1MTSA

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine proteinase
molecule keywords TRYPSIN
publication title Crystal structures of factor Xa specific inhibitors in complex with trypsin: structural grounds for inhibition of factor Xa and selectivity against thrombin.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtsA02
2YNAA 4ISOA 5EU8A 2ANMH 3M37A 2KAIA 3PLKA 1GBHA 1O3FA 1V2ST 4TWWA 3U1JB 2FOMB 4NIVA 2ZHWH 1GI9B 3HK6B 3SBKA 1ANDA 2VIQA 1A5GH 3M5NA 3W95A 4MNYA 3RXBA 1DDJA 1QL8A 2FOBA 4ABJA 1SB1H 2BDHA 1FMGA 5E0GA 3T5FH 1WQSA 1SG8B 2J95A 2D2DA 1TRYA 1UVOA 1SLXB 2FDAA 1DXWA 2GCHG 2VIPA 4K3JA 4AB9A 4X8TH 1EJMA 2Y7XA 5LGOA 1NY22 1O2XA 2PWXA 1GHXH 1D3TB 2V3OH 2FS8A 1CT0E 1BUIA 4IN2A 2P59A 3OSYA 5DGJA 1HAIH 1SGDE 3KQDA 4YT6H 3RXOA 3QTVH 1CA0B 2FYQA 4DY7B 1UK2A 3MI4A 3I78A 3DT0H 1GVZA 2PGBB 2CF8H 1LPKB 3M35A 5F8TA 4K1EA 2ZCHP 1DXPA 1BTXA 2EI6A 1P10A 1GI2A 1LVOA 1VCPA 1NFXA 1PPCE 2JH5D 2A4QA 1SC8U 4OGYA 1J17T 4KGAA 1XX9A 2GMTC 3P8OA 3RU4T 4O9VA 4Y6DA 1SLVB 4Z6AH 2CV3A 2BY6X 1CSOE 1O3GA 4JZEH 2IPHA 1ZPBA 3RDZA 1K2I1 2Z6BD 4E7RG 1O34A 1N6XA 4GAWA 2G00A 4BAOB 2GD4B 4IGDA 1LHGH 2O8LA 3TH4H 1QJ7B 1Y8TA 1DLEA 2GZ7A 5FX5A 2Z9IA 2XYAA 3M5MA 1YCPH 1F0SA 1K21H 2D8WA 1GBAA 4BXSA 1D6RA 1SBWA 2ZGJA 4AYYB 1EPTA 3V12A 4AZ2B 1GI3A 1KSNA 1BBRK 3SJ8A 4TPIZ 5FCRA 1G3DA 1S81A 1Y3YA 5DK1A 3ZVFA 1OP0A 1ANBA 3CS0A 1KXFA 1W3CA 5C5NA 5A0AE 1UTJA 1TAWA 3ZZ5A 3LGWA 5DP8A 2OUAA 1IHTH 2A4OA 3T62A 1AE8H 4BTUB 1A3EH 2GMTB 2J9NA 4BANB 4DVAU 1AGJA 3S0NA 1FY1A 1E36B 2VJ1A 4Y11E 1V2QT 4XDEA 1GJ7B 4DGJA 2QY0B 1EAXA 5H4IB 1SFIA 2ZF0H 2VGCC 4J1YA 1O2KA 2WUCA 1C2GA 4CR9A 3ZVBA 1HAZB 4ABBA 4JMYA 2WINI 1MTVA 5HM2A 4TY6A 3UNSA 5DP5A 2C8YB 4YO9A 4E05H 1XUIA 4B74A 1Q31A 3TLOA 1RTLA 1BBRH 1SR5C 2ULLA 3MFJA 2IOTA 4RN6A 1SQOA 1T8NA 3VXFH 1CT2E 1GBLA 1K1PA 1SGEE 2BVXH 1EZQA 5FPYA 1VZQH 1JIMA 2BQWB 1TABE 2ZTYA 2TGDA 1LCYA 1AUJA 1GL0E 2FOCA 2AFQB 3QTOH 1WTGH 1EKBB 3SNCA 1DUAA 1W2KH 1VCWA 2RCEA 2F3CE 1P2MA 1Y59T 2WUBA 1A46H 4DG4A 3TK5A 2J92A 1C2KA 2VGCB 5L6NH 2BY5X 2ZHDA 4GCHG 1MD7A 1Y3XA 4ABHA 1IQFA 1GHAF 1S83A 1KXBA 1TNHA 1HAPH 1DY9A 1QFKH 2QC2A 4MPXA 1SL3A 2HNTF 4X8VH 2R3YA 1GMDF 1P57B 3A8BA 3DFJA 1P09A 2XRCA 1XUJA 3RUOA 4X6MA 1T8LA 1K1OA 1W13U 1O2SA 4A1VA 1BMAA 2HGTH 2ZCKP 1GI0A 3RXFA 4U32A 1D6WA 3ZZBA 1RTKA 2Z7FE 3SOSA 3ZVEA 5EODA 3F6UH 1SMFE 2FOGA 2AH4X 5ESTE 4ZKSU 2W3KA 1BOQA 5JYIA 2FZZA 4FUFA 1DICA 3MNBA 1GMCF 2ZQ1A 1ZTLA 3LC5A 1QIXB 1OP2A 1PPBH 4Q2KA 4UFEH 1EATA 2GDDA 3ZV9A 1XUKA 2GZ9A 2FOAA 2GTBA 3F1SB 1MTUA 5GJ4B 3ZV8A 1GGDC 4ISLA 1Z1IA 1P02A 5DKMA 3E3TA 3GCTG 4FUJA 3RXRA 5DP4A 1MQ5A 2ZDKA 1IQGA 1MH0A 2PHBA 3RLYH 3SU0A 5A09A 1Y3WA 1C1OA 3RXHA 2AIQA 1FPHH 3BTEE 1A7SA 3LIWA 4X2XA 8ESTE 3M3VA 1BMMH 2FOFA 2UWOA 3S9BA 2ZFSA 4MVNA 4K8BA 4GPGA 4I7YH 3UIRA 1YBWA 1V2LT 1ZTJA 3KCGH 1FY5A 3MNCA 1C4U2 1RS0A 5JB9S 3NXPA 2GCHF 2BZ6H 1XVOA 2XTTB 5A8ZA 4JK6A 3SN8A 2V3HH 1H9IE 3PV4A 1HFDA 2I6QA 3V13A 2V35A 1FUJA 1KTSB 4OS6A 3O8DA 1B0FA 4K1SA 1Z71A 2CN0H 1TNLA 2I6SA 1C2JA 1TX7A 2F9OA 3PMAB 1ELGA 2VWMA 1NU7B 1ZRBA 4YLQH 1GGDB 3BTKE 2OC8A 1C5QA 3M7TA 3P8NA 4LK4A 2ODQA 2UWPA 1O2GH 2BY9X 2W7SA 3TH3H 4DIIH 1QGFA 3ZVDA 1OYQA 3ELAH 3TJVA 4A1XA 4WVPE 2O9QA 1PPEE 2Y80A 1GJ8B 1DVAH 1LHEH 1MBMA 1T4UH 3SNEA 1SLWB 2H2ZA 2WV4A 3BIUH 1P11E 4GHTA 1V2KT 3TGJE 1BA8B 2OP9A 2NU3E 2W5EA 4WH8A 1GI6A 4O3UA 1NROH 1KY9A 5LH8A 3RXJA 3BG8A 1NRRH 4B2AA 1GBIA 2P94A 3U98H 3AASA 3L6PA 1KXCA 4AFUA 4D76A 4ABFA 1ORFA 1YKTA 3SGQE 2ZFRH 3B9FH 2VNTA 1ELFA 1EASA 2TGPZ 1ESBA 1NRQH 1RJXB 5LPRA 3LGIA 2ZU5A 1ABJH 1YLDA 3P92A 5JBAS 1O5AB 3ZZAA 1TGNA 8LPRA 2JH0D 4UFFH 5G4BA 1NN6A 1GBJA 2BD7A 4JK5A 1WUNH 1ELCA 2OC0A 3Q76A 8KME2 1EZUC 3EDXB 1G3BA 1O32A 1SOTA 3MNXA 4ZUHA 2J2UA 2OQ5A 3A80A 1C5NH 4F49A 1UTLM 1UVSH 1OWDA 3TJUA 4D8NA 5JB8S 2GDEH 1QBNA 3VXEH 3TK6A 4JZ1A 1H9LB 2P93A 2FO9A 2B9LA 2NU1E 3SV7A 2B7DH 1FXYA 4ZHAA 1F2SE 2C93B 1TRNA 5BPEA 2SNWA 1YPJH 4KTCA 2F9UA 1O35A 4Q80A 1YLCA 1DY8A 3TITA 1TYNA 1JXPA 2VWOA 1HAGE 4UEHH 1FLEE 1P9SA 1KTTB 5TCAA 1DE7H 1BTYA 3W94A 3UNRA 1DOJA 2CMYA 1RXPA 2OC1A 2ZPSA 5EXMA 2BD2A 1AN1E 1EAWA 2R0LA 5DPAA 1CVWH 2H9TH 1G2LA 1P3CA 2ZU1A 3SU2A 4AYVB 1Z8JB 2AMQA 1IQIA 2J4IA 1GHVH 2SGAA 3JZ1B 2UUYA 1Y5AT 2XBYA 1AD8H 2VIWA 1GHWH 4O3TA 2ALPA 4I8KA 3SJOA 1SGRE 1O2WA 3QK1A 1GI1A 1FV9A 1F0TA 5T6DA 3ZZDA 4M7GA 1JBUH 1QCPA 3EQ0H 4ISNA 1AE5A 1VJAU 3UFAA 1J9CH 3KN2A 2GGVB 1MMJN 2YOLA 3PMHB 3SUEA 4YOJA 2PUXB 2OTVA 1GJ5H 3QGJA 4GCHF 3LJOA 4A6LA 1DFPA 4CRGA 3U8TH 4Y76A 1ELVA 3RMMH 2PKAB 2WYGA 1LPGB 1UTOA 3GDSA 1V2UT 3DA9B 2O8TA 2THFB 3GCHB 1HAYB 2BQ6B 1UK3A 3RXAA 4MDSA 3DD2H 2HRVA 2A2XH 2TRMA 3ZZ6A 2OD3B 3PO1B 1MU8B 2Z9JA 1VITG 4DJZB 2BY7X 2J38A 1BRAA 4NGAH 2BHGA 4ABAA 1O37A 1P01A 2EA3A 3VB4A 4KTSA 2WPJS 1CHOG 3U69H 2WYJA 2UWLA 5A0BA 5HYOA 2D1JA 1A2CH 1O5EH 1Q3XA 4ESTE 2BD4A 2FEQH 1V2TT 5A0CA 2ZC9H 1AB9C 3A81A 1K1JA 1Y5BT 1C1WH 2EC9H 3RXIA 1V2PT 2A5KA 3UTUH 1UTKA 1LMWB 1SGCA 1V2MT 3Q3YA 3NPSA 3UR6A 2ZHQH 5DP6A 1O3NA 1OWHA 3GCTF 2H1UA 4NSYA 1DANH 4X1QU 1PYTD 1DSTA 2XNIA 1A5HA 1HXFH 4FUEA 3UOPA 5K0HA 1GWAA 2XC4A 4D9RA 2ODPA 3K6ZA 1AQ7A 1WV7H 4BAQB 4IC6A 1EPTC 2PKAA 4RKOB 1D3QB 2CGAA 3D49H 2NWNA 1QBOA 2H5CA 5AFZH 2AMDA 1GBDA 3BV9B 1K1IA 3RM2H 1HJAB 4JZIA 4D9QA 3KF2A 1T7CA 5EPYA 3HK3B 1W12U 7ESTE 2A5IA 1K22H 4INHA 1ESTA 3RXSA 3HKIB 3EA7A 4A7IB 2H6MA 3R3GB 4IMQA 1HGTH 1W11U 3QUMP 3GY3A 3H5CB 1C1TA 5B6OA 1WSSH 1K28D 2AYWA 3SGAE 4E06H 3KQEA 4LZ1H 5BRRE 2G5NA 2XC0A 2SNVA 2BOKA 4ABIA 1AB9B 3PYHA 3RXDA 1AZ8A 4UE7H 2PGQB 3TPIZ 4IC5A 1LHFH 4ZXYH 1GBFA 4NIXA 5K7RA 9LPRA 4ISHH 3P70B 1O3PB 1MAXA 4A1TA 3HGPA 3NKKA 3URDA 1TGCA 4FU8A 3KGPA 3A7TA 1NRNH 7LPRA 1QJ6B 1AMHA 3KIDU 1C5OH 2QYIA 1EPTB 3UPEA 2BLQA 9ESTA 2BOHB 4XSKU 1C4Y2 1V2RT 1VJ9U 1YCPK 2XCFA 3TIUA 2JETB 1THSH 1V3XA 4O03A 2BB4A 1C1RA 1SQTA 4KELA 1NPMA 1QRZA 5I25A 1W0ZU 1FZZA 1LKAA 5HXFA 1YPEH 3TJOA 4Y8XA 2AERH 2A7HA 2XW9A 2Q6DA 4HTCH 1QB9A 1TQ0B 3VB7A 4R0IA 1ZZZA 2QXJA 4CH2B 3F9HA 1ZMLA 3SU1A 1ZOMA 1HYLA 1YCPM 4GVUA 1CQQA 1CO7E 5IYTA 3SI3H 1CGJE 1CGHA 3QWCH 4XFQA 3BN9A 3EAJA 2ZU4A 2ZPRA 3UREA 3LPRA 4F4OC 2G5VA 2HALA 1X7AC 4KP0A 3A82A 1ZR0A 1PYTC 1G32B 1F5LA 4ISIH 2C8WB 3RXQA 1UJ1A 3SI4H 3BEUA 4E7NA 1QL7A 3K65B 4GSOA 4MPWA 3S9CA 3QN7A 4Q7XA 1IOEA 1O2ZA 5PTPA 1FY4A 1NFWA 1J15A 5FXLA 1S84A 2A5AA 1EXFA 1O3HA 1N6YA 2BM2A 2Z3DA 4ZKNU 4YESB 1EJAA 1LO6A 5C2ZA 1Z8GA 5EOKA 1DM4B 3UNQA 3WY8A 1OS8A 2BYAX 2F9PA 3GCNA 2ZTXA 1E35B 3SJ9A 1W10U 2FODA 1XMNB 1TBZH 4X2VA 1GDQA 2W3IA 1T4VH 1BTHH 1AVWA 1C5TA 3F9EA 3RXVA 4AFQA 4OS5A 1EX3A 1DWCH 3F9GA 1C1PA 3BF6H 4R8TB 3GICB 3TH2H 2EI7A 4CRAA 3I77A 5CE1A 2PFEA 3BTTE 1C5RA 1ZRKA 1LDTT 1A3BH 3ODFA 4B2BA 4BTTB 1O2JA 2ZDLA 1DSUA 1TPPA 1CHGA 3PMBB 3LGVA 4RKJB 4K1TA 4WY3A 1FAXA 1TWXB 1A5IA 2PSYA 2BDAA 2VB0A 4YLUA 4D7GA 1G2MA 1O3OA 2GP9B 1VITH 1PQAA 4VGCC 1W14U 7KMEH 2Z3EA 2F91A 1YPHC 5AVDA 2QXHA 2M5TA 2RG3A 2ZIQH 4WMDA 3TNTA 3MHWU 1VITF 7GCHG 1NTPA 2TBSA 1ANEA 1O2LA 4FUGA 5AFYH 4IMZA 4NSVA 1CHOF 1ZTKA 2FLBH 3KQBA 3SGBE 3T25A 4K69A 4U01A 3NCLA 4AG1A 1HLTH 3A89A 3BSQA 4NIYA 3VB3A 2OQUA 3E16B 1ABIH 3PWBA 2GX4A 2QXGA 1O2HA 3OY5U 4ABGA 2WPKS 1EAIA 2ZQ2A 4NWKA 1O3JA 4HZHA 3T26A 1AWHB 1UMAH 2QXIA 4YT7H 3FP6E 2BX3A 4FUDA 1DWEH 2VH6A 1H4WA 1SSXA 4J2YB 1OP8A 2GV7A 3MU0A 3RC4A 2OLGA 4FUIA 1NFYA 1MBQA 3RXKA 2C3SA 1O2VA 2FP7B 4BOHA 2VVUA 2WPHS 1GPZA 1O39A 1RRKA 1LVBA 1QA0A 1O33A 2C4FH 5C3NA 1E38B 1THPB 3ENSB 1YPKH 3FZDA 1O3EA 4CHAC 2HVXA 4DW2U 4NZLA 5SGAE 2JH6D 3Q77A 4VGCB 4B73A 1W7GH 1AI8H 1AVXA 1QHRB 1K1LA 1GHYH 3SU5A 3RC5A 1HNEE 4H4FA 5FHTA 1GJDB 3MU4A 4IW4E 1P9UA 2OC7A 2O8MA 1UVUH 1WAYB 4Q7YA 3SHAH 1PQ7A 1BIOA 1TALA 1C5YB 1JMOH 4BAMB 2H9EH 1BRBE 4FXGH 1XKAC 1GCTC 4BNRA 2V6NA 4WXVA 4XOJA 1T31A 2GZ8A 1LVMA 1TOMH 1NS3A 2Y5GA 3D65E 3U8OH 3A7YA 4UFGH 2ZI2H 3GDUA 8GCHG 2SGFE 3E1XB 2F9BH 1AUTC 5E0HA 4OS1A 2C90B 2ZU3A 2ZFPH 1EZSC 4XE4A 3PROA 1CT4E 3VEQB 4Y71A 3SJKA 2WPIS 4CHAB 2IJOB 1G3CA 3RC6A 1E34B 1SHHB 5EQQA 4FU7A 2VIOA 1GDNA 1GBEA 3M3SA 1PPFE 2C8ZB 2UUJB 1YC0A 2G4TA 4WF8A 2XBWA 4I31A 3LKWA 3ZZ7A 2BVRH 1GJ9B 2VIDA 3PTBA 2HWLB 2R0KA 1P12E 3D23A 1SGTA 4K2YA 2A0QB 3ZZ3A 5GDSH 1MKWH 4CREA 5DJ7A 3SUDA 2OBQA 1C1NA 1CA8B 1L2EA 1FQ3A 1BB0B 2ZCLP 3S7HB 3MNSA 1GCTB 3SQEE 1TE0A 1UTQA 5EQRA 1C1UH 1NRSH 1HUTH 1LHCH 3LU9B 2FM2A 3AAUA 4NFEA 1G36A 4Y0YE 2BTCE 1BMLA 1HRTH 3BIVH 2Q6FA 5ESBA 2GCTB 3VPKA 4YTAA 5EQSA 1BT7A 2ALVA 5C67A 2H5DA 5C5OA 3PLBA 3Q3XA 1G9IE 1GBTA 2FXRA 1BJUA 1DX5M 4NWLA 1C5MD 2RA0A 3SV2H 3ZZ4A 2STAE 1O3IA 1GJCB 2AGGX 1ETRH 1YPMH 3ZZ8A 1L4DA 1QRWA 2SGQE 1H8DH 3SV6A 1V6DA 2FLRH 3ZZCA 1C1QA 4AFZA 4WMFA 3PB1E 3RXCA 1J8AA 3RMLH 4X8SH 1NFUA 3GY5A 3B8JA 4H6SB 4X2WA 1MCTA 4X8UH 1C5PA 1Z8RA 1KXDA 1F0RA 3P8FA 1O3KA 1XM1A 2XC5A 1C1SA 2RDLA 5GWZA 1DUEA 3KL6A 4WXIA 4JYTA 1TMTH 3A7XA 3TJNA 4WWYA 3SU6A 1GMHG 3VFEA 3A85A 3E91A 1GI8B 1AWFH 1O31A 1UVPA 1OWEA 6GCHG 3MH5A 4NFFA 1A4WH 4WJG2 4LXBH 4DURA 2QF0A 1XUHA 2XCNA 5E0JA 4CRDA 2EEKA 1GVLA 1MQ6A 4XBBA 1SHYA 1TNGA 1HAHH 3H7TA 1QRXA 2BDBA 1A61H 4XBCA 4TYDA 1ETSH 1PQ5A 1A0JA 4UFDH 2PR3A 1BZXE 3JZ2B 3T2NA 1HXEH 1NO9H 1DPOA 1C2DA 4TWYA 1O38A 3QO6A 1A1RA 1BITA 1ZMJA 2QCYA 3KQCA 4OS2A 5GIBA 2ZNKH 3GCHC 3MU1A 1SGYE 4X6PA 3U9AH 3RXGA 1DLKB 1L1GA 1BCUH 1ZHRA 3BTWE 3PO1C 4Y0ZE 3RXTA 3RLWH 1TBRH 4DT7B 1T8MA 3LOXA 1IQNA 4I8HA 1D4PB 5E2PA 1YP9A 2A7JA 2A2QH 1QY6A 2F9NA 3A7VA 3OYPA 3L33A 4X0WU 2TGAA 1QTFA 1GJAB 1AO5A 1PFXC 2BLVA 2PKSC 1BDAA 1FJSA 1H8IH 3GY2A 3QDZB 1O3MA 3LGTA 1BTUA 4GLYA 2B8OH 4WMEA 7GCHF 1HAVB 2ILNA 1GDUA 2SGPE 5C20A 3NK8A 1MTSA 3DFLA 5C1XA 3IWMA 1C5UA 1C9TA 1XUFA 5J4QA 2AS9A 1EAUA 3A86A 2G8TA 3MYWA 2ZPQA 4ABDA 3ESTA 1FONA 3SU3A 2R2MB 5E2OA 1OWJA 1N1LA 2SFAA 3K6YA 2W26A 1TGTA 4NZQA 3SW2B 2G52A 3CS7A 1EB2A 1EUFA 1TNJA 1SGQE 4Q7ZA 1CBWC 3F68H 6CHAC 2F9VA 4KTUA 3TGKE 5JDUB 4AGJA 3UQVA 2AMPA 3SNDA 2ANYA 2FYRA 5ETXA 3STJA 1MTWA 4PROA 5EG4A 3PLPA 3PWCA 1GJBB 1F0UA 1C2FA 3FAOA 3NWUA 2WPMS 2XXLA 3ATIA 1HJAC 2Z3CA 2ZKSA 3VB5A 5AF9H 3BG4C 2WPLS 1TIOA 4NA7A 4SGAE 1KDQB 3E90B 1HCGA 1BHXF 3QZQA 2BX4A 2PKSB 2BXUH 2IN2A 1HB0B 3KEEA 5DP3A 5HGGA 4Y10E 3MH7A 1AZZA 2G81E 1C5SA 1P2QA 1EB1H 2ZDVH 4I8JA 2ASUB 3KHVA 3NUMA 1V2VT 1GVKB 1GBMA 3B23B 3ATLA 3ODDA 1TMUH 3STIA 3G01A 1IQMA 2FESH 2P8OC 4MTBA 4X1PU 1NM6A 2ZDAH 2ZHEH 4ZHLU 2PTNA 1HAVA 3T29A 4LZ4B 1XUGA 3UR9A 1V2JT 1QB6A 1FI8A 4ABEA 3P95A 3ZVAA 1O5DH 4O97A 1CBWB 1TPSA 6CHAB 5CMXH 1NESE 1O2TA 4QT8C 1GJ6A 4IN1A 4HGCA 2J34A 5EPNA 2PV9B 1SQAA 1EQ9A 3TNSA 8GCHF 4CBOA 3AVZA 1KLIH 1Z7KA 3HATH 3MH4A 2ZA5A 1O3LA 3MO9A 3QZRA 2JETC 1O3BA 1H1BA 4LOYH 1QURH 4AOQA 3BG4B 5DP7A 3BEFB 4JYVH 1YM0A 1C4V2 4MPVA 1JIRA 4INLA 1KIGH 3IG6B 4FVBA 4KKDA 1TA6A 2FTMA 4BXWA 1D3PB 2O8UA 2ZGCA 1KDQA 1DT2A 1SOZA 2Y82A 5FBEA 3T27A 1GBCA 1FY8E 4NA8A 1QQUA 1LTOA 3V7TA 1UO6A 4Y8YA 1ACBE 2HOBA 3GY8A 5C1YA 2BXTH 3P6ZB 3MO6A 1NRPH 1TQ7B 2XWBI 2P8OB 4NA9H 3A87A 4XBDA 3UWJH 1IQLA 1HAOH 4H42U 4ZHMU 4CH8B 2YNBA 1QNJA 1ZSLA 1VR1H 1P03A 2NU0E 1UK4A 3M61U 1SGPE 1AKSB 1ELDE 1AIXH 3RM0H 4CBNA 1QA7A 4FUCA 4SGBE 1A0HB 1OOKB 3BTDE 3A83A 1RTFB 3V3MA 3ZZ9A 3KNXA 3SV9A 2HPQH 4TPYA 4YOIA 5GCHG 3DHKH 1C5WB 1HDTH 3LONA 1P2JA 1UCYE 1GBBA 2FMJA 5FAHA 1T8OA 1SLUB 1UVTH 1WBGB 1OWIA 3RXLA 2Y81A 2BMGB 3CENA 1ELEE 1G30B 1MAYA 2F83A 1ZLRA 4FU9A 1F92A 1GHZA 1HIAB 3FZZA 3ZVGA 3SNBA 5IDKA 4JZFH 1MD8A 1EOJA 3TVJB 5EW1H 1SI5H 5FBIA 4JCNA 3LDXH 2ZP0H 1U6QA 5E8EH 1S0RA 1EP5A 1TGBA 3ZVCA 4DCDA 1W8BH 2A1DB 3RXMA 4ASHA 3SNAA 5CHAB 1Y5UT 1ZHMA 2H9HA 1L0ZA 3BTME 1QJ1B 2ZECA 3SUFA 5HMAA 1O2MA 1EJNA 3A84A 4FUHA 1GMHF 1UCYK 1ZHPA 2RA3A 3GY6A 1Z6EA 1WCZA 3LH3A 1DITH 1Q2WA 1ZSKA 6GCHF 4MNWA 5HM9A 1ESAA 2TGTA 4MPUA 3H7OA 2NU4E 5F8XA 3M3TA 3TGIE 1AKSA 4I33A 1BBRE 5LPEA 1J16A 5T6FA 1FPCH 1FIZA 2LNCA 1C5LH 1HV7A 2ZFQH 4AN7A 2GKVE 3MWIU 2AIPA 1TONA 4DOQA 1N8OC 2NU2E 2G51A 2Y5HA 1PJPA 1ZMNA 4AORA 2VIVA 2ZO3H 1GCDA 1CGIE 4K60A 1TMBH 4ZXXH 1BMNH 1WYKA 2EI8A 1ETTH 1PPZA 1HAXB 5T6GA 2HNTC 3E8LA 3QX5H 4MQAA 1RIWC 3MO3A 1UTMA 1HIAA 2DUCA 2C8XB 3M36A 3NZIA 2HNTE 3F9FA 1Z8IB 2A31A 1LPZB 1QB1A 3EYDA 1S5SA 1O3CA 3A8CA 2BD5A 1OXGA 4B75A 1E37B 3IITA 4CR5A 1UCYH 1K1NA 2ANKH 4MLFB 3E0NB 3RXUA 1BTZA 1GJ4H 1KXEA 1MU6B 1THRH 3N7OA 1BJVA 2P3UB 3AW1A 2ZEBA 2R2WU 1NT1A 3OU0A 1AHTH 1O5GH 3Q00A 1TNIA 2QGRA 4AX9H 3OY6U 1M9UA 1O5FH 3K2UA 4UONA 2GT7A 2A7CA 3BTGE 2ANWA 1V2OT 2FWWA 1S6HA 3HGNA 2Z9GA 2FOHA 1N8OB 4UD9H 2OXSA 4ZH8A 1IHSH 2A32A 4H6TA 3U8RH 1P06A 3MTYA 1SGIB 3BTFE 1P3EA 2Y7ZA 1GI5A 5AHGH 1GHBG 6LPRA 3URCA 1K9OE 1JRTA 1QQ4A 1SGFA 4THNH 4ZROA 1ZPZA 2Q1JA 1ZJDA 1OX1A 1ANCA 1W0YH 4X1RU 1S6FA 1P2NA 1RIWB 4B71A 1AFEH 4WH6A 1O2PA 4ZKRU 3MMGA 2A4GA 1C5XB 4HI3A 1ZPCA 1YPHE 5F03A 2ZG0H 5EXNA 3AW0A 5FPTA 5EGMA 1P2KA 2VINA 1P04A 3VB6A 1DS2E 1KYNA 1LHDH 1VCQA 1ELAA 2CJIA 2R9PA 2QV1A 2PUQH 2BVSH 4CRBA 4MNXA 1GI7B 1TB6H 4OS4A 2A45B 1P2OA 1ELTA 3O8RA 1K1MA 1RFNA 2TPIZ 2CXVA 2VU8E 3M7UA 2XWAA 2QF3A 5FCKA 1UHBB 5LPFA 1P05A 3BEIB 3P8GA 5GPIB 2UUKB 3RP2A 1PPGE 1WTHD 1TRMA 2QN5T 2FI5E 1D3DB 2QA9E 4AGKA 1NU9A 1NZQH 3MH6A 2ZZUH 2AEIH 2FTLE 1SPJA 1Y3VA 4BAHB 4BAKB 4ZMAH 2B0FA 2HLCA 2Z9KA 1BTPA 2Y6TA 3ATWA 1MKXK 2ODYB 1LQDB 3LGUA 5ABWA 1C5VA 2ZHFH 1MKWK 3U1IB 4HFPB 2Q6GA 5DO4H 3RU4D 1YYY1 1OPHB 1S85A 1TX8A 2VWLA 4B1TA 2B5TB 2BLWA 4IS5A 5JBBS 4INKA 1UTPA 2OCVB 1B7XB 3LT3A 4FUBA 3PTNA 1SVPA 2GCTC 1RD3B 3O8CA 1QBVH 5TJXA 2LPRA 1E0FD 1DWBH 3FANA 2A4RA 1WOFA 3EA9A 1ZJKA 3M5LA 5A8YA 1YGCH 4I8LA 2ZWLH 1AVGH 1LQEA 1O2IA 1UHBA 4OGXA 3ZYDA 1ZYOA 2BQ7B 3UOUA 5JPMH 1XXFA 5GCHF 2ZDMA 1C9PA 2QAAA 1TPOA 2ZFFH 3RMNH 5JBTA 1B0EA 1F7ZA 4AG2A 2SGDE 2STBE 1L1JA 1NC6A 1MZAA 1O0DH 3FFGA 3P17H 2BD3A 2G55A 1TFXA 3HKJB 1MKXH 1SFQB 1KLTA 1O2UA 1FN6A 3HPTB 2AGEX 3UQOA 1MTNC 5A2MH 2VVVA 1P2IA 2ESTE 3A8AA 1FNIA 1ARCA 5A8XA 2BD9A 1PPHE 1INCA 1A0LA 4X6NA 1O5BB 3A7WA 4YM9A 3ZYEA 1O3AA 2FI3E 3A7ZA 3LH1A 1H9HE 4I32A 5T3HA 1KLJH 3UUZA 3FP7E 3A88A 3CP7A 5I46H 1KXAA 2ZGXH 4DIHH 2BZAA 1YPGH 2P16A 4A5TS 2BDCA 2K1QA 5F8ZA 4MG3A 1HJ8A 5C1UA 3GDVA 1C2MA 2BD8A 2ZDNA 3OX7U 3GCOA 1G3EA 4TY7A 5EW2H 1Z6JH 2UUFB 2BDIA 1FY3A 3T28A 1SGNE 4X1SU 2XBXA 1BQYA 1XVMA 2JKHA 2GT8A 1FIWA 1Z1JA 3TU7H 1O5CB 1WU1A 1IQHA 3GY7A 1MTNB 3BTHE 1O30A 2PTCE 3O8BA 1V2WT 3S9AA 3VGCC 1FAKH 2TIOA 1L1NA 4AFSA 5JBCS 3FVFB 4RSPA 2BY8X 1IQKA 1V2NT 1JOUB 1TGSZ 5GXPA 1MUEB 1S0QA 2OINA 1EOLA 3ATKA 3RU4E 3PMJA 1F5RA 3LJJA 1LKBA 4Z0KA 4CRFA 1C2HA 1EZXC 1C2EA 4K8YA 2J94A 3S7KB 3V0XA 4MNVA 3EE0B 1W7XH 1AU8A 4U2WA 2FOEA 3Q3KA 1VGCC 3FP8E 1C2IA 3BTQE 2QIQA 1CU1A 4UDWH 1TPAE 3SUGA 2D26C 1BTWA 4K5ZA 3RMOH 3SZNA 1O2OA 3RXEA 3QLPH 4BTIB 2ZTZA 5L30H 1J14A 2VVCA 3ITIA 5F6MA 1OSSA 4Y79A 4OS7A 3LGYA 1GHBF 3GYLB 1D9IA 2V0BA 1LVYA 4JYUH 3SQHE 4GUXA 3VGCB 1YPLH 2FS9A 3SO3A 2OBOA 5FX6A 5EXLA 3AAVA 3S69A 2P3TB 1AFQC 1HBTH 1O3DA 1YF4A 4ZKOU 1TA2A 1MCVA 4A92A 1SGFG 1FN8A 3SU4A 1OWKA 2BDGA 2FPZA 1HJ9A 2Y5FA 1BRCE 2FX6A 4Y7BA 2PW8H 3DUXH 1OYTH 5DG6A 1OKXA 2ZGBH 3A8DA 3L3TA 1BHXB 3E0PB 4Y7AA 3LC3A 4D7FA 1VGCB 3ATMA 2P95A 3QGNB 1TX6A 3SHCH 1O2QA 2ZGHA 4ZAEA 1TOCB 1TBQH 3SV8A 4FVDA 1ELBA 2DE9A 2PLXA 2FX4A 2ZFTA 1GBKA 1S82A 2CHAC 3SJIA 1ZSJA 3UY9A 5J4SA 3EGKH 1F5KU 5L2ZH 2CF9H 1C1VH 1GG6C 4X1NU 4X2YA 1WQVH 1Y3UA 3GISB 1MZDA 2SGEE 2XBVA 3OTJE 1ID5H 1XXDA 1AFQB 3I29A 1O2YA 4CRCA 2AGIX 1ARBA 4NIWA 1XKBC 2KAIB 3C1KA 3RXPA 3UWIA 1G37A 2Z94A 1JWTA 2FI4E 4X6OA 4NCYA 1EP6A 5DP9A 1C5ZB 4Y8ZA 1C2LA 2R3UA 1GHAG 2VWNA 3M7QA 1T32A 2G4UA 3GYMA 1QL9A 2GVFA 3SORA 2PSXA 2BDYA 3C27B 1CE5A 1GMDG 1JRSA 6ESTA 2FIRH 4B2CA 1UTNA 1DWDH 3MU5A 1P0SH 1HPGA 2CHAB 3D62A 2VH0A 1RGQA 3MU8A 4U30A 1IQEA 1AY6H 3MOCA 1IAUA 4I8GA 3GY4A 3GOVB 1C1MA 1L4ZA 1TLDA 1QR3E 3K9XB 1B5GH 2O8WA 1GG6B 1FDPA 2ZU2A 4B76A 4YOGA 1ZGVA 3R0FA 2P3FH 2W7UA 2Z9LA 1GL1A 2HPPH 4AB8A 1GMCG 5FPSA 2WV5A 4IBLH 3E6PH 1TNKA 1O2RA 1O2NA 3M5OA 1PQ8A 1IQJA 1GI4A 3EA8A 5CHAC 4NG9H 2BLOA 1CA0C 4GHQA 5TCCA 2GV6A 4JZDH 2DE8A 1P8VC 1ZGIA 4YZUA 3PM3A 3TK9A 1O36A 1BRUP 5L2YH
chains in the Genus database with same CATH superfamily
2YNAA 4ISOA 5EU8A 2ANMH 3M37A 2KAIA 3PLKA 1GBHA 1O3FA 1V2ST 4TWWA 3U1JB 2FOMB 4NIVA 2ZHWH 1GI9B 3HK6B 3SBKA 1ANDA 2VIQA 1A5GH 3M5NA 3W95A 4MNYA 3RXBA 1DDJA 1QL8A 2FOBA 4ABJA 1SB1H 1YLNA 2BDHA 1FMGA 5E0GA 3T5FH 1WQSA 1SG8B 2J95A 2D2DA 1TRYA 1UVOA 1SLXB 2FDAA 1DXWA 2GCHG 2VIPA 4K3JA 4AB9A 4X8TH 1EJMA 2Y7XA 5LGOA 1NY22 1O2XA 2PWXA 1GHXH 1D3TB 2V3OH 2FS8A 1CT0E 1BUIA 4IN2A 2P59A 3OSYA 5DGJA 1HAIH 2XOKD 1SGDE 3DCLA 3KQDA 4YT6H 5KGOA 3RXOA 3QTVH 1CA0B 2FYQA 4DY7B 1UK2A 3MI4A 3I78A 3DT0H 1GVZA 2PGBB 2CF8H 1LPKB 3M35A 5F8TA 4K1EA 2ZCHP 1DXPA 1BTXA 2EI6A 1P10A 1GI2A 1LVOA 1VCPA 3DSOA 1NFXA 1PPCE 2JH5D 2A4QA 1SC8U 4OGYA 1J17T 2W6JD 4KGAA 1XX9A 2GMTC 3P8OA 3RU4T 4O9VA 4Y6DA 1SLVB 4Z6AH 2CV3A 2BY6X 1CSOE 2YMSD 1O3GA 4JZEH 2IPHA 1ZPBA 3RDZA 1K2I1 2Z6BD 4E7RG 1O34A 1N6XA 4GAWA 2G00A 4BAOB 2GD4B 4IGDA 1LHGH 2O8LA 3TH4H 1QJ7B 1Y8TA 1DLEA 2GZ7A 5FX5A 5C17A 2Z9IA 2XYAA 3M5MA 1YCPH 1F0SA 1K21H 2D8WA 1GBAA 4BXSA 1D6RA 1SBWA 2ZGJA 4AYYB 1EPTA 3V12A 4AZ2B 1GI3A 1KSNA 1BBRK 3SJ8A 4TPIZ 5HKKD 5FCRA 1G3DA 1S81A 1Y3YA 5DK1A 3ZVFA 1OP0A 1ANBA 3CS0A 1KXFA 1W3CA 5C5NA 5A0AE 1UTJA 1TAWA 3ZZ5A 3LGWA 5DP8A 2OUAA 1IHTH 2A4OA 3T62A 1AE8H 4BTUB 1A3EH 2GMTB 2J9NA 4BANB 4DVAU 1AGJA 3S0NA 1FY1A 1E36B 2VJ1A 4Y11E 1V2QT 4XDEA 1GJ7B 4DGJA 2QY0B 1EAXA 5H4IB 1SFIA 2ZF0H 3MQKC 2VGCC 4J1YA 1O2KA 2WUCA 1C2GA 1E1QD 5IK2D 4CR9A 3ZVBA 1HAZB 4ABBA 4JMYA 2LELA 2WINI 1MTVA 5HM2A 4TY6A 3UNSA 5DP5A 2C8YB 4YO9A 4E05H 1XUIA 4B74A 1Q31A 3TLOA 1YWUA 1RTLA 1BBRH 1SR5C 2ULLA 3MFJA 2IOTA 4RN6A 1SQOA 1T8NA 3VXFH 1CT2E 1GBLA 1K1PA 1SGEE 2BVXH 1EZQA 5FPYA 1VZQH 1JIMA 2BQWB 1TABE 2ZTYA 2TGDA 1LCYA 1AUJA 1GL0E 2FOCA 2AFQB 3QTOH 1WTGH 1EKBB 3SNCA 4B6EA 1DUAA 1W2KH 3OE7D 1VCWA 2RCEA 2F3CE 1P2MA 4YXWD 1Y59T 2WUBA 1A46H 4DG4A 3TK5A 2J92A 1C2KA 2VGCB 5L6NH 2BY5X 2YMSC 2ZHDA 4GCHG 1MD7A 1Y3XA 4ABHA 2RFKC 1IQFA 1GHAF 1S83A 1KXBA 1TNHA 1HAPH 1DY9A 1QFKH 2QC2A 4MPXA 1SL3A 2HNTF 4X8VH 2R3YA 1GMDF 1P57B 3A8BA 3DFJA 1P09A 2XRCA 1XUJA 3RUOA 4X6MA 1T8LA 1K1OA 1W13U 1O2SA 4A1VA 1BMAA 2HGTH 2ZCKP 1GI0A 3RXFA 2WZQA 4U32A 3GS9A 1D6WA 3ZZBA 1RTKA 2Z7FE 3SOSA 3ZVEA 5EODA 3F6UH 1SMFE 2FOGA 2AH4X 5ESTE 4ZKSU 2W3KA 1BOQA 5JYIA 2FZZA 4FUFA 1DICA 3MNBA 1GMCF 2ZQ1A 1ZTLA 3LC5A 1QIXB 1OP2A 1PPBH 4Q2KA 4UFEH 1EATA 2GDDA 3ZV9A 1XUKA 2GZ9A 2FOAA 2GTBA 3F1SB 1MTUA 5GJ4B 3ZV8A 1GGDC 4ISLA 1Z1IA 1P02A 5DKMA 2YMSB 3E3TA 3GCTG 4FUJA 3RXRA 5DP4A 1MQ5A 2ZDKA 1IQGA 1MH0A 2PHBA 3RLYH 3SU0A 5A09A 1Y3WA 1C1OA 3RXHA 2AIQA 1FPHH 3BTEE 1A7SA 3LIWA 4X2XA 8ESTE 3M3VA 1BMMH 1OHHD 2FOFA 2UWOA 3S9BA 2ZFSA 4MVNA 4K8BA 4GPGA 4I7YH 3UIRA 1YBWA 1V2LT 1ZTJA 3KCGH 2KM0A 1FY5A 3MNCA 1C4U2 1RS0A 5JB9S 3NXPA 2GCHF 2BZ6H 4B6FA 1XVOA 2XTTB 5A8ZA 4JK6A 3SN8A 2V3HH 1H9IE 3PV4A 1HFDA 2I6QA 3V13A 2V35A 1FUJA 1KTSB 4OS6A 2KX4A 3O8DA 1B0FA 4K1SA 1Z71A 2CN0H 1TNLA 2I6SA 1C2JA 1TX7A 2F9OA 3PMAB 1ELGA 2VWMA 1NU7B 1ZRBA 4YLQH 1GGDB 3BTKE 2OC8A 1C5QA 3M7TA 3P8NA 4LK4A 2ODQA 2UWPA 1O2GH 2BY9X 2W7SA 2KCPA 3TH3H 4DIIH 1QGFA 3ZVDA 1OYQA 3ELAH 3TJVA 5HIYA 4A1XA 3UB0A 4WVPE 2O9QA 1PPEE 2Y80A 1GJ8B 1DVAH 1LHEH 1MBMA 1T4UH 3SNEA 1SLWB 2H2ZA 2WV4A 3BIUH 1P11E 1NBMD 4GHTA 1V2KT 3TGJE 1BA8B 2OP9A 2NU3E 2W5EA 4WH8A 1GI6A 4O3UA 2EQNA 1NROH 1KY9A 5LH8A 3RXJA 3BG8A 1NRRH 4B2AA 1GBIA 2P94A 3U98H 1COWD 3AASA 3L6PA 1KXCA 4AFUA 4D76A 4ABFA 1ORFA 1YKTA 3SGQE 1VKYA 2ZFRH 3B9FH 2VNTA 1ELFA 1EASA 2TGPZ 5EJ1A 1ESBA 1NRQH 1RJXB 5LPRA 2VBCA 3LGIA 2ZU5A 1ABJH 1YLDA 3P92A 5JBAS 1O5AB 1E79D 3ZZAA 1E1RD 1TGNA 8LPRA 2JH0D 4UFFH 5G4BA 1NN6A 1GBJA 2BD7A 4JK5A 1WUNH 1ELCA 2OC0A 3Q76A 8KME2 1EZUC 3EDXB 1G3BA 1O32A 1SOTA 3MNXA 4ZUHA 2J2UA 2OQ5A 3A80A 1C5NH 4F49A 1UTLM 1UVSH 1OWDA 3TJUA 4D8NA 5JB8S 2GDEH 1QBNA 4ACAA 3VXEH 3TK6A 4JZ1A 1H9LB 2P93A 2FO9A 2B9LA 2NU1E 3SV7A 2B7DH 1FXYA 4ZHAA 1F2SE 2C93B 1TRNA 5BPEA 2SNWA 1YPJH 4KTCA 2F9UA 1O35A 4Q80A 1YLCA 1DY8A 3TITA 1TYNA 1JXPA 2VWOA 1HAGE 4UEHH 1FLEE 1P9SA 1KTTB 5TCAA 1DE7H 1BTYA 3W94A 3VG8A 3UNRA 1DOJA 2CMYA 1RXPA 2OC1A 2ZPSA 5EXMA 2BD2A 1AN1E 1EAWA 2R0LA 5DPAA 1CVWH 2H9TH 1G2LA 1P3CA 2ZU1A 3KQ5A 3SU2A 4AYVB 1Z8JB 2AMQA 1IQIA 2J4IA 1GHVH 2SGAA 3JZ1B 2UUYA 1Y5AT 2XBYA 1AD8H 2VIWA 1GHWH 4O3TA 2ALPA 4I8KA 3SJOA 1SGRE 4ZCNA 1O2WA 3QK1A 1GI1A 1FV9A 1F0TA 5T6DA 3ZZDA 4M7GA 5FL7D 1JBUH 1QCPA 2KZ4A 3EQ0H 4ISNA 1AE5A 1VJAU 3UFAA 1J9CH 3KN2A 2GGVB 1MMJN 2YOLA 3PMHB 3SUEA 4YOJA 1WXRA 2PUXB 2RDEA 2OTVA 1GJ5H 3QGJA 4GCHF 3LJOA 2QF4A 5HIZA 4A6LA 1DFPA 4CRGA 3U8TH 1NBME 4Y76A 1ELVA 3RMMH 2PKAB 2WYGA 1LPGB 4TSFD 1UTOA 3GDSA 1V2UT 3DA9B 2L74A 2O8TA 2THFB 3GCHB 1HAYB 2BQ6B 1UK3A 3RXAA 4MDSA 3DD2H 2HRVA 2A2XH 2TRMA 3ZZ6A 2OD3B 3PO1B 1MU8B 2Z9JA 1VITG 4DJZB 2BY7X 2J38A 1BRAA 4NGAH 2BHGA 4ABAA 1O37A 1P01A 2EA3A 3VB4A 4KTSA 2WPJS 1CHOG 3U69H 2WYJA 2UWLA 5A0BA 5HYOA 2D1JA 1A2CH 1O5EH 1Q3XA 4HG6A 4ESTE 3KYGA 2BD4A 2FEQH 1V2TT 1SQRA 5A0CA 2ZC9H 1AB9C 3A81A 1K1JA 3PV2A 5C94A 1Y5BT 1C1WH 2EC9H 3RXIA 1V2PT 2A5KA 3UTUH 1UTKA 1LMWB 1SGCA 1V2MT 3Q3YA 3NPSA 3UR6A 2IPQX 2ZHQH 4P00A 1O3NA 5DP6A 1OWHA 3GCTF 3WWFA 2H1UA 4NSYA 1DANH 4X1QU 4DT4A 1PYTD 1DSTA 2XNIA 1A5HA 1HXFH 4FUEA 3UOPA 5K0HA 1GWAA 2XC4A 4D9RA 2ODPA 3K6ZA 1AQ7A 1WV7H 4BAQB 4IC6A 1EPTC 2PKAA 4RKOB 1D3QB 2CGAA 3D49H 2NWNA 1QBOA 2H5CA 5AFZH 2AMDA 1GBDA 3BV9B 1K1IA 3RM2H 1HJAB 4JZIA 4D9QA 3KF2A 1T7CA 5EPYA 3HK3B 1W12U 7ESTE 2A5IA 1K22H 4INHA 1ESTA 2OK5A 3RXSA 3HKIB 3EA7A 4A7IB 2H6MA 3R3GB 4IMQA 1HGTH 1W11U 2GJGA 3QUMP 3GY3A 3H5CB 1C1TA 5B6OA 1WSSH 1K28D 2AYWA 2HLDD 3SGAE 4E06H 3KQEA 4LZ1H 5BRRE 2G5NA 2XC0A 1WDIA 2SNVA 2BOKA 3F2GA 1AB9B 4ABIA 3PYHA 3RXDA 1AZ8A 4UE7H 2PGQB 3TPIZ 4IC5A 1LHFH 4ZXYH 1GBFA 4NIXA 5K7RA 9LPRA 4ISHH 3P70B 1O3PB 1MAXA 4A1TA 3HGPA 3NKKA 3URDA 1TGCA 4FU8A 1W0JD 3A7TA 1NRNH 3KGPA 7LPRA 1QJ6B 1AMHA 3KIDU 1C5OH 2QYIA 3FO8D 1EPTB 3UPEA 2BLQA 9ESTA 2BOHB 4XSKU 1C4Y2 1V2RT 1VJ9U 1YCPK 2XCFA 3TIUA 2JETB 1THSH 1V3XA 4O03A 2BB4A 1C1RA 1SQTA 4KELA 1NPMA 1QRZA 5I25A 1W0ZU 1FZZA 1LKAA 5HXFA 1YPEH 3TJOA 4Y8XA 2AERH 2A7HA 2XW9A 2Q6DA 4HTCH 1QB9A 1TQ0B 5DN6D 3VB7A 4R0IA 1ZZZA 2QXJA 4CH2B 3F9HA 1ZMLA 3SU1A 1ZOMA 1HYLA 1YCPM 4GVUA 1CQQA 1CO7E 5IYTA 3SI3H 1CGJE 1CGHA 3QWCH 4XFQA 3BN9A 2IJD1 3EAJA 2ZU4A 2ZPRA 3UREA 3LPRA 4F4OC 2G5VA 2HALA 1X7AC 3DSPA 4KP0A 3A82A 3CNRA 1ZR0A 1PYTC 1G32B 1F5LA 4ISIH 2C8WB 3RXQA 1UJ1A 3SI4H 3BEUA 4E7NA 1QL7A 3K65B 4GSOA 4MPWA 3S9CA 3QN7A 4Q7XA 1IOEA 1O2ZA 5PTPA 1FY4A 1NFWA 1J15A 5FXLA 1S84A 2A5AA 1EXFA 1O3HA 1N6YA 2BM2A 2Z3DA 4ZKNU 4YESB 1EJAA 1LO6A 5C2ZA 1Z8GA 5EOKA 1DM4B 5CDFE 3UNQA 3WY8A 1OS8A 2BYAX 2F9PA 3GCNA 2ZTXA 1E35B 3SJ9A 1W10U 2FODA 1XMNB 1TBZH 4X2VA 3F3BA 1GDQA 1MABB 2W3IA 1T4VH 3EE7A 1BTHH 1AVWA 1C5TA 2EY4C 3F9EA 3RXVA 4AFQA 4OS5A 1EX3A 1DWCH 3F9GA 1C1PA 3BF6H 4R8TB 3GICB 3TH2H 2EI7A 4CRAA 3I77A 5CE1A 2PFEA 3PRBA 3BTTE 1C5RA 1ZRKA 1LDTT 1A3BH 3ODFA 4B2BA 4BTTB 1O2JA 2ZDLA 1DSUA 1TPPA 1CHGA 3PMBB 3LGVA 4RKJB 4K1TA 4WY3A 3N7DA 1FAXA 5T1VA 1TWXB 1A5IA 2PSYA 2BDAA 2VB0A 4YLUA 4D7GA 1G2MA 1O3OA 2GP9B 1VITH 1PQAA 4VGCC 1W14U 7KMEH 2Z3EA 2F91A 1YPHC 5AVDA 2QXHA 2M5TA 3OTPA 2RG3A 2ZIQH 4WMDA 3TNTA 3MHWU 1VITF 3N99A 7GCHG 1NTPA 2TBSA 1ANEA 1O2LA 4FUGA 5AFYH 4IMZA 4NSVA 1CHOF 1ZTKA 2FLBH 3KQBA 3SGBE 3T25A 4K69A 4U01A 3NCLA 4AG1A 1HLTH 3A89A 3BSQA 5B6LA 4NIYA 3VB3A 2OQUA 3E16B 1ABIH 3PWBA 2GX4A 2QXGA 1O2HA 3OY5U 4ABGA 2WPKS 1EAIA 2ZQ2A 4NWKA 1O3JA 2KCOA 4HZHA 3T26A 1AWHB 1UMAH 2QXIA 4YT7H 3FP6E 2BX3A 4FUDA 1DWEH 2VH6A 1H4WA 1SSXA 4J2YB 1OP8A 2GV7A 3MU0A 3RC4A 2OLGA 3FKSD 4FUIA 1NFYA 1MBQA 3RXKA 2C3SA 1O2VA 2FP7B 4BOHA 2VVUA 2WPHS 1GPZA 1O39A 1RRKA 1LVBA 1QA0A 1O33A 2C4FH 5C3NA 1E38B 4F48B 1THPB 3AK5A 3ENSB 1YPKH 3FZDA 1O3EA 4CHAC 2HVXA 4DW2U 4NZLA 5SGAE 2JH6D 3Q77A 4VGCB 4B73A 1W7GH 1AI8H 1AVXA 1QHRB 3SZEA 1K1LA 1GHYH 3SU5A 3RC5A 1HNEE 2L6OA 4H4FA 5FHTA 1GJDB 3MU4A 4IW4E 1P9UA 2OC7A 2O8MA 1UVUH 1WAYB 4Q7YA 3SHAH 1PQ7A 1BIOA 1TALA 1C5YB 1JMOH 4BAMB 2H9EH 1BRBE 1S6LA 4FXGH 1XKAC 1GCTC 4BNRA 2V6NA 4WXVA 4XOJA 1T31A 2GZ8A 1LVMA 1TOMH 1NS3A 2Y5GA 3D65E 3U8OH 3A7YA 4UFGH 2ZI2H 3GDUA 8GCHG 2SGFE 3E1XB 2F9BH 1AUTC 5E0HA 4OS1A 2C90B 2ZU3A 2ZFPH 1EZSC 5DSFA 4XE4A 3H09A 3PROA 1CT4E 3VEQB 4Y71A 3SJKA 2WPIS 4CHAB 2IJOB 1G3CA 3RC6A 1E34B 1SHHB 5EQQA 3WWBA 4FU7A 2VIOA 1GDNA 1GBEA 3M3SA 1PPFE 4M9FA 2C8ZB 2UUJB 1YC0A 2G4TA 4WF8A 2XBWA 4I31A 3LKWA 3ZZ7A 2BVRH 4Z1MD 1GJ9B 2VIDA 3PTBA 2HWLB 2R0KA 1UW7A 1P12E 3D23A 1SGTA 4K2YA 2A0QB 3ZZ3A 5GDSH 1MKWH 4CREA 5DJ7A 3SUDA 2OBQA 1C1NA 1CA8B 1L2EA 1FQ3A 1BB0B 2ZCLP 3ZIAD 3S7HB 3MNSA 1GCTB 5KEDA 3SQEE 1TE0A 1UTQA 5EQRA 1C1UH 1NRSH 1HUTH 1LHCH 3LU9B 2FM2A 3AAUA 4NFEA 1G36A 4Y0YE 2BTCE 1BMLA 1HRTH 3BIVH 2Q6FA 5ESBA 2GCTB 3VPKA 4YTAA 5EQSA 2QE7D 1BT7A 2ALVA 5C67A 2H5DA 5C5OA 3PLBA 3Q3XA 1G9IE 1GBTA 2FXRA 1BJUA 1DX5M 4NWLA 1C5MD 2RA0A 3SV2H 3ZZ4A 2STAE 1O3IA 1GJCB 2AGGX 1ETRH 1YPMH 3ZZ8A 1L4DA 1QRWA 2SGQE 1H8DH 3SV6A 1V6DA 2FLRH 3ZZCA 1C1QA 4AFZA 4WMFA 3PB1E 3RXCA 1J8AA 3RMLH 4X8SH 1NFUA 3GY5A 3B8JA 4H6SB 4X2WA 1MCTA 4X8UH 1C5PA 1Z8RA 1KXDA 1F0RA 3P8FA 1O3KA 1XM1A 2XC5A 1C1SA 2RDLA 5GWZA 1DUEA 3KL6A 4WXIA 4JYTA 1TMTH 3A7XA 3TJNA 4WWYA 3SU6A 1GMHG 3VFEA 3A85A 3E91A 1GI8B 1AWFH 1O31A 4XRNA 1UVPA 1OWEA 6GCHG 3MH5A 4NFFA 1A4WH 4WJG2 4LXBH 4DURA 2QF0A 1XUHA 2XCNA 5E0JA 4CRDA 2EEKA 1GVLA 1MQ6A 4XBBA 1SHYA 1TNGA 1HAHH 3H7TA 1QRXA 2BDBA 1A61H 4XBCA 4TYDA 1ETSH 1PQ5A 1A0JA 2CK3D 2PR3A 4UFDH 1BZXE 3JZ2B 3T2NA 1HXEH 1NO9H 1DPOA 1C2DA 1KMHB 4TWYA 1O38A 3QO6A 1A1RA 1BITA 1ZMJA 3N7EA 2QCYA 3KQCA 4OS2A 5GIBA 2ZNKH 3GCHC 3MU1A 1SGYE 4X6PA 3U9AH 3RXGA 1DLKB 1L1GA 1BCUH 1ZHRA 3BTWE 3PO1C 4Y0ZE 3RXTA 3RLWH 1TBRH 4DT7B 1T8MA 2J97A 3LOXA 1IQNA 4I8HA 1D4PB 5E2PA 1YP9A 2A7JA 2A2QH 1QY6A 2F9NA 3A7VA 3OYPA 3L33A 4X0WU 2TGAA 1QTFA 1GJAB 1AO5A 1PFXC 2BLVA 2PKSC 1BDAA 1FJSA 1H8IH 3GY2A 5EJZA 3QDZB 1O3MA 5C0TA 3LGTA 1BTUA 4GLYA 2B8OH 4WMEA 7GCHF 1HAVB 2ILNA 1GDUA 2SGPE 5C20A 3NK8A 1MTSA 3DFLA 5C1XA 3IWMA 1C5UA 1C9TA 1XUFA 5J4QA 2AS9A 1EAUA 3A86A 2G8TA 3F0OA 2ZPQA 3MYWA 4ABDA 3ESTA 1FONA 3SU3A 2R2MB 5E2OA 1OWJA 1N1LA 2SFAA 3K6YA 2W26A 1TGTA 5CHBA 4NZQA 1H8HD 2G52A 3CS7A 1EB2A 3SW2B 1EUFA 1TNJA 1SGQE 4Q7ZA 1CBWC 3F68H 6CHAC 2F9VA 4KTUA 3TGKE 5JDUB 4AGJA 3UQVA 2AMPA 3SNDA 2ANYA 2FYRA 5ETXA 3STJA 1MTWA 4PROA 5EG4A 3PLPA 3PWCA 4RI0A 1GJBB 1F0UA 1C2FA 3FAOA 3NWUA 2WPMS 2XXLA 3ATIA 1HJAC 2Z3CA 2ZKSA 3VB5A 5AF9H 3BG4C 2WPLS 1TIOA 4NA7A 4SGAE 1KDQB 3E90B 1HCGA 1BHXF 3QZQA 2BX4A 2PKSB 2BXUH 2IN2A 1HB0B 3KEEA 5DP3A 5HGGA 4Y10E 3MH7A 1AZZA 2G81E 1C5SA 1P2QA 1EB1H 2ZDVH 4I8JA 2ASUB 3KHVA 3NUMA 1V2VT 1GVKB 1GBMA 3B23B 3ATLA 3ODDA 1TMUH 3STIA 3G01A 1IQMA 2FESH 2P8OC 4MTBA 4X1PU 1NM6A 2ZDAH 2ZHEH 4ZHLU 2PTNA 1HAVA 3T29A 4LZ4B 1XUGA 3UR9A 1V2JT 1QB6A 1FI8A 4ABEA 3P95A 3ZVAA 1O5DH 4O97A 1CBWB 1TPSA 6CHAB 5CMXH 1NESE 1O2TA 4FETA 4QT8C 1GJ6A 4IN1A 4HGCA 2J34A 5EPNA 2PV9B 1SQAA 1EQ9A 3TNSA 8GCHF 4CBOA 3AVZA 1KLIH 1Z7KA 3HATH 3W1EA 3MH4A 2ZA5A 2W6ID 1O3LA 3MO9A 3QZRA 2JETC 1O3BA 1H1BA 4LOYH 3OFND 1QURH 4TT3D 4AOQA 3BG4B 5DP7A 3BEFB 4JYVH 1YM0A 1C4V2 4MPVA 1JIRA 4INLA 3F2HA 1KIGH 3IG6B 4FVBA 4KKDA 1TA6A 2FTMA 4BXWA 1D3PB 2O8UA 2ZGCA 1KDQA 1DT2A 1SOZA 2Y82A 5FBEA 3T27A 1GBCA 1FY8E 2WPDD 4NA8A 1QQUA 1LTOA 3V7TA 1UO6A 4Y8YA 1ACBE 2HOBA 3GY8A 5C1YA 2BXTH 3P6ZB 3MO6A 1NRPH 1TQ7B 2XWBI 2LP6A 2P8OB 4NA9H 4ASUD 3A87A 4XBDA 3UWJH 1IQLA 1HAOH 4H42U 4ZHMU 4CH8B 2YNBA 1QNJA 1ZSLA 1VR1H 1P03A 2NU0E 1UK4A 3M61U 1SGPE 1AKSB 1ELDE 1AIXH 3RM0H 4CBNA 1QA7A 4FUCA 4SGBE 1A0HB 1OOKB 3BTDE 3A83A 1RTFB 3V3MA 3ZZ9A 3KNXA 3SV9A 2HPQH 4TPYA 4YOIA 5GCHG 3DHKH 1C5WB 1HDTH 3LONA 1P2JA 1UCYE 1GBBA 2FMJA 5FAHA 1T8OA 1SLUB 1UVTH 3F0PA 1K0HA 1WBGB 1OWIA 3RXLA 2Y81A 2BMGB 2KCYA 3CENA 1ELEE 1G30B 1MAYA 2K0QA 2F83A 1ZLRA 4FU9A 1F92A 1GHZA 1HIAB 3FZZA 3ZVGA 3SNBA 5IDKA 4JZFH 2K8IA 1MD8A 1EOJA 3TVJB 5EW1H 1SI5H 5FBIA 4JCNA 3LDXH 2ZP0H 1U6QA 5E8EH 1S0RA 1EP5A 1TGBA 1YY3A 3ZVCA 4DCDA 1W8BH 2A1DB 3RXMA 4ASHA 3WW7A 3SNAA 5CHAB 4Q63A 1Y5UT 1ZHMA 2H9HA 1L0ZA 3BTME 1QJ1B 2ZECA 5EIYA 3SUFA 5HMAA 1O2MA 1EJNA 3A84A 4FUHA 1GMHF 1UCYK 1ZHPA 2RA3A 3GY6A 1Z6EA 1WCZA 3LH3A 1DITH 1Q2WA 1ZSKA 6GCHF 2QF5A 5C0UA 4MNWA 5HM9A 1ESAA 2TGTA 4MPUA 3H7OA 2NU4E 1W0KD 3M3TA 5F8XA 3TGIE 1AKSA 4I33A 1BBRE 5LPEA 1J16A 5T6FA 1FPCH 1FIZA 2LNCA 1C5LH 1HV7A 2JDID 2ZFQH 4AN7A 2GKVE 3MWIU 2AIPA 1TONA 4DOQA 2PP6A 1N8OC 2NU2E 2G51A 2Y5HA 4ACBA 1PJPA 1ZMNA 4AORA 2VIVA 2ZO3H 1GCDA 1CGIE 4K60A 1TMBH 4ZXXH 1BMNH 1WYKA 2EI8A 1ETTH 1PPZA 1HAXB 5T6GA 2HNTC 3KYFA 3E8LA 3QX5H 4MQAA 1RIWC 3MO3A 1UTMA 1HIAA 2DUCA 2C8XB 1BMFD 4XD7D 3M36A 3NZIA 2HNTE 3F9FA 1Z8IB 2A31A 1LPZB 1QB1A 3EYDA 1S5SA 1O3CA 3A8CA 2BD5A 1OXGA 4B75A 1E37B 3IITA 4CR5A 1UCYH 1K1NA 2ANKH 4MLFB 3E0NB 3RXUA 1BTZA 1GJ4H 1KXEA 1MU6B 1THRH 3N7OA 2V3MA 1BJVA 2P3UB 2WV9A 3AW1A 2ZEBA 2R2WU 1NT1A 3OU0A 1AHTH 1O5GH 3Q00A 1TNIA 2QGRA 4AX9H 3OY6U 1M9UA 1O5FH 3K2UA 4UONA 2GT7A 2A7CA 3BTGE 2ANWA 1V2OT 2FWWA 1S6HA 3HGNA 2Z9GA 3OAAD 2FOHA 1N8OB 4UD9H 2OXSA 4ZH8A 1IHSH 2A32A 4H6TA 3U8RH 1P06A 3MTYA 1SGIB 3BTFE 1P3EA 2Y7ZA 1GI5A 5AHGH 5GNDA 1GHBG 6LPRA 3URCA 1K9OE 1JRTA 1QQ4A 1SGFA 4THNH 4ZROA 3DSGA 1ZPZA 2Q1JA 1ZJDA 1OX1A 1ANCA 1W0YH 4X1RU 1S6FA 1P2NA 1RIWB 4B71A 1AFEH 4WH6A 1O2PA 4ZKRU 3MMGA 2A4GA 1C5XB 4HI3A 1ZPCA 1YPHE 5F03A 2ZG0H 5EXNA 3AW0A 2F4LA 5FPTA 5EGMA 1P2KA 2VINA 4RT0A 1P04A 3VB6A 1DS2E 1KYNA 1LHDH 1VCQA 1ELAA 2CJIA 2R9PA 2QV1A 2PUQH 3UAIC 2BVSH 4CRBA 4MNXA 1GI7B 1TB6H 4OS4A 2A45B 2F43B 1P2OA 1ELTA 3O8RA 2KFWA 1K1MA 1RFNA 2TPIZ 2CXVA 2VU8E 2J98B 3M7UA 4OM9A 2KCAA 2QF3A 2XWAA 5FCKA 1EFRD 1UHBB 5LPFA 1P05A 3BEIB 3P8GA 2V7QD 5GPIB 2UUKB 3RP2A 1PPGE 1WTHD 2JIZD 1TRMA 2QN5T 2FI5E 1D3DB 2QA9E 4AGKA 1NU9A 1NZQH 3MH6A 2ZZUH 2AEIH 2FTLE 1SPJA 1Y3VA 4BAHB 4BAKB 3OEHD 4ZMAH 2B0FA 2HLCA 2Z9KA 3F2FA 1BTPA 2Y6TA 3ATWA 1MKXK 2ODYB 1LQDB 3LGUA 2WHXA 5ABWA 1C5VA 2ZHFH 1MKWK 3U1IB 4HFPB 2Q6GA 5DO4H 3RU4D 1YYY1 1OPHB 1S85A 1TX8A 2VWLA 4B1TA 2B5TB 2BLWA 4IS5A 5JBBS 4INKA 1UTPA 2OCVB 1B7XB 3LT3A 4FUBA 3PTNA 3FOAA 1SVPA 2GCTC 1RD3B 3O8CA 1QBVH 5TJXA 2LPRA 1E0FD 1DWBH 3FANA 2A4RA 1WOFA 2J98A 3EA9A 1ZJKA 3M5LA 5A8YA 1YGCH 4I8LA 2ZWLH 3U28C 1AVGH 1LQEA 1O2IA 1UHBA 4OGXA 3ZYDA 1ZYOA 2BQ7B 3UOUA 5JPMH 1XXFA 5GCHF 2ZDMA 1C9PA 2QAAA 1TPOA 2ZFFH 3RMNH 5JBTA 1B0EA 1F7ZA 4AG2A 2SGDE 2STBE 1L1JA 1NC6A 1MZAA 1O0DH 3FFGA 3P17H 4RT1A 2BD3A 2HVYB 2G55A 1TFXA 3HKJB 1MKXH 1SFQB 1KLTA 1O2UA 1FN6A 3HPTB 2AGEX 3UQOA 1MTNC 5A2MH 2VVVA 1P2IA 2ESTE 3A8AA 1FNIA 1ARCA 5A8XA 2BD9A 1PPHE 1INCA 1A0LA 4X6NA 1O5BB 3A7WA 4YM9A 3ZYEA 1O3AA 2FI3E 3A7ZA 3LH1A 2KR7A 1H9HE 4I32A 5T3HA 1KLJH 1QZ8A 3UUZA 3FP7E 3A88A 3CP7A 5I46H 1KXAA 2ZGXH 4DIHH 2BZAA 4F55A 1YPGH 2P16A 4I86A 4A5TS 2BDCA 2K1QA 5F8ZA 4MG3A 1HJ8A 5C1UA 3GDVA 1C2MA 2BD8A 2ZDNA 3OX7U 3GCOA 1G3EA 4TY7A 5EW2H 1FX0B 1Z6JH 2UUFB 2BDIA 4Q4LA 1FY3A 3T28A 1SGNE 4X1SU 2XBXA 1BQYA 2J5UA 1XVMA 2JKHA 2GT8A 1FIWA 1Z1JA 3TU7H 1O5CB 1WU1A 1IQHA 3GY7A 1MTNB 3BTHE 2JJ1D 1O30A 2PTCE 3O8BA 1V2WT 3S9AA 3VGCC 1FAKH 2TIOA 1L1NA 4AFSA 5JBCS 3FVFB 4P02A 4RSPA 5KECA 2BY8X 1IQKA 1V2NT 1JOUB 1TGSZ 5GXPA 1MUEB 1S0QA 2OINA 1EOLA 3ATKA 3RU4E 3PMJA 1F5RA 3LJJA 1LKBA 4Z0KA 4CRFA 1C2HA 1EZXC 1C2EA 4K8YA 2J94A 3S7KB 3V0XA 4MNVA 3EE0B 1W7XH 1AU8A 4U2WA 2FOEA 3Q3KA 1VGCC 3FP8E 1C2IA 3BTQE 2QIQA 1CU1A 4UDWH 1TPAE 3SUGA 2D26C 1BTWA 4K5ZA 3RMOH 3SZNA 1O2OA 3OEED 3RXEA 3QLPH 4BTIB 2ZTZA 5L30H 1J14A 2VVCA 3ITIA 5F6MA 1OSSA 4Y79A 4OS7A 3LGYA 1GHBF 3GYLB 1D9IA 2V0BA 1LVYA 2M2AA 4JYUH 5F53A 3SQHE 4GUXA 3VGCB 1YPLH 2FS9A 3SO3A 2OBOA 5FX6A 5EXLA 3AAVA 3S69A 2P3TB 1AFQC 1H8ED 2WSSD 1HBTH 1O3DA 1YF4A 4ZKOU 3PV5A 1TA2A 5EJLA 1MCVA 4A92A 1SGFG 1FN8A 3SU4A 3PRDA 1OWKA 2BDGA 2FPZA 1HJ9A 2Y5FA 1BRCE 2FX6A 4Y7BA 2PW8H 3DUXH 1OYTH 5DG6A 1OKXA 1SKYE 2ZGBH 3A8DA 3L3TA 1BHXB 3E0PB 4FOUC 4Y7AA 3LC3A 4D7FA 1VGCB 3ATMA 2P95A 3QGNB 1TX6A 3SHCH 1O2QA 2ZGHA 4ZAEA 2JJ2D 1TOCB 1TBQH 3SV8A 4FVDA 1ELBA 2DE9A 2PLXA 2FX4A 2ZFTA 1GBKA 1S82A 2CHAC 3SJIA 1ZSJA 3UY9A 5J4SA 3EGKH 1F5KU 5L2ZH 2CF9H 1C1VH 1GG6C 4X1NU 4X2YA 1WQVH 1Y3UA 3GISB 1MZDA 2SGEE 3SYJA 2XBVA 3OTJE 3NRLA 1ID5H 1XXDA 1AFQB 3I29A 1O2YA 4CRCA 3FN8A 2AGIX 2AHME 1ARBA 4NIWA 1XKBC 2KAIB 3C1KA 3RXPA 3UWIA 1G37A 2Z94A 1JWTA 2FI4E 4X6OA 4NCYA 1EP6A 5DP9A 1C5ZB 4Y8ZA 1C2LA 2R3UA 1GHAG 2VWNA 3M7QA 1T32A 2G4UA 3GYMA 1QL9A 2GVFA 3SORA 2PSXA 2BDYA 3C27B 1CE5A 1GMDG 1JRSA 6ESTA 2FIRH 4B2CA 1UTNA 1DWDH 3MU5A 2XNDD 1P0SH 1HPGA 2CHAB 3D62A 2VH0A 1RGQA 3MU8A 4U30A 1IQEA 1AY6H 3MOCA 1IAUA 4I8GA 3GY4A 3GOVB 1C1MA 1L4ZA 1TLDA 1QR3E 3K9XB 1B5GH 2O8WA 1GG6B 1FDPA 2ZU2A 4B76A 4YOGA 1ZGVA 3R0FA 2P3FH 2W7UA 2Z9LA 1GL1A 2HPPH 4AB8A 1GMCG 5FPSA 2WV5A 4IBLH 3E6PH 1TNKA 1O2RA 1O2NA 3M5OA 1PQ8A 1IQJA 1GI4A 4AC9A 3EA8A 5CHAC 4NG9H 2BLOA 1CA0C 4GHQA 5TCCA 2GV6A 4JZDH 2DE8A 1P8VC 1ZGIA 4YZUA 3PM3A 3TK9A 1O36A 1BRUP 5L2YH
chains in the Genus database with same CATH topology
2YNAA 4ISOA 5EU8A 2ANMH 3M37A 2KAIA 3PLKA 1GBHA 1O3FA 1V2ST 4TWWA 3U1JB 2FOMB 4NIVA 2ZHWH 1GI9B 3HK6B 3SBKA 1ANDA 2VIQA 1A5GH 3M5NA 3W95A 4MNYA 3RXBA 1DDJA 1QL8A 2FOBA 4ABJA 1SB1H 2BDHA 1FMGA 5E0GA 3T5FH 1WQSA 1SG8B 2J95A 2D2DA 1TRYA 1UVOA 1SLXB 2FDAA 1DXWA 2GCHG 2VIPA 4K3JA 4AB9A 4X8TH 1EJMA 2Y7XA 5LGOA 1NY22 1O2XA 2PWXA 1GHXH 1D3TB 2V3OH 2FS8A 1CT0E 1BUIA 4IN2A 2P59A 3OSYA 5DGJA 1HAIH 1SGDE 3KQDA 4YT6H 3RXOA 3QTVH 1CA0B 2FYQA 4DY7B 1UK2A 3MI4A 3I78A 3DT0H 1GVZA 2PGBB 2CF8H 1LPKB 3M35A 5F8TA 4K1EA 2ZCHP 1DXPA 1BTXA 2EI6A 1P10A 1GI2A 1LVOA 1VCPA 1NFXA 1PPCE 2JH5D 2A4QA 1SC8U 4OGYA 1J17T 4KGAA 1XX9A 2GMTC 3P8OA 3RU4T 4O9VA 4Y6DA 1SLVB 4Z6AH 2CV3A 2BY6X 1CSOE 1O3GA 4JZEH 2IPHA 1ZPBA 3RDZA 1K2I1 2Z6BD 4E7RG 1O34A 1N6XA 4GAWA 2G00A 4BAOB 2GD4B 4IGDA 1LHGH 2O8LA 3TH4H 1QJ7B 1Y8TA 1DLEA 2GZ7A 5FX5A 2Z9IA 2XYAA 3M5MA 1YCPH 1F0SA 1K21H 2D8WA 1GBAA 4BXSA 1D6RA 1SBWA 2ZGJA 4AYYB 1EPTA 3V12A 4AZ2B 1GI3A 1KSNA 1BBRK 3SJ8A 4TPIZ 5FCRA 1G3DA 1S81A 1Y3YA 5DK1A 3ZVFA 1OP0A 1ANBA 3CS0A 1KXFA 1W3CA 5C5NA 5A0AE 1UTJA 1TAWA 3ZZ5A 3LGWA 5DP8A 2OUAA 1IHTH 2A4OA 3T62A 1AE8H 4BTUB 1A3EH 2GMTB 2J9NA 4BANB 4DVAU 1AGJA 3S0NA 1FY1A 1E36B 2VJ1A 4Y11E 1V2QT 4XDEA 1GJ7B 4DGJA 2QY0B 1EAXA 5H4IB 1SFIA 2ZF0H 2VGCC 4J1YA 1O2KA 2WUCA 1C2GA 4CR9A 3ZVBA 1HAZB 4ABBA 4JMYA 2WINI 1MTVA 5HM2A 4TY6A 3UNSA 5DP5A 2C8YB 4YO9A 4E05H 1XUIA 4B74A 1Q31A 3TLOA 1RTLA 1BBRH 1SR5C 2ULLA 3MFJA 2IOTA 4RN6A 1SQOA 1T8NA 3VXFH 1CT2E 1GBLA 1K1PA 1SGEE 2BVXH 1EZQA 5FPYA 1VZQH 1JIMA 2BQWB 1TABE 2ZTYA 2TGDA 1LCYA 1AUJA 1GL0E 2FOCA 2AFQB 3QTOH 1WTGH 1EKBB 3SNCA 1DUAA 1W2KH 1VCWA 2RCEA 2F3CE 1P2MA 1Y59T 2WUBA 1A46H 4DG4A 3TK5A 2J92A 1C2KA 2VGCB 5L6NH 2BY5X 2ZHDA 4GCHG 1MD7A 1Y3XA 4ABHA 1IQFA 1GHAF 1S83A 1KXBA 1TNHA 1HAPH 1DY9A 1QFKH 2QC2A 4MPXA 1SL3A 2HNTF 4X8VH 2R3YA 1GMDF 1P57B 3A8BA 3DFJA 1P09A 2XRCA 1XUJA 3RUOA 4X6MA 1T8LA 1K1OA 1W13U 1O2SA 4A1VA 1BMAA 2HGTH 2ZCKP 1GI0A 3RXFA 4U32A 1D6WA 3ZZBA 1RTKA 2Z7FE 3SOSA 3ZVEA 5EODA 3F6UH 1SMFE 2FOGA 2AH4X 5ESTE 4ZKSU 2W3KA 1BOQA 5JYIA 2FZZA 4FUFA 1DICA 3MNBA 1GMCF 2ZQ1A 1ZTLA 3LC5A 1QIXB 1OP2A 1PPBH 4Q2KA 4UFEH 1EATA 2GDDA 3ZV9A 1XUKA 2GZ9A 2FOAA 2GTBA 3F1SB 1MTUA 5GJ4B 3ZV8A 1GGDC 4ISLA 1Z1IA 1P02A 5DKMA 3E3TA 3GCTG 4FUJA 3RXRA 5DP4A 1MQ5A 2ZDKA 1IQGA 1MH0A 2PHBA 3RLYH 3SU0A 5A09A 1Y3WA 1C1OA 3RXHA 2AIQA 1FPHH 3BTEE 1A7SA 3LIWA 4X2XA 8ESTE 3M3VA 1BMMH 2FOFA 2UWOA 3S9BA 2ZFSA 4MVNA 4K8BA 4GPGA 4I7YH 3UIRA 1YBWA 1V2LT 1ZTJA 3KCGH 1FY5A 3MNCA 1C4U2 1RS0A 5JB9S 3NXPA 2GCHF 2BZ6H 1XVOA 2XTTB 5A8ZA 4JK6A 3SN8A 2V3HH 1H9IE 3PV4A 1HFDA 2I6QA 3V13A 2V35A 1FUJA 1KTSB 4OS6A 3O8DA 1B0FA 4K1SA 1Z71A 2CN0H 1TNLA 2I6SA 1C2JA 1TX7A 2F9OA 3PMAB 1ELGA 2VWMA 1NU7B 1ZRBA 4YLQH 1GGDB 3BTKE 2OC8A 1C5QA 3M7TA 3P8NA 4LK4A 2ODQA 2UWPA 1O2GH 2BY9X 2W7SA 3TH3H 4DIIH 1QGFA 3ZVDA 1OYQA 3ELAH 3TJVA 4A1XA 4WVPE 2O9QA 1PPEE 2Y80A 1GJ8B 1DVAH 1LHEH 1MBMA 1T4UH 3SNEA 1SLWB 2H2ZA 2WV4A 3BIUH 1P11E 4GHTA 1V2KT 3TGJE 1BA8B 2OP9A 2NU3E 2W5EA 4WH8A 1GI6A 4O3UA 1NROH 1KY9A 5LH8A 3RXJA 3BG8A 1NRRH 4B2AA 1GBIA 2P94A 3U98H 3AASA 3L6PA 1KXCA 4AFUA 4D76A 4ABFA 1ORFA 1YKTA 3SGQE 2ZFRH 3B9FH 2VNTA 1ELFA 1EASA 2TGPZ 1ESBA 1NRQH 1RJXB 5LPRA 3LGIA 2ZU5A 1ABJH 1YLDA 3P92A 5JBAS 1O5AB 3ZZAA 1TGNA 8LPRA 2JH0D 4UFFH 5G4BA 1NN6A 1GBJA 2BD7A 4JK5A 1WUNH 1ELCA 2OC0A 3Q76A 8KME2 1EZUC 3EDXB 1G3BA 1O32A 1SOTA 3MNXA 4ZUHA 2J2UA 2OQ5A 3A80A 1C5NH 4F49A 1UTLM 1UVSH 1OWDA 3TJUA 4D8NA 5JB8S 2GDEH 1QBNA 3VXEH 3TK6A 4JZ1A 1H9LB 2P93A 2FO9A 2B9LA 2NU1E 3SV7A 2B7DH 1FXYA 4ZHAA 1F2SE 2C93B 1TRNA 5BPEA 2SNWA 1YPJH 4KTCA 2F9UA 1O35A 4Q80A 1YLCA 1DY8A 3TITA 1TYNA 1JXPA 2VWOA 1HAGE 4UEHH 1FLEE 1P9SA 1KTTB 5TCAA 1DE7H 1BTYA 3W94A 3UNRA 1DOJA 2CMYA 1RXPA 2OC1A 2ZPSA 5EXMA 2BD2A 1AN1E 1EAWA 2R0LA 5DPAA 1CVWH 2H9TH 1G2LA 1P3CA 2ZU1A 3SU2A 4AYVB 1Z8JB 2AMQA 1IQIA 2J4IA 1GHVH 2SGAA 3JZ1B 2UUYA 1Y5AT 2XBYA 1AD8H 2VIWA 1GHWH 4O3TA 2ALPA 4I8KA 3SJOA 1SGRE 1O2WA 3QK1A 1GI1A 1FV9A 1F0TA 5T6DA 3ZZDA 4M7GA 1JBUH 1QCPA 3EQ0H 4ISNA 1AE5A 1VJAU 3UFAA 1J9CH 3KN2A 2GGVB 1MMJN 2YOLA 3PMHB 3SUEA 4YOJA 2PUXB 2OTVA 1GJ5H 3QGJA 4GCHF 3LJOA 4A6LA 1DFPA 4CRGA 3U8TH 4Y76A 1ELVA 3RMMH 2PKAB 2WYGA 1LPGB 1UTOA 3GDSA 1V2UT 3DA9B 2O8TA 2THFB 3GCHB 1HAYB 2BQ6B 1UK3A 3RXAA 4MDSA 3DD2H 2HRVA 2A2XH 2TRMA 3ZZ6A 2OD3B 3PO1B 1MU8B 2Z9JA 1VITG 4DJZB 2BY7X 2J38A 1BRAA 4NGAH 2BHGA 4ABAA 1O37A 1P01A 2EA3A 3VB4A 4KTSA 2WPJS 1CHOG 3U69H 2WYJA 2UWLA 5A0BA 5HYOA 2D1JA 1A2CH 1O5EH 1Q3XA 4ESTE 2BD4A 2FEQH 1V2TT 5A0CA 2ZC9H 1AB9C 3A81A 1K1JA 1Y5BT 1C1WH 2EC9H 3RXIA 1V2PT 2A5KA 3UTUH 1UTKA 1LMWB 1SGCA 1V2MT 3Q3YA 3NPSA 3UR6A 2ZHQH 5DP6A 1O3NA 1OWHA 3GCTF 2H1UA 4NSYA 1DANH 4X1QU 1PYTD 1DSTA 2XNIA 1A5HA 1HXFH 4FUEA 3UOPA 5K0HA 1GWAA 2XC4A 4D9RA 2ODPA 3K6ZA 1AQ7A 1WV7H 4BAQB 4IC6A 1EPTC 2PKAA 4RKOB 1D3QB 2CGAA 3D49H 2NWNA 1QBOA 2H5CA 5AFZH 2AMDA 1GBDA 3BV9B 1K1IA 3RM2H 1HJAB 4JZIA 4D9QA 3KF2A 1T7CA 5EPYA 3HK3B 1W12U 7ESTE 2A5IA 1K22H 4INHA 1ESTA 3RXSA 3HKIB 3EA7A 4A7IB 2H6MA 3R3GB 4IMQA 1HGTH 1W11U 3QUMP 3GY3A 3H5CB 1C1TA 5B6OA 1WSSH 1K28D 2AYWA 3SGAE 4E06H 3KQEA 4LZ1H 5BRRE 2G5NA 2XC0A 2SNVA 2BOKA 4ABIA 1AB9B 3PYHA 3RXDA 1AZ8A 4UE7H 2PGQB 3TPIZ 4IC5A 1LHFH 4ZXYH 1GBFA 4NIXA 5K7RA 9LPRA 4ISHH 3P70B 1O3PB 1MAXA 4A1TA 3HGPA 3NKKA 3URDA 1TGCA 4FU8A 3KGPA 3A7TA 1NRNH 7LPRA 1QJ6B 1AMHA 3KIDU 1C5OH 2QYIA 1EPTB 3UPEA 2BLQA 9ESTA 2BOHB 4XSKU 1C4Y2 1V2RT 1VJ9U 1YCPK 2XCFA 3TIUA 2JETB 1THSH 1V3XA 4O03A 2BB4A 1C1RA 1SQTA 4KELA 1NPMA 1QRZA 5I25A 1W0ZU 1FZZA 1LKAA 5HXFA 1YPEH 3TJOA 4Y8XA 2AERH 2A7HA 2XW9A 2Q6DA 4HTCH 1QB9A 1TQ0B 3VB7A 4R0IA 1ZZZA 2QXJA 4CH2B 3F9HA 1ZMLA 3SU1A 1ZOMA 1HYLA 1YCPM 4GVUA 1CQQA 1CO7E 5IYTA 3SI3H 1CGJE 1CGHA 3QWCH 4XFQA 3BN9A 3EAJA 2ZU4A 2ZPRA 3UREA 3LPRA 4F4OC 2G5VA 2HALA 1X7AC 4KP0A 3A82A 1ZR0A 1PYTC 1G32B 1F5LA 4ISIH 2C8WB 3RXQA 1UJ1A 3SI4H 3BEUA 4E7NA 1QL7A 3K65B 4GSOA 4MPWA 3S9CA 3QN7A 4Q7XA 1IOEA 1O2ZA 5PTPA 1FY4A 1NFWA 1J15A 5FXLA 1S84A 2A5AA 1EXFA 1O3HA 1N6YA 2BM2A 2Z3DA 4ZKNU 4YESB 1EJAA 1LO6A 5C2ZA 1Z8GA 5EOKA 1DM4B 3UNQA 3WY8A 1OS8A 2BYAX 2F9PA 3GCNA 2ZTXA 1E35B 3SJ9A 1W10U 2FODA 1XMNB 1TBZH 4X2VA 1GDQA 2W3IA 1T4VH 1BTHH 1AVWA 1C5TA 3F9EA 3RXVA 4AFQA 4OS5A 1EX3A 1DWCH 3F9GA 1C1PA 3BF6H 4R8TB 3GICB 3TH2H 2EI7A 4CRAA 3I77A 5CE1A 2PFEA 3BTTE 1C5RA 1ZRKA 1LDTT 1A3BH 3ODFA 4B2BA 4BTTB 1O2JA 2ZDLA 1DSUA 1TPPA 1CHGA 3PMBB 3LGVA 4RKJB 4K1TA 4WY3A 1FAXA 1TWXB 1A5IA 2PSYA 2BDAA 2VB0A 4YLUA 4D7GA 1G2MA 1O3OA 2GP9B 1VITH 1PQAA 4VGCC 1W14U 7KMEH 2Z3EA 2F91A 1YPHC 5AVDA 2QXHA 2M5TA 2RG3A 2ZIQH 4WMDA 3TNTA 3MHWU 1VITF 7GCHG 1NTPA 2TBSA 1ANEA 1O2LA 4FUGA 5AFYH 4IMZA 4NSVA 1CHOF 1ZTKA 2FLBH 3KQBA 3SGBE 3T25A 4K69A 4U01A 3NCLA 4AG1A 1HLTH 3A89A 3BSQA 4NIYA 3VB3A 2OQUA 3E16B 1ABIH 3PWBA 2GX4A 2QXGA 1O2HA 3OY5U 4ABGA 2WPKS 1EAIA 2ZQ2A 4NWKA 1O3JA 4HZHA 3T26A 1AWHB 1UMAH 2QXIA 4YT7H 3FP6E 2BX3A 4FUDA 1DWEH 2VH6A 1H4WA 1SSXA 4J2YB 1OP8A 2GV7A 3MU0A 3RC4A 2OLGA 4FUIA 1NFYA 1MBQA 3RXKA 2C3SA 1O2VA 2FP7B 4BOHA 2VVUA 2WPHS 1GPZA 1O39A 1RRKA 1LVBA 1QA0A 1O33A 2C4FH 5C3NA 1E38B 1THPB 3ENSB 1YPKH 3FZDA 1O3EA 4CHAC 2HVXA 4DW2U 4NZLA 5SGAE 2JH6D 3Q77A 4VGCB 4B73A 1W7GH 1AI8H 1AVXA 1QHRB 1K1LA 1GHYH 3SU5A 3RC5A 1HNEE 4H4FA 5FHTA 1GJDB 3MU4A 4IW4E 1P9UA 2OC7A 2O8MA 1UVUH 1WAYB 4Q7YA 3SHAH 1PQ7A 1BIOA 1TALA 1C5YB 1JMOH 4BAMB 2H9EH 1BRBE 4FXGH 1XKAC 1GCTC 4BNRA 2V6NA 4WXVA 4XOJA 1T31A 2GZ8A 1LVMA 1TOMH 1NS3A 2Y5GA 3D65E 3U8OH 3A7YA 4UFGH 2ZI2H 3GDUA 8GCHG 2SGFE 3E1XB 2F9BH 1AUTC 5E0HA 4OS1A 2C90B 2ZU3A 2ZFPH 1EZSC 4XE4A 3PROA 1CT4E 3VEQB 4Y71A 3SJKA 2WPIS 4CHAB 2IJOB 1G3CA 3RC6A 1E34B 1SHHB 5EQQA 4FU7A 2VIOA 1GDNA 1GBEA 3M3SA 1PPFE 2C8ZB 2UUJB 1YC0A 2G4TA 4WF8A 2XBWA 4I31A 3LKWA 3ZZ7A 2BVRH 1GJ9B 2VIDA 3PTBA 2HWLB 2R0KA 1P12E 3D23A 1SGTA 4K2YA 2A0QB 3ZZ3A 5GDSH 1MKWH 4CREA 5DJ7A 3SUDA 2OBQA 1C1NA 1CA8B 1L2EA 1FQ3A 1BB0B 2ZCLP 3S7HB 3MNSA 1GCTB 3SQEE 1TE0A 1UTQA 5EQRA 1C1UH 1NRSH 1HUTH 1LHCH 3LU9B 2FM2A 3AAUA 4NFEA