1MTSA

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structures of factor Xa specific inhibitors in complex with trypsin: structural grounds for inhibition of factor Xa and selectivity against thrombin.
pubmed doi rcsb
molecule tags Serine proteinase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtsA02
2GCTC 3SI4H 4ESTE 2W3IA 4IMZA 4IW4E 2GCHG 2FYQA 1EATA 1UO6A 1A7SA 1BTWA 2HPQH 5C5NA 8ESTE 1NU7B 5GWZA 2WPHS 2FP7B 1SI5H 3P17H 4AZ2B 2FZZA 1H9HE 3ZZAA 1UCYK 1BRBE 1LQEA 2JH5D 4R8TB 3RXEA 2GMTC 4ZKSU 8LPRA 1C1NA 1UVOA 3GY5A 4GCHG 1ID5H 1FI8A 1VCQA 1SC8U 1H9IE 3EA8A 1O2RA 1O2PA 1YPLH 1BTYA 1CT2E 3K6ZA 4AX9H 1NRSH 5EXMA 5CE1A 4A7IB 1OYQA 2CXVA 2C4FH 3TGIE 2F9UA 2SGEE 4K5ZA 1IQNA 4A5TS 1GHBG 4IS5A 4RN6A 1UTPA 1C9PA 1PPZA 1UK3A 4BTTB 4O03A 3HKIB 1EPTC 4R0IA 4Y8XA 3RXBA 2HLCA 2H6MA 3D62A 1BMNH 2PSXA 2OXSA 5ABWA 1GG6C 2FOFA 3URCA 4BOHA 1SGIB 2G52A 5J4SA 1MKXK 1G37A 1MCVA 3K2UA 1GVLA 4ZKOU 3DA9B 4WJG2 2VIDA 1PFXC 4J1YA 1OYTH 1GI7B 1C1OA 2H5CA 2A2QH 3OY5U 5EU8A 2H2ZA 2QXJA 2ZGJA 1ACBE 1C5PA 4U32A 3S9AA 4BTIB 1X7AC 1LHDH 4ABIA 1C2DA 1NC6A 1VITH 3BTQE 2W26A 2FTMA 3FFGA 1CHOF 3JZ1B 1TBQH 1BOQA 1RGQA 1P2NA 1V2WT 1W3CA 2GDEH 3TITA 3P95A 4KTSA 1P9SA 1SLUB 2A5KA 1J8AA 1CU1A 4O3UA 1VCWA 4XBCA 1H8IH 2FM2A 3C1KA 2RCEA 1HYLA 4J2YB 3U8RH 1QQUA 1DWDH 1F0UA 1HLTH 1NZQH 2FOEA 3GYMA 3LGYA 2HALA 1GL0E 3OY6U 3TNSA 3SNEA 4CR5A 2Q6DA 1YLCA 1B0FA 3LC5A 1O3HA 1NRPH 3RM2H 1O2NA 1YCPK 4GPGA 2C8XB 2HOBA 3HKJB 2FEQH 3ITIA 1TMUH 3QZQA 3MH7A 2ZCHP 3IWMA 1P9UA 3GYLB 1Y3UA 2GCTB 2ZO3H 5DP8A 2GV7A 2A1DB 8GCHF 1QTFA 2AYWA 4X8UH 2GCHF 1SLVB 3ATWA 3I78A 4YLQH 5A0CA 2NU4E 4Y10E 1O2UA 1ZHMA 2BD3A 4XDEA 1O2KA 2DE8A 2OD3B 4YT7H 5EW2H 1BB0B 4GHTA 1ANBA 1QBNA 2BB4A 2GMTB 1GBEA 1LVOA 1TNLA 1HGTH 3KQCA 1WOFA 2BD7A 4B74A 1C2LA 2EI8A 2ALVA 1QRXA 2EI6A 2F9VA 1DANH 3PMBB 1CGJE 3S7KB 3ZZ3A 2TGDA 3Q3XA 1GHBF 3IITA 1NFYA 1RS0A 4BTUB 2ANWA 3A7XA 3FVFB 4CREA 1QJ7B 4INHA 8KME2 2YNBA 2A4RA 2FOAA 3EA9A 5T6FA 6CHAB 2QCYA 2IOTA 1GG6B 1DX5M 5LPRA 1DM4B 2AGGX 4FU9A 1ZOMA 1O0DH 1BTPA 1Q31A 1YPHE 2LNCA 2VVCA 2W5EA 1C1WH 1CA0C 5GPIB 2OCVB 3UWJH 3MNXA 2A31A 2FMJA 3DD2H 4NA9H 2XW9A 4UE7H 2GKVE 3GCHC 1LHCH 1YPJH 5F6MA 2F3CE 3PLBA 1YKTA 1B5GH 3CS0A 3BTTE 3MU4A 4F4OC 5A8XA 1TX6A 2GVFA 3R0FA 1HJ8A 1T8MA 1Y5BT 1L4DA 1YPEH 1S83A 1P2OA 4MTBA 1Z6EA 2HNTC 1HB0B 1HXEH 3QK1A 2IPHA 3ZVAA 1O2HA 1O5DH 1WTGH 1EUFA 1RIWC 4WH8A 3T62A 2PFEA 1GJ9B 2NU3E 2ZDNA 4B1TA 5CHAB 4JZ1A 2ZIQH 1A5HA 3TGKE 1ANEA 1BTZA 3F1SB 5DP9A 1O37A 1GBCA 1AFEH 2QY0B 1LQDB 3M3TA 4OS5A 5C1XA 1C5MD 1AWFH 1F5KU 4FVDA 3SV6A 1KTSB 2WPMS 1Q3XA 4WY3A 4MNVA 1ELTA 2Z9KA 3RU4D 1C1TA 2QXHA 4ZKRU 2ZG0H 4ZXYH 2LPRA 1VGCC 1S85A 1TQ7B 1GBHA 3SN8A 1MAXA 4AG1A 5AVDA 1TRNA 1FY4A 1UCYE 3TJOA 2RA0A 1ABIH 1XUGA 3RXJA 4ZXXH 1GHZA 3PROA 1W7GH 3L6PA 4ABEA 2AMDA 4DT7B 1EP5A 1GBJA 3GY4A 1FLEE 2IN2A 1DSTA 1GDUA 1V2MT 1TNIA 2XNIA 1UJ1A 1L1JA 4E05H 1KXEA 2ZPQA 4NA8A 5ESTE 1U6QA 1NRRH 4KP0A 1FONA 1P03A 4X6NA 4CRAA 1WYKA 2WV4A 1FN8A 1UTMA 3TK9A 1FXYA 1EAUA 1C2GA 4DCDA 1BJUA 2BDBA 1O34A 1RRKA 2B8OH 4B75A 3SGQE 3U69H 3BTGE 4Y0YE 4I8HA 1ANCA 2QGRA 2ZTYA 4DIHH 1EPTA 5BPEA 3TU7H 1CA0B 4NWKA 2H1UA 1NRNH 1YC0A 1AMHA 3KHVA 1O2XA 4IMQA 1GI8B 2VGCB 3TGJE 4K2YA 3V7TA 4A92A 4ISNA 3T29A 7ESTE 3SV8A 1O2SA 2FS9A 3SI3H 2BD8A 1GJAB 1P09A 3KL6A 1SGYE 1XKAC 5T6DA 4KELA 3NXPA 2B0FA 1BBRH 3K9XB 2P8OC 2BDCA 3BSQA 2CMYA 3PB1E 1OWKA 1TPOA 3ATLA 3LGWA 2ZDLA 3A81A 1SHYA 2F83A 3LGUA 2C3SA 5A8ZA 4WF8A 5DK1A 1MMJN 2AS9A 2VU8E 5H4IB 1RIWB 3RXDA 1JIRA 1RD3B 1JIMA 4K1TA 2PKSC 1C2KA 1TWXB 1OWJA 1SQAA 4JYVH 2KAIA 1C2HA 3PM3A 1SLXB 4WH6A 1UTOA 2ZHFH 1GDNA 1O2WA 1O2GH 3SUDA 4X6OA 1O36A 1SGFA 2O8WA 1UVTH 2BLQA 1HAZB 3ELAH 1TPAE 2ZFRH 1A5IA 3OYPA 4INLA 1MD7A 4D76A 1O3AA 5FPTA 1C1RA 1DDJA 3PYHA 1C5XB 1GCTB 4LK4A 1E37B 3TJNA 2STBE 3T27A 3U8OH 1O3PB 2F9NA 3KNXA 1UVUH 4AFUA 1O39A 2TGTA 3M3SA 2TIOA 2VIOA 1HXFH 1TRMA 2ZPRA 3KGPA 1LPKB 3UQVA 1KYNA 4K1SA 3RLYH 3T26A 3SGAE 1YPGH 4FUCA 1L0ZA 3SW2B 1JWTA 2ZCKP 1GJCB 5C20A 1DLKB 1MKXH 1WCZA 3MH5A 3NCLA 1ZRKA 4UD9H 3ZZ7A 1C2JA 1K1MA 1K1NA 1IHTH 1TX7A 2ZU3A 3V0XA 1FUJA 2VWMA 1RTFB 1HIAA 4UFFH 3UR9A 1BHXB 1DS2E 1ZLRA 3QZRA 2BY8X 2ZWLH 1TB6H 1C1MA 2AGIX 2RA3A 1ZGVA 4ISLA 1P2KA 1AKSB 1P06A 3PWCA 1LMWB 1BRUP 1HJAB 2A32A 2M5TA 3A7ZA 4JK5A 4NSVA 1OPHB 3Q3KA 1QY6A 4H42U 1T4VH 3M3VA 4YOGA 2FODA 2R3YA 2SGAA 1F92A 3VFEA 1ETTH 1TE0A 1PQAA 3G01A 1OXGA 1E0FD 2XBYA 1TLDA 4Y8YA 2O8UA 4AFSA 2AMPA 1O5CB 3SUFA 1ZPCA 4CH2B 1CHGA 1MCTA 3UUZA 3KQDA 1YYY1 2BOKA 4A1XA 5JB8S 1F0RA 1C5LH 2D26C 5A09A 2PKSB 1HAPH 1XM1A 1D3PB 2ZHQH 2BX3A 1PPGE 3NZIA 1J15A 4Q80A 1GJ4H 3AVZA 5HM2A 2BVSH 1GBMA 1ZMJA 1B7XB 3LH1A 1D3DB 3M61U 1E35B 2FLBH 2ZFTA 3L33A 4WXVA 1T32A 1FY8E 3UNRA 3UFAA 1D3QB 4X1SU 5TCAA 3UTUH 4FUBA 1LTOA 2GDDA 1TNJA 2ASUB 3A86A 1GI9B 3UOUA 2ZZUH 3GCTG 4AYVB 1O2QA 1JXPA 3QTVH 3R3GB 1ZZZA 2R2WU 1O30A 2A7HA 3GISB 4DIIH 1S0QA 6ESTA 1C4U2 1K1LA 3ZVGA 1TX8A 1MZDA 2WPLS 3SNAA 3RXVA 1FZZA 2ULLA 4NFEA 3TK6A 2F9BH 3BIUH 4ABDA 2BD4A 1C1SA 1MTVA 2XC4A 2V3OH 1O5BB 2WUBA 4D8NA 4B2BA 4U30A 2ZNKH 2SNWA 2Z3EA 4ABFA 1SOZA 4UDWH 3SU5A 2RDLA 3BTDE 2AFQB 5L2ZH 4GAWA 4H4FA 3T2NA 1Y5UT 1CGHA 3LJOA 1B0EA 1V2TT 3ODDA 1S82A 1QBOA 1NROH 1W10U 4NIXA 2D1JA 4X2YA 5HM9A 1FV9A 5DKMA 3MU0A 3VB7A 2BQ7B 3E3TA 5HXFA 4KGAA 3V12A 3MO9A 1C1QA 1LKBA 1Y3VA 4XE4A 3P8NA 4JZIA 4I8LA 1GBBA 2TPIZ 3KEEA 2XRCA 1SSXA 1W2KH 2FTLE 1W0YH 1C5OH 2UUKB 1DXPA 1O5EH 1SQTA 3SORA 2BXTH 3E6PH 5T6GA 1GJBB 5C1UA 4GHQA 2XWAA 1HAVB 2XC5A 5DPAA 5I25A 1WV7H 2FPZA 3V13A 5EPYA 3SV7A 1DY8A 3ZZ5A 1Y59T 2ANMH 2ZFFH 2FX6A 4K8BA 2ZFQH 2ZU5A 2QIQA 1ZRBA 2QXGA 4NG9H 3FP6E 1BBRK 3F9GA 5SGAE 4JZDH 1O31A 1ELAA 1N6XA 1QL7A 2I6QA 1EJMA 2GTBA 1P3CA 1QNJA 1MQ5A 2BQ6B 2QA9E 2BY9X 1IQLA 1C2MA 4IN2A 2OC8A 4FU7A 3OSYA 8GCHG 1SMFE 1EB1H 3D65E 1TA6A 2IJOB 2XBWA 1TOMH 1TPPA 1NFWA 3BTEE 3U9AH 2VIWA 2I6SA 2OLGA 2R3UA 2R0LA 1SGTA 1RTLA 1UVPA 4B73A 2FS8A 4IN1A 4OS7A 3GCTF 1AE8H 1MH0A 2Y5GA 4LZ1H 3TH4H 1SQOA 1O2OA 3KQEA 2BDYA 1NESE 3KF2A 3SZNA 1SGDE 5DP7A 2QXIA 2BDAA 2BY5X 3F9HA 3PMHB 3QX5H 5LH8A 2DE9A 3OX7U 2G5NA 3Q77A 2VVUA 3B8JA 1LHGH 1ZMLA 1ARBA 4X1RU 2GZ8A 2A45B 1FY3A 4E06H 4ZHLU 1QA0A 3MMGA 2A4QA 1PQ8A 1D9IA 1Z8GA 5DGJA 4FUJA 2ZGCA 1TYNA 1G36A 4FUIA 3GICB 1AGJA 2FO9A 4Y6DA 2V6NA 3UQOA 2P95A 2F9PA 1OP2A 1V2NT 1E34B 5IDKA 3A7VA 1MQ6A 4A6LA 1A4WH 4FXGH 5C5OA 1IOEA 1T4UH 3P70B 1KTTB 3VGCC 1GMCF 3ATIA 1IQIA 4LZ4B 1C4Y2 1C2IA 3D49H 4INKA 1Y3YA 2STAE 1YLDA 2BYAX 4I31A 2BLVA 3MU5A 1P2QA 3ZZCA 5EGMA 3RXTA 3SV9A 1F5LA 4NWLA 5F8TA 1FY5A 2HWLB 3A82A 2TBSA 5DP6A 2G81E 4UONA 5HYOA 1FIWA 3NPSA 1ZTLA 3E16B 4DY7B 1DWCH 3E90B 3LOXA 3LONA 4Y71A 1CE5A 1HAHH 3PLKA 4CBNA 6LPRA 2G00A 2P16A 1KXBA 2ZTXA 1K1PA 1S0RA 1TPSA 3T28A 1IQMA 1OWEA 1VR1H 3P8OA 3P8FA 1GWAA 3RU4T 2P3UB 1P8VC 3GCNA 3VEQB 3A8DA 4Y7BA 2FOHA 3S9BA 1QQ4A 1O2JA 3W95A 1TMBH 5E2PA 2UUYA 4DJZB 4XBDA 3TPIZ 1QB9A 2XXLA 3ATKA 1XUJA 3TVJB 1O3JA 1ESBA 3M7TA 5GIBA 5DG6A 4OS6A 5EQQA 5AF9H 3MO3A 4AB9A 2A4GA 2B7DH 2BMGB 5EXNA 1NPMA 1GHYH 3PMJA 1DE7H 1DWEH 2H9HA 5FBIA 1CVWH 4UFEH 3TH2H 4NGAH 1Y5AT 1V3XA 4K3JA 2Z7FE 1V2RT 2SGDE 4X0WU 4IC6A 1EPTB 4KKDA 4YOIA 1MU6B 2XYAA 1FQ3A 2K1QA 1EX3A 3BTME 1LPZB 4BXSA 2Z9IA 2PHBA 2OINA 3Q00A 4AFQA 1C2FA 1OWDA 3DFJA 1NRQH 4I8JA 2TGAA 4ZMAH 5DP4A 1O3OA 1SGEE 2AIPA 2G55A 3Q76A 4H6SB 3TLOA 4CBOA 1PYTD 2WPIS 4CRGA 2ZECA 5C2ZA 2G4UA 2GD4B 3LU9B 3UNSA 4YLUA 5AFZH 1S6FA 4X8VH 1YCPM 1SLWB 2FIRH 2W7UA 3LT3A 3ZZ6A 1G30B 1NFUA 1QRZA 1SG8B 2UUFB 1HBTH 3PO1C 1XUIA 1P02A 3MTYA 1GI0A 3MFJA 2BX4A 1AVGH 5JBTA 2BHGA 3M37A 2KAIB 2BLWA 1T7CA 1VJAU 1QB6A 3FZDA 3AASA 1W13U 2Z6BD 1AVWA 2PUQH 2C93B 3SQEE 2RG3A 1G9IE 3RXHA 3A88A 4TPIZ 1VITG 3K6YA 4ISIH 4OS1A 3VB5A 4FVBA 5LPEA 1V2OT 4NIVA 1BMLA 4X8SH 1TAWA 1ZYOA 1XUFA 2BY6X 1MTUA 2ZHDA 2FOCA 3A7WA 5HGGA 1P2JA 3LGIA 4WMFA 3PTBA 1WQSA 3U8TH 1G2LA 2WPKS 1BHXF 1K28D 3MH6A 3O8BA 4BAQB 2Z3DA 1JBUH 1MBQA 1WQVH 1XX9A 1EZSC 1AU8A 2SGQE 3PMAB 5GJ4B 5BRRE 2ZI2H 3SHAH 1BJVA 3BTKE 1ABJH 2PTNA 2FYRA 1TNHA 3BN9A 3KQBA 2AGEX 2AMQA 3FZZA 2Y82A 1GI4A 1UHBA 4MLFB 3MYWA 3M5MA 1HIAB 3ZYDA 2GGVB 3QWCH 1S84A 2ANYA 1TOCB 1OP0A 3LH3A 1KXAA 2J92A 1AUJA 2F9OA 2A4OA 1UK4A 4THNH 1VCPA 4Y11E 5LGOA 3EA7A 1W8BH 5A0AE 2BTCE 4CH8B 1NFXA 2NU0E 4SGAE 3RXMA 1QBVH 1O33A 1SGCA 1O3LA 1H1BA 5FCKA 1HUTH 1GJ7B 2Q6GA 3V3MA 5FCRA 5DP3A 4DURA 3FP7E 5EODA 3M7QA 2C8ZB 6GCHG 1K1IA 4MPWA 1OOKB 1JMOH 1OWIA 2G51A 2VWNA 3GY6A 1IQEA 2FX4A 3LC3A 1QFKH 1P11E 1KXDA 1THRH 2BZ6H 1OS8A 3GCHB 1XVOA 1V2JT 1C5ZB 1SFQB 1P05A 2ZDKA 2OC1A 3P6ZB 3RDZA 2AH4X 4AFZA 1PPBH 1A1RA 4MG3A 2G5VA 2GT8A 3A8CA 1GBLA 1IQKA 2FDAA 1MBMA 5B6OA 1TA2A 2J38A 3A85A 3FP8E 1AFQC 1ZJKA 1XVMA 1C2EA 3A87A 2VB0A 2ZDMA 4DVAU 1HCGA 1ELEE 4B2AA 1C5NH 2J4IA 2P93A 1VITF 1AIXH 1INCA 2PV9B 2F91A 5A0BA 1EOJA 1HAIH 1Y3WA 3GY2A 3SHCH 1HAXB 3MU1A 4VGCC 3RXOA 2FI4E 4TWWA 1DSUA 1THSH 5K7RA 3A84A 1W11U 2O8MA 1C1UH 3L3TA 2ODYB 1VGCB 1BTUA 1FPHH 1MTNC 4NSYA 1KLTA 2FOBA 3SU2A 1N8OC 1E38B 1A5GH 2XBXA 2W7SA 3SUGA 3UNQA 1ELDE 1ZTKA 1CSOE 2D8WA 4O3TA 1EAIA 3MNCA 5JBCS 2QC2A 4H6TA 7GCHF 1O3NA 4AOQA 2ZQ2A 1BZXE 2HNTE 4WVPE 3PTNA 2VIVA 2J95A 2J34A 3RXRA 1QIXB 4Q7ZA 1ZTJA 3BG8A 3BV9B 4I8KA 4X1NU 3SUEA 4IBLH 1QGFA 2ZC9H 1GPZA 3N7OA 2UWOA 4O9VA 3UR6A 2V0BA 4JK6A 5F8XA 1YBWA 2YOLA 1W12U 1O2ZA 2ALPA 1BUIA 5GDSH 1YPKH 1JOUB 6GCHF 4AORA 4CHAC 1A0JA 5JDUB 5LPFA 3RXIA 3SNCA 3QTOH 1C5QA 1C5TA 1P01A 1SGRE 1OKXA 4ZHAA 2FLRH 5C67A 1N6YA 1UTJA 5L6NH 1V6DA 4JYTA 3UPEA 1GBKA 2ESTE 1DUAA 1K1OA 4ABBA 2VJ1A 2VH6A 4RKOB 2P8OB 4NFFA 1EZXC 4K60A 5C1YA 2QN5T 1AFQB 2C90B 1O3DA 1GBDA 1Z6JH 3SU3A 3E1XB 1F0TA 1BDAA 2P59A 4HI3A 3P92A 1GI2A 3TK5A 1TBZH 3QUMP 2BOHB 5E0HA 5JBBS 1O35A 2TRMA 3BEFB 2CN0H 1EASA 1AO5A 4Y8ZA 3ATMA 2WPJS 3C27B 4VGCB 4BNRA 3SJOA 4KTCA 1ELGA 2ZTZA 1L1GA 1GL1A 1BTXA 1MUEB 2HPPH 2O9QA 2ZU4A 4Y79A 5HMAA 1MTNB 4CRFA 1UVSH 1LHFH 2OQ5A 1Z1IA 1YP9A 3DT0H 4TYDA 1ZR0A 1CO7E 2ZU1A 3GDUA 4DOQA 3LIWA 2Z3CA 4B76A 7LPRA 5FPYA 3BG4C 1V2KT 2BD5A 1TGSZ 2Z9JA 3O8DA 2ZQ1A 1KY9A 3QGNB 3VPKA 3RXCA 3BTWE 1IQHA 4D7GA 2W3KA 3O8RA 1GHWH 4NIWA 3OTJE 4NZQA 1HAGE 1YGCH 1KXCA 1Z1JA 2PGQB 2JKHA 4IGDA 4DGJA 1OP8A 1XUHA 1H4WA 4X2WA 3MU8A 1V2VT 3SV2H 3ZV8A 4OS4A 4OGXA 5EW1H 1AY6H 2QF0A 4JCNA 4Z6AH 2Y81A 4X1QU 2OQUA 1HRTH 4X1PU 1AE5A 2AEIH 1QCPA 1LKAA 1DFPA 3SJIA 1GMCG 5IYTA 1DOJA 1NM6A 4NZLA 2Q6FA 1VJ9U 1T31A 4YT6H 2BDHA 1MD8A 1ZHRA 1O5GH 2PGBB 3RXKA 4OS2A 1EAWA 3TJUA 1H9LB 4WMDA 1V2ST 1QURH 2J2UA 1PJPA 1K9OE 1PPHE 5A8YA 5ESBA 3SQHE 1C9TA 4Z0KA 4BAHB 2OBQA 1EKBB 2FWWA 1TALA 2GX4A 4K1EA 1AQ7A 2ZFSA 1AKSA 4Y7AA 4JZEH 1DY9A 3SJ8A 3SBKA 3BTFE 1NT1A 1Z8IB 1ZPBA 3QGJA 3MNSA 5L2YH 1C5YB 3S0NA 4BAKB 3A8AA 5AHGH 5JYIA 1SFIA 4GLYA 2WYGA 1LCYA 4MNXA 3RMMH 1AN1E 1MTWA 4ASHA 2XWBI 4YESB 1LHEH 1M9UA 3RXLA 2PTCE 3P8GA 1F7ZA 2ZF0H 3RXUA 1C5UA 1XUKA 1W7XH 3H7TA 1O2LA 1GJ6A 1AWHB 5DO4H 4CR9A 1V2QT 2HGTH 1DVAH 3EAJA 1K22H 3H7OA 1ETRH 1YPHC 1VZQH 3MO6A 4ISOA 2CJIA 2Z9GA 2G8TA 1O3MA 3ZZDA 1FPCH 2A5IA 3ZVFA 3LJJA 1C1VH 2BZAA 4WXIA 4YO9A 1ZSLA 1RTKA 1PQ7A 1O3BA 1E36B 4WWYA 3BG4B 3A89A 3VXEH 1EB2A 2BDGA 3IG6B 3RC4A 1TONA 2CF8H 1UK2A 5EG4A 1IAUA 2BQWB 1IQGA 1J14A 3ZZ8A 2VINA 3HGPA 3F9FA 1JRSA 3QDZB 3GOVB 1P57B 1L2EA 1TBRH 1GJ5H 3PWBA 1O32A 3GDSA 5EXLA 2CGAA 2XBVA 1CT0E 1SOTA 2VIPA 3O8CA 4ZAEA 1CQQA 3RXAA 4TPYA 1WTHD 2GT7A 2Y7XA 7KMEH 6CHAC 2ZU2A 3HATH 3S9CA 1GHXH 1KDQA 4JZFH 1XXFA 3TJVA 1JRTA 4QT8C 1GBTA 1HJ9A 2FI3E 3EDXB 1L1NA 3E0PB 1FY1A 1ZJDA 1P2MA 1EZQA 3UWIA 2BM2A 1G3CA 3BF6H 3LDXH 1A0LA 5E0GA 1GI6A 1P0SH 2UWPA 1GMDF 1D3TB 3ZVDA 1G32B 2VWOA 1HAOH 2XTTB 5GXPA 4HTCH 1QJ6B 1OX1A 1LVBA 3GY3A 1GI3A 1SR5C 1SGQE 2AERH 2VNTA 3RC6A 1IQFA 2D2DA 1TGTA 1MTSA 1T8NA 2ZCLP 1ZMNA 2ZPSA 3BIVH 4LOYH 1NO9H 4K69A 4M7GA 1YPMH 1A2CH 2O8LA 3FAOA 3U98H 1NU9A 3VB3A 4D9RA 1PYTC 1NY22 2PKAA 2A0QB 1Y3XA 3M36A 3RC5A 5CHAC 1HAVA 4KTUA 4Q7XA 3M5NA 5GCHF 1UHBB 2P94A 2FI5E 1SB1H 5TCCA 3VB4A 3NWUA 1O3KA 1O3CA 5FHTA 2P3TB 3K65B 1UTQA 1ANDA 2CHAC 4D7FA 4X8TH 3SJKA 4BAMB 2PWXA 3OU0A 3ZZ4A 1CGIE 3EYDA 1EJNA 3ZVBA 3ODFA 2ODQA 4XSKU 1DLEA 1TGNA 1BIOA 2ZA5A 3RXQA 4X2VA 1A46H 2ILNA 3DHKH 3ZZ9A 1FJSA 1IHSH 1ZSKA 1S81A 4GCHF 4XOJA 4F49A 1HV7A 1AB9C 1XMNB 1DPOA 4UFGH 1J17T 2B9LA 4FUGA 1HFDA 1RXPA 2HNTF 3KN2A 4DG4A 4CRCA 3ENSB 1ESTA 3RMLH 4B71A 1C5VA 5JPMH 2JH0D 2NU2E 2WUCA 5ETXA 5FXLA 2OTVA 1FIZA 1HAYB 4MQAA 2PR3A 5E2OA 4E7RG 1PQ5A 3GY7A 2THFB 2JETC 1QJ1B 3VGCB 1TNKA 2ZGBH 1ARCA 4Y76A 1O5FH 3LPRA 1ELFA 1UTLM 4I8GA 4DW2U 3LKWA 2B5TB 2GP9B 3DUXH 4WMEA 2NU1E 1WSSH 1GHAG 1N1LA 1V2LT 1DITH 1WUNH 2XC0A 5EQSA 1AUTC 4YM9A 2XCFA 2OUAA 2QYIA 2VGCC 2UUJB 1EJAA 2ZKSA 3I77A 3EE0B 2Y7ZA 1QRWA 1MKWK 1TIOA 1UMAH 3LGTA 1D6WA 2BD2A 1AZZA 1KIGH 2SFAA 1BBRE 3TNTA 3U1JB 3SOSA 3NUMA 3S7HB 2JH6D 2OC0A 5E8EH 3T5FH 3HK3B 2VIQA 1A61H 2FXRA 1Q2WA 2R0KA 5C3NA 4BXWA 1RFNA 2OC7A 2O8TA 1SPJA 2C8WB 1DWBH 4FUEA 3SU1A 1AI8H 1TFXA 2Y5HA 1ELBA 1O3FA 1DXWA 1W14U 1QA7A 1FAXA 2A2XH 4I32A 1P3EA 5J4QA 1K21H 4CRBA 2CHAB 3RXFA 3SO3A 4UEHH 2BLOA 1THPB 1FAKH 1H8DH 7GCHG 1FDPA 3S69A 4GVUA 4NCYA 3T25A 1RJXB 2BDIA 1GCTC 3M5LA 3I29A 4MNWA 3UY9A 3AAUA 1AZ8A 4SGBE 4MPXA 3BEIB 1AB9B 1FMGA 1LVYA 4MPUA 1SVPA 2WV5A 2CV3A 5EOKA 1KSNA 3A83A 1V2PT 1S6HA 1EP6A 4I7YH 4Q2KA 3RM0H 3RMOH 1FNIA 3SNDA 1Z71A 1P10A 2BD9A 3CS7A 2QAAA 4OGYA 1BMMH 1PPEE 2EC9H 2JETB 5CMXH 1GBFA 3AW0A 1TRYA 1ZSJA 4AGKA 1GVKB 1D6RA 2P3FH 1QHRB 1HDTH 1DICA 2Z9LA 2PLXA 3UOPA 2ZGXH 3QO6A 3A80A 3MOCA 1GHAF 1SGNE 3SNBA 4ZKNU 3PO1B 4TY6A 1BTHH 1HJAC 1GDQA 4I33A 2A5AA 4AG2A 4GSOA 1MAYA 1IQJA 1FN6A 2VWLA 1GBIA 1G3EA 1OSSA 2GZ7A 3A7TA 2FOMB 1P04A 3E0NB 3KCGH 3HK6B 3RXGA 1UTNA 1GVZA 3CENA 1HPGA 1BA8B 1UTKA 2HVXA 3SU4A 5K0HA 1SL3A 2OP9A 1HNEE 1WU1A 1MZAA 4YZUA 1KXFA 5AFYH 4UFDH 3B9FH 9ESTA 4AGJA 2PW8H 4BAOB 5I46H 1LO6A 1G3BA 4TWYA 1GJDB 1A3BH 1QR3E 3RU4E 3TH3H 2C8YB 2XCNA 2EI7A 2BXUH 1BQYA 4AYYB 2R2MB 1GMHG 4MDSA 1GBAA 2A7CA 3EQ0H 4YOJA 5EPNA 1WAYB 2ZEBA 1CT4E 3GCOA 3SU0A 2VH0A 1EXFA 1A0HB 1UCYH 3M7UA 2QV1A 1P12E 3ZYEA 3A8BA 3EGKH 3VB6A 1F5RA 5E0JA 1CA8B 1BRCE 3JZ2B 1S5SA 3F9EA 1V2UT 3BTHE 1BMAA 1C5RA 2NWNA 3ZV9A 1O2VA 3F68H 5FBEA 1QB1A 1PPFE 3RXSA 4ABHA 1T8LA 4FUFA 1G2MA 1LDTT 4AB8A 2OBOA 1C5WB 4YTAA 2Y6TA 5F8ZA 4RSPA 4ABJA 1MU8B 1ELCA 4B2CA 1KLJH 1GI1A 3RUOA 1BT7A 4MNYA 4X2XA 5DP5A 4RKJB 1D4PB 3RMNH 5DJ7A 2ANKH 2WINI 4FUHA 1ELVA 4ABGA 1PPCE 1TMTH 3A7YA 3ZVEA 3H5CB 2A7JA 2R9PA 1W0ZU 1ORFA 1TQ0B 3W94A 2PSYA 1T8OA 4ZUHA 3MNBA 1ZHPA 1CBWC 3U1IB 3RLWH 3KIDU 3Q3YA 9LPRA 2ZDVH 1EAXA 3SJ9A 3SGBE 4X6PA 4LXBH 3UIRA 1NN6A 3E8LA 1DUEA 1AHTH 4Y0ZE 1O2IA 1G3DA 2YNAA 1LPGB 2G4TA 5L30H 1F2SE 4E7NA 5JBAS 1P2IA 4A1VA 2QF3A 2H9TH 1WBGB 1GGDC 4HGCA 4AN7A 1KLIH 4GUXA 2EA3A 3STJA 2SGFE 5PTPA 3MHWU 1ETSH 2CF9H 1K2I1 4FU8A 2BY7X 2SGPE 1J9CH 1YCPH 4D9QA 1YF4A 2FOGA 3QLPH 3RXPA 4ABAA 4JMYA 5FAHA 3MH4A 1XKBC 3ESTA 3F6UH 1GMHF 1TNGA 5G4BA 3ZVCA 3NK8A 1O3EA 4ZROA 3URDA 1N8OB 1AVXA 3B23B 2BVXH 3M5OA 1GCDA 2Z94A 3E91A 3UREA 2ZGHA 3AW1A 1O3IA 4IC5A 1NS3A 4PROA 3STIA 3PV4A 2V3HH 3GY8A 3DFLA 4FUDA 1NTPA 1EZUC 1QL8A 2Y80A 2EEKA 3D23A 3LGVA 2ZDAH 3PLPA 2TGPZ 1K1JA 1L4ZA 2Y5FA 3AAVA 2ZP0H 1TGBA 4K8YA 2J94A 2WYJA 3MWIU 1KDQB 5TJXA 4HZHA 4XFQA 1EQ9A 3GDVA 3MI4A 1O5AB 1GI5A 1F0SA 1SGFG 1GHVH 1O38A 4JYUH 4CHAB 1SHHB 3ZZBA 4TY7A 1O2MA 2AIQA 4NA7A 2H5DA 3FANA 1BCUH 3QN7A 2BVRH 1CBWB 1C4V2 1OWHA 4CRDA 2V35A 1O2YA 2GZ9A 3WY8A 1J16A 4MVNA 3M35A 1Z7KA 1TABE 4NIYA 1QL9A 1MKWH 2ZHWH 3HGNA 1ESAA 1TGCA 3TIUA 2ZHEH 5F03A 2VVVA 3VXFH 1GMDG 3SU6A 1XXDA 3BEUA 1BITA 5EQRA 4ZHMU 2GV6A 3RP2A 1CHOG 5FX5A 4HFPB 4A1TA 2J9NA 1C5SA 1O2TA 2PKAB 1A3EH 1O3GA 1Z8JB 1GGDB 3CP7A 2FESH 5T3HA 1BRAA 4U2WA 4O97A 1GJ8B 4ISHH 2H9EH 4Q7YA 4ZH8A 4BANB 4U01A 5A2MH 1Z8RA 1ZGIA 1YM0A 2Q1JA 5FPSA 2ODPA 1SGPE 1EOLA 2DUCA 2PUXB 1C1PA 3HPTB 2SNVA 2HRVA 5FX6A 3NKKA 4MPVA 4X6MA 4XBBA 1Y8TA 1DT2A 1LVMA 5GCHG 2UWLA 1SBWA 1AD8H 2ZFPH 5JB9S 1ZPZA
chains in the Genus database with same CATH superfamily
2GCTC 3SI4H 4ESTE 2W3IA 4IMZA 4IW4E 2GCHG 4DT4A 2FYQA 1EATA 1UO6A 1A7SA 1BTWA 2HPQH 5C5NA 8ESTE 1NU7B 5GWZA 2WPHS 2FP7B 1SI5H 3P17H 4AZ2B 2FZZA 1H9HE 3ZZAA 1UCYK 1BRBE 1LQEA 2JH5D 4R8TB 3RXEA 2GMTC 4ZKSU 8LPRA 1C1NA 1UVOA 2WZQA 3GY5A 4GCHG 1ID5H 1FI8A 1VCQA 1SC8U 1H9IE 3EA8A 1O2RA 1O2PA 1YPLH 1BTYA 1CT2E 3K6ZA 4AX9H 1NRSH 5EXMA 5CE1A 3OEHD 4A7IB 1OYQA 2CXVA 2C4FH 3TGIE 2F9UA 2SGEE 4K5ZA 1IQNA 4A5TS 1GHBG 4IS5A 4RN6A 2RDEA 1UTPA 1C9PA 1PPZA 1UK3A 4BTTB 4F55A 4O03A 3HKIB 1EPTC 4R0IA 4Y8XA 3RXBA 2HLCA 2H6MA 3D62A 5EJ1A 1BMNH 2PSXA 2OXSA 5ABWA 1GG6C 2FOFA 3URCA 4BOHA 1SGIB 2G52A 5J4SA 1MKXK 1G37A 1MCVA 3K2UA 1GVLA 4ZKOU 3DA9B 4WJG2 2VIDA 1PFXC 4J1YA 1OYTH 1GI7B 1C1OA 2H5CA 2A2QH 3OY5U 5EU8A 2H2ZA 2QXJA 2ZGJA 1ACBE 1C5PA 4U32A 3S9AA 4BTIB 1X7AC 1LHDH 4ABIA 1C2DA 1NC6A 1VITH 3BTQE 2W26A 2FTMA 3FFGA 1CHOF 3JZ1B 1TBQH 5EJZA 1BOQA 1RGQA 1P2NA 1V2WT 1W3CA 2GDEH 3TITA 3P95A 4KTSA 1P9SA 1SLUB 2A5KA 1J8AA 1CU1A 4O3UA 1VCWA 4XBCA 1H8IH 2FM2A 3C1KA 4ACAA 2RCEA 1HYLA 4J2YB 3U8RH 1QQUA 1DWDH 1F0UA 1HLTH 1NZQH 2FOEA 3GYMA 2QF4A 3LGYA 2HALA 1GL0E 3OY6U 3TNSA 3SNEA 3OEED 4CR5A 2Q6DA 1YLCA 1B0FA 3LC5A 1O3HA 1NRPH 3RM2H 1O2NA 3VG8A 1YCPK 4GPGA 2C8XB 2HOBA 3HKJB 2FEQH 3ITIA 1TMUH 3QZQA 3MH7A 2ZCHP 3IWMA 1P9UA 3GYLB 1OHHD 1Y3UA 2GCTB 2ZO3H 4P02A 2GV7A 2A1DB 5DP8A 1QTFA 2AYWA 8GCHF 4X8UH 2GCHF 1SLVB 3ATWA 3I78A 2JJ2D 4YLQH 5A0CA 2NU4E 4Y10E 1O2UA 1ZHMA 2BD3A 4XDEA 1O2KA 2DE8A 2OD3B 4YT7H 5EW2H 1BB0B 4GHTA 1ANBA 1QBNA 2BB4A 3N99A 2GMTB 1GBEA 1LVOA 1TNLA 1HGTH 3KQCA 1WOFA 2BD7A 4B74A 1C2LA 2EI8A 2ALVA 1VKYA 1QRXA 2EI6A 2F9VA 1DANH 3PMBB 1CGJE 3S7KB 3ZZ3A 2TGDA 3Q3XA 1GHBF 3IITA 1NFYA 1RS0A 4BTUB 2ANWA 3A7XA 3FVFB 4CREA 4TT3D 1QJ7B 4INHA 8KME2 2YNBA 2A4RA 2FOAA 3EA9A 5T6FA 6CHAB 2QCYA 2IOTA 1GG6B 1DX5M 5LPRA 1DM4B 2AGGX 4FU9A 1ZOMA 3U28C 3F2GA 1O0DH 1BTPA 1Q31A 1YPHE 2LNCA 2VVCA 2W5EA 1C1WH 1CA0C 5GPIB 2J5UA 2OCVB 3UWJH 3MNXA 2A31A 2FMJA 3DD2H 4NA9H 2XW9A 4UE7H 2GKVE 3GCHC 1LHCH 1YPJH 2V3MA 5F6MA 2F3CE 3PLBA 1YKTA 1B5GH 3CS0A 3BTTE 3MU4A 4F4OC 5A8XA 1TX6A 2GVFA 3R0FA 1HJ8A 1T8MA 1Y5BT 1L4DA 1YPEH 1S83A 1P2OA 4MTBA 1Z6EA 2HNTC 1HB0B 1HXEH 3QK1A 2IPHA 3ZVAA 1O2HA 1O5DH 1WTGH 1EUFA 1RIWC 4WH8A 3T62A 2PFEA 1GJ9B 2NU3E 2ZDNA 4B1TA 5CHAB 4JZ1A 2ZIQH 1A5HA 3TGKE 1ANEA 1BTZA 3F1SB 5DP9A 1O37A 1GBCA 4TSFD 1AFEH 2QY0B 1LQDB 3M3TA 4OS5A 5C1XA 1C5MD 1AWFH 2IJD1 1H8HD 1F5KU 4FVDA 3SV6A 5KEDA 1KTSB 2WPMS 1Q3XA 4WY3A 4MNVA 1ELTA 2Z9KA 3RU4D 1C1TA 2QXHA 4ZKRU 2ZG0H 4ZXYH 2LPRA 1VGCC 3NRLA 1S85A 1TQ7B 1GBHA 3SN8A 1MAXA 4AG1A 5AVDA 1TRNA 1FY4A 1UCYE 3TJOA 2RA0A 1ABIH 1XUGA 3RXJA 4ZXXH 1GHZA 3PROA 1W7GH 3L6PA 1MABB 2AMDA 4ABEA 4DT7B 1EP5A 1GBJA 3GY4A 1FLEE 2IN2A 1DSTA 1GDUA 1V2MT 1TNIA 2XNIA 1UJ1A 1L1JA 4E05H 1KXEA 2ZPQA 4NA8A 5ESTE 1U6QA 1NRRH 4KP0A 1FONA 1P03A 2KZ4A 4X6NA 1WYKA 4CRAA 2WV4A 1FN8A 4XRNA 1UTMA 3TK9A 1FXYA 1EAUA 1C2GA 4DCDA 1BJUA 2BDBA 1O34A 1RRKA 2B8OH 4B75A 3SGQE 3U69H 2WSSD 3BTGE 4RT1A 4Y0YE 4I8HA 1ANCA 2QGRA 2ZTYA 4DIHH 1EPTA 5BPEA 3TU7H 1CA0B 4NWKA 2H1UA 1NRNH 1YC0A 1AMHA 3KHVA 1O2XA 4IMQA 1GI8B 2VGCB 4RT0A 3TGJE 4K2YA 3UAIC 3V7TA 4A92A 4ISNA 3T29A 7ESTE 3SV8A 1O2SA 2FS9A 3SI3H 2BD8A 1GJAB 1P09A 3KL6A 1SGYE 1XKAC 5T6DA 4KELA 3NXPA 3MQKC 2B0FA 1BBRH 3K9XB 2KCYA 2P8OC 2BDCA 3BSQA 2CMYA 5CDFE 3PB1E 1OWKA 1TPOA 3ATLA 3LGWA 2ZDLA 3A81A 1SHYA 2F83A 3LGUA 2C3SA 1BMFD 5A8ZA 4WF8A 5DK1A 1MMJN 2AS9A 2VU8E 5H4IB 1RIWB 3RXDA 1JIRA 1RD3B 1JIMA 4K1TA 2PKSC 1C2KA 1UW7A 1TWXB 1OWJA 1SQAA 4JYVH 2KAIA 3GS9A 2PP6A 1C2HA 3PM3A 1SLXB 4WH6A 1UTOA 2ZHFH 1GDNA 1O2WA 1O2GH 3SUDA 4X6OA 1O36A 1SGFA 4RI0A 2O8WA 1UVTH 2BLQA 1HAZB 3ELAH 1TPAE 2ZFRH 1A5IA 3OYPA 4INLA 1MD7A 4D76A 1O3AA 5FPTA 1C1RA 1DDJA 3PYHA 5DSFA 1C5XB 1GCTB 3OFND 4LK4A 1E37B 3TJNA 2STBE 3T27A 3U8OH 1O3PB 5HIZA 2F9NA 3FN8A 3KNXA 2V7QD 1UVUH 4AFUA 1O39A 2TGTA 3M3SA 2TIOA 2VIOA 1HXFH 1TRMA 2ZPRA 3KGPA 1LPKB 3UQVA 1KYNA 4K1SA 3RLYH 3T26A 3SGAE 1YPGH 4FUCA 1L0ZA 3SW2B 1JWTA 2JJ1D 2ZCKP 1GJCB 5C20A 1DLKB 1MKXH 1WCZA 3MH5A 3NCLA 1ZRKA 4UD9H 3ZZ7A 1C2JA 1K1MA 1K1NA 1IHTH 1TX7A 2ZU3A 3V0XA 1FUJA 2VWMA 1RTFB 1HIAA 4UFFH 3UR9A 1BHXB 1DS2E 1ZLRA 3QZRA 2BY8X 2ZWLH 1TB6H 1C1MA 2AGIX 2RA3A 1ZGVA 4ISLA 1P2KA 1AKSB 1P06A 1NBME 3PWCA 1LMWB 1BRUP 1HJAB 4I86A 5C0TA 2A32A 2M5TA 3A7ZA 4JK5A 4NSVA 1OPHB 3Q3KA 1QY6A 4H42U 1T4VH 3M3VA 4YOGA 2FODA 2R3YA 1W0JD 2SGAA 1F92A 3VFEA 1ETTH 1TE0A 1PQAA 3G01A 1OXGA 1E0FD 2F4LA 2XBYA 1TLDA 4Y8YA 2O8UA 4AFSA 2AMPA 1O5CB 5FL7D 3SUFA 1ZPCA 1W0KD 4CH2B 1CHGA 5HIYA 1MCTA 3UUZA 3KQDA 1YYY1 2BOKA 4A1XA 5JB8S 1F0RA 1C5LH 2D26C 5A09A 2PKSB 1HAPH 4Z1MD 1XM1A 1D3PB 2ZHQH 2BX3A 1PPGE 3NZIA 1J15A 4Q80A 1GJ4H 3AVZA 5HM2A 2BVSH 1GBMA 1ZMJA 1B7XB 3LH1A 1D3DB 3M61U 1E35B 2FLBH 2ZFTA 3L33A 4WXVA 1T32A 1FY8E 3UNRA 3UFAA 1D3QB 4X1SU 5TCAA 3UTUH 4FUBA 3F2HA 1LTOA 2GDDA 1TNJA 2ASUB 3A86A 1GI9B 3UOUA 2ZZUH 3GCTG 4AYVB 1O2QA 1JXPA 3QTVH 3R3GB 1ZZZA 2R2WU 1O30A 2A7HA 3GISB 4DIIH 1S0QA 6ESTA 1C4U2 1K1LA 1E1RD 3ZVGA 1TX8A 5B6LA 1MZDA 2WPLS 3SNAA 3RXVA 1FZZA 2ULLA 4NFEA 3TK6A 2F9BH 2WHXA 3BIUH 4ABDA 2BD4A 1C1SA 1MTVA 2XC4A 2V3OH 1O5BB 4B6EA 2WUBA 4D8NA 4B2BA 4U30A 2ZNKH 2SNWA 2Z3EA 4ABFA 1SOZA 4UDWH 3SU5A 2RDLA 3BTDE 2AFQB 5L2ZH 4GAWA 4H4FA 3T2NA 1Y5UT 1CGHA 3LJOA 1B0EA 1V2TT 3ODDA 1S82A 1QBOA 1NROH 1W10U 4NIXA 2D1JA 4X2YA 5HM9A 1FV9A 5DKMA 3MU0A 3VB7A 2BQ7B 3E3TA 5HXFA 4KGAA 3V12A 3MO9A 1C1QA 1LKBA 1Y3VA 4XE4A 3P8NA 4JZIA 4I8LA 1GBBA 2TPIZ 3KEEA 2XRCA 1SSXA 1W2KH 2FTLE 1W0YH 1C5OH 2UUKB 1DXPA 1O5EH 1SQTA 3SORA 2BXTH 3E6PH 5T6GA 1GJBB 5C1UA 2K0QA 4GHQA 2XWAA 1HAVB 2XC5A 5DPAA 5I25A 1WV7H 2FPZA 3V13A 5EPYA 3SV7A 1DY8A 3ZZ5A 1Y59T 2ANMH 2ZFFH 2FX6A 4K8BA 2ZFQH 2ZU5A 2QIQA 1ZRBA 2QXGA 4NG9H 3FP6E 1BBRK 3F9GA 5SGAE 4JZDH 1O31A 1ELAA 1N6XA 1QL7A 2I6QA 1EJMA 2GTBA 2WPDD 1P3CA 1QNJA 1MQ5A 2BQ6B 2QA9E 2BY9X 1IQLA 1C2MA 4IN2A 2OC8A 4FU7A 3OSYA 8GCHG 1SMFE 1EB1H 3D65E 5KGOA 1TA6A 2W6JD 2IJOB 2XBWA 3WWFA 1TOMH 1TPPA 1NFWA 3BTEE 3U9AH 2VIWA 2I6SA 2OLGA 2R3UA 2R0LA 1SGTA 1RTLA 5HKKD 1UVPA 4B73A 2FS8A 4IN1A 4OS7A 3GCTF 1AE8H 1MH0A 2Y5GA 4LZ1H 3TH4H 1SQOA 1O2OA 3KQEA 2BDYA 1NESE 3KF2A 3SZNA 1SGDE 5DP7A 2QXIA 2BDAA 2BY5X 3F9HA 3N7EA 3PMHB 3QX5H 5LH8A 2DE9A 3OX7U 2G5NA 3Q77A 2VVUA 3B8JA 1LHGH 2HLDD 1ZMLA 1ARBA 4X1RU 2GZ8A 3SYJA 1H8ED 2A45B 1FY3A 4E06H 2KR7A 4ZHLU 5C94A 5EIYA 1QA0A 3MMGA 2A4QA 1PQ8A 1D9IA 1Z8GA 5DGJA 4FUJA 2ZGCA 1TYNA 1G36A 4FUIA 3GICB 1AGJA 2FO9A 4Y6DA 2V6NA 3UQOA 2P95A 2F9PA 1OP2A 1V2NT 1E34B 5IDKA 3A7VA 1MQ6A 4A6LA 1A4WH 4FXGH 5C5OA 1IOEA 1T4UH 3P70B 1KTTB 3VGCC 1GMCF 3ATIA 1IQIA 4LZ4B 1C4Y2 4ZCNA 1C2IA 3D49H 4INKA 1QZ8A 1Y3YA 2STAE 1YLDA 2BYAX 4I31A 2BLVA 3MU5A 1P2QA 3ZZCA 5EGMA 3RXTA 3SV9A 1F5LA 4NWLA 5F8TA 1FY5A 2HWLB 3A82A 3DCLA 2TBSA 5DP6A 2G81E 4UONA 5HYOA 1FIWA 3EE7A 3NPSA 1ZTLA 3E16B 2J98A 4B6FA 4DY7B 1DWCH 3E90B 3LOXA 3LONA 4Y71A 1CE5A 1HAHH 3PLKA 4CBNA 6LPRA 2G00A 2P16A 1KXBA 2ZTXA 1K1PA 1S0RA 1TPSA 3T28A 1IQMA 1OWEA 1VR1H 3P8OA 3P8FA 1GWAA 3RU4T 2P3UB 1P8VC 3GCNA 3VEQB 3A8DA 4Y7BA 3F0PA 2FOHA 3S9BA 1QQ4A 1O2JA 1WXRA 3W95A 1TMBH 1E79D 5E2PA 2UUYA 3CNRA 4DJZB 4XBDA 3TPIZ 1QB9A 2XXLA 3ATKA 1XUJA 3TVJB 1O3JA 1ESBA 3M7TA 5GIBA 5DG6A 4OS6A 5EQQA 5IK2D 5AF9H 3MO3A 4AB9A 2A4GA 2B7DH 2BMGB 5EXNA 1NPMA 1GHYH 3PMJA 1DE7H 1DWEH 2H9HA 5FBIA 1CVWH 4UFEH 2YMSC 3TH2H 4NGAH 1Y5AT 1V3XA 4K3JA 2Z7FE 1V2RT 2SGDE 4X0WU 4IC6A 1EPTB 4KKDA 4YOIA 1MU6B 2XYAA 1FQ3A 2K1QA 1EX3A 3BTME 1LPZB 4BXSA 2Z9IA 2PHBA 2OINA 2L6OA 3Q00A 4AFQA 1C2FA 1OWDA 3DFJA 1NRQH 4I8JA 2TGAA 4ZMAH 5DP4A 1O3OA 1SGEE 2AIPA 2G55A 3Q76A 4H6SB 3TLOA 4CBOA 1ZPZA 1PYTD 2WPIS 4CRGA 2ZECA 5C2ZA 2G4UA 2GD4B 3LU9B 3UNSA 4YLUA 1YY3A 5AFZH 1S6FA 4X8VH 1YCPM 1SLWB 2FIRH 2W7UA 3LT3A 3ZZ6A 1G30B 1NFUA 1QRZA 1SG8B 2UUFB 1HBTH 3PO1C 1XUIA 1P02A 3DSOA 3MTYA 1GI0A 3MFJA 2BX4A 1AVGH 5JBTA 2BHGA 3M37A 2KAIB 2BLWA 2KCPA 1T7CA 2YMSD 1VJAU 1QB6A 3FZDA 3AASA 1W13U 2Z6BD 1AVWA 2PUQH 2C93B 3SQEE 2RG3A 1G9IE 1COWD 3RXHA 3A88A 4TPIZ 1VITG 3K6YA 4ISIH 4OS1A 3VB5A 3ZIAD 4FVBA 5LPEA 1V2OT 4NIVA 1BMLA 3OAAD 4X8SH 1TAWA 1ZYOA 1XUFA 2BY6X 3WWBA 1MTUA 2ZHDA 2FOCA 3A7WA 5HGGA 1P2JA 3LGIA 4WMFA 3PTBA 1WQSA 3U8TH 1G2LA 2WPKS 1BHXF 1K28D 3MH6A 3O8BA 4BAQB 2Z3DA 1JBUH 1MBQA 1WQVH 1XX9A 1EZSC 1AU8A 2SGQE 3PMAB 5GJ4B 5BRRE 2ZI2H 3SHAH 1BJVA 3BTKE 1ABJH 2PTNA 2FYRA 1TNHA 3BN9A 3KQBA 2AGEX 2AMQA 3FZZA 2Y82A 1GI4A 1UHBA 4MLFB 3MYWA 2IPQX 3M5MA 1HIAB 3ZYDA 2GGVB 3QWCH 1S84A 2ANYA 1TOCB 1OP0A 3LH3A 1KXAA 2J92A 1AUJA 2F9OA 2A4OA 1UK4A 4THNH 1VCPA 4Y11E 5LGOA 3EA7A 1W8BH 5A0AE 2BTCE 4CH8B 1NFXA 2NU0E 2AHME 4SGAE 3RXMA 1QBVH 1O33A 1SGCA 1O3LA 3F0OA 1H1BA 5FCKA 1HUTH 1GJ7B 2Q6GA 3V3MA 5FCRA 5DP3A 4DURA 3FP7E 5EODA 3M7QA 2C8ZB 6GCHG 1K1IA 4MPWA 1OOKB 1JMOH 1OWIA 2G51A 2VWNA 3GY6A 1IQEA 2FX4A 3LC3A 1QFKH 1P11E 1KXDA 1THRH 2BZ6H 1OS8A 3GCHB 4FETA 1XVOA 1V2JT 1C5ZB 1SFQB 1P05A 2ZDKA 2OC1A 3P6ZB 1NBMD 3RDZA 2AH4X 4AFZA 1PPBH 1A1RA 4MG3A 2G5VA 2GT8A 3A8CA 1GBLA 1IQKA 2FDAA 1MBMA 5B6OA 1TA2A 2J38A 3A85A 3FP8E 1AFQC 1ZJKA 1XVMA 1EFRD 1C2EA 3A87A 2VB0A 2ZDMA 4DVAU 1HCGA 1ELEE 4B2AA 1C5NH 2J4IA 2P93A 1VITF 1AIXH 1INCA 2PV9B 2F91A 5A0BA 1EOJA 1HAIH 1Y3WA 2XNDD 3GY2A 3SHCH 1HAXB 3MU1A 4F48B 4VGCC 3RXOA 5C0UA 2FI4E 4ACBA 4XD7D 4TWWA 1DSUA 1THSH 5K7RA 3PRBA 3A84A 1W11U 2O8MA 1C1UH 3L3TA 2ODYB 1VGCB 1BTUA 1FPHH 1MTNC 4NSYA 1KLTA 2FOBA 3SU2A 1N8OC 1E38B 1A5GH 2XBXA 2W7SA 3SUGA 1SQRA 3UNQA 1ELDE 1YWUA 1ZTKA 1CSOE 2D8WA 4OM9A 4O3TA 1EAIA 3MNCA 5JBCS 2QC2A 4H6TA 7GCHF 1O3NA 4AOQA 2ZQ2A 1BZXE 2HNTE 4WVPE 3PTNA 2VIVA 2J95A 2J34A 3RXRA 1QIXB 4Q7ZA 1ZTJA 3BG8A 3BV9B 4I8KA 4X1NU 3SUEA 4IBLH 1QGFA 2ZC9H 1GPZA 3F2FA 3N7OA 2UWOA 3PRDA 4O9VA 3UR6A 2V0BA 4JK6A 5F8XA 1YBWA 2YOLA 1W12U 1O2ZA 2ALPA 1BUIA 5GDSH 1YPKH 1JOUB 6GCHF 4AORA 4CHAC 1A0JA 5JDUB 5LPFA 3RXIA 3SNCA 3QTOH 1C5QA 1C5TA 1P01A 1SGRE 1OKXA 5CHBA 4ZHAA 2FLRH 5C67A 1N6YA 3FO8D 1UTJA 5L6NH 1V6DA 4JYTA 3UPEA 1GBKA 2ESTE 1DUAA 1K1OA 4ABBA 2VJ1A 2VH6A 4RKOB 2P8OB 4Q4LA 4NFFA 1EZXC 4K60A 5C1YA 2QN5T 1AFQB 5T1VA 2C90B 2QF5A 1O3DA 1GBDA 1Z6JH 3SU3A 3E1XB 1F0TA 1BDAA 2P59A 4HI3A 3P92A 1GI2A 3TK5A 1TBZH 3QUMP 5DN6D 2BOHB 5E0HA 5JBBS 1O35A 2TRMA 3BEFB 2CN0H 1EASA 1AO5A 4Y8ZA 3ATMA 2WPJS 3C27B 4VGCB 4BNRA 3SJOA 3FOAA 4KTCA 1ELGA 2ZTZA 1L1GA 1GL1A 1BTXA 1MUEB 2HPPH 2O9QA 2ZU4A 4Y79A 5HMAA 1MTNB 4CRFA 1UVSH 1LHFH 2OQ5A 1Z1IA 1YP9A 3DT0H 4TYDA 1ZR0A 1CO7E 2ZU1A 3GDUA 4DOQA 3KYFA 2Z3CA 3LIWA 4B76A 5KECA 7LPRA 5FPYA 3BG4C 1V2KT 2BD5A 1TGSZ 2Z9JA 3O8DA 2ZQ1A 1KY9A 3QGNB 3VPKA 2LELA 3RXCA 3BTWE 1IQHA 2L74A 4D7GA 2W3KA 3O8RA 1GHWH 4NIWA 3OTJE 2KM0A 4NZQA 1HAGE 5EJLA 1YGCH 1KXCA 1Z1JA 2PGQB 2JKHA 4IGDA 4DGJA 1OP8A 1XUHA 1H4WA 4X2WA 3MU8A 1V2VT 3SV2H 4HG6A 3ZV8A 4OS4A 4OGXA 5EW1H 1AY6H 2QF0A 4JCNA 4Z6AH 2Y81A 4X1QU 2OQUA 1HRTH 4X1PU 1AE5A 2AEIH 1QCPA 1LKAA 1DFPA 3SJIA 1GMCG 5IYTA 1DOJA 1NM6A 4NZLA 2Q6FA 1VJ9U 1T31A 4YT6H 2BDHA 1MD8A 2J98B 1ZHRA 1O5GH 2PGBB 3RXKA 4OS2A 1EAWA 3TJUA 1H9LB 4WMDA 1V2ST 1QURH 2J2UA 5F53A 1PJPA 1K9OE 1PPHE 5A8YA 5ESBA 3SQHE 1C9TA 4Z0KA 4BAHB 4P00A 2OBQA 1EKBB 2FWWA 1TALA 2GX4A 4K1EA 1AQ7A 2ZFSA 1AKSA 4Y7AA 4JZEH 1DY9A 3SJ8A 3SBKA 3BTFE 3WW7A 1NT1A 1Z8IB 1ZPBA 3QGJA 3MNSA 5L2YH 1C5YB 3S0NA 4BAKB 3A8AA 5AHGH 5JYIA 2RFKC 1SFIA 4GLYA 2WYGA 1LCYA 4MNXA 3RMMH 1AN1E 1MTWA 4ASHA 2XWBI 4YESB 1LHEH 1M9UA 3RXLA 2PTCE 3P8GA 1F7ZA 2ZF0H 3RXUA 1C5UA 1XUKA 1W7XH 3H7TA 1O2LA 1GJ6A 1AWHB 5DO4H 4CR9A 1V2QT 2HGTH 1DVAH 3EAJA 1K22H 3H7OA 1ETRH 1YPHC 1VZQH 3OTPA 3MO6A 4ISOA 2CJIA 2Z9GA 2G8TA 1O3MA 3ZZDA 1FPCH 2A5IA 3ZVFA 3LJJA 1C1VH 2BZAA 4WXIA 1WDIA 4YO9A 1ZSLA 1RTKA 1PQ7A 1O3BA 1E36B 4WWYA 3BG4B 3A89A 3VXEH 1EB2A 2BDGA 3IG6B 3RC4A 1TONA 2CF8H 4AC9A 1UK2A 5EG4A 1IAUA 2BQWB 1IQGA 1J14A 3ZZ8A 2VINA 3HGPA 3F9FA 1JRSA 3QDZB 3GOVB 1P57B 1L2EA 1TBRH 1GJ5H 3PWBA 1O32A 3GDSA 5EXLA 2CGAA 2XBVA 1CT0E 1SOTA 2VIPA 3O8CA 4ZAEA 1CQQA 3RXAA 4TPYA 1WTHD 2GT7A 2Y7XA 7KMEH 6CHAC 2ZU2A 3HATH 3S9CA 1GHXH 2OK5A 1KDQA 4JZFH 1XXFA 3TJVA 1JRTA 4QT8C 1GBTA 1HJ9A 3DSPA 2FI3E 3EDXB 1L1NA 3E0PB 1FY1A 1ZJDA 1P2MA 1EZQA 3UWIA 2BM2A 1G3CA 2W6ID 3BF6H 4M9FA 3LDXH 1A0LA 5E0GA 1GI6A 1P0SH 2UWPA 1GMDF 3FKSD 1D3TB 3ZVDA 1G32B 2VWOA 1HAOH 2XTTB 5GXPA 4HTCH 1QJ6B 1OX1A 1LVBA 3GY3A 3DSGA 1GI3A 1SR5C 1SGQE 2AERH 2VNTA 3RC6A 1IQFA 2D2DA 1TGTA 1MTSA 1T8NA 2ZCLP 1ZMNA 2ZPSA 3BIVH 4LOYH 1NO9H 4K69A 4M7GA 1YPMH 2JIZD 1A2CH 2O8LA 3FAOA 3U98H 1NU9A 3VB3A 4D9RA 1PYTC 1NY22 2PKAA 2A0QB 1Y3XA 3M36A 3RC5A 3PV5A 5CHAC 1HAVA 4KTUA 4Q7XA 3M5NA 5GCHF 1UHBB 2P94A 2EQNA 2FI5E 1SB1H 5TCCA 3VB4A 3NWUA 1O3KA 1O3CA 5FHTA 2P3TB 3K65B 1UTQA 1ANDA 2CHAC 4D7FA 4X8TH 3SJKA 4BAMB 2PWXA 3OU0A 3ZZ4A 1CGIE 3EYDA 1EJNA 3ZVBA 3ODFA 2ODQA 4XSKU 3PV2A 1DLEA 1TGNA 1BIOA 2ZA5A 3RXQA 4X2VA 1A46H 2ILNA 3DHKH 3ZZ9A 1FJSA 1IHSH 1ZSKA 1S81A 4GCHF 4XOJA 4F49A 1HV7A 2K8IA 1AB9C 1XMNB 1DPOA 4UFGH 1J17T 2B9LA 4FUGA 1E1QD 1HFDA 1RXPA 2HNTF 3KN2A 4DG4A 4CRCA 3ENSB 1ESTA 3RMLH 4B71A 1C5VA 5JPMH 2JH0D 2NU2E 2WUCA 5ETXA 5FXLA 2OTVA 1FIZA 3W1EA 1HAYB 4MQAA 2PR3A 5E2OA 4E7RG 1PQ5A 3GY7A 2THFB 2JETC 1QJ1B 3VGCB 1TNKA 2ZGBH 1ARCA 4Y76A 1O5FH 3LPRA 1ELFA 1UTLM 4I8GA 4DW2U 3LKWA 2B5TB 2GP9B 3DUXH 4WMEA 2NU1E 3UB0A 1WSSH 1GHAG 1N1LA 1V2LT 1DITH 1WUNH 2XC0A 5EQSA 1AUTC 4YM9A 2XCFA 2OUAA 2QYIA 2VGCC 2UUJB 1EJAA 2ZKSA 3I77A 3EE0B 2Y7ZA 1QRWA 1MKWK 1TIOA 1UMAH 3LGTA 1D6WA 2BD2A 1AZZA 1KIGH 2SFAA 1BBRE 3TNTA 3U1JB 3SOSA 3NUMA 3S7HB 2JH6D 2OC0A 5E8EH 3T5FH 3HK3B 2VIQA 1A61H 2FXRA 1Q2WA 2R0KA 5C3NA 4BXWA 1RFNA 2OC7A 2O8TA 1SPJA 2C8WB 1DWBH 4FUEA 1K0HA 3SU1A 1AI8H 1TFXA 2Y5HA 1ELBA 1O3FA 1DXWA 1W14U 1QA7A 1FAXA 2A2XH 4I32A 1P3EA 5J4QA 1K21H 4CRBA 2CHAB 2CK3D 3RXFA 3SO3A 4UEHH 2BLOA 1THPB 1FAKH 1H8DH 1S6LA 7GCHG 1FDPA 3S69A 2YMSB 4GVUA 4NCYA 3T25A 1RJXB 2BDIA 1GCTC 3N7DA 3M5LA 5GNDA 3I29A 4MNWA 3UY9A 3AAUA 1AZ8A 2QE7D 4SGBE 4MPXA 3BEIB 1AB9B 1FMGA 1LVYA 4MPUA 1SVPA 2WV5A 2CV3A 5EOKA 1KSNA 3A83A 1V2PT 1S6HA 1EP6A 4I7YH 4Q2KA 3RM0H 3RMOH 1FNIA 3SNDA 1Z71A 1P10A 2BD9A 3CS7A 2QAAA 2VBCA 4OGYA 1BMMH 1PPEE 2EC9H 2JETB 5CMXH 1GBFA 3AW0A 1TRYA 1ZSJA 4AGKA 1GVKB 1D6RA 2P3FH 1QHRB 2WV9A 1HDTH 1DICA 2Z9LA 2PLXA 3UOPA 2ZGXH 3QO6A 3A80A 3MOCA 1GHAF 1SGNE 3SNBA 4ZKNU 3PO1B 4TY6A 1BTHH 2GJGA 1HJAC 1GDQA 2J97A 2A5AA 4I33A 4AG2A 4GSOA 1MAYA 1IQJA 1FN6A 2VWLA 1GBIA 1G3EA 1OSSA 2GZ7A 3A7TA 2FOMB 1P04A 3E0NB 3KCGH 3HK6B 3RXGA 1UTNA 3F3BA 5C17A 1GVZA 3CENA 1HPGA 1BA8B 1UTKA 2HVXA 3SU4A 5K0HA 1SL3A 2OP9A 1HNEE 1KMHB 1WU1A 1MZAA 4YZUA 1KXFA 5AFYH 4UFDH 3B9FH 9ESTA 4AGJA 2PW8H 4BAOB 5I46H 1LO6A 1G3BA 4TWYA 1GJDB 1A3BH 1QR3E 2XOKD 3RU4E 3TH3H 2C8YB 2XCNA 2EI7A 2BXUH 1BQYA 4AYYB 2KCOA 2R2MB 1GMHG 4MDSA 1GBAA 2A7CA 2KX4A 3EQ0H 4YOJA 5EPNA 1WAYB 2ZEBA 1CT4E 3GCOA 3SU0A 2VH0A 1EXFA 1A0HB 1UCYH 3M7UA 2QV1A 1P12E 3ZYEA 3A8BA 3EGKH 3VB6A 1F5RA 5E0JA 1CA8B 1BRCE 2M2AA 1S5SA 3JZ2B 3F9EA 1V2UT 4Q63A 3BTHE 1BMAA 1C5RA 2NWNA 3ZV9A 1O2VA 3F68H 5FBEA 1QB1A 1PPFE 3RXSA 4ABHA 1T8LA 4FUFA 1G2MA 1LDTT 4AB8A 2OBOA 1C5WB 4YTAA 2Y6TA 5F8ZA 4RSPA 4ABJA 1MU8B 1ELCA 4B2CA 1KLJH 1GI1A 3RUOA 1BT7A 4MNYA 2LP6A 4X2XA 5DP5A 4RKJB 1D4PB 3RMNH 5DJ7A 2ANKH 2WINI 4FUHA 1ELVA 4ABGA 1PPCE 1TMTH 4YXWD 3A7YA 3ZVEA 3H5CB 4ASUD 2A7JA 2R9PA 1W0ZU 1ORFA 1TQ0B 3W94A 2PSYA 1T8OA 4ZUHA 3MNBA 1ZHPA 1CBWC 3U1IB 3RLWH 3KIDU 3Q3YA 9LPRA 2ZDVH 1EAXA 3SJ9A 3SGBE 4X6PA 4LXBH 3UIRA 1NN6A 3E8LA 1DUEA 1AHTH 4Y0ZE 1O2IA 1G3DA 2YNAA 1LPGB 2G4TA 3AK5A 5L30H 1F2SE 4E7NA 5JBAS 1P2IA 4A1VA 2QF3A 2H9TH 1WBGB 2KFWA 1GGDC 4HGCA 4AN7A 1KLIH 4GUXA 2EA3A 3STJA 2SGFE 5PTPA 3MHWU 1ETSH 2CF9H 1K2I1 4FU8A 2BY7X 2SGPE 1J9CH 1YCPH 4D9QA 1YF4A 2FOGA 3QLPH 3RXPA 4ABAA 4JMYA 5FAHA 3MH4A 1XKBC 1FX0B 3ESTA 3KYGA 3F6UH 1GMHF 1TNGA 5G4BA 3ZVCA 3NK8A 1O3EA 4ZROA 3URDA 2HVYB 1N8OB 1AVXA 3B23B 2BVXH 3M5OA 1GCDA 2Z94A 3E91A 3UREA 2ZGHA 3AW1A 1O3IA 4IC5A 1NS3A 4PROA 3STIA 3PV4A 3KQ5A 2V3HH 3GY8A 3DFLA 4FUDA 1NTPA 1EZUC 1QL8A 2Y80A 2EEKA 3D23A 3LGVA 2ZDAH 3PLPA 2TGPZ 1K1JA 1L4ZA 2Y5FA 3AAVA 2ZP0H 1TGBA 4K8YA 2J94A 2WYJA 3MWIU 1SKYE 1KDQB 5TJXA 4HZHA 4XFQA 1EQ9A 3GDVA 3MI4A 1O5AB 1GI5A 1F0SA 1SGFG 1GHVH 1O38A 4JYUH 4CHAB 1SHHB 3ZZBA 4TY7A 1O2MA 2AIQA 4NA7A 2H5DA 3FANA 1BCUH 3QN7A 2BVRH 1CBWB 1C4V2 1OWHA 4CRDA 2V35A 1O2YA 3SZEA 2GZ9A 3WY8A 1J16A 2KCAA 4MVNA 3M35A 1Z7KA 1TABE 4NIYA 1QL9A 1MKWH 2ZHWH 3HGNA 1ESAA 1TGCA 3TIUA 2ZHEH 5F03A 2VVVA 3VXFH 1GMDG 3SU6A 1XXDA 3BEUA 2EY4C 1BITA 5EQRA 4ZHMU 2GV6A 3OE7D 3RP2A 1CHOG 5FX5A 4HFPB 4A1TA 2J9NA 1C5SA 1O2TA 2PKAB 1A3EH 1O3GA 1Z8JB 1GGDB 1YLNA 3CP7A 2FESH 5T3HA 1BRAA 4U2WA 3H09A 4FOUC 4O97A 1GJ8B 2F43B 4ISHH 2H9EH 4Q7YA 4ZH8A 4BANB 4U01A 5A2MH 1Z8RA 1ZGIA 1YM0A 2Q1JA 5FPSA 2ODPA 1SGPE 1EOLA 2DUCA 2PUXB 1C1PA 3HPTB 2SNVA 2HRVA 5FX6A 3NKKA 4MPVA 4X6MA 4XBBA 1Y8TA 1DT2A 1LVMA 5GCHG 2UWLA 1SBWA 1AD8H 2ZFPH 5JB9S 2JDID
chains in the Genus database with same CATH topology
2GCTC 3SI4H 4ESTE 2W3IA 4IMZA 4IW4E 2GCHG 2FYQA 1EATA 1UO6A 1A7SA 1BTWA 2HPQH 5C5NA 8ESTE 1NU7B 5GWZA 2WPHS 2FP7B 1SI5H 3P17H 4AZ2B 2FZZA 1H9HE 3ZZAA 1UCYK 1BRBE 1LQEA 2JH5D 4R8TB 3RXEA 2GMTC 4ZKSU 8LPRA 1C1NA 1UVOA 3GY5A 4GCHG 1ID5H 1FI8A 1VCQA 1SC8U 1H9IE 3EA8A 1O2RA 1O2PA 1YPLH 1BTYA 1CT2E 3K6ZA 4AX9H 1NRSH 5EXMA 5CE1A 4A7IB 1OYQA 2CXVA 2C4FH 3TGIE 2F9UA 2SGEE 4K5ZA 1IQNA 4A5TS 1GHBG 4IS5A 4RN6A 1UTPA 1C9PA 1PPZA 1UK3A 4BTTB 4O03A 3HKIB 1EPTC 4R0IA 4Y8XA 3RXBA 2HLCA 2H6MA 3D62A 1BMNH 2PSXA 2OXSA 5ABWA 1GG6C 2FOFA 3URCA 4BOHA 1SGIB 2G52A 5J4SA 1MKXK 1G37A 1MCVA 3K2UA 1GVLA 4ZKOU 3DA9B 4WJG2 2VIDA 1PFXC 4J1YA 1OYTH 1GI7B 1C1OA 2H5CA 2A2QH 3OY5U 5EU8A 2H2ZA 2QXJA 2ZGJA 1ACBE 1C5PA 4U32A 3S9AA 4BTIB 1X7AC 1LHDH 4ABIA 1C2DA 1NC6A 1VITH 3BTQE 2W26A 2FTMA 3FFGA 1CHOF 3JZ1B 1TBQH 1BOQA 1RGQA 1P2NA 1V2WT 1W3CA 2GDEH 3TITA 3P95A 4KTSA 1P9SA 1SLUB 2A5KA 1J8AA 1CU1A 4O3UA 1VCWA 4XBCA 1H8IH 2FM2A 3C1KA 2RCEA 1HYLA 4J2YB 3U8RH 1QQUA 1DWDH 1F0UA 1HLTH 1NZQH 2FOEA 3GYMA 3LGYA 2HALA 1GL0E 3OY6U 3TNSA 3SNEA 4CR5A 2Q6DA 1YLCA 1B0FA 3LC5A 1O3HA 1NRPH 3RM2H 1O2NA 1YCPK 4GPGA 2C8XB 2HOBA 3HKJB 2FEQH 3ITIA 1TMUH 3QZQA 3MH7A 2ZCHP 3IWMA 1P9UA 3GYLB 1Y3UA 2GCTB 2ZO3H 5DP8A 2GV7A 2A1DB 8GCHF 1QTFA 2AYWA 4X8UH 2GCHF 1SLVB 3ATWA 3I78A 4YLQH 5A0CA 2NU4E 4Y10E 1O2UA 1ZHMA 2BD3A 4XDEA 1O2KA 2DE8A 2OD3B 4YT7H 5EW2H 1BB0B 4GHTA 1ANBA 1QBNA 2BB4A 2GMTB 1GBEA 1LVOA 1TNLA 1HGTH 3KQCA 1WOFA 2BD7A 4B74A 1C2LA 2EI8A 2ALVA 1QRXA 2EI6A 2F9VA 1DANH 3PMBB 1CGJE 3S7KB 3ZZ3A 2TGDA 3Q3XA 1GHBF 3IITA 1NFYA 1RS0A 4BTUB 2ANWA 3A7XA 3FVFB 4CREA 1QJ7B 4INHA 8KME2 2YNBA 2A4RA 2FOAA 3EA9A 5T6FA 6CHAB 2QCYA 2IOTA 1GG6B 1DX5M 5LPRA 1DM4B 2AGGX 4FU9A 1ZOMA 1O0DH 1BTPA 1Q31A 1YPHE 2LNCA 2VVCA 2W5EA 1C1WH 1CA0C 5GPIB 2OCVB 3UWJH 3MNXA 2A31A 2FMJA 3DD2H 4NA9H 2XW9A 4UE7H 2GKVE 3GCHC 1LHCH 1YPJH 5F6MA 2F3CE 3PLBA 1YKTA 1B5GH 3CS0A 3BTTE 3MU4A 4F4OC 5A8XA 1TX6A 2GVFA 3R0FA 1HJ8A 1T8MA 1Y5BT 1L4DA 1YPEH 1S83A 1P2OA 4MTBA 1Z6EA 2HNTC 1HB0B 1HXEH 3QK1A 2IPHA 3ZVAA 1O2HA 1O5DH 1WTGH 1EUFA 1RIWC 4WH8A 3T62A 2PFEA 1GJ9B 2NU3E 2ZDNA 4B1TA 5CHAB 4JZ1A 2ZIQH 1A5HA 3TGKE 1ANEA 1BTZA 3F1SB 5DP9A 1O37A 1GBCA 1AFEH 2QY0B 1LQDB 3M3TA 4OS5A 5C1XA 1C5MD 1AWFH 1F5KU 4FVDA 3SV6A 1KTSB 2WPMS 1Q3XA 4WY3A 4MNVA 1ELTA 2Z9KA 3RU4D 1C1TA 2QXHA 4ZKRU 2ZG0H 4ZXYH 2LPRA 1VGCC 1S85A 1TQ7B 1GBHA 3SN8A 1MAXA 4AG1A 5AVDA 1TRNA 1FY4A 1UCYE 3TJOA 2RA0A 1ABIH 1XUGA 3RXJA 4ZXXH 1GHZA 3PROA 1W7GH 3L6PA 4ABEA 2AMDA 4DT7B 1EP5A 1GBJA 3GY4A 1FLEE 2IN2A 1DSTA 1GDUA 1V2MT 1TNIA 2XNIA 1UJ1A 1L1JA 4E05H 1KXEA 2ZPQA 4NA8A 5ESTE 1U6QA 1NRRH 4KP0A 1FONA 1P03A 4X6NA 4CRAA 1WYKA 2WV4A 1FN8A 1UTMA 3TK9A 1FXYA 1EAUA 1C2GA 4DCDA 1BJUA 2BDBA 1O34A 1RRKA 2B8OH 4B75A 3SGQE 3U69H 3BTGE 4Y0YE 4I8HA 1ANCA 2QGRA 2ZTYA 4DIHH 1EPTA 5BPEA 3TU7H 1CA0B 4NWKA 2H1UA 1NRNH 1YC0A 1AMHA 3KHVA 1O2XA 4IMQA 1GI8B 2VGCB 3TGJE 4K2YA 3V7TA 4A92A 4ISNA 3T29A 7ESTE 3SV8A 1O2SA 2FS9A 3SI3H 2BD8A 1GJAB 1P09A 3KL6A 1SGYE 1XKAC 5T6DA 4KELA 3NXPA 2B0FA 1BBRH 3K9XB 2P8OC 2BDCA 3BSQA 2CMYA 3PB1E 1OWKA 1TPOA 3ATLA 3LGWA 2ZDLA 3A81A 1SHYA 2F83A 3LGUA 2C3SA 5A8ZA 4WF8A 5DK1A 1MMJN 2AS9A 2VU8E 5H4IB 1RIWB 3RXDA 1JIRA 1RD3B 1JIMA 4K1TA 2PKSC 1C2KA 1TWXB 1OWJA 1SQAA 4JYVH 2KAIA 1C2HA 3PM3A 1SLXB 4WH6A 1UTOA 2ZHFH 1GDNA 1O2WA 1O2GH 3SUDA 4X6OA 1O36A 1SGFA 2O8WA 1UVTH 2BLQA 1HAZB 3ELAH 1TPAE 2ZFRH 1A5IA 3OYPA 4INLA 1MD7A 4D76A 1O3AA 5FPTA 1C1RA 1DDJA 3PYHA 1C5XB 1GCTB 4LK4A 1E37B 3TJNA 2STBE 3T27A 3U8OH 1O3PB 2F9NA 3KNXA 1UVUH 4AFUA 1O39A 2TGTA 3M3SA 2TIOA 2VIOA 1HXFH 1TRMA 2ZPRA 3KGPA 1LPKB 3UQVA 1KYNA 4K1SA 3RLYH 3T26A 3SGAE 1YPGH 4FUCA 1L0ZA 3SW2B 1JWTA 2ZCKP 1GJCB 5C20A 1DLKB 1MKXH 1WCZA 3MH5A 3NCLA 1ZRKA 4UD9H 3ZZ7A 1C2JA 1K1MA 1K1NA 1IHTH 1TX7A 2ZU3A 3V0XA 1FUJA 2VWMA 1RTFB 1HIAA 4UFFH 3UR9A 1BHXB 1DS2E 1ZLRA 3QZRA 2BY8X 2ZWLH 1TB6H 1C1MA 2AGIX 2RA3A 1ZGVA 4ISLA 1P2KA 1AKSB 1P06A 3PWCA 1LMWB 1BRUP 1HJAB 2A32A 2M5TA 3A7ZA 4JK5A 4NSVA 1OPHB 3Q3KA 1QY6A 4H42U 1T4VH 3M3VA 4YOGA 2FODA 2R3YA 2SGAA 1F92A 3VFEA 1ETTH 1TE0A 1PQAA 3G01A 1OXGA 1E0FD 2XBYA 1TLDA 4Y8YA 2O8UA 4AFSA 2AMPA 1O5CB 3SUFA 1ZPCA 4CH2B 1CHGA 1MCTA 3UUZA 3KQDA 1YYY1 2BOKA 4A1XA 5JB8S 1F0RA 1C5LH 2D26C 5A09A 2PKSB 1HAPH 1XM1A 1D3PB 2ZHQH 2BX3A 1PPGE 3NZIA 1J15A 4Q80A 1GJ4H 3AVZA 5HM2A 2BVSH 1GBMA 1ZMJA 1B7XB 3LH1A 1D3DB 3M61U 1E35B 2FLBH 2ZFTA 3L33A 4WXVA 1T32A 1FY8E 3UNRA 3UFAA 1D3QB 4X1SU 5TCAA 3UTUH 4FUBA 1LTOA 2GDDA 1TNJA 2ASUB 3A86A 1GI9B 3UOUA 2ZZUH 3GCTG 4AYVB 1O2QA 1JXPA 3QTVH 3R3GB 1ZZZA 2R2WU 1O30A 2A7HA 3GISB 4DIIH 1S0QA 6ESTA 1C4U2 1K1LA 3ZVGA 1TX8A 1MZDA 2WPLS 3SNAA 3RXVA 1FZZA 2ULLA 4NFEA 3TK6A 2F9BH 3BIUH 4ABDA 2BD4A 1C1SA 1MTVA 2XC4A 2V3OH 1O5BB 2WUBA 4D8NA 4B2BA 4U30A 2ZNKH 2SNWA 2Z3EA 4ABFA 1SOZA 4UDWH 3SU5A 2RDLA 3BTDE 2AFQB 5L2ZH 4GAWA 4H4FA 3T2NA 1Y5UT 1CGHA 3LJOA 1B0EA 1V2TT 3ODDA 1S82A 1QBOA 1NROH 1W10U 4NIXA 2D1JA 4X2YA 5HM9A 1FV9A 5DKMA 3MU0A 3VB7A 2BQ7B 3E3TA 5HXFA 4KGAA 3V12A 3MO9A 1C1QA 1LKBA 1Y3VA 4XE4A 3P8NA 4JZIA 4I8LA 1GBBA 2TPIZ 3KEEA 2XRCA 1SSXA 1W2KH 2FTLE 1W0YH 1C5OH 2UUKB 1DXPA 1O5EH 1SQTA 3SORA 2BXTH 3E6PH 5T6GA 1GJBB 5C1UA 4GHQA 2XWAA 1HAVB 2XC5A 5DPAA 5I25A 1WV7H 2FPZA 3V13A 5EPYA 3SV7A 1DY8A 3ZZ5A 1Y59T 2ANMH 2ZFFH 2FX6A 4K8BA 2ZFQH 2ZU5A 2QIQA 1ZRBA 2QXGA 4NG9H 3FP6E 1BBRK 3F9GA 5SGAE 4JZDH 1O31A 1ELAA 1N6XA 1QL7A 2I6QA 1EJMA 2GTBA 1P3CA 1QNJA 1MQ5A 2BQ6B 2QA9E 2BY9X 1IQLA 1C2MA 4IN2A 2OC8A 4FU7A 3OSYA 8GCHG 1SMFE 1EB1H 3D65E 1TA6A 2IJOB 2XBWA 1TOMH 1TPPA 1NFWA 3BTEE 3U9AH 2VIWA 2I6SA 2OLGA 2R3UA 2R0LA 1SGTA 1RTLA 1UVPA 4B73A 2FS8A 4IN1A 4OS7A 3GCTF 1AE8H 1MH0A 2Y5GA 4LZ1H 3TH4H 1SQOA 1O2OA 3KQEA 2BDYA 1NESE 3KF2A 3SZNA 1SGDE 5DP7A 2QXIA 2BDAA 2BY5X 3F9HA 3PMHB 3QX5H 5LH8A 2DE9A 3OX7U 2G5NA 3Q77A 2VVUA 3B8JA 1LHGH 1ZMLA 1ARBA 4X1RU 2GZ8A 2A45B 1FY3A 4E06H 4ZHLU 1QA0A 3MMGA 2A4QA 1PQ8A 1D9IA 1Z8GA 5DGJA 4FUJA 2ZGCA 1TYNA 1G36A 4FUIA 3GICB 1AGJA 2FO9A 4Y6DA 2V6NA 3UQOA 2P95A 2F9PA 1OP2A 1V2NT 1E34B 5IDKA 3A7VA 1MQ6A 4A6LA 1A4WH 4FXGH 5C5OA 1IOEA 1T4UH 3P70B 1KTTB 3VGCC 1GMCF 3ATIA 1IQIA 4LZ4B 1C4Y2 1C2IA 3D49H 4INKA 1Y3YA 2STAE 1YLDA 2BYAX 4I31A 2BLVA 3MU5A 1P2QA 3ZZCA 5EGMA 3RXTA 3SV9A 1F5LA 4NWLA 5F8TA 1FY5A 2HWLB 3A82A 2TBSA 5DP6A 2G81E 4UONA 5HYOA 1FIWA 3NPSA 1ZTLA 3E16B 4DY7B 1DWCH 3E90B 3LOXA 3LONA 4Y71A 1CE5A 1HAHH 3PLKA 4CBNA 6LPRA 2G00A 2P16A 1KXBA 2ZTXA 1K1PA 1S0RA 1TPSA 3T28A 1IQMA 1OWEA 1VR1H 3P8OA 3P8FA 1GWAA 3RU4T 2P3UB 1P8VC 3GCNA 3VEQB 3A8DA 4Y7BA 2FOHA 3S9BA 1QQ4A 1O2JA 3W95A 1TMBH 5E2PA 2UUYA 4DJZB 4XBDA 3TPIZ 1QB9A 2XXLA 3ATKA 1XUJA 3TVJB 1O3JA 1ESBA 3M7TA 5GIBA 5DG6A 4OS6A 5EQQA 5AF9H 3MO3A 4AB9A 2A4GA 2B7DH 2BMGB 5EXNA 1NPMA 1GHYH 3PMJA 1DE7H 1DWEH 2H9HA 5FBIA 1CVWH 4UFEH 3TH2H 4NGAH 1Y5AT 1V3XA 4K3JA 2Z7FE 1V2RT 2SGDE 4X0WU 4IC6A 1EPTB 4KKDA 4YOIA 1MU6B 2XYAA 1FQ3A 2K1QA 1EX3A 3BTME 1LPZB 4BXSA 2Z9IA 2PHBA 2OINA 3Q00A 4AFQA 1C2FA 1OWDA 3DFJA 1NRQH 4I8JA 2TGAA 4ZMAH 5DP4A 1O3OA 1SGEE 2AIPA 2G55A 3Q76A 4H6SB 3TLOA 4CBOA 1PYTD 2WPIS 4CRGA 2ZECA 5C2ZA 2G4UA 2GD4B 3LU9B 3UNSA 4YLUA 5AFZH 1S6FA 4X8VH 1YCPM 1SLWB 2FIRH 2W7UA 3LT3A 3ZZ6A 1G30B 1NFUA 1QRZA 1SG8B 2UUFB 1HBTH 3PO1C 1XUIA 1P02A 3MTYA 1GI0A 3MFJA 2BX4A 1AVGH 5JBTA 2BHGA 3M37A 2KAIB 2BLWA 1T7CA 1VJAU 1QB6A 3FZDA 3AASA 1W13U 2Z6BD 1AVWA 2PUQH 2C93B 3SQEE 2RG3A 1G9IE 3RXHA 3A88A 4TPIZ 1VITG 3K6YA 4ISIH 4OS1A 3VB5A 4FVBA 5LPEA 1V2OT 4NIVA 1BMLA 4X8SH 1TAWA 1ZYOA 1XUFA 2BY6X 1MTUA 2ZHDA 2FOCA 3A7WA 5HGGA 1P2JA 3LGIA 4WMFA 3PTBA 1WQSA 3U8TH 1G2LA 2WPKS 1BHXF 1K28D 3MH6A 3O8BA 4BAQB 2Z3DA 1JBUH 1MBQA 1WQVH 1XX9A 1EZSC 1AU8A 2SGQE 3PMAB 5GJ4B 5BRRE 2ZI2H 3SHAH 1BJVA 3BTKE 1ABJH 2PTNA 2FYRA 1TNHA 3BN9A 3KQBA 2AGEX 2AMQA 3FZZA 2Y82A 1GI4A 1UHBA 4MLFB 3MYWA 3M5MA 1HIAB 3ZYDA 2GGVB 3QWCH 1S84A 2ANYA 1TOCB 1OP0A 3LH3A 1KXAA 2J92A 1AUJA 2F9OA 2A4OA 1UK4A 4THNH 1VCPA 4Y11E 5LGOA 3EA7A 1W8BH 5A0AE 2BTCE 4CH8B 1NFXA 2NU0E 4SGAE 3RXMA 1QBVH 1O33A