3MU4A

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region b of the crystal. first step of radiation damage
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu4A01
1DITH 1VGCB 2ESTE 1CO7E 1GHYH 4IGDA 5EG4A 1ABIH 1H9IE 2YNBA 1C9PA 1MAYA 3BV9B 5E0HA 3NPSA 3HKIB 3B9FH 2DUCA 3PLPA 8GCHF 1AUJA 2BZ6H 1DSTA 2Y82A 4MPUA 1NM6A 1EAXA 1LKAA 3P95A 1O33A 1THRH 2ZHQH 3SGQE 2VH6A 1AE8H 1LQEA 3KIDU 3M5NA 1C1QA 2H9HA 2A5KA 1KXAA 1AFQC 3RXTA 1A1RA 2W7SA 4B71A 5DO4H 2PV9B 1UTQA 2BVSH 1E37B 1EASA 3PWBA 2A32A 1HYLA 1D9IA 1EAIA 1QY6A 2YOLA 3A8DA 1A46H 6CHAC 2NU2E 1W0YH 3TH3H 1P11E 1BBRE 4UEHH 4IC6A 1C2FA 2B7DH 1TLDA 2BB4A 2P3TB 3OSYA 3FZDA 1L2EA 3MH5A 1BRUP 4MNXA 3LT3A 2Q1JA 2ANKH 1V6DA 1ELGA 2Z9GA 1FI8A 1GJ7B 3BG4C 3SBKA 4CR9A 5AFZH 3QN7A 5JPMH 1FIZA 1ZPBA 2GTBA 1K1PA 4XBDA 2VIWA 1V2VT 3E6PH 4DW2U 1O37A 1CT2E 2PUXB 1YPEH 1EP6A 1DFPA 5T6DA 3SO3A 5DP9A 1F5LA 1S84A 2RA0A 1K1NA 1BBRK 1AU8A 1TPOA 5EGMA 4BTIB 1GCTB 1GI4A 5F8ZA 2QXHA 1XVOA 2GCTC 2J2UA 4WH8A 3LGUA 4Y76A 3ZZAA 4FUJA 3JZ2B 1JIMA 2NWNA 1G30B 2P3UB 3OX7U 1C5QA 3GISB 1BUIA 1DT2A 3VFEA 1NU9A 1GMCF 2BD4A 3LGTA 4X6PA 1TIOA 4MPWA 1D4PB 3F6UH 1HUTH 4LK4A 2FLBH 1AD8H 3G01A 2A31A 1CHOF 4KELA 2P93A 2TGTA 1BDAA 4ISNA 1YPLH 2PGBB 2XW9A 1ZGIA 1GWAA 2IN2A 3ODDA 3RM0H 2BD3A 1TA2A 3LH3A 1FZZA 2AERH 1TALA 1TMUH 1DWBH 3UY9A 4X2VA 5CE1A 4FUGA 2P3FH 4IW4E 5GDSH 2WINI 1OYTH 2VIDA 3GCHB 1K1IA 3GCNA 1EAUA 8KME2 1ZTKA 2G4UA 2PWXA 7KMEH 4FVDA 2UWOA 1ESAA 4A6LA 1MBMA 1DE7H 1ZPZA 3LU9B 3PLKA 1YLCA 3SU3A 2F9BH 3GY2A 1WOFA 1LO6A 3MNXA 1GBLA 1G37A 4XBCA 2OUAA 1E36B 1MZAA 1GI7B 4Y11E 3SI4H 3MU4A 1Y59T 1BB0B 1PFXC 3GDVA 2ZPRA 4OGXA 4Y8ZA 1OWEA 1BBRH 1QL9A 4SGBE 5IYTA 1RS0A 1SHHB 1ZOMA 1G36A 1GVKB 5DPAA 1PQAA 2GZ8A 1YCPM 3MYWA 1TQ7B 4ASHA 3S9BA 1WCZA 1D3PB 4WH6A 1VITF 2VVVA 4UE7H 3A7YA 2WPMS 2ZDNA 3PMHB 3KL6A 2I6QA 3SU0A 5EPYA 1THSH 2BVRH 4DURA 2XCNA 1P03A 3PO1B 3SOSA 1GI0A 1HAZB 1TNJA 5JDUB 1EP5A 5JYIA 1Q31A 3M7UA 1B7XB 4TPIZ 2A2QH 1EPTA 4YESB 1CBWB 3KQBA 2VIPA 1O5EH 4RKJB 1ZLRA 3E90B 1YCPK 1UHBA 2BD7A 2IPHA 5C67A 2G5NA 3V0XA 4X1QU 8GCHG 4NIVA 2Z9IA 2BXTH 4YOJA 1YP9A 1O2JA 1PPZA 3O8RA 2WUBA 1T7CA 3GY7A 4I31A 1OP8A 4Q7XA 2FMJA 3TJNA 3VGCB 3LDXH 2ULLA 4AZ2B 4CHAB 5T3HA 3C1KA 5EQRA 5G4BA 1BT7A 3RU4E 1BJVA 1GPZA 2JH5D 2PUQH 3D62A 5K0HA 2BDCA 5LGOA 2VGCC 1PPHE 3CENA 4X0WU 1NRNH 3GYMA 2GD4B 3RXGA 4R8TB 2QV1A 2HPPH 1C5RA 3S7KB 2ZDLA 5EQQA 1FQ3A 1OWKA 4BANB 1CHGA 2UUYA 5LPEA 1DY8A 1P2MA 1IQIA 4AB8A 1TWXB 2F9OA 2ZPSA 2CJIA 1ID5H 5C1YA 1DS2E 1SGFG 4JCNA 5EW2H 3SUDA 1P2IA 4I8HA 3D49H 1P04A 2C8XB 4A1XA 3VB6A 2ODYB 1HBTH 1AO5A 4FUIA 2V3HH 1GBBA 4D76A 4UONA 2PKAB 1Y8TA 1GI3A 1XUKA 2H6MA 4IN1A 1H4WA 1BHXB 2XBVA 1UTNA 1QR3E 1O3GA 3A7TA 1MQ5A 1EOJA 3ZZBA 3S0NA 5C20A 4MQAA 3M3TA 3SU5A 1LPKB 1L0ZA 2O8LA 3L6PA 5TCCA 4B73A 1P3CA 1SGTA 2XBWA 2BX3A 1EZXC 4ZROA 1P06A 5E2PA 3E16B 3PYHA 2XC4A 3MU0A 1J16A 2Y7XA 1SFIA 4HTCH 2Y5HA 4ABJA 1ZTJA 1AKSA 3RC6A 2ZHWH 1AZZA 1YCPH 1DWDH 2AFQB 3PMAB 3MTYA 1HJAC 3SZNA 4TY6A 1GMCG 2WPJS 3K9XB 4JMYA 3UWIA 1F0RA 1C5VA 5IDKA 1ARCA 1E35B 1QB6A 2JETB 3A83A 1KXBA 1OPHB 1SG8B 1MU8B 3MNBA 3RXDA 1CHOG 2F9PA 1ETTH 3EYDA 1O35A 4IBLH 3TK6A 3EE0B 2BQ7B 4B74A 2PR3A 2OC1A 5EODA 3URDA 3DFLA 4AG2A 1P0SH 1V2NT 1BOQA 1BTPA 4XBBA 2FI5E 3TPIZ 1ZSLA 3F68H 2BD8A 3DFJA 4YZUA 1HJAB 1GBIA 2FS8A 1EJMA 2GP9B 3RXKA 2AEIH 1AI8H 3ITIA 4WWYA 1V2LT 1KDQA 3LC3A 1K1LA 2ZPQA 3U8OH 1NY22 1T8MA 4O03A 4INHA 3RXFA 2AGEX 4GHQA 1S85A 4OS7A 1LHCH 1QBNA 2BDGA 2WYGA 2SGAA 2HGTH 1EB1H 1L4ZA 2RG3A 1ESBA 1C1UH 3M61U 4CH8B 1TGSZ 2W3IA 1RFNA 2A7CA 3ENSB 1ZTLA 4J2YB 2ASUB 3T27A 2ZTZA 1GBDA 1Q3XA 3P17H 1C1MA 5A0BA 4CRAA 2XTTB 2GGVB 2VWLA 2FTMA 1GL1A 2STAE 2ZIQH 3UNRA 2STBE 3PB1E 4ZHLU 2PKSB 1YBWA 1ANEA 4WXIA 1FAKH 1P02A 1SLWB 3QGNB 1H1BA 2UUKB 1VITG 1YLDA 3Q3KA 3KF2A 1FNIA 1AHTH 3LC5A 2VIOA 1MBQA 2C4FH 3B23B 2RDLA 1ZMJA 3PMBB 3ATIA 1GDQA 1XUHA 1BMAA 1QL8A 2ZFRH 2W5EA 4GUXA 1PPGE 5FBEA 1QBOA 4ZKRU 1SGQE 2LPRA 4M7GA 3NK8A 4A1TA 5C2ZA 3HKJB 2D1JA 1O5FH 2Z9KA 2FOFA 4CRFA 1P8VC 3PLBA 4OS6A 3ELAH 1T8OA 1BMLA 5HXFA 4LZ4B 3EA9A 4TWWA 1ANDA 1GG6B 2AIQA 3QWCH 3SNBA 3ZVEA 5ESBA 2ZTYA 1M9UA 2VVCA 3RXIA 1MU6B 4ISOA 3M35A 2FODA 2CN0H 1FY8E 1OXGA 3SJIA 1EOLA 1VCWA 2PLXA 5FXLA 2FEQH 2TIOA 4GLYA 3QO6A 2ILNA 5T6GA 1D6RA 3VXEH 1W7XH 1ACBE 1V2TT 2A4QA 1KSNA 4K1TA 3VB7A 2BYAX 1G3BA 3S7HB 2ZCHP 3P8NA 4DGJA 1GBKA 4AG1A 2ZECA 2B5TB 4YTAA 1RD3B 3VPKA 4Y79A 3MNCA 3NKKA 1MD7A 2ODQA 3STJA 1RXPA 2Z9LA 1IQKA 1O3HA 2CHAB 4MLFB 4AN7A 3GCTF 2P94A 4K2YA 1DXPA 1EUFA 2UUFB 4WJG2 3S9CA 1L4DA 1O32A 1Z7KA 4TY7A 4UDWH 3U1JB 4H6SB 1H9HE 1ZJKA 3BN9A 3M5OA 1GCDA 1UK4A 5B6OA 2A7JA 2VINA 3ZYDA 3HPTB 3RLWH 8LPRA 3PWCA 3A86A 1YPHC 2ZFPH 1FPHH 5EU8A 5C1XA 3R0FA 3VB4A 1VJ9U 2OC8A 1CT4E 3WY8A 4X8TH 2Y5GA 1T8NA 3PROA 2QF0A 1JRTA 2VWNA 3TGJE 1P05A 3BTHE 1BZXE 2TBSA 3RMOH 2FO9A 2FOGA 3IG6B 1C5MD 3FFGA 2SNVA 1HJ8A 3ZVDA 4JZFH 3A84A 2WPHS 1WSSH 1MH0A 3D23A 3TGIE 1FAXA 1GHAG 4I8JA 4AFUA 5DP7A 1D3DB 4BXSA 1MUEB 4RSPA 3V7TA 2ALPA 4X2WA 2QYIA 2BD9A 3LKWA 1W3CA 3RP2A 1C5UA 3TH2H 4XDEA 4GSOA 2ZTXA 3EQ0H 1NS3A 4JZ1A 5FPYA 1KLTA 4WXVA 1UVOA 3T28A 3S69A 1DLEA 1UK2A 2BDBA 1NU7B 1KTSB 1P10A 1W13U 4BNRA 1TYNA 1WV7H 3MO9A 1LPZB 1N6YA 2ZDVH 4FU9A 1FY4A 2FOHA 3UOUA 2ZU3A 1NFWA 1B5GH 5L2YH 2VNTA 1GI9B 3GY8A 4JYUH 1D3QB 1J9CH 1QQUA 3F9EA 3MU1A 1HAGE 4YOGA 1N1LA 1AB9B 1HB0B 3O8CA 1SBWA 1F5RA 1Z6JH 2GMTB 3BIUH 5FPTA 3FANA 2HNTC 4ZXXH 3ODFA 1QCPA 2RCEA 4WF8A 1O3AA 3BTWE 3N7OA 2AMDA 2FM2A 3D65E 5C3NA 4WY3A 1HXEH 1OS8A 3GOVB 1FY1A 2Z3CA 5HGGA 3TGKE 1C4Y2 4JK5A 2J92A 4AYVB 4NZLA 3ZZ3A 1OYQA 1NFUA 3MH6A 1BA8B 4X1RU 2CF9H 3P70B 3R3GB 2ZFQH 5DKMA 3A81A 1O3DA 3E3TA 3Q77A 4ABEA 2Q6FA 1ELFA 1TNGA 3FP7E 5J4SA 2SGFE 5PTPA 3GDUA 4DIIH 4XSKU 1IQMA 1OX1A 4FUBA 3T25A 1P2JA 1ABJH 4OS4A 1HAYB 1SOZA 1O2WA 4YM9A 5DP6A 4ISIH 3ZZ9A 1A2CH 1AFQB 2ZGXH 4X6MA 1TRYA 4INLA 4O9VA 2AMPA 2ZFFH 6CHAB 4H6TA 4MNWA 1BMNH 1F0SA 4HI3A 4YO9A 2R0KA 1VZQH 3U98H 1O3CA 4ZXYH 2HPQH 3UREA 2EI6A 1Y3VA 1KTTB 2CV3A 5DJ7A 1A5HA 3EA8A 4NCYA 2ZQ2A 1SOTA 1MCVA 3BG4B 1H8IH 4D9RA 4CRCA 1V3XA 3CS0A 1K1OA 2H5DA 2SGEE 1JBUH 1O3MA 1QNJA 1Y5BT 3T29A 3MI4A 2ANMH 2BXUH 1FDPA 1SGCA 1WYKA 3MWIU 5HYOA 2BDYA 3KCGH 1SLVB 4BTTB 3NCLA 1XX9A 1ZRBA 3SNAA 4MNVA 1AMHA 3UUZA 1HNEE 4IS5A 3BSQA 1J15A 3AASA 2GCTB 3BTGE 3GY4A 3GCTG 2C3SA 2TRMA 2A5IA 3OU0A 1W8BH 1WQSA 3SHCH 1DWCH 1EZSC 1GHXH 2UWPA 1TFXA 3LONA 4F4OC 4B2AA 1ELEE 4Q7YA 1GI5A 2HOBA 4JK6A 5GWZA 3PTNA 4VGCC 1FN6A 4ZHMU 2PKAA 1O3KA 2BTCE 1IOEA 2JKHA 1HXFH 5F8XA 2PHBA 1SI5H 1W10U 2FI4E 3SNEA 2QIQA 1LTOA 2Y81A 2HALA 1GVZA 1O2SA 4Q80A 1ZHRA 1ZRKA 4AX9H 3DHKH 3AAVA 1AQ7A 3ZVBA 1YKTA 3E8LA 3A88A 3P8GA 1MTWA 1GJ4H 1TMBH 4I32A 4Y71A 2AH4X 1UCYE 5CHAC 1ANCA 1W12U 4KP0A 3PM3A 2AYWA 4I8GA 4CRGA 1WBGB 2G51A 1SGRE 1NROH 1O2HA 3NUMA 5A8YA 1KIGH 1O2MA 3BTTE 5ETXA 3SU2A 5A09A 4OS5A 1O2UA 1WQVH 4I7YH 1V2RT 3UNQA 3A80A 1LKBA 4X1SU 1QFKH 2A1DB 2GZ7A 1O5GH 1ELTA 6GCHG 3GCOA 3UTUH 1IAUA 4HGCA 4B75A 2ZCKP 3MH7A 3ZZDA 3NXPA 4NWLA 1P2QA 2P59A 3MFJA 1C2GA 1DUEA 1C5TA 4B2BA 2F9UA 2DE8A 1G2MA 4X1PU 1PPFE 1UCYK 2OTVA 2ZHFH 4Z0KA 3RU4T 2J34A 2PFEA 2V3OH 1A7SA 3AW0A 2QF3A 1CSOE 1X7AC 1O2KA 4B1TA 2VIVA 1S83A 1C2MA 1Z71A 2THFB 5C5NA 2FPZA 2BD2A 3QZRA 1OWIA 1N8OC 3GY3A 2G81E 1P2OA 1XUFA 2P95A 1ZYOA 3ESTA 1TONA 4NIWA 3SORA 3ZZ5A 1GI1A 2CMYA 1GMDF 5F8TA 3M7TA 4D7GA 3HK3B 3CP7A 4R0IA 1GJCB 3IITA 1YYY1 2VB0A 1E0FD 3DT0H 1PQ8A 1HIAB 1NC6A 3P6ZB 2HVXA 2OP9A 1T4VH 4XFQA 2Y5FA 4Y8XA 1K22H 1MTVA 1J17T 1S6HA 2C8ZB 2C93B 4E05H 3A7ZA 2OC0A 1GBFA 3FP8E 5FPSA 1C1WH 2B0FA 1JIRA 1GJ9B 2KAIB 3SQHE 1GMHF 5GXPA 1TE0A 1GJDB 1TAWA 2BQ6B 3A89A 4UD9H 2ZU2A 1EZUC 3AVZA 5HMAA 2ANYA 1XUIA 2HRVA 3F1SB 2EI7A 4K8YA 1UJ1A 2SGDE 1Y3WA 1K9OE 2VGCB 3KHVA 3NZIA 1Y3XA 2ZU5A 6ESTA 3V13A 1C5ZB 1O2LA 3PMJA 1KLIH 1GBTA 1IHSH 2OLGA 1H9LB 1ELAA 1ZR0A 2F3CE 2F91A 1EATA 3A7WA 3EDXB 1AWFH 4NWKA 1UCYH 1DX5M 2ZZUH 5E2OA 2PTCE 1OKXA 4ZUHA 2F9VA 1O2VA 3UR6A 1CVWH 3SV9A 1ZPCA 5T6FA 2G52A 3ATMA 1C5SA 2G55A 5L2ZH 5DP8A 4AYYB 1C5XB 1GBJA 3VXFH 5K7RA 1GJ6A 1JXPA 3HK6B 1O0DH 4K8BA 1GHAF 3M5LA 7GCHG 3OY5U 4MDSA 1LDTT 5JBCS 1Y3UA 4TWYA 1G2LA 1AGJA 3NWUA 1O5BB 2EA3A 2PW8H 1QJ1B 4ESTE 2AMQA 1TB6H 2XYAA 1F0UA 2LNCA 2J38A 3P8OA 2H5CA 1C2KA 1BTZA 1C2LA 1UVTH 1BJUA 5DG6A 5ABWA 1CE5A 2FYQA 3RMMH 1QB9A 4FVBA 4WMEA 4I8KA 2WUCA 3MU8A 3K2UA 3P8FA 3RU4D 2WPIS 2O8UA 1SGPE 2HWLB 2Y7ZA 1AWHB 2C8YB 1A5IA 2BQWB 3U69H 4F49A 4Y6DA 2A45B 2QXIA 1G32B 1U6QA 1G3DA 2JH0D 4Y7AA 4BAOB 3RXVA 2BOHB 4FXGH 2D2DA 2RA3A 2BLQA 4NA7A 1CA0C 2K1QA 3U9AH 4D9QA 5EXNA 1TNKA 1ZJDA 1P57B 1NESE 1GL0E 1O3EA 1PYTD 3SV2H 3O8DA 2HNTE 1AIXH 1GHZA 1Z8JB 1UVUH 3KN2A 1NN6A 4YLUA 8ESTE 1YC0A 2FS9A 1TGBA 4Y7BA 1O3LA 2BY9X 1LHGH 3SN8A 3ZVAA 3LGYA 2ZFSA 4D7FA 1ELDE 2WV4A 4MTBA 3QTVH 5JBTA 1F2SE 1O2IA 3SU4A 3QTOH 2XCFA 4YT6H 1DOJA 2EEKA 3RXPA 2ZKSA 2Y6TA 1C9TA 3SV8A 2FOMB 4HZHA 4ZH8A 3W94A 1GJ5H 1MCTA 5LPRA 1SL3A 3F9HA 1VCPA 1GJBB 1MKXK 1ZHPA 4E7NA 1IQEA 2ODPA 1CA0B 3MU5A 5TCAA 2G5VA 1UVSH 3B8JA 4ISLA 1HAPH 2ZNKH 1QBVH 4CH2B 3E1XB 3M5MA 3SU6A 5EQSA 2D26C 4CBOA 1XUGA 1XKAC 1AE5A 4AB9A 4A5TS 2B9LA 3FP6E 1CGIE 4E7RG 2VVUA 1DUAA 3OTJE 1A4WH 2Z94A 1GI6A 2ZI2H 1MD8A 3SU1A 1GI8B 4DOQA 5E8EH 1WTHD 4AGJA 1O36A 4K5ZA 1GMDG 5F03A 5GJ4B 4JYTA 3SI3H 5J4QA 3BTFE 3UFAA 1LCYA 1QL7A 2BM2A 1L1JA 1QB1A 2F83A 4ABBA 4Y0ZE 1ZGVA 3SJ9A 1RIWC 2ZG0H 1O2YA 1SLXB 3SGBE 3UIRA 1A0LA 1C2HA 1ZSJA 4X6NA 3ZZ8A 1ORFA 4CREA 1S6FA 3HGPA 1KLJH 1V2UT 3RXLA 3A7XA 2ZCLP 1ELVA 1UTKA 1QIXB 3SHAH 2OD3B 4DIHH 5FX5A 4ZKNU 4HFPB 3RMLH 1K1JA 3STIA 1GMHG 2A4RA 1HAOH 1O3FA 3TVJB 1BMMH 5FX6A 3LJJA 3ZZCA 1FONA 2UUJB 3QGJA 1Z6EA 5GPIB 2FX6A 1LHDH 1P09A 1PYTC 2BD5A 1EB2A 1QTFA 2FP7B 2QC2A 1O2XA 1IQGA 4J1YA 1W11U 2ZP0H 2FYRA 2ALVA 5ESTE 1ARBA 2NU1E 1AFEH 1EJAA 1CT0E 4A92A 1MKXH 1HLTH 1LVMA 1UTPA 2O8TA 4OS2A 1FXYA 4CBNA 3A8BA 4X1NU 3RXUA 1OP0A 2VWMA 1GI2A 3UWJH 4D8NA 1XVMA 1MTNC 1V2JT 5TJXA 1O3PB 4FU7A 4FUDA 4TPYA 1GJ8B 2O9QA 4NGAH 4UFGH 1V2WT 1SHYA 2FTLE 4DVAU 4I33A 3TJOA 1C1SA 1C1TA 3LIWA 1TGNA 3T26A 4FUFA 3T2NA 2H9TH 1QQ4A 3KGPA 4RN6A 1HAHH 1FN8A 1A3BH 1GHVH 4IMZA 1GBAA 4X6OA 2Z3EA 3ZZ6A 2TGDA 4XE4A 1C4U2 1UTMA 4K60A 1YF4A 1XM1A 1BRAA 3TU7H 5DP5A 1AUTC 3SNDA 3H5CB 1CGHA 4DG4A 1SQAA 1VGCC 6GCHF 1SMFE 3MO3A 3GY5A 4AFQA 3SV6A 2ZWLH 2F9NA 3ATLA 2FWWA 3RXHA 2FXRA 2FX4A 1TX6A 1YPMH 5DP4A 2OXSA 3A7VA 1HGTH 1O2NA 1PJPA 1TQ0B 4U2WA 2P16A 2Q6GA 2WPKS 2TPIZ 3RXSA 1RTLA 3SJKA 3Q3XA 2V35A 1C5LH 1G9IE 1W2KH 1TX7A 1EKBB 1JOUB 1FLEE 3SUFA 3U8TH 1QHRB 1A61H 1QRXA 1PPBH 3M36A 4YOIA 4ZKSU 1K28D 1QRZA 2QCYA 5CMXH 4PROA 3U1IB 1TOCB 1EXFA 2XC0A 1XKBC 2FI3E 4TYDA 3PV4A 4INKA 1ANBA 2EI8A 4A7IB 4SGAE 3M7QA 1TRNA 1EX3A 1PPCE 3K6YA 2OQ5A 3W95A 1AN1E 1LVOA 1JRSA 4AGKA 5DP3A 1O2GH 3SW2B 2VJ1A 3QUMP 4K3JA 4U32A 3H7OA 3H7TA 1AZ8A 1C2EA 1BITA 1TRMA 3I78A 1ESTA 3RXAA 3IWMA 1VR1H 2FZZA 1TGCA 2FLRH 1NRPH 3ZZ4A 1AVGH 3SV7A 1SC8U 1D6WA 3BTKE 1O5CB 1O5AB 5FAHA 4DY7B 5AF9H 1SLUB 2Q6DA 3L3TA 1QURH 1P12E 1RRKA 2EC9H 1MMJN 1MTUA 1TBZH 1E38B 1GCTC 7LPRA 2P8OC 2BOKA 1Z8IB 2A7HA 1C5NH 1XXDA 1A5GH 1Z8RA 3ATWA 9LPRA 1SB1H 2OQUA 1XMNB 3A8AA 1MTSA 3DA9B 2XBYA 1FUJA 2AGIX 1TPAE 4BAKB 2M5TA 3DD2H 2GCHF 5C1UA 1B0EA 3RC4A 3LJOA 1C5WB 2BLOA 3MHWU 1S5SA 1SGFA 4Y8YA 2ZHDA 1GHBF 2BY5X 1TBRH 1UMAH 5HM2A 3A87A 1KXEA 5GCHG 3A8CA 1C1NA 1DSUA 4YLQH 5FCKA 1BTXA 2OCVB 1LHEH 2SGPE 3JZ1B 1K1MA 4NZQA 3BEFB 4DT7B 5JBAS 2W3KA 4NFEA 1KXDA 4IMQA 2ZDKA 1QA7A 4QT8C 1Y5UT 2P8OB 2FOBA 3HGNA 4Q7ZA 1P9SA 3SJOA 2ZF0H 2BX4A 3L33A 3MO6A 7ESTE 1TX8A 1OOKB 3LPRA 1O31A 4ABDA 1W7GH 4O3TA 2BDHA 4GPGA 3C27B 7GCHF 1AVWA 2VIQA 4MVNA 1TNHA 1ETRH 1GDUA 1HIAA 3V12A 1AY6H 4I8LA 3GCHC 1NO9H 4NIYA 2J4IA 1K2I1 1RJXB 4O3UA 4JZDH 1O3BA 2C8WB 3QDZB 2R2WU 2J94A 1LQDB 2C90B 4ABHA 2ZU1A 3U8RH 1C5PA 5EXMA 1O3NA 3QLPH 5I46H 2KAIA 3UR9A 2FDAA 1BHXF 1ZZZA 2Y80A 5AFYH 4OGYA 3KQEA 4K1EA 1S81A 4NSYA 1BRCE 1F7ZA 4MG3A 1FIWA 1CGJE 3GICB 4GHTA 5L30H 3O8BA 1HRTH 1KXCA 1SVPA 4X2YA 1AVXA 2TGPZ 4ABIA 1DANH 5H4IB 1DLKB 1NFXA 1C2IA 1FMGA 5GIBA 3RXRA 3TNSA 1TBQH 4BAQB 1DICA 2XXLA 1O34A 1ZMNA 1QGFA 5EOKA 4CR5A 3PO1C 5A2MH 5HM9A 2A2XH 2WV5A 1EQ9A 5EW1H 1CA8B 3TK5A 2FOEA 2W7UA 4Y10E 2ZGHA 1GBEA 1CBWC 2CF8H 1IHTH 4BAHB 3BTQE 4VGCB 1C1VH 5JBBS 4A1VA 4YT7H 2ZFTA 3UNSA 4K1SA 1P2KA 3RXBA 3PTBA 4NA9H 2BHGA 3TK9A 4X8UH 2J9NA 2GZ9A 2QAAA 4MPVA 2XWAA 1GBMA 2CGAA 1TMTH 1CQQA 1TGTA 2VU8E 3BTDE 3VGCC 2R0LA 1BTHH 2G8TA 4CHAC 1NFYA 1SGYE 3QZQA 5CHAB 3S9AA 3A82A 3E0PB 1YM0A 4OS1A 1B0FA 1GBCA 1SQOA 1VITH 4ZAEA 3ZVFA 1C1OA 2H9EH 2ZC9H 2GV7A 1C2JA 3GY6A 1JWTA 1DWEH 1HAXB 1LPGB 2DE9A 3M37A 4UFEH 4WMFA 5A0AE 2AS9A 3SUEA 4GCHF 1L1NA 4IN2A 5FCRA 3RXQA 4JZIA 1YGCH 1MAXA 3BTME 4Z6AH 1O39A 1TPSA 2YNAA 5FBIA 1Z1IA 1ETSH 4ISHH 4AFSA 1UTOA 4B2CA 1MZDA 2Z9JA 2GT7A 1C1RA 1ZSKA 1LMWB 2ZGJA 3BEUA 1SGNE 3KQDA 4LOYH 5AVDA 2UWLA 3ZVCA 1TABE 4CRBA 4K69A 1BTYA 2BY8X 3ZZ7A 1V2ST 2R3UA 1PQ7A 5DK1A 1N8OB 4GAWA 3SGAE 2FOCA 1Z8GA 4H4FA 3DUXH 1BTUA 1DPOA 2BZAA 5A8ZA 1IQFA 1RTKA 2FESH 4FUHA 3TH4H 1FPCH 5EPNA 2FOAA 1BTWA 1DY9A 1W14U 2GCHG 4IC5A 2ANWA 3UPEA 2CXVA 4AFZA 2QN5T 3URCA 9ESTA 2ZHEH 1NPMA 3Q3YA 1O3IA 2D8WA 1GHBG 3RXCA 4BOHA 1EZQA 1HCGA 2GT8A 2JETC 3SQEE 1YPHE 1LVYA 1P3EA 4MPXA 1V2KT 4NIXA 5EXLA 1S0QA 3QX5H 3KQCA 1BRBE 1GHWH 1WU1A 4NFFA 1HFDA 2BY7X 2I6SA 3ZV9A 2R9PA 1MKWK 1EPTC 1VJAU 2XBXA 1N6XA 1GGDC 5FHTA 1A0HB 2QXGA 1T32A 2SFAA 1FV9A 3M3VA 1FY5A 2BY6X 4U01A 1BCUH 4KTSA 3BIVH 1OWJA 1O2TA 3OY6U 3BF6H 3MOCA 1KYNA 2BDAA 4GVUA 2ZDMA 1HAVA 1OSSA 4AORA 1A0JA 4NA8A 1K21H 3VEQB 2OBOA 4MNYA 4Q2KA 1DXWA 1NRSH 3GDSA 3SUGA 1PQ5A 4ABGA 1T31A 2PTNA 4BXWA 2ZGCA 1DVAH 2SGQE 1OWDA 3AW1A 4LXBH 2XNIA 1EPTB 1TPPA 4KKDA 1OWHA 1P2NA 1F92A 1GGDB 2V0BA 4ABFA 1SQTA 3I77A 2WYJA 3RDZA 1FJSA 2ZA5A 1ZHMA 6LPRA 1LVBA 1P01A 1UHBB 3VB3A 3P92A 4NG9H 1GVLA 2G4TA 2ZEBA 2PKSC 3RXMA 1O2OA 1Y5AT 1SGIB 2O8WA 2XC5A 1QJ6B 3RMNH 5A8XA 5L6NH 3ZV8A 5E0JA 3TLOA 1IQHA 1HDTH 3K6ZA 1YPKH 2OC7A 1WAYB 2Z6BD 4UFFH 1NRRH 2Z7FE 3TITA 1V2QT 1V2OT 4O97A 2R2MB 1TNIA 4X2XA 1O2QA 1SGEE 2PSXA 3RM2H 5F6MA 1O3JA 1W0ZU 5I25A 4FU8A 3TNTA 1GBHA 1QJ7B 2A5AA 1S82A 1ELBA 2Z3DA 1EJNA 2H2ZA 1J8AA 1HPGA 2AGGX 4DCDA 3RXEA 1PPEE 2VH0A 2O8MA 1H8DH 5JB8S 3LOXA 4Y0YE 4ZMAH 1VCQA 1YPJH 4ABAA 3GYLB 3KNXA 1MKWH 2WPLS 3BG8A 4RKOB 1TNLA 3TJVA 1NT1A 1WUNH 1O5DH 2AIPA 1GG6C 5BRRE 1C5YB 2BVXH 1SSXA 3Q00A 4BAMB 1HV7A 3ATKA 4CRDA 1LHFH 3UQVA 3LH1A 3A85A 1UTJA 4KTUA 1F5KU 1DDJA 3RC5A 3MH4A 1SPJA 3FZZA 1BQYA 4AOQA 1HJ9A 2BLVA 2QXJA 1UO6A 4FUCA 3LGIA 1FY3A 3BEIB 5GCHF 1A3EH 4GCHG 1TA6A 2A4OA 1SGDE 3F9GA 3HATH 3SNCA 1AKSB 1ELCA 1XXFA 2IJOB 1T8LA 2ZQ1A 1QRWA 2A0QB 1JMOH 1CU1A 3V3MA 2CHAC 1KY9A 3TJUA 3AAUA 3K65B 1G3EA 1HAVB 3FAOA 1IQLA 4ZHAA 5DGJA 1QA0A 3UOPA 1Y3YA 2GDDA 1EAWA 1V2PT 1XUJA 1O2ZA 3SJ8A 1TOMH 1UK3A 4B76A 1V2MT 1RTFB 2GVFA 2TGAA 1OP2A 2NU0E 3MMGA 1E34B 2ZU4A 2PGQB 5JB9S 2J95A 5BPEA 1O2PA 1O3OA 1DM4B 3Q76A 2OBQA 2OINA 3FVFB 1YPGH 1KXFA 3I29A 5E0GA 1O2RA 1C2DA 1MQ6A 3KEEA 1O38A 1UTLM 1GJAB 1P9UA 1IQJA 4WMDA 4E06H 2HNTF 5AHGH 1C1PA 2PSYA 1ZMLA 5LPFA 4KGAA 2GX4A 1C5OH 2W26A 3T5FH 3TIUA 1RIWB 3BTEE 3OYPA 4THNH 1KDQB 3CS7A 3EGKH 3F9FA 2BMGB 2B8OH 1BIOA 2G00A 2H1UA 2GV6A 5SGAE 1Z1JA 3RUOA 4X8VH 4BTUB 3UQOA 3VB5A 1IQNA 3E0NB 1Q2WA 3ZYEA 1C4V2 2BLWA 2GDEH 4DJZB 4ZKOU 3T62A 1SFQB 3EAJA 2FIRH 4WVPE 2A4GA 3QK1A 1GDNA 1G3CA 2BDIA 4NSVA 5A0CA 2GKVE 5C5OA 2V6NA 2QGRA 3LGVA 1RGQA 3ZVGA 2XRCA 1NRQH 1F0TA 2IOTA 3EA7A 2JH6D 4UFDH 2XWBI 3LGWA 4FUEA 1THPB 4XOJA 3RXOA 2ZGBH 3RLYH 2R3YA 2ZO3H 3E91A 1MTNB 1WTGH 4KTCA 2QA9E 4H42U 4LZ1H 1AB9C 2VWOA 1D3TB 1SR5C 1HAIH 4X8SH 3MNSA 4JYVH 2NU3E 1L1GA 1INCA 1J14A 1UVPA 2GMTC 2ZDAH 3RXJA 1S0RA 4U30A 1NTPA 4JZEH 2QY0B 5LH8A 2HLCA 1NZQH 1T4UH 2NU4E 2SNWA 3M3SA 1O30A
chains in the Genus database with same CATH superfamily
1DITH 1VGCB 2ESTE 1CO7E 1GHYH 4IGDA 5EG4A 1ABIH 1H9IE 2YNBA 1C9PA 1MAYA 3BV9B 5E0HA 3NPSA 3HKIB 3B9FH 2DUCA 3PLPA 8GCHF 1AUJA 2BZ6H 3N99A 3F2HA 1DSTA 2Y82A 4MPUA 1NM6A 5HIZA 1EAXA 1LKAA 3P95A 1O33A 1THRH 2ZHQH 3SGQE 2VH6A 1AE8H 1LQEA 3KIDU 3M5NA 1C1QA 2H9HA 2A5KA 1KXAA 1AFQC 3RXTA 1A1RA 2W7SA 4B71A 3OAAD 5DO4H 2PV9B 1UTQA 2BVSH 1E37B 1EASA 3PWBA 2A32A 1HYLA 1D9IA 1EAIA 1QY6A 2YOLA 3A8DA 1A46H 6CHAC 2NU2E 1W0YH 3TH3H 1P11E 1BBRE 4UEHH 4IC6A 1C2FA 2B7DH 1TLDA 2BB4A 2P3TB 3OSYA 3FZDA 1L2EA 3MH5A 1BRUP 4MNXA 3LT3A 5CDFE 2Q1JA 2ANKH 1V6DA 2JJ1D 1ELGA 1NBME 2Z9GA 1FI8A 1GJ7B 3BG4C 3SBKA 4CR9A 5AFZH 3QN7A 5JPMH 1FIZA 1ZPBA 2GTBA 1K1PA 2J97A 4XBDA 2VIWA 2LP6A 1V2VT 3E6PH 4DW2U 1O37A 1CT2E 2PUXB 1YPEH 1EP6A 1DFPA 5T6DA 3SO3A 5DP9A 1F5LA 1S84A 2RA0A 1K1NA 1BBRK 1AU8A 1TPOA 5EGMA 4BTIB 1GCTB 1GI4A 5F8ZA 3FN8A 2QXHA 1XVOA 2GCTC 2J2UA 4WH8A 3LGUA 4Y76A 3ZZAA 4FUJA 3JZ2B 1JIMA 2NWNA 1G30B 2P3UB 3OX7U 1C5QA 3GISB 3W1EA 1BUIA 1DT2A 3VFEA 1NU9A 1GMCF 2BD4A 3LGTA 4X6PA 1TIOA 4MPWA 1D4PB 3F6UH 1HUTH 4LK4A 2FLBH 1AD8H 2M2AA 3G01A 2A31A 1CHOF 4KELA 2P93A 2TGTA 1BDAA 4ISNA 1YPLH 2PGBB 2XW9A 1ZGIA 5DSFA 1GWAA 2IN2A 3ODDA 3RM0H 2BD3A 1TA2A 3LH3A 3AK5A 1FZZA 2AERH 1TALA 1TMUH 1DWBH 3UY9A 4X2VA 5CE1A 4FUGA 2P3FH 4IW4E 5GDSH 2WINI 1OYTH 2VIDA 3GCHB 1K1IA 3GCNA 1EAUA 8KME2 1ZTKA 2G4UA 2PWXA 7KMEH 4FVDA 2UWOA 1ESAA 4A6LA 1MBMA 1DE7H 1ZPZA 3LU9B 3PLKA 1YLCA 3SU3A 2F9BH 3GY2A 1WOFA 1LO6A 3MNXA 1GBLA 1G37A 4XBCA 2OUAA 1E36B 1MZAA 1GI7B 2EQNA 4Y11E 3SI4H 3MU4A 1Y59T 1BB0B 1PFXC 3GDVA 2ZPRA 4OGXA 4Y8ZA 1OWEA 1BBRH 1QL9A 4SGBE 5IYTA 1RS0A 1SHHB 1ZOMA 1G36A 1GVKB 5DPAA 1PQAA 2GZ8A 1YCPM 3MYWA 1TQ7B 4ASHA 3S9BA 1WCZA 1D3PB 4WH6A 1VITF 2VVVA 4UE7H 2JDID 3A7YA 2WPMS 2ZDNA 3PMHB 3KL6A 2I6QA 3SU0A 5EPYA 1THSH 2BVRH 4DURA 2XCNA 1P03A 3PO1B 3SOSA 1GI0A 1HAZB 1TNJA 5JDUB 1EP5A 5JYIA 1Q31A 3M7UA 1B7XB 4TPIZ 2A2QH 1EPTA 4YESB 1CBWB 3KQBA 2VIPA 1O5EH 4RKJB 1ZLRA 3E90B 1YCPK 4DT4A 1UHBA 2BD7A 4P02A 2IPHA 5C67A 2G5NA 3V0XA 4X1QU 8GCHG 4NIVA 2Z9IA 2BXTH 4YOJA 1YP9A 1O2JA 1PPZA 4HG6A 3O8RA 2WUBA 1T7CA 3GY7A 4I31A 1OP8A 4Q7XA 2FMJA 3TJNA 3VGCB 3LDXH 2ULLA 4AZ2B 4CHAB 5T3HA 1FX0B 3C1KA 5EQRA 5G4BA 1BT7A 3RU4E 1BJVA 1GPZA 2JH5D 2PUQH 3D62A 4TT3D 5K0HA 2KCYA 2BDCA 5LGOA 2VGCC 1PPHE 3CENA 4X0WU 1NRNH 3GYMA 2GD4B 3RXGA 4R8TB 2QV1A 2HPPH 1C5RA 3S7KB 2ZDLA 5EQQA 1FQ3A 1OWKA 4BANB 1CHGA 2UUYA 5LPEA 1DY8A 4B6FA 1P2MA 1IQIA 4AB8A 1TWXB 2F9OA 2ZPSA 2CJIA 3ZIAD 1ID5H 5C1YA 1WDIA 1DS2E 1SGFG 4JCNA 5EW2H 3SUDA 3SYJA 1P2IA 4I8HA 3D49H 1P04A 2C8XB 4A1XA 3VB6A 2ODYB 1HBTH 1AO5A 4FUIA 2V3HH 1GBBA 4D76A 4UONA 2PKAB 1Y8TA 1GI3A 1XUKA 2H6MA 4IN1A 1H4WA 1BHXB 2XBVA 1UTNA 1QR3E 1O3GA 3A7TA 1MQ5A 1EOJA 3ZZBA 3S0NA 5C20A 4MQAA 3M3TA 3SU5A 1LPKB 1L0ZA 2O8LA 3L6PA 5TCCA 4B73A 1P3CA 1SGTA 2XBWA 2BX3A 1EZXC 4ZROA 1P06A 5E2PA 3E16B 3PYHA 5KGOA 2XC4A 3MU0A 1J16A 2Y7XA 1SFIA 1BMFD 4HTCH 2Y5HA 3OE7D 1ZTJA 4ABJA 1AKSA 3RC6A 2QF4A 2ZHWH 1AZZA 1YCPH 1DWDH 2AFQB 3PMAB 3MTYA 3PRDA 1HJAC 3SZNA 4TY6A 2W6ID 1GMCG 2WPJS 3K9XB 4JMYA 3UWIA 1F0RA 1C5VA 5IDKA 1ARCA 1E35B 1QB6A 2JETB 3A83A 1KXBA 1OPHB 1SG8B 1MU8B 1YY3A 3MNBA 3RXDA 1CHOG 2F9PA 1ETTH 3EYDA 1O35A 4XRNA 4IBLH 3TK6A 3VG8A 3EE0B 2BQ7B 4B74A 2PR3A 2OC1A 5EODA 3URDA 3DFLA 4AG2A 1P0SH 1V2NT 2HLDD 1BOQA 1BTPA 4XBBA 2FI5E 3TPIZ 1ZSLA 3OTPA 3F68H 2BD8A 3DFJA 4YZUA 1HJAB 1GBIA 2FS8A 1EJMA 2GP9B 3FOAA 3RXKA 2AEIH 1AI8H 3ITIA 4WWYA 1V2LT 1KDQA 3LC3A 1K1LA 2ZPQA 3U8OH 1NY22 1T8MA 4O03A 4INHA 3RXFA 2AGEX 4GHQA 1S85A 4OS7A 1LHCH 1QBNA 2BDGA 2WYGA 2SGAA 2HGTH 3F0OA 1EB1H 1L4ZA 2RG3A 1ESBA 1C1UH 3M61U 4CH8B 1TGSZ 2W3IA 1RFNA 2A7CA 3ENSB 1ZTLA 4J2YB 2ASUB 3T27A 2ZTZA 3DSPA 1GBDA 1Q3XA 3P17H 1C1MA 5A0BA 4CRAA 2XTTB 2GGVB 2VWLA 2FTMA 1GL1A 2STAE 2ZIQH 3UNRA 2STBE 3PB1E 4ZHLU 2PKSB 1YBWA 1ANEA 4WXIA 1FAKH 1P02A 1SLWB 3QGNB 1H1BA 2UUKB 1VITG 1YLDA 3Q3KA 3KF2A 1FNIA 1AHTH 3LC5A 2VIOA 1MBQA 2C4FH 3B23B 2RDLA 1ZMJA 3PMBB 3ATIA 1GDQA 1XUHA 2IJD1 1BMAA 1QL8A 2ZFRH 2W5EA 4GUXA 1PPGE 5FBEA 1QBOA 4ZKRU 1SGQE 2LPRA 4M7GA 3NK8A 4A1TA 5C2ZA 3HKJB 2D1JA 1O5FH 2Z9KA 2FOFA 4CRFA 1P8VC 3PLBA 4OS6A 3ELAH 1T8OA 1BMLA 5HXFA 4LZ4B 3N7EA 3EA9A 4TWWA 1ANDA 2WZQA 1GG6B 2AIQA 3QWCH 3SNBA 3ZVEA 5ESBA 2ZTYA 3WWFA 1M9UA 2VVCA 3RXIA 1MU6B 3FKSD 4ISOA 3M35A 2FODA 4F55A 2CN0H 1FY8E 1OXGA 3SJIA 1EOLA 1VCWA 2PLXA 5FXLA 2FEQH 2TIOA 4GLYA 3QO6A 2ILNA 5T6GA 1D6RA 3VXEH 1W7XH 1ACBE 1V2TT 2A4QA 1KSNA 4K1TA 3U28C 3VB7A 2BYAX 1G3BA 3S7HB 2ZCHP 3P8NA 4DGJA 1SKYE 1GBKA 4AG1A 2ZECA 2B5TB 4YTAA 1RD3B 3VPKA 4Y79A 3MNCA 3NKKA 1MD7A 2ODQA 3STJA 2JIZD 1RXPA 2Z9LA 1IQKA 1O3HA 2CHAB 4MLFB 4AN7A 3GCTF 2P94A 4K2YA 1DXPA 1EUFA 2UUFB 4WJG2 3S9CA 2RFKC 1L4DA 1O32A 2YMSD 1Z7KA 3PV5A 4TY7A 4UDWH 3U1JB 4H6SB 1H9HE 1ZJKA 2V7QD 3BN9A 3M5OA 1GCDA 1UK4A 5B6OA 2A7JA 2VINA 3ZYDA 3HPTB 3RLWH 8LPRA 3PWCA 5KECA 3A86A 2LELA 1YPHC 2KM0A 2ZFPH 1FPHH 5EU8A 5C1XA 3R0FA 3VB4A 1VJ9U 2OC8A 1CT4E 3WY8A 4X8TH 2Y5GA 1T8NA 3PROA 2QF0A 1JRTA 3UB0A 2VWNA 2JJ2D 1P05A 3BTHE 3TGJE 1BZXE 2TBSA 3RMOH 2FO9A 2FOGA 5EIYA 3IG6B 1C5MD 3FFGA 2SNVA 1HJ8A 3ZVDA 4JZFH 3A84A 2WPHS 1WSSH 1MH0A 3D23A 3TGIE 2QE7D 3WW7A 1FAXA 2KFWA 1GHAG 4I8JA 4AFUA 5DP7A 4I86A 1D3DB 1OHHD 4BXSA 1MUEB 4RSPA 3V7TA 2ALPA 4X2WA 2QYIA 2BD9A 2EY4C 3LKWA 1W3CA 3RP2A 1C5UA 3TH2H 4XDEA 4GSOA 2ZTXA 3EQ0H 1NS3A 4JZ1A 5FPYA 1KLTA 4WXVA 1UVOA 3T28A 3S69A 4ACBA 1DLEA 1UK2A 2BDBA 1NU7B 1KTSB 1P10A 1W13U 4BNRA 1TYNA 2KCPA 1WV7H 5DN6D 3MO9A 1LPZB 1N6YA 2ZDVH 4FU9A 1FY4A 2FOHA 3UOUA 2ZU3A 1NFWA 1B5GH 5L2YH 2VNTA 1GI9B 3GY8A 4JYUH 1D3QB 1J9CH 1QQUA 3F9EA 3MU1A 1HAGE 4YOGA 1N1LA 1AB9B 1HB0B 3O8CA 1SBWA 1F5RA 1Z6JH 2GMTB 3BIUH 5FPTA 3FANA 2HNTC 4ZXXH 3ODFA 1QCPA 2RCEA 4WF8A 1O3AA 3BTWE 3N7OA 2AMDA 2FM2A 3D65E 5C3NA 4WY3A 1HXEH 1OS8A 3GOVB 1FY1A 2Z3CA 5HGGA 3TGKE 1C4Y2 4JK5A 2J92A 4AYVB 4NZLA 3ZZ3A 1OYQA 1NFUA 3MH6A 1BA8B 4X1RU 2CF9H 3P70B 3R3GB 2ZFQH 5DKMA 3A81A 1O3DA 3E3TA 3Q77A 4ABEA 1E1QD 2Q6FA 1ELFA 1TNGA 3FP7E 5J4SA 2SGFE 5PTPA 3GDUA 4DIIH 4XSKU 1IQMA 1OX1A 4FUBA 3T25A 2K0QA 1P2JA 1ABJH 4OS4A 1HAYB 1SOZA 1O2WA 4YM9A 5DP6A 4ISIH 3ZZ9A 1A2CH 1AFQB 2ZGXH 4X6MA 1TRYA 4INLA 4O9VA 2AMPA 4FOUC 2ZFFH 6CHAB 4H6TA 4MNWA 1BMNH 1F0SA 4HI3A 4YO9A 2R0KA 1VZQH 3U98H 1O3CA 4ZXYH 2HPQH 3UREA 4OM9A 2EI6A 1Y3VA 1KTTB 2CV3A 5DJ7A 1A5HA 3EA8A 4NCYA 2ZQ2A 1SOTA 1MCVA 3BG4B 1H8IH 4D9RA 4CRCA 1V3XA 3CS0A 2OK5A 1K1OA 2H5DA 2SGEE 1JBUH 3F0PA 1O3MA 1QNJA 1Y5BT 3T29A 3MI4A 2ANMH 2BXUH 1FDPA 4M9FA 1SGCA 1WYKA 3MWIU 5HYOA 2BDYA 3KCGH 1SLVB 4BTTB 3NCLA 1XX9A 1ZRBA 3SNAA 4MNVA 1AMHA 3UUZA 4B6EA 3MQKC 1HNEE 4IS5A 3BSQA 1J15A 3AASA 2GCTB 3BTGE 3GY4A 3GCTG 2C3SA 2TRMA 2A5IA 1W0JD 3OU0A 1W8BH 1WQSA 3SHCH 1DWCH 1EZSC 1GHXH 2UWPA 1TFXA 3LONA 4F4OC 4B2AA 1ELEE 4Q7YA 1GI5A 2HOBA 4JK6A 5GWZA 3PTNA 4VGCC 1FN6A 4ZHMU 2PKAA 1O3KA 2IPQX 2BTCE 1IOEA 2JKHA 1HXFH 5F8XA 2PHBA 1SI5H 1W10U 2FI4E 3SNEA 2QIQA 1LTOA 2Y81A 2HALA 1GVZA 1O2SA 4Q80A 1ZHRA 1ZRKA 4AX9H 3DHKH 3AAVA 2KR7A 1AQ7A 3ZVBA 1YKTA 3E8LA 3A88A 3P8GA 1MTWA 1GJ4H 1TMBH 4I32A 4Y71A 1NBMD 2AH4X 1UCYE 5CHAC 1ANCA 1W12U 4KP0A 3PM3A 2AYWA 4I8GA 4CRGA 1WBGB 2G51A 1SGRE 1NROH 1O2HA 3NUMA 5A8YA 1KIGH 1O2MA 3BTTE 5ETXA 3SU2A 5A09A 4OS5A 1O2UA 1WQVH 4I7YH 1V2RT 3UNQA 3A80A 1LKBA 4X1SU 1QFKH 2A1DB 5T1VA 2GZ7A 1O5GH 1ELTA 6GCHG 1KMHB 3KYFA 3GCOA 3UTUH 3DCLA 1IAUA 4HGCA 4B75A 2ZCKP 3MH7A 3ZZDA 3NXPA 4NWLA 1P2QA 2P59A 3MFJA 1C2GA 1DUEA 1C5TA 4B2BA 2F9UA 2DE8A 1G2MA 4X1PU 1PPFE 3UAIC 1UCYK 2OTVA 2ZHFH 4Z0KA 3RU4T 2J34A 2PFEA 2V3OH 1A7SA 3AW0A 2QF3A 1CSOE 4FETA 1X7AC 1O2KA 4B1TA 2VIVA 1S83A 5C0UA 1C2MA 1Z71A 2THFB 5C5NA 2FPZA 2BD2A 3QZRA 1OWIA 1N8OC 3GY3A 2G81E 1P2OA 1XUFA 2P95A 1ZYOA 3ESTA 1TONA 4NIWA 3SORA 3ZZ5A 1GI1A 2CMYA 1GMDF 5F8TA 3M7TA 4D7GA 3HK3B 3CP7A 4R0IA 3CNRA 1GJCB 3IITA 1YYY1 2VB0A 1E0FD 3DT0H 1PQ8A 1HIAB 1NC6A 3P6ZB 2HVXA 2OP9A 1T4VH 4XFQA 2Y5FA 4Y8XA 1K22H 1MTVA 1J17T 1S6HA 2C8ZB 2C93B 4E05H 3A7ZA 2OC0A 1GBFA 3FP8E 5FPSA 1C1WH 2B0FA 1JIRA 3KQ5A 1GJ9B 2KAIB 3SQHE 1GMHF 5GXPA 1TE0A 1GJDB 1TAWA 2BQ6B 3A89A 4UD9H 2ZU2A 1COWD 1EZUC 3AVZA 5HMAA 2ANYA 1XUIA 2HRVA 3F1SB 2EI7A 4K8YA 1UJ1A 2SGDE 1Y3WA 1K9OE 2VGCB 3KHVA 3NZIA 1Y3XA 2ZU5A 6ESTA 3V13A 1C5ZB 1O2LA 3PMJA 1KLIH 1GBTA 1IHSH 2OLGA 1H9LB 1ELAA 1ZR0A 2F3CE 2F91A 1EATA 3A7WA 3EDXB 2J5UA 1AWFH 4NWKA 1UCYH 1DX5M 2ZZUH 5E2OA 4Q63A 2PTCE 1OKXA 4ZUHA 2F9VA 1O2VA 3UR6A 1CVWH 3SV9A 1ZPCA 5T6FA 2G52A 3ATMA 1C5SA 2G55A 5L2ZH 5DP8A 4AYYB 1C5XB 1GBJA 3VXFH 5K7RA 1GJ6A 3F2FA 1JXPA 3HK6B 1O0DH 4K8BA 1GHAF 3M5LA 7GCHG 3OY5U 1S6LA 4MDSA 1LDTT 5JBCS 2WPDD 1Y3UA 4TWYA 1G2LA 1AGJA 3NWUA 1O5BB 2EA3A 2PW8H 1QJ1B 4ACAA 4ESTE 2AMQA 1TB6H 2XYAA 1F0UA 2LNCA 2J38A 3P8OA 2H5CA 1C2KA 1BTZA 1C2LA 1UVTH 1BJUA 5DG6A 5ABWA 2CK3D 2GJGA 1CE5A 5CHBA 2FYQA 3RMMH 1QB9A 4FVBA 4WMEA 4I8KA 2WUCA 3MU8A 3K2UA 3P8FA 3RU4D 2WPIS 2O8UA 1SGPE 2HWLB 2Y7ZA 1AWHB 2C8YB 1A5IA 2BQWB 3U69H 4F49A 5EJ1A 4Y6DA 2A45B 2QXIA 1G32B 1U6QA 1G3DA 2JH0D 4Y7AA 1E1RD 4BAOB 3RXVA 2BOHB 4FXGH 2D2DA 2RA3A 2BLQA 4NA7A 1CA0C 2K1QA 3U9AH 4D9QA 5EXNA 1TNKA 1ZJDA 2J98A 1P57B 1NESE 1GL0E 1O3EA 1PYTD 3SV2H 3O8DA 2HNTE 1AIXH 1GHZA 1Z8JB 5C17A 1UVUH 3KN2A 1NN6A 4YLUA 8ESTE 1YC0A 2FS9A 1TGBA 4Y7BA 1O3LA 2BY9X 1LHGH 3SN8A 3ZVAA 3LGYA 2ZFSA 4D7FA 1ELDE 2WV4A 4MTBA 3QTVH 5JBTA 1F2SE 1O2IA 2KZ4A 3SU4A 3QTOH 2XCFA 4YT6H 1DOJA 2EEKA 3RXPA 2ZKSA 2Y6TA 1C9TA 3SV8A 2FOMB 4HZHA 4ZH8A 3W94A 1GJ5H 1MCTA 5LPRA 1SL3A 3F9HA 1VCPA 1GJBB 1MKXK 1ZHPA 4E7NA 1IQEA 2ODPA 1CA0B 3MU5A 5TCAA 2G5VA 1UVSH 3B8JA 4ISLA 1HAPH 2ZNKH 1QBVH 4CH2B 3E1XB 3M5MA 3DSOA 5EQSA 3SU6A 2D26C 4CBOA 1XUGA 1XKAC 1AE5A 4AB9A 4A5TS 2KCOA 2B9LA 3FP6E 1CGIE 4E7RG 2VVUA 1DUAA 3OTJE 1A4WH 2Z94A 1GI6A 2ZI2H 1MD8A 3SU1A 1GI8B 4DOQA 5E8EH 1WTHD 4AGJA 1O36A 4K5ZA 1GMDG 5F03A 5GJ4B 4JYTA 3SI3H 4Q4LA 5J4QA 3BTFE 3UFAA 1LCYA 1QL7A 2BM2A 1L1JA 1QB1A 2F83A 4ABBA 4Y0ZE 1ZGVA 3SJ9A 1RIWC 2ZG0H 1O2YA 1SLXB 3SGBE 3UIRA 1A0LA 1C2HA 1ZSJA 4TSFD 4X6NA 3ZZ8A 1ORFA 4CREA 1S6FA 3HGPA 1KLJH 1V2UT 3RXLA 3A7XA 1W0KD 2ZCLP 1ELVA 1UTKA 1QIXB 3SHAH 2OD3B 4DIHH 5FX5A 4ZKNU 4HFPB 3RMLH 1K1JA 3STIA 1GMHG 2A4RA 1HAOH 1O3FA 3TVJB 1BMMH 5FX6A 3LJJA 3ZZCA 1FONA 2UUJB 3QGJA 1Z6EA 5GPIB 5F53A 2FX6A 1LHDH 1P09A 1PYTC 2BD5A 1EB2A 1QTFA 2FP7B 2QC2A 1O2XA 1IQGA 4J1YA 1W11U 2ZP0H 2RDEA 1SQRA 2ALVA 2FYRA 3F3BA 5ESTE 5HKKD 1ARBA 2NU1E 1AFEH 1EJAA 1CT0E 4A92A 1MKXH 1HLTH 1LVMA 5C94A 1UTPA 2J98B 2O8TA 4OS2A 1FXYA 4CBNA 3A8BA 2KCAA 4X1NU 3RXUA 1OP0A 2VWMA 1GI2A 3UWJH 4D8NA 2F4LA 1XVMA 1MTNC 1V2JT 5TJXA 1O3PB 3KYGA 4FU7A 4FUDA 4TPYA 1GJ8B 2O9QA 4NGAH 4UFGH 1V2WT 1SHYA 2FTLE 2L6OA 4DVAU 4I33A 3TJOA 1C1SA 1C1TA 3LIWA 1TGNA 3T26A 4FUFA 3T2NA 2H9TH 1QQ4A 3KGPA 4RN6A 1HAHH 1FN8A 1A3BH 1GHVH 1WXRA 4IMZA 1GBAA 4X6OA 2Z3EA 5C0TA 3ZZ6A 2TGDA 4XE4A 1C4U2 1UTMA 4K60A 1YF4A 1XM1A 1BRAA 3TU7H 5DP5A 1AUTC 3SNDA 3H5CB 1CGHA 4DG4A 1SQAA 1VGCC 6GCHF 1VKYA 3SZEA 1SMFE 3MO3A 3GY5A 4AFQA 3SV6A 2ZWLH 2F9NA 3ATLA 5KEDA 2FWWA 3RXHA 2FXRA 2FX4A 1TX6A 1YPMH 2WV9A 2OXSA 3A7VA 5DP4A 1HGTH 1K0HA 1O2NA 1PJPA 4RT1A 1TQ0B 4U2WA 2P16A 2Q6GA 2WPKS 2TPIZ 3RXSA 2VBCA 1RTLA 3SJKA 3Q3XA 2V35A 1C5LH 1G9IE 1W2KH 2W6JD 1TX7A 1EKBB 3F2GA 1JOUB 4P00A 1FLEE 3SUFA 3U8TH 4F48B 1QHRB 1A61H 1QRXA 1PPBH 3M36A 4YOIA 4ZKSU 1K28D 1QRZA 2QCYA 5CMXH 4PROA 3U1IB 4ZCNA 1TOCB 1EXFA 2XC0A 1XKBC 2FI3E 4TYDA 3PV4A 4INKA 1ANBA 2EI8A 4A7IB 4SGAE 3M7QA 1TRNA 1EX3A 1PPCE 3K6YA 2OQ5A 2YMSC 3W95A 1AN1E 1LVOA 1JRSA 4AGKA 5DP3A 1O2GH 3SW2B 2VJ1A 3QUMP 4K3JA 4U32A 3H7OA 3H7TA 1AZ8A 1C2EA 1BITA 1TRMA 3I78A 1ESTA 3RXAA 3IWMA 1VR1H 2FZZA 1TGCA 2FLRH 1NRPH 3ZZ4A 1AVGH 3SV7A 1SC8U 1D6WA 3BTKE 1O5CB 1O5AB 5FAHA 4DY7B 5AF9H 1SLUB 2Q6DA 3L3TA 1QURH 1P12E 1RRKA 2EC9H 1MMJN 1MTUA 4RI0A 1TBZH 1E38B 1GCTC 7LPRA 2P8OC 2BOKA 1Z8IB 2A7HA 1C5NH 1XXDA 1A5GH 1Z8RA 3ATWA 9LPRA 1SB1H 2OQUA 1XMNB 3A8AA 5EJLA 1MTSA 3DA9B 2XBYA 1FUJA 2AGIX 2YMSB 1TPAE 4BAKB 2M5TA 4XD7D 2GCHF 5C1UA 3DD2H 1B0EA 3RC4A 3LJOA 1C5WB 2BLOA 3MHWU 1S5SA 1SGFA 4Y8YA 2ZHDA 1GHBF 2BY5X 1TBRH 1UMAH 5HM2A 3A87A 1KXEA 5GCHG 3A8CA 1C1NA 1DSUA 4YLQH 5FCKA 1BTXA 2OCVB 1LHEH 2SGPE 3JZ1B 1K1MA 4NZQA 3BEFB 4DT7B 5JBAS 2XOKD 2W3KA 4NFEA 1KXDA 4IMQA 2ZDKA 1QA7A 4QT8C 1Y5UT 2P8OB 2FOBA 3HGNA 4Q7ZA 1P9SA 3SJOA 2ZF0H 2BX4A 3L33A 3MO6A 7ESTE 1TX8A 1OOKB 3LPRA 3N7DA 1O31A 4ABDA 1W7GH 4O3TA 2BDHA 4GPGA 2F43B 3C27B 7GCHF 1AVWA 2VIQA 4MVNA 1TNHA 1ETRH 1GDUA 1HIAA 3V12A 1AY6H 4I8LA 3GCHC 1NO9H 4NIYA 2J4IA 1K2I1 1RJXB 4O3UA 4JZDH 1O3BA 2C8WB 3QDZB 2R2WU 2J94A 1LQDB 2C90B 4ABHA 2ZU1A 3U8RH 1C5PA 5EXMA 1O3NA 3QLPH 5I46H 2KAIA 3UR9A 2FDAA 1BHXF 1ZZZA 2Y80A 3OEHD 5AFYH 4OGYA 3KQEA 4K1EA 1S81A 4NSYA 4Z1MD 1BRCE 1F7ZA 4MG3A 1FIWA 1CGJE 1YWUA 3GICB 4GHTA 5L30H 3O8BA 1HRTH 1KXCA 1SVPA 4X2YA 1AVXA 2TGPZ 4ABIA 1DANH 5H4IB 1DLKB 1NFXA 1C2IA 1FMGA 5GIBA 3RXRA 3TNSA 1TBQH 4BAQB 1DICA 2XXLA 1O34A 1ZMNA 1QGFA 5EOKA 4CR5A 3PO1C 5A2MH 5HM9A 2A2XH 1EFRD 2WV5A 1EQ9A 5EW1H 1CA8B 3TK5A 2FOEA 2W7UA 4Y10E 2ZGHA 1GBEA 1CBWC 2CF8H 1IHTH 4BAHB 3BTQE 4VGCB 1C1VH 5JBBS 4A1VA 4YT7H 2ZFTA 3UNSA 4K1SA 1P2KA 3RXBA 3PTBA 4NA9H 3FO8D 2BHGA 3TK9A 4X8UH 2J9NA 2GZ9A 2QAAA 4MPVA 2XWAA 1GBMA 2CGAA 2L74A 1TMTH 1CQQA 1TGTA 2VU8E 3BTDE 3VGCC 2R0LA 1BTHH 2G8TA 4CHAC 1NFYA 1SGYE 3QZQA 5CHAB 3S9AA 3A82A 3E0PB 1YM0A 4OS1A 1B0FA 1GBCA 1SQOA 1VITH 4ZAEA 3ZVFA 1C1OA 2H9EH 2ZC9H 2GV7A 1C2JA 3GY6A 1JWTA 1DWEH 1HAXB 1LPGB 2DE9A 3M37A 4UFEH 4WMFA 5A0AE 5GNDA 2AS9A 3SUEA 4GCHF 3NRLA 2V3MA 1L1NA 4IN2A 5FCRA 3RXQA 4JZIA 1YGCH 1MAXA 3BTME 4Z6AH 1O39A 1TPSA 2YNAA 5FBIA 1Z1IA 1ETSH 4ISHH 4AFSA 1UTOA 4B2CA 1MZDA 2Z9JA 2GT7A 2KX4A 1C1RA 1ZSKA 1LMWB 2ZGJA 3BEUA 1SGNE 3KQDA 4LOYH 5AVDA 2UWLA 3ZVCA 1TABE 3OEED 4K69A 4CRBA 1BTYA 2BY8X 3ZZ7A 1V2ST 2R3UA 1PQ7A 5DK1A 2QF5A 2PP6A 1N8OB 4GAWA 3SGAE 2FOCA 1Z8GA 4H4FA 4YXWD 3DUXH 1BTUA 1DPOA 2BZAA 5A8ZA 1IQFA 1RTKA 2FESH 3GS9A 4FUHA 3TH4H 1FPCH 5EPNA 2FOAA 1BTWA 1DY9A 1W14U 2GCHG 4IC5A 2ANWA 3UPEA 2CXVA 4AFZA 2QN5T 3URCA 9ESTA 2ZHEH 1NPMA 3Q3YA 1O3IA 2D8WA 1GHBG 3RXCA 4BOHA 1EZQA 1HCGA 2GT8A 2JETC 3DSGA 3SQEE 1YPHE 1LVYA 1P3EA 4MPXA 1V2KT 2WSSD 4NIXA 5EXLA 1S0QA 2K8IA 3QX5H 3KQCA 1BRBE 1GHWH 1WU1A 4NFFA 1HFDA 2BY7X 2I6SA 3ZV9A 2R9PA 1MKWK 1EPTC 1VJAU 2XBXA 1N6XA 1GGDC 5FHTA 1A0HB 2QXGA 1T32A 2SFAA 1FV9A 3M3VA 1FY5A 1QZ8A 2BY6X 4U01A 1BCUH 4KTSA 3BIVH 1OWJA 1O2TA 3OY6U 3BF6H 3MOCA 1KYNA 2BDAA 4GVUA 2ZDMA 1HAVA 1OSSA 4AORA 1A0JA 4NA8A 1K21H 3PV2A 3VEQB 2OBOA 4MNYA 4Q2KA 1DXWA 1NRSH 3GDSA 3SUGA 1PQ5A 3PRBA 4ABGA 1T31A 2XNDD 2PTNA 4BXWA 2ZGCA 1DVAH 2SGQE 1OWDA 3AW1A 4LXBH 2XNIA 1EPTB 1TPPA 4KKDA 1OWHA 1P2NA 1F92A 1GGDB 2V0BA 4ABFA 1SQTA 3I77A 2WYJA 3RDZA 1FJSA 2ZA5A 1ZHMA 6LPRA 1LVBA 1P01A 1UHBB 3VB3A 3P92A 4NG9H 1GVLA 2G4TA 2ZEBA 5FL7D 2PKSC 3RXMA 1O2OA 1Y5AT 1SGIB 2O8WA 2XC5A 1QJ6B 3RMNH 5A8XA 5L6NH 3ZV8A 5E0JA 3TLOA 4ASUD 1IQHA 1HDTH 3K6ZA 1YPKH 2OC7A 1WAYB 2Z6BD 4UFFH 1NRRH 2Z7FE 3TITA 1V2QT 1V2OT 5IK2D 4O97A 2R2MB 1UW7A 1TNIA 4X2XA 1O2QA 1SGEE 2PSXA 3RM2H 5F6MA 1O3JA 1W0ZU 5I25A 4FU8A 3TNTA 1GBHA 1QJ7B 2A5AA 1S82A 1ELBA 2Z3DA 1EJNA 2H2ZA 1J8AA 1HPGA 2AGGX 4DCDA 3RXEA 1PPEE 2VH0A 3EE7A 2O8MA 1H8DH 5JB8S 3LOXA 4Y0YE 4ZMAH 1VCQA 1YPJH 4ABAA 3GYLB 3KNXA 1MKWH 2WPLS 3BG8A 4RKOB 1TNLA 3TJVA 1NT1A 1WUNH 1O5DH 2AIPA 1GG6C 5BRRE 1C5YB 2BVXH 1SSXA 3Q00A 4BAMB 1HV7A 3ATKA 4CRDA 1LHFH 3UQVA 3LH1A 3A85A 1UTJA 1H8ED 4KTUA 1F5KU 1DDJA 3RC5A 3MH4A 3WWBA 1SPJA 3FZZA 1BQYA 4AOQA 1HJ9A 2BLVA 2QXJA 1UO6A 1E79D 2AHME 4FUCA 3LGIA 1FY3A 1YLNA 3BEIB 5GCHF 1A3EH 4GCHG 1TA6A 2A4OA 1SGDE 3F9GA 3HATH 3SNCA 5EJZA 1AKSB 1ELCA 1XXFA 2IJOB 1T8LA 2ZQ1A 1QRWA 2HVYB 2A0QB 1JMOH 1CU1A 3V3MA 2CHAC 1KY9A 3TJUA 3AAUA 3K65B 1G3EA 1HAVB 5B6LA 3FAOA 1IQLA 4ZHAA 5DGJA 4AC9A 1QA0A 3UOPA 1Y3YA 2GDDA 1EAWA 1V2PT 1XUJA 1O2ZA 3SJ8A 1TOMH 1UK3A 4B76A 1V2MT 1RTFB 2GVFA 2TGAA 1OP2A 2NU0E 3MMGA 1E34B 2ZU4A 2PGQB 5JB9S 2J95A 5BPEA 1O2PA 1O3OA 1DM4B 3OFND 3Q76A 2OBQA 2OINA 3FVFB 1YPGH 1KXFA 3I29A 5E0GA 1O2RA 1C2DA 1MQ6A 3KEEA 1O38A 1UTLM 1GJAB 1P9UA 1IQJA 4WMDA 4E06H 2HNTF 5AHGH 1C1PA 2PSYA 1ZMLA 5LPFA 4KGAA 2GX4A 1C5OH 2W26A 3T5FH 3TIUA 1RIWB 3BTEE 3OYPA 4THNH 1KDQB 3CS7A 3EGKH 3F9FA 2BMGB 2B8OH 1BIOA 2G00A 3H09A 2H1UA 2GV6A 5SGAE 1Z1JA 3RUOA 4X8VH 4BTUB 3UQOA 3VB5A 1IQNA 3E0NB 1Q2WA 3ZYEA 1C4V2 2BLWA 2GDEH 4DJZB 4ZKOU 3T62A 1SFQB 3EAJA 2FIRH 4WVPE 2A4GA 3QK1A 1GDNA 1G3CA 2BDIA 4NSVA 5A0CA 2GKVE 5C5OA 2V6NA 2QGRA 3LGVA 1RGQA 3ZVGA 2XRCA 1NRQH 1MABB 1F0TA 2IOTA 3EA7A 2JH6D 4UFDH 2XWBI 3LGWA 4FUEA 4RT0A 1THPB 4XOJA 3RXOA 2WHXA 2ZGBH 3RLYH 2R3YA 2ZO3H 3E91A 1MTNB 1WTGH 4KTCA 2QA9E 4H42U 4LZ1H 1AB9C 2VWOA 1D3TB 1SR5C 1HAIH 4X8SH 3MNSA 4JYVH 2NU3E 1H8HD 1L1GA 1INCA 1J14A 1UVPA 2GMTC 2ZDAH 3RXJA 1S0RA 4U30A 1NTPA 4JZEH 2QY0B 5LH8A 2HLCA 5HIYA 1NZQH 1T4UH 2NU4E 2SNWA 3M3SA 1O30A
chains in the Genus database with same CATH topology
1DITH 1VGCB 2ESTE 1CO7E 1GHYH 4IGDA 5EG4A 1ABIH 1H9IE 2YNBA 1C9PA 1MAYA 3BV9B 5E0HA 3NPSA 3HKIB 3B9FH 2DUCA 3PLPA 8GCHF 1AUJA 2BZ6H 1DSTA 2Y82A 4MPUA 1NM6A 1EAXA 1LKAA 3P95A 1O33A 1THRH 2ZHQH 3SGQE 2VH6A 1AE8H 1LQEA 3KIDU 3M5NA 1C1QA 2H9HA 2A5KA 1KXAA 1AFQC 3RXTA 1A1RA 2W7SA 4B71A 5DO4H 2PV9B 1UTQA 2BVSH 1E37B 1EASA 3PWBA 2A32A 1HYLA 1D9IA 1EAIA 1QY6A 2YOLA 3A8DA 1A46H 6CHAC 2NU2E 1W0YH 3TH3H 1P11E 1BBRE 4UEHH 4IC6A 1C2FA 2B7DH 1TLDA 2BB4A 2P3TB 3OSYA 3FZDA 1L2EA 3MH5A 1BRUP 4MNXA 3LT3A 2Q1JA 2ANKH 1V6DA 1ELGA 2Z9GA 1FI8A 1GJ7B 3BG4C 3SBKA 4CR9A 5AFZH 3QN7A 5JPMH 1FIZA 1ZPBA 2GTBA 1K1PA 4XBDA 2VIWA 1V2VT 3E6PH 4DW2U 1O37A 1CT2E 2PUXB 1YPEH 1EP6A 1DFPA 5T6DA 3SO3A 5DP9A 1F5LA 1S84A 2RA0A 1K1NA 1BBRK 1AU8A 1TPOA 5EGMA 4BTIB 1GCTB 1GI4A 5F8ZA 2QXHA 1XVOA 2GCTC 2J2UA 4WH8A 3LGUA 4Y76A 3ZZAA 4FUJA 3JZ2B 1JIMA 2NWNA 1G30B 2P3UB 3OX7U 1C5QA 3GISB 1BUIA 1DT2A 3VFEA 1NU9A 1GMCF 2BD4A 3LGTA 4X6PA 1TIOA 4MPWA 1D4PB 3F6UH 1HUTH 4LK4A 2FLBH 1AD8H 3G01A 2A31A 1CHOF 4KELA 2P93A 2TGTA 1BDAA 4ISNA 1YPLH 2PGBB 2XW9A 1ZGIA 1GWAA 2IN2A 3ODDA 3RM0H 2BD3A 1TA2A 3LH3A 1FZZA 2AERH 1TALA 1TMUH 1DWBH 3UY9A 4X2VA 5CE1A 4FUGA 2P3FH 4IW4E 5GDSH 2WINI 1OYTH 2VIDA 3GCHB 1K1IA 3GCNA 1EAUA 8KME2 1ZTKA 2G4UA 2PWXA 7KMEH 4FVDA 2UWOA 1ESAA 4A6LA 1MBMA 1DE7H 1ZPZA 3LU9B 3PLKA 1YLCA 3SU3A 2F9BH 3GY2A 1WOFA 1LO6A 3MNXA 1GBLA 1G37A 4XBCA 2OUAA 1E36B 1MZAA 1GI7B 4Y11E 3SI4H 3MU4A 1Y59T 1BB0B 1PFXC 3GDVA 2ZPRA 4OGXA 4Y8ZA 1OWEA 1BBRH 1QL9A 4SGBE 5IYTA 1RS0A 1SHHB 1ZOMA 1G36A 1GVKB 5DPAA 1PQAA 2GZ8A 1YCPM 3MYWA 1TQ7B 4ASHA 3S9BA 1WCZA 1D3PB 4WH6A 1VITF 2VVVA 4UE7H 3A7YA 2WPMS 2ZDNA 3PMHB 3KL6A 2I6QA 3SU0A 5EPYA 1THSH 2BVRH 4DURA 2XCNA 1P03A 3PO1B 3SOSA 1GI0A 1HAZB 1TNJA 5JDUB 1EP5A 5JYIA 1Q31A 3M7UA 1B7XB 4TPIZ 2A2QH 1EPTA 4YESB 1CBWB 3KQBA 2VIPA 1O5EH 4RKJB 1ZLRA 3E90B 1YCPK 1UHBA 2BD7A 2IPHA 5C67A 2G5NA 3V0XA 4X1QU 8GCHG 4NIVA 2Z9IA 2BXTH 4YOJA 1YP9A 1O2JA 1PPZA 3O8RA 2WUBA 1T7CA 3GY7A 4I31A 1OP8A 4Q7XA 2FMJA 3TJNA 3VGCB 3LDXH 2ULLA 4AZ2B 4CHAB 5T3HA 3C1KA 5EQRA 5G4BA 1BT7A 3RU4E 1BJVA 1GPZA 2JH5D 2PUQH 3D62A 5K0HA 2BDCA 5LGOA 2VGCC 1PPHE 3CENA 4X0WU 1NRNH 3GYMA 2GD4B 3RXGA 4R8TB 2QV1A 2HPPH 1C5RA 3S7KB 2ZDLA 5EQQA 1FQ3A 1OWKA 4BANB 1CHGA 2UUYA 5LPEA 1DY8A 1P2MA 1IQIA 4AB8A 1TWXB 2F9OA 2ZPSA 2CJIA 1ID5H 5C1YA 1DS2E 1SGFG 4JCNA 5EW2H 3SUDA 1P2IA 4I8HA 3D49H 1P04A 2C8XB 4A1XA 3VB6A 2ODYB 1HBTH 1AO5A 4FUIA 2V3HH 1GBBA 4D76A 4UONA 2PKAB 1Y8TA 1GI3A 1XUKA 2H6MA 4IN1A 1H4WA 1BHXB 2XBVA 1UTNA 1QR3E 1O3GA 3A7TA 1MQ5A 1EOJA 3ZZBA 3S0NA 5C20A 4MQAA 3M3TA 3SU5A 1LPKB 1L0ZA 2O8LA 3L6PA 5TCCA 4B73A 1P3CA 1SGTA 2XBWA 2BX3A 1EZXC 4ZROA 1P06A 5E2PA 3E16B 3PYHA 2XC4A 3MU0A 1J16A 2Y7XA 1SFIA 4HTCH 2Y5HA 4ABJA 1ZTJA 1AKSA 3RC6A 2ZHWH 1AZZA 1YCPH 1DWDH 2AFQB 3PMAB 3MTYA 1HJAC 3SZNA 4TY6A 1GMCG 2WPJS 3K9XB 4JMYA 3UWIA 1F0RA 1C5VA 5IDKA 1ARCA 1E35B 1QB6A 2JETB 3A83A 1KXBA 1OPHB 1SG8B 1MU8B 3MNBA 3RXDA 1CHOG 2F9PA 1ETTH 3EYDA 1O35A 4IBLH 3TK6A 3EE0B 2BQ7B 4B74A 2PR3A 2OC1A 5EODA 3URDA 3DFLA 4AG2A 1P0SH 1V2NT 1BOQA 1BTPA 4XBBA 2FI5E 3TPIZ 1ZSLA 3F68H 2BD8A 3DFJA 4YZUA 1HJAB 1GBIA 2FS8A 1EJMA 2GP9B 3RXKA 2AEIH 1AI8H 3ITIA 4WWYA 1V2LT 1KDQA 3LC3A 1K1LA 2ZPQA 3U8OH 1NY22 1T8MA 4O03A 4INHA 3RXFA 2AGEX 4GHQA 1S85A 4OS7A 1LHCH 1QBNA 2BDGA 2WYGA 2SGAA 2HGTH 1EB1H 1L4ZA 2RG3A 1ESBA 1C1UH 3M61U 4CH8B 1TGSZ 2W3IA 1RFNA 2A7CA 3ENSB 1ZTLA 4J2YB 2ASUB 3T27A 2ZTZA 1GBDA 1Q3XA 3P17H 1C1MA 5A0BA 4CRAA 2XTTB 2GGVB 2VWLA 2FTMA 1GL1A 2STAE 2ZIQH 3UNRA 2STBE 3PB1E 4ZHLU 2PKSB 1YBWA 1ANEA 4WXIA 1FAKH 1P02A 1SLWB 3QGNB 1H1BA 2UUKB 1VITG 1YLDA 3Q3KA 3KF2A 1FNIA 1AHTH 3LC5A 2VIOA 1MBQA 2C4FH 3B23B 2RDLA 1ZMJA 3PMBB 3ATIA 1GDQA 1XUHA 1BMAA 1QL8A 2ZFRH 2W5EA 4GUXA 1PPGE 5FBEA 1QBOA 4ZKRU 1SGQE 2LPRA 4M7GA 3NK8A 4A1TA 5C2ZA 3HKJB 2D1JA 1O5FH 2Z9KA 2FOFA 4CRFA 1P8VC 3PLBA 4OS6A 3ELAH 1T8OA 1BMLA 5HXFA 4LZ4B 3EA9A 4TWWA 1ANDA 1GG6B 2AIQA 3QWCH 3SNBA 3ZVEA 5ESBA 2ZTYA 1M9UA 2VVCA 3RXIA 1MU6B 4ISOA 3M35A 2FODA 2CN0H 1FY8E 1OXGA 3SJIA 1EOLA 1VCWA 2PLXA 5FXLA 2FEQH 2TIOA 4GLYA 3QO6A 2ILNA 5T6GA 1D6RA 3VXEH 1W7XH 1ACBE 1V2TT 2A4QA 1KSNA 4K1TA 3VB7A 2BYAX 1G3BA 3S7HB 2ZCHP 3P8NA 4DGJA 1GBKA 4AG1A 2ZECA 2B5TB 4YTAA 1RD3B 3VPKA 4Y79A 3MNCA 3NKKA 1MD7A 2ODQA 3STJA 1RXPA 2Z9LA 1IQKA 1O3HA 2CHAB 4MLFB 4AN7A 3GCTF 2P94A 4K2YA 1DXPA 1EUFA 2UUFB 4WJG2 3S9CA 1L4DA 1O32A 1Z7KA 4TY7A 4UDWH 3U1JB 4H6SB 1H9HE 1ZJKA 3BN9A 3M5OA 1GCDA 1UK4A 5B6OA 2A7JA 2VINA 3ZYDA 3HPTB 3RLWH 8LPRA 3PWCA 3A86A 1YPHC 2ZFPH 1FPHH 5EU8A 5C1XA 3R0FA 3VB4A 1VJ9U 2OC8A 1CT4E 3WY8A 4X8TH 2Y5GA 1T8NA 3PROA 2QF0A 1JRTA 2VWNA 3TGJE 1P05A 3BTHE 1BZXE 2TBSA 3RMOH 2FO9A 2FOGA 3IG6B 1C5MD 3FFGA 2SNVA 1HJ8A 3ZVDA 4JZFH 3A84A 2WPHS 1WSSH 1MH0A 3D23A 3TGIE 1FAXA 1GHAG 4I8JA 4AFUA 5DP7A 1D3DB 4BXSA 1MUEB 4RSPA 3V7TA 2ALPA 4X2WA 2QYIA 2BD9A 3LKWA 1W3CA 3RP2A 1C5UA 3TH2H 4XDEA 4GSOA 2ZTXA 3EQ0H 1NS3A 4JZ1A 5FPYA 1KLTA 4WXVA 1UVOA 3T28A 3S69A 1DLEA 1UK2A 2BDBA 1NU7B 1KTSB 1P10A 1W13U 4BNRA 1TYNA 1WV7H 3MO9A 1LPZB 1N6YA 2ZDVH 4FU9A 1FY4A 2FOHA 3UOUA 2ZU3A 1NFWA 1B5GH 5L2YH 2VNTA 1GI9B 3GY8A 4JYUH 1D3QB 1J9CH 1QQUA 3F9EA 3MU1A 1HAGE 4YOGA 1N1LA 1AB9B 1HB0B 3O8CA 1SBWA 1F5RA 1Z6JH 2GMTB 3BIUH 5FPTA 3FANA 2HNTC 4ZXXH 3ODFA 1QCPA 2RCEA 4WF8A 1O3AA 3BTWE 3N7OA 2AMDA 2FM2A 3D65E 5C3NA 4WY3A 1HXEH 1OS8A 3GOVB 1FY1A 2Z3CA 5HGGA 3TGKE 1C4Y2 4JK5A 2J92A 4AYVB 4NZLA 3ZZ3A 1OYQA 1NFUA 3MH6A 1BA8B 4X1RU 2CF9H 3P70B 3R3GB 2ZFQH 5DKMA 3A81A 1O3DA 3E3TA 3Q77A 4ABEA 2Q6FA 1ELFA 1TNGA 3FP7E 5J4SA 2SGFE 5PTPA 3GDUA 4DIIH 4XSKU 1IQMA 1OX1A 4FUBA 3T25A 1P2JA 1ABJH 4OS4A 1HAYB 1SOZA 1O2WA 4YM9A 5DP6A 4ISIH 3ZZ9A 1A2CH 1AFQB 2ZGXH 4X6MA 1TRYA 4INLA 4O9VA 2AMPA 2ZFFH 6CHAB 4H6TA 4MNWA 1BMNH 1F0SA 4HI3A 4YO9A 2R0KA 1VZQH 3U98H 1O3CA 4ZXYH 2HPQH 3UREA 2EI6A 1Y3VA 1KTTB 2CV3A 5DJ7A 1A5HA 3EA8A 4NCYA 2ZQ2A 1SOTA 1MCVA 3BG4B 1H8IH 4D9RA 4CRCA 1V3XA 3CS0A 1K1OA 2H5DA 2SGEE 1JBUH 1O3MA 1QNJA 1Y5BT 3T29A 3MI4A 2ANMH 2BXUH 1FDPA 1SGCA 1WYKA 3MWIU 5HYOA 2BDYA 3KCGH 1SLVB 4BTTB 3NCLA 1XX9A 1ZRBA 3SNAA 4MNVA 1AMHA 3UUZA 1HNEE 4IS5A 3BSQA 1J15A 3AASA 2GCTB 3BTGE 3GY4A 3GCTG 2C3SA 2TRMA 2A5IA 3OU0A 1W8BH 1WQSA 3SHCH 1DWCH 1EZSC 1GHXH 2UWPA 1TFXA 3LONA 4F4OC 4B2AA 1ELEE 4Q7YA 1GI5A 2HOBA 4JK6A 5GWZA 3PTNA 4VGCC 1FN6A 4ZHMU 2PKAA 1O3KA 2BTCE 1IOEA 2JKHA 1HXFH 5F8XA 2PHBA 1SI5H 1W10U 2FI4E 3SNEA 2QIQA 1LTOA 2Y81A 2HALA 1GVZA 1O2SA 4Q80A 1ZHRA 1ZRKA 4AX9H 3DHKH 3AAVA 1AQ7A 3ZVBA 1YKTA 3E8LA 3A88A 3P8GA 1MTWA 1GJ4H 1TMBH 4I32A 4Y71A 2AH4X 1UCYE 5CHAC 1ANCA 1W12U 4KP0A 3PM3A 2AYWA 4I8GA 4CRGA 1WBGB 2G51A 1SGRE 1NROH 1O2HA 3NUMA 5A8YA 1KIGH 1O2MA 3BTTE 5ETXA 3SU2A 5A09A 4OS5A 1O2UA 1WQVH 4I7YH 1V2RT 3UNQA 3A80A 1LKBA 4X1SU 1QFKH 2A1DB 2GZ7A 1O5GH 1ELTA 6GCHG 3GCOA 3UTUH 1IAUA 4HGCA 4B75A 2ZCKP 3MH7A 3ZZDA 3NXPA 4NWLA 1P2QA 2P59A 3MFJA 1C2GA 1DUEA 1C5TA 4B2BA 2F9UA 2DE8A 1G2MA 4X1PU 1PPFE 1UCYK 2OTVA 2ZHFH 4Z0KA 3RU4T 2J34A 2PFEA 2V3OH 1A7SA 3AW0A 2QF3A 1CSOE 1X7AC 1O2KA 4B1TA 2VIVA 1S83A 1C2MA 1Z71A 2THFB 5C5NA 2FPZA 2BD2A 3QZRA 1OWIA 1N8OC 3GY3A 2G81E 1P2OA 1XUFA 2P95A 1ZYOA 3ESTA 1TONA 4NIWA 3SORA 3ZZ5A 1GI1A 2CMYA 1GMDF 5F8TA 3M7TA 4D7GA 3HK3B 3CP7A 4R0IA 1GJCB 3IITA 1YYY1 2VB0A 1E0FD 3DT0H 1PQ8A 1HIAB 1NC6A 3P6ZB 2HVXA 2OP9A 1T4VH 4XFQA 2Y5FA 4Y8XA 1K22H 1MTVA 1J17T 1S6HA 2C8ZB 2C93B 4E05H 3A7ZA 2OC0A 1GBFA 3FP8E 5FPSA 1C1WH 2B0FA 1JIRA 1GJ9B 2KAIB 3SQHE 1GMHF 5GXPA 1TE0A 1GJDB 1TAWA 2BQ6B 3A89A 4UD9H 2ZU2A 1EZUC 3AVZA 5HMAA 2ANYA 1XUIA 2HRVA 3F1SB 2EI7A 4K8YA 1UJ1A 2SGDE 1Y3WA 1K9OE 2VGCB 3KHVA 3NZIA 1Y3XA 2ZU5A 6ESTA 3V13A 1C5ZB 1O2LA 3PMJA 1KLIH 1GBTA 1IHSH 2OLGA 1H9LB 1ELAA 1ZR0A 2F3CE 2F91A 1EATA 3A7WA 3EDXB 1AWFH 4NWKA 1UCYH 1DX5M 2ZZUH 5E2OA 2PTCE 1OKXA 4ZUHA 2F9VA 1O2VA 3UR6A 1CVWH 3SV9A 1ZPCA 5T6FA 2G52A 3ATMA 1C5SA 2G55A 5L2ZH 5DP8A 4AYYB 1C5XB 1GBJA 3VXFH 5K7RA 1GJ6A 1JXPA 3HK6B 1O0DH 4K8BA 1GHAF 3M5LA 7GCHG 3OY5U 4MDSA 1LDTT 5JBCS 1Y3UA