETC 2V3OH 1TPSA 3H5CB 1ZRKA 4X8SH 1UHBA 5LPFA 1YCPH 1RIWC 3PMJA 3GY8A 1AGJA 5EODA 2G5VA 4B2AA 1S81A 1C5SA 2YNBA 1BTHH 3ZZDA 3RXPA 1JBUH 1F7ZA 5C17A 1AZZA 5JYIA 4XOJA 3TNSA 1F0RA 1JRSA 5BPEA 1D6RA 3NKKA 1WV7H 2BD2A 2XBYA 1IAUA 2PKSB 1BMFD 1UTKA 4U2WA 1UVOA 2J5UA 2GD4B 3ZVEA 3SJOA 4IMZA 4NZQA 3SNCA 3H7TA 1KLIH 1YLNA 1NU9A 1YM0A 1GHBF 1ETTH 2J38A 2L74A 1TNIA 3LGUA 2OC1A 1C5MD 3MHWU 3L33A 2AH4X 3O8CA 3SORA 2GX4A 2H2ZA 2FDAA 2OUAA 1EQ9A 5HMAA 1D3TB 2H9HA 4DT7B 2XXLA 1O2QA 4B76A 2ANKH 2Y7XA 4WJG2 4HFPB 4ZXYH 4AB8A 4CRFA 3UTUH 1C5NH 3A8DA 4KTCA 3F9FA 3A84A 1O37A 2ZGJA 2BVXH 2WPDD 3AW0A 3Q3YA 4XD7D 3BEUA 2AMQA 3QK1A 2ZKSA 1AZ8A 3A82A 1XUGA 3VB7A 1Q3XA 3TH2H 3U9AH 3KYGA 3P8FA 3SU5A 1O5DH 4K1TA 2VWNA 5HM2A 4WH6A 1C4Y2 2VB0A 3SV7A 1P02A 1L2EA 1UHBB 2DE9A 1AE8H 3ZZ7A 5C0UA 1BCUH 1O2OA 2G81E 1P9UA 3HKIB 1P12E 2UWPA 2K7XA 1F5KU 4D7FA 2F91A 2PSYA 1GCTB 2QYIA 3MH6A 2FOAA 1Y3UA 1SGYE 4F48B 2BXUH 5EU8A 2FEQH 3SV2H 4FU7A 3GDUA 3OU0A 2XNDD 1FQ3A 1V2LT 3VGCC 4I8HA 2ZFTA 5ETXA 3TNTA 1W7GH 2BDIA 3BIUH 1K2I1 1NFUA 1A7SA 3OTPA 6LPRA 4JZFH 1ZSLA 5IK2D 3AK5A 1AFEH 1CBWC 3DT0H 1ANDA 4NGAH 1GJAB 3KL6A 1MAXA 1W14U 1W7XH 4ISNA 1GBLA 4H42U 3UQVA 3KYFA 1ACBE 6CHAB 1XVMA 1ANBA 2W5EA 3M61U 2GDDA 2J97A 4DY7B 1GHAF 2FZZA 3URDA 1EPTB 1ZMLA 1OYTH 4RSPA 4E7NA 5HGGA 3D49H 3K6YA 2W7SA 1C2EA 2BQ7B 1RJXB 1DVAH 1PQ5A 2TRMA 1L1JA 3Q76A 1S6LA 2ZDNA 4WVPE 5EJLA 1TRNA 1C1WH 3MH5A 1VGCC 3RC4A 5EPYA 3BSQA 1C1SA 3CP7A 4Q7YA 1GL0E 5KEDA 2AS9A 2R2WU 1DSTA 3LGVA 5F03A 3C27B 3F1SB 2BX3A 2W26A 2B9LA 2PFEA 4NIYA 2VIPA 1ETSH 4O3UA 1EOJA 1P01A 2I6QA 1GDQA 3T27A 1WTGH 3P8OA 3AVZA 1D6WA 1W2KH 4GAWA 5A09A 3RXVA 1BTWA 1BOQA 1HXEH 1V2PT 4ISHH 1RRKA 3A89A 2VIVA 1UCYK 2ZPQA 3DFJA 1H8DH 3DCLA 4JYTA 2LPRA 2ZG0H 1P11E 4ABGA 4YT7H 1DDJA 2ZDLA 4WMEA 2FI3E 1QY6A 3DFLA 1QIXB 3BG4B 2C8WB 2Z3CA 2BOHB 2JH6D 2TIOA 5DJ7A 4MNYA 1ZGVA 2WHXA 8KME2 2A31A 5C0TA 3PTNA 2SGAA 2F9OA 3SV8A 4MVNA 4YM9A 1HAGE 4A7IB 1SVPA 2W3IA 3NUMA 4Q63A 4F55A 2WPJS 1HXFH 3S7KB 5EJZA 1BTPA 1OWJA 1GCDA 1K1PA 5DO4H 1TLDA 4X8UH 1IQHA 1YCPM 1BUIA 1N8OB 4FVDA 4K2YA 1COWD 1O2XA 2ZWLH 2EY4C 2O8UA 1DUAA 1GGDC 4I8JA 1HJAC 3BTGE 1D3DB 3DSPA 1WDIA 5IYTA 1OWEA 3OYPA 1AU8A 2C8XB 5E2OA 1AQ7A 5EXLA 4AOQA 1B0EA 4E05H 3GY5A 1G36A 1FY5A 1WCZA 4IN1A 4Q4LA 1C5OH 4Q80A 4B1TA 2ZU2A 3SGAE 2ZPSA 2BZ6H 3HGPA 1MQ5A 3DSGA 3GY2A 2TGTA 3UNSA 3PWBA 3T26A 2BD4A 1F0SA 1GMHF 1QB1A 1VITF 1MCVA 2VIWA 2A5AA 2XW9A 5J4SA 2SGPE 1Y8TA 2EI7A 1G3BA 1WBGB 3GY4A 1PPEE 2TGPZ 1D4PB 2XNIA 3A86A 1NO9H 1PYTD 2WPLS 1XUIA 4JYUH 3Q3KA 2XBWA 4ASHA 2SGFE 4K8YA 2WUBA 1EB2A 2BVSH 1SQTA 1QB6A 5B6LA 1V2WT 4CRDA 8LPRA 3FOAA 2IJD1 3PROA 1BQYA 3MO3A 2ZHQH 3U8OH 4SGBE 3P8NA 1KLTA 1C5QA 4IMQA 1LPZB 1H8HD 4NZLA 5A8ZA 1WXRA 3CS0A 1UTPA 1GMCF 1V2MT 1HGTH 3GICB 3F0PA 5T6DA 1GJ4H 1FDPA 1G2LA 3I77A 2XWBI 3UR6A 1H4WA 1TQ0B 2J4IA 5LPEA 1GJ6A 1C9PA 3STIA 2UWOA 3ODFA 4DCDA 1P05A 5CDFE 5TJXA 4MQAA 4VGCB 3U1IB 1JXPA 5LPRA 1IQIA 4FUJA 1SHHB 3NRLA 2PV9B 1FXYA 2FPZA 3A8CA 2BMGB 1O2GH 2R3UA 2GTBA 4MPWA 4X6MA 3KNXA 1UTMA 2A7JA 2A0QB 3KCGH 1BBRH 3JZ2B 4X6NA 1UTOA 3PWCA 2VWMA 5C67A 1QCPA 2LIZA 1Z7KA 4OS7A 3ZVBA 2GMTB 1IOEA 3MU4A 1TMTH 1UW7A 1EJMA 4MDSA 2AMDA 3SZNA 1SL3A 2QE7D 2BD7A 1EJAA 4INKA 1MCTA 1PQ7A 2D1JA 4RN6A 3LGWA 5B6OA 1K1NA 3PV2A 5H4IB 3UY9A 1O3EA 2ZU3A 1IQKA 3LGIA 1FY8E 3HPTB 3V7TA 3RXUA 2W6JD 2KCAA 4HGCA 1A5IA 1PPHE 4LOYH 2A4QA 4A5TS 2B0FA 3VB4A 2LELA 2W6ID 2ZFFH 2BY9X 2V7QD 2TBSA 2IOTA 5FPYA 4YESB 1TGBA 1XMNB 1QURH 3RXSA 2GV7A 3F2FA 4CREA 3RMOH 4ZKNU 2WINI 1SGEE 4JZDH 1TOMH 3SJKA 4AYYB 3TGIE 1MTWA 1MKXH 1QBOA 1W12U 2ZCLP 5GDSH 3PB1E 1GG6B 1C5YB 1RD3B 2QXIA 3PO1C 4AC9A 1SLWB 4FU8A 2BYAX 3A7YA 5C94A 1GI1A 2HVYB 3IITA 4A1VA 1A4WH 1O2RA 2ZGBH 5KGOA 2P94A 3FP6E 4I7YH 1DWBH 4JK5A 4DGJA 1CGHA 3UR9A 2H9TH 4X2WA 1BB0B 1O32A 1S6FA 3SU4A 3RXFA 2BY7X 1MD7A 3K9XB 4GSOA 5LGOA 1C5PA 2C8YB 4NSVA 1SGIB 3RM2H 2KR7A 3T5FH 3GCOA 3AW1A 3SZEA 5DP6A 2OCVB 2ZDAH 1C5ZB 2FYRA 3EE0B 4P00A 4XBDA 5EPNA 3RC5A 4B6FA 1A61H 2A1DB 4B71A 2IJOB 3RUOA 2BM2A 3SJ9A 5FPSA 1YLDA 1QBNA 2G55A 1JOUB 1A3EH 1TE0A 3GDVA 2VIQA 1EP5A 1GI3A 1SMFE 3ATMA 3MMGA 2CK3D 3L6PA 3QTVH 5GXPA 1HAOH 1FY4A 4TSFD 2CF8H 2AYWA 1O2TA 1JMOH 1NZQH 1HAVB 2ZDKA 4KELA 1ZGIA 3B23B 1C1MA 1GMDF 1TBRH 3QUMP 4U30A 1SQOA 3UREA 2QF5A 1LQDB 2HGTH 2P3UB 3VB5A 7LPRA 1YYY1 2QA9E 1QBVH 2H5CA 4FOUC 2BLQA 4CRCA 4A92A 2IPQX 1LO6A 1ZRBA 1RTFB 1CT2E 3GY6A 1SSXA 1LPKB 1TNJA 1J17T 1QR3E 3RXCA 1O2SA 5F8XA 2SNVA 2OQ5A 3KN2A 2R3YA 1O33A 4SGAE 1SB1H 5ESTE 3GCHC 5HIZA 3M3VA 1JWTA 1SLUB 2FLBH 3P6ZB 1HAXB 1YLCA 3DUXH 3BG8A 5ESBA 1FZZA 5I46H 1SHYA 3SN8A 3RXHA 2JJ1D 1Z1IA 3M5MA 3UOUA 2HVXA 1C2FA 1TGCA 1PPBH 3NK8A 2J98A 5JBAS 1ZLRA 5KECA 2VU8E 2HPPH 3TK5A 2VGCB 2A4OA 1NFYA 3DA9B 1NS3A 1O38A 3ZVCA 1A0LA 3MH7A 2PP6A 3LDXH 4X2XA 2ALVA 1GI8B 1P2IA 1GBTA 2GJGA 3F9HA 1THSH 2FIRH 1P04A 2R0KA 1Z8JB 1DWDH 2F9UA 1HJ9A 1EZUC 4BANB 3PTBA 4CBNA 1MMJN 4XRNA 2XC0A 5EXNA 2EI8A 3UB0A 2D26C 5DG6A 1TWXB 5A8YA 1XUFA 1PPFE 1TX6A 4CH2B 5EQRA 5GWZA 1Q31A 2CHAB 2B8OH 2NU0E 2ODPA 4K60A 4X6OA 1EATA 1K0HA 1DICA 4TWYA 1F92A 2GVFA 2OLGA 1A5GH 1E1QD 3ZVDA 3ZYEA 3U8RH 2CJIA 1C5TA 4Y0YE 1S82A 1TIOA 2VH6A 1YGCH 1EFRD 1FPCH 4WMDA 1UTLM 2FOBA 1O35A 1NRQH 4ACAA 2O8TA 4WMFA 8GCHF 4Y11E 5A8XA 2FS8A 1DLKB 1WUNH 4FUFA 2D8WA 4ZROA 1V2UT 2SGDE 1FNIA 1P03A 3PRBA 5BRRE 1O5FH 2PKSC 2OQUA 1MBQA 1WU1A 2BLVA 2WYJA 3SV9A 1SGTA 1VCQA 1H9LB 4NIXA 2XBXA 3ZV8A 4BNRA 3RM0H 1TMUH 2L6OA 1QA7A 1C1PA 3MU1A 2GDEH 5T3HA 2J98B 3A7TA 4Y71A 1LKBA 3RXBA 4BTTB 1QTFA 3D62A 1ZHMA 2Y5GA 1W0KD 3F0OA 3MYWA 3RP2A 2BY5X 1LHEH 5C1UA 2YOLA 1GBMA 2K8IA 2BD3A 3LOXA 1IHTH 5CHAB 2FOCA 1ELBA 1WQVH 3ATWA 2AEIH 1O3LA 2UUKB 2Y80A 4JMYA 1TALA 4IGDA 3HGNA 4NA7A 1HAHH 1K21H 1SPJA 1HRTH 3Q77A 1KXDA 3E0NB 1O3OA 4DIIH 1UVUH 2VVCA 3SU0A 1QGFA 1DANH 1XVOA 1BA8B 1UO6A 4J2YB 4A1TA 1C5UA 1V2TT 2JETB 2Q1JA 2ZEBA 5FCKA 1YCPK 2BQ6B 4RKOB 1RIWB 1O2PA 1EAIA 4NA8A 3S9AA 2QXJA 4KTSA 4HI3A 1SGNE 1RFNA 1G32B 4NCYA 3PRDA 1KIGH 5EQSA 3BEFB 4MNXA 2W7UA 4YO9A 1AUTC 9ESTA 1EASA 2G4TA 2Q6FA 2J94A 2NWNA 1O2LA 1Z6EA 1Z8IB 2ODQA 1EZXC 6GCHF 1YP9A 2ZGHA 1WTHD 1TQ7B 2GCHF 2VJ1A 1O2UA 1MZAA 2PR3A 4JCNA 1C2HA 4CRGA 2XTTB 5HIYA 4D9QA 3M3SA 1TABE 1ZJKA 1GHBG 1FI8A 1NT1A 2KCPA 4WF8A 4X2VA 1BHXF 1HNEE 1T4UH 3QO6A 1O2VA 1QL8A 1O3JA 6CHAC 3MU8A 2RA0A 3LONA 1AI8H 4ZHLU 2Y6TA 4NIWA 1SOZA 1C5LH 1OWIA 2BDHA 5DP8A 4X2YA 3SNDA 1CE5A 1SFIA 5GIBA 4UE7H 3T2NA 5F6MA 3SNEA 1YPHC 4ZCNA 3ZZ4A 1OP2A 4YT6H 1BITA 2C3SA 4UD9H 3UNQA 1X7AC 1AB9B 2VVUA 4X8VH 1ZPCA 3GY7A 1BDAA 4XE4A 4THNH 2ZC9H 4WWYA 1ELAA 1TNLA 2Z94A 3N7DA 2KM0A 1S5SA 2ZZUH 2Q6DA 2A32A 2YMSC 1SGFA 1UVPA 3VB3A 3BEIB 3TJUA 3M5LA 2BDYA 2QXHA 1WSSH 1O36A 1VZQH 2ZTZA 3MNXA 3N7EA 3RXGA 1UCYE 1O3PB 1C1UH 1TA2A 2OC0A 4ABFA 2R2MB 1T4VH 1P2QA 1T8LA 1V2RT 1P57B 3UPEA 1C1OA 3CENA 3FKSD 1EAXA 1SGQE 2ZFRH 4GCHF 1A46H 1ABIH 3A88A 4D8NA 2QY0B 3M7TA 3E3TA 4YLQH 3LGYA 1AVGH 2OK5A 1CU1A 1Z8RA 2QV1A 5C20A 3UOPA 3SW2B 2F3CE 1FAKH 1PPZA 4D9RA 2C90B 4LZ4B 3KQDA 4ZUHA 1O5GH 1O2JA 3SV6A 1VCWA 3SQHE 1J8AA 2GZ9A 1H8ED 1OXGA 4UFEH 5FXLA 1AVWA 1CBWB 1KXBA 3GYMA 4YXWD 1PJPA 2CMYA 2QGRA 4KTUA 1S0QA 2K0QA 2BD5A 4JZEH 1LVMA 3O8DA 2HOBA 1HAIH 1K28D 1DUEA 2ZF0H 4ABEA 3RLWH 3FO8D 2BHGA 1O5EH 2Z3DA 1P2KA 3P95A 1GDNA 1EXFA 1GI7B 3IWMA 3CS7A 2WUCA 3VEQB 1C4V2 1TAWA 3ZZ8A 1GJ9B 1A3BH 1E38B 1NRSH 2ZU4A 3PLBA 3UQOA 1ELFA 2CXVA 1KXFA 1E36B 1FN6A 1MABB 2B5TB 2A7HA 3KF2A 1F2SE 1VGCB 4BXSA 2PGBB 3QN7A 5K7RA 4AZ2B 1SR5C 4XBCA 4B73A 1MQ6A 3F2HA 3SU6A 1BMLA 1Y3XA 3RXEA 3E6PH 5DP3A 1LMWB 3RXQA 1F0TA 1OOKB 2Z9KA 4OGXA 3RXDA 4U01A 1ZSJA 1BTZA 4AFQA 3RU4D 3RXMA 2GT8A 3JZ1B 3G01A 3L3TA 1K1LA 5DSFA 2QC2A 1ARCA 2P8OB 3LT3A 4HTCH 3V13A 1SGFG 4ACBA 2OC7A 1ZMJA 2PUQH 3MU0A 3U8TH 2ZECA 1NRPH 3P70B 1TNGA 1BMAA 1BTUA 3BTKE 1GBKA 4A6LA 5F53A 5EQQA 2CF9H 3RMNH 4AFUA 1NM6A 1P06A 1MAYA 4ZHMU 3EBNA 5HKKD 1HIAA 4OS4A 4AGJA 1CT0E 3KEEA 3EA9A 4JYVH 2F9NA 5GJ4B 1NY22 1SQRA 1TGTA 3DD2H 1ESBA 1V2NT 1GJ8B 3KGPA 3IG6B 1G30B 3GDSA 1GJ5H 1K1JA 3E91A 2QXGA 2WPHS 1QL9A 3EYDA 5HM9A 1DOJA 1E35B 1ORFA 1HJAB 2VVVA 1NPMA 1EAUA 4OS1A 4IC5A 4K3JA 1BRAA 1V2JT 5L30H 3SUGA 1C2KA 5AHGH 1TGNA 3SUFA 3R3GB 1YPKH 1FJSA 2XWAA 1IHSH 1XUKA 3KIDU 4KGAA 3EA8A 1FY1A 1TBQH 3QGNB 2RFKC 1J15A 1L4DA 5FX5A 1Y5UT 7ESTE 1H1BA 1VITG 1PPCE 2EI6A 2IN2A 3HK3B 3U98H 1QQ4A 3ZIAD 1K9OE 3BTFE 1P8VC 1OSSA 2XCFA 5T6GA 3RXOA 2SGQE 2ULLA 1BIOA 1NESE 1OP8A 3MTYA 2GV6A 1DE7H 1YPHE 1HDTH 2GCTC 4BAOB 2QN5T 1K1IA 1Z6JH 2NU3E 3SGBE 3MWIU 2NU1E 1DXPA 3M37A 4O03A 1CHOF 2SGEE 3MO6A 3SU2A 5AFYH 1C2DA 1QJ7B 1SGCA 1RXPA 1GI5A 4HG6A 1ZOMA 1CO7E 1JIRA 2VINA 1AUJA 2V3MA 2VWLA 1GMCG 4CHAC 1DFPA 2FOHA 3SNAA 3BTDE 1NTPA 4RT1A 3SI4H 2PKAA 4U32A 2JKHA 1GBCA 1CQQA 3OX7U 1GI4A 5TCCA 1L1GA 1GJCB 3C1KA 4FVBA 1UMAH 2JIZD 5DKMA 3ZVAA 5C1YA 1O34A 4CRAA 4DJZB 3H09A 5J4QA 5JBCS 1C4U2 1DY8A 1GG6C 1SFQB 4OM9A 1GBAA 1GWAA 1TRYA 1V2OT 4WH8A 1AD8H 1IQEA 3PLKA 5T6FA 1Y5BT 2HWLB 1FONA 4I8KA 4X1SU 4Q7XA 4B2BA 3QZRA 3PV4A 3GCTF 2AGIX 2F9VA 2M5TA 5GCHF 2V3HH 3ENSB 3W94A 2ZFSA 3HKJB 1EZSC 5F8TA 3W1EA 5C2ZA 3STJA 1E1RD 1AKSA 1IQGA 1SGDE 2P16A 1O3MA 4OS2A 2ZGXH 1AVXA 5E2PA 1O2YA 4INLA 3V3MA 4LK4A 2TGAA 2UWLA 1GPZA 3LU9B 3AAVA 3UFAA 1HAPH 1A1RA 3TH4H 1GBJA 1CVWH 3URCA 2PLXA 2BB4A 1AFQB 4FETA 1TX7A 4FUBA 1PQAA 1TNKA 3RXJA 3TK6A 4ABHA 2PW8H 1HPGA 4TWWA 3E0PB 1FN8A 1HAYB 4BAMB 2FI5E 4RT0A 3B8JA 5FL7D 2RA3A 1QFKH 1N1LA 3W95A 2VWOA 4FXGH 1LHCH 1MTSA 3TPIZ 4MG3A 3TITA 2OP9A 1O2MA 3NWUA 2Y5FA 1O3KA 2RDEA 1O5BB 1GI0A 1S0RA 1VITH 4GHQA 3SYJA 3O8RA 1ESAA 1SLXB 2ILNA 3MNBA 3VXEH 4LXBH 1FPHH 4YZUA 1C2LA 4E7RG 5L2YH 1DT2A 1Y3WA 2EA3A 1C2GA 2ZCHP 4Y7AA 2P95A 3ZZ3A 3FP7E 1QL7A 3BF6H 4P02A 1MKXK 4CBOA 1NC6A 3R0FA 5FCRA 3RXIA 2GZ8A 4I33A 4BAHB 2BOKA 1SLVB 1AHTH 1GHXH 3M5OA 1GBDA 1GBIA 1MKWK 3PO1B 5CE1A 8ESTE 3MNCA 3Q00A 4LZ1H 1FV9A 2KAIA 5FAHA 1GHYH 3LC5A 1T8NA 3E8LA 2G8TA 1EOLA 1HFDA 3LIWA 4DG4A 3Q3XA 1C1TA 1FMGA 2ZCKP 2XC4A 1GL1A 2Y82A 1O5CB 5L2ZH 1G9IE 3F2GA 5DP9A 2BY6X 3H7OA 1KXAA 4I32A 3EGKH 3OEHD 1GI9B 1KSNA 1VJAU 1P3EA 2VGCC 1G3CA 1YWUA 2ZQ1A 1VJ9U 1LVYA 1O3GA 1TPOA 4Y76A 3VXFH 4ESTE 2R0LA 2P59A 1W8BH
chains in the Genus database with same CATH topology
1HBTH 1CA0C 1S85A 1AN1E 1GHVH 1GI2A 2EC9H 2ANWA 1UVSH 1ZZZA 5LH8A 1NRNH 1K1MA 1T8OA 2ANMH 5F8ZA 3A85A 3BTTE 2PTNA 4ABJA 3AASA 3LJJA 3V12A 1V3XA 4Y7BA 4OS6A 1OS8A 1NN6A 4MTBA 1IQLA 2CHAC 2ZGCA 2YNAA 2K1QA 2QCYA 4IC6A 2XBVA 4ISOA 2FM2A 2ZO3H 2JH0D 3GOVB 3ITIA 1A2CH 4WY3A 3VFEA 4KKDA 5AFZH 3UWJH 1QQUA 1G2MA 1EZQA 3U1JB 4NFEA 4R8TB 2CV3A 1SQAA 2FESH 1P2NA 2A7CA 1DM4B 1MTNB 4JZIA 2UUYA 4ZXXH 3WY8A 3GYLB 4YTAA 4DVAU 2FX6A 1FUJA 2VIDA 1YF4A 3NXPA 1G37A 1O3BA 2FO9A 5E0HA 3SU3A 1OWKA 1THPB 2IPHA 2Z9LA 3GISB 3SOSA 5C1XA 3QDZB 4K5ZA 7GCHF 3ATLA 3RC6A 1E34B 2HRVA 4F4OC 1B0FA 2AIQA 5A0AE 1ANEA 1ZJDA 1CT4E 1MTUA 1MU8B 1C5XB 1QB9A 4MNVA 1TYNA 4D7GA 1WOFA 5JB9S 2DE8A 4CR5A 1XUJA 1BRBE 4TYDA 1OYQA 3RXTA 2FI4E 5A2MH 1V2QT 1ZSKA 3UWIA 4GPGA 2FYQA 1AY6H 5CHAC 3UNRA 3ZVGA 1G3EA 2FWWA 2UUFB 1CA8B 4ZKOU 2PUXB 2A2QH 2A4GA 4IN2A 1XKAC 2QF3A 5DGJA 1KY9A 2FOMB 4BAKB 2AMPA 2FS9A 3LKWA 1LPGB 3SJ8A 3TVJB 4ABIA 2H5DA 1ANCA 2C8ZB 1GHWH 5L6NH 3BTME 2CGAA 1KXEA 2AERH 2D2DA 3FVFB 5HYOA 1DX5M 5CMXH 1D9IA 2XRCA 2FOEA 3GY3A 2XYAA 4Q7ZA 8GCHG 1SBWA 4YOIA 5E0GA 2FOFA 4ZMAH 1FIWA 6ESTA 2Z9GA 3FANA 1TNHA 3OTJE 5IDKA 2Z9IA 1KYNA 5E0JA 1ELGA 1ZHRA 2OD3B 1ELEE 4DOQA 1IQJA 1H9IE 2PHBA 1LTOA 3BTQE 4OGYA 1ELDE 3MI4A 1S84A 2ZHFH 1TFXA 2TGDA 1GCTC 5JBBS 3EQ0H 4ISIH 1O3IA 2DUCA 4MPUA 2AGGX 4IBLH 1C1VH 1Z1JA 1P2OA 2ZFPH 1FAXA 3TJVA 3EDXB 4R0IA 1HYLA 1E0FD 2HNTE 3PMHB 3LC3A 1AO5A 1QRWA 1YPEH 4AORA 1T8MA 1EPTA 1YC0A 4F49A 1C9TA 1EX3A 2GZ7A 1GVZA 1P3CA 3RXKA 1VCPA 1AB9C 2FP7B 1SC8U 2ZIQH 4JK6A 3M5NA 2BZAA 1SI5H 4YOGA 2XC5A 1NFXA 1LHFH 4X1QU 4TY6A 2BLWA 2TPIZ 4A1XA 3TH3H 1XKBC 1ABJH 1MUEB 1YKTA 2ASUB 1ESTA 3NPSA 1M9UA 1EPTC 4BTIB 1C2JA 4M7GA 1N6XA 3LPRA 2FXRA 3QZQA 1BHXB 2BTCE 1PYTC 1D3PB 3F9EA 1C5WB 3ODDA 4B2CA 2J95A 1UTNA 1HLTH 2XCNA 4GLYA 6GCHG 2V35A 1FLEE 1WAYB 2O9QA 1A0JA 3A80A 3SGQE 3SU1A 2GCHG 1AMHA 1XX9A 1L1NA 1YPJH 2BDBA 1QJ1B 1ZTLA 1IQFA 1O31A 1BRUP 1Z71A 3SQEE 2ZDMA 1UK2A 2F9PA 3OY5U 4ZKSU 1DITH 1V2VT 3LGTA 2ANYA 2ZFQH 1GJBB 4YLUA 4AFSA 2RCEA 5EOKA 5SGAE 1UCYH 4UONA 4AX9H 1A5HA 1QA0A 1KTSB 4H6TA 1TA6A 5JBTA 4UFFH 2J92A 3BG4C 5JB8S 1N6YA 2ZTYA 1CGJE 5ABWA 2GP9B 1SOTA 1CSOE 1DSUA 3VGCB 1T32A 2ZA5A 1ELVA 1Y3YA 4IW4E 3BIVH 4Y79A 1NU7B 1PQ8A 1YPLH 2O8MA 3M3TA 1TMBH 4ABDA 2FLRH 1ZMNA 2BLOA 3SNBA 1UK3A 3RXRA 2Y81A 3MO9A 3OY6U 1OKXA 4Q2KA 1AIXH 1N8OC 3VPKA 4FUDA 3M7UA 4UFDH 4I8GA 1O2HA 1GHAG 1RGQA 3TJOA 3MU5A 4TPYA 1OP0A 1DY9A 4CH8B 3A8AA 1C2IA 1OWDA 4O97A 3NCLA 2GGVB 1O3FA 5DP4A 5EW1H 4GCHG 2LNCA 1QRXA 1PPGE 3FP8E 1MBMA 2BQWB 2P8OC 4UEHH 3KQEA 4XBBA 1V6DA 1RTLA 4NA9H 1XM1A 1MTVA 2BDCA 2H6MA 4INHA 5I25A 2HALA 1W10U 2G4UA 4CR9A 3T28A 1PFXC 2BDAA 2RDLA 3FAOA 3A7VA 3I78A 3LJOA 1C1NA 4ZKRU 4X8TH 1E37B 4ABAA 4X6PA 3TJNA 2ZHDA 4WXVA 1LQEA 2FTMA 2ODYB 2VH0A 1O2NA 5DP7A 5DK1A 1V2KT 2UUJB 1HV7A 1DXWA 2OINA 1MH0A 3E90B 2A4RA 2ZTXA 1W0ZU 4DURA 1H8IH 2ESTE 1K22H 1BTYA 4FUGA 1SGRE 3M36A 1HAZB 1O3DA 1DWEH 3RMMH 1GBEA 1INCA 3NZIA 3KHVA 2BDGA 4FUIA 4NWLA 1SG8B 4IS5A 2FODA 1Q2WA 1ETRH 2OBOA 1GI6A 1O39A 3ZZBA 1GJ7B 3SUEA 2R9PA 3M35A 1O2ZA 3B9FH 1RS0A 1TBZH 3AAUA 1GJDB 4AFZA 4AG2A 1LVBA 2A2XH 1GGDB 1KLJH 2V0BA 4VGCC 3S7HB 2O8LA 4TY7A 4NFFA 3ATKA 2FTLE 1ELCA 4X1RU 3UUZA 2Z9JA 1P2JA 3DHKH 4WXIA 5GPIB 3RU4E 1MD8A 3SUDA 4ZAEA 3BTWE 1Z8GA 1GMHG 1ZTJA 2C4FH 3ZVFA 1TONA 3ZZ5A 2C93B 2BD9A 5JDUB 1O30A 1HB0B 1LKAA 2F9BH 2A5IA 4Y0ZE 3ZZAA 3PMBB 3MFJA 2P3FH 2GMTC 1ZPZA 1GDUA 4BTUB 3VB6A 4FUCA 5FBIA 5HXFA 3F9GA 1DLEA 2WV4A 1BZXE 2WYGA 9LPRA 3A83A 4FU9A 1P09A 3PLPA 2HLCA 3BTEE 3S9BA 1O0DH 5A0CA 3V0XA 2A45B 4GHTA 4YOJA 1QNJA 4AG1A 3P8GA 1O3NA 1BTXA 3RMLH 3SBKA 3D23A 5DPAA 2BVRH 3PM3A 1SGPE 3N7OA 5FPTA 1HUTH 4Y10E 1XUHA 1BJUA 3FFGA 2BY8X 2H1UA 5C5OA 1EP6A 2ZP0H 1XXFA 5AVDA 4DIHH 2ZNKH 5E8EH 3TLOA 1F0UA 1BRCE 1TX8A 1F5RA 1QRZA 5G4BA 1HJ8A 3K2UA 1LCYA 4Y6DA 1HIAB 2ZDVH 3QWCH 1LDTT 4J1YA 1O3AA 1BBRE 2G00A 2SNWA 1BMMH 3RU4T 4AYVB 5EXMA 1WYKA 4ABBA 5C3NA 2ALPA 2G51A 1CGIE 4FUEA 3S9CA 1AE5A 4ZHAA 1ZYOA 4NG9H 2ZU5A 5K0HA 2STAE 1AFQC 1W0YH 2GCTB 4I8LA 3RXLA 4DW2U 4H4FA 2NU4E 2G5NA 1EAWA 3PMAB 1O2KA 2V6NA 2BXTH 2STBE 1IQMA 5EG4A 3SI3H 2OTVA 1CHOG 1H9HE 5TCAA 3QX5H 3FZZA 3MH4A 1S83A 1EKBB 1L4ZA 1CHGA 1W3CA 3A7ZA 1G3DA 1BBRK 2THFB 2ZU1A 1TPAE 1C5VA 3QTOH 4BOHA 1WQSA 1P0SH 3S69A 3S0NA 4CHAB 2WV5A 1HAVA 5EGMA 4BXWA 2JH5D 1GVKB 1UVTH 3E16B 4E06H 1TRMA 1YBWA 2WPKS 2OXSA 3TK9A 3QGJA 4AGKA 1UTJA 1XXDA 3P92A 4Z6AH 2EEKA 1MU6B 4K1EA 4X1NU 3ZV9A 1S6HA 3KQCA 4ISLA 4GVUA 4FUHA 4X0WU 1HCGA 4K69A 1KXCA 1B5GH 3TGKE 1TB6H 1MKWH 1NRRH 3ZZCA 4KP0A 1LVOA 1THRH 2W3KA 3E1XB 3GCTG 3P17H 4PROA 1KDQA 2FMJA 2PKAB 3SJIA 1LHDH 1O5AB 5GCHG 4NWKA 2A5KA 2WPMS 2QIQA 1EJNA 4RKJB 1OPHB 4GUXA 2Z3EA 1A0HB 1W11U 3TIUA 1ID5H 1J14A 4NSYA 3F68H 1AWHB 2AFQB 4XFQA 3D65E 1W13U 1O3CA 3ATIA 2P3TB 2HPQH 5C5NA 1KTTB 3I29A 2PTCE 1JIMA 1GBHA 2FOGA 2QAAA 4O9VA 2HNTC 3A8BA 2OC8A 3F6UH 1BMNH 2H9EH 4MPXA 4K8BA 3T29A 2QF0A 2WPIS 1FY3A 3ZZ9A 1IQNA 1TPPA 1EUFA 1AKSB 2ZQ2A 1Y5AT 3A87A 4I31A 4HZHA 4NIVA 1C2MA 5FHTA 3ESTA 1B7XB 3FZDA 3BV9B 4XSKU 3A7WA 5FBEA 3UIRA 4UFGH 4CRBA 2PSXA 4B74A 4B75A 2HNTF 4O3TA 4Z0KA 2GT7A 1D3QB 4QT8C 1Y3VA 1BT7A 4MPVA 2AIPA 2PGQB 2PWXA 4BAQB 1MTNC 3ELAH 3SHCH 1UK4A 2Z7FE 1ZR0A 3A81A 1Y59T 2O8WA 1DS2E 3BN9A 1F5LA 4MLFB 3K65B 1GMDG 1KDQB 3A7XA 4K1SA 2CN0H 5FX6A 4TPIZ 3K6ZA 2VIOA 3HK6B 4JZ1A 4XDEA 4X1PU 1UJ1A 1C1QA 3O8BA 2P93A 1L0ZA 1VR1H 2GKVE 2Q6GA 2G52A 1GBBA 1C5RA 1EB1H 5AF9H 1QHRB 1T31A 1NROH 1JRTA 3LH1A 3KQBA 3MOCA 1C1RA 3U69H 5A0BA 1QJ6B 1ZHPA 1GHZA 3ZZ6A 2Y7ZA 2RG3A 4OS5A 2KAIB 1YPGH 1ARBA 2Z6BD 2ZHEH 3GCHB 1CA0B 3T25A 2I6SA 5DP5A 4Y8ZA 4ZH8A 1ZTKA 2ZHWH 3RLYH 5JPMH 1T7CA 3MNSA 4Y8YA 1DWCH 3OSYA 1P2MA 3RDZA 1GBFA 1NFWA 1FIZA 1DPOA 1OX1A 3RXAA 3EA7A 5PTPA 2ZI2H 3TU7H 1P9SA 4UDWH 1RTKA 1TGSZ 1U6QA 2F83A 1K1OA 3GCNA 4MNWA 3M7QA 1OWHA 1YPMH 1O2IA 1O3HA 3QLPH 3PYHA 1UTQA 1V2ST 3LH3A 1P10A 3SHAH 2BD8A 3SO3A 2SFAA 2J34A 2BX4A 1AWFH 2J2UA 2AGEX 2ZPRA 3ZYDA 1LHGH 2OBQA 2VNTA 3T62A 4AN7A 1J16A 2B7DH 3BTHE 1MZDA 1J9CH 2Y5HA 3TGJE 4D76A 1O2WA 3HATH 1BJVA 1GVLA 2J9NA 3EAJA 2FX4A 5EW2H 2NU2E 1ELTA 1ZPBA 4H6SB 4Y8XA 1TOCB 4AB9A 7GCHG 7KMEH 2JETC 2V3OH 1TPSA 3H5CB 1ZRKA 4X8SH 1UHBA 5LPFA 1YCPH 1RIWC 3PMJA 3GY8A 1AGJA 5EODA 2G5VA 4B2AA 1S81A 1C5SA 2YNBA 1BTHH 3ZZDA 3RXPA 1JBUH 1F7ZA 5JYIA 1AZZA 4XOJA 3TNSA 1F0RA 1JRSA 5BPEA 1D6RA 3NKKA 1WV7H 2BD2A 2XBYA 1IAUA 2PKSB 1UTKA 4U2WA 1UVOA 2GD4B 3ZVEA 3SJOA 4IMZA 4NZQA 3SNCA 3H7TA 1KLIH 1NU9A 1YM0A 1GHBF 1ETTH 2J38A 1TNIA 3LGUA 2OC1A 1C5MD 3MHWU 3L33A 2AH4X 3O8CA 3SORA 2GX4A 2H2ZA 2FDAA 2OUAA 1EQ9A 5HMAA 1D3TB 2H9HA 4DT7B 2XXLA 1O2QA 4B76A 2ANKH 2Y7XA 4WJG2 4HFPB 4ZXYH 4AB8A 4CRFA 3UTUH 1C5NH 3A8DA 4KTCA 3F9FA 3A84A 1O37A 2ZGJA 2BVXH 3AW0A 3Q3YA 3BEUA 2AMQA 3QK1A 2ZKSA 1AZ8A 3A82A 1XUGA 3VB7A 1Q3XA 3TH2H 3U9AH 3P8FA 3SU5A 1O5DH 4K1TA 2VWNA 5HM2A 4WH6A 1C4Y2 2VB0A 3SV7A 1P02A 1L2EA 1UHBB 2DE9A 1AE8H 3ZZ7A 1BCUH 1O2OA 2G81E 1P9UA 3HKIB 1P12E 2UWPA 2K7XA 1F5KU 4D7FA 2F91A 2PSYA 1GCTB 2QYIA 3MH6A 2FOAA 1Y3UA 1SGYE 2BXUH 5EU8A 2FEQH 3SV2H 4FU7A 3GDUA 3OU0A 1FQ3A 1V2LT 3VGCC 4I8HA 2ZFTA 5ETXA 3TNTA 1W7GH 2BDIA 3BIUH 1K2I1 1NFUA 1A7SA 6LPRA 4JZFH 1ZSLA 1AFEH 1CBWC 3DT0H 1ANDA 4NGAH 1GJAB 3KL6A 1MAXA 1W14U 1W7XH 4ISNA 1GBLA 4H42U 3UQVA 1ACBE 6CHAB 1XVMA 1ANBA 2W5EA 3M61U 2GDDA 4DY7B 1GHAF 2FZZA 3URDA 1EPTB 1ZMLA 1OYTH 4RSPA 4E7NA 5HGGA 3D49H 3K6YA 2W7SA 1C2EA 2BQ7B 1RJXB 1DVAH 1PQ5A 2TRMA 1L1JA 3Q76A 2ZDNA 4WVPE 1TRNA 1C1WH 3MH5A 1VGCC 3RC4A 5EPYA 3BSQA 1C1SA 3CP7A 4Q7YA 1GL0E 2AS9A 2R2WU 1DSTA 3LGVA 5F03A 3C27B 3F1SB 2BX3A 2W26A 2B9LA 2PFEA 4NIYA 2VIPA 1ETSH 4O3UA 1EOJA 1P01A 2I6QA 1GDQA 3T27A 1WTGH 3P8OA 3AVZA 1D6WA 1W2KH 4GAWA 5A09A 3RXVA 1BTWA 1BOQA 1HXEH 1V2PT 4ISHH 1RRKA 3A89A 2VIVA 1UCYK 2ZPQA 3DFJA 1H8DH 4JYTA 2LPRA 2ZG0H 1P11E 4ABGA 4YT7H 1DDJA 2ZDLA 4WMEA 2FI3E 1QY6A 3DFLA 1QIXB 3BG4B 2C8WB 2Z3CA 2BOHB