3MU4A

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region b of the crystal. first step of radiation damage
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu4A01
3STJA 1XKBC 2PHBA 3BIUH 1VGCC 3N7OA 3EDXB 2EA3A 2BD7A 2FDAA 4NA7A 3RP2A 1GGDC 4DVAU 4OS1A 2ALVA 1QIXB 2ALPA 1C9PA 3NZIA 2FI4E 3MYWA 4Z6AH 1YLCA 1XMNB 2BDBA 1KYNA 4THNH 1TE0A 3FVFB 1GJ8B 1O3MA 3PYHA 4DURA 1PJPA 2P93A 3VB6A 3QN7A 4KTCA 1WAYB 3ZZ3A 2XBWA 2AS9A 3RDZA 2GCHF 1WQVH 2ZU2A 4JYUH 1HXEH 1VCQA 2WINI 4HGCA 4NZQA 2H5CA 4CRAA 2JH6D 2Z6BD 1N8OB 2VGCB 1C4U2 1LHDH 3TK5A 1ZZZA 3VPKA 1H1BA 4ABJA 1GJ6A 1K21H 1KLTA 4WJG2 1MUEB 4ZKRU 2WPHS 1BBRK 1GJAB 1TQ0B 3SUDA 3EQ0H 4BXSA 1J9CH 3LGYA 5C5OA 4YESB 2VWOA 1A3BH 5EQSA 1FN6A 3SHAH 2V3HH 4BTTB 2ZHFH 5CMXH 1BBRH 4INKA 1QFKH 5G4BA 1P09A 1NU7B 2KAIB 2BY5X 3OY5U 3UQOA 3SV7A 1FAXA 2J2UA 1ZRKA 1AB9C 1HXFH 3M5LA 1V2WT 2FPZA 2FLBH 3ZVCA 1AD8H 1O36A 1G3BA 1HDTH 1TBRH 3RMMH 1GDNA 1SFIA 1T31A 2C8YB 2FS9A 4XDEA 4ISNA 5EW1H 1IHSH 2ODPA 4H4FA 2J95A 2Z9KA 1NPMA 5HGGA 3UQVA 1GMDG 3OU0A 1O2GH 3SNAA 2F9NA 2P8OC 5JDUB 1WSSH 4FU9A 5T6GA 3MO6A 1ZLRA 5FAHA 4B2CA 4Q80A 3SO3A 1C1QA 3T29A 2GMTC 1VCWA 1AVGH 1FV9A 3NCLA 4A5TS 1C5ZB 1MBMA 2FWWA 1FAKH 4IW4E 1DFPA 3RXDA 3RXHA 3GY6A 1BHXF 1AE8H 2BZ6H 2P3UB 5FCRA 3U9AH 1O2XA 3MI4A 4IN2A 3KHVA 1KDQA 3SUEA 4YO9A 3BTQE 3DFLA 3RMNH 1H8DH 4J1YA 9ESTA 1ABJH 5K0HA 2AFQB 3PWCA 4VGCB 2XC5A 1C9TA 1TNGA 2PSYA 3HGPA 3TK9A 2XNIA 1P0SH 1FQ3A 2Z7FE 1V2OT 4WXVA 3BTKE 4CBNA 3V3MA 1G37A 3HK6B 2BHGA 1WQSA 3GYLB 1Y3UA 1C5YB 3HPTB 3UY9A 1Q3XA 5JBTA 4WMFA 1NFWA 1BJUA 4X6OA 4X6MA 1IOEA 4MPXA 2H1UA 3P8FA 3LGWA 1GHBG 1GVLA 3PWBA 3EA9A 1XXFA 1AO5A 1GHAF 1SC8U 2ZU3A 1ESTA 1W0ZU 1GJ7B 3GCHB 1DY8A 1A2CH 1TPPA 2OP9A 3WY8A 1DWEH 2VGCC 3M5OA 4PROA 1TNLA 1XVOA 2JETC 3TGKE 3SJIA 1ZSJA 4FU7A 1P05A 1ELDE 2ANYA 2FI5E 1SGTA 1ZGVA 5C1UA 1V3XA 2GDEH 4YTAA 1ELBA 1ETSH 3MHWU 2CMYA 1GCTB 1PPEE 2RG3A 5EODA 4HFPB 1GBCA 2V35A 2FXRA 4AG1A 2ZU1A 3RU4E 3F9GA 1O5FH 1UTJA 1GBMA 3BSQA 4O3UA 2F3CE 3SOSA 3RXJA 4NWLA 3ODDA 1CT0E 2ZHQH 3GY4A 2PKAB 1F2SE 1ZRBA 2PFEA 1O3FA 1HUTH 4MNXA 4ZAEA 4KELA 1OYQA 3FFGA 3K65B 3Q3KA 2CV3A 1TA2A 2ODQA 4IN1A 2DE8A 3GCTG 3T26A 1AFEH 8ESTE 2FM2A 3H7OA 2QGRA 1LPGB 1W7GH 1H8IH 1QJ6B 1RFNA 4NGAH 1GBBA 1PQAA 3STIA 3FZDA 3Q77A 2H9HA 2PTCE 3DA9B 1P11E 8LPRA 1OS8A 2VNTA 3ZZBA 3A8AA 4O97A 2A5KA 2H6MA 3NUMA 3RXLA 4AOQA 2A31A 1EB2A 1PPBH 5DPAA 1SGYE 5DP3A 3C1KA 4BAKB 4X1PU 1SL3A 1G3CA 3O8CA 3P95A 3KGPA 2BQ6B 3C27B 2F9BH 3KF2A 1D3DB 1SGNE 2FO9A 2FYRA 1ESBA 4Y7AA 2ZIQH 1YPJH 1LPKB 1N6XA 1S82A 4NG9H 1MCVA 1C5WB 1CBWB 1E34B 5GPIB 1QB9A 1Y3WA 1HAXB 1UTOA 2OBQA 3OYPA 5TCCA 5B6OA 2FYQA 2BTCE 1YBWA 1HRTH 1LDTT 1ZGIA 4UD9H 4IMZA 4JCNA 2W3KA 4K2YA 4Q7ZA 1F0SA 3U98H 2PLXA 3O8BA 3BTEE 1BZXE 3ZZ6A 2FOCA 4JZIA 2ZTYA 1IQGA 2B0FA 4AFZA 3QX5H 2ZDMA 1F5KU 2ZFPH 1O38A 2ZHWH 2FMJA 2Z9JA 4B74A 1RRKA 3CS7A 1C2JA 4ZXXH 2WPKS 5T6DA 1SSXA 3MU1A 1ETTH 2G4UA 3GCHC 2ZGHA 1NC6A 4CREA 3VB5A 1BTPA 4NIXA 3AW1A 4MPWA 4ABDA 1O30A 5EXLA 1UCYE 4WWYA 3ZVGA 1H4WA 1HCGA 2A4GA 1IQJA 1A3EH 1MKXK 1TRMA 3SI3H 1C5XB 1HFDA 3SNBA 2RA3A 4B2BA 2G51A 1C5VA 2EEKA 1GCTC 5JYIA 1ZYOA 1JOUB 1NRPH 4NZLA 1NY22 4ZHAA 1YPHE 2ZWLH 3A84A 4XE4A 2VIWA 1BMAA 1AZZA 1E0FD 2AGEX 2ZI2H 2ZHEH 5L2ZH 1O3GA 4A1XA 1V2RT 2Z3DA 2OTVA 1XUFA 1PPCE 1C5LH 1C1OA 4YT7H 1AN1E 1GDUA 2BMGB 1GJCB 2CF9H 2PKSB 1C2EA 1GI2A 1O2YA 1QBNA 3KEEA 1GMCG 1ZSLA 1TA6A 4FUFA 1KIGH 5HMAA 5SGAE 1KXAA 5ESTE 1E35B 1ELGA 1GHBF 1TX6A 2ZFQH 4UFFH 2OC8A 1ACBE 4NA9H 2TGAA 2W3IA 1SPJA 1C5RA 3SV8A 3GYMA 5A2MH 5JB9S 3P92A 1BTZA 5CHAC 2J4IA 4AG2A 1QJ1B 1O3BA 3QZRA 1SLXB 3MU8A 1FONA 2AMQA 3MH7A 2BD4A 5TCAA 1NM6A 2C4FH 1H9HE 5FCKA 2ZFRH 1DXPA 2A0QB 2Y81A 3L3TA 2LPRA 3EAJA 4D76A 4D9QA 1AHTH 1IAUA 2RA0A 4D8NA 4ZUHA 3AW0A 3QGNB 4BAHB 2BQWB 4Y0YE 2YNAA 1HAHH 2ZFFH 4GUXA 3MU4A 1O5BB 3BTGE 4Y76A 5HM9A 4MQAA 1CBWC 2VVCA 1G3EA 5HXFA 4A1VA 3PLKA 6LPRA 1GJ5H 1YF4A 2G52A 3PMHB 4X2XA 2C90B 2WPIS 1ZSKA 1FMGA 1O2SA 3A8CA 3SU4A 3MU5A 1P03A 3E90B 1VITF 4IBLH 5DP6A 4E7NA 1PPGE 4Y6DA 1O5GH 5J4QA 1GBFA 1XM1A 3P8GA 1DDJA 2ZHDA 1W10U 2Z9IA 1TGCA 3ZZ9A 1UTMA 2A2XH 1ORFA 1QY6A 3DHKH 1NESE 1O3OA 4A7IB 1KSNA 3U1JB 1O35A 1TB6H 1DX5M 1K28D 1ANEA 3SU1A 3PLPA 1GHXH 1S6FA 2HALA 1FIWA 5FPYA 3V13A 5EW2H 1ABIH 1G3DA 2OC7A 1SG8B 2NU2E 4KP0A 5C3NA 4MPVA 1DLEA 1OSSA 2WUBA 2BY9X 1QRWA 2ZTZA 2P94A 3BG8A 7GCHF 1O3DA 1YPGH 1BTUA 1TNKA 2VVVA 4E7RG 3LKWA 2PUQH 2BOHB 2GTBA 3ODFA 5GDSH 3S9AA 5AVDA 1GBEA 1LKBA 4WH6A 5E8EH 1P06A 1C1RA 1TFXA 1GBLA 2GV6A 4TYDA 1BIOA 1BUIA 1CO7E 1OP8A 2HNTF 1BB0B 3PO1B 2CN0H 2ZCKP 4ESTE 1DWDH 1O34A 4FUIA 5EOKA 2OQUA 2ASUB 4X1NU 1BRCE 3M7QA 3S7KB 3RXQA 5FXLA 3K2UA 1FY4A 1JRTA 1DITH 1F5LA 4YT6H 2ZG0H 3KQEA 4JZFH 1ANDA 3M61U 1DUAA 3RMOH 2P3FH 1DWCH 1DVAH 2BD5A 1GI5A 1OWDA 4BTUB 4K69A 5EGMA 4JZEH 1NFXA 4IMQA 4Q7XA 3SNEA 1TWXB 4CBOA 1MQ6A 3UTUH 1FDPA 2V3OH 1BMMH 1C2FA 5GJ4B 4TPIZ 1EPTB 3DUXH 5HYOA 2HGTH 4NIYA 5E2PA 1BT7A 2J94A 4FVDA 1HIAB 1ELTA 3ZVAA 1AWHB 1QNJA 3GISB 3S0NA 4NSYA 1IQLA 2NU1E 4H6SB 1P9SA 1RD3B 2FOBA 2OQ5A 3QLPH 2FX6A 4BTIB 3BG4B 4MNVA 3P70B 1YP9A 3BTHE 2BXTH 1C2HA 1HAVA 3E3TA 1SQTA 2XW9A 1ZHMA 1HJ9A 2Q6DA 1GL0E 6GCHG 4YOGA 3SUGA 1GL1A 2V0BA 1G2LA 3QUMP 1YPKH 1ZMNA 4Q2KA 3CP7A 3ZZAA 2ILNA 4GAWA 4YLUA 3OY6U 3EA7A 5FBEA 1UHBB 1FI8A 3NPSA 2I6QA 1AGJA 1NO9H 2ZPSA 1ZR0A 3HK3B 1FXYA 1EX3A 2ZZUH 1EAUA 1Z8GA 4FU8A 4JZ1A 3SGQE 4OS4A 2ZECA 2QXHA 1FN8A 1A7SA 2YNBA 1GBHA 2VIQA 3H7TA 2ANWA 1HAGE 2FTLE 3V0XA 2FOGA 5C1YA 4M7GA 4IS5A 1BMLA 1O2JA 3RU4T 1MTVA 2UUKB 1AFQB 1MTSA 1QBVH 3PM3A 4FVBA 3SNDA 2BVSH 2W26A 1OYTH 2GZ8A 1A5IA 3PLBA 4CRBA 2EI7A 1XXDA 4X6PA 3OTJE 3GDUA 3VGCB 5H4IB 3VB4A 2XBVA 4F4OC 1G2MA 1W8BH 3MH4A 1T8OA 1J8AA 3TVJB 3PO1C 3T2NA 1TMTH 2XXLA 1TNIA 4LOYH 4ZH8A 4XBDA 2H2ZA 2ZGXH 1G32B 4DOQA 1UVSH 3F6UH 4RSPA 1S84A 4I31A 1FLEE 1XUHA 1O2LA 1FY1A 1GI0A 3A82A 3HKIB 4X2WA 3OSYA 3S9CA 1BHXB 1LVMA 3KQDA 3TIUA 3A7YA 5DJ7A 2BVRH 2QC2A 1Z8IB 1TRNA 1AKSA 1O5DH 4GLYA 2M5TA 1SVPA 2GZ9A 1MAXA 3TU7H 1GI6A 1EPTC 3K6ZA 2FZZA 3P8NA 4B71A 2AEIH 1NRSH 1OOKB 1SBWA 1EZSC 1ESAA 1RTKA 4R0IA 1DS2E 3TJOA 3LONA 1DSUA 1NROH 1SLVB 3SW2B 1TNHA 1D3TB 3UR6A 3U1IB 4UDWH 2GVFA 2ZDKA 2C8ZB 3VB7A 2TGTA 2ZC9H 2G8TA 3BG4C 2ZGBH 4D7GA 5DGJA 1O33A 2XBYA 1YCPH 4ISLA 3Q3YA 1BITA 1RJXB 1PYTC 1CE5A 2XRCA 1EJMA 1L4ZA 1GWAA 1GG6B 1O3IA 5C1XA 2BY6X 1AZ8A 2XCNA 3JZ1B 2TGDA 2IPHA 2UUYA 1SOZA 2FS8A 2VWNA 3RXBA 1O2RA 1V2VT 2IOTA 3QWCH 1GHVH 3HKJB 2P16A 4K1SA 1MCTA 1IQNA 3UREA 5AFYH 1HJAB 2ZCHP 3UOUA 4CR9A 1OWJA 1ZPCA 4AFQA 1BBRE 1C5SA 4NIVA 1GI4A 2FODA 1EAWA 4Y8ZA 4Y10E 5A0CA 1AUTC 1NRRH 1EASA 3ATKA 1W13U 1AFQC 3BEIB 1XUIA 1C4Y2 4SGAE 5DP4A 2ZGCA 1QHRB 3AAUA 3OX7U 4D7FA 3RLWH 3KNXA 3FP7E 3VGCC 1C5UA 3A86A 2F83A 3MH5A 3AAVA 1N8OC 5DG6A 1TGSZ 3BEFB 1EKBB 2O8MA 1GI1A 3T5FH 3QGJA 1AWFH 3RXRA 4JYVH 4ZKOU 1K1OA 2SNWA 3GY2A 1MAYA 3LDXH 1SGQE 4X6NA 2Z9GA 4IC6A 1IQMA 4ISOA 3LGUA 1L1NA 3A88A 1SHHB 4DY7B 3I29A 1UVOA 2HWLB 2C8XB 1HYLA 1EZQA 1PQ7A 3MU0A 3T25A 3UWJH 1WU1A 5DP9A 1AVWA 2VIOA 3A7XA 2XWBI 1ETRH 3PMBB 5DKMA 1Z71A 3W94A 1O37A 5J4SA 1ZJKA 2C3SA 4B76A 2VIVA 1AUJA 2HNTE 3QTOH 1HB0B 4Y11E 4ABFA 1E37B 2B8OH 3M36A 1FY8E 2Y7XA 1BRBE 1MZDA 4FUGA 1GVZA 3VEQB 2ZDAH 1ELAA 1P10A 3V7TA 1CHOG 1HPGA 1N1LA 2G00A 2RDLA 2PUXB 5LH8A 1OKXA 2A5IA 4MG3A 3LJOA 3D49H 4H42U 5F8ZA 4K1EA 2UWPA 1DWBH 3M5MA 4INHA 3TLOA 1B0FA 1SGEE 1PPFE 2UWLA 4MLFB 2W5EA 5L30H 1TMUH 1FJSA 1XUJA 1OWKA 2R0LA 3RMLH 3DD2H 3KL6A 4ZXYH 1BTYA 3AASA 1RXPA 1D4PB 1UCYH 4O03A 1Y59T 3AVZA 2ZO3H 3LIWA 2J34A 1GG6C 4LZ1H 3LH3A 2WV5A 1MTUA 2F9OA 5FX6A 3TJVA 1INCA 4FXGH 4VGCC 2BDGA 2UWOA 3NK8A 5GWZA 2THFB 2Y5GA 3SGAE 1Z1IA 1HAYB 4DIIH 1QBOA 2IJOB 2ANKH 5AHGH 5EG4A 3TNTA 4ZMAH 1FY3A 5FBIA 2WV4A 5JBAS 1LHGH 2RCEA 4ABEA 2VIDA 1JXPA 1HLTH 2FI3E 3TGIE 3SJKA 4Y8XA 1VJ9U 2GCTB 1PFXC 3K6YA 3L33A 2QIQA 1C2MA 1DLKB 3DFJA 1LQEA 1P2OA 2B5TB 2F9VA 3ENSB 1TABE 1S85A 1GCDA 7LPRA 1DPOA 1SLUB 1GMDF 2ZDNA 1MBQA 1ZTJA 3E1XB 3VXFH 2FP7B 3ZVDA 1FY5A 1UTPA 3ZYDA 2VJ1A 2ZA5A 1EJAA 3ZVEA 2BXUH 5T3HA 2VH0A 1LHCH 3ZV8A 2BD9A 3H5CB 1YYY1 3M3SA 4U01A 1SGDE 1V2UT 1BCUH 3F68H 4E05H 2FOAA 4KGAA 1TLDA 1T4UH 2AERH 1KLJH 2OXSA 5IYTA 5EXNA 1YPEH 4ASHA 3A8BA 3GICB 1Z6EA 2FLRH 1WTHD 5AFZH 1L4DA 4WXIA 1L1JA 2QA9E 4AFUA 1ZTLA 1CA0B 1K1MA 4NCYA 2H9TH 1LVOA 4DJZB 1CGJE 1NZQH 1UJ1A 4YZUA 1KTSB 4CHAB 1GHYH 8GCHG 3EA8A 2Z94A 2NU4E 1S83A 4JMYA 4K60A 1SHYA 3NWUA 2QV1A 3SQEE 1ARBA 4UFEH 4AZ2B 1O5EH 1H9IE 2ZEBA 3UOPA 4OGYA 1MTNB 1GI7B 4CRCA 4X1RU 1CA8B 1UTNA 4I8GA 2BB4A 1HV7A 3LC5A 1FPHH 8KME2 3RC5A 2KAIA 1C5TA 5T6FA 4UE7H 1V2TT 3GY5A 1O2PA 1NRQH 5E0GA 4DGJA 1SOTA 3LGIA 1RIWB 1SGIB 2ZPQA 4DT7B 3URDA 1O0DH 2V6NA 3M3TA 3E91A 3RXKA 2R3YA 4X8UH 1Y5AT 5TJXA 4A6LA 1KY9A 3UR9A 2Z3EA 4AFSA 4Y7BA 1ZPZA 3RC4A 1BTXA 1CT2E 1DM4B 1CVWH 2Y80A 3LT3A 2AGIX 1FIZA 1TBZH 1CU1A 2D2DA 1F0TA 1PPZA 4WMEA 3NKKA 3RXOA 2P59A 2FOEA 3TH2H 1L2EA 1S81A 2G81E 3GCTF 3MNXA 1G36A 1DY9A 1AMHA 1CHOF 5FPTA 1V2LT 2BDIA 3B8JA 2SGPE 2GCTC 2GCHG 3E0PB 3ZZ7A 2ZTXA 3KN2A 1JWTA 1KDQB 3A7ZA 1CT4E 1AI8H 5DO4H 4UFGH 4FUDA 1C5OH 3E16B 2XC4A 1ANCA 3B9FH 1GJ4H 1T4VH 3SU2A 1THRH 1YLDA 2OC0A 2XTTB 4GVUA 3MO9A 2PW8H 4FUEA 5L6NH 3M5NA 3KCGH 1W3CA 4BNRA 1B0EA 4BAQB 3ELAH 1UTLM 3ZZ4A 4BANB 5FX5A 1T7CA 4INLA 1T8MA 2H9EH 1NRNH 3HATH 2B7DH 2QXJA 1VGCB 3SORA 1AQ7A 1MTWA 1GBAA 1GGDB 1Z7KA 2B9LA 4JYTA 1VR1H 1JIMA 1OXGA 3F9HA 2ODYB 1CA0C 3R0FA 3SI4H 4K5ZA 2XCFA 2A7HA 2VIPA 2ZQ1A 1A61H 1IQEA 2FOMB 1IQHA 2F9PA 5I46H 2BDHA 1G9IE 2PSXA 4CHAC 3EE0B 2HPPH 1W14U 1O3EA 1TX7A 3U8OH 2PKSC 1P57B 3Q76A 2STBE 2BQ7B 2WPMS 4B1TA 3LC3A 1Y3XA 5ABWA 1TIOA 2R0KA 1MTNC 2QXGA 7KMEH 3ZVFA 3FP6E 2BOKA 1GMHG 5F8XA 2JKHA 2GP9B 4AX9H 1HAOH 3SN8A 2C93B 1TOMH 2PR3A 3RXFA 3P17H 4B73A 4NFFA 3RM0H 1V2NT 2PKAA 2ZF0H 4ISHH 1P2MA 2BDYA 1RIWC 3LOXA 3RXUA 1TMBH 1BTWA 1GBJA 3UWIA 1QA0A 3PV4A 2J92A 3A89A 3BTWE 3MH6A 2LNCA 3MTYA 4X2YA 3FP8E 2A4OA 2OUAA 4OS2A 2BX4A 2BX3A 5L2YH 3RLYH 3RM2H 2A1DB 4ZHLU 1DSTA 3A7VA 3Q00A 2Q1JA 2FEQH 2J9NA 4AGKA 4J2YB 1QL7A 1MQ5A 1GVKB 1EP6A 1LHEH 3PTNA 3RXEA 1P2KA 2UUFB 1KLIH 4Z0KA 1THSH 3UNSA 4BOHA 3I77A 3M7TA 1GBIA 2BD3A 2DE9A 1TNJA 1AB9B 3A83A 2ZNKH 1NT1A 2BLOA 1NS3A 2D26C 2OLGA 4OS5A 1GMCF 3M7UA 2A5AA 2HOBA 5E0HA 1ID5H 1F7ZA 5A8YA 1TPAE 1P8VC 1J16A 4MNYA 4FUCA 3B23B 1L0ZA 1O2HA 2P95A 1QA7A 1E36B 2PV9B 3RXTA 3U8RH 7ESTE 4Q7YA 2AMDA 1MKWH 3ATLA 2ZU5A 1Y3VA 1MMJN 1LKAA 1C1MA 5EU8A 5EPNA 4FUHA 2CXVA 2GMTB 4K8YA 4DCDA 1EOJA 1BA8B 3VFEA 2QXIA 1PQ5A 5HM2A 3W95A 3TJUA 1O2QA 3MNSA 2TGPZ 3URCA 2AIPA 4CRFA 1EAXA 3TNSA 1WTGH 3UNRA 2O8LA 3GY3A 3GDSA 1O2UA 4O3TA 1C1NA 1EATA 1XUKA 2Z3CA 1RTLA 3GCOA 5E0JA 1NTPA 2EI6A 1C4V2 3TITA 1F0RA 2GGVB 4XBBA 1QL8A 2OBOA 1O5CB 4I8LA 5AF9H 1GHWH 1TX8A 1ANBA 1QRXA 1SGRE 2VWMA 3PMAB 3TPIZ 3UFAA 1V2KT 1V2PT 2I6SA 1GDQA 1K1JA 3I78A 4YOIA 1OX1A 1O3NA 2WPJS 4A92A 4X8TH 4NIWA 4B2AA 3TK6A 1UVTH 4TY7A 1OPHB 1LTOA 1VCPA 2FIRH 1TRYA 1G30B 3O8RA 3SGBE 2VVUA 1ELVA 5BRRE 2SFAA 3BV9B 4DIHH 2HRVA 5K7RA 2A2QH 2JETB 1GI8B 2O8UA 2ZP0H 2SGDE 3BTFE 3F1SB 1Z6JH 2VH6A 1DT2A 1Z8RA 4OS6A 1QQUA 5DP5A 5JBBS 4MPUA 3S9BA 4AYYB 4AN7A 1W12U 4TY6A 2NU0E 4QT8C 2CJIA 3D62A 1U6QA 2QAAA 1P01A 4I32A 1C1WH 2WYGA 1TGTA 4Y0ZE 3SNCA 5LGOA 2CHAB 6ESTA 1BQYA 4WF8A 1VITH 3QO6A 1SGFG 4XBCA 1S5SA 1MH0A 1YCPK 2SNVA 1OP0A 2BLVA 1N6YA 1RTFB 1JBUH 1TPOA 1B5GH 3QDZB 1MU6B 4RKOB 1SMFE 2QF3A 2DUCA 1O2MA 2BLWA 2A45B 5GCHG 1P02A 1QR3E 3MNBA 1P2IA 1VJAU 2WUCA 1YPHC 1QL9A 1ZHRA 1C1SA 3IWMA 1K9OE 1OWIA 2P3TB 4KTUA 4E06H 1C1UH 2FOHA 4YM9A 4F49A 1SLWB 4UEHH 1OWEA 1HAZB 2PGBB 4DW2U 5DP8A 1GMHF 4K1TA 3RXSA 1UMAH 3RU4D 3U69H 2Y82A 4YLQH 2ZU4A 4WMDA 3SUFA 4TWWA 3ZYEA 1ZHPA 2TBSA 2WYJA 1DXWA 1C2GA 1FPCH 2AMPA 3PB1E 1ELFA 2OINA 2FTMA 4O9VA 1O2IA 3PROA 1A46H 3QK1A 3T27A 1TGNA 1PPHE 1S0RA 4X0WU 2BY8X 1BJVA 3T28A 1PQ8A 3MNCA 3E8LA 1P12E 3GDVA 1XKAC 1WBGB 4GHQA 1EZUC 1ZMLA 1C2DA 1V2JT 3BEUA 4I8JA 2TRMA 1QURH 3UIRA 1AIXH 1CHGA 4ABGA 2A4QA 2QCYA 4FUBA 4LZ4B 3RC6A 1YPMH 3TH4H 1WOFA 3TH3H 5EPYA 1P04A 5EQRA 3MMGA 1BOQA 4UONA 1P2JA 3IITA 2ZGJA 1W11U 1V2QT 1K1IA 1EJNA 3D65E 1MD8A 4OGXA 4HI3A 1GHZA 1GI9B 1RGQA 6GCHF 2JH5D 3L6PA 2Y5FA 1F0UA 1MZAA 2TPIZ 5F6MA 3QTVH 1EOLA 1F5RA 2QN5T 1DICA 4GCHG 1O3PB 2OD3B 1XX9A 3UPEA 3A87A 3QZQA 4A1TA 1V2ST 1TPSA 4XOJA 1A0JA 1UK2A 4NA8A 3MFJA 2O9QA 4U30A 2A7CA 4AB8A 9LPRA 1EZXC 3G01A 1XVMA 2VINA 1P3CA 5A09A 1TAWA 2O8TA 1O3HA 2R9PA 3LGVA 1D3PB 2CHAC 3KQCA 1BTHH 2F91A 1Q2WA 5FHTA 1O3KA 2YOLA 3MO3A 4WVPE 1B7XB 1DOJA 3CENA 1GPZA 2ZKSA 5LPRA 1UCYK 6CHAB 1K2I1 1LMWB 4X8SH 1V2MT 1FUJA 1EPTA 1NFUA 1Z1JA 4Y79A 3VB3A 3LU9B 1HIAA 1NFYA 4RN6A 1SFQB 3SV6A 1VITG 2SGQE 1WUNH 1O2KA 1S0QA 1T8NA 1P9UA 1BDAA 3SQHE 1OWHA 1LQDB 4FUJA 5CHAB 1QB6A 1CSOE 1MU8B 2NU3E 2PGQB 2Q6FA 3ZVBA 4NSVA 1D6WA 1JMOH 1D3QB 1Q31A 1PYTD 1UVUH 2ULLA 4SGBE 1O5AB 2CGAA 1HAPH 2Y6TA 2G55A 4OS7A 1O2WA 1HJAC 1SQAA 1ZMJA 1HAVB 5JPMH 4KKDA 2HLCA 1CGIE 3K9XB 4NWKA 2D8WA 3RXPA 2R2WU 1KXBA 2ZDVH 5LPEA 7GCHG 2CF8H 3T62A 4JK6A 2BD2A 2Z9LA 1UHBA 2O8WA 3KQBA 1H9LB 4X1QU 1KXDA 3ZZDA 3SJOA 5GCHF 2ZDLA 4D9RA 1O3CA 1DUEA 2GZ7A 3A80A 1CQQA 2AYWA 1V6DA 3CS0A 4CRGA 5A8ZA 1TALA 4KTSA 2SGAA 5F03A 1O3JA 4MDSA 4AORA 3R3GB 2EC9H 4ABAA 5C5NA 2QF0A 1L1GA 4TPYA 2J38A 4HTCH 1EB1H 1O2VA 1P2NA 2ZQ2A 4X2VA 1W2KH 1YC0A 4AGJA 1JIRA 1LVBA 3JZ2B 3M35A 1E38B 1LPZB 4ISIH 3KIDU 3S7HB 5A8XA 1QRZA 1T8LA 3M3VA 1Y3YA 1EAIA 1LVYA 5EQQA 1JRSA 4WH8A 1BRUP 3SZNA 1A5HA 5C67A 1OP2A 3A7TA 2BDAA 1D6RA 5GIBA 2ESTE 1KTTB 3MWIU 1O39A 3ATMA 4LK4A 1AY6H 4Y8YA 1UVPA 3SU6A 1LO6A 1RS0A 5E2OA 3V12A 1KXCA 5GXPA 5PTPA 2GX4A 3FAOA 3TGJE 3LPRA 1MKXH 3DT0H 1AU8A 3F9FA 4Y71A 2VB0A 3RUOA 4NFEA 1UO6A 2Y7ZA 3F9EA 3LH1A 1AVXA 2AIQA 2R2MB 1IQKA 3BF6H 4CRDA 3SBKA 1ZTKA 3MOCA 1C2KA 6CHAC 1QB1A 1X7AC 2UUJB 1O31A 1FZZA 2SGEE 2BZAA 5JB8S 3BTME 4JZDH 1GI3A 2Y5HA 3Q3XA 1C5QA 3HGNA 3PMJA 5C2ZA 1AKSB 3PTBA 2AGGX 4K3JA 3ZZ5A 4GCHF 3BTDE 4ZKNU 4ABIA 1DE7H 2G4TA 2JH0D 4GPGA 2BY7X 1O32A 2NWNA 2BM2A 2STAE 1YGCH 2F9UA 1A5GH 2W7UA 3SU0A 4GSOA 1TBQH 1ZOMA 4MVNA 1HBTH 1UTQA 1J14A 2GKVE 3SU5A 1DANH 2GT8A 1A0LA 2XC0A 5DK1A 2W7SA 5DP7A 4DG4A 4ZROA 3GCNA 3LGTA 3BN9A 4R8TB 2A32A 1O2NA 4YOJA 3E6PH 1BRAA 5C20A 1D9IA 1UTKA 4RKJB 2G5VA 2VWLA 3O8DA 3P8OA 3VXEH 1GBDA 2BD8A 2EI8A 4TWYA 4GHTA 4XSKU 4H6TA 2K1QA 4X1SU 1WV7H 1ZPBA 3SU3A 2QY0B 1THPB 1Y5BT 4U32A 5A0BA 4MTBA 1O2TA 3A7WA 1LHFH 1GJDB 3D23A 3ITIA 1EXFA 5F8TA 1QGFA 3ZZ8A 1AE5A 4ABHA 4CH2B 1Z8JB 1TGBA 1J17T 1YPLH 1GBKA 1W7XH 1C5PA 4ZHMU 1TOCB 5A0AE 1SQOA 1W0YH 2H5DA 1NU9A 3GY8A 3SJ8A 2GD4B 1C2LA 3UUZA 1HJ8A 3GOVB 1GJBB 4ABBA 1K22H 1CGHA 5I25A 5BPEA 2PWXA 4U2WA 1HGTH 2QYIA 2FESH 1ELEE 3RXVA 2PTNA 2HPQH 2A7JA 2FOFA 3A81A 2HVXA 1C1TA 4XFQA 2OC1A 2ZCLP 5FPSA 1IQIA 4BXWA 3FZZA 2A4RA 3FANA 1WCZA 2Q6GA 1C5MD 1S6HA 3A8DA 2XYAA 4I33A 4I8HA 1KXEA 1YM0A 4WY3A 2XBXA 2R3UA 1VZQH 1HAIH 2GT7A 5EXMA 1TYNA 2IN2A 1IHTH 3BIVH 1QJ7B 4HZHA 3RXIA 4B75A 1BMNH 1ELCA 1A4WH 3TJNA 4BAOB 1SGFA 1A1RA 3SJ9A 4JK5A 1UK4A 2D1JA 1GBTA 3EYDA 4IC5A 3EGKH 2TIOA 3SV2H 1T32A 1K1NA 1O2ZA 1SB1H 4LXBH 2VU8E 1P2QA 1XUGA 5CE1A 1FNIA 1F92A 1J15A 1HNEE 2BDCA 1UK3A 4AYVB 2BLQA 3UNQA 2AH4X 3NXPA 4MNWA 4IGDA 2WPLS 1QQ4A 1YCPM 1C1PA 1MD7A 2ZPRA 3RXAA 2ZFTA 1EUFA 4ZKSU 4CH8B 1C5NH 1C1VH 2XWAA 2ZFSA 1NN6A 2BVXH 1SR5C 2C8WB 4K8BA 3RXCA 4CR5A 3ZV9A 3ZZCA 2GV7A 2ANMH 1LCYA 1TONA 1M9UA 8GCHF 1O3AA 4I7YH 4X8VH 1GJ9B 2G5NA 1P3EA 2BYAX 1A0HB 3GY7A 5ESBA 1QCPA 1EP5A 1KXFA 1Y5UT 3ATWA 2OCVB 1IQFA 1K1PA 1Y8TA 1QTFA 3S69A 3ATIA 3M37A 3P6ZB 1MKWK 2GDDA 1ZJDA 2HNTC 5JBCS 1K1LA 2SGFE 1EQ9A 3A85A 4AB9A 5IDKA 1O3LA 1GHAG 1SI5H 4I8KA 3SHCH 3U8TH 2P8OB 3IG6B 3SV9A 3E0NB 1ARCA 1YKTA 1WYKA 5ETXA 4BAMB 1C2IA 2FX4A 3ESTA 3RXMA 1SGPE 3RXGA 5LPFA 1O2OA 3LJJA 3BTTE 1SGCA 4UFDH 1TQ7B
chains in the Genus database with same CATH superfamily
3STJA 1XKBC 3EE7A 2PHBA 3BIUH 1VGCC 2JJ1D 3EDXB 2EA3A 3N7OA 1H8ED 4OM9A 2BD7A 2FDAA 4NA7A 3RP2A 1GGDC 4DVAU 4OS1A 2ALVA 1QIXB 2ALPA 1C9PA 3NZIA 2FI4E 3MYWA 4Z6AH 1YLCA 1XMNB 2BDBA 1KYNA 4THNH 1TE0A 3FVFB 1GJ8B 1O3MA 3PYHA 4DURA 1PJPA 1S6LA 2P93A 3VB6A 3QN7A 4KTCA 1WAYB 1E79D 3ZZ3A 2XBWA 2AS9A 3RDZA 2GCHF 1WQVH 2ZU2A 4JYUH 1HXEH 1VCQA 2WINI 4HGCA 4NZQA 2H5CA 4CRAA 2JH6D 2Z6BD 3F3BA 1N8OB 2VGCB 1C4U2 1LHDH 2WV9A 3TK5A 1ZZZA 3VPKA 4HG6A 1H1BA 4ABJA 1GJ6A 1K21H 1KLTA 4WJG2 1MUEB 4ZKRU 2WPHS 1BBRK 1GJAB 1TQ0B 3SUDA 3EQ0H 4BXSA 1J9CH 2JIZD 3LGYA 5C5OA 4YESB 2VWOA 1A3BH 5EQSA 1FN6A 3SHAH 2V3HH 4BTTB 2ZHFH 5CMXH 2PP6A 1BBRH 4INKA 1QFKH 5G4BA 1P09A 1NU7B 2KAIB 2BY5X 3OY5U 3UQOA 3SV7A 1FAXA 2J2UA 1ZRKA 1AB9C 1HXFH 3M5LA 1QZ8A 2EQNA 1V2WT 2FPZA 2FLBH 3ZVCA 1AD8H 1O36A 1G3BA 1HDTH 1TBRH 3RMMH 1GDNA 1SFIA 1T31A 2C8YB 2FS9A 4XDEA 4ISNA 5EW1H 1IHSH 2ODPA 4H4FA 2J95A 2Z9KA 1NPMA 5HGGA 3UQVA 1GMDG 3OU0A 1O2GH 3SNAA 2F9NA 2P8OC 5JDUB 1WSSH 4FU9A 5T6GA 3MO6A 1ZLRA 5FAHA 4B2CA 4Q80A 3SO3A 1C1QA 1WXRA 3T29A 2GMTC 1VCWA 1AVGH 1FV9A 3NCLA 4A5TS 1C5ZB 1MBMA 2FWWA 1FAKH 4IW4E 1DFPA 3RXDA 3RXHA 3GY6A 1BHXF 1AE8H 2BZ6H 2P3UB 5FCRA 3U9AH 1O2XA 3MI4A 4IN2A 3KHVA 1KDQA 3SUEA 3SYJA 1FX0B 4YO9A 3BTQE 3DFLA 3RMNH 2F43B 1H8DH 4J1YA 9ESTA 1ABJH 5K0HA 2AFQB 3PWCA 4VGCB 2XC5A 1C9TA 1TNGA 2PSYA 3HGPA 3TK9A 2XNIA 1P0SH 1FQ3A 2Z7FE 1V2OT 4WXVA 3BTKE 4CBNA 3V3MA 1G37A 3HK6B 2BHGA 3NRLA 1WQSA 3GYLB 1Y3UA 1C5YB 3HPTB 3UY9A 1Q3XA 5JBTA 4WMFA 1NFWA 1BJUA 4X6OA 4X6MA 1IOEA 4MPXA 2H1UA 3P8FA 3LGWA 1GHBG 1GVLA 3PWBA 3EA9A 1XXFA 1AO5A 1GHAF 1SC8U 2ZU3A 1ESTA 1W0ZU 1GJ7B 3GCHB 1DY8A 1A2CH 1TPPA 2OP9A 3WY8A 1DWEH 2VGCC 3M5OA 2J98A 4PROA 1TNLA 1XVOA 2JETC 3TGKE 3SJIA 1ZSJA 4FU7A 1P05A 1ELDE 2ANYA 2FI5E 1SGTA 1ZGVA 5C1UA 1V3XA 2GDEH 4YTAA 1ELBA 1ETSH 3MHWU 2CMYA 1GCTB 1PPEE 2RG3A 5EODA 4HFPB 1GBCA 2V35A 4TSFD 2FXRA 4AG1A 2ZU1A 3RU4E 3F9GA 1O5FH 1UTJA 1GBMA 3BSQA 4O3UA 2F3CE 3SOSA 3RXJA 5B6LA 4NWLA 3ODDA 1CT0E 2ZHQH 3GY4A 2PKAB 1F2SE 1ZRBA 2PFEA 1O3FA 1HUTH 4MNXA 4ZAEA 4KELA 1OYQA 3FFGA 3K65B 3Q3KA 2CV3A 1TA2A 2ODQA 4IN1A 2DE8A 3GCTG 3T26A 1AFEH 8ESTE 2FM2A 3H7OA 2QGRA 2QF4A 1LPGB 1W7GH 1H8IH 1QJ6B 1RFNA 4NGAH 1GBBA 1PQAA 3STIA 3FZDA 3Q77A 2H9HA 2PTCE 3DA9B 4RT0A 2W6ID 1P11E 8LPRA 1OS8A 3PRBA 2VNTA 3ZZBA 3A8AA 4O97A 2A5KA 2H6MA 3NUMA 3RXLA 5C0UA 4AOQA 2A31A 1EB2A 1PPBH 5DPAA 1SGYE 5DP3A 3C1KA 3DCLA 4BAKB 4X1PU 1SL3A 1G3CA 3O8CA 3P95A 3KGPA 2BQ6B 3C27B 3CNRA 2F9BH 3KF2A 2KCAA 1D3DB 1SGNE 2FO9A 2FYRA 1ESBA 4Y7AA 2ZIQH 1YPJH 1LPKB 1N6XA 1S82A 4NG9H 1MCVA 1C5WB 1CBWB 1E34B 5GPIB 1QB9A 1Y3WA 1HAXB 1UTOA 2OBQA 3OYPA 5TCCA 5B6OA 2FYQA 2BTCE 1YBWA 1HRTH 1LDTT 1ZGIA 4UD9H 4IMZA 4JCNA 2W3KA 4K2YA 4Q7ZA 1F0SA 3U98H 2PLXA 3O8BA 3BTEE 1BZXE 3ZZ6A 2FOCA 4JZIA 2ZTYA 1IQGA 2B0FA 4AFZA 3ZIAD 3QX5H 2ZDMA 1F5KU 2ZFPH 1O38A 2ZHWH 2FMJA 2Z9JA 4B74A 1RRKA 3CS7A 1C2JA 4ZXXH 2WPKS 5T6DA 1SSXA 3MU1A 1ETTH 2G4UA 3GCHC 2ZGHA 1NC6A 4CREA 3VB5A 1BMFD 1BTPA 4NIXA 3AW1A 4MPWA 4ABDA 1O30A 5EXLA 1UCYE 4WWYA 3ZVGA 1H4WA 1HCGA 2A4GA 1IQJA 1A3EH 1MKXK 5FL7D 1TRMA 3SI3H 1C5XB 1HFDA 3SNBA 2RA3A 4B2BA 2G51A 1C5VA 2EEKA 1GCTC 2KCOA 5JYIA 3F2GA 1ZYOA 1JOUB 1NRPH 4NZLA 1NY22 4ZHAA 1YPHE 2ZWLH 3A84A 4RI0A 2VIWA 1BMAA 4XE4A 1AZZA 1E0FD 2AGEX 2ZI2H 2ZHEH 5IK2D 5L2ZH 1O3GA 4A1XA 1V2RT 2Z3DA 2OTVA 1XUFA 1PPCE 1C5LH 1C1OA 4YT7H 1AN1E 1GDUA 2BMGB 1GJCB 2CF9H 2PKSB 1C2EA 1GI2A 1O2YA 1QBNA 3KEEA 1GMCG 4M9FA 1ZSLA 1TA6A 4FUFA 1KIGH 5HMAA 5SGAE 1KXAA 5ESTE 1E35B 1ELGA 1GHBF 1TX6A 2ZFQH 4UFFH 2OC8A 1ACBE 4NA9H 2TGAA 2W3IA 4P00A 1SPJA 1C5RA 4XRNA 3GYMA 3SV8A 5A2MH 3P92A 5JB9S 1BTZA 2JJ2D 5CHAC 2J4IA 4AG2A 1QJ1B 1O3BA 3QZRA 1SLXB 3MU8A 2KFWA 1FONA 2AMQA 3MH7A 2BD4A 5TCAA 1NM6A 2C4FH 1H9HE 5FCKA 2ZFRH 1DXPA 2A0QB 2Y81A 3L3TA 2LPRA 3EAJA 4D76A 4D9QA 1AHTH 1IAUA 2RA0A 4D8NA 4ZUHA 3AW0A 3QGNB 4BAHB 2BQWB 4Y0YE 2YNAA 1HAHH 2ZFFH 4GUXA 3MU4A 1O5BB 3BTGE 4Y76A 5HM9A 4MQAA 1CBWC 2VVCA 1G3EA 5EJ1A 5HXFA 4A1VA 3PLKA 4B6EA 6LPRA 1GJ5H 1YF4A 2G52A 3PMHB 4X2XA 2KR7A 2C90B 2WPIS 1ZSKA 1FMGA 1O2SA 3A8CA 3SU4A 3MU5A 1P03A 3E90B 1VITF 4IBLH 5DP6A 4E7NA 1PPGE 4Y6DA 1O5GH 5J4QA 1GBFA 1XM1A 3P8GA 1DDJA 2ZHDA 1W10U 2Z9IA 1TGCA 3OTPA 3ZZ9A 1UTMA 2A2XH 1ORFA 1QY6A 2GJGA 3DHKH 3KQ5A 1NESE 1O3OA 4A7IB 1KSNA 3U1JB 1O35A 1E1RD 1TB6H 1DX5M 1K28D 1ANEA 3SU1A 3PLPA 1GHXH 1S6FA 2HALA 1FIWA 5FPYA 3V13A 5EW2H 1ABIH 1G3DA 2OC7A 1SG8B 2NU2E 4KP0A 4ZCNA 5C3NA 4MPVA 1DLEA 1OSSA 2WUBA 3AK5A 2BY9X 1QRWA 2ZTZA 2P94A 3BG8A 7GCHF 1O3DA 1YPGH 1BTUA 1TNKA 2VVVA 4E7RG 3LKWA 2PUQH 2BOHB 4YXWD 2GTBA 3ODFA 5GDSH 3S9AA 5AVDA 1GBEA 1LKBA 4WH6A 5E8EH 1P06A 1C1RA 1TFXA 1GBLA 2GV6A 4TYDA 1BIOA 1BUIA 1CO7E 4P02A 1OP8A 2HNTF 1BB0B 3PO1B 2CN0H 2ZCKP 4ESTE 1DWDH 1O34A 4FUIA 5EOKA 2OQUA 2ASUB 4X1NU 1BRCE 3M7QA 3S7KB 3RXQA 5FXLA 3K2UA 1FY4A 1JRTA 1DITH 1F5LA 4YT6H 2ZG0H 3KQEA 4JZFH 1ANDA 3M61U 3GS9A 1DUAA 2VBCA 3RMOH 2P3FH 1DWCH 1DVAH 2BD5A 1GI5A 1OWDA 4BTUB 1NBMD 4K69A 5EGMA 4JZEH 1NFXA 4IMQA 4Q7XA 3SNEA 1TWXB 4CBOA 1MQ6A 3UTUH 1FDPA 2V3OH 1BMMH 1C2FA 5GJ4B 4TPIZ 1EPTB 3DUXH 5HYOA 2HGTH 1UW7A 4NIYA 5E2PA 1BT7A 4F48B 2J94A 4FVDA 1HIAB 1ELTA 3ZVAA 1AWHB 1QNJA 3GISB 3S0NA 4NSYA 1IQLA 2NU1E 4H6SB 1P9SA 1RD3B 2FOBA 2OQ5A 3QLPH 2FX6A 4BTIB 3BG4B 4MNVA 3P70B 1YP9A 3BTHE 2BXTH 1C2HA 1HAVA 5DSFA 3E3TA 1SQTA 2XW9A 1ZHMA 1HJ9A 2Q6DA 1GL0E 6GCHG 4YOGA 3SUGA 1GL1A 2V0BA 3OFND 1G2LA 3QUMP 1YPKH 1ZMNA 4Q2KA 3CP7A 3ZZAA 2ILNA 2LP6A 4GAWA 4YLUA 3OY6U 3EA7A 5FBEA 1UHBB 1FI8A 3NPSA 2I6QA 1AGJA 1NO9H 2ZPSA 1ZR0A 3HK3B 1FXYA 1EX3A 2ZZUH 1EAUA 1Z8GA 4FU8A 4JZ1A 3SGQE 4OS4A 2ZECA 2QXHA 1FN8A 1A7SA 2YNBA 1GBHA 2VIQA 3H7TA 3F0OA 2ANWA 1HAGE 2FTLE 3V0XA 2FOGA 5C1YA 4M7GA 4IS5A 4I86A 1BMLA 5CDFE 1O2JA 3RU4T 1MTVA 2UUKB 1AFQB 1MTSA 1QBVH 3PM3A 4FVBA 2YMSD 3SNDA 2BVSH 2W26A 1OYTH 2GZ8A 1A5IA 3PLBA 4CRBA 1NBME 1XXDA 2EI7A 3OTJE 3GDUA 4X6PA 5H4IB 3VB4A 3VGCB 1E1QD 2L74A 2XBVA 1G2MA 1W8BH 2WSSD 4F4OC 3MH4A 1T8OA 1J8AA 3TVJB 3PO1C 3T2NA 1TMTH 2XXLA 1TNIA 3OAAD 4LOYH 4ZH8A 4XBDA 2H2ZA 2ZGXH 1G32B 4DOQA 1UVSH 3F6UH 4RSPA 1S84A 4I31A 3PV5A 1FLEE 1XUHA 1O2LA 1FY1A 1GI0A 3A82A 3HKIB 4X2WA 3OSYA 3S9CA 2K0QA 1BHXB 1LVMA 3KQDA 3TIUA 3A7YA 5DJ7A 2BVRH 2QC2A 1Z8IB 1TRNA 1AKSA 1O5DH 4GLYA 2M5TA 1SVPA 2GZ9A 1MAXA 3TU7H 1GI6A 1EPTC 3K6ZA 2FZZA 3P8NA 2LELA 4B71A 2AEIH 1NRSH 1OOKB 1SBWA 1EZSC 1ESAA 1RTKA 4R0IA 1DS2E 3TJOA 3LONA 1DSUA 1NROH 1SLVB 3SW2B 1TNHA 1D3TB 3UR6A 3U1IB 4UDWH 2GVFA 2ZDKA 2C8ZB 3VB7A 2TGTA 2ZC9H 2G8TA 1WDIA 3BG4C 2ZGBH 4D7GA 5DGJA 1O33A 2XBYA 2QE7D 1YCPH 4ISLA 3Q3YA 1BITA 1RJXB 1PYTC 1CE5A 2XRCA 1EJMA 1L4ZA 1GWAA 1GG6B 1O3IA 5C1XA 2BY6X 1AZ8A 2XCNA 3JZ1B 2TGDA 2IPHA 2UUYA 1SOZA 2FS8A 2VWNA 3RXBA 1O2RA 1V2VT 2IOTA 3QWCH 1GHVH 5EJZA 3HKJB 2P16A 4K1SA 1MCTA 1IQNA 3UREA 4Z1MD 5AFYH 1HJAB 2ZCHP 3UOUA 4CR9A 1OWJA 1ZPCA 4AFQA 1BBRE 1C5SA 4NIVA 1GI4A 2FODA 1EAWA 4Y8ZA 4Y10E 3H09A 1AUTC 5A0CA 1NRRH 1EASA 3ATKA 1W13U 1AFQC 3BEIB 1XUIA 1C4Y2 4SGAE 5DP4A 2ZGCA 1QHRB 3AAUA 5KECA 3OX7U 4D7FA 3RLWH 3KNXA 3FP7E 3VGCC 1C5UA 3A86A 2F83A 3MH5A 3AAVA 4Q4LA 1N8OC 1W0JD 5DG6A 1TGSZ 3BEFB 1EKBB 2O8MA 1GI1A 3T5FH 3QGJA 1AWFH 3RXRA 4JYVH 4ZKOU 2CK3D 1K1OA 2SNWA 3GY2A 1MAYA 3LDXH 1SGQE 4X6NA 2Z9GA 4IC6A 1IQMA 4ISOA 3LGUA 1L1NA 3A88A 1SHHB 4DY7B 3I29A 1UVOA 4ACBA 2HWLB 3OEED 2C8XB 1HYLA 1EZQA 1PQ7A 3MU0A 3T25A 4TT3D 1WU1A 3UWJH 5DP9A 1AVWA 2VIOA 3A7XA 2XWBI 1ETRH 3PMBB 5DKMA 1Z71A 3W94A 1O37A 5J4SA 1ZJKA 2C3SA 4B76A 2VIVA 1AUJA 2HNTE 3QTOH 1HB0B 4Y11E 4ABFA 1E37B 2B8OH 3M36A 1FY8E 2Y7XA 1BRBE 1MZDA 4FUGA 1GVZA 2J5UA 3VEQB 2ZDAH 1ELAA 1P10A 3V7TA 1CHOG 1HPGA 1N1LA 2G00A 2RDLA 2PUXB 5LH8A 1OKXA 2A5IA 4MG3A 3LJOA 3D49H 4H42U 5F8ZA 1KMHB 2AHME 2UWPA 4K1EA 2WZQA 1DWBH 3M5MA 4INHA 3TLOA 1B0FA 1SGEE 1PPFE 2UWLA 4MLFB 2W5EA 5L30H 1TMUH 4DT4A 1FJSA 1XUJA 1OWKA 2R0LA 3RMLH 3DD2H 3KL6A 4ZXYH 1BTYA 3AASA 1RXPA 1D4PB 1UCYH 4O03A 1Y59T 3AVZA 2ZO3H 3DSGA 2J34A 3LIWA 1GG6C 4LZ1H 3U28C 3LH3A 2WV5A 1MTUA 2F9OA 5FX6A 3TJVA 1INCA 4FXGH 4VGCC 2BDGA 2UWOA 3NK8A 5GWZA 2THFB 2QF5A 2Y5GA 3SGAE 1Z1IA 1HAYB 4DIIH 1QBOA 2IJOB 2ANKH 5AHGH 5EG4A 3TNTA 4ZMAH 1FY3A 5FBIA 2WV4A 5JBAS 2L6OA 1LHGH 2RCEA 4ABEA 2VIDA 1JXPA 1HLTH 2FI3E 3TGIE 3SJKA 4Y8XA 1VJ9U 2GCTB 1PFXC 3K6YA 3L33A 2QIQA 1C2MA 1DLKB 3DFJA 1LQEA 1P2OA 2B5TB 2F9VA 3ENSB 1TABE 1S85A 1GCDA 7LPRA 1DPOA 1SLUB 1GMDF 2ZDNA 1MBQA 1ZTJA 3E1XB 2IPQX 3VXFH 2FP7B 3ZVDA 1FY5A 1UTPA 3ZYDA 2VJ1A 2ZA5A 1EJAA 3ZVEA 2BXUH 5T3HA 2VH0A 1LHCH 3ZV8A 2BD9A 3H5CB 1YYY1 3M3SA 4U01A 1SGDE 1V2UT 1BCUH 3F68H 4E05H 3MQKC 2FOAA 4KGAA 1TLDA 1T4UH 2HVYB 2AERH 1KLJH 2OXSA 5IYTA 5EXNA 1YPEH 4ASHA 3A8BA 3GICB 1Z6EA 2FLRH 5KEDA 1WTHD 5AFZH 1L4DA 4WXIA 1L1JA 2QA9E 4AFUA 1ZTLA 1CA0B 1K1MA 2OK5A 4NCYA 2H9TH 5C0TA 1LVOA 4DJZB 1CGJE 1NZQH 1UJ1A 4YZUA 1KTSB 4CHAB 1GHYH 8GCHG 2XNDD 3EA8A 2Z94A 2YMSB 2NU4E 1S83A 4JMYA 4K60A 1SHYA 2V7QD 3NWUA 2QV1A 3SQEE 1ARBA 4UFEH 4AZ2B 1O5EH 1H9IE 5C17A 2ZEBA 3UOPA 2J97A 4OGYA 1MTNB 1GI7B 4CRCA 4X1RU 1CA8B 1UTNA 4I8GA 2BB4A 1HV7A 3LC5A 1FPHH 8KME2 3RC5A 2KAIA 1C5TA 5T6FA 4UE7H 1V2TT 3GY5A 1O2PA 1NRQH 5E0GA 4DGJA 1SOTA 3LGIA 5F53A 1RIWB 1SGIB 2ZPQA 4DT7B 3URDA 1O0DH 2V6NA 3M3TA 3E91A 3RXKA 2R3YA 4X8UH 1Y5AT 5TJXA 4A6LA 1KY9A 3UR9A 2Z3EA 4AFSA 4Y7BA 1EFRD 1ZPZA 3RC4A 1W0KD 5CHBA 1BTXA 1CT2E 1DM4B 1CVWH 2Y80A 3LT3A 2AGIX 1FIZA 3N7DA 1TBZH 2WHXA 1CU1A 3PRDA 2D2DA 1F0TA 1PPZA 4WMEA 3NKKA 3RXOA 2P59A 2FOEA 3TH2H 1L2EA 3KYFA 1S81A 2G81E 3GCTF 3MNXA 1G36A 1DY9A 1AMHA 1CHOF 5FPTA 1V2LT 2BDIA 3B8JA 2SGPE 2GCTC 2GCHG 3E0PB 3ZZ7A 2ZTXA 3KN2A 1JWTA 1KDQB 3A7ZA 1CT4E 1AI8H 5DO4H 3FKSD 4UFGH 4FUDA 1C5OH 3E16B 2XC4A 1ANCA 3F0PA 3B9FH 1GJ4H 1T4VH 3SU2A 1THRH 1YLDA 2OC0A 2XTTB 4GVUA 3MO9A 2PW8H 4FUEA 5L6NH 3M5NA 3KCGH 1W3CA 4BNRA 3WWFA 1B0EA 2RFKC 4BAQB 3ELAH 1UTLM 3ZZ4A 4BANB 5FX5A 1T7CA 4INLA 1T8MA 2H9EH 1NRNH 3HATH 2B7DH 2QXJA 1VGCB 3SORA 1AQ7A 2M2AA 1MTWA 1GBAA 1GGDB 1Z7KA 2B9LA 4JYTA 1VR1H 1JIMA 1OXGA 3F9HA 2ODYB 1CA0C 3R0FA 3SI4H 4K5ZA 2XCFA 2A7HA 2VIPA 2ZQ1A 1A61H 1IQEA 2FOMB 1IQHA 2F9PA 1YLNA 2J98B 5I46H 2BDHA 1G9IE 2PSXA 4CHAC 3EE0B 2HPPH 1W14U 1VKYA 1O3EA 1TX7A 3U8OH 2PKSC 1P57B 3Q76A 2STBE 2BQ7B 2WPMS 4B1TA 3LC3A 1Y3XA 5ABWA 1TIOA 2R0KA 1MTNC 2QXGA 7KMEH 3ZVFA 3FP6E 2BOKA 1GMHG 5F8XA 2JKHA 2GP9B 4AX9H 1HAOH 3SN8A 2C93B 1TOMH 2K8IA 2PR3A 3RXFA 3P17H 4B73A 4NFFA 3RM0H 1V2NT 2PKAA 2ZF0H 4ISHH 1P2MA 2BDYA 1RIWC 3LOXA 3RXUA 1TMBH 1BTWA 1GBJA 3UWIA 1QA0A 3PV4A 2J92A 3A89A 3BTWE 3MH6A 2LNCA 3MTYA 4X2YA 3FP8E 2A4OA 2OUAA 4OS2A 2BX4A 2BX3A 5L2YH 3RLYH 3RM2H 2A1DB 4ZHLU 1DSTA 3A7VA 3Q00A 2Q1JA 2FEQH 2J9NA 2V3MA 4AGKA 4J2YB 1QL7A 1MQ5A 5EIYA 1GVKB 1EP6A 1LHEH 3PTNA 3RXEA 1P2KA 2UUFB 1KLIH 4Z0KA 1THSH 3UNSA 4BOHA 3I77A 3M7TA 1GBIA 2BD3A 2DE9A 1TNJA 1AB9B 3A83A 2ZNKH 1NT1A 2BLOA 1NS3A 2D26C 2OLGA 2KCYA 4OS5A 1GMCF 2JDID 3M7UA 2A5AA 2HOBA 5E0HA 1ID5H 1F7ZA 5A8YA 1TPAE 1P8VC 1J16A 4MNYA 4FUCA 3B23B 1L0ZA 1O2HA 2P95A 1QA7A 1E36B 2PV9B 3RXTA 3U8RH 7ESTE 4Q7YA 2AMDA 1MKWH 3ATLA 2ZU5A 1Y3VA 1MMJN 1LKAA 1C1MA 5EU8A 5EPNA 4FUHA 2CXVA 2GMTB 4K8YA 4DCDA 1EOJA 1BA8B 3VFEA 2QXIA 1PQ5A 5HM2A 3W95A 3TJUA 1O2QA 3MNSA 2TGPZ 3URCA 2AIPA 4CRFA 1EAXA 3TNSA 1WTGH 3UNRA 2O8LA 3GY3A 3GDSA 3FN8A 1O2UA 4O3TA 1C1NA 1EATA 1XUKA 2Z3CA 1RTLA 3GCOA 5E0JA 1NTPA 2EI6A 1C4V2 3TITA 1F0RA 2GGVB 4XBBA 1QL8A 2OBOA 3WW7A 1O5CB 4I8LA 5AF9H 4F55A 1GHWH 1TX8A 1ANBA 1QRXA 1SGRE 2VWMA 3PMAB 3TPIZ 3UFAA 1V2KT 1V2PT 2I6SA 1GDQA 1K1JA 3I78A 4YOIA 1OX1A 2KCPA 1O3NA 2WPJS 4A92A 4X8TH 4NIWA 4B2AA 3TK6A 1UVTH 4TY7A 3W1EA 1OPHB 1LTOA 1VCPA 2FIRH 1TRYA 1G30B 3O8RA 3SGBE 2VVUA 1ELVA 5BRRE 2SFAA 2KM0A 3BV9B 4DIHH 2HRVA 5K7RA 2A2QH 2JETB 1GI8B 2O8UA 2ZP0H 2SGDE 3BTFE 3F1SB 1Z6JH 2VH6A 1DT2A 1Z8RA 4OS6A 1QQUA 5DP5A 5JBBS 4MPUA 3S9BA 4AYYB 4AN7A 1W12U 4TY6A 2NU0E 4QT8C 2CJIA 3D62A 1U6QA 2QAAA 1P01A 4I32A 1C1WH 2WYGA 1TGTA 4Y0ZE 3SNCA 5LGOA 2CHAB 6ESTA 1BQYA 4WF8A 2EY4C 1VITH 3QO6A 1SGFG 4XBCA 1S5SA 1MH0A 1YCPK 2SNVA 1OP0A 2BLVA 1N6YA 1RTFB 1JBUH 1TPOA 1B5GH 3QDZB 1MU6B 4RKOB 1SMFE 2QF3A 2DUCA 3UAIC 1O2MA 2BLWA 2A45B 5GCHG 1P02A 1QR3E 3F2FA 1P2IA 3MNBA 1VJAU 2WUCA 1YPHC 1QL9A 1ZHRA 1C1SA 3IWMA 1K9OE 1OWIA 2P3TB 4KTUA 4E06H 1C1UH 2F4LA 2FOHA 4F49A 4YM9A 1SLWB 4UEHH 1OWEA 1HAZB 2PGBB 4DW2U 5DP8A 1GMHF 5HKKD 4K1TA 3RXSA 1UMAH 3RU4D 3U69H 2Y82A 3FO8D 4YLQH 2ZU4A 4WMDA 3SUFA 4TWWA 3ZYEA 1ZHPA 2TBSA 2WYJA 1DXWA 1C2GA 1FPCH 2AMPA 3PB1E 1ELFA 2OINA 2FTMA 4O9VA 1O2IA 3PROA 1A46H 3QK1A 3T27A 1TGNA 1PPHE 1S0RA 4X0WU 2BY8X 1BJVA 3T28A 1PQ8A 2IJD1 3MNCA 3E8LA 1P12E 3GDVA 1COWD 1XKAC 1WBGB 4GHQA 1EZUC 3DSPA 1ZMLA 1C2DA 1V2JT 3BEUA 4I8JA 2TRMA 1QURH 3UIRA 1AIXH 1CHGA 4ABGA 2A4QA 2QCYA 4FUBA 4LZ4B 3RC6A 1YPMH 3TH4H 1WOFA 3TH3H 5EPYA 1P04A 5EQRA 3MMGA 1BOQA 1K0HA 4UONA 1P2JA 3IITA 2ZGJA 1W11U 5C94A 5DN6D 3OEHD 1V2QT 1K1IA 1EJNA 3D65E 1MD8A 4OGXA 4HI3A 1GHZA 1GI9B 1RGQA 1OHHD 6GCHF 2JH5D 3L6PA 2Y5FA 1F0UA 1MZAA 4ACAA 2TPIZ 5F6MA 3QTVH 1EOLA 1F5RA 2QN5T 1DICA 4GCHG 1O3PB 2OD3B 2W6JD 1XX9A 3UPEA 3A87A 3QZQA 4A1TA 1V2ST 4Q63A 1TPSA 4XOJA 1A0JA 1UK2A 4NA8A 3MFJA 2O9QA 4U30A 2A7CA 4AB8A 9LPRA 1EZXC 3G01A 1XVMA 2VINA 1P3CA 5A09A 1TAWA 2O8TA 2XOKD 1O3HA 2R9PA 3LGVA 1D3PB 2CHAC 3KQCA 1BTHH 2F91A 1Q2WA 5FHTA 5T1VA 1O3KA 2YOLA 3MO3A 2WPDD 4WVPE 1B7XB 2HLDD 1DOJA 3CENA 1GPZA 1YWUA 2ZKSA 5LPRA 1UCYK 6CHAB 1K2I1 1LMWB 4X8SH 1V2MT 1FUJA 4XD7D 1EPTA 1NFUA 3PV2A 1Z1JA 4Y79A 3VB3A 3LU9B 1HIAA 1NFYA 4RN6A 1SFQB 3SV6A 1VITG 3N99A 2SGQE 1WUNH 1O2KA 1S0QA 1T8NA 1P9UA 1BDAA 3SQHE 1OWHA 1LQDB 3WWBA 4FUJA 5CHAB 1QB6A 1CSOE 1MU8B 2NU3E 2PGQB 2Q6FA 3ZVBA 4NSVA 3N7EA 1D6WA 1JMOH 1D3QB 1Q31A 1PYTD 1UVUH 2ULLA 4SGBE 1O5AB 2CGAA 1HAPH 2Y6TA 5HIZA 2G55A 4OS7A 1O2WA 1HJAC 1SQAA 1ZMJA 1HAVB 5JPMH 4KKDA 2HLCA 1CGIE 3K9XB 4NWKA 2D8WA 3RXPA 2R2WU 1KXBA 2ZDVH 5LPEA 7GCHG 2CF8H 1MABB 4JK6A 2BD2A 3T62A 2Z9LA 1UHBA 2O8WA 3KQBA 1H9LB 4X1QU 1KXDA 3ZZDA 3SJOA 5GCHF 2ZDLA 4D9RA 1O3CA 1DUEA 2GZ7A 3A80A 1CQQA 2AYWA 1V6DA 3CS0A 4CRGA 5A8ZA 1TALA 4KTSA 2SGAA 5F03A 1O3JA 4MDSA 4AORA 3R3GB 2EC9H 4ABAA 5C5NA 2QF0A 1L1GA 4TPYA 2J38A 4HTCH 1EB1H 4B6FA 1O2VA 1P2NA 2ZQ2A 4X2VA 1W2KH 1YC0A 4AGJA 1JIRA 1LVBA 3JZ2B 3M35A 5HIYA 1E38B 1LPZB 4ISIH 3KIDU 3S7HB 5A8XA 1QRZA 1T8LA 3M3VA 1Y3YA 1EAIA 1LVYA 5EQQA 1JRSA 4WH8A 1BRUP 3SZNA 1A5HA 5C67A 1OP2A 3A7TA 2BDAA 1D6RA 5GIBA 2ESTE 1KTTB 3MWIU 1O39A 3ATMA 4LK4A 1AY6H 4Y8YA 1UVPA 2KX4A 3SU6A 1LO6A 1RS0A 5E2OA 3V12A 1KXCA 5GXPA 5PTPA 2GX4A 3FAOA 3FOAA 3TGJE 3LPRA 1MKXH 3DT0H 1AU8A 3F9FA 4Y71A 2VB0A 3RUOA 4NFEA 1UO6A 2Y7ZA 3F9EA 3LH1A 1AVXA 2AIQA 3UB0A 2R2MB 1IQKA 3BF6H 1YY3A 4CRDA 3SBKA 1ZTKA 3MOCA 1C2KA 6CHAC 5KGOA 1QB1A 1X7AC 2UUJB 1O31A 1FZZA 2SGEE 2BZAA 5JB8S 3BTME 4JZDH 1GI3A 2Y5HA 3Q3XA 1C5QA 3HGNA 3PMJA 5C2ZA 1AKSB 4FETA 3PTBA 2AGGX 4K3JA 3ZZ5A 4GCHF 3BTDE 4ZKNU 4ABIA 1DE7H 2G4TA 2JH0D 4GPGA 2BY7X 1O32A 2NWNA 2BM2A 3F2HA 2STAE 1YGCH 2F9UA 1A5GH 2W7UA 3OE7D 3SU0A 4GSOA 1TBQH 1ZOMA 4MVNA 1HBTH 1UTQA 4FOUC 1J14A 2GKVE 3SU5A 1DANH 2GT8A 1A0LA 2XC0A 5DK1A 2W7SA 5DP7A 4DG4A 4ZROA 3GCNA 3LGTA 3BN9A 4R8TB 2A32A 1O2NA 4YOJA 3E6PH 1BRAA 5C20A 1D9IA 1UTKA 4RKJB 2G5VA 2VWLA 3O8DA 3P8OA 3VXEH 1GBDA 2BD8A 2EI8A 4TWYA 4GHTA 4XSKU 4H6TA 2K1QA 4X1SU 1WV7H 1ZPBA 3SU3A 2QY0B 1THPB 1Y5BT 4U32A 5A0BA 4MTBA 1O2TA 3A7WA 1LHFH 1H8HD 1GJDB 3D23A 3ITIA 1EXFA 5F8TA 1QGFA 3ZZ8A 1AE5A 4ABHA 4CH2B 1Z8JB 1TGBA 1J17T 1YPLH 1GBKA 1W7XH 1C5PA 5GNDA 1TOCB 4ZHMU 4ASUD 5A0AE 1SQOA 1W0YH 2H5DA 1NU9A 3GY8A 3SJ8A 2GD4B 1C2LA 3KYGA 3UUZA 1HJ8A 3GOVB 1GJBB 4ABBA 1K22H 1CGHA 5I25A 5BPEA 2PWXA 4U2WA 1HGTH 2QYIA 2FESH 1ELEE 3RXVA 3DSOA 2PTNA 2HPQH 2A7JA 2FOFA 3A81A 2HVXA 5EJLA 1C1TA 4XFQA 2OC1A 2YMSC 4RT1A 2ZCLP 5FPSA 1IQIA 4BXWA 3FZZA 2A4RA 1SKYE 3FANA 1WCZA 2Q6GA 1C5MD 1S6HA 3A8DA 2XYAA 4I33A 4I8HA 1KXEA 1YM0A 4WY3A 2XBXA 2R3UA 1VZQH 1HAIH 2GT7A 5EXMA 1TYNA 2IN2A 1IHTH 3BIVH 2RDEA 1QJ7B 4HZHA 3RXIA 4B75A 1BMNH 1ELCA 1A4WH 3TJNA 4BAOB 1SGFA 1A1RA 3SJ9A 4JK5A 1UK4A 2D1JA 1GBTA 3EYDA 4IC5A 3EGKH 2TIOA 3SV2H 1T32A 1K1NA 1O2ZA 1SB1H 4LXBH 2VU8E 1P2QA 1XUGA 5CE1A 1FNIA 1F92A 1J15A 1HNEE 2BDCA 1UK3A 4AYVB 2BLQA 3UNQA 3SZEA 2AH4X 3NXPA 4MNWA 4IGDA 2WPLS 1QQ4A 1YCPM 1C1PA 1MD7A 2ZPRA 3RXAA 2ZFTA 1EUFA 4ZKSU 4CH8B 1C5NH 1C1VH 2XWAA 2ZFSA 1NN6A 2BVXH 1SR5C 2C8WB 4K8BA 3RXCA 4CR5A 3ZV9A 3ZZCA 2GV7A 2ANMH 1LCYA 1TONA 1M9UA 8GCHF 1O3AA 4I7YH 4X8VH 1GJ9B 2G5NA 1P3EA 2BYAX 1A0HB 3GY7A 5ESBA 1QCPA 1EP5A 1KXFA 1Y5UT 3ATWA 2OCVB 1IQFA 1K1PA 1Y8TA 1QTFA 3VG8A 3S69A 3ATIA 3M37A 3P6ZB 1MKWK 2GDDA 1ZJDA 2HNTC 5JBCS 1K1LA 2SGFE 1EQ9A 3A85A 4AB9A 5IDKA 1O3LA 1GHAG 1SI5H 4I8KA 3SHCH 3U8TH 2P8OB 3IG6B 3SV9A 3E0NB 2KZ4A 1ARCA 1YKTA 1WYKA 5ETXA 4BAMB 1C2IA 2FX4A 3ESTA 3RXMA 1SGPE 3RXGA 5LPFA 1O2OA 3LJJA 4AC9A 1SQRA 3BTTE 1SGCA 4UFDH 1TQ7B
chains in the Genus database with same CATH topology
3STJA 1XKBC 2PHBA 3BIUH 1VGCC 3N7OA 3EDXB 2EA3A 2BD7A 2FDAA 4NA7A 3RP2A 1GGDC 4DVAU 4OS1A 2ALVA 1QIXB 2ALPA 1C9PA 3NZIA 2FI4E 3MYWA 4Z6AH 1YLCA 1XMNB 2BDBA 1KYNA 4THNH 1TE0A 3FVFB 1GJ8B 1O3MA 3PYHA 4DURA 1PJPA 2P93A 3VB6A 3QN7A 4KTCA 1WAYB 3ZZ3A 2XBWA 2AS9A 3RDZA 2GCHF 1WQVH 2ZU2A 4JYUH 1HXEH 1VCQA 2WINI 4HGCA 4NZQA 2H5CA 4CRAA 2JH6D 2Z6BD 1N8OB 2VGCB 1C4U2 1LHDH 3TK5A 1ZZZA 3VPKA 1H1BA 4ABJA 1GJ6A 1K21H 1KLTA 4WJG2 1MUEB 4ZKRU 2WPHS 1BBRK 1GJAB 1TQ0B 3SUDA 3EQ0H 4BXSA 1J9CH 3LGYA 5C5OA 4YESB 2VWOA 1A3BH 5EQSA 1FN6A 3SHAH 2V3HH 4BTTB 2ZHFH 5CMXH 1BBRH 4INKA 1QFKH 5G4BA 1P09A 1NU7B 2KAIB 2BY5X 3OY5U 3UQOA 3SV7A 1FAXA 2J2UA 1ZRKA 1AB9C 1HXFH 3M5LA 1V2WT 2FPZA 2FLBH 3ZVCA 1AD8H 1O36A 1G3BA 1HDTH 1TBRH 3RMMH 1GDNA 1SFIA 1T31A 2C8YB 2FS9A 4XDEA 4ISNA 5EW1H 1IHSH 2ODPA 4H4FA 2J95A 2Z9KA 1NPMA 5HGGA 3UQVA 1GMDG 3OU0A 1O2GH 3SNAA 2F9NA 2P8OC 5JDUB 1WSSH 4FU9A 5T6GA 3MO6A 1ZLRA 5FAHA 4B2CA 4Q80A 3SO3A 1C1QA 3T29A 2GMTC 1VCWA 1AVGH 1FV9A 3NCLA 4A5TS 1C5ZB 1MBMA 2FWWA 1FAKH 4IW4E 1DFPA 3RXDA 3RXHA 3GY6A 1BHXF 1AE8H 2BZ6H 2P3UB 5FCRA 3U9AH 1O2XA 3MI4A 4IN2A 3KHVA 1KDQA 3SUEA 4YO9A 3BTQE 3DFLA 3RMNH 1H8DH 4J1YA 9ESTA 1ABJH 5K0HA 2AFQB 3PWCA 4VGCB 2XC5A 1C9TA 1TNGA 2PSYA 3HGPA 3TK9A 2XNIA 1P0SH 1FQ3A 2Z7FE 1V2OT 4WXVA 3BTKE 4CBNA 3V3MA 1G37A 3HK6B 2BHGA 1WQSA 3GYLB 1Y3UA 1C5YB 3HPTB 3UY9A 1Q3XA 5JBTA 4WMFA 1NFWA 1BJUA 4X6OA 4X6MA 1IOEA 4MPXA 2H1UA 3P8FA 3LGWA 1GHBG 1GVLA 3PWBA 3EA9A 1XXFA 1AO5A 1GHAF 1SC8U 2ZU3A 1ESTA 1W0ZU 1GJ7B 3GCHB 1DY8A 1A2CH 1TPPA 2OP9A 3WY8A 1DWEH 2VGCC 3M5OA 4PROA 1TNLA 1XVOA 2JETC 3TGKE 3SJIA 1ZSJA 4FU7A 1P05A 1ELDE 2ANYA 2FI5E 1SGTA 1ZGVA 5C1UA 1V3XA 2GDEH 4YTAA 1ELBA 1ETSH 3MHWU 2CMYA 1GCTB 1PPEE 2RG3A 5EODA 4HFPB 1GBCA 2V35A 2FXRA 4AG1A 2ZU1A 3RU4E 3F9GA 1O5FH 1UTJA 1GBMA 3BSQA 4O3UA 2F3CE 3SOSA 3RXJA 4NWLA 3ODDA 1CT0E 2ZHQH 3GY4A 2PKAB 1F2SE 1ZRBA 2PFEA 1O3FA 1HUTH 4MNXA 4ZAEA 4KELA 1OYQA 3FFGA 3K65B 3Q3KA 2CV3A 1TA2A 2ODQA 4IN1A 2DE8A 3GCTG 3T26A 1AFEH 8ESTE 2FM2A 3H7OA 2QGRA 1LPGB 1W7GH 1H8IH 1QJ6B 1RFNA 4NGAH 1GBBA 1PQAA 3STIA 3FZDA 3Q77A 2H9HA 2PTCE 3DA9B 1P11E 8LPRA 1OS8A 2VNTA 3ZZBA 3A8AA 4O97A 2A5KA 2H6MA 3NUMA 3RXLA 4AOQA 2A31A 1EB2A 1PPBH 5DPAA 1SGYE 5DP3A 3C1KA 4BAKB 4X1PU 1SL3A 1G3CA 3O8CA 3P95A 3KGPA 2BQ6B 3C27B 2F9BH 3KF2A 1D3DB 1SGNE 2FO9A 2FYRA 1ESBA 4Y7AA 2ZIQH 1YPJH 1LPKB 1N6XA 1S82A 4NG9H 1MCVA 1C5WB 1CBWB 1E34B 5GPIB 1QB9A 1Y3WA 1HAXB 1UTOA 2OBQA 3OYPA 5TCCA 5B6OA 2FYQA 2BTCE 1YBWA 1HRTH 1LDTT 1ZGIA 4UD9H 4IMZA 4JCNA 2W3KA 4K2YA 4Q7ZA 1F0SA 3U98H 2PLXA 3O8BA 3BTEE 1BZXE 3ZZ6A 2FOCA 4JZIA 2ZTYA 1IQGA 2B0FA 4AFZA 3QX5H 2ZDMA 1F5KU 2ZFPH 1O38A 2ZHWH 2FMJA 2Z9JA 4B74A 1RRKA 3CS7A 1C2JA 4ZXXH 2WPKS 5T6DA 1SSXA 3MU1A 1ETTH 2G4UA 3GCHC 2ZGHA 1NC6A 4CREA 3VB5A 1BTPA 4NIXA 3AW1A 4MPWA 4ABDA 1O30A 5EXLA 1UCYE 4WWYA 3ZVGA 1H4WA 1HCGA 2A4GA 1IQJA 1A3EH 1MKXK 1TRMA 3SI3H 1C5XB 1HFDA 3SNBA 2RA3A 4B2BA 2G51A 1C5VA 2EEKA 1GCTC 5JYIA 1ZYOA 1JOUB 1NRPH 4NZLA 1NY22 4ZHAA 1YPHE 2ZWLH 3A84A 4XE4A 2VIWA 1BMAA 1AZZA 1E0FD 2AGEX 2ZI2H 2ZHEH 5L2ZH 1O3GA 4A1XA 1V2RT 2Z3DA 2OTVA 1XUFA 1PPCE 1C5LH 1C1OA 4YT7H 1AN1E 1GDUA 2BMGB 1GJCB 2CF9H 2PKSB 1C2EA 1GI2A 1O2YA 1QBNA 3KEEA 1GMCG 1ZSLA 1TA6A 4FUFA 1KIGH 5HMAA 5SGAE 1KXAA 5ESTE 1E35B 1ELGA 1GHBF 1TX6A 2ZFQH 4UFFH 2OC8A 1ACBE 4NA9H 2TGAA 2W3IA 1SPJA 1C5RA 3SV8A 3GYMA 5A2MH 5JB9S 3P92A 1BTZA 5CHAC 2J4IA 4AG2A 1QJ1B 1O3BA 3QZRA 1SLXB 3MU8A 1FONA 2AMQA 3MH7A 2BD4A 5TCAA 1NM6A 2C4FH 1H9HE 5FCKA 2ZFRH 1DXPA 2A0QB 2Y81A 3L3TA 2LPRA 3EAJA 4D76A 4D9QA 1AHTH 1IAUA 2RA0A 4D8NA 4ZUHA 3AW0A 3QGNB 4BAHB 2BQWB 4Y0YE 2YNAA 1HAHH 2ZFFH 4GUXA 3MU4A 1O5BB 3BTGE 4Y76A 5HM9A 4MQAA 1CBWC 2VVCA 1G3EA 5HXFA 4A1VA 3PLKA 6LPRA 1GJ5H 1YF4A 2G52A 3PMHB 4X2XA 2C90B 2WPIS 1ZSKA 1FMGA 1O2SA 3A8CA 3SU4A 3MU5A 1P03A 3E90B 1VITF 4IBLH 5DP6A 4E7NA 1PPGE 4Y6DA 1O5GH 5J4QA 1GBFA 1XM1A 3P8GA 1DDJA 2ZHDA 1W10U 2Z9IA 1TGCA 3ZZ9A 1UTMA 2A2XH 1ORFA 1QY6A 3DHKH 1NESE 1O3OA 4A7IB 1KSNA 3U1JB 1O35A 1TB6H 1DX5M 1K28D 1ANEA 3SU1A 3PLPA 1GHXH 1S6FA 2HALA 1FIWA 5FPYA 3V13A 5EW2H 1ABIH 1G3DA 2OC7A 1SG8B 2NU2E 4KP0A 5C3NA 4MPVA 1DLEA 1OSSA 2WUBA 2BY9X 1QRWA 2ZTZA 2P94A 3BG8A 7GCHF 1O3DA 1YPGH 1BTUA 1TNKA 2VVVA 4E7RG 3LKWA 2PUQH 2BOHB 2GTBA 3ODFA 5GDSH 3S9AA 5AVDA 1GBEA 1LKBA 4WH6A 5E8EH 1P06A 1C1RA 1TFXA 1GBLA 2GV6A 4TYDA 1BIOA 1BUIA 1CO7E 1OP8A 2HNTF 1BB0B 3PO1B 2CN0H 2ZCKP 4ESTE 1DWDH 1O34A 4FUIA 5EOKA 2OQUA 2ASUB 4X1NU 1BRCE 3M7QA 3S7KB 3RXQA 5FXLA 3K2UA 1FY4A 1JRTA 1DITH 1F5LA 4YT6H 2ZG0H 3KQEA 4JZFH 1ANDA 3M61U 1DUAA 3RMOH 2P3FH 1DWCH 1DVAH 2BD5A 1GI5A 1OWDA 4BTUB 4K69A 5EGMA 4JZEH 1NFXA 4IMQA 4Q7XA 3SNEA 1TWXB 4CBOA 1MQ6A 3UTUH 1FDPA 2V3OH 1BMMH 1C2FA 5GJ4B 4TPIZ 1EPTB 3DUXH 5HYOA 2HGTH 4NIYA 5E2PA 1BT7A 2J94A 4FVDA 1HIAB 1ELTA 3ZVAA 1AWHB 1QNJA 3GISB 3S0NA 4NSYA 1IQLA 2NU1E 4H6SB 1P9SA 1RD3B 2FOBA 2OQ5A 3QLPH 2FX6A 4BTIB 3BG4B 4MNVA 3P70B 1YP9A 3BTHE 2BXTH 1C2HA 1HAVA 3E3TA 1SQTA 2XW9A 1ZHMA 1HJ9A 2Q6DA 1GL0E 6GCHG 4YOGA 3SUGA 1GL1A 2V0BA 1G2LA 3QUMP 1YPKH 1ZMNA 4Q2KA 3CP7A 3ZZAA 2ILNA 4GAWA 4YLUA 3OY6U 3EA7A 5FBEA 1UHBB 1FI8A 3NPSA 2I6QA 1AGJA 1NO9H 2ZPSA 1ZR0A 3HK3B 1FXYA 1EX3A 2ZZUH 1EAUA 1Z8GA 4FU8A 4JZ1A 3SGQE 4OS4A 2ZECA 2QXHA 1FN8A 1A7SA 2YNBA 1GBHA 2VIQA 3H7TA 2ANWA 1HAGE 2FTLE 3V0XA 2FOGA 5C1YA 4M7GA 4IS5A 1BMLA 1O2JA 3RU4T 1MTVA 2UUKB 1AFQB 1MTSA 1QBVH 3PM3A 4FVBA 3SNDA 2BVSH 2W26A 1OYTH 2GZ8A 1A5IA 3PLBA 4CRBA 2EI7A 1XXDA 4X6PA 3OTJE 3GDUA 3VGCB 5H4IB 3VB4A 2XBVA 4F4OC 1G2MA 1W8BH 3MH4A 1T8OA 1J8AA 3TVJB 3PO1C 3T2NA 1TMTH 2XXLA 1TNIA 4LOYH 4ZH8A 4XBDA 2H2ZA 2ZGXH 1G32B 4DOQA 1UVSH 3F6UH 4RSPA 1S84A 4I31A 1FLEE 1XUHA 1O2LA 1FY1A 1GI0A 3A82A 3HKIB 4X2WA 3OSYA 3S9CA 1BHXB 1LVMA 3KQDA 3TIUA 3A7YA 5DJ7A 2BVRH 2QC2A 1Z8IB 1TRNA 1AKSA 1O5DH 4GLYA 2M5TA 1SVPA 2GZ9A 1MAXA 3TU7H 1GI6A 1EPTC 3K6ZA 2FZZA 3P8NA 4B71A 2AEIH 1NRSH 1OOKB 1SBWA 1EZSC 1ESAA 1RTKA 4R0IA 1DS2E 3TJOA 3LONA 1DSUA 1NROH 1SLVB 3SW2B 1TNHA 1D3TB 3UR6A 3U1IB 4UDWH 2GVFA 2ZDKA 2C8ZB 3VB7A 2TGTA 2ZC9H 2G8TA 3BG4C 2ZGBH 4D7GA 5DGJA 1O33A 2XBYA 1YCPH 4ISLA 3Q3YA 1BITA 1RJXB 1PYTC 1CE5A 2XRCA 1EJMA 1L4ZA 1GWAA 1GG6B 1O3IA 5C1XA 2BY6X 1AZ8A 2XCNA 3JZ1B 2TGDA 2IPHA 2UUYA 1SOZA 2FS8A 2VWNA 3RXBA 1O2RA 1V2VT 2IOTA 3QWCH 1GHVH 3HKJB 2P16A 4K1SA 1MCTA 1IQNA 3UREA 5AFYH 1HJAB 2ZCHP 3UOUA 4CR9A 1OWJA 1ZPCA 4AFQA 1BBRE 1C5SA 4NIVA 1GI4A 2FODA 1EAWA 4Y8ZA 4Y10E 5A0CA 1AUTC 1NRRH 1EASA 3ATKA 1W13U 1AFQC 3BEIB 1XUIA 1C4Y2 4SGAE 5DP4A 2ZGCA 1QHRB 3AAUA 3OX7U 4D7FA 3RLWH 3KNXA 3FP7E 3VGCC 1C5UA 3A86A 2F83A 3MH5A 3AAVA 1N8OC 5DG6A 1TGSZ 3BEFB 1EKBB 2O8MA 1GI1A 3T5FH 3QGJA 1AWFH 3RXRA 4JYVH 4ZKOU 1K1OA 2SNWA 3GY2A 1MAYA 3LDXH 1SGQE 4X6NA 2Z9GA 4IC6A 1IQMA 4ISOA 3LGUA 1L1NA 3A88A 1SHHB 4DY7B 3I29A 1UVOA 2HWLB 2C8XB 1HYLA 1EZQA 1PQ7A 3MU0A 3T25A 3UWJH 1WU1A 5DP9A 1AVWA 2VIOA 3A7XA 2XWBI 1ETRH 3PMBB 5DKMA 1Z71A 3W94A 1O37A 5J4SA 1ZJKA 2C3SA 4B76A 2VIVA 1AUJA 2HNTE 3QTOH 1HB0B 4Y11E 4ABFA 1E37B 2B8OH 3M36A 1FY8E 2Y7XA 1BRBE 1MZDA 4FUGA 1GVZA 3VEQB 2ZDAH 1ELAA 1P10A 3V7TA 1CHOG 1HPGA 1N1LA 2G00A 2RDLA 2PUXB 5LH8A 1OKXA 2A5IA 4MG3A 3LJOA 3D49H 4H42U 5F8ZA 4K1EA 2UWPA 1DWBH 3M5MA 4INHA 3TLOA 1B0FA 1SGEE 1PPFE 2UWLA 4MLFB 2W5EA 5L30H 1TMUH 1FJSA 1XUJA 1OWKA 2R0LA 3RMLH 3DD2H 3KL6A 4ZXYH 1BTYA 3AASA 1RXPA 1D4PB 1UCYH 4O03A 1Y59T 3AVZA 2ZO3H 3LIWA 2J34A 1GG6C 4LZ1H 3LH3A 2WV5A 1MTUA 2F9OA 5FX6A 3TJVA 1INCA 4FXGH 4VGCC 2BDGA 2UWOA 3NK8A 5GWZA 2THFB 2Y5GA 3SGAE 1Z1IA 1HAYB 4DIIH 1QBOA 2IJOB 2ANKH 5AHGH 5EG4A 3TNTA 4ZMAH 1FY3A 5FBIA 2WV4A 5JBAS 1LHGH 2RCEA 4ABEA 2VIDA 1JXPA 1HLTH 2FI3E 3TGIE 3SJKA 4Y8XA 1VJ9U 2GCTB 1PFXC 3K6YA 3L33A 2QIQA 1C2MA 1DLKB 3DFJA 1LQEA 1P2OA 2B5TB 2F9VA 3ENSB 1TABE 1S85A 1GCDA 7LPRA 1DPOA 1SLUB 1GMDF 2ZDNA 1MBQA 1ZTJA 3E1XB 3VXFH 2FP7B 3ZVDA 1FY5A 1UTPA 3ZYDA 2VJ1A 2ZA5A 1EJAA 3ZVEA 2BXUH 5T3HA 2VH0A 1LHCH 3ZV8A 2BD9A 3H5CB 1YYY1 3M3SA 4U01A 1SGDE 1V2UT 1BCUH 3F68H 4E05H 2FOAA 4KGAA <