4X1SU

The crystal structure of mupain-1-16-d9a in complex with murinised human upa at ph7.4
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mupain-1-16
publication title A cyclic peptidic serine protease inhibitor: increasing affinity by increasing peptide flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
total genus 59
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1sU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1sU01
4A1XA 1HNEE 3F6UH 3SNDA 4A1VA 4IBLH 6ESTA 3ATWA 2QN5T 1ANEA 3ZV8A 1MMJN 2UWPA 4ISHH 2Z94A 1ANCA 5E0HA 3SUEA 3UIRA 3NZIA 2ZC9H 4AOQA 3ZVGA 1HJ9A 5EQRA 1GI8B 1V2RT 2P95A 3LGVA 1JXPA 5LPEA 1GJAB 1SGDE 2JH6D 1GBMA 2ALVA 3GISB 4H42U 4KP0A 1O2QA 4JZIA 4NZLA 3LGYA 2H9HA 1TQ7B 1O5AB 1TGSZ 2VGCC 3SO3A 4OS2A 5A8YA 1XUGA 2C8WB 1RIWB 1SHHB 2BD9A 1T8LA 1TGBA 1DOJA 3LJJA 4ISOA 2BVRH 4ABAA 1A0LA 2BD4A 1AUJA 1BRAA 1E37B 1GBTA 2IPHA 1K1IA 1F92A 1QCPA 3CS7A 1CA8B 2BDCA 1EAIA 4OS7A 4NWLA 1INCA 1QURH 3DHKH 4MNYA 1EPTB 1O2OA 2LNCA 4RN6A 5ABWA 4MPUA 1QIXB 1Z7KA 1YPKH 1C5PA 1ZHRA 1P9SA 3SW2B 1EP5A 5EXLA 1KY9A 1DSTA 5HGGA 3PTNA 4K1SA 2ZHWH 2V35A 3MNXA 1UVTH 3Q3XA 5F6MA 1F5RA 3BSQA 5HM9A 1UTPA 3U1JB 1O2YA 2YNBA 1YF4A 5JPMH 4X1QU 2Z9JA 1O3HA 3A87A 2Z9KA 1BQYA 1AFQB 3FP7E 1IQGA 2BTCE 2ZHEH 4NIVA 1VJAU 1HAVA 2ZTXA 1T32A 2EI7A 4UEHH 1GBFA 1FY4A 1MCVA 1MKWK 4ABFA 2IOTA 4GCHG 2KAIA 4B2CA 1TFXA 1EKBB 3NXPA 5F03A 2BQWB 1MH0A 1AO5A 2ODPA 2XXLA 4ASHA 1ZHPA 3M5NA 2AMQA 1AGJA 1O3GA 2R0LA 3BTFE 2BHGA 1Q31A 3V3MA 4X8UH 1GDUA 3SGAE 4ABJA 2R0KA 3P92A 3SUGA 2C93B 4FUEA 3IITA 4D9RA 1TX6A 1WQVH 1LMWB 1TALA 2ZGCA 1SGTA 1VCQA 1OWJA 3K6ZA 3S7HB 3ATMA 4SGAE 1TNKA 2Z3EA 3BN9A 1GI7B 1KLTA 3U69H 1SC8U 1ZSJA 3VB4A 1BA8B 3IG6B 8KME2 1TBRH 2A2QH 4OGYA 3ZZ9A 2KAIB 3WY8A 2P8OC 3A85A 9ESTA 1D3QB 4H4FA 1DE7H 1UK3A 2FX4A 2HALA 1OSSA 3MHWU 2O8WA 1ZLRA 1C1VH 2ZQ1A 2Y81A 3BTWE 3STJA 2ZPRA 4THNH 3VB3A 3ZZ5A 1IOEA 3TH3H 2Q6FA 4BAMB 4CH8B 1V2VT 2CF8H 2PWXA 3GCHC 4GCHF 3KQBA 2Z3CA 3BEIB 1YBWA 2SGFE 2ZQ2A 1VCWA 1YLCA 1AVXA 1J9CH 2VIDA 3MU4A 2FOAA 2JETB 2Y5HA 4BAQB 1YPEH 1O3JA 3U1IB 2ODQA 1KXFA 3MWIU 1XVMA 3RXPA 2H5CA 5CMXH 4FU7A 1YPGH 4BTTB 3RC4A 1BTPA 2QY0B 5JDUB 1K1NA 2O8UA 2R3UA 1VITF 5C5NA 1FLEE 1P2NA 1LKBA 4IGDA 1QNJA 3MH4A 4LZ4B 2XBWA 2QCYA 2VH0A 1PQ7A 1AHTH 2J9NA 1LKAA 3S0NA 1F0RA 2G00A 2STBE 2RDLA 1DFPA 2OC8A 1SB1H 1ZZZA 1VGCB 3PMAB 1YYY1 2SGDE 2VB0A 5J4SA 2QAAA 1UTLM 2VIPA 2FO9A 1DX5M 2VU8E 3FP8E 1V2WT 1E0FD 4YOJA 3A80A 3RXMA 3ATKA 5E2PA 2PR3A 4X1PU 3SI3H 2XC4A 3KF2A 1TE0A 1FY3A 1DLKB 3GDVA 1O31A 3A8DA 3M37A 4X8SH 3KN2A 2CXVA 1SHYA 1CHGA 1OX1A 3PLPA 4OS5A 2CMYA 3QN7A 1C9PA 1AY6H 2XCFA 1C5MD 1J15A 1JOUB 2G5VA 1D6RA 3E1XB 1RTLA 4IW4E 4X2YA 4U30A 1TYNA 2GP9B 1GI5A 5A0CA 3RXBA 2R3YA 4E7NA 4DOQA 3TGIE 3ZVDA 4AFZA 1GBIA 1QL9A 3RU4E 1Z71A 3NKKA 3SJ8A 1MCTA 1G37A 2ILNA 4WXIA 1XXDA 4XBCA 1HAPH 1O5DH 1GG6C 4YO9A 1NC6A 2A4RA 1ZPCA 4IMZA 1ZSKA 1W8BH 2QIQA 2WPKS 4IMQA 5JYIA 4JK6A 2QF0A 3RMLH 4CRBA 2ZCKP 3PYHA 2FOFA 1V2UT 1HYLA 3VEQB 2A31A 4K1EA 2VJ1A 4Z0KA 3ZZAA 3JZ1B 1MD8A 1OPHB 1OP2A 3E0PB 5DP4A 1GI4A 5EXMA 1SGEE 1C4Y2 1F0TA 3TK5A 4D9QA 3FANA 1GWAA 2ZDVH 1Q2WA 1T7CA 2ZTYA 1Y5BT 1YPMH 1CBWC 4FUDA 4A1TA 1V2MT 3C27B 2P3FH 3TNTA 3QWCH 3AAUA 1QA7A 1TRNA 3MFJA 3QTOH 1GVKB 1XUJA 2BQ6B 1CU1A 1ELAA 1BDAA 7GCHG 2G8TA 2VH6A 2A5KA 1SLWB 4NA9H 1QJ6B 4IN1A 1FY1A 4K8YA 1QQ4A 1GDQA 1TNIA 2BLQA 3RLWH 2BQ7B 4TYDA 2V0BA 1NZQH 2WPMS 4ABGA 4TPYA 4CR5A 2GV7A 1L2EA 2ASUB 3T5FH 3SV6A 1MTVA 2FOGA 4NCYA 1P2JA 3N7OA 2UUKB 1RTKA 1UCYK 2AERH 1P2IA 3BIVH 4X6PA 1UO6A 2WPIS 1QQUA 1AZ8A 2LPRA 3MNBA 3TJVA 1O2LA 3RC5A 4OS1A 2HOBA 3P8FA 4FU9A 4XFQA 2VIOA 2PW8H 1ESTA 3NCLA 1P3CA 3H5CB 1CGIE 2VGCB 3RM2H 4DVAU 3O8BA 1A2CH 5EPNA 3SBKA 4K1TA 3TNSA 1JWTA 3MNCA 2XC0A 2B8OH 9LPRA 4DG4A 1FY5A 3URDA 5L2ZH 3F9FA 1A3EH 1Y5UT 3A8BA 5JB8S 1JBUH 4GPGA 2ALPA 1RGQA 3HKIB 4GAWA 4Y11E 4BAOB 1NM6A 1S5SA 2B5TB 3O8DA 2F9BH 2BLWA 5CE1A 5DP5A 1V2OT 5TJXA 3RXLA 1IQEA 2NU1E 1CT0E 3MTYA 3ODFA 5A8XA 1C5SA 1H9IE 1TONA 1D6WA 4KGAA 1S81A 2UUFB 2J4IA 3GY8A 5DP7A 1LPZB 2BM2A 1N6XA 1GL1A 1P0SH 1MQ6A 1K9OE 1CO7E 1IQKA 2WPHS 1G3CA 1EZUC 3H7OA 5TCCA 3SUDA 1C5QA 3AASA 4NIYA 3BG8A 3GY7A 1ETRH 1DT2A 2ZGJA 1A0JA 1NT1A 1XXFA 3P17H 3SNEA 4X1NU 5FPTA 1BTHH 2GCHG 3GYLB 3L6PA 3A7XA 2BDBA 1UVPA 3A7TA 5HM2A 3Q76A 1GBBA 1GHBG 1M9UA 5JBAS 2CV3A 2ZDAH 1ABJH 3B9FH 1HAHH 1EXFA 1MBMA 4YLUA 5C1XA 1IAUA 1LDTT 1O2VA 2FOHA 2F91A 3QGJA 1OXGA 1FIZA 1WAYB 2FEQH 4INKA 4WJG2 1SQOA 1F5KU 1V2PT 4WWYA 1P02A 2GV6A 3LJOA 4X1SU 3TITA 3ZZ8A 4CRAA 3L3TA 2G55A 1TBQH 2C8XB 4FUBA 3S9CA 1EATA 4TY7A 4I8HA 3MU1A 4TWWA 1H4WA 4WVPE 1HUTH 1O32A 4KKDA 5DGJA 1LCYA 3AW1A 1WTHD 5K7RA 2ANWA 5EODA 8LPRA 3T25A 1GMDG 1BMLA 4XOJA 1KLJH 2Y5FA 7KMEH 1V6DA 4FUHA 2H1UA 2G4TA 1XMNB 2JH5D 5L2YH 2ZU1A 1NESE 2DUCA 3FZDA 3HK3B 1P09A 1Z1IA 1D4PB 2VWNA 4FUCA 4TWYA 4VGCC 4CRGA 1SPJA 3TJOA 3ZYEA 5FX5A 3K2UA 1QRZA 2XTTB 2NU3E 2H6MA 2TGDA 3GCHB 1O5FH 4YOGA 2JKHA 3V7TA 1SR5C 5DPAA 3GCNA 3SOSA 2IN2A 4FUJA 3OTJE 4NA8A 1BBRH 2WUBA 1Q3XA 4CR9A 2FOMB 4YZUA 4O3TA 1JMOH 1S82A 2B9LA 1FN6A 3MO3A 4ZMAH 1RXPA 3UY9A 2FX6A 3VPKA 3GY5A 1UTKA 5FBIA 4J1YA 1Y3XA 1V2LT 3BG4C 4GVUA 1WU1A 2RG3A 2P93A 1GMCG 5ESBA 2OTVA 1G32B 1UTNA 4AG2A 1PQAA 3F9GA 1O36A 2BDYA 1C1UH 1X7AC 1UTOA 3RXKA 2DE9A 2HPQH 3PB1E 1ANDA 3ZZDA 1GBJA 1W12U 2TBSA 5C3NA 3ZZ7A 1THRH 2V3OH 3BTDE 4ZXYH 4ESTE 4X6NA 1W7XH 1BRBE 3AW0A 1GMDF 1CHOF 2FLRH 2XWAA 3KQCA 1QB9A 2PHBA 5H4IB 3MMGA 3CS0A 1SFQB 3SV8A 4BXSA 4MG3A 3OY6U 1MKXH 1MTUA 2GDDA 3SJOA 1PPEE 2ZGXH 1W11U 3W94A 3PO1B 1DS2E 1SQTA 1CT4E 2GT8A 1MU8B 2NWNA 2BDAA 1GBDA 2H2ZA 1SGRE 3KHVA 5A2MH 2ZEBA 1BMAA 3S9AA 4GLYA 1SBWA 3E90B 3GCTG 5F8TA 1EPTA 3BTEE 3VXEH 1TX7A 1D3DB 1FPCH 1KXCA 3UPEA 3SUFA 1BJVA 4X6MA 5HMAA 1O2NA 3T28A 1GG6B 1GMCF 1SMFE 3G01A 1ZOMA 3K9XB 1GHXH 1TBZH 1HAZB 1E35B 3I29A 3VB7A 1SVPA 2AIPA 1O38A 3DFLA 3P8NA 2A7HA 2EA3A 1EB1H 3A82A 2ZGHA 4WF8A 2GGVB 4CHAC 5FCKA 5JBTA 1O2SA 1YP9A 3MNSA 3E16B 2VWMA 1HCGA 2OINA 4BAHB 2VIQA 1KTTB 1S6FA 3T29A 2Y7ZA 3ESTA 3RXIA 2M5TA 3UNQA 5TCAA 4JMYA 4TY6A 1G30B 1DWDH 1P2KA 1CBWB 2AH4X 1Y5AT 5J4QA 3A7VA 4JYVH 3UR9A 4Y10E 2C4FH 2I6QA 3M7QA 1PYTD 4KTUA 1GVLA 3P8GA 1WV7H 2BY7X 1UHBB 1LHGH 1DPOA 1EUFA 4ZXXH 3BV9B 1YM0A 2ZA5A 2G51A 2W3KA 1SGFA 2C90B 3UQOA 7ESTE 4XSKU 1AVWA 2G81E 4ISIH 4BTUB 2TGTA 4MLFB 2A7CA 1OKXA 2OXSA 2ESTE 1SFIA 4UONA 1EJAA 1AB9B 2NU0E 2OC7A 2UWOA 2FOEA 1RJXB 2AEIH 2ZHQH 4HI3A 1GBKA 1PPBH 3PWCA 2B7DH 1LPKB 4B2BA 1QY6A 2P3UB 1GCTC 2FWWA 4DW2U 5GCHG 1NRQH 2FS8A 4ABBA 1FAXA 1ZR0A 1ELFA 2QXJA 5E0JA 1ETSH 4FUIA 2ZKSA 2PGBB 1OWHA 3ZVEA 1G3BA 4LOYH 4CBOA 1C1OA 1RFNA 2BD7A 2W26A 3D23A 4QT8C 1H9LB 5LPRA 1FY8E 5DG6A 2SGPE 3A84A 1O5GH 3U8OH 1NRSH 4HZHA 4IS5A 4Y7AA 4BAKB 1A5HA 5FPYA 2P94A 5FBEA 3QTVH 1O3KA 1YCPK 2XRCA 1K2I1 4I8JA 3RU4D 4WH8A 1HAIH 2BD3A 5EW1H 1FV9A 1DY9A 3M5OA 4NSYA 1OYQA 5EQSA 5FPSA 5AHGH 2ZU5A 3L33A 3PWBA 1LVMA 1V2NT 1C2LA 3H7TA 1LHCH 1QJ7B 1HB0B 1WQSA 3BIUH 1QL8A 2D2DA 3M7TA 4FUGA 1SGCA 3MH7A 4YLQH 2QC2A 4I8KA 3UR6A 1C5RA 1W0YH 1ZJDA 3FP6E 2BY9X 1GVZA 5GWZA 2OQ5A 1UTJA 1N8OC 1W10U 3VGCC 4UFEH 2XBVA 1SI5H 5EOKA 4DIIH 1TMUH 1H8DH 3EA9A 1C2DA 4DCDA 5JBBS 1TABE 3RC6A 1DWBH 4BXWA 3GICB 1QR3E 1V2ST 1GI2A 2FTMA 2ZDNA 3ZVFA 2GCTC 3S9BA 4DT7B 3UREA 2GX4A 4CRCA 6CHAC 4DIHH 3SI4H 2BLOA 1YPHE 4WMFA 5L30H 1T4VH 3UOPA 3PMJA 1MTWA 1ETTH 1TQ0B 4HFPB 2VIVA 1IQFA 1W13U 5JB9S 1NRNH 4UFGH 2WINI 3MU8A 1IHSH 5HXFA 1TLDA 4JZFH 2HNTF 1ELVA 3FZZA 1LTOA 1G2LA 4HGCA 1XM1A 1PQ5A 3SU2A 2IJOB 1C2EA 3UOUA 2SNVA 3RM0H 2BVXH 2BZAA 1GDNA 1GJ7B 1MU6B 3BTQE 1TNJA 3RUOA 1A3BH 1C1RA 1KDQA 1MQ5A 1C5YB 1O2RA 1S0QA 2BXUH 3GY4A 4CRFA 5E2OA 1GGDC 1L1NA 4WMDA 5T6DA 1S0RA 2XW9A 1B5GH 4K8BA 1F2SE 4ZHLU 1AI8H 3BEFB 2AMPA 1T31A 2A7JA 3FAOA 1C2KA 2FTLE 1C5VA 3SU6A 4CREA 1O3IA 1Y3VA 1TX8A 3ODDA 3PO1C 1OWKA 2A0QB 4JCNA 1O2MA 1K22H 4H6SB 4MNVA 4NSVA 4NZQA 1OWEA 2A1DB 1NFWA 4OS6A 3QZRA 3QGNB 4I31A 1BHXF 3D62A 2HGTH 2H5DA 2FYQA 4GSOA 1A4WH 1O2UA 4FVDA 4VGCB 3ZZ6A 1NU9A 1ZMLA 2UUJB 1GJCB 1P06A 4TPIZ 3SU1A 1XUHA 1TWXB 2RA3A 2SGEE 2ZHDA 2DE8A 1KDQB 2ANKH 2TGPZ 4I8LA 1XKAC 2GZ9A 4Y0YE 3TLOA 2BVSH 1MKWH 1XX9A 3Q00A 4FVBA 3RXOA 1DWCH 3F68H 1E36B 4FU8A 2A4QA 1O39A 1MTNC 1YPLH 2W7SA 2BOKA 3BG4B 1OYTH 3VB6A 2ZCHP 1H8IH 3A7YA 1GHAG 2BXTH 3LGUA 1YKTA 1Z8IB 3ZYDA 1XVOA 4ZROA 3E8LA 5C5OA 1KIGH 1HXEH 2OBOA 1H9HE 3MI4A 5DK1A 2GZ7A 1GBHA 3R0FA 1P2OA 3R3GB 6LPRA 1NTPA 1GHVH 1BBRE 1PFXC 1SL3A 3OYPA 5I25A 1D3PB 1P04A 2G5NA 1O37A 1FIWA 2FXRA 1P03A 3QZQA 4FUFA 1TIOA 1QBVH 3NWUA 4X2VA 5EXNA 2THFB 2PSYA 4MTBA 4ZHMU 1HLTH 4AG1A 3A7WA 4Y6DA 1BIOA 3NK8A 1AB9C 5A8ZA 2B0FA 2EEKA 2QGRA 3TU7H 2FMJA 4AYYB 4K3JA 2A32A 1TPOA 3ZVAA 1T8NA 1LVBA 3PV4A 3M3VA 2SNWA 1O33A 3UNSA 1FN8A 4FXGH 1C1QA 1V2JT 2FS9A 1FDPA 3HKJB 1Z6JH 1NRPH 1UK4A 1BBRK 1BRCE 1BITA 2STAE 4B71A 3M3SA 1TA2A 1TB6H 1W2KH 1PQ8A 1GHAF 2ZCLP 5L6NH 2RCEA 2FIRH 1LVYA 2FOBA 5G4BA 1LQEA 1VCPA 2ZNKH 1MD7A 1V3XA 3ATIA 1B7XB 1GI3A 1C5XB 1D9IA 1LPGB 1SGIB 2OCVB 5AVDA 1SG8B 5LPFA 1KYNA 4XBDA 8GCHG 1RS0A 1FMGA 2HVXA 4NIWA 2F9UA 1S83A 4CHAB 1FJSA 1PPFE 1SOTA 3PMHB 1BMNH 2PSXA 3TGJE 1F7ZA 4AB8A 4AZ2B 3STIA 5IDKA 1C1WH 1CGJE 1ABIH 4JZEH 1C4V2 5IYTA 4D7FA 5DP9A 1C5NH 1AKSB 3DT0H 7GCHF 2TRMA 4AN7A 3P70B 4KELA 1CA0B 4AYVB 4UFFH 2ZFTA 2NU2E 2FOCA 3LONA 1O2KA 2BX3A 2AS9A 3UUZA 2G52A 7LPRA 3RLYH 1GBCA 2WV5A 1ZSLA 1AFEH 2HPPH 1GL0E 3U8TH 1VJ9U 1WSSH 3EE0B 4Z6AH 1AN1E 1BTUA 4B76A 2XYAA 4O03A 1GBLA 4K60A 1J16A 1O3CA 5GJ4B 1DY8A 3DD2H 2SGQE 3F1SB 3E3TA 3I78A 5CHAC 1KSNA 2C8YB 1O2ZA 4MNXA 1XUIA 2J94A 3U9AH 2YNAA 2JH0D 3M36A 1TOCB 2PKSC 4JK5A 1MZAA 3UWIA 2ZIQH 1PPZA 1GCTB 4X8TH 4OS4A 1C1MA 2F9NA 2PKAB 2PTCE 4X2XA 4ABEA 4R0IA 5EU8A 1P9UA 3S7KB 1GCDA 2VVVA 3HPTB 4Q7ZA 3QLPH 2PLXA 4X6OA 6GCHG 4AX9H 1O35A 1BTWA 1MAYA 4Y0ZE 1SGPE 4AGKA 1FQ3A 1GBEA 4LXBH 3AAVA 4KTCA 4Y76A 4D8NA 3KGPA 1ZRBA 1V2TT 4IC5A 4Y8XA 5I46H 3GCOA 1GI6A 2VVCA 2VIWA 1A1RA 1TPPA 1CE5A 5AFZH 1QA0A 3EQ0H 1Z8JB 3OSYA 1AVGH 1J17T 3LGIA 1IQNA 1J14A 3ZZ4A 2VVUA 5K0HA 1WUNH 1A7SA 1HIAB 2ZPQA 1IQHA 1TMBH 4J2YB 2O9QA 1QJ1B 2OBQA 1TNHA 3CP7A 1O30A 2GCHF 1H1BA 2FI5E 3A86A 1N8OB 1K1PA 1WCZA 3VGCB 2HNTC 2XNIA 5E8EH 4B75A 4MPXA 1GHBF 1O3EA 1IQMA 1SGNE 2BOHB 1E38B 1AWFH 2GCTB 2Q1JA 3GYMA 2I6SA 2O8TA 2ZFFH 6CHAB 1G9IE 1C4U2 1UCYH 2ZI2H 4Y7BA 2ZFPH 3QK1A 4AB9A 4X8VH 1SSXA 2GDEH 1T8MA 2ZGBH 1HAXB 2AIQA 3BF6H 4B74A 2QXIA 1YPHC 1V2KT 4GHTA 1HJ8A 1O2WA 1QGFA 3SJ9A 1ARCA 4B2AA 1FXYA 2BMGB 2GD4B 1GMHG 4H6TA 1GGDB 1O2JA 4MVNA 1DSUA 1N6YA 4ZKRU 3TVJB 1C9TA 1KXEA 3B23B 3EDXB 2VINA 5C1UA 2OC0A 3E0NB 2ZU3A 3EYDA 1C1SA 1PPHE 1NROH 5FCRA 1BCUH 1S84A 1EAXA 3BTKE 3F9EA 1UVOA 5GDSH 1BTXA 2J95A 1ZTLA 1V2QT 4NFEA 1JRSA 2CGAA 1AD8H 4LZ1H 1ZPBA 3SU4A 4AGJA 4OGXA 1TGNA 1XKBC 2F83A 2UUYA 1K1OA 1SGFG 1ZTJA 2BY5X 2FODA 3TJUA 2CF9H 3GDSA 3OX7U 4ISNA 2ANYA 1CSOE 1P8VC 3Q3KA 1ANBA 1XUFA 2A5IA 4I32A 4Y8YA 1DXWA 3SORA 1LHEH 1MAXA 2WYJA 1ACBE 4K2YA 1O5EH 2Q6DA 2FM2A 4DY7B 1A0HB 1ZJKA 2GT7A 1FONA 1UHBA 4U32A 1UTMA 4B73A 4JYTA 1LVOA 5FAHA 2ZWLH 3LDXH 3PTBA 1MTSA 5A0BA 1U6QA 2QA9E 1EAWA 2FDAA 5EG4A 1MTNB 1YC0A 4MDSA 1W3CA 2XCNA 2FYRA 2K1QA 1ZTKA 3RXFA 1GMHF 1J8AA 5C67A 5DP8A 5ESTE 5BRRE 1AUTC 2HLCA 3RMOH 1KXBA 3SV7A 5B6OA 2GTBA 3BEUA 1BT7A 1ZGIA 1C2MA 1E34B 4M7GA 2C8ZB 2J2UA 1CA0C 4GHQA 3I77A 2QYIA 4MPWA 3ATLA 3SN8A 4E05H 4U01A 1QB1A 1GHZA 1O3AA 3MH6A 3T26A 2AMDA 3LH3A 4O3UA 2WPLS 1BTYA 3HGNA 1A61H 1B0FA 2EI8A 1HRTH 4JZDH 2F3CE 3GCTF 1QBNA 3LGTA 1RD3B 3OU0A 3RXDA 5DP3A 5EW2H 1O3DA 1GI9B 3LH1A 3EAJA 1MBQA 4WXVA 1RRKA 1FZZA 2OUAA 1GBAA 3P8OA 3QDZB 1Y8TA 2ZU2A 3GY6A 2BDIA 2OD3B 3DUXH 1YCPM 2FLBH 2Z6BD 2GMTC 1NPMA 5GPIB 3M7UA 3ZV9A 1AZZA 2XBYA 3SV2H 1C5TA 4K69A 4UD9H 4F49A 1ID5H 1W7GH 4E7RG 5JBCS 2BD8A 1P10A 1O3BA 1GJDB 1GJ4H 3LOXA 1HV7A 3M5LA 1QFKH 4NWKA 4LK4A 5LH8A 3LIWA 4SGBE 2XC5A 1ELEE 1NRRH 1O3MA 2A5AA 1SGQE 3MO9A 1B0EA 4DGJA 1O2TA 3SHCH 3TPIZ 1DICA 3RP2A 1QHRB 1TNGA 1YPJH 3SJKA 1EB2A 3RMMH 1VITG 3TK9A 1DVAH 2GKVE 4E06H 3SQEE 2CHAB 3UWJH 3SU3A 2QXHA 1O3NA 2PTNA 4UE7H 5C2ZA 2QXGA 1O2PA 4I8GA 1C5UA 3DFJA 3D49H 1UK2A 3KQDA 1HJAC 3ZZCA 3A89A 1Y59T 1HAVB 1EZQA 1Z8RA 1ZMNA 2CN0H 1GHWH 2HNTE 1IQLA 4X0WU 2BY6X 1TPAE 2Y7XA 3GY3A 4Q2KA 4NFFA 1GJ5H 2R2MB 2J34A 2F9VA 5EPYA 5GCHF 1OOKB 5AFYH 1C1NA 1F0SA 1EX3A 5AF9H 3MH5A 3P6ZB 3ZZBA 4NG9H 3ITIA 4IC6A 2FPZA 1QTFA 5CHAB 2BYAX 1K1MA 2A4GA 2ZFQH 3SGBE 4AFQA 1ZMJA 1ELDE 1TMTH 3RU4T 1L4DA 2EI6A 1GHYH 1A5IA 2PKSB 2A2XH 3RXHA 3URCA 1Z1JA 3DA9B 1C1PA 1GJ6A 1O3PB 2Y80A 3AVZA 1EJMA 1OWIA 3V0XA 1GJ9B 4INHA 4I33A 2Z3DA 3BTHE 2ZECA 4YOIA 4MQAA 4DJZB 2R2WU 1JRTA 5E0GA 2VWOA 1SLVB 1FNIA 2ODYB 1S6HA 1BJUA 1P11E 2TGAA 2TIOA 4U2WA 3RXVA 5HYOA 3A8AA 3PMBB 2WV4A 1W0ZU 3TIUA 1TGCA 2BDHA 1ORFA 4PROA 1C2HA 2Z9GA 4NGAH 1N1LA 1Y3YA 3LC3A 1GJ8B 1BUIA 1PPGE 2XWBI 2EC9H 2D8WA 4GUXA 1K1JA 3NUMA 1SLUB 2HWLB 3O8CA 1YLDA 1HBTH 1L0ZA 5T6FA 2Q6GA 2ZU4A 1OP0A 1LHDH 1DANH 5SGAE 2BD2A 1SQAA 1UMAH 4B1TA 1C1TA 3MU0A 1C2FA 1LQDB 1Y3WA 3KCGH 2P59A 2FESH 4NA7A 2W7UA 2WUCA 3A7ZA 3W95A 1G2MA 2YOLA 2FI4E 4WY3A 4ZH8A 3Q77A 3E91A 3UQVA 3SGQE 2ANMH 1VR1H 1XUKA 1P2QA 1KXDA 4K5ZA 2OP9A 1THPB 1O2IA 1FAKH 3ZZ3A 1ZPZA 2SFAA 3UNRA 2F9OA 1RTFB 2XBXA 1NO9H 2H9TH 1EOLA 5EQQA 4ISLA 1RIWC 4R8TB 1DXPA 1TRMA 1TNLA 4DURA 3CENA 3V13A 1DITH 1ELCA 1KTSB 5DJ7A 3BTGE 4JYUH 3SJIA 3O8RA 1IHTH 1L1GA 1SOZA 2QV1A 3VFEA 1AE5A 5ETXA 3HGPA 1P3EA 3B8JA 3K65B 1BHXB 1P57B 1YCPH 4D76A 4ZKOU 1C2GA 2PFEA 4A6LA 1EPTC 1ESAA 1GI1A 1HGTH 2OQUA 3BTME 1UTQA 5FX6A 1OWDA 1DM4B 2AGIX 1UCYE 3RXGA 3HK6B 1W14U 3QO6A 4INLA 2GZ8A 4YTAA 1O5BB 1Z6EA 3UFAA 3KEEA 4ZUHA 5EGMA 1CGHA 2FP7B 4ABDA 3U98H 3A81A 1DWEH 1T8OA 3D65E 3M35A 4BOHA 1AKSA 1AFQC 5GIBA 2SGAA 2WYGA 1AQ7A 2VWLA 2UWLA 3RXRA 4RKOB 3MU5A 3NPSA 1HAYB 3F9HA 1DLEA 4F4OC 1MUEB 4WMEA 3S69A 1OP8A 5A09A 3M61U 2BZ6H 4A5TS 4BTIB 1AE8H 1VITH 2FI3E 3GY2A 1K21H 3PROA 2BLVA 3LPRA 4CBNA 3LU9B 3IWMA 3KQEA 3RXEA 1FI8A 4X2WA 1GI0A 2V6NA 3ELAH 1G3EA 1EP6A 2CHAC 5T3HA 3GDUA 3RXAA 1EZXC 4CRDA 3OY5U 2W3IA 2AGEX 1FPHH 3RDZA 1HPGA 4MNWA 4ZKNU 1O2GH 1UJ1A 1IQJA 1UVSH 3TGKE 1P12E 1TGTA 1TA6A 3QUMP 3KL6A 4MPVA 2PKAA 5DKMA 3M3TA 1IQIA 3RXJA 1QB6A 4ZHAA 1A5GH 5F8ZA 1ARBA 5FHTA 2ZDLA 3MOCA 1F0UA 1C5LH 1O3FA 1S85A 1MKXK 3M5MA 1EOJA 4JZ1A 4Y79A 5A0AE 1KLIH 2ZPSA 1ELBA 3MO6A 1O5CB 1C2JA 2PUXB 3SU5A 3Q3YA 2A45B 3MYWA 2Z9LA 3RXCA 3SZNA 2QF3A 2VNTA 1Z8GA 3E6PH 4O97A 2ZDKA 3FFGA 1ZYOA 4RKJB 2AFQB 1HXFH 3TH2H 4ABHA 1WOFA 1BOQA 1LHFH 3QX5H 1NU7B 4AFUA 1THSH 4ABIA 1TOMH 3RMNH 1QRWA 3SV9A 4YESB 5PTPA 4XBBA 2ZHFH 1DUAA 3SNAA 4YT7H 1L4ZA 2O8LA 2CJIA 2GMTB 3K6YA 2JETC 1TAWA 4HTCH 1O2HA 2HRVA 3SHAH 1PJPA 4KTSA 3RXSA 1SLXB 8GCHF 2ZFSA 3FVFB 3LT3A 2ZDMA 2C3SA 3PLBA 2WPJS 2OLGA 4BNRA 3VXFH 1HIAA 1NFXA 4ZAEA 4D7GA 1O3OA 1CVWH 1FUJA 1P01A 3EA8A 3T2NA 1MZDA 2BY8X 1G36A 3RXTA 2Z7FE 2Y5GA 2GVFA 1F5LA 1VZQH 2W5EA 1P05A 1WTGH 3PLKA 1Y3UA 2P3TB 3ZVBA 2Y6TA 4WH6A 1O34A 2AYWA 3SNBA 4CH2B 1VGCC 2R9PA 3P95A 2FZZA 1QBOA 2P16A 3HATH 3U8RH 1NY22 3KNXA 3PM3A 4A92A 4AORA 2PV9B 2PUQH 5C1YA 5T6GA 4O9VA 3SU0A 5GXPA 2ZTZA 2BX4A 5LGOA 5DP6A 1AU8A 2NU4E 1AWHB 1NN6A 1ZGVA 1OS8A 1C5ZB 1BTZA 2F9PA 1BMMH 1ELTA 1C5OH 5BPEA 2RA0A 1HJAB 1DUEA 3LGWA 4Q80A 3ENSB 1EASA 1ZHMA 1BB0B 1HAOH 2ULLA 3A8CA 1CQQA 1K1LA 5F8XA 2P8OB 1PPCE 3V12A 2D1JA 1CHOG 1HFDA 4UFDH 1BRUP 2PGQB 2V3HH 1K28D 1CT2E 4Y8ZA 8ESTE 4Y71A 3RXQA 3UTUH 1C2IA 4I7YH 2BDGA 1WYKA 4NIXA 2ZF0H 3A83A 1ELGA 2O8MA 4XE4A 2Y82A 2Z9IA 1JIRA 2ZO3H 1TPSA 1L1JA 2BB4A 1G3DA 1HDTH 4ZKSU 1KXAA 3RXUA 1ESBA 4AFSA 1DDJA 1NS3A 1T4UH 1AIXH 1EAUA 4A7IB 1AMHA 1HAGE 6GCHF 2ZG0H 3BTTE 1NFYA 2H9EH 4YT6H 4X1RU 1ZRKA 2A4OA 3TH4H 2J92A 1O3LA 1A46H 2ZFRH 5DO4H 3LKWA 1EQ9A 3TJNA 3EA7A 1LO6A 3SQHE 1EJNA 1SGYE 3TK6A 1BZXE 1TRYA 4UDWH 3KIDU 1P2MA 1C5WB 1GJBB 3C1KA 5FXLA 1O2XA 4YM9A 3SNCA 1JIMA 1YGCH 2TPIZ 4Q7YA 1PYTC 5C20A 2ZZUH 3T27A 4BANB 2BD5A 1GPZA 3VB5A 3GOVB 3LC5A 2D26C 4Q7XA 1QL7A 1UVUH 3A88A 1D3TB 2J38A 3JZ2B 1NFUA 1EZSC 3EGKH 4RSPA 4IN2A 3ZVCA 2OC1A 1QRXA 4XDEA 1O0DH 2AGGX 2G4UA 2ZP0H 1WBGB 3T62A
chains in the Genus database with same CATH superfamily
4A1XA 1HNEE 3F6UH 3SNDA 4A1VA 4IBLH 6ESTA 3ATWA 2QN5T 1ANEA 3ZV8A 1MMJN 2UWPA 4ISHH 2Z94A 1ANCA 5E0HA 3SUEA 3UIRA 3NZIA 2YMSD 2ZC9H 4AOQA 1KMHB 1HJ9A 5EQRA 3ZVGA 1GI8B 1V2RT 2P95A 1W0JD 3LGVA 1JXPA 5LPEA 1GJAB 1SGDE 2JH6D 1GBMA 2ALVA 2GJGA 3GISB 4H42U 4KP0A 1O2QA 4JZIA 4Z1MD 4NZLA 3LGYA 2H9HA 1TQ7B 1O5AB 1TGSZ 2VGCC 3SO3A 4OS2A 5A8YA 1XUGA 2C8WB 2J97A 1RIWB 1SHHB 2BD9A 1T8LA 1TGBA 1DOJA 3LJJA 4ISOA 2BVRH 4ABAA 1A0LA 2EQNA 2BD4A 1AUJA 1BRAA 1E37B 1GBTA 2IPHA 1K1IA 1F92A 1QCPA 3CS7A 1CA8B 2BDCA 1EAIA 4OS7A 4NWLA 1INCA 1QURH 3DHKH 4MNYA 1EPTB 1O2OA 2LNCA 4RN6A 5ABWA 4MPUA 1QIXB 1Z7KA 1YPKH 1C5PA 1ZHRA 1P9SA 3SW2B 1EP5A 5EXLA 1KY9A 1DSTA 5HGGA 3PTNA 4K1SA 2ZHWH 2V35A 3MNXA 1UVTH 3Q3XA 5F6MA 1F5RA 3BSQA 5HM9A 1UTPA 3U1JB 1O2YA 2YNBA 1YF4A 4ZCNA 4X1QU 2Z9JA 5JPMH 1O3HA 3A87A 2Z9KA 1BQYA 1AFQB 3FP7E 5CDFE 1IQGA 2BTCE 2ZHEH 4NIVA 1VJAU 1HAVA 2ZTXA 1T32A 2EI7A 2JJ1D 4UEHH 1GBFA 1FY4A 1MCVA 1MKWK 2V7QD 2IOTA 4GCHG 4ABFA 2KAIA 4B2CA 1TFXA 1EKBB 3NXPA 5F03A 2BQWB 1MH0A 1AO5A 1E79D 2ODPA 2XXLA 4ASHA 1ZHPA 3M5NA 2AMQA 1AGJA 1O3GA 3UB0A 2HVYB 1FX0B 2R0LA 3BTFE 2BHGA 1Q31A 2KM0A 3V3MA 1YLNA 4X8UH 1GDUA 3SGAE 4ABJA 2R0KA 3P92A 3SUGA 2C93B 4FUEA 3IITA 4D9RA 1TX6A 1WQVH 1LMWB 1TALA 2ZGCA 1SGTA 1VCQA 1OWJA 3K6ZA 3S7HB 3ATMA 4SGAE 1TNKA 2Z3EA 3BN9A 3DSOA 1GI7B 1KLTA 3U69H 1SC8U 1ZSJA 3VB4A 1BA8B 3IG6B 8KME2 1TBRH 1YY3A 2A2QH 4OGYA 3ZZ9A 2KAIB 3WY8A 2P8OC 3A85A 9ESTA 1D3QB 4H4FA 1DE7H 1UK3A 2FX4A 2HALA 1OSSA 3MHWU 2O8WA 1ZLRA 1C1VH 2ZQ1A 2Y81A 3BTWE 3STJA 2ZPRA 4THNH 3VB3A 3ZZ5A 1IOEA 3TH3H 2Q6FA 4BAMB 4CH8B 1V2VT 2CF8H 2PWXA 3GCHC 4GCHF 3KQBA 2Z3CA 3BEIB 1YBWA 2SGFE 2ZQ2A 1VCWA 2F43B 1YLCA 1AVXA 1J9CH 2VIDA 3MU4A 2FOAA 2JETB 2Y5HA 4BAQB 1YPEH 1O3JA 3U1IB 2ODQA 1KXFA 3MWIU 1XVMA 3RXPA 2H5CA 5CMXH 4FU7A 1YPGH 4BTTB 3RC4A 1BTPA 2QY0B 5JDUB 1K1NA 2O8UA 2R3UA 1VITF 5C5NA 1FLEE 1P2NA 1LKBA 4IGDA 1QNJA 3MH4A 4LZ4B 2XBWA 2QCYA 2VH0A 1PQ7A 1AHTH 2J9NA 1LKAA 3S0NA 1F0RA 2G00A 2STBE 2RDLA 1DFPA 2OC8A 1SB1H 1ZZZA 1VGCB 3PMAB 1YYY1 2SGDE 2VB0A 5J4SA 2QAAA 1UTLM 4M9FA 2VIPA 2FO9A 1DX5M 2VU8E 3FP8E 1V2WT 1E0FD 4YOJA 3A80A 3RXMA 3ATKA 5E2PA 2PR3A 4X1PU 3SI3H 2XC4A 3DCLA 3KF2A 1TE0A 1FY3A 1DLKB 3GDVA 1O31A 3A8DA 3M37A 4X8SH 3KN2A 2CXVA 1SHYA 1CHGA 3KYGA 1OX1A 3PLPA 4OS5A 2CMYA 3QN7A 1C9PA 1AY6H 2XCFA 1C5MD 1J15A 1JOUB 2G5VA 1D6RA 3E1XB 1RTLA 4IW4E 4X2YA 4U30A 1TYNA 2GP9B 1GI5A 5A0CA 3RXBA 2R3YA 4E7NA 5C17A 3OE7D 3PRBA 4DOQA 3TGIE 3ZVDA 4AFZA 1GBIA 1QL9A 3RU4E 1Z71A 3NKKA 3SJ8A 1MCTA 1G37A 2ILNA 2KCOA 4WXIA 1XXDA 4XBCA 1HAPH 1O5DH 1GG6C 4YO9A 1NC6A 2A4RA 1ZPCA 4IMZA 1ZSKA 1W8BH 2QIQA 2WPKS 4IMQA 5JYIA 4JK6A 2QF0A 3RMLH 4CRBA 2ZCKP 3PYHA 2FOFA 1V2UT 1HYLA 3VEQB 2A31A 4K1EA 2VJ1A 4RT1A 4Z0KA 3ZZAA 3JZ1B 1MD8A 1OPHB 1OP2A 3E0PB 5DP4A 1GI4A 5EXMA 1SGEE 1C4Y2 1F0TA 3TK5A 4D9QA 3FANA 3FO8D 1GWAA 2ZDVH 1Q2WA 1T7CA 2ZTYA 1Y5BT 1YPMH 4F48B 1CBWC 4FUDA 4A1TA 1V2MT 3C27B 2P3FH 3TNTA 3QWCH 3AAUA 1QA7A 1TRNA 3MFJA 3QTOH 1GVKB 1XUJA 2BQ6B 1CU1A 1ELAA 1BDAA 7GCHG 2G8TA 2VH6A 2A5KA 1SLWB 4NA9H 1QJ6B 4IN1A 1FY1A 4K8YA 1QQ4A 1GDQA 1TNIA 2BLQA 3RLWH 2BQ7B 4TYDA 2V0BA 1NZQH 2WPMS 4ABGA 4YXWD 4TPYA 4CR5A 2GV7A 1L2EA 2ASUB 3T5FH 3SV6A 1OHHD 5DSFA 1MTVA 2FOGA 4NCYA 1P2JA 3N7OA 2UUKB 1RTKA 1WXRA 1UCYK 2AERH 1P2IA 3BIVH 4X6PA 1UO6A 2WPIS 1QQUA 1AZ8A 2LPRA 3MNBA 3TJVA 1O2LA 3RC5A 4OS1A 2HOBA 3P8FA 4FU9A 4XFQA 2VIOA 2PW8H 1ESTA 3NCLA 1P3CA 3H5CB 1CGIE 2VGCB 3RM2H 4DVAU 3O8BA 1A2CH 5EPNA 3SBKA 1NBME 4K1TA 3TNSA 1JWTA 3MNCA 2XC0A 2B8OH 9LPRA 4DG4A 1FY5A 3URDA 5L2ZH 3F9FA 1A3EH 1Y5UT 3A8BA 5JB8S 1JBUH 4GPGA 2ALPA 1RGQA 2CK3D 3HKIB 4GAWA 4Y11E 4BAOB 1NM6A 1S5SA 2B5TB 3O8DA 2F9BH 2BLWA 5CE1A 5DP5A 1V2OT 5TJXA 3RXLA 1IQEA 2NU1E 1CT0E 3MTYA 3ODFA 2LP6A 5A8XA 1C5SA 1H9IE 1TONA 1D6WA 4KGAA 1S81A 2UUFB 2J4IA 3GY8A 5DP7A 1LPZB 1COWD 2BM2A 1N6XA 1GL1A 1P0SH 1MQ6A 3WWBA 1K9OE 1CO7E 1IQKA 2WPHS 1G3CA 1EZUC 3H7OA 5TCCA 3SUDA 1C5QA 3AASA 4NIYA 3BG8A 3GY7A 1ETRH 1DT2A 5KECA 2ZGJA 1A0JA 1NT1A 1XXFA 3P17H 3SNEA 4X1NU 5FPTA 1BTHH 1WDIA 2GCHG 3GYLB 3L6PA 3A7XA 2BDBA 1UVPA 3A7TA 5HM2A 3Q76A 1GBBA 1GHBG 1M9UA 5JBAS 3W1EA 2CV3A 2ZDAH 1ABJH 3B9FH 1HAHH 1EXFA 1MBMA 4YLUA 5C1XA 1IAUA 1LDTT 1O2VA 2FOHA 2F91A 3QGJA 1OXGA 1FIZA 1WAYB 2FEQH 4INKA 4WJG2 1SQOA 1F5KU 1V2PT 4WWYA 1P02A 2F4LA 2GV6A 3LJOA 4X1SU 3TITA 3ZZ8A 4CRAA 4FETA 3L3TA 2G55A 1TBQH 2C8XB 2QF4A 4FUBA 3S9CA 1EATA 4TY7A 2RFKC 4I8HA 3MU1A 4TWWA 1H4WA 4WVPE 1HUTH 1O32A 4KKDA 5DGJA 1LCYA 3AW1A 1WTHD 5K7RA 2ANWA 5EODA 8LPRA 3T25A 1GMDG 1BMLA 4XOJA 1KLJH 2Y5FA 7KMEH 1V6DA 4FUHA 2H1UA 2G4TA 1XMNB 2JH5D 5L2YH 2ZU1A 1NESE 2DUCA 3FZDA 3HK3B 1P09A 1Z1IA 1D4PB 2VWNA 4FUCA 4TWYA 4VGCC 4CRGA 1SPJA 3TJOA 3NRLA 3ZYEA 5FX5A 3K2UA 1QRZA 2XTTB 2NU3E 2H6MA 2TGDA 3GCHB 1O5FH 4YOGA 2JKHA 3V7TA 1SR5C 5DPAA 3GCNA 3SOSA 2IN2A 4FUJA 2K8IA 3OTJE 4NA8A 1BBRH 2WUBA 1Q3XA 4CR9A 2FOMB 4YZUA 4O3TA 1JMOH 1S82A 2B9LA 1FN6A 3MO3A 4ZMAH 1RXPA 3UY9A 2FX6A 3VPKA 3GY5A 1UTKA 5FBIA 4J1YA 1Y3XA 1V2LT 3BG4C 4GVUA 1WU1A 2RG3A 2P93A 1GMCG 5ESBA 2OTVA 1G32B 1UTNA 3AK5A 4AG2A 1PQAA 3F9GA 1O36A 2BDYA 1C1UH 1X7AC 1UTOA 3RXKA 2DE9A 2HPQH 3PB1E 1ANDA 3ZZDA 1GBJA 1W12U 2TBSA 5C3NA 3ZZ7A 1THRH 2V3OH 3BTDE 4ZXYH 4ESTE 4X6NA 1W7XH 1BRBE 3AW0A 1GMDF 1CHOF 2FLRH 2XWAA 3KQCA 1QB9A 2PHBA 5H4IB 3MMGA 3CS0A 1SFQB 3SV8A 4BXSA 4MG3A 3FOAA 1MKXH 3OY6U 1MTUA 2GDDA 3SJOA 1PPEE 2ZGXH 1W11U 3W94A 3PO1B 1DS2E 1SQTA 1CT4E 2GT8A 1MU8B 2NWNA 2BDAA 1GBDA 2H2ZA 1SGRE 3KHVA 5A2MH 2ZEBA 3MQKC 1BMAA 3S9AA 4GLYA 1SBWA 3E90B 3GCTG 5F8TA 1EPTA 3BTEE 3VXEH 1TX7A 1D3DB 1FPCH 1KXCA 3UPEA 3SUFA 1BJVA 3N7DA 4X6MA 5HMAA 1O2NA 3T28A 1GG6B 3KYFA 1GMCF 2XNDD 1SMFE 3G01A 1ZOMA 3K9XB 1GHXH 1TBZH 1HAZB 1E35B 3I29A 3VB7A 1SVPA 4OM9A 2AIPA 1O38A 3DFLA 3P8NA 4TSFD 2A7HA 2EA3A 1EB1H 3A82A 2ZGHA 4WF8A 2GGVB 4CHAC 5FCKA 5JBTA 1O2SA 1YP9A 3MNSA 3E16B 2VWMA 1HCGA 2OINA 4BAHB 2VIQA 1KTTB 1S6FA 3T29A 2Y7ZA 3ESTA 3RXIA 2M5TA 3UNQA 5TCAA 4JMYA 4TY6A 1G30B 5EIYA 1DWDH 1P2KA 1CBWB 2J98B 2AH4X 3N99A 1Y5AT 5J4QA 3A7VA 4JYVH 3FKSD 3UR9A 2V3MA 4Y10E 2C4FH 2I6QA 3M7QA 1PYTD 3N7EA 4KTUA 1GVLA 5IK2D 3P8GA 1WV7H 2BY7X 1UHBB 1LHGH 2M2AA 1DPOA 1EUFA 4ZXXH 3BV9B 1YM0A 2ZA5A 4F55A 2G51A 2W3KA 1SGFA 2C90B 3UQOA 7ESTE 4XSKU 1AVWA 2G81E 4ISIH 4BTUB 2TGTA 4MLFB 2A7CA 1OKXA 2OXSA 2ESTE 1SFIA 4UONA 1EJAA 1AB9B 2NU0E 2OC7A 2UWOA 2FOEA 1RJXB 2AEIH 2ZHQH 4HI3A 1GBKA 1PPBH 3PWCA 2B7DH 1LPKB 4B2BA 1QY6A 2P3UB 1GCTC 2FWWA 4DW2U 5GCHG 1NRQH 2FS8A 4ABBA 1FAXA 1ZR0A 1ELFA 2QXJA 3OTPA 5E0JA 1ETSH 4FUIA 5F53A 2ZKSA 2PGBB 1OWHA 3ZVEA 1G3BA 4LOYH 4CBOA 1C1OA 1RFNA 2BD7A 2W26A 3D23A 4QT8C 1H9LB 5LPRA 1FY8E 5DG6A 2SGPE 3A84A 1O5GH 3U8OH 1NRSH 4HZHA 4IS5A 4Y7AA 5FL7D 4BAKB 1A5HA 5FPYA 2P94A 5FBEA 3QTVH 1O3KA 1YCPK 2XRCA 1K2I1 4I8JA 3RU4D 4WH8A 1HAIH 2BD3A 5EW1H 1FV9A 4XD7D 1DY9A 3M5OA 4NSYA 1OYQA 5EQSA 5FPSA 3KQ5A 5AHGH 3F2HA 2WPDD 2ZU5A 3L33A 3PWBA 1LVMA 1V2NT 1C2LA 2QF5A 3H7TA 1LHCH 1QJ7B 1HB0B 1WQSA 3BIUH 1QL8A 2D2DA 3M7TA 4FUGA 1SGCA 3MH7A 5HIYA 4YLQH 2QC2A 4I8KA 3UR6A 1C5RA 1W0YH 1ZJDA 3FP6E 2BY9X 1GVZA 5GWZA 2OQ5A 1UTJA 1N8OC 1W10U 3VGCC 4UFEH 2XBVA 1SI5H 5EOKA 4DIIH 1TMUH 1H8DH 3EA9A 1C2DA 4DCDA 5JBBS 1TABE 3RC6A 1DWBH 4BXWA 3GICB 1QR3E 1V2ST 1GI2A 2FTMA 2ZDNA 3ZVFA 2GCTC 3S9BA 4DT7B 3UREA 2GX4A 4CRCA 6CHAC 4DIHH 3SI4H 2BLOA 1YPHE 4WMFA 5L30H 1T4VH 3UOPA 3PMJA 3DSGA 1MTWA 1ETTH 1TQ0B 4HFPB 2VIVA 1IQFA 1W13U 5JB9S 1NRNH 4UFGH 2WINI 3MU8A 1IHSH 5HXFA 1TLDA 3EE7A 4JZFH 2HNTF 1ELVA 3FZZA 1LTOA 1G2LA 4HGCA 1XM1A 1PQ5A 3SU2A 2IJOB 1C2EA 3UOUA 2SNVA 3RM0H 2BVXH 2BZAA 1GDNA 1GJ7B 1MU6B 3FN8A 3BTQE 1TNJA 3RUOA 1A3BH 1C1RA 1KDQA 1MQ5A 1C5YB 1O2RA 1S0QA 2BXUH 3GY4A 4CRFA 5E2OA 1GGDC 1L1NA 4WMDA 5T6DA 1S0RA 2XW9A 1B5GH 4K8BA 1F2SE 4ZHLU 1AI8H 3BEFB 2AMPA 1T31A 2A7JA 3FAOA 1C2KA 2FTLE 1C5VA 3SU6A 4CREA 1O3IA 1Y3VA 1TX8A 3ODDA 5EJZA 3PO1C 1OWKA 2A0QB 2L6OA 1O2MA 4JCNA 1K22H 5EJ1A 4H6SB 4MNVA 4NSVA 4NZQA 1OWEA 2A1DB 2WSSD 1NFWA 4OS6A 3QZRA 3QGNB 4I31A 1BHXF 3D62A 2J5UA 2HGTH 2H5DA 2FYQA 4GSOA 1A4WH 4Q63A 1O2UA 4FVDA 4VGCB 3ZZ6A 5GNDA 1NU9A 1ZMLA 2UUJB 1GJCB 1P06A 4TPIZ 3SU1A 1XUHA 1TWXB 2RA3A 2SGEE 2ZHDA 2DE8A 1KDQB 2ANKH 2TGPZ 4I8LA 1XKAC 2GZ9A 4Y0YE 3TLOA 2BVSH 1MKWH 1XX9A 3Q00A 4FVBA 3RXOA 1DWCH 3F68H 1E36B 4FU8A 2A4QA 1O39A 1MTNC 1YPLH 2W7SA 2BOKA 3BG4B 1OYTH 3VB6A 2ZCHP 1H8IH 3A7YA 1GHAG 2BXTH 3LGUA 1YKTA 1Z8IB 3ZYDA 1XVOA 4ZROA 3E8LA 3F0PA 5C5OA 1KIGH 1HXEH 2OBOA 1H9HE 3MI4A 2WHXA 5DK1A 2GZ7A 1GBHA 1BMFD 3R0FA 4ACBA 1P2OA 3R3GB 6LPRA 1NTPA 1GHVH 1BBRE 1PFXC 1SL3A 3OYPA 5I25A 4I86A 1D3PB 1P04A 2G5NA 1O37A 1FIWA 2FXRA 1P03A 5C0TA 3QZQA 4FUFA 1TIOA 1QBVH 3NWUA 4X2VA 5EXNA 3GS9A 2THFB 2PSYA 4MTBA 4ZHMU 1HLTH 5C0UA 4AG1A 3A7WA 4Y6DA 1BIOA 3NK8A 1AB9C 5A8ZA 2B0FA 2EEKA 2QGRA 3TU7H 2FMJA 4AYYB 4K3JA 2A32A 1TPOA 3ZVAA 1T8NA 1LVBA 3PV4A 3M3VA 2SNWA 1O33A 3UNSA 1FN8A 4FXGH 1C1QA 1V2JT 2FS9A 1FDPA 3HKJB 1Z6JH 3PV5A 1NRPH 1UK4A 1BBRK 1BRCE 1BITA 2STAE 4B71A 3M3SA 1TA2A 1TB6H 1W2KH 1PQ8A 1GHAF 2ZCLP 5L6NH 2RCEA 2FIRH 1LVYA 2FOBA 5G4BA 1LQEA 1VCPA 2ZNKH 3UAIC 1MD7A 1V3XA 3ATIA 1B7XB 1GI3A 1C5XB 1D9IA 1LPGB 1SGIB 2OCVB 5AVDA 1SG8B 5LPFA 1KYNA 4XBDA 8GCHG 1RS0A 1FMGA 2HVXA 4NIWA 2F9UA 1S83A 4CHAB 1FJSA 1PPFE 1SOTA 3PMHB 1BMNH 2PSXA 3TGJE 1F7ZA 4AB8A 4AZ2B 3STIA 5IDKA 1C1WH 1CGJE 1ABIH 4JZEH 1C4V2 5IYTA 4D7FA 5DP9A 1C5NH 1AKSB 3DT0H 7GCHF 2TRMA 4AN7A 3P70B 4KELA 1CA0B 4AYVB 4UFFH 2ZFTA 2NU2E 2FOCA 3LONA 1O2KA 2BX3A 1K0HA 2AS9A 5DN6D 3UUZA 2G52A 7LPRA 2AHME 3RLYH 1GBCA 2WV5A 1ZSLA 1AFEH 2HPPH 1GL0E 3U8TH 1VJ9U 1WSSH 3EE0B 4Z6AH 1AN1E 1BTUA 4B76A 2W6ID 2XYAA 4O03A 1GBLA 4K60A 1J16A 5C94A 1O3CA 5GJ4B 1DY8A 3DD2H 2SGQE 3F1SB 3E3TA 3I78A 5CHAC 1KSNA 2C8YB 1O2ZA 4MNXA 1XUIA 2J94A 3U9AH 2YNAA 2JH0D 3M36A 1TOCB 2PKSC 4JK5A 1MZAA 3UWIA 2ZIQH 1PPZA 1GCTB 4X8TH 4OS4A 1C1MA 2F9NA 2PKAB 2PTCE 4X2XA 4ABEA 4R0IA 5B6LA 5EU8A 1P9UA 3S7KB 3OEHD 1GCDA 2VVVA 3HPTB 4Q7ZA 3QLPH 2PLXA 4X6OA 6GCHG 4AX9H 1O35A 1BTWA 1MAYA 1EFRD 4Y0ZE 1SGPE 4AGKA 1FQ3A 1GBEA 4LXBH 3AAVA 2HLDD 4KTCA 4Y76A 4D8NA 3KGPA 1ZRBA 1V2TT 4IC5A 4Y8XA 5I46H 3GCOA 1GI6A 2VVCA 2VIWA 1A1RA 1TPPA 1CE5A 5AFZH 1QA0A 4XRNA 3EQ0H 1Z8JB 4FOUC 3OSYA 1AVGH 1J17T 2YMSC 3LGIA 1IQNA 1J14A 3ZZ4A 2VVUA 5K0HA 1WUNH 1A7SA 1HIAB 2ZPQA 1IQHA 1TMBH 4J2YB 2O9QA 1QJ1B 2OBQA 1TNHA 3CP7A 1O30A 2GCHF 1H1BA 2FI5E 3A86A 1N8OB 1K1PA 1WCZA 3VGCB 2OK5A 2HNTC 2XNIA 2QE7D 2W6JD 5E8EH 4B75A 4MPXA 1GHBF 1O3EA 1IQMA 1SGNE 2BOHB 1E38B 1AWFH 2GCTB 2Q1JA 3GYMA 2I6SA 2O8TA 2ZFFH 6CHAB 1G9IE 1C4U2 1UCYH 2ZI2H 4Y7BA 2ZFPH 3QK1A 4AB9A 4X8VH 1SSXA 2GDEH 1T8MA 2ZGBH 1HAXB 2AIQA 3BF6H 4B74A 2QXIA 1YPHC 1V2KT 4GHTA 1HJ8A 1O2WA 1QGFA 3SJ9A 1H8ED 1ARCA 3PV2A 4B6EA 4B2AA 1FXYA 2BMGB 4AC9A 2GD4B 1GMHG 4H6TA 1GGDB 1O2JA 4MVNA 1DSUA 1N6YA 4ZKRU 3TVJB 1C9TA 1KXEA 3B23B 3EDXB 2VINA 5C1UA 2OC0A 3E0NB 2ZU3A 3EYDA 1C1SA 1PPHE 1NROH 5FCRA 1BCUH 1S84A 1EAXA 3BTKE 3F9EA 1UVOA 5GDSH 1BTXA 2J95A 1ZTLA 1V2QT 4NFEA 1JRSA 2CGAA 1AD8H 4LZ1H 1ZPBA 3SU4A 2JDID 4AGJA 4OGXA 1TGNA 1XKBC 2F83A 2UUYA 1K1OA 1SGFG 1ZTJA 2BY5X 2FODA 3TJUA 2CF9H 3GDSA 3OX7U 4ISNA 3OFND 2ANYA 1CSOE 2J98A 1P8VC 3Q3KA 1ANBA 1XUFA 2A5IA 4I32A 4Y8YA 1DXWA 3SORA 1LHEH 1MAXA 2WYJA 1ACBE 3CNRA 1O5EH 2Q6DA 2FM2A 4K2YA 1A0HB 4DY7B 1ZJKA 2GT7A 1FONA 1UHBA 4U32A 2KCYA 1UTMA 4B73A 4JYTA 1LVOA 5FAHA 2ZWLH 3LDXH 3PTBA 1MTSA 5A0BA 1U6QA 2QA9E 1EAWA 2FDAA 5EG4A 1MTNB 1YC0A 4ACAA 4MDSA 1W3CA 2XCNA 2FYRA 2K1QA 1ZTKA 3RXFA 1GMHF 1J8AA 5C67A 5DP8A 2LELA 5ESTE 5BRRE 1AUTC 2HLCA 3RMOH 1KXBA 3SV7A 5B6OA 2GTBA 3BEUA 1BT7A 1ZGIA 1C2MA 1E34B 4M7GA 2C8ZB 2J2UA 1CA0C 4GHQA 3I77A 2QYIA 4MPWA 3ATLA 3SYJA 3SN8A 3U28C 4E05H 4U01A 1QB1A 1GHZA 1O3AA 1H8HD 3MH6A 2AMDA 3T26A 3LH3A 4O3UA 2WPLS 1BTYA 3HGNA 2KR7A 1A61H 1B0FA 2EI8A 1HRTH 4JZDH 2F3CE 3GCTF 3WW7A 1QBNA 3OAAD 3F2GA 3LGTA 1RD3B 3OU0A 3RXDA 5DP3A 5EW2H 1O3DA 1GI9B 3LH1A 3EAJA 1MBQA 3SZEA 4WXVA 1RRKA 1FZZA 2OUAA 1GBAA 3P8OA 3QDZB 1Y8TA 2ZU2A 3GY6A 2BDIA 2OD3B 3DUXH 1YCPM 2FLBH 2Z6BD 4P00A 2GMTC 1NPMA 5GPIB 3M7UA 3ZV9A 1AZZA 2XBYA 3SV2H 1C5TA 4K69A 4UD9H 4F49A 1ID5H 1W7GH 4E7RG 5JBCS 4ASUD 2BD8A 2JJ2D 1P10A 1O3BA 1GJDB 1GJ4H 3LOXA 1HV7A 3M5LA 1QFKH 4NWKA 4LK4A 5LH8A 3LIWA 4SGBE 2XC5A 1ELEE 1NRRH 1O3MA 2A5AA 1SGQE 3MO9A 1B0EA 2KX4A 4DGJA 1O2TA 3SHCH 1S6LA 3TPIZ 1DICA 3RP2A 5HIZA 1QHRB 1TNGA 1YPJH 3SJKA 1EB2A 3RMMH 1VITG 3TK9A 1DVAH 2GKVE 4E06H 3SQEE 2CHAB 3UWJH 3SU3A 2QXHA 1O3NA 2PTNA 4UE7H 5C2ZA 2KCPA 2QXGA 1O2PA 4I8GA 1C5UA 3DFJA 3D49H 1UK2A 3KQDA 1HJAC 3ZZCA 3A89A 1Y59T 1HAVB 1EZQA 1Z8RA 1ZMNA 2CN0H 1GHWH 2HNTE 1IQLA 4X0WU 2BY6X 1TPAE 2Y7XA 3GY3A 3DSPA 4Q2KA 4NFFA 1GJ5H 2R2MB 2J34A 2F9VA 5EPYA 5GCHF 4HG6A 1OOKB 5AFYH 1C1NA 1F0SA 1EX3A 5AF9H 3MH5A 3P6ZB 3ZZBA 4NG9H 3ITIA 4IC6A 2FPZA 1QTFA 1E1QD 5CHAB 2BYAX 1K1MA 2A4GA 2ZFQH 3SGBE 4AFQA 1ZMJA 1ELDE 1TMTH 3RU4T 1L4DA 2EI6A 1GHYH 1A5IA 2PKSB 2A2XH 1VKYA 3RXHA 3URCA 1Z1JA 1E1RD 2IPQX 3DA9B 1C1PA 1GJ6A 1O3PB 2Y80A 3AVZA 2K0QA 1EJMA 1OWIA 3V0XA 1GJ9B 4INHA 4I33A 2Z3DA 3BTHE 2ZECA 4YOIA 4MQAA 4DJZB 2R2WU 1JRTA 5E0GA 2VWOA 1SLVB 1FNIA 2ODYB 1S6HA 1BJUA 1P11E 2TGAA 2TIOA 4U2WA 3RXVA 5HYOA 3A8AA 3PMBB 2WV4A 1W0ZU 3PRDA 3TIUA 1TGCA 2BDHA 1ORFA 4PROA 3WWFA 2IJD1 1C2HA 2Z9GA 4NGAH 1N1LA 1Y3YA 3OEED 2VBCA 2EY4C 3LC3A 1GJ8B 1BUIA 1PPGE 2XWBI 2EC9H 2D8WA 4GUXA 1K1JA 3NUMA 1SLUB 2HWLB 3O8CA 3VG8A 1YLDA 1HBTH 1L0ZA 4RT0A 5T6FA 4B6FA 2Q6GA 2ZU4A 1OP0A 1LHDH 1DANH 5SGAE 2BD2A 1SQAA 2YMSB 1SKYE 1NBMD 1MABB 1UMAH 4B1TA 1C1TA 3MU0A 1C2FA 1LQDB 1Y3WA 2XOKD 3KCGH 2P59A 2FESH 2WZQA 4NA7A 2W7UA 2WUCA 3A7ZA 3W95A 1G2MA 2YOLA 2FI4E 4WY3A 4ZH8A 3Q77A 3E91A 3UQVA 3SGQE 2ANMH 1VR1H 1XUKA 1P2QA 3H09A 1KXDA 4K5ZA 2OP9A 1THPB 1O2IA 1FAKH 3ZZ3A 1ZPZA 2SFAA 3UNRA 2F9OA 1RTFB 2XBXA 4TT3D 1NO9H 2H9TH 1EOLA 5CHBA 5EJLA 5EQQA 4ISLA 1RIWC 4R8TB 1DXPA 1TRMA 1TNLA 3ZIAD 4DURA 3CENA 3V13A 1DITH 1ELCA 1KTSB 5DJ7A 3BTGE 4JYUH 3SJIA 3O8RA 1IHTH 1QZ8A 1L1GA 5T1VA 1SOZA 2QV1A 3VFEA 1AE5A 5ETXA 3HGPA 1P3EA 3B8JA 3K65B 1BHXB 1P57B 1YCPH 4D76A 4ZKOU 1C2GA 2PFEA 4A6LA 1EPTC 1ESAA 1GI1A 1HGTH 2OQUA 3BTME 1UTQA 5FX6A 1OWDA 1DM4B 2AGIX 1UCYE 3RXGA 3HK6B 1W14U 3QO6A 4INLA 2GZ8A 4YTAA 1O5BB 1Z6EA 3UFAA 3KEEA 4ZUHA 5EGMA 1CGHA 2FP7B 4ABDA 3U98H 3A81A 1DWEH 2KZ4A 4RI0A 1T8OA 1SQRA 3D65E 3M35A 1AKSA 4BOHA 1AFQC 5GIBA 2SGAA 2WYGA 1AQ7A 5KEDA 2VWLA 2UWLA 3RXRA 4RKOB 3MU5A 3NPSA 1HAYB 3F9HA 1DLEA 2KFWA 4F4OC 1MUEB 4WMEA 3S69A 1OP8A 5A09A 3M61U 2BZ6H 4A5TS 4BTIB 1AE8H 1VITH 2FI3E 3GY2A 1K21H 3PROA 2BLVA 3LPRA 4CBNA 3LU9B 3IWMA 3KQEA 3RXEA 1FI8A 4X2WA 1GI0A 2V6NA 3ELAH 1G3EA 1EP6A 2CHAC 5T3HA 2KCAA 1YWUA 3GDUA 3RXAA 1EZXC 4CRDA 1UW7A 3OY5U 2W3IA 2AGEX 1FPHH 3RDZA 1HPGA 4MNWA 4ZKNU 1O2GH 1UJ1A 1IQJA 1UVSH 3TGKE 1P12E 1TGTA 1TA6A 3QUMP 3KL6A 4MPVA 2PKAA 5DKMA 3M3TA 1IQIA 3RXJA 1QB6A 4ZHAA 1A5GH 5F8ZA 1ARBA 5FHTA 2ZDLA 3MOCA 1F0UA 1C5LH 1O3FA 1S85A 1MKXK 3M5MA 1EOJA 4JZ1A 4Y79A 5A0AE 1KLIH 2ZPSA 1ELBA 3MO6A 1O5CB 1C2JA 2PUXB 3SU5A 3Q3YA 2A45B 3MYWA 2Z9LA 3RXCA 3SZNA 2QF3A 2VNTA 1Z8GA 3E6PH 4O97A 2ZDKA 3FFGA 2WV9A 1ZYOA 4RKJB 2AFQB 1HXFH 3TH2H 4ABHA 1WOFA 1BOQA 1LHFH 3QX5H 1NU7B 4Q4LA 1THSH 4ABIA 1TOMH 3RMNH 1QRWA 4AFUA 3SV9A 4YESB 5PTPA 4XBBA 2ZHFH 1DUAA 3SNAA 4YT7H 1L4ZA 2O8LA 2CJIA 2GMTB 5HKKD 3K6YA 2JETC 1TAWA 4HTCH 1O2HA 2HRVA 3F2FA 3SHAH 1PJPA 4KTSA 3RXSA 1SLXB 8GCHF 2ZFSA 3FVFB 3LT3A 2ZDMA 2C3SA 3PLBA 2WPJS 2OLGA 4BNRA 3VXFH 1HIAA 1NFXA 4ZAEA 4D7GA 1O3OA 1CVWH 1FUJA 1P01A 3EA8A 3T2NA 1MZDA 2BY8X 1G36A 3RXTA 2Z7FE 2Y5GA 2GVFA 1F5LA 1VZQH 2W5EA 1P05A 1WTGH 3PLKA 1Y3UA 2P3TB 3ZVBA 2Y6TA 4WH6A 1O34A 2AYWA 3SNBA 4CH2B 1VGCC 2L74A 2R9PA 3P95A 2FZZA 1QBOA 2P16A 3HATH 3U8RH 1NY22 3KNXA 3PM3A 4A92A 4AORA 2PV9B 2PUQH 5C1YA 5T6GA 4O9VA 3SU0A 5GXPA 2ZTZA 2BX4A 5LGOA 3F0OA 1AU8A 2NU4E 5DP6A 1AWHB 1NN6A 1ZGVA 1OS8A 1C5ZB 1BTZA 2F9PA 1BMMH 2JIZD 1ELTA 1C5OH 5BPEA 2RA0A 1HJAB 1DUEA 3LGWA 4Q80A 3ENSB 1EASA 5KGOA 1ZHMA 1BB0B 1HAOH 2ULLA 3A8CA 1CQQA 1K1LA 5F8XA 2P8OB 1PPCE 3V12A 2D1JA 1CHOG 1HFDA 4UFDH 1BRUP 2PGQB 2V3HH 1K28D 1CT2E 4Y8ZA 8ESTE 4Y71A 3RXQA 3UTUH 1C2IA 4I7YH 2BDGA 1WYKA 4NIXA 2ZF0H 3A83A 1ELGA 2O8MA 4XE4A 2Y82A 2Z9IA 1JIRA 2ZO3H 1TPSA 2PP6A 1L1JA 2BB4A 1G3DA 1HDTH 4ZKSU 1KXAA 3RXUA 1ESBA 4AFSA 1DDJA 1NS3A 1T4UH 1AIXH 1EAUA 4A7IB 1AMHA 1HAGE 6GCHF 2ZG0H 3BTTE 1NFYA 2H9EH 4YT6H 4X1RU 1ZRKA 2A4OA 3TH4H 2J92A 1O3LA 1A46H 2ZFRH 4P02A 5DO4H 3LKWA 1EQ9A 3TJNA 3EA7A 1LO6A 3SQHE 1EJNA 1SGYE 3TK6A 1BZXE 1TRYA 4UDWH 3KIDU 4DT4A 1P2MA 1C5WB 1GJBB 1W0KD 3C1KA 5FXLA 1O2XA 4YM9A 3SNCA 1JIMA 1YGCH 2TPIZ 4Q7YA 1PYTC 2RDEA 5C20A 2ZZUH 3T27A 4BANB 2BD5A 1GPZA 3VB5A 3GOVB 3LC5A 2D26C 4Q7XA 1QL7A 1UVUH 3A88A 1D3TB 2J38A 3JZ2B 1NFUA 1EZSC 3EGKH 4RSPA 4IN2A 3ZVCA 2OC1A 1QRXA 4XDEA 3F3BA 1O0DH 2AGGX 2G4UA 2ZP0H 1WBGB 3T62A
chains in the Genus database with same CATH topology
4A1XA 1HNEE 3F6UH 3SNDA 4A1VA 4IBLH 6ESTA 3ATWA 2QN5T 1ANEA 3ZV8A 1MMJN 2UWPA 4ISHH 2Z94A 1ANCA 5E0HA 3SUEA 3UIRA 3NZIA 2ZC9H 4AOQA 3ZVGA 1HJ9A 5EQRA 1GI8B 1V2RT 2P95A 3LGVA 1JXPA 5LPEA 1GJAB 1SGDE 2JH6D 1GBMA 2ALVA 3GISB 4H42U 4KP0A 1O2QA 4JZIA 4NZLA 3LGYA 2H9HA 1TQ7B 1O5AB 1TGSZ 2VGCC 3SO3A 4OS2A 5A8YA 1XUGA 2C8WB 1RIWB 1SHHB 2BD9A 1T8LA 1TGBA 1DOJA 3LJJA 4ISOA 2BVRH 4ABAA 1A0LA 2BD4A 1AUJA 1BRAA 1E37B 1GBTA 2IPHA 1K1IA 1F92A 1QCPA 3CS7A 1CA8B 2BDCA 1EAIA 4OS7A 4NWLA 1INCA 1QURH 3DHKH 4MNYA 1EPTB 1O2OA 2LNCA 4RN6A 5ABWA 4MPUA 1QIXB 1Z7KA 1YPKH 1C5PA 1ZHRA 1P9SA 3SW2B 1EP5A 5EXLA 1KY9A 1DSTA 5HGGA 3PTNA 4K1SA 2ZHWH 2V35A 3MNXA 1UVTH 3Q3XA 5F6MA 1F5RA 3BSQA 5HM9A 1UTPA 3U1JB 1O2YA 2YNBA 1YF4A 5JPMH 4X1QU 2Z9JA 1O3HA 3A87A 2Z9KA 1BQYA 1AFQB 3FP7E 1IQGA 2BTCE 2ZHEH 4NIVA 1VJAU 1HAVA 2ZTXA 1T32A 2EI7A 4UEHH 1GBFA 1FY4A 1MCVA 1MKWK 4ABFA 2IOTA 4GCHG 2KAIA 4B2CA 1TFXA 1EKBB 3NXPA 5F03A 2BQWB 1MH0A 1AO5A 2ODPA 2XXLA 4ASHA 1ZHPA 3M5NA 2AMQA 1AGJA 1O3GA 2R0LA 3BTFE 2BHGA 1Q31A 3V3MA 4X8UH 1GDUA 3SGAE 4ABJA 2R0KA 3P92A 3SUGA 2C93B 4FUEA 3IITA 4D9RA 1TX6A 1WQVH 1LMWB 1TALA 2ZGCA 1SGTA 1VCQA 1OWJA 3K6ZA 3S7HB 3ATMA 4SGAE 1TNKA 2Z3EA 3BN9A 1GI7B 1KLTA 3U69H 1SC8U 1ZSJA 3VB4A 1BA8B 3IG6B 8KME2 1TBRH 2A2QH 4OGYA 3ZZ9A 2KAIB 3WY8A 2P8OC 3A85A 9ESTA 1D3QB 4H4FA 1DE7H 1UK3A 2FX4A 2HALA 1OSSA 3MHWU 2O8WA 1ZLRA 1C1VH 2ZQ1A 2Y81A 3BTWE 3STJA 2ZPRA 4THNH 3VB3A 3ZZ5A 1IOEA 3TH3H 2Q6FA 4BAMB 4CH8B 1V2VT 2CF8H 2PWXA 3GCHC 4GCHF 3KQBA 2Z3CA 3BEIB 1YBWA 2SGFE 2ZQ2A 1VCWA 1YLCA 1AVXA 1J9CH 2VIDA 3MU4A 2FOAA 2JETB 2Y5HA 4BAQB 1YPEH 1O3JA 3U1IB 2ODQA 1KXFA 3MWIU 1XVMA 3RXPA 2H5CA 5CMXH 4FU7A 1YPGH 4BTTB 3RC4A 1BTPA 2QY0B 5JDUB 1K1NA 2O8UA 2R3UA 1VITF 5C5NA 1FLEE 1P2NA 1LKBA 4IGDA 1QNJA 3MH4A 4LZ4B 2XBWA 2QCYA 2VH0A 1PQ7A 1AHTH 2J9NA 1LKAA 3S0NA 1F0RA 2G00A 2STBE 2RDLA 1DFPA 2OC8A 1SB1H 1ZZZA 1VGCB 3PMAB 1YYY1 2SGDE 2VB0A 5J4SA 2QAAA 1UTLM 2VIPA 2FO9A 1DX5M 2VU8E 3FP8E 1V2WT 1E0FD 4YOJA 3A80A 3RXMA 3ATKA 5E2PA 2PR3A 4X1PU 3SI3H 2XC4A 3KF2A 1TE0A 1FY3A 1DLKB 3GDVA 1O31A 3A8DA 3M37A 4X8SH 3KN2A 2CXVA 1SHYA 1CHGA 1OX1A 3PLPA 4OS5A 2CMYA 3QN7A 1C9PA 1AY6H 2XCFA 1C5MD 1J15A 1JOUB 2G5VA 1D6RA 3E1XB 1RTLA 4IW4E 4X2YA 4U30A 1TYNA 2GP9B 1GI5A 5A0CA 3RXBA 2R3YA 4E7NA 4DOQA 3TGIE 3ZVDA 4AFZA 1GBIA 1QL9A 3RU4E 1Z71A 3NKKA 3SJ8A 1MCTA 1G37A 2ILNA 4WXIA 1XXDA 4XBCA 1HAPH 1O5DH 1GG6C 4YO9A 1NC6A 2A4RA 1ZPCA 4IMZA 1ZSKA 1W8BH 2QIQA 2WPKS 4IMQA 5JYIA 4JK6A 2QF0A 3RMLH 4CRBA 2ZCKP 3PYHA 2FOFA 1V2UT 1HYLA 3VEQB 2A31A 4K1EA 2VJ1A 4Z0KA 3ZZAA 3JZ1B 1MD8A 1OPHB 1OP2A 3E0PB 5DP4A 1GI4A 5EXMA 1SGEE 1C4Y2 1F0TA 3TK5A 4D9QA 3FANA 1GWAA 2ZDVH 1Q2WA 1T7CA 2ZTYA 1Y5BT 1YPMH 1CBWC 4FUDA 4A1TA 1V2MT 3C27B 2P3FH 3TNTA 3QWCH 3AAUA 1QA7A 1TRNA 3MFJA 3QTOH 1GVKB 1XUJA 2BQ6B 1CU1A 1ELAA 1BDAA 7GCHG 2G8TA 2VH6A 2A5KA 1SLWB 4NA9H 1QJ6B 4IN1A 1FY1A 4K8YA 1QQ4A 1GDQA 1TNIA 2BLQA 3RLWH 2BQ7B 4TYDA 2V0BA 1NZQH 2WPMS 4ABGA 4TPYA 4CR5A 2GV7A 1L2EA 2ASUB 3T5FH 3SV6A 1MTVA 2FOGA 4NCYA 1P2JA 3N7OA 2UUKB 1RTKA 1UCYK 2AERH 1P2IA 3BIVH 4X6PA 1UO6A 2WPIS 1QQUA 1AZ8A 2LPRA 3MNBA 3TJVA 1O2LA 3RC5A 4OS1A 2HOBA 3P8FA 4FU9A 4XFQA 2VIOA 2PW8H 1ESTA 3NCLA 1P3CA 3H5CB 1CGIE 2VGCB 3RM2H 4DVAU 3O8BA 1A2CH 5EPNA 3SBKA 4K1TA 3TNSA 1JWTA 3MNCA 2XC0A 2B8OH 9LPRA 4DG4A 1FY5A 3URDA 5L2ZH 3F9FA 1A3EH 1Y5UT 3A8BA 5JB8S 1JBUH 4GPGA 2ALPA 1RGQA 3HKIB 4GAWA 4Y11E 4BAOB 1NM6A 1S5SA 2B5TB 3O8DA 2F9BH 2BLWA 5CE1A 5DP5A 1V2OT 5TJXA 3RXLA 1IQEA 2NU1E 1CT0E 3MTYA 3ODFA 5A8XA 1C5SA 1H9IE 1TONA 1D6WA 4KGAA 1S81A 2UUFB 2J4IA 3GY8A 5DP7A 1LPZB 2BM2A 1N6XA 1GL1A 1P0SH 1MQ6A 1K9OE 1CO7E 1IQKA 2WPHS 1G3CA 1EZUC 3H7OA 5TCCA 3SUDA 1C5QA 3AASA 4NIYA 3BG8A 3GY7A 1ETRH 1DT2A 2ZGJA 1A0JA 1NT1A 1XXFA 3P17H 3SNEA 4X1NU 5FPTA 1BTHH 2GCHG 3GYLB 3L6PA 3A7XA 2BDBA 1UVPA 3A7TA 5HM2A 3Q76A 1GBBA 1GHBG 1M9UA 5JBAS 2CV3A 2ZDAH 1ABJH 3B9FH 1HAHH 1EXFA 1MBMA 4YLUA 5C1XA 1IAUA 1LDTT 1O2VA 2FOHA 2F91A 3QGJA 1OXGA 1FIZA 1WAYB 2FEQH 4INKA 4WJG2 1SQOA 1F5KU 1V2PT 4WWYA 1P02A 2GV6A 3LJOA 4X1SU 3TITA 3ZZ8A 4CRAA 3L3TA 2G55A 1TBQH 2C8XB 4FUBA 3S9CA 1EATA 4TY7A 4I8HA 3MU1A 4TWWA 1H4WA 4WVPE 1HUTH 1O32A 4KKDA 5DGJA 1LCYA 3AW1A 1WTHD 5K7RA 2ANWA 5EODA 8LPRA 3T25A 1GMDG 1BMLA 4XOJA 1KLJH 2Y5FA 7KMEH 1V6DA 4FUHA 2H1UA 2G4TA 1XMNB 2JH5D 5L2YH 2ZU1A 1NESE 2DUCA 3FZDA 3HK3B 1P09A 1Z1IA 1D4PB 2VWNA 4FUCA 4TWYA 4VGCC 4CRGA 1SPJA 3TJOA 3ZYEA 5FX5A 3K2UA 1QRZA 2XTTB 2NU3E 2H6MA 2TGDA 3GCHB 1O5FH 4YOGA 2JKHA 3V7TA 1SR5C 5DPAA 3GCNA 3SOSA 2IN2A 4FUJA 3OTJE 4NA8A 1BBRH 2WUBA 1Q3XA 4CR9A 2FOMB 4YZUA 4O3TA 1JMOH 1S82A 2B9LA 1FN6A 3MO3A 4ZMAH 1RXPA 3UY9A 2FX6A 3VPKA 3GY5A 1UTKA 5FBIA 4J1YA 1Y3XA 1V2LT 3BG4C 4GVUA 1WU1A 2RG3A 2P93A 1GMCG 5ESBA 2OTVA 1G32B 1UTNA 4AG2A 1PQAA 3F9GA 1O36A 2BDYA 1C1UH 1X7AC 1UTOA 3RXKA 2DE9A 2HPQH 3PB1E 1ANDA 3ZZDA 1GBJA 1W12U 2TBSA 5C3NA 3ZZ7A 1THRH 2V3OH 3BTDE 4ZXYH 4ESTE 4X6NA 1W7XH 1BRBE 3AW0A 1GMDF 1CHOF 2FLRH 2XWAA 3KQCA 1QB9A 2PHBA 5H4IB 3MMGA 3CS0A 1SFQB 3SV8A 4BXSA 4MG3A 3OY6U 1MKXH 1MTUA 2GDDA 3SJOA 1PPEE 2ZGXH 1W11U 3W94A 3PO1B 1DS2E 1SQTA 1CT4E 2GT8A 1MU8B 2NWNA 2BDAA 1GBDA 2H2ZA 1SGRE 3KHVA 5A2MH 2ZEBA 1BMAA 3S9AA 4GLYA 1SBWA 3E90B 3GCTG 5F8TA 1EPTA 3BTEE 3VXEH 1TX7A 1D3DB 1FPCH 1KXCA 3UPEA 3SUFA 1BJVA 4X6MA 5HMAA 1O2NA 3T28A 1GG6B 1GMCF 1SMFE 3G01A 1ZOMA 3K9XB 1GHXH 1TBZH 1HAZB 1E35B 3I29A 3VB7A 1SVPA 2AIPA 1O38A 3DFLA 3P8NA 2A7HA 2EA3A 1EB1H 3A82A 2ZGHA 4WF8A 2GGVB 4CHAC 5FCKA 5JBTA 1O2SA 1YP9A 3MNSA 3E16B 2VWMA 1HCGA 2OINA 4BAHB 2VIQA 1KTTB 1S6FA 3T29A 2Y7ZA 3ESTA 3RXIA 2M5TA 3UNQA 5TCAA 4JMYA 4TY6A 1G30B 1DWDH 1P2KA 1CBWB 2AH4X 1Y5AT 5J4QA 3A7VA 4JYVH 3UR9A 4Y10E 2C4FH 2I6QA 3M7QA 1PYTD 4KTUA 1GVLA 3P8GA 1WV7H 2BY7X 1UHBB 1LHGH 1DPOA 1EUFA 4ZXXH 3BV9B 1YM0A 2ZA5A 2G51A 2W3KA 1SGFA 2C90B 3UQOA 7ESTE 4XSKU 1AVWA 2G81E 4ISIH 4BTUB 2TGTA 4MLFB 2A7CA 1OKXA 2OXSA 2ESTE 1SFIA 4UONA 1EJAA 1AB9B 2NU0E 2OC7A 2UWOA 2FOEA 1RJXB 2AEIH 2ZHQH 4HI3A 1GBKA 1PPBH 3PWCA 2B7DH 1LPKB 4B2BA 1QY6A 2P3UB 1GCTC 2FWWA 4DW2U 5GCHG 1NRQH 2FS8A 4ABBA 1FAXA 1ZR0A 1ELFA 2QXJA 5E0JA 1ETSH 4FUIA 2ZKSA 2PGBB 1OWHA 3ZVEA 1G3BA 4LOYH 4CBOA 1C1OA 1RFNA 2BD7A 2W26A 3D23A 4QT8C 1H9LB 5LPRA 1FY8E 5DG6A 2SGPE 3A84A 1O5GH 3U8OH 1NRSH 4HZHA 4IS5A 4Y7AA 4BAKB 1A5HA 5FPYA 2P94A 5FBEA 3QTVH 1O3KA 1YCPK 2XRCA 1K2I1 4I8JA 3RU4D 4WH8A 1HAIH 2BD3A 5EW1H 1FV9A 1DY9A 3M5OA 4NSYA 1OYQA 5EQSA 5FPSA 5AHGH 2ZU5A 3L33A 3PWBA 1LVMA 1V2NT 1C2LA 3H7TA 1LHCH 1QJ7B 1HB0B 1WQSA 3BIUH 1QL8A 2D2DA 3M7TA 4FUGA 1SGCA 3MH7A 4YLQH 2QC2A 4I8KA 3UR6A 1C5RA 1W0YH 1ZJDA 3FP6E 2BY9X 1GVZA 5GWZA 2OQ5A 1UTJA 1N8OC 1W10U 3VGCC 4UFEH 2XBVA 1SI5H 5EOKA 4DIIH 1TMUH 1H8DH 3EA9A 1C2DA 4DCDA 5JBBS 1TABE 3RC6A 1DWBH 4BXWA 3GICB 1QR3E 1V2ST 1GI2A 2FTMA 2ZDNA 3ZVFA 2GCTC 3S9BA 4DT7B 3UREA 2GX4A 4CRCA 6CHAC 4DIHH 3SI4H 2BLOA 1YPHE 4WMFA 5L30H 1T4VH 3UOPA 3PMJA 1MTWA 1ETTH 1TQ0B 4HFPB 2VIVA 1IQFA 1W13U 5JB9S 1NRNH 4UFGH 2WINI 3MU8A 1IHSH 5HXFA 1TLDA 4JZFH 2HNTF 1ELVA 3FZZA 1LTOA 1G2LA 4HGCA 1XM1A 1PQ5A 3SU2A 2IJOB 1C2EA 3UOUA 2SNVA 3RM0H 2BVXH 2BZAA 1GDNA 1GJ7B 1MU6B 3BTQE 1TNJA 3RUOA 1A3BH 1C1RA 1KDQA 1MQ5A 1C5YB 1O2RA 1S0QA 2BXUH 3GY4A 4CRFA 5E2OA 1GGDC 1L1NA 4WMDA 5T6DA 1S0RA 2XW9A 1B5GH 4K8BA 1F2SE 4ZHLU 1AI8H 3BEFB 2AMPA 1T31A 2A7JA 3FAOA 1C2KA 2FTLE 1C5VA 3SU6A 4CREA 1O3IA 1Y3VA 1TX8A 3ODDA 3PO1C 1OWKA 2A0QB 4JCNA 1O2MA 1K22H 4H6SB 4MNVA 4NSVA 4NZQA 1OWEA 2A1DB 1NFWA 4OS6A 3QZRA 3QGNB 4I31A 1BHXF 3D62A 2HGTH 2H5DA 2FYQA 4GSOA 1A4WH 1O2UA 4FVDA 4VGCB 3ZZ6A 1NU9A 1ZMLA 2UUJB 1GJCB 1P06A 4TPIZ 3SU1A 1XUHA 1TWXB 2RA3A 2SGEE 2ZHDA 2DE8A 1KDQB 2ANKH 2TGPZ 4I8LA 1XKAC 2GZ9A 4Y0YE 3TLOA 2BVSH 1MKWH 1XX9A 3Q00A 4FVBA 3RXOA 1DWCH 3F68H 1E36B 4FU8A 2A4QA 1O39A 1MTNC 1YPLH 2W7SA 2BOKA 3BG4B 1OYTH 3VB6A 2ZCHP 1H8IH 3A7YA 1GHAG 2BXTH 3LGUA 1YKTA 1Z8IB 3ZYDA 1XVOA 4ZROA 3E8LA 5C5OA 1KIGH 1HXEH 2OBOA 1H9HE 3MI4A 5DK1A 2GZ7A 1GBHA 3R0FA 1P2OA 3R3GB 6LPRA