4X1SU

The crystal structure of mupain-1-16-d9a in complex with murinised human upa at ph7.4
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords mupain-1-16
publication title A cyclic peptidic serine protease inhibitor: increasing affinity by increasing peptide flexibility.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1sU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1sU01
1C2MA 1FDPA 1MZDA 3DT0H 4XBDA 5A0BA 1ZMLA 3GISB 3E16B 4Z6AH 2ZFTA 2Z9IA 1EATA 4MNVA 1EZUC 4X2WA 1QR3E 1P57B 4MNYA 1LTOA 1XM1A 1C2LA 4K1EA 3BIVH 3GY3A 1EP6A 1O2RA 3TH4H 2FS9A 2XCNA 1A4WH 5FBEA 1C1SA 1V2KT 3GY4A 3U9AH 1EB2A 1LPGB 1M9UA 4AOQA 1QBVH 3QK1A 3K9XB 1F7ZA 3TK9A 4XOJA 1OSSA 5E2PA 3M3SA 1AU8A 1A61H 4TYDA 3GCTF 2ZU2A 3U1JB 3QTOH 1O33A 1ABIH 1YM0A 1CGHA 2ZG0H 5C5NA 4Q7ZA 1AY6H 3IITA 1NU9A 1PYTC 1A0HB 4A6LA 5LPEA 4GHTA 2GDDA 4H42U 2RA3A 4IC5A 4THNH 5GPIB 2Z94A 1BMLA 2GT7A 1X7AC 1FI8A 1F5LA 4GCHG 3LC3A 2HPPH 1BTHH 1TPPA 2NU1E 4X1PU 2FI3E 1SGTA 3KHVA 1O2YA 1O2JA 1SQOA 2Q6GA 1AKSA 2BLQA 3BTQE 1P2OA 2FP7B 1GBCA 3PMBB 3A8BA 5DO4H 1GI0A 1FY1A 4CHAB 2KAIA 1VZQH 2GCTB 1KXDA 4D9RA 2PFEA 2J2UA 4FU8A 3A82A 3RC6A 3RC5A 1KDQB 3U8OH 2AGGX 3MNXA 2ZECA 1C5OH 4JZ1A 4ZUHA 1HIAB 1BJUA 1EAIA 1OWHA 1XMNB 4Y8YA 3OYPA 4KTUA 1LVOA 3P95A 4KGAA 3QLPH 1MKXK 3MU5A 2P8OB 3EE0B 1NRNH 3SUGA 3ATWA 5JB9S 2PUQH 2Y5FA 3LONA 4MDSA 3RLWH 1FN6A 2BLOA 1HJ9A 1SLVB 1B0FA 2PKSB 1BITA 1C2EA 4YZUA 3BIUH 2VINA 3RP2A 3D62A 4JYVH 1O2GH 1NPMA 1UK4A 4OS1A 3UNQA 1QJ6B 4CH8B 8GCHF 2GGVB 1HFDA 5GCHG 1CT4E 2R3YA 4CRFA 3GY5A 2FOCA 3C27B 2VU8E 3NXPA 1DM4B 4ZAEA 1U6QA 2SNVA 3E0NB 4JZEH 1BT7A 2EC9H 6CHAC 3C1KA 4F49A 2F9VA 3AW1A 1IOEA 3SV8A 1BQYA 2ZZUH 4X8TH 2XC0A 3ENSB 3U69H 1Z8JB 4IMQA 2O8LA 5TCCA 2XWBI 1C5RA 1ZYOA 3PWCA 1QL8A 3G01A 1P9UA 1FUJA 1N6XA 5HM9A 1PPCE 1QIXB 2ZU1A 1O3IA 1D3TB 1MU8B 1XUIA 1QFKH 3QUMP 1K1MA 3B9FH 3T25A 2O8MA 2CV3A 1YPHE 4I33A 4NZQA 1MTUA 1O3FA 3A7XA 2BY7X 3A7YA 3E0PB 2UWOA 1O5CB 2Z9LA 1C2FA 4X8SH 1KTSB 2P59A 2XBVA 2W5EA 2HALA 8KME2 1OOKB 2BY6X 1PQAA 4IS5A 1O35A 1TGNA 1GGDC 1A1RA 2ZFQH 4ESTE 1NFYA 4XBBA 3SQEE 3WY8A 1ZSJA 2WPJS 3KQBA 6LPRA 1GJ9B 1AZ8A 5DJ7A 3RU4D 2Z3EA 2SGAA 1EKBB 3CP7A 3MYWA 5H4IB 2ZU5A 1FZZA 4BAMB 1QTFA 4YOJA 3A89A 3RXUA 4Y71A 4AG1A 3A84A 5EOKA 1RTKA 2OQUA 4OS2A 4CBOA 4NG9H 1LKAA 4I8JA 4DURA 1Z71A 3U8TH 1O3AA 1IQMA 4GSOA 1FJSA 1SOTA 2V6NA 5FPYA 4ZH8A 2BM2A 1SGEE 3SU0A 3MH4A 1O2TA 4CBNA 1V2JT 1WQVH 3HKJB 3E91A 3MH5A 1UTJA 1AFEH 1O31A 1OX1A 3SGBE 2ZQ1A 1CE5A 1ETSH 1OKXA 4B1TA 2C8YB 4CREA 4B2CA 1TPOA 1FY3A 2BOKA 1A3BH 1O34A 1W8BH 3LGIA 1CGJE 1ZHRA 1UTPA 1C9PA 1YF4A 2W26A 1N8OC 2A31A 3KGPA 2GCHF 1GMDF 2AGEX 1TPSA 5BPEA 3HGPA 2BTCE 4BTIB 3TH3H 2A4QA 5A8ZA 2C3SA 1DOJA 1VCQA 3L6PA 1TNHA 3H7OA 4I8HA 1HAHH 1Z8IB 1BJVA 1IQGA 3ZVEA 1EB1H 1NT1A 1P10A 1KXAA 1C1WH 1AN1E 4DCDA 3LKWA 5CE1A 2FYQA 2GVFA 2PSXA 2BMGB 5CHAC 1P2QA 1PQ8A 2FDAA 1Z1IA 1PQ7A 1TX8A 2FOEA 3MNCA 1P2MA 1SGRE 3P92A 4BAOB 4YM9A 1ZMNA 2GDEH 4O9VA 1UTNA 1V2PT 3GYMA 4DVAU 2IPHA 4U01A 1O2UA 2A4OA 3PM3A 1BMNH 1HYLA 3SN8A 3T27A 1ESBA 3TLOA 1E36B 2ZGJA 3S7HB 4OGYA 1LCYA 1O5EH 1HNEE 2ASUB 1SGQE 1CO7E 3MI4A 4LOYH 2WINI 4K3JA 1CSOE 3RXPA 4PROA 3JZ1B 1IHSH 2VH0A 4X1NU 1UK3A 3SU1A 1W12U 2I6QA 3U1IB 1FMGA 2H5DA 1AB9C 1GMCG 2F9NA 1C5UA 1CT0E 4NFEA 1XXFA 4SGBE 1EJAA 3TU7H 2OTVA 1AWHB 1GI1A 2XCFA 3GCHB 5IDKA 3SW2B 3FAOA 1LHFH 1A46H 3A88A 2BX3A 4AYVB 5ESTE 1G32B 1G3DA 1GBHA 1QRWA 3PO1C 3MTYA 1AO5A 9LPRA 4MQAA 1ELGA 3GDSA 2G4UA 2CF9H 1O2PA 2ZDKA 2BD8A 1NRQH 4CR5A 3S9BA 2F9UA 2OQ5A 2FWWA 3ZZ8A 2AMDA 1PPEE 2HNTF 5LH8A 1K1OA 1EPTC 4X8VH 2QC2A 3MFJA 2AS9A 4NWLA 3Q3YA 1HAZB 3M61U 4KTCA 2OXSA 2W3KA 2BDHA 2G52A 3TNSA 1BTPA 2FTLE 2H9EH 3FZDA 5C3NA 2D2DA 3MO9A 1TNGA 1IHTH 2BQ6B 1E34B 4XBCA 1ZJKA 3W94A 1TABE 3PB1E 4Y8ZA 1MTSA 1TRNA 3QTVH 2EI8A 1PPFE 1W0ZU 1T4UH 1AE5A 1TOMH 1WU1A 1EXFA 2VJ1A 3MO6A 1QL7A 1A0LA 4NGAH 5E0JA 2Z3CA 3I77A 4FUIA 1DLEA 3ZZ9A 3UTUH 2CHAC 2SGEE 2XC4A 4K69A 2Z9KA 2V35A 1GJBB 4Y0ZE 3SNAA 2VWNA 2BVRH 1GGDB 1RIWB 3D65E 1A5GH 4RN6A 3UR6A 1Y5UT 2IOTA 2PKAA 2TRMA 3BN9A 3U98H 1H9IE 1W0YH 2PV9B 5C1YA 2ZHWH 1MCTA 4MPXA 3GY7A 1UTMA 1T8LA 5GDSH 1MTNB 2R2MB 2RG3A 3VFEA 2C8ZB 3RXMA 1OS8A 1QQUA 2ANWA 1O38A 2AFQB 2BVXH 1E37B 1XX9A 4O3UA 1BTXA 5AFYH 1TBZH 1J16A 1BIOA 3VGCB 3UQOA 2UUKB 4K1SA 1KYNA 4FXGH 6ESTA 3TIUA 1CBWC 2J34A 1DICA 4FUCA 3F9EA 3NKKA 3URCA 3PROA 3GY6A 4MVNA 1G3BA 5E8EH 5DP6A 4JK6A 2STBE 2J38A 2YOLA 3ODDA 1L1NA 2NU3E 2ZTYA 1SL3A 1GHXH 3MMGA 1AVWA 1OWEA 1GJ5H 1C5XB 1GBEA 1P3CA 2WYGA 2FO9A 4Y6DA 3GDVA 1GCDA 4X0WU 1HCGA 2CGAA 2GTBA 3O8RA 1O3DA 4R0IA 3TK5A 1EQ9A 1DWCH 2YNAA 5JB8S 1FNIA 1XUKA 1EX3A 2ODPA 3E3TA 1NY22 2QYIA 2ZDNA 1GBLA 2SGQE 1YKTA 1O2WA 1VJ9U 1HJAB 3DUXH 1C5MD 3GCNA 2PR3A 3RU4T 3FZZA 1GJ7B 3Q3XA 4O03A 4RKOB 1P2IA 1YC0A 1ZTLA 1TFXA 4ISLA 3SBKA 4YT7H 4XFQA 4BTUB 4LZ4B 4VGCC 4R8TB 2WPKS 1AWFH 2WUBA 1F0UA 1HGTH 4BXSA 2A4GA 5AFZH 4YTAA 1SFQB 3SNCA 1S0QA 3LIWA 1SFIA 3SUEA 1JXPA 1SGCA 1V2TT 2ZIQH 1V6DA 2ZFRH 1EPTA 1GG6B 3SU4A 1GHWH 2UUYA 1SGYE 3M7UA 3A8AA 4MPUA 5HGGA 3SU6A 3SI4H 3K65B 2TPIZ 1JRTA 1V2LT 4E05H 1P0SH 1GVZA 1P11E 1TRMA 4NIVA 4JYTA 4NIXA 1JBUH 3SNBA 5A0AE 2GZ9A 3RXIA 1ANBA 4CR9A 4DG4A 3FP8E 1MTVA 2XRCA 2VGCC 3DD2H 1FAXA 1GJ4H 3OU0A 1GJDB 1G2LA 2Y6TA 2P3FH 5E2OA 3OSYA 1EJMA 1VGCB 5F8ZA 1GDNA 3A85A 1QL9A 5J4QA 1TNLA 2HWLB 3TJUA 1K1JA 1Y3VA 1ZHPA 1MQ6A 1ZRBA 3CS0A 4UDWH 1FIWA 1QB9A 1O2VA 3BEIB 1Y3WA 4QT8C 4MPWA 5EPYA 3L3TA 1YPEH 2PLXA 4A1VA 1HAVA 1Y3UA 2BY5X 2THFB 1C5YB 2BB4A 3TNTA 2FXRA 1C2KA 2K1QA 2R0LA 2UUFB 2QY0B 3QGJA 2A2XH 3UOUA 2Y5GA 3UOPA 4OS4A 2HRVA 2A0QB 2BQ7B 1THSH 3GCTG 1QJ7B 1K2I1 4TPIZ 1EAXA 2BHGA 4K1TA 2ANKH 2SGPE 1T32A 2FTMA 2ZQ2A 1O3EA 4ZXXH 2GX4A 1BCUH 1DDJA 1FLEE 1O2OA 3Q76A 5K0HA 1PJPA 1FN8A 3K2UA 4Z0KA 5F6MA 1DSUA 2TGDA 1TWXB 3LGTA 3SJOA 1QJ1B 4GHQA 1BA8B 1SB1H 1BHXF 3KN2A 3SOSA 1L4DA 2M5TA 1QBOA 4B73A 1GBTA 5DPAA 2VVVA 1EASA 2H9HA 3RUOA 1ETTH 1NM6A 1V2OT 1G30B 3SI3H 2G4TA 1IQHA 1K1NA 5EU8A 4KELA 1O0DH 3SV7A 1YCPK 5DP9A 3ZVAA 4X6NA 3ZZAA 1Z6JH 4ABGA 4ABIA 4RSPA 2H1UA 4FU9A 2VVCA 1GCTC 1ARCA 4IC6A 5J4SA 1VCPA 4ISNA 3PV4A 1AKSB 1SGDE 2G51A 4MTBA 1BHXB 2KAIB 1DWEH 3E6PH 2FEQH 1WSSH 2B5TB 1DFPA 1D3DB 3QWCH 1C5SA 3QDZB 1UVPA 4JCNA 4UONA 7GCHF 1C1VH 2XBXA 2V3OH 1JWTA 2A2QH 3O8DA 3AAUA 5DP3A 1K1LA 3MH7A 4MPVA 4A5TS 1H8IH 3GICB 1C5ZB 3A8CA 4WMFA 1O3PB 1RTFB 2A45B 3RDZA 1C1PA 3LPRA 3N7OA 3PLKA 4FU7A 5AHGH 4ZHLU 1TRYA 2ODYB 3A80A 2GZ7A 1K1IA 1W13U 1OWDA 2JETB 1TALA 8GCHG 8LPRA 1JRSA 3LOXA 1QNJA 2AH4X 4NCYA 1SGFA 4Y11E 3V7TA 3M5NA 1GHVH 4UE7H 1NRPH 2QXJA 4WF8A 4K5ZA 3SQHE 4DIIH 2BQWB 4AFQA 1Q3XA 2FOBA 3AVZA 1GJCB 1BMMH 4BXWA 3BG4C 3SNDA 2DUCA 4VGCB 4YESB 2BYAX 1NESE 1SSXA 1O3MA 1O5BB 1PFXC 1MCVA 2W3IA 1LPKB 1AD8H 1OYTH 4AYYB 1TGCA 2BD2A 2Q1JA 2ZPQA 2W7SA 1TYNA 1ORFA 1BRAA 2FOMB 2A5AA 2QXHA 2Y82A 1IQKA 3S9CA 1SHYA 3RXFA 4X1QU 1ZTKA 4ISHH 3TJVA 2FLRH 1TAWA 2PTCE 1IQJA 1TNKA 2XYAA 5JYIA 4FUGA 3RXEA 1MAYA 2J94A 4YLUA 1O5AB 2H9TH 1TMTH 1ESAA 1F0RA 6GCHF 3BG8A 3QO6A 3HKIB 4KP0A 4ZKRU 3ZV8A 2GMTC 1P05A 3SGAE 2TBSA 2JH6D 4HZHA 3LJJA 2G55A 4ZXYH 1D3PB 4AN7A 3GY8A 5EODA 1EAUA 1UHBA 3QX5H 4NZLA 1CGIE 1KTTB 4GVUA 4TWYA 2ILNA 1GI3A 1O2LA 5ETXA 2STAE 1C2GA 2V3HH 3R3GB 2ZEBA 2RCEA 2HGTH 2PWXA 1BRCE 2OLGA 3SJ8A 1AI8H 4JK5A 4WXIA 4I7YH 1Y3YA 3MHWU 4UD9H 3RXAA 1TQ7B 5A09A 1DWDH 1BBRK 1B5GH 1ESTA 2O9QA 3PTBA 3BEFB 4ABJA 1HUTH 4YO9A 3BF6H 3FFGA 5DP5A 2ZHFH 2XWAA 5FPSA 1B7XB 1YYY1 2OC8A 1TBRH 2I6SA 1V2UT 1P8VC 2CF8H 1TA6A 3CS7A 4Y76A 1T8OA 2BD7A 1OYQA 2AMPA 2ZHQH 2ZA5A 1E38B 2BZ6H 3RU4E 3RC4A 3SZNA 4GUXA 4DT7B 2AIPA 1GHYH 2GCHG 1GMDG 2AMQA 4YOIA 4CRGA 3ZVDA 3ZVGA 2OC7A 2BDBA 1WUNH 1GPZA 1GHZA 5E0GA 2DE9A 4WMDA 4UFEH 1MTWA 1ZSLA 4IMZA 1D6WA 3B23B 1UCYK 1NS3A 5LGOA 1QURH 5TJXA 1HAIH 4AFSA 1B0EA 3RXOA 1RTLA 2QF0A 1UTQA 3M3TA 4WY3A 1CA0C 1GI7B 3TH2H 2ZHEH 3FP6E 3I78A 3NK8A 2EI7A 3GY2A 4H6TA 4ABFA 1A0JA 2VIQA 3BTWE 1BRUP 2OD3B 1H1BA 4MG3A 4NIWA 1RS0A 1L1JA 5EG4A 3RXRA 1TGSZ 1WAYB 3M7TA 1AUTC 4HI3A 2R2WU 4IGDA 1S6HA 2R3UA 1O3GA 2PSYA 1EZXC 1WQSA 1THPB 1FPHH 2PW8H 4GAWA 2ZDLA 1O30A 3ATKA 3R0FA 1ELCA 5C5OA 2QA9E 1GHAF 1OP8A 1AFQC 4WWYA 2ESTE 2VH6A 3ZZ7A 4Y10E 2BD5A 5FHTA 2RDLA 1YPMH 4IW4E 1GBMA 1GVKB 4Q80A 1V2VT 4FUFA 3UNSA 4AX9H 2OUAA 1YPKH 1AMHA 4LK4A 2H6MA 4AFZA 5CMXH 2BX4A 5FBIA 1INCA 4B75A 4D76A 2SFAA 1PPBH 2Q6FA 1DXWA 5C20A 1YCPH 3P17H 1S5SA 1G37A 1J9CH 1YPGH 4XE4A 5DG6A 1AHTH 1O36A 2VVUA 2ALPA 4OS7A 1WOFA 3GYLB 1EZSC 1HBTH 2AGIX 2FESH 2BDGA 1F5KU 1OWIA 1QGFA 2WYJA 3NPSA 1V2WT 4CRDA 6CHAB 4I32A 1UTKA 1UVUH 5GIBA 2WUCA 1PYTD 1DVAH 1DXPA 3ZYDA 4A1TA 5JPMH 4NSVA 2EEKA 1CHOF 1ZZZA 4KTSA 3TGJE 4RKJB 3OTJE 2OBQA 4Y8XA 1CHOG 1DLKB 4CRBA 4U32A 1NFUA 3VPKA 1K28D 3E90B 1C4U2 3VXEH 1SOZA 3KIDU 1YGCH 4X8UH 1GBKA 1LQEA 3KQEA 2ZF0H 2CN0H 2ZPRA 3A7TA 2ZKSA 2LPRA 1O3HA 2VB0A 5HXFA 2GD4B 4ZKNU 3RXHA 5C2ZA 1GI4A 1DANH 1O2MA 3MO3A 2PGBB 2OC0A 4OGXA 1YCPM 2ZFFH 1XVOA 3BTGE 3ZZBA 1MAXA 3SV2H 3P8GA 1TPAE 1KXCA 1YPHC 1W7GH 2QXIA 3RXKA 1ELEE 1QB6A 2GP9B 4IN2A 1GMHF 3UPEA 1FY8E 4WXVA 1SLXB 1KXFA 3VXFH 2XTTB 1GMHG 2TGTA 1MMJN 1C1NA 1GI9B 3OX7U 3F1SB 1OPHB 3H7TA 1CVWH 5JBBS 1HDTH 2ALVA 4D7FA 1XVMA 1NROH 4ZHAA 4B74A 3FP7E 1O2NA 2OC1A 1C2HA 1O3BA 3LU9B 4Y79A 1GI2A 2VIOA 3BTME 1V2QT 2O8TA 1C9TA 1K21H 1XUGA 5C1UA 1TQ0B 4X2VA 3PYHA 1ELFA 1WTGH 1H9HE 2QGRA 1WBGB 3NCLA 1HXEH 1A5HA 3Q77A 1AIXH 2FOGA 2PKAB 1D9IA 3SU3A 4CHAC 2F83A 1BTUA 1BOQA 2VWLA 1C5LH 1H9LB 2NU0E 1H4WA 1ETRH 3FANA 2GCTC 1PPZA 1VR1H 5EXNA 1EUFA 3MU1A 2FZZA 1GBJA 1N8OB 2QV1A 3RXDA 2R9PA 1BBRH 3A86A 1C4V2 1Z8RA 2B0FA 3ZVCA 4YOGA 3BSQA 3VB4A 2FI4E 1K9OE 2GV7A 2DE8A 5F03A 2BDCA 1SGIB 3RXQA 2BY8X 2P8OC 5HMAA 5A8YA 1AZZA 1C1TA 1NFWA 1LHGH 1O2KA 1P12E 1UTOA 3PMAB 4ABAA 3SUFA 2BDAA 1AE8H 2PUXB 1TNJA 2FLBH 3E8LA 2NWNA 4NFFA 2J92A 5CHAB 1O5FH 1CA0B 1C5VA 2PKSC 1NN6A 1IQNA 2FM2A 4AGKA 5BRRE 3M36A 5FPTA 1THRH 1NTPA 2A5KA 1ANCA 1XUHA 3JZ2B 1HJ8A 2F9OA 1UCYH 1LVMA 1BB0B 3T28A 1L1GA 3VB7A 1BMAA 3S9AA 1ZR0A 1LQDB 1C2JA 3UY9A 4U30A 2BOHB 1RGQA 3RXGA 1WTHD 4M7GA 3T29A 4NWKA 3UWJH 1AB9B 1NO9H 1OP0A 2GV6A 5AVDA 4NA8A 4Y7BA 1BDAA 1P02A 1S85A 3RXVA 4JMYA 5C67A 5DK1A 3V13A 8ESTE 4XDEA 5T6DA 1C5TA 4D8NA 1MH0A 2EI6A 2HNTE 4X1SU 1LPZB 1ZPZA 1MUEB 3M37A 3PO1B 1BRBE 2A32A 2ZP0H 2FOAA 4DY7B 3TPIZ 3M5OA 2P95A 5L2ZH 3ELAH 5DKMA 1C5QA 1C5PA 2OBOA 2PTNA 2O8WA 2W7UA 4O3TA 1TMUH 5EQRA 1NFXA 3MOCA 2TIOA 3TITA 2ZDMA 3TGIE 1O3KA 2P16A 2OINA 1EPTB 1C1RA 4BAQB 1JMOH 4H4FA 3RXBA 1JIMA 2ZI2H 3T5FH 1TB6H 5LPFA 3HATH 2ZCLP 5B6OA 1OP2A 2WV4A 4CRCA 4UEHH 2F3CE 5FAHA 2A1DB 4KKDA 2ZTXA 5JBAS 1C2DA 1VCWA 4DGJA 1O5DH 3MNBA 1OWKA 3D49H 4GLYA 2YNBA 1QRXA 3EQ0H 3EGKH 2VIVA 1D3QB 1DX5M 1E0FD 1ZSKA 2BDIA 1H8DH 1FXYA 1FY4A 3GCOA 1GBFA 1DS2E 2Q6DA 4ABBA 4Y7AA 3SO3A 5HM2A 1QHRB 2BLWA 2ZC9H 3NZIA 4ZKOU 1TGBA 5DP7A 3ATMA 3RXTA 2CHAB 2SNWA 4BAHB 3BTKE 4HGCA 5G4BA 1Z1JA 5FXLA 3SUDA 1O3JA 2P3UB 3B8JA 1HAVB 3EDXB 1MZAA 1W7XH 3ZV9A 1GJ8B 1VITF 4X6OA 4X6MA 2O8UA 2UWPA 1GJ6A 1IQLA 1G36A 1FPCH 1O3NA 1VITG 5T6GA 1TLDA 1ZHMA 2Z3DA 3A8DA 3ZZ6A 4BOHA 3T62A 1KDQA 4GCHF 4E06H 1KLIH 1UK2A 1DY9A 2G5VA 3HGNA 1HIAA 3ZZCA 3BTDE 2BZAA 3VEQB 4TY6A 3ODFA 4AB8A 2XC5A 1MU6B 3OY6U 2R0KA 1P04A 2GT8A 5I46H 1AQ7A 1G9IE 1XKBC 4ZHMU 4ABHA 1GI8B 1CBWB 3URDA 3TGKE 1Z6EA 2WV5A 2FS8A 3A7ZA 5F8TA 2QN5T 1IQIA 1D4PB 1RFNA 3GDUA 3A7VA 3BTTE 4D7GA 3AASA 3IG6B 2EA3A 3IWMA 5A0CA 1CT2E 1ANEA 4K60A 2V0BA 1LVBA 1QB1A 5L30H 1RJXB 3AAVA 2BD9A 2ZGXH 3SJIA 2A5IA 3UREA 1BTWA 5FCKA 3A81A 1HAGE 1SGNE 2G5NA 2VWOA 1ANDA 7GCHG 1HRTH 4I31A 4J2YB 3V3MA 1O3CA 1GI6A 3PLPA 1GBBA 3ZVFA 1C2IA 2XBYA 3M5LA 1GBDA 3GCHC 4WH8A 4TWWA 4ZKSU 4LZ1H 2FOFA 1RXPA 1P06A 3UR9A 1GHBF 5EPNA 3PLBA 1SG8B 3F9GA 2Z7FE 3S7KB 3UFAA 4CRAA 1GHBG 2XBWA 1SGFG 1QA0A 1DSTA 1TNIA 1GBAA 1RRKA 5GCHF 3RMLH 1S0RA 4ASHA 2NU2E 1P01A 3P8FA 3STIA 3BTFE 1Z7KA 1T8MA 3W95A 1LKBA 5T3HA 3D23A 1O32A 1Q31A 2QIQA 3RMNH 5EXLA 1C1QA 1DT2A 1BBRE 1PQ5A 2FPZA 3UWIA 3M5MA 2J95A 2C8WB 4Q7XA 3EAJA 5JDUB 3VB3A 1NC6A 4B2AA 1L0ZA 3T26A 5L2YH 1ELDE 1XUJA 5TCAA 1NRSH 2FODA 1MBMA 2AYWA 1TONA 2ZPSA 3STJA 2F91A 4AFUA 2RA0A 1FIZA 3L33A 3SORA 2VIDA 2VNTA 1QQ4A 5DP8A 3CENA 3M7QA 3MU0A 1S81A 1LDTT 2OCVB 3HPTB 1EP5A 1ZTJA 3MU4A 1L2EA 2J4IA 5LPRA 4INKA 3P6ZB 1G3CA 2C90B 4NSYA 1ZMJA 2BD3A 2FYRA 2A4RA 4X2XA 4YT6H 6GCHG 2HNTC 3FVFB 2VIPA 2PHBA 2HOBA 2P3TB 1SLWB 3EA9A 4I8LA 5EQSA 2VGCB 3P8OA 3ATLA 2C4FH 5GWZA 2GKVE 3RMOH 2ZFSA 2B7DH 1EAWA 1O2ZA 2Z6BD 3RM0H 1Z8GA 4BNRA 2ZGHA 1UCYE 1P2KA 1AGJA 1DE7H 1TX6A 2BXUH 3RXLA 3A83A 1S84A 3SJKA 1ABJH 4B2BA 1RIWC 1T4VH 1EOLA 2Y5HA 3QN7A 7KMEH 4DIHH 3RXJA 1KY9A 3VB6A 1CA8B 2ZCKP 2ZTZA 3I29A 3ZZ3A 1DITH 1DWBH 1GJAB 1EZQA 1GL0E 3MU8A 3DHKH 4FUEA 3O8BA 2Z9JA 5EQQA 5FCRA 1WV7H 3RMMH 4TY7A 2A7CA 1UHBB 4ZMAH 4FUHA 1C4Y2 1V2RT 5I25A 1MTNC 1YPLH 4UFDH 1A7SA 1QA7A 1YLDA 1IQFA 1NRRH 3RXSA 1ZLRA 1O3LA 5EXMA 1N6YA 3VGCC 4SGAE 1O2HA 1P9SA 1ZPBA 2ANYA 2AERH 1IQEA 1OXGA 3MH6A 1ZRKA 2Y80A 2JH5D 4I8GA 1D6RA 3A7WA 1FV9A 4NIYA 5IYTA 9ESTA 3DA9B 4AORA 3LGYA 1ELBA 1MKWK 2F9PA 2VIWA 1DUAA 1Y8TA 2CJIA 1C5NH 4CH2B 1C1UH 2VWMA 4NA9H 4UFGH 1F2SE 5JBCS 2G81E 4XSKU 2Y81A 1ZGVA 1UJ1A 4DOQA 1LHDH 3EA8A 4ISIH 2G8TA 1UO6A 3UUZA 1TOCB 4J1YA 5EW1H 2SGDE 1LHEH 1YPJH 4Q2KA 1EJNA 5FX5A 3ZVBA 1ZJDA 2HVXA 1HJAC 1YBWA 4IN1A 1SR5C 1GCTB 1JIRA 1OWJA 1GHAG 3ITIA 1NZQH 1Y3XA 1SQAA 1BTYA 3ZZDA 1BTZA 3UQVA 4H6SB 3KF2A 2Y7ZA 1O39A 1HXFH 2HLCA 3EA7A 4B71A 2G00A 3BTHE 2SGFE 4FUJA 1GMCF 1F5RA 1MD7A 1ZGIA 2ZDVH 5F8XA 2D8WA 1KXEA 1LVYA 3K6YA 4ISOA 3LC5A 4FUDA 1HAPH 1TIOA 2JKHA 2FOHA 4BANB 1GG6C 4TPYA 2QAAA 1CQQA 4MLFB 5GXPA 1LO6A 3KEEA 2ODQA 3TVJB 1XXDA 2QCYA 3BV9B 1J15A 2ZNKH 3NWUA 4GPGA 1C1OA 3PTNA 1MBQA 2LNCA 5L6NH 2B9LA 2TGAA 1J14A 1SQTA 1A3EH 5DP4A 2ZU4A 4WMEA 1LMWB 1MKXH 3E1XB 4OS6A 5C1XA 1HAXB 2Y7XA 3BG4B 3MNSA 4K2YA 3SGQE 1ZPCA 1J17T 4JZIA 4BAKB 4X1RU 3BTEE 1VGCC 4BTTB 3SHCH 1DUEA 3O8CA 3ATIA 1HLTH 1GDUA 3SU5A 1V2NT 1O37A 1Y5AT 1VJAU 2ZWLH 1XKAC 3QZQA 3S0NA 4ABDA 2C93B 7LPRA 4FUBA 1A2CH 3HK3B 3PMJA 2FX6A 1SI5H 3ESTA 2QF3A 5A8XA 1IAUA 3ZYEA 1NU7B 1ARBA 1SVPA 1P3EA 3TJNA 2CXVA 1GBIA 3F9HA 3DFJA 1LHCH 1KIGH 5SGAE 4DJZB 2GMTB 1ELAA 1EOJA 1J8AA 2BVSH 1SPJA 2D26C 2FX4A 3SU2A 3UIRA 3V0XA 5A2MH 2QXGA 5HYOA 2FIRH 2BXTH 1SBWA 2HPQH 5GJ4B 2TGPZ 3P70B 1W11U 3LH1A 3P8NA 1GDQA 1AVGH 1GL1A 1QBNA 1QY6A 2JH0D 4K8YA 3M35A 3QZRA 1TMBH 3F68H 3SV9A 2J9NA 2UUJB 1QCPA 1FY5A 1Y59T 1HAOH 3A87A 3LGVA 4Q7YA 2F9BH 4X2YA 4HFPB 1O5GH 4B76A 4ZROA 4OS5A 5E0HA 5PTPA 4E7RG 1TGTA 3SJ9A 3PMHB 1ELTA 5ABWA 1F0TA 3GOVB 3KNXA 2P94A 1O2QA 2B8OH 1UVOA 2WPIS 1Q2WA 3Q3KA 1S83A 1YLCA 3RLYH 2WPLS 3KQDA 3TK6A 1S82A 2BLVA 3RM2H 2AIQA 4O97A 2XW9A 1AUJA 1P03A 2IN2A 3LT3A 1K22H 3KL6A 4U2WA 1CHGA 1GWAA 1W10U 2ULLA 2ZGCA 2H5CA 2ZHDA 4MNWA 1P09A 4AB9A 1YP9A 4WH6A 1KLJH 4FVDA 4AGJA 2A7HA 4I8KA 1T7CA 1Y5BT 4A7IB 1TA2A 1UTLM 1UVTH 2XXLA 5T6FA 3U8RH 5DGJA 1F0SA 2ZDAH 3QGNB 4AZ2B 3SV6A 4JZFH 4A1XA 5EW2H 3PWBA 3ZZ5A 3V12A 1P2NA 1O2SA 4DW2U 1W14U 2Z9GA 3BEUA 3NUMA 2P93A 1DPOA 2H2ZA 1F92A 1G2MA 1SLUB 1JOUB 5FX6A 3F6UH 2BD4A 3AW0A 4D9QA 1L4ZA 3T2NA 1TBQH 2FI5E 3K6ZA 1QRZA 2ZU3A 1ZOMA 2UWLA 3UNRA 1CU1A 2ZFPH 1E35B 4X6PA 4INLA 1KSNA 4LXBH 4WVPE 4NA7A 1MKWH 1HAYB 3Q00A 4F4OC 1MD8A 5AF9H 1T31A 1P2JA 7ESTE 2C8XB 4K8BA 2OP9A 2ZO3H 1W3CA 2JETC 1C5WB 1DY8A 3OY5U 1V2ST 3H5CB 3SHAH 4E7NA 5ESBA 1AFQB 1UVSH 2IJOB 1KXBA 3LDXH 2XNIA 1C1MA 1GI5A 1O2XA 1SGPE 1UMAH 1GVLA 4HTCH 3TJOA 4AG2A 2ZCHP 1AVXA 1ELVA 1T8NA 1TX7A 1V3XA 2WPMS 4ABEA 3LGUA 2ANMH 1A5IA 3ZZ4A 1O3OA 4UFFH 1KLTA 3EYDA 1BZXE 4INHA 3KQCA 2NU4E 1HB0B 1TE0A 2CMYA 3MWIU 4Y0YE 1BUIA 1PPHE 4MNXA 2D1JA 1HV7A 1V2MT 3HK6B 1SMFE 1ID5H 2BDYA 1WCZA 1K1PA 2PGQB 1FONA 1SHHB 1WYKA 1VITH 3RXCA 3F9FA 4WJG2 3VB5A 3DFLA 5K7RA 5JBTA 2WPHS 4A92A 2GZ8A 1XUFA 1W2KH 2A7JA 3SNEA 3LH3A 1RD3B 4JYUH 2FMJA 1G3EA 1SC8U 1FQ3A 3LGWA 1O2IA 2BY9X 1PPGE 3KCGH 1N1LA 4IBLH 3S69A 5EGMA 1ACBE 1HPGA 3M3VA 4FVBA 3LJOA 2ZGBH 1MQ5A 4JZDH 1S6FA 1FAKH 4YLQH 2AEIH
chains in the Genus database with same CATH superfamily
1C2MA 1FDPA 1MZDA 3DT0H 4XBDA 5A0BA 1ZMLA 3GISB 3E16B 4Z6AH 2ZFTA 2Z9IA 1EATA 2EY4C 4MNVA 1EZUC 4X2WA 1S6LA 1QR3E 1P57B 3PRBA 4MNYA 1LTOA 1XM1A 2K0QA 1C2LA 4K1EA 3BIVH 3GY3A 1EP6A 1O2RA 3TH4H 2FS9A 2XCNA 1A4WH 5FBEA 1YLNA 4OM9A 1C1SA 1V2KT 3GY4A 3U9AH 1EB2A 2EQNA 1LPGB 1M9UA 4AOQA 1QBVH 2GJGA 3QK1A 3K9XB 1F7ZA 3TK9A 4XOJA 1OSSA 5E2PA 3M3SA 1AU8A 1A61H 4TYDA 3GCTF 2ZU2A 3U1JB 3QTOH 1O33A 1ABIH 3WWFA 1YM0A 1CGHA 2ZG0H 5C5NA 4Q7ZA 1AY6H 3IITA 1NU9A 1PYTC 1A0HB 4A6LA 5LPEA 4GHTA 2GDDA 4H42U 2RA3A 4IC5A 4THNH 5GPIB 2Z94A 2XOKD 3W1EA 1BMLA 2GT7A 1X7AC 1FI8A 1F5LA 4GCHG 3LC3A 2HPPH 1BTHH 1TPPA 4ZCNA 2NU1E 4X1PU 2FI3E 1SGTA 2KR7A 3KHVA 1O2YA 1O2JA 1SQOA 2Q6GA 1AKSA 2BLQA 3BTQE 1P2OA 2FP7B 1GBCA 3PMBB 3A8BA 5DO4H 1GI0A 1FY1A 4CHAB 2KAIA 1VZQH 3F3BA 2GCTB 1KXDA 4D9RA 2PFEA 2J2UA 4FU8A 3A82A 3RC6A 3F0PA 3RC5A 1KDQB 3U8OH 2AGGX 3MNXA 2ZECA 1C5OH 4JZ1A 4ZUHA 1HIAB 1BJUA 3UAIC 1EAIA 2WZQA 1OWHA 1XMNB 2IJD1 4Y8YA 3OYPA 4KTUA 1LVOA 3P95A 4KGAA 1WDIA 3QLPH 1MKXK 3MU5A 3KYGA 2P8OB 3EE0B 1NRNH 3SUGA 3ATWA 5JB9S 2PUQH 2Y5FA 3LONA 4MDSA 3RLWH 1FN6A 2BLOA 1HJ9A 1QZ8A 5C17A 1SLVB 1B0FA 2PKSB 1BITA 1C2EA 3DSPA 4YZUA 3BIUH 1SQRA 2VINA 3RP2A 3D62A 4JYVH 1O2GH 1NPMA 1UK4A 4OS1A 3UNQA 1QJ6B 4CH8B 2VBCA 8GCHF 2GGVB 1HFDA 5GCHG 1CT4E 2R3YA 4CRFA 3GY5A 2FOCA 3C27B 2VU8E 3NXPA 1DM4B 4ZAEA 1U6QA 2SNVA 3E0NB 4JZEH 1BT7A 2EC9H 6CHAC 3C1KA 4F49A 2F9VA 3AW1A 1IOEA 3SV8A 1BQYA 2ZZUH 4X8TH 2XC0A 3ENSB 3U69H 1Z8JB 4IMQA 2O8LA 5TCCA 2XWBI 1C5RA 1ZYOA 3PWCA 1QL8A 3G01A 1P9UA 1FUJA 1N6XA 2AHME 5HM9A 1PPCE 1QIXB 2ZU1A 4YXWD 1O3IA 1D3TB 1MU8B 1XUIA 1QFKH 3QUMP 1K1MA 3B9FH 3T25A 2O8MA 2CV3A 1YPHE 4I33A 4NZQA 1MTUA 1O3FA 3A7XA 1UW7A 2BY7X 2J98B 3A7YA 3E0PB 2UWOA 1O5CB 2Z9LA 1C2FA 4X8SH 1KTSB 2P59A 3KYFA 2XBVA 2W5EA 2HALA 8KME2 1OOKB 2BY6X 1PQAA 4IS5A 1O35A 1TGNA 3U28C 1GGDC 1A1RA 2ZFQH 4ESTE 1NFYA 4XBBA 3SQEE 3WY8A 1ZSJA 2WPJS 3KQBA 6LPRA 1GJ9B 1AZ8A 5DJ7A 3RU4D 2Z3EA 2SGAA 1W0JD 4FOUC 1EKBB 3CP7A 3MYWA 5H4IB 2ZU5A 1FZZA 4BAMB 1QTFA 4YOJA 3A89A 3H09A 3RXUA 4Y71A 4AG1A 2QF5A 3A84A 5EOKA 1RTKA 2OQUA 4OS2A 4CBOA 4NG9H 1LKAA 4I8JA 4DURA 1Z71A 3U8TH 4B6FA 1O3AA 1IQMA 4GSOA 1FJSA 1SOTA 2V6NA 5FPYA 4ZH8A 2BM2A 1SGEE 3SU0A 3MH4A 1O2TA 3CNRA 4CBNA 1V2JT 1WQVH 3HKJB 3E91A 3MH5A 1UTJA 1AFEH 1O31A 1OX1A 3SGBE 2ZQ1A 1CE5A 1ETSH 1OKXA 4B1TA 2C8YB 4CREA 4B2CA 1TPOA 1FY3A 2BOKA 1A3BH 1O34A 1W8BH 3LGIA 1CGJE 1ZHRA 1UTPA 1C9PA 1YF4A 2W26A 1N8OC 2A31A 3KGPA 2GCHF 1GMDF 2QF4A 2AGEX 1TPSA 5BPEA 3HGPA 2BTCE 4BTIB 2K8IA 3TH3H 2A4QA 5A8ZA 2C3SA 1DOJA 1VCQA 3L6PA 1TNHA 3H7OA 4I8HA 1HAHH 1Z8IB 1BJVA 1IQGA 3ZVEA 3EE7A 1EB1H 1NT1A 1P10A 1KXAA 1C1WH 1AN1E 2YMSB 4DCDA 3LKWA 5CE1A 2FYQA 2GVFA 2PSXA 2BMGB 5CHAC 1P2QA 1PQ8A 2FDAA 1Z1IA 1PQ7A 1TX8A 2FOEA 3MNCA 1P2MA 1SGRE 3P92A 4BAOB 4YM9A 1ZMNA 2GDEH 4O9VA 1UTNA 1V2PT 3GYMA 4DVAU 2IPHA 4U01A 1O2UA 2A4OA 3PM3A 1BMNH 1HYLA 3SN8A 3T27A 1ESBA 3TLOA 3OAAD 1E36B 2ZGJA 3S7HB 4OGYA 1LCYA 1O5EH 1HNEE 2ASUB 1SGQE 1CO7E 3MI4A 4LOYH 2WINI 1K0HA 4K3JA 1CSOE 1E79D 3RXPA 4PROA 3JZ1B 1IHSH 2VH0A 4X1NU 1UK3A 3SU1A 1W12U 2I6QA 3U1IB 1FMGA 2H5DA 1AB9C 1GMCG 2F9NA 1C5UA 5GNDA 1CT0E 4NFEA 1XXFA 4SGBE 1EJAA 3TU7H 2OTVA 1AWHB 1MABB 1GI1A 2XCFA 3GCHB 5IDKA 3SW2B 3FAOA 1LHFH 1A46H 3A88A 2BX3A 4AYVB 5ESTE 1G32B 1G3DA 1GBHA 1QRWA 3PO1C 3MTYA 1AO5A 9LPRA 4MQAA 1ELGA 3GDSA 2G4UA 2CF9H 1O2PA 2ZDKA 2BD8A 1NRQH 4CR5A 3S9BA 2F9UA 2OQ5A 2FWWA 3ZZ8A 2AMDA 1PPEE 2J97A 2HNTF 4AC9A 4Z1MD 5LH8A 1K1OA 1EPTC 4X8VH 2QC2A 3MFJA 2AS9A 4NWLA 3Q3YA 1HAZB 3M61U 4KTCA 4TT3D 2OXSA 3AK5A 2W3KA 2BDHA 2G52A 3TNSA 1BTPA 2FTLE 2H9EH 3FZDA 3DSGA 5C3NA 2D2DA 3MO9A 1TNGA 1IHTH 2BQ6B 1E34B 4XBCA 1ZJKA 3W94A 1TABE 3PB1E 4Y8ZA 2JIZD 1VKYA 1MTSA 1TRNA 3QTVH 4XD7D 2EI8A 1PPFE 1W0ZU 1T4UH 1AE5A 2YMSD 1TOMH 1WU1A 1EXFA 3DSOA 2VJ1A 3MO6A 1QL7A 1A0LA 4NGAH 3F2GA 2V3MA 5E0JA 2Z3CA 3I77A 4FUIA 1DLEA 3ZZ9A 3UTUH 2CHAC 2SGEE 2JJ1D 2XC4A 4K69A 2WSSD 2Z9KA 2V35A 1GJBB 4Y0ZE 3SNAA 2VWNA 2BVRH 1GGDB 1RIWB 3D65E 1A5GH 4RN6A 2RFKC 3UR6A 1Y5UT 2IOTA 2PKAA 2TRMA 3BN9A 3U98H 1H9IE 1W0YH 2PV9B 2HLDD 5C1YA 2ZHWH 1MCTA 4MPXA 3GY7A 1FX0B 1UTMA 1T8LA 5GDSH 1MTNB 2R2MB 2RG3A 3VFEA 2C8ZB 3RXMA 1OS8A 1QQUA 2ANWA 1O38A 2AFQB 2BVXH 1E37B 1XX9A 4O3UA 1BTXA 5AFYH 1TBZH 1J16A 1BIOA 3VGCB 3UQOA 2UUKB 4K1SA 1KYNA 4FXGH 6ESTA 3TIUA 1CBWC 2J34A 1DICA 4FUCA 3F9EA 3NKKA 3URCA 3PROA 3GY6A 4MVNA 1G3BA 5E8EH 5DP6A 4JK6A 2STBE 2J38A 2YOLA 3ODDA 1L1NA 2NU3E 2ZTYA 1WXRA 1SL3A 1GHXH 3MMGA 3N7EA 1AVWA 1OWEA 1GJ5H 1C5XB 1GBEA 1P3CA 2WYGA 2FO9A 4Y6DA 3GDVA 3F2HA 1GCDA 4X0WU 1HCGA 2CGAA 2GTBA 3O8RA 1O3DA 4R0IA 3TK5A 1EQ9A 1DWCH 2YNAA 5JB8S 1FNIA 1XUKA 1EX3A 2ODPA 3E3TA 1NY22 2QYIA 2ZDNA 1GBLA 2SGQE 1YKTA 1O2WA 1VJ9U 1HJAB 3DUXH 1C5MD 3GCNA 2PR3A 5B6LA 3RU4T 3FZZA 1GJ7B 3Q3XA 4O03A 4RKOB 1NBMD 1P2IA 1YC0A 1ZTLA 5KGOA 1TFXA 4ISLA 3SBKA 4YT7H 4XFQA 4BTUB 4LZ4B 4VGCC 4R8TB 2WPKS 1AWFH 2WUBA 1F0UA 1HGTH 4BXSA 5C0TA 2A4GA 5AFZH 4YTAA 1SFQB 3SNCA 1S0QA 3LIWA 1SFIA 3SUEA 1JXPA 1SGCA 1V2TT 2ZIQH 1V6DA 2ZFRH 1EPTA 1GG6B 3SU4A 1GHWH 2UUYA 1SGYE 3M7UA 3A8AA 4MPUA 5HGGA 3SU6A 3SI4H 3K65B 2TPIZ 1JRTA 1V2LT 4E05H 1P0SH 1GVZA 1P11E 1TRMA 4NIVA 4JYTA 4NIXA 1JBUH 3SNBA 5A0AE 2GZ9A 3RXIA 1ANBA 4CR9A 4DG4A 3FP8E 1MTVA 2XRCA 2VGCC 3DD2H 1FAXA 1GJ4H 3OU0A 1GJDB 1G2LA 2Y6TA 2P3FH 5E2OA 3OSYA 1EJMA 1VGCB 5F8ZA 1GDNA 3A85A 1QL9A 5J4QA 1TNLA 5EJZA 2HWLB 3TJUA 1K1JA 1Y3VA 1ZHPA 3PV2A 1MQ6A 1ZRBA 3CS0A 4UDWH 1FIWA 1QB9A 1O2VA 3BEIB 1Y3WA 4QT8C 4MPWA 5EPYA 3L3TA 1YPEH 2PLXA 4A1VA 1HAVA 1Y3UA 2BY5X 2THFB 1C5YB 3SZEA 2BB4A 3TNTA 2FXRA 1C2KA 2K1QA 2R0LA 2UUFB 2QY0B 3QGJA 2A2XH 3UOUA 2Y5GA 3UOPA 4OS4A 2HRVA 2A0QB 2BQ7B 1THSH 3GCTG 1QJ7B 2RDEA 1K2I1 4TPIZ 1EAXA 2BHGA 4K1TA 2ANKH 2SGPE 4Q4LA 1T32A 2FTMA 2ZQ2A 1O3EA 4ZXXH 2GX4A 1BCUH 1DDJA 1FLEE 1O2OA 3Q76A 5K0HA 1PJPA 1FN8A 3K2UA 4Z0KA 5F6MA 1DSUA 2TGDA 1TWXB 3LGTA 3SJOA 1QJ1B 4GHQA 1BA8B 1SB1H 1BHXF 5HIZA 3KN2A 4RI0A 3SOSA 1L4DA 2M5TA 1QBOA 4B73A 1GBTA 5DPAA 2VVVA 1EASA 2H9HA 3RUOA 1ETTH 1NM6A 1V2OT 1G30B 3SI3H 2G4TA 1IQHA 1K1NA 3DCLA 5EU8A 4KELA 1O0DH 3SV7A 1YCPK 5DP9A 3ZVAA 4X6NA 3ZZAA 1Z6JH 4ABGA 4ABIA 4RSPA 2H1UA 4FU9A 2VVCA 1GCTC 1ARCA 4IC6A 5J4SA 1VCPA 4ISNA 3PV4A 1AKSB 1SGDE 2G51A 4MTBA 1BHXB 2KAIB 1DWEH 3E6PH 2FEQH 1WSSH 2B5TB 1DFPA 1D3DB 3OEHD 1C5SA 3QDZB 1UVPA 3QWCH 4JCNA 4UONA 7GCHF 1C1VH 2XBXA 2V3OH 1JWTA 2A2QH 3O8DA 3AAUA 5DP3A 1K1LA 3MH7A 4MPVA 4A5TS 1H8IH 3GICB 1C5ZB 3A8CA 4WMFA 1O3PB 1RTFB 2A45B 3RDZA 1C1PA 3LPRA 3N7OA 3PLKA 4FU7A 5AHGH 4ZHLU 1TRYA 2ODYB 3A80A 2GZ7A 1K1IA 1W13U 1OWDA 2JETB 2WV9A 1TALA 8GCHG 8LPRA 1JRSA 3LOXA 1EFRD 1QNJA 2AH4X 4NCYA 3F0OA 1SGFA 4Y11E 3V7TA 3M5NA 1GHVH 4UE7H 1NRPH 2QXJA 4WF8A 4K5ZA 3SQHE 4DIIH 2BQWB 4Q63A 3FOAA 4AFQA 1Q3XA 2FOBA 3AVZA 1GJCB 1BMMH 4BXWA 3BG4C 3SNDA 2DUCA 4VGCB 4YESB 2BYAX 1NESE 1SSXA 1O3MA 1O5BB 1PFXC 1MCVA 2W3IA 1LPKB 1AD8H 1OYTH 4AYYB 1TGCA 2BD2A 2Q1JA 2ZPQA 2W7SA 1TYNA 1ORFA 1BRAA 2FOMB 2A5AA 2QXHA 2Y82A 1IQKA 3S9CA 1SHYA 3RXFA 4X1QU 1ZTKA 4ISHH 2KCAA 3TJVA 2FLRH 1TAWA 2PTCE 1IQJA 1TNKA 3FN8A 2XYAA 5JYIA 4FUGA 3RXEA 1MAYA 2J94A 4YLUA 1O5AB 2H9TH 1TMTH 1ESAA 1F0RA 6GCHF 3BG8A 3QO6A 3HKIB 4KP0A 4ZKRU 3ZV8A 2GMTC 1P05A 3SGAE 2TBSA 2JH6D 4HZHA 3LJJA 2G55A 4ZXYH 1D3PB 4AN7A 3GY8A 5EODA 1EAUA 1UHBA 3QX5H 4NZLA 1CGIE 1KTTB 4GVUA 5HIYA 4TWYA 2ILNA 1GI3A 1O2LA 5ETXA 2STAE 1C2GA 2V3HH 3R3GB 2ZEBA 3MQKC 2RCEA 2HGTH 2PWXA 4ASUD 1BRCE 2OLGA 3SJ8A 1AI8H 4JK5A 4WXIA 4I7YH 1Y3YA 3MHWU 4UD9H 3RXAA 1TQ7B 4F55A 5A09A 1DWDH 1BBRK 1B5GH 1ESTA 2O9QA 3PTBA 3BEFB 4ABJA 1HUTH 4YO9A 3BF6H 3FFGA 5DP5A 1H8ED 2ZHFH 2XWAA 5FPSA 1B7XB 1YYY1 3N99A 2OC8A 1TBRH 2I6SA 1V2UT 1P8VC 2CF8H 1TA6A 3CS7A 4Y76A 1T8OA 2BD7A 1OYQA 2AMPA 2ZHQH 2ZA5A 1E38B 2BZ6H 3RU4E 3RC4A 3SZNA 4GUXA 1KMHB 4DT7B 2AIPA 1GHYH 2GCHG 1GMDG 2AMQA 4YOIA 4CRGA 3ZVDA 3ZVGA 2OC7A 2BDBA 1WUNH 1GPZA 1GHZA 5E0GA 2DE9A 4WMDA 4UFEH 1MTWA 1ZSLA 4IMZA 1D6WA 3B23B 1UCYK 1YY3A 1NS3A 5LGOA 1QURH 5TJXA 1HAIH 4AFSA 1B0EA 3RXOA 1RTLA 2QF0A 1UTQA 3M3TA 4WY3A 1CA0C 1GI7B 5DSFA 3F2FA 3TH2H 2ZHEH 3FP6E 3I78A 3NK8A 2EI7A 3GY2A 4H6TA 4ABFA 1A0JA 2VIQA 3BTWE 1BRUP 2OD3B 1H1BA 4MG3A 4NIWA 1RS0A 1L1JA 5EG4A 3RXRA 1TGSZ 1WAYB 3M7TA 1AUTC 4HI3A 2R2WU 4IGDA 1S6HA 2R3UA 2KX4A 1O3GA 2PSYA 1EZXC 1WQSA 1THPB 1FPHH 2PW8H 4GAWA 3OFND 2ZDLA 1O30A 3ATKA 3R0FA 1ELCA 5C5OA 2QA9E 1GHAF 1OP8A 1AFQC 4WWYA 2ESTE 2VH6A 3ZZ7A 4Y10E 2BD5A 5FHTA 2RDLA 1YPMH 4IW4E 1GBMA 1GVKB 4Q80A 1V2VT 4FUFA 3UNSA 4AX9H 2OUAA 1YPKH 1AMHA 4LK4A 2H6MA 4AFZA 3OTPA 4I86A 5CMXH 2BX4A 5FBIA 1INCA 4B75A 4D76A 2SFAA 1PPBH 2Q6FA 1DXWA 5C20A 1YCPH 3P17H 1S5SA 1G37A 1J9CH 1YPGH 4XE4A 5DG6A 1AHTH 1O36A 2VVUA 2ALPA 2KCYA 4OS7A 1WOFA 3GYLB 1EZSC 1HBTH 2AGIX 2FESH 2BDGA 1F5KU 1OWIA 1QGFA 2WYJA 3NPSA 5F53A 1V2WT 4CRDA 6CHAB 4I32A 1UTKA 1UVUH 5GIBA 2WUCA 1PYTD 1DVAH 1DXPA 3ZYDA 4A1TA 5CDFE 4NSVA 2EEKA 5JPMH 1CHOF 1ZZZA 4KTSA 4XRNA 3TGJE 4RKJB 3OTJE 2OBQA 5T1VA 4Y8XA 1CHOG 1DLKB 4CRBA 4U32A 1NFUA 3VPKA 1K28D 3E90B 1C4U2 3VXEH 1SOZA 2JDID 3KIDU 1YGCH 4X8UH 1GBKA 1LQEA 3KQEA 2ZF0H 2CN0H 2ZPRA 3A7TA 2ZKSA 2LPRA 1O3HA 2VB0A 5HXFA 2GD4B 4ZKNU 3RXHA 5C2ZA 1GI4A 1DANH 1O2MA 3MO3A 2PGBB 2OC0A 4OGXA 1YCPM 2ZFFH 1XVOA 3BTGE 3ZZBA 1MAXA 3SV2H 3P8GA 1TPAE 1KXCA 1YPHC 4TSFD 1W7GH 2QXIA 3RXKA 1ELEE 1QB6A 2GP9B 4IN2A 1GMHF 3UPEA 1FY8E 4WXVA 1SLXB 3WWBA 1KXFA 3VXFH 2XTTB 1GMHG 2TGTA 1MMJN 1C1NA 1GI9B 3OX7U 3F1SB 1OPHB 3H7TA 1CVWH 5JBBS 1HDTH 2ALVA 4D7FA 1XVMA 1NROH 4ZHAA 4B74A 3FP7E 1O2NA 2OC1A 1C2HA 1O3BA 3LU9B 4Y79A 1GI2A 2VIOA 3BTME 1V2QT 2O8TA 1E1RD 1C9TA 1K21H 1XUGA 5C1UA 1TQ0B 4X2VA 3PYHA 1ELFA 1WTGH 1H9HE 2QGRA 1WBGB 3NCLA 1HXEH 1A5HA 3Q77A 2W6ID 1AIXH 2FOGA 2L74A 2PKAB 1D9IA 3SU3A 4CHAC 2F83A 1BTUA 1BOQA 2VWLA 1C5LH 1H9LB 2NU0E 1H4WA 1ETRH 3FANA 2GCTC 2CK3D 2W6JD 1PPZA 1VR1H 5EXNA 1EUFA 3MU1A 2FZZA 1GBJA 1N8OB 2QV1A 3RXDA 2R9PA 1BBRH 3A86A 1C4V2 1Z8RA 2B0FA 5FL7D 3ZVCA 2IPQX 4YOGA 3BSQA 3VB4A 2FI4E 4ACAA 1K9OE 2V7QD 2GV7A 3VG8A 2DE8A 5F03A 2BDCA 1SGIB 3RXQA 2BY8X 2P8OC 5HMAA 5A8YA 1AZZA 1C1TA 1NFWA 1LHGH 1O2KA 1P12E 1UTOA 3PMAB 4ABAA 3SUFA 2BDAA 1AE8H 2PUXB 1TNJA 2FLBH 3E8LA 2NWNA 4NFFA 2J92A 5CHAB 1O5FH 1CA0B 1C5VA 2PKSC 1NN6A 1IQNA 2FM2A 4AGKA 5BRRE 3M36A 5FPTA 1THRH 1NTPA 2A5KA 1ANCA 1XUHA 3JZ2B 1HJ8A 2F9OA 1UCYH 1LVMA 1BB0B 3T28A 1L1GA 3VB7A 1BMAA 3S9AA 5KECA 1ZR0A 1LQDB 4ACBA 1C2JA 3UY9A 4U30A 2BOHB 1RGQA 3RXGA 4F48B 1WTHD 4M7GA 3T29A 4NWKA 3UWJH 1AB9B 1NO9H 1OP0A 2GV6A 5AVDA 4NA8A 4Y7BA 1BDAA 1P02A 5C94A 1S85A 3RXVA 4JMYA 5C67A 5DK1A 3V13A 8ESTE 4XDEA 5T6DA 1C5TA 4D8NA 1MH0A 2EI6A 2HNTE 3SYJA 4X1SU 1LPZB 1ZPZA 1MUEB 3M37A 3PO1B 1BRBE 2A32A 2ZP0H 2FOAA 4DY7B 3TPIZ 5EIYA 3M5OA 2P95A 5L2ZH 3ELAH 5DKMA 1C5QA 1C5PA 2OBOA 2PTNA 2O8WA 2W7UA 4O3TA 1TMUH 5EQRA 1NBME 1NFXA 3MOCA 2TIOA 3TITA 2ZDMA 3TGIE 1O3KA 2P16A 2OINA 1EPTB 1C1RA 4BAQB 1JMOH 4H4FA 3RXBA 1JIMA 2ZI2H 3T5FH 1COWD 2QE7D 1TB6H 5LPFA 3HATH 2ZCLP 2KZ4A 5B6OA 1OP2A 2WV4A 4CRCA 4UEHH 2F3CE 5FAHA 2A1DB 4KKDA 2ZTXA 5JBAS 1C2DA 1VCWA 4DGJA 1O5DH 3MNBA 1OWKA 3D49H 4GLYA 2YNBA 1QRXA 3EQ0H 2HVYB 3EGKH 2VIVA 1D3QB 1DX5M 1E0FD 1ZSKA 2BDIA 1H8DH 1FXYA 1FY4A 3GCOA 1GBFA 1DS2E 2KCPA 2Q6DA 4ABBA 4Y7AA 3SO3A 5HM2A 1QHRB 2BLWA 2ZC9H 3NZIA 3OEED 4ZKOU 1TGBA 5DP7A 3ATMA 3RXTA 2CHAB 2SNWA 4BAHB 3BTKE 4HGCA 5G4BA 1Z1JA 5FXLA 4DT4A 3SUDA 3OE7D 1O3JA 2P3UB 3B8JA 1HAVB 3EDXB 1MZAA 1W7XH 2F4LA 3ZV9A 1GJ8B 1VITF 4X6OA 4X6MA 2O8UA 2UWPA 1GJ6A 1IQLA 1G36A 1FPCH 1O3NA 1VITG 5T6GA 1TLDA 1ZHMA 2Z3DA 3A8DA 3ZZ6A 4BOHA 3T62A 1KDQA 4GCHF 4E06H 1KLIH 1UK2A 1DY9A 2G5VA 3HGNA 1HIAA 3ZZCA 3BTDE 2BZAA 4RT1A 3VEQB 4TY6A 3FO8D 3ODFA 4AB8A 2XC5A 1MU6B 3OY6U 2R0KA 1P04A 2GT8A 5I46H 1AQ7A 1G9IE 1XKBC 2YMSC 4ZHMU 4ABHA 1GI8B 1CBWB 3URDA 3TGKE 1Z6EA 2WV5A 2FS8A 3A7ZA 5F8TA 2QN5T 1IQIA 1D4PB 1RFNA 3GDUA 3A7VA 3BTTE 4D7GA 3AASA 3IG6B 4P02A 2EA3A 3IWMA 5A0CA 1CT2E 1ANEA 4K60A 2V0BA 1LVBA 1QB1A 5L30H 1RJXB 3AAVA 2BD9A 2ZGXH 3SJIA 2WHXA 2A5IA 3UREA 1BTWA 5FCKA 3A81A 1HAGE 1SGNE 2G5NA 2VWOA 1ANDA 7GCHG 1HRTH 4I31A 4J2YB 3V3MA 1O3CA 1GI6A 3PLPA 1GBBA 3ZVFA 1C2IA 2XBYA 3M5LA 1GBDA 3GCHC 4WH8A 4TWWA 4ZKSU 4LZ1H 2FOFA 1RXPA 1P06A 3UR9A 1GHBF 5EPNA 3PLBA 1SG8B 3F9GA 2Z7FE 3S7KB 3UFAA 4CRAA 1GHBG 2XBWA 1SGFG 1QA0A 1DSTA 1TNIA 1GBAA 1RRKA 5GCHF 3RMLH 1S0RA 4ASHA 2NU2E 1P01A 3P8FA 3STIA 3UB0A 3BTFE 1Z7KA 1T8MA 3W95A 1LKBA 5T3HA 3D23A 1O32A 1Q31A 2QIQA 3RMNH 5EXLA 1C1QA 1DT2A 1BBRE 1PQ5A 2FPZA 3UWIA 3M5MA 2J95A 2C8WB 4Q7XA 2J98A 3EAJA 5JDUB 3VB3A 1NC6A 4B2AA 1L0ZA 3T26A 5L2YH 1ELDE 1XUJA 5TCAA 1NRSH 2FODA 1MBMA 2AYWA 1H8HD 1TONA 2ZPSA 2F43B 2F91A 2RA0A 1FIZA 3L33A 3STJA 4AFUA 3SORA 1YWUA 2VIDA 2VNTA 1QQ4A 5DP8A 3CENA 3M7QA 3MU0A 1S81A 1LDTT 2OCVB 3HPTB 1EP5A 1ZTJA 3MU4A 1L2EA 2J4IA 5LPRA 4INKA 3P6ZB 1G3CA 2C90B 4NSYA 1ZMJA 2BD3A 2FYRA 2A4RA 4X2XA 4YT6H 2M2AA 6GCHG 2WPDD 2HNTC 3FVFB 2VIPA 2PHBA 2HOBA 2P3TB 1SLWB 3EA9A 4I8LA 2KM0A 5EQSA 2VGCB 3P8OA 3ATLA 2C4FH 5GWZA 2GKVE 3RMOH 2ZFSA 2B7DH 1EAWA 1O2ZA 2Z6BD 3RM0H 1Z8GA 4BNRA 2ZGHA 1UCYE 4FETA 1P2KA 1AGJA 4B6EA 1DE7H 1TX6A 2BXUH 3RXLA 3A83A 1S84A 3SJKA 1ABJH 5CHBA 4B2BA 1RIWC 1T4VH 1EOLA 2Y5HA 3QN7A 7KMEH 4DIHH 3RXJA 1KY9A 3VB6A 1CA8B 2ZCKP 2ZTZA 4M9FA 5IK2D 2OK5A 3I29A 3ZZ3A 4P00A 1DITH 1DWBH 1GJAB 2JJ2D 1EZQA 1GL0E 3MU8A 3DHKH 4FUEA 3O8BA 2Z9JA 5EQQA 5FCRA 1WV7H 3RMMH 4TY7A 2A7CA 1UHBB 4ZMAH 4FUHA 1C4Y2 1V2RT 5I25A 1MTNC 1YPLH 4UFDH 1A7SA 1QA7A 1YLDA 1IQFA 1NRRH 3RXSA 1ZLRA 5EJLA 1O3LA 5EXMA 1N6YA 3VGCC 4SGAE 1O2HA 1P9SA 1ZPBA 2ANYA 2AERH 1IQEA 1OXGA 3MH6A 1ZRKA 2Y80A 2JH5D 4I8GA 1D6RA 3A7WA 1FV9A 4NIYA 5IYTA 9ESTA 3DA9B 4AORA 3LGYA 1ELBA 1MKWK 2F9PA 2VIWA 1DUAA 2J5UA 1Y8TA 2CJIA 1C5NH 4CH2B 1C1UH 2VWMA 4NA9H 4UFGH 1F2SE 5JBCS 2G81E 4XSKU 2Y81A 1ZGVA 1UJ1A 4DOQA 1LHDH 3EA8A 4ISIH 2G8TA 1UO6A 3UUZA 1TOCB 4J1YA 5EW1H 2LP6A 2SGDE 1LHEH 1YPJH 1BMFD 4Q2KA 1EJNA 5FX5A 2KFWA 3PV5A 3ZVBA 1ZJDA 2HVXA 1HJAC 1YBWA 4IN1A 1SR5C 1GCTB 1JIRA 1OWJA 1GHAG 3ITIA 1NZQH 1Y3XA 1SQAA 1BTYA 3ZZDA 1BTZA 3UQVA 4H6SB 3KF2A 2Y7ZA 1O39A 1HXFH 2HLCA 3EA7A 4B71A 2G00A 3BTHE 2SGFE 4FUJA 1GMCF 1F5RA 1MD7A 1ZGIA 2ZDVH 5F8XA 2D8WA 1KXEA 1LVYA 3K6YA 4ISOA 3LC5A 4FUDA 1HAPH 1TIOA 2JKHA 2FOHA 4BANB 1GG6C 4TPYA 2QAAA 1CQQA 4MLFB 5GXPA 1LO6A 3KEEA 2ODQA 3TVJB 1XXDA 2QCYA 3BV9B 1J15A 2ZNKH 3NWUA 4GPGA 1SKYE 1C1OA 3PTNA 3N7DA 1MBQA 2LNCA 5L6NH 2B9LA 2TGAA 1J14A 1SQTA 1A3EH 5DP4A 2ZU4A 4WMEA 1LMWB 1MKXH 3E1XB 4OS6A 4HG6A 5C1XA 1HAXB 2Y7XA 3BG4B 3MNSA 4K2YA 3SGQE 4RT0A 1ZPCA 1J17T 4JZIA 4BAKB 4X1RU 3BTEE 1VGCC 4BTTB 3SHCH 1DUEA 3O8CA 3ATIA 1HLTH 1GDUA 3SU5A 1V2NT 1O37A 1Y5AT 1VJAU 2ZWLH 1XKAC 3QZQA 3S0NA 4ABDA 2C93B 7LPRA 4FUBA 1A2CH 3HK3B 3PMJA 2FX6A 1W0KD 1SI5H 2XNDD 3ESTA 2QF3A 5A8XA 1IAUA 3ZYEA 1NU7B 1ARBA 1SVPA 1P3EA 3TJNA 2CXVA 1GBIA 3F9HA 3DFJA 1LHCH 1KIGH 5SGAE 4DJZB 2GMTB 1ELAA 1EOJA 1J8AA 2BVSH 1SPJA 2D26C 2FX4A 3SU2A 3UIRA 3GS9A 3V0XA 5A2MH 2QXGA 5HYOA 2FIRH 2BXTH 1SBWA 2HPQH 5GJ4B 2TGPZ 3P70B 1W11U 3LH1A 3P8NA 5EJ1A 1GDQA 1AVGH 1GL1A 1QBNA 1QY6A 2JH0D 4K8YA 3M35A 3QZRA 1TMBH 3F68H 3SV9A 2J9NA 2UUJB 1QCPA 1FY5A 1Y59T 3NRLA 1HAOH 3A87A 3LGVA 4Q7YA 2F9BH 4X2YA 4HFPB 1O5GH 4B76A 4ZROA 4OS5A 5E0HA 5PTPA 1OHHD 4E7RG 1TGTA 3SJ9A 3PMHB 5DN6D 1ELTA 5ABWA 1F0TA 3GOVB 3KNXA 2P94A 1O2QA 2B8OH 1UVOA 2WPIS 1Q2WA 3Q3KA 1S83A 1YLCA 3RLYH 2WPLS 3KQDA 3TK6A 1S82A 2BLVA 3RM2H 2AIQA 4O97A 2XW9A 1AUJA 1P03A 2IN2A 3LT3A 1K22H 3KL6A 4U2WA 3WW7A 1CHGA 1GWAA 1W10U 2ULLA 2ZGCA 2H5CA 2ZHDA 4MNWA 1P09A 4AB9A 1YP9A 4WH6A 1KLJH 4FVDA 4AGJA 2A7HA 4I8KA 1T7CA 1Y5BT 4A7IB 1TA2A 1UTLM 1UVTH 2XXLA 5T6FA 3U8RH 5DGJA 1F0SA 2ZDAH 3QGNB 4AZ2B 3SV6A 4JZFH 4A1XA 5EW2H 3PWBA 3ZZ5A 3V12A 1P2NA 1O2SA 4DW2U 1W14U 2Z9GA 3BEUA 3NUMA 1DPOA 2H2ZA 2P93A 1F92A 1G2MA 1SLUB 1JOUB 5FX6A 3F6UH 2BD4A 3AW0A 4D9QA 1L4ZA 3T2NA 5KEDA 1TBQH 1E1QD 2FI5E 3K6ZA 1QRZA 2ZU3A 3ZIAD 1ZOMA 5HKKD 2UWLA 3UNRA 1CU1A 2ZFPH 1E35B 4X6PA 4INLA 1KSNA 3FKSD 4LXBH 4WVPE 4NA7A 1MKWH 1HAYB 3Q00A 4F4OC 1MD8A 5AF9H 1T31A 1P2JA 7ESTE 2C8XB 4K8BA 2OP9A 2ZO3H 1W3CA 2JETC 1C5WB 1DY8A 3OY5U 1V2ST 3H5CB 3SHAH 4E7NA 5ESBA 1AFQB 1UVSH 2IJOB 2LELA 1KXBA 3LDXH 2XNIA 1C1MA 1GI5A 1O2XA 1SGPE 1UMAH 1GVLA 4HTCH 3TJOA 4AG2A 2ZCHP 1AVXA 1ELVA 1T8NA 1TX7A 1V3XA 2L6OA 2WPMS 4ABEA 3LGUA 2ANMH 1A5IA 3ZZ4A 1O3OA 4UFFH 1KLTA 3EYDA 1BZXE 2KCOA 4INHA 3KQCA 2NU4E 1HB0B 1TE0A 2CMYA 3MWIU 4Y0YE 1BUIA 1PPHE 4MNXA 2D1JA 1HV7A 1V2MT 3HK6B 1SMFE 1ID5H 2BDYA 1WCZA 1K1PA 2PGQB 1FONA 1SHHB 1WYKA 1VITH 3RXCA 3F9FA 4WJG2 3VB5A 3DFLA 3PRDA 5K7RA 5JBTA 5C0UA 2WPHS 4A92A 2PP6A 2GZ8A 1XUFA 1W2KH 2A7JA 3SNEA 3LH3A 1RD3B 4JYUH 2FMJA 1G3EA 1SC8U 1FQ3A 3LGWA 1O2IA 2BY9X 1PPGE 3KCGH 1N1LA 4IBLH 3S69A 5EGMA 1ACBE 1HPGA 3KQ5A 3M3VA 4FVBA 3LJOA 2ZGBH 1MQ5A 4JZDH 1S6FA 1FAKH 4YLQH 2AEIH
chains in the Genus database with same CATH topology
1C2MA 1FDPA 1MZDA 3DT0H 4XBDA 5A0BA 1ZMLA 3GISB 3E16B 4Z6AH 2ZFTA 2Z9IA 1EATA 4MNVA 1EZUC 4X2WA 1QR3E 1P57B 4MNYA 1LTOA 1XM1A 1C2LA 4K1EA 3BIVH 3GY3A 1EP6A 1O2RA 3TH4H 2FS9A 2XCNA 1A4WH 5FBEA 1C1SA 1V2KT 3GY4A 3U9AH 1EB2A 1LPGB 1M9UA 4AOQA 1QBVH 3QK1A 3K9XB 1F7ZA 3TK9A 4XOJA 1OSSA 5E2PA 3M3SA 1AU8A 1A61H 4TYDA 3GCTF 2ZU2A 3U1JB 3QTOH 1O33A 1ABIH 1YM0A 1CGHA 2ZG0H 5C5NA 4Q7ZA 1AY6H 3IITA 1NU9A 1PYTC 1A0HB 4A6LA 5LPEA 4GHTA 2GDDA 4H42U 2RA3A 4IC5A 4THNH 5GPIB 2Z94A 1BMLA 2GT7A 1X7AC 1FI8A 1F5LA 4GCHG 3LC3A 2HPPH 1BTHH 1TPPA 2NU1E 4X1PU 2FI3E 1SGTA 3KHVA 1O2YA 1O2JA 1SQOA 2Q6GA 1AKSA 2BLQA 3BTQE 1P2OA 2FP7B 1GBCA 3PMBB 3A8BA 5DO4H 1GI0A 1FY1A 4CHAB 2KAIA 1VZQH 2GCTB 1KXDA 4D9RA 2PFEA 2J2UA 4FU8A 3A82A 3RC6A 3RC5A 1KDQB 3U8OH 2AGGX 3MNXA 2ZECA 1C5OH 4JZ1A 4ZUHA 1HIAB 1BJUA 1EAIA 1OWHA 1XMNB 4Y8YA 3OYPA 4KTUA 1LVOA 3P95A 4KGAA 3QLPH 1MKXK 3MU5A 2P8OB 3EE0B 1NRNH 3SUGA 3ATWA 5JB9S 2PUQH 2Y5FA 3LONA 4MDSA 3RLWH 1FN6A 2BLOA 1HJ9A 1SLVB 1B0FA 2PKSB 1BITA 1C2EA 4YZUA 3BIUH 2VINA 3RP2A 3D62A 4JYVH 1O2GH 1NPMA 1UK4A 4OS1A 3UNQA 1QJ6B 4CH8B 8GCHF 2GGVB 1HFDA 5GCHG 1CT4E 2R3YA 4CRFA 3GY5A 2FOCA 3C27B 2VU8E 3NXPA 1DM4B 4ZAEA 1U6QA 2SNVA 3E0NB 4JZEH 1BT7A 2EC9H 6CHAC 3C1KA 4F49A 2F9VA 3AW1A 1IOEA 3SV8A 1BQYA 2ZZUH 4X8TH 2XC0A 3ENSB 3U69H 1Z8JB 4IMQA 2O8LA 5TCCA 2XWBI 1C5RA 1ZYOA 3PWCA 1QL8A 3G01A 1P9UA 1FUJA 1N6XA 5HM9A 1PPCE 1QIXB 2ZU1A 1O3IA 1D3TB 1MU8B 1XUIA 1QFKH 3QUMP 1K1MA 3B9FH 3T25A 2O8MA 2CV3A 1YPHE 4I33A 4NZQA 1MTUA 1O3FA 3A7XA 2BY7X 3A7YA 3E0PB 2UWOA 1O5CB 2Z9LA 1C2FA 4X8SH 1KTSB 2P59A 2XBVA 2W5EA 2HALA 8KME2 1OOKB 2BY6X 1PQAA 4IS5A 1O35A 1TGNA 1GGDC 1A1RA 2ZFQH 4ESTE 1NFYA 4XBBA 3SQEE 3WY8A 1ZSJA 2WPJS 3KQBA 6LPRA 1GJ9B 1AZ8A 5DJ7A 3RU4D 2Z3EA 2SGAA 1EKBB 3CP7A 3MYWA 5H4IB 2ZU5A 1FZZA 4BAMB 1QTFA 4YOJA 3A89A 3RXUA 4Y71A 4AG1A 3A84A 5EOKA 1RTKA 2OQUA 4OS2A 4CBOA 4NG9H 1LKAA 4I8JA 4DURA 1Z71A 3U8TH 1O3AA 1IQMA 4GSOA 1FJSA 1SOTA 2V6NA 5FPYA 4ZH8A 2BM2A 1SGEE 3SU0A 3MH4A 1O2TA 4CBNA 1V2JT 1WQVH 3HKJB 3E91A 3MH5A 1UTJA 1AFEH 1O31A 1OX1A 3SGBE 2ZQ1A 1CE5A 1ETSH 1OKXA 4B1TA 2C8YB 4CREA 4B2CA 1TPOA 1FY3A 2BOKA 1A3BH 1O34A 1W8BH 3LGIA 1CGJE 1ZHRA 1UTPA 1C9PA 1YF4A 2W26A 1N8OC 2A31A 3KGPA 2GCHF 1GMDF 2AGEX 1TPSA 5BPEA 3HGPA 2BTCE 4BTIB 3TH3H 2A4QA 5A8ZA 2C3SA 1DOJA 1VCQA 3L6PA 1TNHA 3H7OA 4I8HA 1HAHH 1Z8IB 1BJVA 1IQGA 3ZVEA 1EB1H 1NT1A 1P10A 1KXAA 1C1WH 1AN1E 4DCDA 3LKWA 5CE1A 2FYQA 2GVFA 2PSXA 2BMGB 5CHAC 1P2QA 1PQ8A 2FDAA 1Z1IA 1PQ7A 1TX8A 2FOEA 3MNCA 1P2MA 1SGRE 3P92A 4BAOB 4YM9A 1ZMNA 2GDEH 4O9VA 1UTNA 1V2PT 3GYMA 4DVAU 2IPHA 4U01A 1O2UA 2A4OA 3PM3A 1BMNH 1HYLA 3SN8A 3T27A 1ESBA 3TLOA 1E36B 2ZGJA 3S7HB 4OGYA 1LCYA 1O5EH 1HNEE 2ASUB 1SGQE 1CO7E 3MI4A 4LOYH 2WINI 4K3JA 1CSOE 3RXPA 4PROA 3JZ1B 1IHSH 2VH0A 4X1NU 1UK3A 3SU1A 1W12U 2I6QA 3U1IB 1FMGA 2H5DA 1AB9C 1GMCG 2F9NA 1C5UA 1CT0E 4NFEA 1XXFA 4SGBE 1EJAA 3TU7H 2OTVA 1AWHB 1GI1A 2XCFA 3GCHB 5IDKA 3SW2B 3FAOA 1LHFH 1A46H 3A88A 2BX3A 4AYVB 5ESTE 1G32B 1G3DA 1GBHA 1QRWA 3PO1C 3MTYA 1AO5A 9LPRA 4MQAA 1ELGA 3GDSA 2G4UA 2CF9H 1O2PA 2ZDKA 2BD8A 1NRQH 4CR5A 3S9BA 2F9UA 2OQ5A 2FWWA 3ZZ8A 2AMDA 1PPEE 2HNTF 5LH8A 1K1OA 1EPTC 4X8VH 2QC2A 3MFJA 2AS9A 4NWLA 3Q3YA 1HAZB 3M61U 4KTCA 2OXSA 2W3KA 2BDHA 2G52A 3TNSA 1BTPA 2FTLE 2H9EH 3FZDA 5C3NA 2D2DA 3MO9A 1TNGA 1IHTH 2BQ6B 1E34B 4XBCA 1ZJKA 3W94A 1TABE 3PB1E 4Y8ZA 1MTSA 1TRNA 3QTVH 2EI8A 1PPFE 1W0ZU 1T4UH 1AE5A 1TOMH 1WU1A 1EXFA 2VJ1A 3MO6A 1QL7A 1A0LA 4NGAH 5E0JA 2Z3CA 3I77A 4FUIA 1DLEA 3ZZ9A 3UTUH 2CHAC 2SGEE 2XC4A 4K69A 2Z9KA 2V35A 1GJBB 4Y0ZE 3SNAA 2VWNA 2BVRH 1GGDB 1RIWB 3D65E 1A5GH 4RN6A 3UR6A 1Y5UT 2IOTA 2PKAA 2TRMA 3BN9A 3U98H 1H9IE 1W0YH 2PV9B 5C1YA 2ZHWH 1MCTA 4MPXA 3GY7A 1UTMA 1T8LA 5GDSH 1MTNB 2R2MB 2RG3A 3VFEA 2C8ZB 3RXMA 1OS8A 1QQUA 2ANWA 1O38A 2AFQB 2BVXH 1E37B 1XX9A 4O3UA 1BTXA 5AFYH 1TBZH 1J16A 1BIOA 3VGCB 3UQOA 2UUKB 4K1SA 1KYNA 4FXGH 6ESTA 3TIUA 1CBWC 2J34A 1DICA 4FUCA 3F9EA 3NKKA 3URCA 3PROA 3GY6A 4MVNA 1G3BA 5E8EH 5DP6A 4JK6A 2STBE 2J38A 2YOLA 3ODDA 1L1NA 2NU3E 2ZTYA 1SL3A 1GHXH 3MMGA 1AVWA 1OWEA 1GJ5H 1C5XB 1GBEA 1P3CA 2WYGA 2FO9A 4Y6DA 3GDVA 1GCDA 4X0WU 1HCGA 2CGAA 2GTBA 3O8RA 1O3DA 4R0IA 3TK5A 1EQ9A 1DWCH 2YNAA 5JB8S 1FNIA 1XUKA 1EX3A 2ODPA 3E3TA 1NY22 2QYIA 2ZDNA 1GBLA 2SGQE 1YKTA 1O2WA 1VJ9U 1HJAB 3DUXH 1C5MD 3GCNA 2PR3A 3RU4T 3FZZA 1GJ7B 3Q3XA 4O03A 4RKOB 1P2IA 1YC0A 1ZTLA 1TFXA 4ISLA 3SBKA 4YT7H 4XFQA 4BTUB 4LZ4B 4VGCC 4R8TB 2WPKS 1AWFH 2WUBA 1F0UA 1HGTH 4BXSA 2A4GA 5AFZH 4YTAA 1SFQB 3SNCA 1S0QA 3LIWA 1SFIA 3SUEA 1JXPA 1SGCA 1V2TT 2ZIQH 1V6DA 2ZFRH 1EPTA 1GG6B 3SU4A 1GHWH 2UUYA 1SGYE 3M7UA 3A8AA 4MPUA 5HGGA 3SU6A 3SI4H 3K65B 2TPIZ 1JRTA 1V2LT 4E05H 1P0SH 1GVZA 1P11E 1TRMA 4NIVA 4JYTA 4NIXA 1JBUH 3SNBA 5A0AE 2GZ9A 3RXIA 1ANBA 4CR9A 4DG4A 3FP8E 1MTVA 2XRCA 2VGCC 3DD2H 1FAXA 1GJ4H 3OU0A 1GJDB 1G2LA 2Y6TA 2P3FH 5E2OA 3OSYA 1EJMA 1VGCB 5F8ZA 1GDNA 3A85A 1QL9A 5J4QA 1TNLA 2HWLB 3TJUA 1K1JA 1Y3VA 1ZHPA 1MQ6A 1ZRBA 3CS0A 4UDWH 1FIWA 1QB9A 1O2VA 3BEIB 1Y3WA 4QT8C 4MPWA 5EPYA 3L3TA 1YPEH 2PLXA 4A1VA 1HAVA 1Y3UA 2BY5X 2THFB 1C5YB 2BB4A 3TNTA 2FXRA 1C2KA 2K1QA 2R0LA 2UUFB 2QY0B 3QGJA 2A2XH 3UOUA 2Y5GA 3UOPA 4OS4A 2HRVA 2A0QB 2BQ7B 1THSH 3GCTG 1QJ7B 1K2I1 4TPIZ 1EAXA 2BHGA 4K1TA 2ANKH 2SGPE 1T32A 2FTMA 2ZQ2A 1O3EA 4ZXXH 2GX4A 1BCUH 1DDJA 1FLEE 1O2OA 3Q76A 5K0HA 1PJPA 1FN8A 3K2UA 4Z0KA 5F6MA 1DSUA 2TGDA 1TWXB 3LGTA 3SJOA 1QJ1B 4GHQA 1BA8B 1SB1H 1BHXF 3KN2A 3SOSA 1L4DA 2M5TA 1QBOA 4B73A 1GBTA 5DPAA 2VVVA 1EASA 2H9HA 3RUOA 1ETTH 1NM6A 1V2OT 1G30B 3SI3H 2G4TA 1IQHA 1K1NA 5EU8A 4KELA 1O0DH 3SV7A 1YCPK 5DP9A 3ZVAA 4X6NA 3ZZAA 1Z6JH 4ABGA 4ABIA 4RSPA 2H1UA 4FU9A 2VVCA 1GCTC 1ARCA 4IC6A 5J4SA 1VCPA 4ISNA 3PV4A 1AKSB 1SGDE 2G51A 4MTBA 1BHXB 2KAIB 1DWEH 3E6PH 2FEQH 1WSSH 2B5TB 1DFPA 1D3DB 3QWCH 1C5SA 3QDZB 1UVPA 4JCNA 4UONA 7GCHF 1C1VH 2XBXA 2V3OH 1JWTA 2A2QH 3O8DA 3AAUA 5DP3A 1K1LA 3MH7A 4MPVA 4A5TS 1H8IH 3GICB 1C5ZB 3A8CA 4WMFA 1O3PB 1RTFB 2A45B 3RDZA 1C1PA 3LPRA 3N7OA 3PLKA 4FU7A 5AHGH 4ZHLU 1TRYA 2ODYB 3A80A 2GZ7A 1K1IA 1W13U 1OWDA 2JETB 1TALA 8GCHG 8LPRA 1JRSA 3LOXA 1QNJA 2AH4X 4NCYA 1SGFA 4Y11E 3V7TA 3M5NA 1GHVH 4UE7H 1NRPH 2QXJA 4WF8A 4K5ZA 3SQHE 4DIIH 2BQWB 4AFQA 1Q3XA 2FOBA 3AVZA 1GJCB 1BMMH 4BXWA 3BG4C 3SNDA 2DUCA 4VGCB 4YESB 2BYAX 1NESE 1SSXA 1O3MA 1O5BB 1PFXC 1MCVA 2W3IA 1LPKB 1AD8H 1OYTH 4AYYB 1TGCA 2BD2A 2Q1JA 2ZPQA 2W7SA 1TYNA 1ORFA 1BRAA 2FOMB 2A5AA 2QXHA 2Y82A 1IQKA 3S9CA 1SHYA 3RXFA 4X1QU 1ZTKA 4ISHH 3TJVA 2FLRH 1TAWA 2PTCE 1IQJA 1TNKA 2XYAA 5JYIA 4FUGA 3RXEA 1MAYA 2J94A 4YLUA 1O5AB 2H9TH 1TMTH 1ESAA 1F0RA 6GCHF 3BG8A 3QO6A 3HKIB 4KP0A 4ZKRU 3ZV8A 2GMTC 1P05A 3SGAE 2TBSA 2JH6D 4HZHA 3LJJA 2G55A 4ZXYH 1D3PB 4AN7A 3GY8A 5EODA 1EAUA 1UHBA 3QX5H 4NZLA 1CGIE 1KTTB 4GVUA 4TWYA 2ILNA 1GI3A 1O2LA 5ETXA 2STAE 1C2GA 2V3HH 3R3GB 2ZEBA 2RCEA 2HGTH 2PWXA 1BRCE 2OLGA 3SJ8A 1AI8H 4JK5A 4WXIA 4I7YH 1Y3YA 3MHWU 4UD9H 3RXAA 1TQ7B 5A09A 1DWDH 1BBRK 1B5GH 1ESTA 2O9QA 3PTBA 3BEFB 4ABJA 1HUTH 4YO9A 3BF6H 3FFGA 5DP5A 2ZHFH 2XWAA 5FPSA 1B7XB 1YYY1 2OC8A 1TBRH 2I6SA 1V2UT 1P8VC 2CF8H 1TA6A 3CS7A 4Y76A 1T8OA 2BD7A 1OYQA 2AMPA 2ZHQH 2ZA5A 1E38B 2BZ6H 3RU4E 3RC4A 3SZNA 4GUXA 4DT7B 2AIPA 1GHYH 2GCHG 1GMDG 2AMQA 4YOIA 4CRGA 3ZVDA 3ZVGA 2OC7A 2BDBA 1WUNH 1GPZA 1GHZA 5E0GA 2DE9A 4WMDA 4UFEH 1MTWA 1ZSLA 4IMZA 1D6WA 3B23B 1UCYK 1NS3A 5LGOA 1QURH 5TJXA 1HAIH 4AFSA 1B0EA 3RXOA 1RTLA 2QF0A 1UTQA 3M3TA 4WY3A 1CA0C 1GI7B 3TH2H 2ZHEH 3FP6E 3I78A 3NK8A 2EI7A 3GY2A 4H6TA 4ABFA 1A0JA 2VIQA 3BTWE 1BRUP 2OD3B 1H1BA 4MG3A 4NIWA 1RS0A 1L1JA 5EG4A 3RXRA 1TGSZ 1WAYB 3M7TA 1AUTC 4HI3A 2R2WU 4IGDA 1S6HA 2R3UA 1O3GA 2PSYA 1EZXC 1WQSA 1THPB 1FPHH 2PW8H 4GAWA 2ZDLA 1O30A 3ATKA 3R0FA 1ELCA 5C5OA 2QA9E 1GHAF 1OP8A 1AFQC 4WWYA 2ESTE 2VH6A 3ZZ7A 4Y10E 2BD5A 5FHTA 2RDLA 1YPMH 4IW4E 1GBMA 1GVKB 4Q80A 1V2VT 4FUFA 3UNSA 4AX9H 2OUAA 1YPKH 1AMHA 4LK4A 2H6MA 4AFZA 5CMXH 2BX4A 5FBIA 1INCA 4B75A 4D76A 2SFAA 1PPBH 2Q6FA