4X1SU

The crystal structure of mupain-1-16-d9a in complex with murinised human upa at ph7.4
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mupain-1-16
publication title A cyclic peptidic serine protease inhibitor: increasing affinity by increasing peptide flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
total genus 59
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1sU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1sU01
3SNDA 4HZHA 1GJ4H 1O3KA 1IAUA 3SQHE 1VITF 2TGDA 4X8UH 2VB0A 4GSOA 3RXHA 3RM2H 3NWUA 5JBAS 2XC4A 2SFAA 1BMAA 1ABIH 2XYAA 1TMUH 2UUKB 2GKVE 3S9CA 1KLIH 1KTSB 2UWPA 3M35A 1GDUA 1TLDA 2TPIZ 2BDCA 2VJ1A 1AQ7A 3A88A 5FCKA 4Y11E 3P8GA 1SOZA 4TY7A 3RLWH 1ETTH 1T8OA 4Q7YA 4JZFH 3VGCC 1QBOA 1TQ7B 1H4WA 4X2YA 2PGQB 3ZV8A 1CSOE 1LO6A 3V3MA 4BAOB 1KXBA 2QXIA 4KGAA 4MDSA 1XUHA 2A7CA 1M9UA 2Z9LA 3V7TA 1NRNH 4GHQA 1P57B 4AFQA 1JXPA 2QC2A 1GMCG 1VGCC 2ALPA 3SHCH 1MMJN 5C67A 1CT2E 2BD4A 5LPRA 3BF6H 3RXBA 3M61U 3KIDU 3E3TA 2CHAC 2BX3A 2ZC9H 4ISIH 3TJUA 4K2YA 2QYIA 1UTMA 1LTOA 1QBNA 2QXJA 1SLWB 2XBYA 2ULLA 2FTMA 3BTWE 1KXFA 3BSQA 4D7FA 1A46H 3A7TA 3TGKE 3TVJB 1SGTA 1HXEH 1PYTD 3C27B 3M7UA 5JB8S 3PO1B 1QL7A 2QIQA 3H7TA 2VIOA 2FWWA 8GCHF 2DE9A 1O30A 1AIXH 2WV5A 3NXPA 1TGCA 3H7OA 1YYY1 1Z1IA 4H6TA 1C5SA 2FEQH 2NU1E 3MNSA 4H6SB 1SR5C 2FODA 4IC5A 1UTPA 2W7UA 1A0LA 1C2DA 1FAXA 1HJ8A 4Q7XA 3T25A 3HGPA 1A61H 1P03A 1OWEA 3PLKA 1H9HE 1V2JT 4TYDA 2ZFFH 5F6MA 3QN7A 3MNBA 4FUHA 1YPHC 2OLGA 3HK3B 1E36B 3PMAB 2SGAA 2GD4B 1SG8B 2GV6A 1OWHA 1T32A 1O5BB 1SOTA 3B9FH 5E0HA 1DVAH 4M7GA 3RU4D 4MPVA 1SQOA 1GBMA 3AAUA 5FAHA 5L6NH 1UTJA 2ODYB 3S7KB 1G32B 1LHGH 4ABEA 1L1NA 4AB9A 1LVOA 5EXNA 1TA2A 1TNHA 3ZZCA 1TQ0B 1HAZB 3GDSA 4ZAEA 3ATLA 3EA8A 1IQNA 2FI3E 1SLXB 1Y5UT 1V2ST 1G2MA 1O2NA 3JZ2B 1HAGE 3OSYA 1O3PB 1V2TT 3A7ZA 1F7ZA 3GICB 4A1XA 3GY3A 3SOSA 1P8VC 3U9AH 1P05A 1HUTH 2PFEA 1F2SE 2UWOA 4BNRA 5L2ZH 4I7YH 3QX5H 1MTWA 3A82A 3BEFB 1C1RA 1T8LA 1NT1A 3BTQE 4I8LA 4NIWA 5K0HA 1HLTH 2ZPSA 4HI3A 2GMTB 1C4U2 1KLTA 1YPEH 3P6ZB 8LPRA 1FUJA 1N8OC 1RTKA 2BOKA 2OP9A 3TH2H 1LCYA 1UTQA 2QV1A 1B0EA 1GL1A 3UWJH 4DURA 2PTCE 2RCEA 3Q3KA 2DUCA 3LONA 3UY9A 3MTYA 3UNQA 4ABBA 1TWXB 2F3CE 4B2AA 3RXLA 3A84A 1C1MA 2A5AA 1O3OA 3S7HB 1TONA 4A5TS 2BY7X 2DE8A 4INKA 1AFQC 1GHAG 1IQJA 2QF3A 4K5ZA 1YCPK 3L33A 1YCPM 3MMGA 3UPEA 2J34A 1TBRH 1GDQA 1K1OA 1P0SH 1TRNA 3DA9B 2ANWA 2WPHS 1T4UH 4JYUH 1JRTA 1RIWC 2FOMB 1O32A 1A0HB 4NFFA 1PYTC 1HAVA 1ELDE 1GBCA 3ZZ6A 1Z6JH 2RA3A 1QRXA 4X1PU 3SJKA 5GPIB 1TE0A 1OPHB 1AWFH 2ZDAH 3T62A 5A0CA 2ZGCA 1UTLM 4AX9H 1CGJE 4MLFB 3ZZBA 4B76A 1XXFA 1MD7A 1NM6A 2SGQE 1Y3XA 3EA9A 2ZA5A 4DJZB 1YPLH 1IQKA 5B6OA 1YF4A 5C1XA 2Y81A 1W13U 4NG9H 1QQ4A 1C1UH 1AMHA 1P10A 2VVVA 3M3SA 4PROA 3FFGA 1ZPBA 3E16B 2G4UA 2RA0A 2CMYA 3VXFH 1QGFA 1INCA 3VB6A 4OGYA 2GZ8A 1ABJH 2AIQA 1AY6H 4VGCC 1HCGA 2J4IA 5H4IB 1FZZA 4UFDH 2ZFPH 1UK3A 1HBTH 4R0IA 5E2PA 2BZ6H 1DWDH 1LPZB 1IHSH 1XVOA 1Q3XA 2OC8A 1QB6A 1P04A 3VGCB 1BTHH 3TU7H 9ESTA 4JZ1A 2ZG0H 5FPYA 3VXEH 1NY22 3Q3YA 1QB9A 1TBZH 3F9HA 1BJUA 4GCHG 1QRZA 2FOCA 1ELAA 2JH0D 5EG4A 2HNTC 4CH2B 1QR3E 1F5KU 3M3TA 3M37A 2OQUA 1FMGA 2ZFQH 1B5GH 4Y7AA 1AFEH 2F9OA 1TX7A 2O8WA 1P02A 2W3IA 2CHAB 1PPCE 1ZJDA 3HK6B 1O38A 2A4QA 3IITA 5C20A 1NN6A 3SU4A 3PM3A 1CA0C 1C5TA 1SGIB 3EE0B 2J38A 2PTNA 2BDAA 1IQHA 4IW4E 4IMQA 1TOMH 3MH6A 1O3DA 2B8OH 3D62A 2AGGX 2F9PA 4I8GA 1AVXA 2HGTH 5EW2H 4MQAA 1RS0A 3RXSA 1SGDE 2YNAA 3EGKH 3SU2A 1O2HA 2WPJS 1K2I1 5JB9S 4FUEA 5GIBA 3MU0A 1C2FA 1C1PA 3LC3A 1AB9C 1KSNA 2Y5HA 4CRFA 4WVPE 1KDQA 2AGEX 3A83A 2GDEH 1MU8B 3QO6A 1EZUC 2WINI 1ZMLA 2WYGA 1DWEH 3OX7U 1XUJA 3NPSA 3GY4A 1PJPA 3E0NB 1GBDA 2J92A 1O2VA 3ZVDA 1FDPA 1DXWA 2SGFE 5BRRE 3SV8A 1G37A 5JBCS 1TGNA 3CP7A 3ITIA 3RXKA 4A1VA 1FN8A 3KQBA 2ODPA 4WJG2 1ZTLA 2THFB 3LKWA 1GJ6A 2HPQH 2CN0H 1IHTH 4AGJA 6GCHG 1A4WH 1BBRK 5T6DA 1LQEA 1LQDB 2PV9B 1O5GH 1AHTH 3M5LA 1ID5H 5F8TA 2A2QH 4YLQH 3M36A 3M7TA 3ZZ9A 2XBWA 3RC5A 1TPPA 2UWLA 4FU8A 2VWMA 4X2XA 2BQ7B 2YNBA 4E7NA 5T6FA 3RXEA 2R9PA 3M3VA 4K3JA 4X1SU 5BPEA 1Z8JB 2SGEE 1DWCH 3MO3A 1EP6A 4LZ4B 1CU1A 1ZSJA 3QK1A 5CHAC 2GGVB 3KHVA 2AS9A 1EOLA 1V2PT 2OCVB 1MKXH 2Z9KA 1QJ6B 1N8OB 3Q76A 4Y10E 1MUEB 1RJXB 2FXRA 3MU8A 2BY9X 1WBGB 1NRPH 2I6SA 1EATA 1O3CA 1XM1A 2BD3A 4AFUA 4NSVA 1V2LT 1EAIA 3K6ZA 4ZMAH 2C93B 2BTCE 1GJ7B 1XUGA 3RXUA 2HLCA 1K1NA 1RRKA 2ZF0H 3PROA 4NIXA 5A09A 3TNSA 1G9IE 1L4ZA 1UVSH 1GBIA 1YKTA 3AAVA 1GJAB 1JRSA 1RTFB 3VEQB 2GP9B 3Q3XA 1GI6A 7KMEH 1UTNA 5IDKA 1S5SA 2XWBI 2RG3A 4YOJA 1ETSH 4AB8A 4UDWH 2AMQA 3FP7E 1JOUB 4CH8B 3M7QA 1RIWB 1PQ5A 4ZHLU 2FYRA 4Q80A 2G81E 2ANKH 3E90B 2KAIA 1K1JA 3S9BA 1C4Y2 3TH3H 3Q00A 2QGRA 1TBQH 8KME2 1AUJA 1V2KT 4JMYA 1E37B 2XWAA 4RKJB 2B7DH 1BIOA 9LPRA 1DXPA 4CRAA 4NCYA 2TGTA 1O2YA 5I25A 1GG6C 2WUBA 2G51A 4CR5A 2Y7ZA 4H42U 1AUTC 1OP2A 2GZ7A 1G2LA 3BN9A 2Q6GA 2FDAA 2WPLS 1MKWH 5DK1A 5DP4A 5FBIA 2STBE 1GL0E 3QZRA 4GLYA 5L30H 4I8JA 4Y0ZE 1CT0E 3GYMA 1V2UT 1BRCE 1EOJA 3NK8A 3RU4T 1EUFA 4VGCB 1KXCA 3UOPA 2A45B 2P16A 1GHYH 4TY6A 1HJ9A 4WH6A 1GHWH 2SNWA 2GVFA 3A81A 2TBSA 4HFPB 5EQSA 4ABFA 1VJ9U 4ABIA 3A89A 4UFGH 1EJNA 1C9TA 2HALA 1J17T 4NWLA 1SFQB 2CGAA 3SNCA 1TGBA 1C1QA 3LT3A 1NROH 1BHXF 4K1EA 3QDZB 1EX3A 3MO6A 1A0JA 3F1SB 1GMDG 4K60A 1V2WT 1RTLA 5FCRA 3LOXA 5EGMA 5LGOA 4NIVA 3MH4A 1C5NH 1BBRH 1TPSA 2QXHA 4HTCH 1D3TB 3FAOA 4OS6A 3O8RA 3SUEA 3EA7A 3GCNA 4X8VH 1O2OA 1VJAU 2OC7A 2PWXA 1SSXA 1NFUA 3MH7A 3R0FA 4OS4A 1RXPA 1CA0B 3ZVGA 4DG4A 4LXBH 1GDNA 4D76A 3DUXH 3VFEA 5EXMA 2OBQA 4UE7H 2ZP0H 4K8BA 3KCGH 1GCTB 3TPIZ 1LDTT 2P3TB 2IOTA 5A8ZA 1G3EA 2P95A 3SORA 5TJXA 1ZR0A 4MG3A 4BOHA 1CHOG 3RMMH 1HAVB 1GHBG 1O2WA 2FP7B 1TPAE 3E8LA 1IQGA 4SGBE 1AB9B 1ZSLA 1GBBA 1SB1H 1HAIH 4WMFA 1O5DH 1QIXB 1G3CA 4ZKSU 5TCAA 4BXSA 4ABHA 2A1DB 4X6NA 1ANDA 1O36A 2BMGB 3RXDA 1V3XA 2VWLA 2G4TA 3EAJA 3FANA 2ZDVH 2A7JA 3SV7A 4WMEA 1NU7B 2VIQA 3V0XA 2PUXB 1GHXH 3GCTG 2J9NA 3A85A 2R0KA 1C5WB 1DS2E 1PPBH 1GHAF 3STJA 4ASHA 5AVDA 3SW2B 4JZDH 3SNAA 1K21H 1ELBA 4DVAU 5F03A 4B74A 1GMHG 4B2BA 2OXSA 3K9XB 4KTCA 4A6LA 1GCDA 1DT2A 2Z94A 3P8NA 3ENSB 4D7GA 7GCHG 1NC6A 3VB3A 1SGCA 2ZPRA 4IN1A 5HM2A 3B8JA 1ELVA 2IJOB 2GT7A 1TAWA 2FESH 2W7SA 1SC8U 4OS7A 1J8AA 2PW8H 1P2QA 2ZHWH 1GGDB 1AE5A 3E0PB 2BDGA 1N1LA 1BA8B 4NFEA 1E35B 3MU4A 5PTPA 5C3NA 1P2OA 4FUGA 1EP5A 3RC4A 1LHEH 1NZQH 2C8ZB 1O3GA 4AYYB 4FUCA 1JMOH 3ODFA 2FOBA 1DX5M 1ARBA 1O35A 4K1SA 1GVKB 3RXTA 3TLOA 1YPJH 5IYTA 3U98H 2BDYA 2G8TA 4Y8ZA 3P8OA 1J15A 2ZHDA 5J4SA 1T8NA 1FY3A 2ZHFH 4A92A 3U8TH 1S6HA 2QAAA 1TRMA 3TIUA 1IQMA 4BAKB 3CS7A 1THSH 1O33A 2D26C 3SO3A 6CHAB 1GI2A 1H9IE 1Y3UA 4AG1A 2VNTA 3GY7A 1HIAA 1MCVA 2OINA 1LPKB 2XC5A 3NUMA 1WOFA 1Z8IB 1FV9A 5HXFA 1KDQB 4GCHF 3H5CB 4U2WA 4KTUA 2XRCA 2ZQ2A 5EOKA 1ZOMA 2FIRH 4ZKOU 3DFLA 2VINA 2HVXA 3MH5A 2Q6FA 1XXDA 1ELEE 1ESTA 1YLCA 4B71A 3ZVBA 4MNVA 4ISNA 2O8MA 4NZLA 3LU9B 1PQAA 1ZMJA 1VCWA 1SHHB 2ILNA 4Z0KA 4DGJA 2Q6DA 1QRWA 1ZHRA 3W95A 4JCNA 1GG6B 4O97A 4SGAE 4ZKRU 2QXGA 2P93A 4LZ1H 1JBUH 2R2MB 2XBVA 2EC9H 2BDIA 1LVBA 1MBMA 1EZQA 4MVNA 4ABJA 3SUDA 1FPHH 1P2NA 1DY9A 2JETB 2LPRA 4ZH8A 3A8CA 3TGIE 1O2LA 1FPCH 3EDXB 3SUFA 1SGYE 1ZPZA 1EASA 2XTTB 3ATIA 3PYHA 3TNTA 3ZYEA 4XBDA 1H9LB 2F9NA 1DLKB 2A4GA 1AKSB 1F0UA 2ZI2H 1QBVH 4GHTA 2BLOA 2HWLB 2OC1A 2ZECA 1GJ5H 1O39A 4FUDA 5A2MH 3RXAA 1O5AB 1MTUA 2WUCA 4RKOB 3PWCA 3AW1A 2ZEBA 3GDUA 3MI4A 1C5PA 2ZQ1A 3BEUA 2VWNA 3M5MA 1C2EA 5C5OA 4MNYA 6GCHF 5G4BA 1RGQA 1O5CB 3QGJA 3F9FA 3RXVA 1CHGA 3K6YA 3SV2H 3UNRA 2ZU2A 1ZHMA 3CENA 4AZ2B 3RXRA 2H5CA 1P9SA 1BTZA 1O2ZA 2ZCKP 4NGAH 2H9TH 4BXWA 3F9EA 2I6QA 4X2WA 1O3LA 2ZTYA 2FLBH 4BAQB 4X8SH 1JWTA 3RXIA 4DY7B 5FPSA 1O2KA 2IPHA 1LMWB 1UVOA 2R0LA 1IQIA 1O2RA 4YT7H 1MKXK 3UIRA 1K22H 2A4RA 1GHVH 2KAIB 3ZYDA 2AMPA 1AZZA 5DP9A 1O3IA 4Y8YA 1W11U 3QZQA 4CR9A 4E06H 2BB4A 3O8CA 2J94A 1HPGA 3K65B 2Y5GA 3D23A 1UJ1A 1WUNH 2C3SA 1MQ6A 2ZFSA 3EQ0H 4X1RU 1F92A 1TOCB 3RC6A 1W7GH 3S69A 1YPMH 1BT7A 1O3AA 1GBTA 3SU0A 1NFWA 2BLVA 1FN6A 2HPPH 5GCHG 1XKBC 3TJVA 1GI5A 1MTNC 3AVZA 2FOHA 3TJNA 1VGCB 1C2KA 5T6GA 1C5XB 2P8OC 2O8TA 1ELCA 1FIWA 2ZTXA 1WSSH 1ELTA 1KY9A 1P12E 1UCYH 2FX4A 3TH4H 4ABAA 5A8XA 3KQCA 1C1TA 4NIYA 2FM2A 4IBLH 4B75A 4BAHB 2VGCC 4LOYH 2ZZUH 5JBBS 4ZKNU 1DICA 4MPXA 5CE1A 1Z8GA 4BANB 3GDVA 4DIHH 3FVFB 3P8FA 1XKAC 1C2IA 3UQOA 4JK6A 4X6OA 2UUJB 2VWOA 1NPMA 1ZRKA 3P92A 1ESBA 3LH1A 1DUAA 1F0RA 2JH6D 4U32A 4CRDA 3M5OA 2Z9IA 2XBXA 1K1PA 3JZ1B 2F9UA 1H1BA 5ETXA 3DD2H 2Z9GA 1GVZA 1QB1A 4GUXA 5HM9A 1L0ZA 1QJ7B 4FVBA 3R3GB 1MAXA 3TGJE 1V2VT 1TMTH 2BY6X 1EQ9A 1OKXA 1GBJA 1HAHH 1MKWK 2ANYA 4YTAA 1ETRH 1S82A 1E34B 1B7XB 1WV7H 1WAYB 4NA7A 1HFDA 1AO5A 3URCA 1KXAA 4CRBA 2STAE 1C5RA 3ZVEA 1A3EH 3KQDA 1S6FA 1LPGB 1SGNE 5J4QA 1IQLA 1UHBA 4TPYA 1EAUA 2BD9A 5AF9H 4DIIH 3S0NA 3QLPH 3LGTA 1Y3YA 3ATKA 4KTSA 1LVMA 1AN1E 1EZSC 1UK4A 1DDJA 5DG6A 3ATMA 1OXGA 2NU3E 1O2TA 4IMZA 1RFNA 3EYDA 3MU5A 3PMHB 1SQTA 3GY5A 1O5EH 1O0DH 5DKMA 5DO4H 1AI8H 1MU6B 1QQUA 2Z3DA 5EODA 4BTUB 4YOGA 1BTWA 1TPOA 1C1OA 4UEHH 2H2ZA 1C2GA 2P59A 2Y82A 2ZTZA 3RXQA 2ZKSA 1CQQA 1GMDF 1C5YB 1PQ7A 4I32A 3SN8A 1GWAA 2F91A 5DP6A 1O3HA 5JPMH 1C5MD 3I77A 3B23B 3VB5A 2GCHG 3UOUA 1ZYOA 2PUQH 1J16A 5GJ4B 1SHYA 2ZHQH 1ESAA 1LVYA 4ZXXH 1MBQA 2BXTH 2ZGJA 1O2IA 3PWBA 1P09A 5CMXH 3RXOA 1OX1A 3A86A 3MNCA 2F83A 2ZDKA 2H6MA 3HKIB 1TX8A 2XCFA 5ESBA 1D9IA 1O34A 1Y3VA 2BM2A 2EI7A 4AOQA 5C5NA 5I46H 1VITH 4XOJA 3GCHC 1QY6A 3PO1C 1O3JA 3BG4C 1CHOF 1P2KA 2ZGHA 1GHBF 1UMAH 2Z6BD 3RLYH 1A2CH 4FXGH 2NU0E 3GYLB 2H9EH 3OU0A 1SGFG 1TIOA 3SHAH 1O2MA 3RMLH 3MWIU 4THNH 5FX5A 1O5FH 3U8OH 1YLDA 4FUIA 2J95A 5DPAA 2A7HA 3FZDA 3E1XB 3AASA 1U6QA 1BBRE 2C90B 3SJIA 1KXEA 4FVDA 3PLPA 2BD8A 3RDZA 1CVWH 1AFQB 1KTTB 1ZSKA 5AFYH 3KNXA 1H8DH 1SMFE 4Q7ZA 3GOVB 1LHDH 4AORA 1MTSA 1BQYA 3GCTF 2FS9A 1EKBB 3GY8A 1L1JA 2BVSH 2EI6A 3UREA 4XDEA 1XUIA 1BCUH 4UFEH 1C4V2 2D8WA 5FBEA 2GX4A 1Z7KA 1OS8A 2B5TB 3AW0A 3GY6A 3SU1A 1GI9B 1GMHF 1W14U 1OWKA 2PLXA 4ZHAA 2V3HH 1Y5BT 4WMDA 1VZQH 2FMJA 1MD8A 1HIAB 2R3YA 7GCHF 3RXJA 2NU4E 2FS8A 2XXLA 1YPKH 2TGPZ 1TFXA 2G52A 3RXMA 2FOFA 3BIVH 3VPKA 1QL8A 4AYVB 1ARCA 2BYAX 1BMNH 2FO9A 1FY1A 2Z9JA 3LIWA 4TWWA 3MO9A 1B0FA 4BTTB 1CGHA 1A1RA 5F8ZA 2C8XB 3F6UH 1GPZA 1EAXA 1ACBE 2FI4E 4YESB 1SGPE 1LHCH 3GISB 6LPRA 1W3CA 4A1TA 5E2OA 1AVWA 3SJOA 4CBOA 1PPZA 3LPRA 1HAPH 1GBHA 4XBCA 2P3UB 4F49A 1E0FD 2FPZA 1BTXA 3RM0H 2PKAA 1Y8TA 2GT8A 1E38B 3ZV9A 3W94A 1ZLRA 5HYOA 1G3DA 3ZZ5A 1TMBH 4YLUA 1A5HA 4K69A 1ELFA 1MTNB 3SUGA 2VIVA 1GHZA 5A8YA 2OC0A 3FZZA 3SNEA 3O8BA 1C5QA 1F5RA 2P8OB 1AD8H 3MNXA 2BLQA 3SV9A 4AG2A 4X6PA 4ISLA 1MCTA 3DHKH 1A3BH 1L2EA 4HGCA 2ZIQH 1FLEE 3C1KA 4MTBA 1BHXB 4E7RG 1WU1A 2BXUH 2VGCB 4KKDA 2W5EA 3TJOA 4WY3A 4FUFA 2ESTE 2XNIA 4IC6A 4D9QA 2GCTC 4GVUA 2SGDE 2ZNKH 3T5FH 1GI8B 1P11E 1DWBH 2V3OH 1QHRB 3LJOA 1A5GH 1XX9A 1TNIA 1OYQA 1C5VA 2H9HA 4DT7B 3MHWU 3NZIA 3T29A 4GPGA 2H5DA 2VIPA 2VVUA 4X2VA 3MOCA 1NFYA 2W3KA 4XSKU 2PKSC 3DFJA 1DOJA 2ZU3A 2UUYA 2WPIS 1QL9A 2O8UA 2RDLA 1PFXC 3E6PH 5E8EH 3RXPA 2G55A 1V2MT 5ESTE 8ESTE 2VH0A 1P06A 1MAYA 1OP0A 1BMMH 2ZO3H 3QTVH 1CT4E 2QN5T 2BVXH 3PTNA 5FXLA 1ZGIA 3RXCA 3SU5A 3BEIB 4Y7BA 1A7SA 1DM4B 2ZU1A 1YP9A 3SU6A 1WTHD 2GV7A 4XFQA 4AN7A 1CBWC 3TITA 2BY5X 4KP0A 3F68H 4FU7A 3OYPA 3SQEE 1F0SA 2ALVA 3A8DA 3UTUH 5DP3A 5FHTA 1UK2A 2NU2E 1BTYA 1GBFA 3UUZA 4UD9H 1S0QA 2TRMA 3PMJA 4YM9A 2HRVA 1EPTA 3A80A 2O8LA 2GDDA 1P3EA 1BDAA 1SGRE 1ANBA 1THRH 1C2LA 4FUJA 2D2DA 2PHBA 3BTDE 2VU8E 1P2JA 1GBLA 2P3FH 4OGXA 1A5IA 1HJAC 2R2WU 4DCDA 1GI7B 1PPFE 2OUAA 2R3UA 2WV4A 1O2SA 5EW1H 4O03A 1ELGA 1NRQH 1OP8A 2A0QB 1YPHE 1EB1H 1S85A 5JBTA 1DITH 3ZZAA 4Y79A 4INLA 3HPTB 2Z3CA 1ZRBA 2J2UA 5CHAB 1V2OT 3ELAH 1GJ8B 3VB4A 3GCHB 1O2GH 3BG4B 1O3BA 1DSTA 1XUFA 3N7OA 1BRAA 3KL6A 1N6XA 3GCOA 3FP8E 5EXLA 3MYWA 3A7VA 3KGPA 3T26A 2AH4X 4D8NA 3PV4A 1SI5H 2QY0B 2AERH 4B2CA 1DUEA 3A87A 3ZZDA 1ZTJA 3BIUH 3BTKE 1GI0A 2CF8H 1SQAA 3RUOA 2ZFRH 1BRBE 4Y71A 5GCHF 1UCYK 1VCPA 3BTHE 2FZZA 4A7IB 1D6RA 1DE7H 5DP7A 5HGGA 4I31A 2BQWB 1UHBB 4NSYA 2PSYA 4UONA 3RXGA 1EZXC 2G5NA 4OS5A 4Z6AH 2PSXA 4B73A 4CHAC 2A2XH 4ISOA 2GTBA 1GI1A 1AWHB 4WWYA 2PGBB 1C2MA 3QGNB 5AFZH 3TK6A 4JZIA 1XVMA 2BDBA 3BTTE 1LHFH 2A5IA 2AIPA 4RN6A 4KELA 4X1NU 1VR1H 3I78A 3V12A 1TRYA 1AVGH 3S9AA 1YC0A 1BZXE 2SGPE 1BOQA 2VVCA 1EPTC 4Q2KA 4CREA 4MNXA 5ABWA 1QURH 1PQ8A 1TALA 3IG6B 4OS1A 2V6NA 4AGKA 1Y3WA 5C1UA 2WYJA 1OYTH 1MZAA 1FIZA 3BTGE 1VITG 4R8TB 4XBBA 2D1JA 1VCQA 4ZHMU 1MTVA 3TK5A 3LGYA 1TNKA 1Q31A 3U1JB 2OD3B 5EQQA 2V0BA 3U8RH 3HGNA 3LGWA 4U01A 1KXDA 1QFKH 1UCYE 1S83A 3SGQE 1EB2A 1D6WA 1UVTH 4DOQA 4QT8C 2AFQB 4AFZA 2PR3A 4RSPA 3T28A 2BD5A 3QUMP 1FJSA 2HOBA 1NRRH 1TGSZ 4U30A 5AHGH 2EI8A 3BG8A 1XMNB 3P70B 4YOIA 2FYQA 1Z1JA 2ODQA 2VIDA 4ZXYH 1BJVA 3SJ9A 3A7XA 4O9VA 3SJ8A 1ZJKA 1GI3A 1CGIE 1TB6H 4BAMB 1C1WH 1QA7A 1BRUP 1L4DA 2EA3A 2GCTB 3G01A 4AFSA 5EQRA 3BTFE 1W0ZU 4JYTA 2BVRH 2ZCHP 3F9GA 2OQ5A 3SI3H 2A4OA 3UR9A 1P9UA 3LGIA 1UVPA 1TGTA 4NZQA 5FPTA 3A8BA 4NA8A 1FY4A 2ZCLP 2GCHF 2C8YB 1NESE 4F4OC 1ORFA 2CF9H 2ANMH 3RU4E 3U69H 2ZDNA 2FOAA 4GAWA 1UTOA 3HKJB 4JYVH 4ZUHA 2PKSB 1SGQE 8GCHG 1HYLA 4ABGA 3I29A 1ZMNA 3BTME 1QA0A 3MU1A 3T27A 2ASUB 2BZAA 2ZWLH 1WQSA 3ZVCA 2HNTE 1K1MA 3FP6E 3SV6A 5DP5A 1NRSH 2IN2A 2VH6A 1UO6A 3ZVFA 2BLWA 1TX6A 1Y59T 2C8WB 2JH5D 3URDA 5C2ZA 1O31A 1O3MA 1QNJA 2NWNA 1TABE 1EXFA 3BTEE 3ZVAA 3RMOH 1H8IH 1SVPA 1W7XH 5A0BA 1CBWB 1T8MA 1PPEE 2Z7FE 5K7RA 1C9PA 1J9CH 1HV7A 3SI4H 3GY2A 1J14A 5SGAE 3ZZ4A 1KIGH 2WPKS 1JIMA 1P3CA 2FLRH 2K1QA 3A8AA 2PKAB 1BMLA 3Q77A 1O2JA 2F9VA 3PB1E 2M5TA 3BV9B 2AEIH 1K1IA 1Z6EA 5E0GA 1LKAA 3ESTA 4Y0YE 1HJAB 3OY6U 1SLVB 4JK5A 1GVLA 1C2HA 4X6MA 5E0JA 1W8BH 3PMBB 1ANCA 1GJBB 5JDUB 1PPHE 1HNEE 1V2NT 3E91A 4I8KA 1MQ5A 2BX4A 3UWIA 1WYKA 4MPUA 5DP8A 5FX6A 5EPNA 1W0YH 5GDSH 1AGJA 1V2QT 1D4PB 1O2PA 3QTOH 5TCCA 1FY5A 4INHA 3P17H 1QTFA 4BTIB 4YO9A 4CRCA 1OWDA 3SGBE 2Y6TA 1D3PB 1GJCB 1GCTC 2BD2A 4OS2A 1V2RT 3WY8A 2XC0A 2FI5E 1HGTH 1NFXA 1RD3B 1G36A 5HMAA 4ISHH 3STIA 2A5KA 1Z8RA 2FOGA 3KF2A 1OWJA 1GI4A 1P2IA 4CRGA 1ZZZA 3KN2A 4NWKA 1IQEA 2P94A 1CO7E 1D3DB 4TPIZ 1HB0B 1LKBA 1O2XA 3SNBA 1THPB 4WH8A 4WF8A 2C4FH 1YGCH 4YZUA 3LJJA 2BDHA 1TA6A 3SU3A 1ZPCA 2F9BH 1MH0A 4Y76A 3KQEA 1GJDB 1G30B 1V6DA 4DW2U 1GBKA 4FU9A 1O3EA 1EJAA 1X7AC 3NCLA 2BHGA 1C5LH 4ABDA 3UNSA 2B0FA 1YCPH 3TK9A 1T7CA 1C1VH 3HATH 2A32A 2QCYA 3CS0A 1WCZA 4CHAB 4IN2A 1OWIA 1BITA 4ESTE 6ESTA 1TNJA 1S81A 1UTKA 5EPYA 4MPWA 3P95A 1N6YA 1BUIA 1F5LA 1C5ZB 4FUBA 3UQVA 3LGVA 3NKKA 1NO9H 1F0TA 2QA9E 3SZNA 1EPTB 4H4FA 3OTJE 5LPFA 1HAOH 1KYNA 1FXYA 1KLJH 4J1YA 1OOKB 2OBOA 1MZDA 1W12U 2Q1JA 4O3TA 5LH8A 1ZTKA 3OY5U 4ZROA 4CBNA 1O2QA 1DFPA 2CXVA 1FI8A 4K8YA 1Q2WA 5LPEA 2ZU5A 1AU8A 1SLUB 1GGDC 2FOEA 2G5VA 1P01A 1AKSA 3A7WA 1OSSA 3RXFA 4B1TA 4LK4A 2WPMS 4E05H 3SGAE 2OTVA 4WXVA 1T4VH 2ZHEH 5C1YA 3L6PA 1C5OH 2G00A 4IGDA 4TWYA 2Z3EA 3ZZ8A 2QF0A 3KEEA 1UVUH 1WQVH 3UR6A 3ATWA 1XUKA 2ZDMA 2BY8X 1HXFH 3M5NA 2O9QA 5JYIA 1YBWA 3QWCH 3DT0H 1EJMA 4WXIA 5GWZA 2AMDA 5DJ7A 1WTGH 6CHAC 2ZFTA 2FX6A 1DLEA 4YT6H 1QJ1B 2ZDLA 4Y6DA 4NA9H 4Y8XA 1DY8A 3LDXH 1GBAA 1ANEA 2EEKA 4MNWA 1GMCF 2W26A 1C1NA 1PPGE 1YM0A 1JIRA 1IOEA 2V35A 2B9LA 4D9RA 1W2KH 1FAKH 3LGUA 2XW9A 1K28D 1Y5AT 3D49H 1S0RA 1HAXB 1O37A 1TYNA 4I33A 2UUFB 1SFIA 3LH3A 1T31A 1IQFA 3MFJA 1BB0B 2ZPQA 1CE5A 3L3TA 3IWMA 5EU8A 1SL3A 2SNVA 2BQ6B 1SGFA 2H1UA 2AYWA 1O3NA 3VB7A 1S84A 2XCNA 1FY8E 2JKHA 2GMTC 1ZGVA 1GJ9B 3SBKA 1C1SA 4O3UA 2ZU4A 1NS3A 1SPJA 2AGIX 1TNGA 2BOHB 1DANH 5T3HA 2TGAA 2CV3A 2JETC 5L2YH 4UFFH 1HRTH 4XE4A 1CA8B 5DGJA 1AZ8A 5F8XA 3U1IB 2Y5FA 3ZZ7A 1HDTH 3PTBA 3ZZ3A 1FNIA 4X1QU 1DSUA 3D65E 2FTLE 1AE8H 5A0AE 1K1LA 2HNTF 2Y80A 2TIOA 1EAWA 5GXPA 2Y7XA 3A7YA 2A31A 7LPRA 1HAYB 3LC5A 1SGEE 1YPGH 3O8DA 1SBWA 4K1TA 3RP2A 1K9OE 1D3QB 7ESTE 2LNCA 2GZ9A 2YOLA 1W10U 4IS5A 1TNLA 1NU9A 1BTUA 4I8HA 3UFAA 1FONA 1GBEA 3PLBA 3T2NA 2VIWA 4J2YB 1O2UA 1C2JA 1G3BA 1L1GA 2BD7A 4X0WU 1BTPA 3K2UA 2ZGBH 3ODDA 1QCPA 1ZHPA 2ZGXH 4X8TH 3RMNH 3V13A 1FQ3A 1NTPA 1O3FA 4JZEH 2CJIA 1DPOA 1Z71A 1P2MA 1C5UA
chains in the Genus database with same CATH superfamily
3SNDA 4HZHA 1GJ4H 1O3KA 1IAUA 3SQHE 1VITF 2TGDA 4X8UH 2VB0A 4GSOA 3RXHA 3RM2H 3NWUA 5JBAS 2XC4A 2SFAA 1BMAA 1ABIH 2XYAA 1TMUH 2UUKB 2GKVE 3S9CA 1KLIH 1KTSB 2UWPA 3M35A 1GDUA 1TLDA 2TPIZ 2BDCA 2VJ1A 1AQ7A 3A88A 5FCKA 4Y11E 3P8GA 1SOZA 4TY7A 3RLWH 1ETTH 1T8OA 4Q7YA 4JZFH 3VGCC 1QBOA 1TQ7B 1H4WA 4X2YA 2PGQB 3ZV8A 1CSOE 1LO6A 3V3MA 4BAOB 1KXBA 2QXIA 4KGAA 4MDSA 1XUHA 2A7CA 1M9UA 2Z9LA 3V7TA 1NRNH 4GHQA 1P57B 4AFQA 1JXPA 2QC2A 1GMCG 3KYFA 1VGCC 2ALPA 2WHXA 3SHCH 1MMJN 5C67A 1CT2E 2BD4A 5LPRA 3BF6H 3RXBA 3M61U 3KIDU 3E3TA 2CHAC 2BX3A 2L74A 2ZC9H 4ISIH 3TJUA 4K2YA 2QYIA 1UTMA 1LTOA 1QBNA 3WWBA 2QXJA 1SLWB 2XBYA 2ULLA 2FTMA 3BTWE 1KXFA 3BSQA 4D7FA 1A46H 2EQNA 3A7TA 3TGKE 3TVJB 1SGTA 1HXEH 1PYTD 3C27B 3M7UA 5JB8S 3PO1B 1QL7A 1YWUA 2QIQA 3H7TA 2VIOA 2FWWA 8GCHF 2DE9A 1O30A 1AIXH 2WV5A 3NXPA 1TGCA 3H7OA 1YYY1 1Z1IA 4H6TA 1C5SA 2FEQH 2NU1E 3MNSA 4H6SB 1SR5C 2FODA 4IC5A 1UTPA 2W7UA 1A0LA 1C2DA 1FAXA 1HJ8A 4Q7XA 3T25A 3HGPA 1A61H 1P03A 5GNDA 3UB0A 1OWEA 3SYJA 3PLKA 1H9HE 1V2JT 4TYDA 2ZFFH 5F6MA 3QN7A 3MNBA 3F2FA 4FUHA 1YPHC 2OLGA 3F3BA 3HK3B 1E36B 3PMAB 2SGAA 2GD4B 3AK5A 1SG8B 2GV6A 1OWHA 1T32A 1O5BB 3UAIC 1SOTA 4AC9A 3B9FH 3W1EA 5E0HA 1DVAH 4M7GA 3RU4D 4MPVA 1SQOA 1GBMA 3AAUA 5FAHA 5L6NH 1UTJA 2ODYB 3S7KB 1G32B 1LHGH 1K0HA 4ABEA 1L1NA 4AB9A 1LVOA 5EXNA 1TA2A 1TNHA 3ZZCA 1TQ0B 1HAZB 3GDSA 4ZAEA 3ATLA 3EA8A 1IQNA 2FI3E 2V3MA 1SLXB 1Y5UT 1V2ST 1G2MA 1O2NA 3JZ2B 1HAGE 3OSYA 1O3PB 1V2TT 3A7ZA 1F7ZA 3GICB 4A1XA 3GY3A 3SOSA 1P8VC 3U9AH 1P05A 1HUTH 2PFEA 1F2SE 2UWOA 4BNRA 5L2ZH 4I7YH 3QX5H 1MTWA 3A82A 3BEFB 1C1RA 1T8LA 1NT1A 3BTQE 4I8LA 4NIWA 5K0HA 1E79D 1HLTH 2ZPSA 4HI3A 2GMTB 1C4U2 1KLTA 1YPEH 3P6ZB 8LPRA 1FUJA 1N8OC 1RTKA 2BOKA 2OP9A 3TH2H 1LCYA 1UTQA 2QV1A 2WZQA 1B0EA 3DSOA 1GL1A 3UWJH 4DURA 2PTCE 2RCEA 3Q3KA 2DUCA 3LONA 3UY9A 3MTYA 3UNQA 4ABBA 1TWXB 2F3CE 4B2AA 3RXLA 3A84A 1C1MA 2A5AA 1O3OA 3S7HB 1TONA 4A5TS 2BY7X 4ACBA 2DE8A 4INKA 1AFQC 1GHAG 1IQJA 2QF3A 4K5ZA 1YCPK 3L33A 1YCPM 2M2AA 3MMGA 3UPEA 2J34A 1TBRH 1GDQA 1K1OA 1P0SH 1TRNA 3DA9B 2K0QA 2ANWA 2WPHS 5C0TA 1T4UH 4JYUH 1JRTA 1RIWC 2FOMB 1O32A 1A0HB 4NFFA 5C0UA 1PYTC 1HAVA 1ELDE 1GBCA 3ZZ6A 1Z6JH 2RA3A 1QRXA 4X1PU 3SJKA 1EFRD 5GPIB 1TE0A 1OPHB 1AWFH 2ZDAH 4TT3D 3T62A 5A0CA 2ZGCA 2K8IA 1UTLM 4AX9H 1CGJE 4MLFB 3ZZBA 4B76A 1XXFA 1MD7A 1NM6A 2SGQE 1Y3XA 3EA9A 2EY4C 2ZA5A 1YPLH 1IQKA 4DJZB 1YF4A 5B6OA 5C1XA 2Y81A 1W13U 4NG9H 1QQ4A 1C1UH 1AMHA 1P10A 2VVVA 3M3SA 4PROA 3FFGA 1ZPBA 3E16B 2W6JD 2G4UA 2RA0A 2CMYA 3VXFH 4DT4A 1QGFA 3PRDA 2GJGA 1INCA 3VB6A 4OGYA 2GZ8A 1ABJH 2AIQA 1AY6H 4VGCC 1HCGA 2J4IA 5H4IB 1FZZA 4UFDH 2ZFPH 1UK3A 1HBTH 4R0IA 5E2PA 2BZ6H 1DWDH 1LPZB 2HVYB 1IHSH 1XVOA 1Q3XA 2OC8A 1QB6A 2KCOA 1E1QD 1P04A 3VGCB 1BTHH 3TU7H 9ESTA 4JZ1A 2ZG0H 5FPYA 3VXEH 1NY22 3Q3YA 1QB9A 1TBZH 3F9HA 1BJUA 4GCHG 1QRZA 2FOCA 1ELAA 2JH0D 5EG4A 5HKKD 2HNTC 4CH2B 1QR3E 1F5KU 3M3TA 5FL7D 3M37A 2OQUA 1FMGA 2ZFQH 1B5GH 4Y7AA 1AFEH 2F9OA 1TX7A 2O8WA 1P02A 2W3IA 2CHAB 1PPCE 1ZJDA 5HIYA 3HK6B 1O38A 2A4QA 3IITA 5C20A 4P00A 1NN6A 3SU4A 3PM3A 1CA0C 1C5TA 4XRNA 1SGIB 3EE0B 2J38A 2PTNA 2BDAA 1IQHA 4IW4E 4IMQA 1TOMH 2VBCA 3MH6A 1O3DA 3PV5A 2B8OH 3D62A 2AGGX 2F9PA 4I8GA 1AVXA 2HGTH 5EW2H 4MQAA 1RS0A 3RXSA 1SGDE 2YNAA 3EGKH 3SU2A 1O2HA 2WPJS 1K2I1 5JB9S 4FUEA 5GIBA 3MU0A 1C2FA 1C1PA 3OAAD 3LC3A 1AB9C 1KSNA 2Y5HA 4CRFA 4WVPE 1KDQA 2AGEX 3A83A 2GDEH 1MU8B 3QO6A 1EZUC 2WINI 1ZMLA 2WYGA 1DWEH 3OX7U 1XUJA 3NPSA 3GY4A 1PJPA 3E0NB 1GBDA 2J92A 1O2VA 3ZVDA 1FDPA 1DXWA 2SGFE 5BRRE 3SV8A 1G37A 5JBCS 1TGNA 3CP7A 3ITIA 3RXKA 4A1VA 1FN8A 3KQBA 2ODPA 4WJG2 1ZTLA 2THFB 3LKWA 1GJ6A 2HPQH 2CN0H 1IHTH 4AGJA 6GCHG 1A4WH 3DSGA 1BBRK 5T6DA 1LQEA 1LQDB 2PV9B 1O5GH 1AHTH 3M5LA 1ID5H 5F8TA 2A2QH 4YLQH 3M36A 4B6EA 3M7TA 3ZZ9A 2XBWA 3RC5A 1TPPA 2UWLA 1SKYE 4FU8A 2VWMA 4X2XA 2BQ7B 5F53A 2YNBA 4E7NA 5T6FA 3RXEA 2R9PA 3M3VA 4K3JA 4X1SU 5BPEA 1Z8JB 2SGEE 1BMFD 1DWCH 3MO3A 1EP6A 4LZ4B 1CU1A 1ZSJA 3QK1A 2YMSD 5CHAC 2GGVB 3KHVA 2AS9A 1EOLA 1V2PT 2OCVB 1MKXH 2Z9KA 1QJ6B 1N8OB 3Q76A 4Y10E 1MUEB 1RJXB 2FXRA 3MU8A 2BY9X 1WBGB 1NRPH 2I6SA 1EATA 1O3CA 1XM1A 2BD3A 4AFUA 4NSVA 1V2LT 1EAIA 3K6ZA 4ZMAH 2C93B 2BTCE 2KFWA 1GJ7B 1XUGA 3RXUA 2HLCA 1K1NA 1RRKA 3F0OA 2ZF0H 3PROA 4NIXA 5A09A 3TNSA 1G9IE 1L4ZA 1UVSH 1GBIA 1YKTA 2XNDD 3AAVA 1GJAB 1JRSA 1RTFB 3VEQB 2GP9B 3Q3XA 1GI6A 4ASUD 7KMEH 1UTNA 5IDKA 1S5SA 1SQRA 2XWBI 2RG3A 4YOJA 2LELA 1ETSH 4AB8A 4UDWH 4I86A 2AMQA 3FP7E 1JOUB 4CH8B 3M7QA 1RIWB 1PQ5A 4ZHLU 2FYRA 4Q80A 2G81E 2ANKH 3E90B 2KAIA 1K1JA 3S9BA 1C4Y2 3TH3H 2J5UA 3Q00A 2QGRA 3CNRA 1TBQH 8KME2 1AUJA 1V2KT 4JMYA 1E37B 2XWAA 4RKJB 2B7DH 1BIOA 9LPRA 1DXPA 4CRAA 4NCYA 2TGTA 1O2YA 5I25A 1OHHD 1GG6C 2WUBA 2G51A 4CR5A 2Y7ZA 4H42U 4XD7D 1AUTC 1OP2A 2GZ7A 1G2LA 3BN9A 2Q6GA 2FDAA 2WPLS 4FETA 2HLDD 1MKWH 5DK1A 5DP4A 5FBIA 2STBE 1GL0E 3QZRA 4GLYA 5L30H 4I8JA 4Y0ZE 1CT0E 3GYMA 1V2UT 1BRCE 1EOJA 3NK8A 3RU4T 1EUFA 4VGCB 1KXCA 3UOPA 2A45B 2P16A 1GHYH 4TY6A 1HJ9A 4WH6A 1GHWH 2SNWA 2GVFA 3A81A 2TBSA 4HFPB 5EQSA 4ABFA 1VJ9U 4ABIA 3A89A 4UFGH 1EJNA 2W6ID 1C9TA 2HALA 1J17T 4NWLA 1SFQB 2CGAA 3SNCA 1QZ8A 1TGBA 1C1QA 3LT3A 1NROH 1BHXF 4K1EA 3QDZB 1EX3A 3MO6A 1A0JA 3F1SB 1GMDG 4K60A 1V2WT 1RTLA 5FCRA 3LOXA 5EGMA 5LGOA 4NIVA 3MH4A 1C5NH 1BBRH 1TPSA 2QXHA 4HTCH 1D3TB 3FAOA 4OS6A 3O8RA 3SUEA 3EA7A 3GCNA 4X8VH 1O2OA 1VJAU 2OC7A 2PWXA 1SSXA 1NFUA 3MH7A 3R0FA 4OS4A 1RXPA 1CA0B 3ZVGA 4DG4A 4LXBH 1GDNA 4D76A 3DUXH 3VFEA 5EXMA 2OBQA 4UE7H 2ZP0H 4Q63A 4K8BA 3KCGH 1GCTB 3TPIZ 1LDTT 2P3TB 2IOTA 5A8ZA 1G3EA 2P95A 3SORA 5TJXA 1ZR0A 4MG3A 4BOHA 1CHOG 3RMMH 1HAVB 1GHBG 1O2WA 2FP7B 1TPAE 3E8LA 3KQ5A 1IQGA 4SGBE 1AB9B 1ZSLA 1GBBA 1SB1H 1HAIH 4WMFA 1O5DH 1QIXB 1G3CA 4ZKSU 5TCAA 4BXSA 4ABHA 2A1DB 4X6NA 1ANDA 1O36A 2BMGB 3RXDA 1V3XA 5C94A 2VWLA 2G4TA 3DSPA 3EAJA 3FANA 2ZDVH 2A7JA 3SV7A 4WMEA 1NU7B 2VIQA 3V0XA 2PUXB 1GHXH 3GCTG 2J9NA 3A85A 2R0KA 1C5WB 1DS2E 1PPBH 1GHAF 3STJA 4ASHA 5AVDA 3SW2B 4JZDH 3SNAA 1K21H 1ELBA 5EJZA 4DVAU 5F03A 4B74A 1GMHG 2OK5A 4B2BA 2OXSA 3K9XB 4KTCA 4A6LA 1GCDA 2XOKD 1DT2A 2Z94A 5EIYA 3P8NA 3ENSB 4D7GA 7GCHG 1NC6A 3VB3A 1SGCA 2ZPRA 4IN1A 5HM2A 3B8JA 1ELVA 2IJOB 2GT7A 1TAWA 2FESH 2W7SA 1SC8U 4OS7A 1J8AA 2PW8H 1P2QA 2ZHWH 1GGDB 1AE5A 3E0PB 2BDGA 1N1LA 1BA8B 4NFEA 1E35B 3MU4A 5PTPA 5C3NA 1P2OA 2KZ4A 4FUGA 4RT0A 1EP5A 3RC4A 1LHEH 1NZQH 1YLNA 2C8ZB 1O3GA 4AYYB 4FUCA 1JMOH 3ODFA 2FOBA 1DX5M 1ARBA 1O35A 4K1SA 1GVKB 3RXTA 3TLOA 1YPJH 5IYTA 3U98H 2BDYA 2G8TA 4Y8ZA 3P8OA 1J15A 2ZHDA 5J4SA 1T8NA 1FY3A 2ZHFH 4A92A 3U8TH 1S6HA 2QAAA 1TRMA 3TIUA 1IQMA 4BAKB 3CS7A 1THSH 1O33A 2D26C 3SO3A 6CHAB 1GI2A 1H9IE 1Y3UA 4AG1A 2VNTA 3GY7A 1HIAA 1MCVA 2OINA 1LPKB 2XC5A 3NUMA 1WOFA 1Z8IB 1FV9A 5HXFA 1KDQB 4GCHF 3H5CB 4U2WA 4KTUA 2XRCA 2ZQ2A 4ACAA 5EOKA 1ZOMA 2FIRH 4F55A 4ZKOU 3DFLA 2VINA 2HVXA 3MH5A 2Q6FA 1XXDA 1ELEE 1ESTA 1YLCA 4B71A 3ZVBA 4MNVA 4ISNA 2O8MA 4NZLA 3LU9B 1PQAA 1ZMJA 1VCWA 1SHHB 2ILNA 4Z0KA 4DGJA 2JIZD 2Q6DA 1QRWA 1ZHRA 3W95A 4JCNA 1GG6B 4O97A 4SGAE 4ZKRU 2QXGA 2P93A 4LZ1H 1JBUH 2R2MB 2XBVA 2EC9H 2BDIA 1LVBA 1MBMA 1EZQA 2J97A 4MVNA 4ABJA 3SUDA 1FPHH 1P2NA 1DY9A 2JETB 2LPRA 2JDID 4ZH8A 3A8CA 3TGIE 1O2LA 2L6OA 1FPCH 3EDXB 3SUFA 1SGYE 1ZPZA 5KECA 1EASA 2XTTB 3ATIA 3PYHA 3TNTA 3N99A 3ZYEA 4XBDA 1H9LB 2F9NA 1DLKB 2A4GA 1AKSB 1F0UA 2ZI2H 1QBVH 2WSSD 4GHTA 2BLOA 2HWLB 2OC1A 2ZECA 1GJ5H 1O39A 4FUDA 5A2MH 3RXAA 1O5AB 1MTUA 2WUCA 4RKOB 3PWCA 3AW1A 2ZEBA 3GDUA 3MI4A 1W0KD 1C5PA 2ZQ1A 3BEUA 2VWNA 3M5MA 1C2EA 3NRLA 4MNYA 5C5OA 6GCHF 5G4BA 1RGQA 1O5CB 3QGJA 3F9FA 3RXVA 1CHGA 3K6YA 3SV2H 3UNRA 2ZU2A 1ZHMA 3CENA 4AZ2B 3RXRA 2H5CA 1P9SA 1BTZA 1O2ZA 2KCYA 2YMSB 2ZCKP 4NGAH 2H9TH 4BXWA 3F9EA 2I6QA 4X2WA 1O3LA 2ZTYA 2FLBH 3DCLA 4BAQB 4X8SH 4M9FA 1JWTA 3RXIA 4DY7B 5FPSA 1O2KA 2IPHA 1LMWB 1UVOA 5T1VA 2R0LA 1IQIA 1O2RA 4YT7H 1MKXK 3UIRA 1K22H 2A4RA 1GHVH 2KAIB 3ZYDA 2AMPA 1AZZA 5DP9A 1O3IA 4Y8YA 1W11U 3QZQA 5IK2D 4CR9A 4E06H 2BB4A 3O8CA 2J94A 1HPGA 3K65B 2Y5GA 3D23A 1UJ1A 1WUNH 2C3SA 1MQ6A 2ZFSA 3EQ0H 4X1RU 1F92A 1TOCB 3RC6A 1W7GH 3S69A 1YPMH 1BT7A 1O3AA 1GBTA 3SU0A 1NFWA 2BLVA 1FN6A 2HPPH 5GCHG 1XKBC 3TJVA 1GI5A 1MTNC 3AVZA 2FOHA 3OTPA 3TJNA 1VGCB 1C2KA 5T6GA 1C5XB 2P8OC 2O8TA 1ELCA 1FIWA 2ZTXA 1WSSH 1ELTA 1KY9A 1P12E 1UCYH 2FX4A 2PP6A 3TH4H 4ABAA 5A8XA 3KQCA 1C1TA 4NIYA 2FM2A 4IBLH 4B75A 4BAHB 2VGCC 4LOYH 3FKSD 2ZZUH 5JBBS 4ZKNU 1DICA 4MPXA 5CE1A 1Z8GA 4BANB 3GDVA 3OEED 4DIHH 3FVFB 3P8FA 1XKAC 1C2IA 3UQOA 4JK6A 4X6OA 2UUJB 2VWOA 1NPMA 1ZRKA 3P92A 1ESBA 3LH1A 1DUAA 1F0RA 2JH6D 4U32A 4CRDA 3M5OA 2Z9IA 2XBXA 3H09A 1K1PA 3JZ1B 2F9UA 2QF4A 1H1BA 5ETXA 3DD2H 2Z9GA 1GVZA 1QB1A 4GUXA 5HM9A 4OM9A 1L0ZA 1QJ7B 4FVBA 3R3GB 1MAXA 3TGJE 1V2VT 1TMTH 2BY6X 1EQ9A 1OKXA 1GBJA 1HAHH 1MKWK 2ANYA 4YTAA 1ETRH 1S82A 1E34B 1B7XB 1WV7H 1WAYB 4NA7A 1HFDA 1AO5A 3URCA 1KXAA 4CRBA 2STAE 1C5RA 3ZVEA 1A3EH 3KQDA 1S6FA 1LPGB 1SGNE 5J4QA 1IQLA 1UHBA 4TPYA 1EAUA 2BD9A 5AF9H 4DIIH 3S0NA 3QLPH 3LGTA 1Y3YA 3ATKA 4KTSA 1LVMA 1AN1E 1EZSC 1UK4A 1DDJA 5DG6A 3ATMA 1OXGA 2NU3E 1O2TA 4IMZA 1RFNA 3EYDA 3MU5A 3PMHB 1SQTA 3GY5A 1O5EH 1O0DH 5DKMA 5DO4H 1AI8H 1MU6B 1QQUA 2Z3DA 5EODA 4BTUB 4YOGA 1BTWA 1TPOA 1C1OA 4UEHH 2H2ZA 1C2GA 2P59A 2Y82A 2ZTZA 3RXQA 2ZKSA 5CDFE 1CQQA 1GMDF 1C5YB 1PQ7A 4I32A 3SN8A 1GWAA 2F91A 5DP6A 1O3HA 5JPMH 1C5MD 3I77A 3B23B 3VB5A 2GCHG 3UOUA 1ZYOA 2PUQH 1J16A 5GJ4B 1SHYA 2ZHQH 1ESAA 1LVYA 3N7EA 4ZXXH 1MBQA 2BXTH 2ZGJA 1O2IA 3PWBA 1P09A 5CMXH 3EE7A 3RXOA 1OX1A 3A86A 1MABB 2F83A 2ZDKA 2H6MA 2WPDD 3HKIB 1E1RD 1TX8A 3MNCA 2XCFA 5ESBA 1D9IA 1O34A 1Y3VA 2BM2A 2EI7A 4AOQA 5C5NA 5I46H 1VITH 4XOJA 3GCHC 1QY6A 3PO1C 1O3JA 3BG4C 1CHOF 1P2KA 2ZGHA 1GHBF 1UMAH 2J98A 2Z6BD 3RLYH 1A2CH 4FXGH 2NU0E 5KGOA 3GYLB 2H9EH 3OU0A 1SGFG 1TIOA 3SHAH 1O2MA 2KCAA 3GS9A 3RMLH 3MWIU 4THNH 5FX5A 1O5FH 3U8OH 1YLDA 4FUIA 2J95A 5DPAA 2A7HA 3FZDA 3E1XB 3AASA 1NBME 1BBRE 1U6QA 2C90B 3SJIA 1KXEA 4FVDA 3PLPA 2BD8A 3RDZA 1CVWH 1AFQB 1KTTB 1ZSKA 5AFYH 3KNXA 1H8DH 1SMFE 4Q7ZA 3GOVB 1LHDH 4AORA 1MTSA 1BQYA 3GCTF 2FS9A 1EKBB 3GY8A 1L1JA 2BVSH 2EI6A 3UREA 4XDEA 1XUIA 1BCUH 3F2HA 4UFEH 1C4V2 2D8WA 2KX4A 5FBEA 2GX4A 1Z7KA 1OS8A 2B5TB 3AW0A 3GY6A 3SU1A 1GI9B 1GMHF 1W14U 3FO8D 1OWKA 2PLXA 4ZHAA 2V3HH 4Z1MD 1Y5BT 4WMDA 1VZQH 2FMJA 1MD8A 1HIAB 2R3YA 7GCHF 3RXJA 2NU4E 2FS8A 3N7DA 2XXLA 1YPKH 2TGPZ 1TFXA 2G52A 3RXMA 2FOFA 3BIVH 3VPKA 3ZIAD 1QL8A 4AYVB 1ARCA 2BYAX 5B6LA 1BMNH 2AHME 2FO9A 1FY1A 2Z9JA 3LIWA 4TWWA 3MO9A 1B0FA 4BTTB 1CGHA 1A1RA 5F8ZA 2C8XB 3F6UH 1GPZA 1EAXA 1ACBE 2FI4E 4YESB 1SGPE 1LHCH 3GISB 6LPRA 1W3CA 4A1TA 5E2OA 1AVWA 3SJOA 4CBOA 1PPZA 3LPRA 1HAPH 1GBHA 2KCPA 4XBCA 2P3UB 4F49A 3SZEA 1E0FD 2FPZA 3OFND 1BTXA 2KR7A 3RM0H 2PKAA 1Y8TA 2QE7D 2GT8A 1E38B 3ZV9A 3W94A 1ZLRA 5HYOA 1G3DA 3ZZ5A 3VG8A 1TMBH 4YLUA 1A5HA 4K69A 1ELFA 1MTNB 3SUGA 2VIVA 1GHZA 5A8YA 2OC0A 3FZZA 3SNEA 3O8BA 1C5QA 1F5RA 2P8OB 1AD8H 1H8ED 3MNXA 2BLQA 3SV9A 4AG2A 4X6PA 1YY3A 4ISLA 1MCTA 3DHKH 1A3BH 1L2EA 4HGCA 2ZIQH 1FLEE 3C1KA 4MTBA 1BHXB 4E7RG 1WU1A 2BXUH 2VGCB 4KKDA 4FOUC 2W5EA 3TJOA 4WY3A 4FUFA 2ESTE 2XNIA 4IC6A 4RT1A 4D9QA 2GCTC 4GVUA 2SGDE 2ZNKH 3T5FH 1GI8B 1P11E 1DWBH 2V3OH 1QHRB 3LJOA 5KEDA 1KMHB 1A5GH 1XX9A 1TNIA 1OYQA 2QF5A 1C5VA 2H9HA 4DT7B 3MHWU 3NZIA 4P02A 3T29A 4GPGA 2H5DA 2VIPA 2V7QD 2VVUA 4X2VA 3MOCA 1NFYA 2W3KA 4XSKU 2RFKC 2PKSC 3DFJA 1DOJA 2ZU3A 2UUYA 2WPIS 1QL9A 2O8UA 2RDLA 1PFXC 3E6PH 5E8EH 3RXPA 2G55A 1V2MT 5ESTE 8ESTE 2VH0A 1P06A 1MAYA 1OP0A 1BMMH 2ZO3H 3QTVH 1FX0B 1CT4E 2QN5T 2BVXH 3PTNA 5FXLA 1ZGIA 3RXCA 3SU5A 3BEIB 4Y7BA 1A7SA 1DM4B 2ZU1A 1YP9A 3SU6A 1WTHD 2GV7A 4XFQA 3KYGA 4AN7A 1CBWC 3TITA 2BY5X 4KP0A 3F68H 4FU7A 3OYPA 3SQEE 1F0SA 2ALVA 3A8DA 3UTUH 5C17A 5DP3A 5FHTA 1UK2A 2NU2E 1BTYA 1GBFA 3UUZA 4UD9H 1S0QA 2TRMA 3PMJA 4YM9A 2HRVA 1EPTA 3A80A 2O8LA 2GDDA 4TSFD 1P3EA 1BDAA 1SGRE 1ANBA 1THRH 4RI0A 1C2LA 4FUJA 2D2DA 2PHBA 3BTDE 2VU8E 1P2JA 1GBLA 2P3FH 4OGXA 1A5IA 1HJAC 2R2WU 4DCDA 1GI7B 1PPFE 2OUAA 2R3UA 2WV4A 1O2SA 5EW1H 4O03A 1ELGA 1NRQH 1OP8A 2A0QB 1YPHE 1EB1H 1S85A 5JBTA 1DITH 3ZZAA 4Y79A 4INLA 1COWD 3HPTB 2Z3CA 1ZRBA 2J2UA 5CHAB 1V2OT 3ELAH 1GJ8B 3VB4A 3GCHB 1O2GH 3BG4B 1O3BA 1DSTA 1XUFA 3N7OA 1BRAA 3KL6A 1N6XA 3PV2A 3GCOA 3FP8E 5EXLA 3MYWA 3FN8A 3A7VA 3KGPA 5EJ1A 3T26A 2AH4X 4D8NA 3PV4A 1SI5H 2QY0B 2AERH 4B2CA 1DUEA 3A87A 3ZZDA 1ZTJA 3BIUH 3BTKE 1GI0A 2CF8H 1SQAA 3RUOA 2ZFRH 1BRBE 4Y71A 5GCHF 1VKYA 1UCYK 1VCPA 3BTHE 2FZZA 4A7IB 1D6RA 1DE7H 5DP7A 5HGGA 4I31A 2BQWB 1UHBB 4NSYA 2PSYA 4UONA 3RXGA 1EZXC 2G5NA 4OS5A 4Z6AH 2PSXA 4B73A 4CHAC 2A2XH 4ISOA 2GTBA 1GI1A 1AWHB 4WWYA 1C2MA 2PGBB 3QGNB 5AFZH 3TK6A 4JZIA 1XVMA 2BDBA 3BTTE 1LHFH 2A5IA 2AIPA 4RN6A 4KELA 4X1NU 1VR1H 3I78A 3V12A 1TRYA 1AVGH 3S9AA 1YC0A 1BZXE 2SGPE 1BOQA 2VVCA 1EPTC 4Q2KA 4CREA 4MNXA 5ABWA 1QURH 1PQ8A 1TALA 3IG6B 3WWFA 2RDEA 4OS1A 2V6NA 4AGKA 1Y3WA 5C1UA 2WYJA 1OYTH 1MZAA 1FIZA 3BTGE 1VITG 4R8TB 4XBBA 2D1JA 1VCQA 4ZHMU 1MTVA 3TK5A 3LGYA 1TNKA 1Q31A 3U1JB 2OD3B 5EQQA 2V0BA 3U8RH 3HGNA 3LGWA 4U01A 1KXDA 1QFKH 1UCYE 1S83A 3SGQE 2JJ1D 1EB2A 1D6WA 3U28C 1UVTH 4DOQA 4QT8C 2AFQB 4AFZA 2PR3A 4RSPA 3T28A 2BD5A 3QUMP 1FJSA 2HOBA 1NRRH 1TGSZ 4U30A 2J98B 5AHGH 2CK3D 2EI8A 3BG8A 1WXRA 1XMNB 3P70B 4YOIA 5CHBA 2FYQA 1Z1JA 2ODQA 2VIDA 4ZXYH 1BJVA 3SJ9A 3A7XA 4O9VA 3SJ8A 1ZJKA 1GI3A 1CGIE 1TB6H 4BAMB 1C1WH 1QA7A 3OEHD 1BRUP 1L4DA 2EA3A 2GCTB 3G01A 4AFSA 5EQRA 3BTFE 1W0ZU 4JYTA 2BVRH 2ZCHP 3F9GA 2OQ5A 3SI3H 2A4OA 1H8HD 3UR9A 1P9UA 3LGIA 1UVPA 1TGTA 4NZQA 5FPTA 3A8BA 4NA8A 1FY4A 2ZCLP 2GCHF 2C8YB 1NESE 4F4OC 1ORFA 2CF9H 2ANMH 3RU4E 3U69H 2ZDNA 2FOAA 4GAWA 1UTOA 3HKJB 4JYVH 4ZUHA 2PKSB 1SGQE 8GCHG 1HYLA 4ABGA 3I29A 1ZMNA 3BTME 1QA0A 3MU1A 3T27A 2ASUB 2BZAA 2ZWLH 3FOAA 1WQSA 3ZVCA 2HNTE 1K1MA 3FP6E 3SV6A 5DP5A 1NRSH 2IN2A 2VH6A 1UO6A 3ZVFA 2BLWA 1TX6A 1Y59T 2C8WB 2JH5D 3URDA 5C2ZA 1O31A 2F4LA 1O3MA 1QNJA 2NWNA 1TABE 1EXFA 3BTEE 3ZVAA 3RMOH 1H8IH 1SVPA 1W7XH 5A0BA 1CBWB 1T8MA 1PPEE 2Z7FE 5K7RA 1C9PA 1J9CH 1HV7A 1UW7A 3SI4H 3GY2A 1J14A 5SGAE 3ZZ4A 1KIGH 2WPKS 1JIMA 1P3CA 2FLRH 2K1QA 3A8AA 2PKAB 1BMLA 3Q77A 1O2JA 1WDIA 2F9VA 3PB1E 2M5TA 3BV9B 2AEIH 1K1IA 1Z6EA 5E0GA 1LKAA 1S6LA 3ESTA 4Y0YE 1HJAB 3OY6U 1SLVB 4JK5A 1GVLA 1C2HA 4X6MA 5E0JA 1W8BH 2KM0A 3PMBB 1ANCA 1GJBB 5JDUB 1PPHE 1HNEE 1V2NT 3E91A 4I8KA 1MQ5A 2BX4A 3UWIA 1WYKA 5DSFA 4MPUA 5DP8A 5FX6A 5EPNA 1W0YH 5GDSH 1AGJA 1V2QT 1D4PB 1O2PA 3QTOH 5TCCA 1FY5A 1NBMD 4INHA 3P17H 1QTFA 4BTIB 4YO9A 4CRCA 1OWDA 3SGBE 2Y6TA 1D3PB 1GJCB 1GCTC 2BD2A 4OS2A 1V2RT 3WY8A 2XC0A 2FI5E 1HGTH 1NFXA 1RD3B 1G36A 5HMAA 4ISHH 3STIA 2A5KA 4Q4LA 1Z8RA 2FOGA 3KF2A 1OWJA 1GI4A 1P2IA 4CRGA 1ZZZA 3KN2A 4NWKA 1IQEA 2P94A 1CO7E 1D3DB 4TPIZ 1HB0B 1LKBA 4F48B 1O2XA 3SNBA 1THPB 4WH8A 4WF8A 2C4FH 1YGCH 4YZUA 3LJJA 2BDHA 1TA6A 3SU3A 1ZPCA 2F9BH 1MH0A 4Y76A 3KQEA 1GJDB 1G30B 1V6DA 4DW2U 1GBKA 4FU9A 1O3EA 1EJAA 1X7AC 3NCLA 2BHGA 1C5LH 4ABDA 3UNSA 2B0FA 1YCPH 3TK9A 1T7CA 1C1VH 3HATH 2A32A 2QCYA 3CS0A 1WCZA 4CHAB 4IN2A 1OWIA 1BITA 4ESTE 6ESTA 1TNJA 1W0JD 1S81A 1UTKA 5EPYA 4MPWA 3P95A 1N6YA 1BUIA 1F5LA 1C5ZB 4FUBA 3UQVA 3LGVA 3NKKA 1NO9H 5HIZA 1F0TA 2QA9E 3SZNA 1EPTB 4H4FA 3OTJE 5LPFA 1HAOH 1KYNA 1FXYA 1KLJH 4J1YA 1OOKB 2OBOA 1MZDA 1W12U 2Q1JA 4O3TA 5LH8A 1ZTKA 3OY5U 4ZROA 4CBNA 1O2QA 1DFPA 2CXVA 4HG6A 1FI8A 4K8YA 1Q2WA 5LPEA 2ZU5A 1AU8A 1SLUB 1GGDC 2FOEA 2G5VA 1P01A 1AKSA 3A7WA 1OSSA 3RXFA 4B1TA 4LK4A 3F2GA 2WPMS 4E05H 3SGAE 2OTVA 4WXVA 1T4VH 2ZHEH 5C1YA 3OE7D 3L6PA 1C5OH 2G00A 4IGDA 4TWYA 2Z3EA 3ZZ8A 2WV9A 2QF0A 3KEEA 1UVUH 1WQVH 4YXWD 3UR6A 3ATWA 1XUKA 2ZDMA 2BY8X 1HXFH 3M5NA 2O9QA 5JYIA 1YBWA 3QWCH 3DT0H 1EJMA 4WXIA 5GWZA 2AMDA 5DJ7A 1WTGH 6CHAC 2ZFTA 2FX6A 1DLEA 4YT6H 1QJ1B 2ZDLA 4Y6DA 4NA9H 4Y8XA 1DY8A 3LDXH 1GBAA 2IPQX 1ANEA 2EEKA 4MNWA 1GMCF 2W26A 1C1NA 1PPGE 1YM0A 1JIRA 1IOEA 2V35A 2B9LA 4D9RA 1W2KH 1FAKH 3LGUA 2XW9A 1K28D 5EJLA 1Y5AT 3D49H 1S0RA 1HAXB 1O37A 1TYNA 4I33A 2UUFB 1SFIA 4ZCNA 3LH3A 1T31A 1IQFA 3MFJA 1BB0B 2ZPQA 1CE5A 3L3TA 3IWMA 5EU8A 1SL3A 2SNVA 2BQ6B 1SGFA 2H1UA 2AYWA 1O3NA 3VB7A 1S84A 2XCNA 1FY8E 2JKHA 2GMTC 3F0PA 1ZGVA 1GJ9B 3SBKA 1C1SA 4O3UA 3MQKC 2ZU4A 1NS3A 1SPJA 2AGIX 1TNGA 2BOHB 1DANH 5T3HA 2TGAA 4B6FA 2CV3A 2JETC 5L2YH 4UFFH 1HRTH 4XE4A 1CA8B 5DGJA 1AZ8A 5F8XA 3U1IB 2Y5FA 3ZZ7A 1HDTH 3PTBA 3ZZ3A 1FNIA 4X1QU 1DSUA 3D65E 2FTLE 1AE8H 5A0AE 1K1LA 5DN6D 2HNTF 2Y80A 2TIOA 1EAWA 5GXPA 2JJ2D 2Y7XA 3WW7A 3A7YA 3PRBA 2A31A 7LPRA 1HAYB 3LC5A 1SGEE 1YPGH 3O8DA 1SBWA 4K1TA 3RP2A 1K9OE 1D3QB 7ESTE 2LNCA 2GZ9A 2YOLA 1W10U 4IS5A 1TNLA 1NU9A 1BTUA 4I8HA 3UFAA 1FONA 1GBEA 3PLBA 3T2NA 2VIWA 4J2YB 1O2UA 1C2JA 1G3BA 1L1GA 2BD7A 2F43B 4X0WU 1BTPA 3K2UA 2ZGBH 3ODDA 1QCPA 1ZHPA 2ZGXH 2IJD1 4X8TH 3RMNH 3V13A 1FQ3A 1NTPA 2LP6A 1O3FA 4JZEH 2CJIA 1DPOA 1Z71A 1P2MA 2YMSC 1C5UA
chains in the Genus database with same CATH topology
3SNDA 4HZHA 1GJ4H 1O3KA 1IAUA 3SQHE 1VITF 2TGDA 4X8UH 2VB0A 4GSOA 3RXHA 3RM2H 3NWUA 5JBAS 2XC4A 2SFAA 1BMAA 1ABIH 2XYAA 1TMUH 2UUKB 2GKVE 3S9CA 1KLIH 1KTSB 2UWPA 3M35A 1GDUA 1TLDA 2TPIZ 2BDCA 2VJ1A 1AQ7A 3A88A 5FCKA 4Y11E 3P8GA 1SOZA 4TY7A 3RLWH 1ETTH 1T8OA 4Q7YA 4JZFH 3VGCC 1QBOA 1TQ7B 1H4WA 4X2YA 2PGQB 3ZV8A 1CSOE 1LO6A 3V3MA 4BAOB 1KXBA 2QXIA 4KGAA 4MDSA 1XUHA 2A7CA 1M9UA 2Z9LA 3V7TA 1NRNH 4GHQA 1P57B 4AFQA 1JXPA 2QC2A 1GMCG 1VGCC 2ALPA 3SHCH 1MMJN 5C67A 1CT2E 2BD4A 5LPRA 3BF6H 3RXBA 3M61U 3KIDU 3E3TA 2CHAC 2BX3A 2ZC9H 4ISIH 3TJUA 4K2YA 2QYIA 1UTMA 1LTOA 1QBNA 2QXJA 1SLWB 2XBYA 2ULLA 2FTMA 3BTWE 1KXFA 3BSQA 4D7FA 1A46H 3A7TA 3TGKE 3TVJB 1SGTA 1HXEH 1PYTD 3C27B 3M7UA 5JB8S 3PO1B 1QL7A 2QIQA 3H7TA 2VIOA 2FWWA 8GCHF 2DE9A 1O30A 1AIXH 2WV5A 3NXPA 1TGCA 3H7OA 1YYY1 1Z1IA 4H6TA 1C5SA 2FEQH 2NU1E 3MNSA 4H6SB 1SR5C 2FODA 4IC5A 1UTPA 2W7UA 1A0LA 1C2DA 1FAXA 1HJ8A 4Q7XA 3T25A 3HGPA 1A61H 1P03A 1OWEA 3PLKA 1H9HE 1V2JT 4TYDA 2ZFFH 5F6MA 3QN7A 3MNBA 4FUHA 1YPHC 2OLGA 3HK3B 1E36B 3PMAB 2SGAA 2GD4B 1SG8B 2GV6A 1OWHA 1T32A 1O5BB 1SOTA 3B9FH 5E0HA 1DVAH 4M7GA 3RU4D 4MPVA 1SQOA 1GBMA 3AAUA 5FAHA 5L6NH 1UTJA 2ODYB 3S7KB 1G32B 1LHGH 4ABEA 1L1NA 4AB9A 1LVOA 5EXNA 1TA2A 1TNHA 3ZZCA 1TQ0B 1HAZB 3GDSA 4ZAEA 3ATLA 3EA8A 1IQNA 2FI3E 1SLXB 1Y5UT 1V2ST 1G2MA 1O2NA 3JZ2B 1HAGE 3OSYA 1O3PB 1V2TT 3A7ZA 1F7ZA 3GICB 4A1XA 3GY3A 3SOSA 1P8VC 3U9AH 1P05A 1HUTH 2PFEA 1F2SE 2UWOA 4BNRA 5L2ZH 4I7YH 3QX5H 1MTWA 3A82A 3BEFB 1C1RA 1T8LA 1NT1A 3BTQE 4I8LA 4NIWA 5K0HA 1HLTH 2ZPSA 4HI3A 2GMTB 1C4U2 1KLTA 1YPEH 3P6ZB 8LPRA 1FUJA 1N8OC 1RTKA 2BOKA 2OP9A 3TH2H 1LCYA 1UTQA 2QV1A 1B0EA 1GL1A 3UWJH 4DURA 2PTCE 2RCEA 3Q3KA 2DUCA 3LONA 3UY9A 3MTYA 3UNQA 4ABBA 1TWXB 2F3CE 4B2AA 3RXLA 3A84A 1C1MA 2A5AA 1O3OA 3S7HB 1TONA 4A5TS 2BY7X 2DE8A 4INKA 1AFQC 1GHAG 1IQJA 2QF3A 4K5ZA 1YCPK 3L33A 1YCPM 3MMGA 3UPEA 2J34A 1TBRH 1GDQA 1K1OA 1P0SH 1TRNA 3DA9B 2ANWA 2WPHS 1T4UH 4JYUH 1JRTA 1RIWC 2FOMB 1O32A 1A0HB 4NFFA 1PYTC 1HAVA 1ELDE 1GBCA 3ZZ6A 1Z6JH 2RA3A 1QRXA 4X1PU 3SJKA 5GPIB 1TE0A 1OPHB 1AWFH 2ZDAH 3T62A 5A0CA 2ZGCA 1UTLM 4AX9H 1CGJE 4MLFB 3ZZBA 4B76A 1XXFA 1MD7A 1NM6A 2SGQE 1Y3XA 3EA9A 2ZA5A 4DJZB 1YPLH 1IQKA 5B6OA 1YF4A 5C1XA 2Y81A 1W13U 4NG9H 1QQ4A 1C1UH 1AMHA 1P10A 2VVVA 3M3SA 4PROA 3FFGA 1ZPBA 3E16B 2G4UA 2RA0A 2CMYA 3VXFH 1QGFA 1INCA 3VB6A 4OGYA 2GZ8A 1ABJH 2AIQA 1AY6H 4VGCC 1HCGA 2J4IA 5H4IB 1FZZA 4UFDH 2ZFPH 1UK3A 1HBTH 4R0IA 5E2PA 2BZ6H 1DWDH 1LPZB 1IHSH 1XVOA 1Q3XA 2OC8A 1QB6A 1P04A 3VGCB 1BTHH 3TU7H 9ESTA 4JZ1A 2ZG0H 5FPYA 3VXEH 1NY22 3Q3YA 1QB9A 1TBZH 3F9HA 1BJUA 4GCHG 1QRZA 2FOCA 1ELAA 2JH0D 5EG4A 2HNTC 4CH2B 1QR3E 1F5KU 3M3TA 3M37A 2OQUA 1FMGA 2ZFQH 1B5GH 4Y7AA 1AFEH 2F9OA 1TX7A 2O8WA 1P02A 2W3IA 2CHAB 1PPCE 1ZJDA 3HK6B 1O38A 2A4QA 3IITA 5C20A 1NN6A 3SU4A 3PM3A 1CA0C 1C5TA 1SGIB 3EE0B 2J38A 2PTNA 2BDAA 1IQHA 4IW4E 4IMQA 1TOMH 3MH6A 1O3DA 2B8OH 3D62A 2AGGX 2F9PA 4I8GA 1AVXA 2HGTH 5EW2H 4MQAA 1RS0A 3RXSA 1SGDE 2YNAA 3EGKH 3SU2A 1O2HA 2WPJS 1K2I1 5JB9S 4FUEA 5GIBA 3MU0A 1C2FA 1C1PA 3LC3A 1AB9C 1KSNA 2Y5HA 4CRFA 4WVPE 1KDQA 2AGEX 3A83A 2GDEH 1MU8B 3QO6A 1EZUC 2WINI 1ZMLA 2WYGA 1DWEH 3OX7U 1XUJA 3NPSA 3GY4A 1PJPA 3E0NB 1GBDA 2J92A 1O2VA 3ZVDA 1FDPA 1DXWA 2SGFE 5BRRE 3SV8A 1G37A 5JBCS 1TGNA 3CP7A 3ITIA 3RXKA 4A1VA 1FN8A 3KQBA 2ODPA 4WJG2 1ZTLA 2THFB 3LKWA 1GJ6A 2HPQH 2CN0H 1IHTH 4AGJA 6GCHG 1A4WH 1BBRK 5T6DA 1LQEA 1LQDB 2PV9B 1O5GH 1AHTH 3M5LA 1ID5H 5F8TA 2A2QH 4YLQH 3M36A 3M7TA 3ZZ9A 2XBWA 3RC5A 1TPPA 2UWLA 4FU8A 2VWMA 4X2XA 2BQ7B 2YNBA 4E7NA 5T6FA 3RXEA 2R9PA 3M3VA 4K3JA 4X1SU 5BPEA 1Z8JB 2SGEE 1DWCH 3MO3A 1EP6A 4LZ4B 1CU1A 1ZSJA 3QK1A 5CHAC 2GGVB 3KHVA 2AS9A 1EOLA 1V2PT 2OCVB 1MKXH 2Z9KA 1QJ6B 1N8OB 3Q76A 4Y10E 1MUEB 1RJXB 2FXRA 3MU8A 2BY9X 1WBGB 1NRPH 2I6SA 1EATA 1O3CA 1XM1A 2BD3A 4AFUA 4NSVA 1V2LT 1EAIA 3K6ZA 4ZMAH 2C93B 2BTCE 1GJ7B 1XUGA 3RXUA 2HLCA 1K1NA 1RRKA 2ZF0H 3PROA 4NIXA 5A09A 3TNSA 1G9IE 1L4ZA 1UVSH 1GBIA 1YKTA 3AAVA 1GJAB 1JRSA 1RTFB 3VEQB 2GP9B 3Q3XA 1GI6A 7KMEH 1UTNA 5IDKA 1S5SA 2XWBI 2RG3A 4YOJA 1ETSH 4AB8A 4UDWH 2AMQA 3FP7E 1JOUB 4CH8B 3M7QA 1RIWB 1PQ5A 4ZHLU 2FYRA 4Q80A 2G81E 2ANKH 3E90B 2KAIA 1K1JA 3S9BA 1C4Y2 3TH3H 3Q00A 2QGRA 1TBQH 8KME2 1AUJA 1V2KT 4JMYA 1E37B 2XWAA 4RKJB 2B7DH 1BIOA 9LPRA 1DXPA 4CRAA 4NCYA 2TGTA 1O2YA 5I25A 1GG6C 2WUBA 2G51A 4CR5A 2Y7ZA 4H42U 1AUTC 1OP2A 2GZ7A 1G2LA 3BN9A 2Q6GA 2FDAA 2WPLS 1MKWH 5DK1A 5DP4A 5FBIA 2STBE 1GL0E 3QZRA 4GLYA 5L30H 4I8JA 4Y0ZE 1CT0E 3GYMA 1V2UT 1BRCE 1EOJA 3NK8A 3RU4T 1EUFA 4VGCB 1KXCA 3UOPA 2A45B 2P16A 1GHYH 4TY6A 1HJ9A 4WH6A 1GHWH 2SNWA 2GVFA 3A81A 2TBSA 4HFPB 5EQSA 4ABFA 1VJ9U 4ABIA 3A89A 4UFGH 1EJNA 1C9TA 2HALA 1J17T 4NWLA 1SFQB 2CGAA 3SNCA 1TGBA 1C1QA 3LT3A 1NROH 1BHXF 4K1EA 3QDZB 1EX3A 3MO6A 1A0JA 3F1SB 1GMDG 4K60A 1V2WT 1RTLA 5FCRA 3LOXA 5EGMA 5LGOA 4NIVA 3MH4A 1C5NH 1BBRH 1TPSA 2QXHA 4HTCH 1D3TB 3FAOA 4OS6A 3O8RA 3SUEA 3EA7A 3GCNA 4X8VH 1O2OA 1VJAU 2OC7A 2PWXA 1SSXA 1NFUA 3MH7A 3R0FA 4OS4A 1RXPA 1CA0B 3ZVGA 4DG4A 4LXBH 1GDNA 4D76A 3DUXH 3VFEA 5EXMA 2OBQA 4UE7H 2ZP0H 4K8BA 3KCGH 1GCTB 3TPIZ 1LDTT 2P3TB 2IOTA 5A8ZA 1G3EA 2P95A 3SORA 5TJXA 1ZR0A 4MG3A 4BOHA 1CHOG 3RMMH 1HAVB 1GHBG 1O2WA 2FP7B 1TPAE 3E8LA 1IQGA 4SGBE 1AB9B 1ZSLA 1GBBA 1SB1H 1HAIH 4WMFA 1O5DH 1QIXB 1G3CA 4ZKSU 5TCAA 4BXSA 4ABHA 2A1DB 4X6NA 1ANDA 1O36A 2BMGB 3RXDA 1V3XA 2VWLA 2G4TA 3EAJA 3FANA 2ZDVH 2A7JA 3SV7A 4WMEA 1NU7B 2VIQA 3V0XA 2PUXB 1GHXH 3GCTG 2J9NA 3A85A 2R0KA 1C5WB 1DS2E 1PPBH 1GHAF 3STJA 4ASHA 5AVDA 3SW2B 4JZDH 3SNAA 1K21H 1ELBA 4DVAU 5F03A 4B74A 1GMHG 4B2BA 2OXSA 3K9XB 4KTCA 4A6LA 1GCDA 1DT2A 2Z94A 3P8NA 3ENSB 4D7GA 7GCHG 1NC6A 3VB3A 1SGCA 2ZPRA 4IN1A 5HM2A 3B8JA 1ELVA 2IJOB 2GT7A 1TAWA 2FESH 2W7SA 1SC8U 4OS7A 1J8AA 2PW8H 1P2QA 2ZHWH 1GGDB 1AE5A 3E0PB 2BDGA 1N1LA 1BA8B 4NFEA 1E35B 3MU4A 5PTPA 5C3NA 1P2OA 4FUGA 1EP5A 3RC4A 1LHEH 1NZQH 2C8ZB 1O3GA 4AYYB 4FUCA 1JMOH 3ODFA 2FOBA 1DX5M 1ARBA 1O35A 4K1SA 1GVKB 3RXTA 3TLOA 1YPJH 5IYTA 3U98H 2BDYA 2G8TA 4Y8ZA 3P8OA 1J15A 2ZHDA 5J4SA 1T8NA 1FY3A 2ZHFH 4A92A 3U8TH 1S6HA 2QAAA 1TRMA 3TIUA 1IQMA 4BAKB 3CS7A 1THSH 1O33A 2D26C 3SO3A 6CHAB 1GI2A 1H9IE 1Y3UA 4AG1A 2VNTA 3GY7A 1HIAA 1MCVA 2OINA 1LPKB 2XC5A 3NUMA 1WOFA 1Z8IB 1FV9A 5HXFA 1KDQB 4GCHF 3H5CB 4U2WA 4KTUA 2XRCA 2ZQ2A 5EOKA 1ZOMA 2FIRH 4ZKOU 3DFLA 2VINA 2HVXA 3MH5A 2Q6FA 1XXDA 1ELEE 1ESTA 1YLCA 4B71A 3ZVBA 4MNVA 4ISNA 2O8MA 4NZLA 3LU9B 1PQAA 1ZMJA 1VCWA 1SHHB 2ILNA 4Z0KA 4DGJA 2Q6DA 1QRWA 1ZHRA 3W95A 4JCNA 1GG6B 4O97A 4SGAE 4ZKRU 2QXGA 2P93A 4LZ1H 1JBUH 2R2MB 2XBVA 2EC9H 2BDIA 1LVBA 1MBMA 1EZQA 4MVNA 4ABJA 3SUDA 1FPHH 1P2NA 1DY9A 2JETB 2LPRA 4ZH8A 3A8CA 3TGIE 1O2LA 1FPCH 3EDXB 3SUFA 1SGYE 1ZPZA 1EASA 2XTTB 3ATIA 3PYHA 3TNTA 3ZYEA 4XBDA 1H9LB 2F9NA 1DLKB 2A4GA 1AKSB 1F0UA 2ZI2H 1QBVH 4GHTA 2BLOA 2HWLB 2OC1A 2ZECA 1GJ5H 1O39A 4FUDA 5A2MH 3RXAA 1O5AB 1MTUA 2WUCA 4RKOB 3PWCA 3AW1A 2ZEBA 3GDUA 3MI4A 1C5PA 2ZQ1A 3BEUA 2VWNA 3M5MA 1C2EA 5C5OA 4MNYA 6GCHF 5G4BA 1RGQA 1O5CB 3QGJA 3F9FA 3RXVA 1CHGA 3K6YA 3SV2H 3UNRA 2ZU2A 1ZHMA 3CENA 4AZ2B 3RXRA 2H5CA 1P9SA 1BTZA 1O2ZA 2ZCKP 4NGAH 2H9TH 4BXWA 3F9EA 2I6QA 4X2WA 1O3LA 2ZTYA 2FLBH 4BAQB 4X8SH 1JWTA 3RXIA 4DY7B 5FPSA 1O2KA 2IPHA 1LMWB 1UVOA 2R0LA 1IQIA 1O2RA 4YT7H 1MKXK 3UIRA 1K22H 2A4RA 1GHVH 2KAIB 3ZYDA 2AMPA 1AZZA 5DP9A 1O3IA 4Y8YA 1W11U 3QZQA 4CR9A 4E06H 2BB4A 3O8CA 2J94A 1HPGA 3K65B 2Y5GA 3D23A 1UJ1A 1WUNH 2C3SA 1MQ6A 2ZFSA 3EQ0H 4X1RU 1F92A 1TOCB 3RC6A 1W7GH 3S69A 1YPMH 1BT7A 1O3AA 1GBTA 3SU0A 1NFWA 2BLVA 1FN6A 2HPPH 5GCHG 1XKBC 3TJVA 1GI5A 1MTNC 3AVZA 2FOHA 3TJNA 1VGCB 1C2KA 5T6GA 1C5XB 2P8OC 2O8TA 1ELCA 1FIWA 2ZTXA 1WSSH 1ELTA 1KY9A 1P12E 1UCYH 2FX4A 3TH4H 4ABAA 5A8XA 3KQCA 1C1TA 4NIYA 2FM2A 4IBLH 4B75A 4BAHB 2VGCC 4LOYH 2ZZUH 5JBBS 4ZKNU 1DICA 4MPXA 5CE1A 1Z8GA 4BANB 3GDVA 4DIHH 3FVFB 3P8FA 1XKAC 1C2IA 3UQOA 4JK6A 4X6OA 2UUJB 2VWOA 1NPMA 1ZRKA 3P92A 1ESBA 3LH1A 1DUAA 1F0RA 2JH6D 4U32A 4CRDA 3M5OA 2Z9IA 2XBXA