3I78A

35/99/170/186/220-loops of fxa in sgt
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
229
structure length
229
Chain Sequence
VVGGTRAAQGEFPFMVRLINEENEGFCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSSSSFILVANEMICAGYDTKQEDTCQGDSGGPMFRKDNADEWVQVGIVSWGEGCARKGKYGVYTEVSTFASAIASAARTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combinatorial Enzyme Design Probes Allostery and Cooperativity in the Trypsin Fold.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase
molecule keywords Trypsin
total genus 56
structure length 229
sequence length 229
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i78A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i78A02
1Z8JB 3KL6A 1F0SA 4LZ1H 2GZ7A 2R2WU 1SGRE 2ZI2H 3STJA 3V13A 2BLOA 4OS2A 4RKOB 3RU4D 1HUTH 1SQAA 4UONA 5F8ZA 4HTCH 1K1OA 3I29A 4GCHG 1L1JA 1HFDA 1RJXB 2ZQ2A 3QDZB 1NRSH 3LJOA 1YPLH 3FP6E 3SNDA 3MO3A 2JH6D 2SNWA 3UREA 3NCLA 3A89A 4AOQA 1O3JA 3LOXA 1LHGH 1V2LT 1YCPM 1RIWB 4TPIZ 3T26A 1V6DA 1GI7B 2UUJB 1O2WA 1IHTH 1MZAA 4CBOA 2ILNA 1AHTH 1WSSH 1F0TA 2HGTH 3UY9A 1AFQC 3RXTA 1FV9A 3MO9A 1ETTH 2R2MB 1AUJA 1BMAA 1Y3WA 4Y0ZE 4UDWH 1K1MA 2A5KA 5GDSH 1KXFA 2ZGHA 2P16A 2Z6BD 3KN2A 1O3MA 2Y81A 3E90B 1OX1A 3AVZA 3OYPA 1T8LA 1ZHRA 1W10U 2P93A 2ZU4A 5DP7A 1GBKA 1O2IA 1NRNH 2OXSA 2VVUA 5PTPA 3RP2A 4E7RG 4ZH8A 4ESTE 1TX8A 2IPHA 3DT0H 2BDAA 3MU4A 2ZO3H 5HGGA 2D26C 1BB0B 3RXPA 3RXJA 1EAUA 4MPXA 4X8UH 1DWCH 1CT4E 3TK9A 1MUEB 2BVSH 2GDEH 1H8DH 3C1KA 1SQOA 1C5XB 5F8TA 3EA8A 1MBMA 3JZ2B 3ZVDA 3CP7A 1GBAA 3MH5A 3FZDA 2FLRH 4D9RA 1O5DH 2LNCA 3F9EA 1A2CH 1O35A 4K69A 2SGAA 3OTJE 2ZGXH 2C4FH 1Q3XA 4XBBA 3RXHA 1A5IA 3MNBA 1NFUA 1NU9A 1TX6A 3BTFE 3R3GB 4AFUA 1JWTA 4SGAE 4UFGH 3ZZDA 2BZAA 4CRGA 3BTME 2VIDA 1UTPA 2RA3A 4YZUA 1L1NA 5A0CA 4YOIA 3GCOA 2G52A 1CE5A 1GBLA 2TGDA 3FP8E 1SGNE 4XOJA 3PO1B 2FZZA 1HXEH 2AYWA 1UVSH 2THFB 3HPTB 1O0DH 2J95A 1AFQB 1PPGE 3PB1E 2XCNA 5FBIA 3EDXB 1UO6A 3A82A 1DPOA 1XUFA 4Q7ZA 1C5WB 1C1RA 1WV7H 5FCKA 1ANEA 1TPOA 3TH4H 1C2HA 1UVTH 1C5TA 1C2JA 3OY6U 1O3KA 1MBQA 2HVXA 2BHGA 3KCGH 4AFZA 2VIWA 2ZEBA 1A1RA 4HGCA 2GMTC 4Y0YE 4WF8A 1HAGE 1C5YB 1GMHF 3O8DA 4CRBA 2OC1A 1HNEE 4ZXYH 3SV8A 1F7ZA 5E2PA 2K1QA 3SU5A 4NCYA 3SOSA 3RC5A 2C8YB 3A8BA 1S83A 4I33A 1FAXA 2CGAA 1ANBA 1J14A 2WPJS 3GYMA 2GT8A 1HAYB 5DP5A 4TPYA 3K6ZA 1KDQA 1TIOA 1HBTH 2P8OC 1KSNA 1GJBB 1P01A 1Q31A 3SV2H 1H9IE 3A81A 1GHVH 1QA7A 1AMHA 2D2DA 1VITH 4I8LA 1P2QA 4X6OA 1HJ8A 4X1NU 1BA8B 2FOEA 1XVMA 2G5NA 3K6YA 1O2ZA 1QRWA 3SI4H 1O2GH 3GDSA 1QTFA 3SBKA 3QZRA 2CMYA 4J2YB 4OS6A 3UNQA 1IAUA 3V12A 1ZGVA 1CGHA 3Q77A 4RSPA 4X8SH 3VB3A 3RXCA 2OINA 1INCA 1WQSA 1SGEE 1BRAA 4U01A 4I8KA 4Y79A 1O2TA 4AB9A 1DXPA 8GCHG 3PMBB 4HZHA 3KQCA 3N7OA 5JB8S 4YOJA 2A45B 3Q76A 1OOKB 4MPUA 1CA0B 3A86A 3MWIU 1QNJA 1GI0A 5I46H 2QC2A 1HDTH 1SHHB 2BDGA 4K5ZA 1AZ8A 1K22H 1GMCG 1SB1H 2XBXA 3PYHA 1P2NA 1UTLM 1GDUA 1TQ7B 7GCHG 5FPYA 4I8JA 5FPSA 3U8OH 2GP9B 5BRRE 1EP6A 4DGJA 3QGJA 1CBWC 3S69A 1FY3A 1P2MA 2Y6TA 3ZZ7A 1C5SA 3CENA 5B6OA 1P03A 2C8ZB 1GI1A 1GHBG 2FP7B 3RM2H 1GBMA 1GMDF 3A85A 3GCTG 1YBWA 1FY1A 2PUQH 1UTNA 1UTMA 3MH4A 4DIHH 4D7FA 3G01A 1SGTA 4X1RU 3SV7A 2FOFA 3BTKE 1LQEA 1QCPA 1ZRBA 2Y82A 4WH6A 1ELVA 4Y6DA 1V2OT 1C9PA 1TBQH 3S7HB 1O3BA 2W7SA 3ZVAA 1L1GA 2OTVA 1N6XA 2ZZUH 3T25A 4WXIA 1TLDA 3D65E 2QGRA 1EAIA 1TPAE 3SQHE 3RU4T 1TGNA 2IJOB 3RU4E 4ZHLU 2FDAA 1MTWA 3MFJA 4Y8YA 1UTKA 4U30A 3ZVGA 4H6TA 5C3NA 5HXFA 5C1YA 1O2QA 5EW2H 4Y7BA 3M7UA 1G37A 3IWMA 4CHAC 2ZHFH 2J34A 4NIWA 3NZIA 1TYNA 2WUBA 4JYUH 2ZU3A 4YTAA 4K8BA 2ZWLH 5FXLA 5JBCS 1TFXA 4MNYA 1O2LA 1HAVB 4H6SB 1LTOA 3LKWA 2NU3E 4I32A 3FVFB 4FUJA 1Z8IB 4JZIA 2FS9A 3S7KB 1D3DB 2PKSB 4X8VH 4I8GA 1ETSH 3SU2A 1H1BA 2CF8H 1ZTJA 1GG6B 2FPZA 4D76A 3LH3A 1C5UA 1KLIH 1GI3A 3DD2H 2G51A 3NWUA 1VITF 2AH4X 3BV9B 1A0JA 2ZDVH 2VINA 4MPWA 1G3CA 1BTHH 2BDIA 1AVWA 2H9HA 5DK1A 4K3JA 5T6GA 3QWCH 2XC4A 4H42U 2WV4A 4JZEH 4UFFH 9LPRA 3GY2A 6LPRA 4BOHA 3LGTA 2XWBI 4A6LA 1AE8H 1L4DA 1ZOMA 2Q1JA 1BMNH 5EQRA 1AKSB 1EOJA 3PLPA 4ISLA 4ABGA 1EAWA 1G32B 2AIQA 1GHWH 2O8MA 3BIUH 1C5NH 4D8NA 2A5AA 2FYRA 1GCTC 2QCYA 3ATWA 5EPNA 1ABJH 2KAIA 1DSUA 1WAYB 1GDNA 1OPHB 1NN6A 4JYVH 1IOEA 1DLKB 4ABDA 2XCFA 7GCHF 5K0HA 1JRSA 1LPKB 1OWHA 5AF9H 2GCHG 1L2EA 1SLUB 1AU8A 4YLUA 3SUEA 2BY8X 1P2KA 4JZDH 1O2RA 1UHBB 1P2JA 2B0FA 2ZG0H 3SO3A 3K9XB 2Y7XA 2ODYB 3ATKA 2BQWB 3M3VA 5ESBA 2ZGJA 3F9HA 3PWBA 5A8XA 4NSVA 4UEHH 3LGIA 4Y8XA 3P8NA 5DGJA 5F03A 2PW8H 2DE8A 3SUFA 1L0ZA 1C2KA 2TRMA 1IQGA 1N8OB 2G00A 3RM0H 1A3EH 1C5ZB 3GCHC 1OP8A 4AG2A 4CBNA 1BTYA 3EGKH 1QJ1B 4ZAEA 1GGDC 1CHOG 2P8OB 2I6SA 3TLOA 1OYQA 3FP7E 5HYOA 1SC8U 4B74A 4X2VA 2PLXA 5LPFA 2QV1A 1EJAA 2FOCA 3BEUA 1FY8E 1GJ6A 1DDJA 4IMZA 4U32A 3ZZ4A 1V2JT 3AW1A 1TNHA 2C8WB 4FUDA 1O5CB 2F3CE 2VB0A 3RXSA 3FZZA 1QA0A 1MD7A 1XXFA 1HRTH 1EKBB 1GGDB 1SG8B 4AG1A 5SGAE 2FOGA 3M35A 2QAAA 1P57B 4CRFA 1O37A 4MG3A 1O3PB 1NRRH 3BTTE 1TALA 1GHYH 1AVGH 2LPRA 5DP9A 1S81A 2Q6FA 1K2I1 4IC5A 3QO6A 2BLQA 2VWLA 1TNJA 3OSYA 1LHFH 2SFAA 2XC5A 1JRTA 1MKXH 1ZR0A 4X2XA 3MO6A 1LKBA 2CHAC 4MDSA 1O3OA 4O97A 2VU8E 3PMHB 1DOJA 1H4WA 1FY4A 1G30B 1GI2A 2UWPA 3T2NA 1VR1H 2NWNA 5FAHA 4A5TS 3M36A 2BQ6B 1TRYA 4YESB 3SNAA 1TABE 4ISHH 1M9UA 3GCNA 1YPGH 3P92A 1EASA 3QUMP 3ZYDA 1W0YH 5DKMA 1V2ST 1DT2A 1O3EA 1FN6A 1O3AA 3TJNA 2CN0H 2WPMS 5TCCA 2WYGA 1FZZA 1QL7A 2GVFA 5DPAA 1DWDH 3ZZAA 3CS0A 1G3BA 2YNBA 1XX9A 1ZPZA 4I31A 3ZZ6A 3NXPA 3U1JB 1GI8B 3SORA 3GY7A 3DFJA 1GJ4H 1CGJE 2FMJA 3E6PH 1C5PA 1SBWA 2O8UA 3TJUA 1G9IE 1FONA 3H5CB 1C2EA 2SGEE 1V2TT 1CA0C 4NIYA 1O3IA 1ESTA 1C4U2 1RRKA 2GX4A 7ESTE 3MMGA 3MOCA 1O3GA 2V35A 1NS3A 2H5CA 3F68H 4K1SA 1KXAA 3SJ9A 1BIOA 2ZU1A 4O03A 2VVCA 1QB9A 2SGFE 2PSXA 1KTTB 5TCAA 3LPRA 4Q7YA 4XDEA 2XRCA 3MHWU 1GMDG 2FODA 1SVPA 5EXLA 1HLTH 1K1LA 1O5BB 3MNXA 4KELA 4FUGA 1B0EA 3PLKA 4TWWA 4XSKU 1PJPA 6ESTA 3MNSA 2BX4A 2JKHA 1GJ7B 3A8AA 1P3CA 4AN7A 4RN6A 1AD8H 3MTYA 3W94A 4DG4A 3HATH 1QFKH 2ZHEH 4KP0A 1MH0A 4WMDA 3TPIZ 2JH5D 3O8CA 1GBDA 3ATIA 2I6QA 4KTUA 1F0UA 3M5LA 5DP6A 3LC5A 2HNTC 2AMQA 5JB9S 1NY22 2BVRH 5ETXA 1AE5A 1S82A 1F0RA 2R9PA 3RXIA 1S5SA 2BY5X 3MH6A 2NU4E 3LGWA 3SJOA 1BQYA 4ABJA 5JBAS 2Z9GA 3Q3YA 2PSYA 2TBSA 1MKXK 5FX5A 5GJ4B 1F2SE 4MVNA 1PQ8A 3KQDA 1EX3A 5JBBS 5F6MA 1LHEH 1VGCC 1BTUA 1QBVH 3L6PA 2G55A 1H9HE 1LHCH 2NU0E 1O3CA 1TMBH 4UE7H 1J8AA 2PUXB 2FYQA 1O2VA 5EXMA 3Q00A 3RXLA 1UVUH 2CF9H 2SNVA 4ASHA 4GCHF 3ZZ5A 5A8YA 1RGQA 4ISIH 4BTUB 1AUTC 2JETB 1UK4A 2XNIA 3KQBA 3E91A 3SU6A 3U9AH 4Z0KA 4CH2B 2O9QA 3DA9B 1C1VH 2QN5T 4IMQA 4FUBA 5LPRA 3ZVEA 1TE0A 1GBFA 3TGIE 3GYLB 1EZUC 3RXOA 3U69H 3ZZ9A 1IQKA 1O31A 1FN8A 1AGJA 5AHGH 5ESTE 1XM1A 4WH8A 4X6PA 1TMUH 3SNBA 3LONA 3CS7A 1W14U 5E0JA 2ZF0H 1S6HA 4OGXA 1MQ5A 4ZROA 1SGFA 1SLWB 3SHCH 4NZQA 5EG4A 1OP0A 2J4IA 1TB6H 3ENSB 4BXWA 3IG6B 2OC8A 1NFYA 1D9IA 3ESTA 1KXEA 2J9NA 5A0AE 1JXPA 1EQ9A 4Y71A 3E0PB 4DOQA 3AASA 4NA7A 2VVVA 2GZ9A 1TONA 3MNCA 1QBOA 2A4QA 1QQUA 2OLGA 1VCPA 1FUJA 3K65B 3SZNA 1GVZA 1K1JA 1G3DA 1HAOH 5EQQA 1NESE 7KMEH 1GBTA 1GJDB 1SGDE 1ZRKA 2ZFPH 1AZZA 1DLEA 1ZSJA 3BG4B 2VWNA 1PFXC 3PO1C 4IW4E 1EOLA 3VB5A 2PV9B 4A92A 1IQNA 4ISNA 3RXFA 3UR6A 3ZZ8A 1IQJA 4IGDA 2BMGB 3SGQE 1T32A 4QT8C 3EAJA 1A61H 1C1UH 1SOTA 2FO9A 4OS4A 3FFGA 1ELAA 1Y5UT 2VWOA 4VGCB 1TRMA 2A5IA 1T31A 1ELGA 3DUXH 2XW9A 2ZCHP 1LVOA 4FUIA 1JIRA 1IQMA 4AGKA 4FU7A 4NG9H 1DITH 5EODA 4YO9A 2HWLB 1XMNB 3BG4C 1RTLA 4X6MA 3UTUH 2Z3EA 1O39A 3ODDA 1OWEA 2V0BA 1S0RA 3C27B 1GBIA 2HNTF 4NFFA 4TWYA 2QXGA 4JYTA 5AVDA 1AWHB 1Y59T 2BVXH 2H9TH 4CREA 1DY8A 5FPTA 2B9LA 3SJKA 2BDYA 4A1XA 1KXCA 2Z9JA 1BRBE 1GL1A 2ZHWH 3E1XB 2OC0A 1O3LA 4CRDA 2A2QH 2WYJA 1BRCE 1C2IA 1LVMA 5GCHF 1THPB 4JZ1A 1NZQH 1O2JA 3VGCB 1NROH 2P95A 1KXBA 1TA6A 2BZ6H 2AEIH 1V2NT 2ODQA 1O36A 1V2PT 1C4Y2 2GCTB 1THRH 1ORFA 5AFZH 3ITIA 1OWDA 1QJ7B 1S85A 1ZJDA 5GIBA 1UVOA 2A7JA 3SU1A 3SGBE 1VCWA 1QRZA 1KY9A 3GICB 4O3TA 3TITA 1O3NA 1DS2E 3ZYEA 2G4TA 5JDUB 1GJ8B 1B5GH 2BD3A 4NWKA 1XUJA 2ANMH 1EPTA 1NRPH 3LT3A 2FTMA 3TJOA 1Y5AT 5DG6A 3VFEA 1SPJA 1HYLA 1VJ9U 1GCTB 1CSOE 3SJ8A 2OBQA 2WUCA 2GD4B 4AGJA 5H4IB 5FCRA 1EJMA 1EZXC 1VJAU 3SV6A 4AFSA 1C2FA 1OWKA 3MH7A 1OKXA 1MKWK 1FI8A 3D23A 1CGIE 4MNXA 1YP9A 3KGPA 3OY5U 1P0SH 3KNXA 3ZZBA 3A7TA 1TOMH 1EAXA 3GY6A 1V2RT 1DXWA 2Z7FE 4UD9H 2BY9X 1TNIA 4IBLH 1T8NA 1XKBC 1MTSA 3T28A 1J16A 2ZFRH 4DVAU 1KDQB 3T27A 4ZHAA 1WYKA 1TQ0B 8KME2 1DICA 4AFQA 1CT0E 2AIPA 1RD3B 4AORA 1YM0A 4Y76A 3EE0B 1ZSLA 2ZGBH 2PKAB 1UCYK 1GVKB 2BX3A 2QA9E 1G3EA 2WV5A 4Y8ZA 3BN9A 4AZ2B 4FXGH 3MYWA 2JH0D 3A84A 3GCHB 4R8TB 6CHAB 5A09A 1RIWC 5HM9A 1THSH 2F9PA 4HFPB 1NM6A 1O3HA 1G2LA 3B23B 3AAUA 1KTSB 5CHAB 3ZZ3A 4ZKNU 1ZGIA 2W26A 3PV4A 2Z9LA 1T4UH 5E2OA 3GY5A 1AIXH 2B5TB 3TGJE 1P12E 3M5NA 5J4QA 2Y5HA 1NC6A 4ZKOU 1PQ5A 3T62A 9ESTA 2ZU5A 3O8BA 4ABFA 4DY7B 1P09A 2ZTXA 5I25A 4GSOA 3P6ZB 3TU7H 3ELAH 2J94A 4NSYA 2PWXA 2EC9H 5L30H 1MTVA 4YLQH 3A7WA 4CH8B 2ZPQA 4YM9A 1QBNA 1ELDE 1O30A 3D49H 1P8VC 1V2MT 2EI6A 2NU1E 1NRQH 2ANWA 1BRUP 1BCUH 3PMAB 3UQVA 2VWMA 4AX9H 2FIRH 3QTVH 3HGNA 1EATA 5DP3A 3LGYA 2ZCKP 5DP8A 1YPHE 2CJIA 1D3QB 1SI5H 3RXVA 1GBHA 2R3UA 2ZFTA 3A88A 3TNSA 1ACBE 1QRXA 1V2KT 2A7CA 5T6FA 3BTHE 1WQVH 2TIOA 4O9VA 5GWZA 4FU8A 3ATLA 5IYTA 3EA7A 1JMOH 3QLPH 3A8CA 1FPHH 1LVYA 1TA2A 1O2MA 1E38B 4WMEA 5BPEA 2RCEA 1F5RA 4ZKRU 3HKIB 1C5VA 1ZPCA 2ZPRA 2ANKH 2R3YA 3RUOA 3PTBA 4K8YA 1FXYA 3BTEE 2GTBA 1NT1A 5C2ZA 1XXDA 2FI5E 1P02A 2H1UA 2AGEX 3A7YA 1QB1A 2HNTE 4ISOA 1HAZB 2OP9A 1E35B 4KGAA 3RLYH 1V3XA 1O34A 1P11E 1TNLA 1YPEH 1ZMJA 3E8LA 4FVDA 5C1XA 1CU1A 1B0FA 2CXVA 3ZVCA 3VEQB 1TPPA 1Z8RA 4ZHMU 3MU8A 2A4RA 2ZHDA 5L6NH 2FS8A 1C1WH 1A0HB 1J17T 1SGFG 1O32A 4B2CA 2PFEA 2F9NA 1C1TA 5T6DA 3M3SA 1VZQH 4GUXA 3QGNB 4Z6AH 3F6UH 3URCA 4FUFA 2ZIQH 2EI8A 4A1VA 3FAOA 5EU8A 2PTCE 1QURH 1OS8A 1D4PB 1Y3VA 5TJXA 1IQHA 1P04A 3PWCA 2G5VA 3A83A 3B8JA 4DURA 1SLVB 1O2HA 1DY9A 1HV7A 1YF4A 2OC7A 1EPTC 3NK8A 2P94A 1DUAA 3I77A 1CA8B 1ELFA 2H5DA 1TNGA 1OSSA 1W11U 1HIAA 1Z1IA 4IS5A 2AS9A 1C5RA 1QR3E 3OX7U 1SR5C 1CHOF 2FLBH 3RXEA 1LMWB 1V2QT 1D3TB 1DFPA 1Y3XA 2C8XB 4INHA 1MCTA 4XFQA 2CHAB 5IDKA 1BHXB 1BTPA 2P3UB 4GHTA 3F1SB 1QGFA 3GY4A 2ULLA 3RXRA 4ZMAH 4MQAA 4ABAA 1ZYOA 1XUGA 1GBCA 1OXGA 2JETC 4BAHB 3ZVFA 1Z1JA 1V2WT 3L3TA 2NU2E 1NTPA 2BD8A 1BJVA 1YPHC 4B2BA 1DUEA 4VGCC 4MNVA 1GI9B 4X1PU 4CR5A 5EXNA 1YLDA 3U8RH 2V3OH 2FI4E 3U98H 1JOUB 1TRNA 1ANDA 4MTBA 1GHBF 1YPKH 1DM4B 3LH1A 1GG6C 4FUHA 3E16B 4IN1A 4IC6A 5E0HA 2XC0A 1ZJKA 1FNIA 4ZKSU 3SI3H 1GI4A 2EI7A 1PYTD 1ANCA 3LIWA 1H9LB 1DWEH 5A0BA 5CHAC 1JBUH 3VB6A 3I78A 4AYYB 4GLYA 2DE9A 4X1QU 3UUZA 1ID5H 1GWAA 1C1OA 3M7QA 5EQSA 3P70B 1KLTA 3LGVA 4I7YH 1MU8B 1LCYA 2ZKSA 4MNWA 1KXDA 5A2MH 4NA8A 1GMHG 4A7IB 5EOKA 2O8WA 2A2XH 1VCQA 1ELCA 1FMGA 1FLEE 3QN7A 2QY0B 2ZDAH 1FIWA 1ELEE 1F5LA 1LO6A 1WCZA 2ZU2A 2BQ7B 4AYVB 2OBOA 2GMTB 1IQFA 1SGYE 1A4WH 1SGQE 1AKSA 5EPYA 2ALVA 1EJNA 1W2KH 2W7UA 4GVUA 1XUHA 3MU1A 2W3IA 3SW2B 2HRVA 2TGAA 3V3MA 4INKA 1ZTKA 2D1JA 3SHAH 1WTGH 3QTOH 4HI3A 4NFEA 4NWLA 4K60A 2AFQB 2Z9KA 1BMMH 1GL0E 2H2ZA 3KF2A 3PMJA 1XUKA 2BXTH 1O2SA 2OUAA 1GHAG 1TGTA 3UWJH 4J1YA 3P8FA 1ARBA 1Y5BT 2C93B 4CRAA 3B9FH 1WOFA 2PGBB 1G2MA 1YPMH 4UFEH 4NA9H 3RC6A 1C5LH 3O8RA 3BSQA 5HMAA 3EQ0H 2WINI 3M37A 2WPLS 1HJAC 2VGCB 2VIQA 1TGCA 2GKVE 3SU4A 2Y5FA 2BD9A 2BY7X 4GAWA 1PPHE 4GHQA 4NZLA 3UWIA 1ARCA 2FTLE 1FJSA 2ZP0H 1BTZA 1T8OA 3D62A 1C1QA 1LVBA 1TMTH 2XBYA 3RXBA 1HAHH 2RG3A 4WJG2 4ABEA 5E8EH 4B76A 5CE1A 1GBBA 2ZNKH 2ZPSA 3MU5A 3GDVA 3PM3A 2XWAA 3PTNA 3P8GA 1E0FD 3BG8A 2R0LA 3RXQA 2BD2A 2H6MA 2FWWA 2UWLA 2VIVA 2BTCE 3M7TA 2ESTE 1OWJA 4NGAH 2UUFB 2AMPA 1F5KU 2B7DH 4B2AA 1EXFA 3TNTA 3NPSA 2ZC9H 3UNRA 1PQAA 1HIAB 2QXJA 1KLJH 4JCNA 3A8DA 1C4V2 3A7XA 3RC4A 1BTWA 3MI4A 3H7TA 1HB0B 3SV9A 1YC0A 5JBTA 2Z9IA 1GDQA 2V3HH 3F9FA 2BM2A 6CHAC 1O2PA 2QIQA 1GJ9B 2BXUH 1SFQB 1A3BH 2J92A 1SGIB 3GY3A 3S0NA 1ETRH 2O8LA 5CMXH 4OS7A 1K1NA 1OWIA 2A4GA 3Q3KA 4TYDA 5ABWA 1UTJA 1E36B 2UUKB 4ABHA 1EPTB 4X6NA 4XBCA 3PLBA 4LOYH 4X1SU 8LPRA 2XYAA 1ESBA 1JIMA 4OGYA 3ZZCA 4FUEA 4INLA 4K2YA 1GI5A 1O38A 1YKTA 1MMJN 2ZQ1A 1O3DA 3SUDA 2SGPE 1HXFH 7LPRA 1GJAB 5HM2A 4UFDH 1T4VH 2STBE 1BOQA 2HALA 2Y5GA 4PROA 1HCGA 3T29A 5DJ7A 1HAIH 1HPGA 1YPJH 1C5OH 4JMYA 1FDPA 1SFIA 1QJ6B 2WPIS 2ZDKA 1DSTA 3SN8A 2ZECA 2HLCA 4MLFB 2C3SA 1W0ZU 3R0FA 1WTHD 2PHBA 4ABIA 2A7HA 2IOTA 4ZXXH 2ZDLA 3RXKA 1EB2A 4JK6A 4H4FA 4Y7AA 3TVJB 4BAMB 1AI8H 1TGSZ 1SGPE 1N8OC 4BNRA 1ESAA 4XBDA 2PKAA 2SGQE 4JK5A 3VXEH 1P3EA 1OYTH 1GHAF 2YNAA 3RMMH 3A7VA 2FESH 5LPEA 1B7XB 1O2UA 1XKAC 4K1TA 3SNEA 2VNTA 1AO5A 3GY8A 2J2UA 4WMFA 4O3UA 1L4ZA 1S6FA 3DFLA 1QIXB 2BD7A 2XTTB 1C2DA 1PPEE 4MPVA 1Y8TA 3H7OA 4E05H 3ZV8A 4B73A 1Z6JH 1PQ7A 2AMDA 1QY6A 2P3FH 1K28D 1BZXE 2HPPH 1UK3A 2UUYA 5JYIA 4OS5A 2FOHA 3WY8A 1F92A 2ZTZA 3TK6A 1D6WA 1A5HA 1MAYA 1QB6A 2G81E 4I8HA 1S0QA 1C5QA 4B75A 1DANH 3E0NB 2D8WA 3UNSA 4WWYA 3V0XA 1O5GH 4ABBA 1Y3UA 4X2WA 8ESTE 4WXVA 3SGAE 1TBZH 2ZFSA 3IITA 4B71A 1C1NA 1K9OE 1GPZA 1BUIA 1GBEA 1BMLA 3SUGA 1TOCB 5G4BA 1MD8A 3M5OA 5E0GA 1T7CA 1MQ6A 1J9CH 1NFWA 1ZMLA 2ANYA 4BTTB 3RMLH 2VIPA 2Y80A 1BDAA 1SHYA 1EZSC 1O33A 4SGBE 3JZ1B 1UMAH 3TIUA 1FQ3A 1O5FH 3ODFA 1W8BH 1GBJA 1Z8GA 3BIVH 2C90B 3URDA 4CHAB 2WPHS 1LQDB 1UTOA 1XVOA 3BTWE 3EYDA 3U1IB 4FU9A 3UPEA 2VH0A 1EP5A 3ATMA 1A7SA 4BAKB 2DUCA 3LC3A 1E37B 2ZTYA 3LDXH 1ELTA 1W13U 2OQUA 1NU7B 2XBWA 1SMFE 2FOAA 1TBRH 1Z7KA 3HK3B 1MTNC 4E7NA 2W3KA 4NIVA 4LXBH 1GI6A 1O2KA 1UCYE 1ZPBA 1K1PA 3LJJA 1W3CA 5C20A 3UR9A 1SGCA 2Y7ZA 3VB7A 2G4UA 4X8TH 3PROA 2BY6X 3V7TA 2TGPZ 2Q6DA 3SU3A 2XXLA 5EW1H 4BTIB 2O8TA 3TJVA 3TH3H 1HAPH 4Y10E 1RFNA 5DO4H 2BYAX 1W7XH 2AGIX 1EUFA 2QF0A 2GV7A 1TNKA 2P59A 2KAIB 1YCPK 2QYIA 1C1MA 3VPKA 4KTCA 1P10A 2CV3A 4F4OC 1BBRE 1BBRK 2W5EA 6GCHG 2BD4A 2PR3A 1EB1H 1YYY1 2ZCLP 2AERH 1KIGH 2ZFFH 1AQ7A 1GCDA 1MAXA 1DWBH 3RMNH 5FBEA 1C2LA 2BOHB 1AVXA 2A4OA 3RXUA 3BTDE 3TK5A 2BDBA 3KHVA 2UWOA 1ZLRA 4AB8A 1PPCE 3SNCA 1UTQA 5GPIB 2GDDA 1RS0A 1O5EH 1Q2WA 2PKSC 1J15A 1ZMNA 1LKAA 2HPQH 1G36A 3S9CA 5L2ZH 2IN2A 1NFXA 1O2OA 3GISB 2OD3B 2PTNA 1D3PB 3E3TA 1YGCH 1TX7A 3GDUA 2R0KA 1A0LA 1MTNB 2GCTC 4WY3A 4BANB 1O5AB 2FOMB 1FIZA 1BTXA 2BB4A 3BTGE 1K1IA 1YLCA 2PGQB 2BLWA 1W7GH 2ZHQH 1UK2A 5K7RA 1V2UT 1QL8A 1PYTC 1Y3YA 3LU9B 3TGKE 1BITA 2F9OA 1MTUA 1C2MA 4OS1A 4D9QA 1BT7A 1IQIA 1GVLA 1X7AC 3AAVA 1FPCH 3QX5H 1MZDA 3VXFH 1WUNH 1DVAH 2GGVB 4DT7B 5GXPA 4M7GA 1TPSA 4THNH 1PPFE 1ZHMA 5A8ZA 1MCVA 1P9UA 5C5OA 3P8OA 1AY6H 2BDHA 1C9TA 2FOBA 3TH2H 5GCHG 1BBRH 2F9VA 2Z94A 1UHBA 4R0IA 2AGGX 1UVPA 3RXDA 1FAKH 1YCPH 2BOKA 2EEKA 1VITG 1HJ9A 1C2GA 2GV6A 2BLVA 4TY7A 2V6NA 5C67A 3EA9A 1O3FA 1GJ5H 1AB9B 1HAXB 2ZDNA 4Q7XA 2GCHF 1P2IA 8GCHF 1NPMA 2ASUB 1GJCB 3Q3XA 4DJZB 1GHZA 3ZV9A 1RXPA 2M5TA 3OU0A 3QK1A 3P95A 2FEQH 2BDCA 4A1TA 3HKJB 1BHXF 4IN2A 3SU0A 1HGTH 1E34B 3UFAA 3A7ZA 4YT6H 3P17H 1NO9H 2QXHA 4BXSA 2FM2A 4FVBA 2SGDE 1UCYH 3RXMA 1ZZZA 1ELBA 2XBVA 1C1SA 1P9SA 3AW0A 1SLXB 1P2OA 2Z3DA 4XE4A 2WPKS 3STIA 5LH8A 2B8OH 3DHKH 4DIIH 1CQQA 4B1TA 2QXIA 3S9AA 1BJUA 2BD5A 3VGCC 4ZUHA 5DP4A 1CT2E 5J4SA 5F8XA 3SQEE 4YT7H 2A0QB 2STAE 1TGBA 2OCVB 1LPZB 3RMOH 1IQLA 1MKWH 2A32A 3BF6H 3UOUA 2RA0A 1CBWB 1ZHPA 1P05A 1LHDH 3NKKA 4Q2KA 2HOBA 3KQEA 1FY5A 2FX4A 2Q6GA 1PPZA 4KTSA 1WBGB 1HJAB 4X0WU 2F91A 3SJIA 1AN1E 1DE7H 3UOPA 4F49A 4Q80A 2FX6A 1A46H 4NIXA 2A1DB 4YOGA 2VJ1A 3W95A 4GPGA 1ZSKA 1QHRB 5AFYH 3RDZA 1XUIA 2FXRA 1TAWA 3LGUA 2J38A 3M3TA 1V2VT 2QF3A 1DX5M 1H8IH 1AFEH 1RTKA 1O2YA 2ODPA 2OQ5A 1C1PA 3BEIB 3L33A 3RLWH 1C5MD 1RTFB 4WVPE 3M61U 4U2WA 1D6RA 1K21H 2TGTA 1A5GH 3BEFB 2VIOA 4KKDA 1WU1A 3U8TH 2G8TA 3GOVB 1W12U 2TPIZ 1GHXH 1O2XA 3M5MA 1LDTT 1QL9A 3VB4A 2YOLA 5FHTA 1CVWH 2GT7A 1SOZA 5L2YH 1CHGA 3A80A 2RDLA 3KEEA 5LGOA 1HAVA 1LPGB 5C1UA 1UJ1A 1SL3A 1N6YA 2ZDMA 4E06H 1QQ4A 5EGMA 5FX6A 1T8MA 2Z3CA 4CR9A 4LK4A 3S9BA 1S84A 2A31A 1ZTLA 1AB9C 3UIRA 6GCHF 4DCDA 5C5NA 3ZVBA 3FANA 1MU6B 2FI3E 1P06A 3K2UA 2H9EH 3MU0A 1PPBH 2ZFQH 1IQEA 4CRCA 3RXAA 3F9GA 1SQTA 1GMCF 1KYNA 2F9UA 2VGCC 4LZ4B 3UQOA 1OP2A 3A87A 4TY6A 2F9BH 1EZQA 3KIDU 3RXGA 1U6QA 1AWFH 2VH6A 2EA3A 1O2NA 1TWXB 2ALPA 3BTQE 3HGPA 4X2YA 4JZFH 2ZA5A 4FUCA 4RKJB 1ABIH 3NUMA 1Z71A 4DW2U 4BAOB 3GCTF 2ZGCA 2GZ8A 3HK6B 1VGCB 1CO7E 1Z6EA 5JPMH 2P3TB 3QZQA 1SSXA 4Y11E 1IHSH 4K1EA 4D7GA 4BAQB 1N1LA 3T5FH 2F83A 5T3HA
chains in the Genus database with same CATH superfamily
1Z8JB 3KL6A 1F0SA 4LZ1H 2GZ7A 2R2WU 1SGRE 2ZI2H 3STJA 3V13A 2BLOA 4OS2A 4RKOB 3RU4D 1HUTH 1SQAA 1BMFD 4UONA 1K0HA 5F8ZA 4HTCH 1K1OA 3I29A 4GCHG 1L1JA 1HFDA 1RJXB 2ZQ2A 3PV2A 1NRSH 3QDZB 3LJOA 1YPLH 3FP6E 3SNDA 3MO3A 2JH6D 3DSPA 2SNWA 3UREA 3NCLA 3A89A 4AOQA 1O3JA 3LOXA 1LHGH 1V2LT 1YCPM 1RIWB 4TPIZ 3T26A 1V6DA 1GI7B 2UUJB 4B6EA 1O2WA 1IHTH 1MZAA 4CBOA 2ILNA 1AHTH 1WSSH 1F0TA 2HGTH 3UY9A 1AFQC 3RXTA 1FV9A 3MO9A 1ETTH 2R2MB 1AUJA 2KCYA 1BMAA 1Y3WA 4FETA 4Y0ZE 4UDWH 1K1MA 2A5KA 5GDSH 1KXFA 2ZGHA 2P16A 2Z6BD 3KN2A 1O3MA 2Y81A 3E90B 1OX1A 3AVZA 3OYPA 1T8LA 1ZHRA 1W10U 3GS9A 2P93A 5HIZA 2ZU4A 5DP7A 1GBKA 1O2IA 4Q63A 1NRNH 2OXSA 2VVUA 5PTPA 3RP2A 4E7RG 4ZH8A 4ESTE 1TX8A 2IPHA 3DT0H 4P00A 2BDAA 3MU4A 2ZO3H 5HGGA 2D26C 1BB0B 3RXPA 3RXJA 1EAUA 4MPXA 4X8UH 1DWCH 1CT4E 3TK9A 1MUEB 2BVSH 2GDEH 1H8DH 3C1KA 1SQOA 1C5XB 5F8TA 3EA8A 1MBMA 3JZ2B 3ZVDA 3CP7A 1GBAA 3MH5A 3FZDA 2FLRH 4D9RA 1O5DH 2LNCA 3F9EA 1A2CH 1O35A 4K69A 5B6LA 2SGAA 3OTJE 2ZGXH 2C4FH 1Q3XA 4XBBA 3RXHA 1A5IA 3MNBA 1NFUA 1NU9A 1TX6A 3BTFE 2YMSD 3R3GB 4AFUA 1JWTA 4SGAE 4UFGH 3ZZDA 2BZAA 4CRGA 3BTME 2VIDA 1UTPA 2RA3A 4YZUA 1L1NA 4XRNA 4YOIA 5A0CA 3GCOA 2G52A 1CE5A 1GBLA 2TGDA 3FP8E 1SGNE 4XOJA 3PO1B 2FZZA 1HXEH 2AYWA 1UVSH 2THFB 3HPTB 1O0DH 2J95A 1AFQB 1PPGE 3PB1E 2XCNA 5FBIA 3EDXB 1UO6A 3A82A 1DPOA 1XUFA 4Q7ZA 4RT0A 1C5WB 2PP6A 1C1RA 1WV7H 5FCKA 1ANEA 1TPOA 3TH4H 1C2HA 1UVTH 1C5TA 1C2JA 3OY6U 1O3KA 3OE7D 1MBQA 2HVXA 2BHGA 4ZCNA 3KCGH 4AFZA 2VIWA 2ZEBA 5HKKD 1A1RA 4HGCA 2GMTC 4Y0YE 4WF8A 1HAGE 1C5YB 1GMHF 1W0JD 3O8DA 4CRBA 2VBCA 2OC1A 1HNEE 4ZXYH 2GJGA 3SV8A 1F7ZA 5E2PA 3ZIAD 2K1QA 3SU5A 4NCYA 3SOSA 3RC5A 2C8YB 3A8BA 1S83A 4I33A 1FAXA 2CGAA 1ANBA 1J14A 2WPJS 3GYMA 2GT8A 1HAYB 5DP5A 4TPYA 3K6ZA 1KDQA 1TIOA 1HBTH 2P8OC 1KSNA 1GJBB 1P01A 1Q31A 3SV2H 1H9IE 3A81A 1GHVH 2KFWA 2QF5A 1QA7A 1AMHA 2D2DA 5IK2D 1VITH 4I8LA 1P2QA 4X6OA 1HJ8A 4X1NU 1BA8B 2FOEA 1XVMA 2G5NA 3K6YA 5C0TA 1O2ZA 1QRWA 3SI4H 1O2GH 3GDSA 1QTFA 3SBKA 3QZRA 2CMYA 5GNDA 4J2YB 4OS6A 3UNQA 1IAUA 3V12A 2XNDD 1ZGVA 1CGHA 3Q77A 4RSPA 4X8SH 3VB3A 3RXCA 2OINA 1INCA 1WQSA 1SGEE 1BRAA 4U01A 4I8KA 4Y79A 1O2TA 4AB9A 1DXPA 3WWBA 4HG6A 8GCHG 3PMBB 4HZHA 3KQCA 2WV9A 3N7OA 3MQKC 5JB8S 4YOJA 2A45B 3Q76A 1OOKB 4MPUA 1CA0B 3A86A 3MWIU 1QNJA 1GI0A 5I46H 2L6OA 2QC2A 1HDTH 1SHHB 2BDGA 4K5ZA 1AZ8A 1K22H 1GMCG 2W6ID 1SB1H 2XBXA 3PYHA 1P2NA 1UTLM 1GDUA 1TQ7B 7GCHG 5FPYA 4I8JA 5FPSA 3U8OH 2GP9B 5BRRE 1EP6A 4DGJA 3QGJA 1CBWC 3S69A 1FY3A 1P2MA 2Y6TA 3ZZ7A 1C5SA 3CENA 5B6OA 3OTPA 1P03A 1MABB 1GI1A 2C8ZB 1GHBG 2FP7B 2JDID 3RM2H 5C0UA 1GBMA 1GMDF 3A85A 3GCTG 1YBWA 1FY1A 2PUQH 1UTNA 2EY4C 1UTMA 3MH4A 4DIHH 4D7FA 3G01A 1SGTA 4X1RU 3SV7A 2FOFA 3BTKE 1LQEA 1QCPA 1ZRBA 2Y82A 2KM0A 4WH6A 1ELVA 4Y6DA 1V2OT 1C9PA 1TBQH 3S7HB 1O3BA 2W7SA 3ZVAA 1L1GA 2OTVA 1N6XA 2ZZUH 3T25A 4WXIA 5CDFE 1TLDA 3D65E 2QGRA 1EAIA 1TPAE 3KYGA 3SQHE 3RU4T 1TGNA 2IJOB 3RU4E 4ZHLU 2FDAA 1MTWA 3MFJA 4Y8YA 1UTKA 4U30A 3ZVGA 4H6TA 5C3NA 5HXFA 3N7EA 5C1YA 1O2QA 5EW2H 4Y7BA 3M7UA 1G37A 3IWMA 4CHAC 2ZHFH 4P02A 2J34A 3PV5A 4NIWA 3NZIA 1TYNA 2WUBA 4JYUH 2ZU3A 4YTAA 4K8BA 2ZWLH 5FXLA 5JBCS 1TFXA 4MNYA 1O2LA 1HAVB 4H6SB 1LTOA 3LKWA 2NU3E 1YLNA 4I32A 3FVFB 4FUJA 1Z8IB 4JZIA 1W0KD 2FS9A 3S7KB 1D3DB 2PKSB 4X8VH 4I8GA 1ETSH 3SU2A 1H1BA 2CF8H 1ZTJA 1GG6B 2FPZA 4D76A 3LH3A 1C5UA 1KLIH 1GI3A 3DD2H 3F0OA 2G51A 3NWUA 1VITF 2AH4X 3BV9B 1A0JA 2ZDVH 2VINA 4MPWA 1G3CA 1BTHH 2BDIA 1AVWA 2H9HA 5DK1A 4K3JA 5T6GA 3QWCH 2XC4A 4H42U 2WV4A 4JZEH 4UFFH 3SYJA 3GY2A 6LPRA 4BOHA 2F43B 9LPRA 3LGTA 2XWBI 4A6LA 1AE8H 1L4DA 1ZOMA 2Q1JA 1BMNH 5EQRA 1AKSB 1EOJA 3PLPA 4ISLA 4ABGA 1EAWA 1G32B 2AIQA 1GHWH 2O8MA 3BIUH 1C5NH 4D8NA 2A5AA 2FYRA 1GCTC 2QCYA 3ATWA 5EPNA 1ABJH 2KAIA 4ASUD 1DSUA 1WAYB 1GDNA 1OPHB 1NN6A 4JYVH 1IOEA 1DLKB 4ABDA 2XCFA 7GCHF 5K0HA 1JRSA 1LPKB 1OWHA 2KX4A 5AF9H 2GCHG 1L2EA 1SLUB 1AU8A 4YLUA 3SUEA 2BY8X 1P2KA 4JZDH 1O2RA 1UHBB 1P2JA 2B0FA 2ZG0H 3SO3A 3K9XB 2Y7XA 2ODYB 3ATKA 2BQWB 3M3VA 5ESBA 2ZGJA 3F9HA 3PWBA 5A8XA 4NSVA 4UEHH 3LGIA 4Y8XA 3P8NA 5DGJA 5F03A 2PW8H 2DE8A 3SUFA 1L0ZA 1C2KA 2TRMA 1IQGA 1N8OB 2G00A 3RM0H 1A3EH 1C5ZB 3GCHC 1OP8A 4AG2A 4CBNA 1BTYA 3EGKH 1QJ1B 4ZAEA 5T1VA 1GGDC 1CHOG 2P8OB 2I6SA 3TLOA 1OYQA 3FP7E 5HYOA 1SC8U 4B74A 4X2VA 2PLXA 5LPFA 2QV1A 1EJAA 2FOCA 3BEUA 1FY8E 1GJ6A 1DDJA 4IMZA 4U32A 3FOAA 3ZZ4A 1KMHB 1V2JT 3AW1A 1TNHA 2C8WB 4FUDA 1O5CB 2F3CE 2VB0A 3RXSA 3FZZA 1QA0A 1MD7A 1XXFA 1HRTH 1EKBB 1GGDB 1SG8B 4AG1A 5SGAE 2FOGA 3M35A 2QAAA 3F2HA 1P57B 4CRFA 1O37A 4MG3A 1O3PB 1NRRH 3BTTE 1TALA 1GHYH 1AVGH 2JIZD 2LPRA 5DP9A 1S81A 2Q6FA 1K2I1 4IC5A 3QO6A 2BLQA 2VWLA 1TNJA 3OSYA 1LHFH 2SFAA 2XC5A 1JRTA 1MKXH 2LELA 1ZR0A 4X2XA 3MO6A 1LKBA 2CHAC 4MDSA 3SZEA 1O3OA 4O97A 2VU8E 3PMHB 1DOJA 1H4WA 1FY4A 1G30B 1GI2A 2UWPA 3T2NA 1VR1H 2NWNA 5FAHA 4A5TS 3M36A 2BQ6B 1TRYA 4YESB 3SNAA 1TABE 4ISHH 1M9UA 4Z1MD 3GCNA 1YPGH 3P92A 1EASA 3QUMP 3ZYDA 1W0YH 5DKMA 1V2ST 1DT2A 1O3EA 1FN6A 1O3AA 3TJNA 2CN0H 2WPMS 5TCCA 2WYGA 1FZZA 1QL7A 2GVFA 5DPAA 1DWDH 3ZZAA 3CS0A 1G3BA 2YNBA 1XX9A 1ZPZA 4I31A 3ZZ6A 3NXPA 3U1JB 1GI8B 3SORA 3GY7A 3DFJA 1GJ4H 1CGJE 2FMJA 3E6PH 1C5PA 1SBWA 2O8UA 3TJUA 1G9IE 1FONA 3H5CB 1C2EA 2SGEE 1V2TT 1CA0C 4NIYA 5HIYA 1O3IA 1ESTA 1C4U2 1RRKA 2GX4A 7ESTE 3MMGA 2M2AA 3MOCA 1O3GA 1COWD 2V35A 1NS3A 2H5CA 3F68H 4K1SA 1KXAA 3SJ9A 1BIOA 2ZU1A 4O03A 2VVCA 1QB9A 2SGFE 2PSXA 1KTTB 5TCAA 3LPRA 4Q7YA 4XDEA 2XRCA 3MHWU 1GMDG 2FODA 1SVPA 5EXLA 5KGOA 1HLTH 1K1LA 1O5BB 3MNXA 4KELA 3F3BA 4FUGA 1B0EA 3PLKA 4TWWA 4XSKU 1PJPA 6ESTA 3MNSA 2BX4A 2JKHA 1GJ7B 3A8AA 1P3CA 4AN7A 4RN6A 1AD8H 3MTYA 3W94A 4DG4A 3HATH 2YMSB 1QFKH 2ZHEH 5FL7D 4KP0A 1MH0A 4WMDA 5EJZA 3TPIZ 2JH5D 3O8CA 1GBDA 3ATIA 2I6QA 4KTUA 1F0UA 3M5LA 5DP6A 3LC5A 2HNTC 2AMQA 5JB9S 1NY22 2BVRH 5ETXA 1AE5A 1S82A 3DSOA 1F0RA 2R9PA 3RXIA 1S5SA 2BY5X 3MH6A 2NU4E 3LGWA 3SJOA 1BQYA 4ABJA 5JBAS 2Z9GA 3Q3YA 2PSYA 2TBSA 1MKXK 5FX5A 5GJ4B 1F2SE 4MVNA 1PQ8A 3KQDA 1EX3A 5JBBS 5F6MA 1LHEH 1VGCC 1BTUA 1QBVH 3L6PA 2G55A 1H9HE 1LHCH 2NU0E 1O3CA 1TMBH 4UE7H 1J8AA 2PUXB 2FYQA 1O2VA 5EXMA 3Q00A 3RXLA 1UVUH 2CF9H 2SNVA 4ASHA 4GCHF 3ZZ5A 5A8YA 1RGQA 4ISIH 4BTUB 1AUTC 2JETB 1UK4A 2XNIA 3KQBA 3E91A 3SU6A 3U9AH 4Z0KA 4CH2B 2O9QA 3DA9B 1C1VH 2QN5T 4IMQA 3KYFA 4FUBA 5LPRA 1SKYE 3FKSD 3ZVEA 1TE0A 1GBFA 3TGIE 3GYLB 1EZUC 3RXOA 3U69H 3ZZ9A 1IQKA 1O31A 1FN8A 1AGJA 5AHGH 4TT3D 5ESTE 1XM1A 4WH8A 4X6PA 1TMUH 3SNBA 3LONA 3CS7A 1W14U 5E0JA 2ZF0H 1S6HA 4OGXA 1MQ5A 4ZROA 1SGFA 1SLWB 3SHCH 4NZQA 5EG4A 1OP0A 2J4IA 1TB6H 3ENSB 4BXWA 3IG6B 2OC8A 1NFYA 1D9IA 3ESTA 1KXEA 2J9NA 5A0AE 1JXPA 2F4LA 1EQ9A 4Y71A 3E0PB 4DOQA 3AASA 4NA7A 2VVVA 1FX0B 2GZ9A 1TONA 3MNCA 2YMSC 1QBOA 2A4QA 1QQUA 2OLGA 1VCPA 1FUJA 3K65B 3SZNA 1GVZA 1K1JA 1G3DA 1HAOH 5EQQA 1NESE 7KMEH 1GBTA 1GJDB 1SGDE 1ZRKA 2ZFPH 1AZZA 1DLEA 1ZSJA 3BG4B 2VWNA 1PFXC 3PO1C 4IW4E 1EOLA 3VB5A 2PV9B 4A92A 1IQNA 4ISNA 3RXFA 3UR6A 3ZZ8A 1IQJA 4IGDA 2J98B 2BMGB 3SGQE 1T32A 4QT8C 3EAJA 1A61H 1C1UH 1SOTA 2FO9A 4OS4A 3FFGA 1ELAA 1Y5UT 2VWOA 4VGCB 1TRMA 2A5IA 1T31A 1ELGA 3DUXH 2XW9A 2ZCHP 1LVOA 4FUIA 1JIRA 1E1RD 1IQMA 4AGKA 4FU7A 4NG9H 1DITH 5EODA 4YO9A 2HWLB 1XMNB 3BG4C 4RI0A 1RTLA 4X6MA 4XD7D 3UTUH 2Z3EA 1O39A 3ODDA 1OWEA 2V0BA 1S0RA 3C27B 1GBIA 2HNTF 4NFFA 4TWYA 2QXGA 4JYTA 2WSSD 5AVDA 1AWHB 1Y59T 2BVXH 2H9TH 4CREA 1DY8A 5FPTA 2B9LA 3SJKA 2BDYA 4A1XA 1KXCA 2Z9JA 1BRBE 2RDEA 2WPDD 1GL1A 2ZHWH 3E1XB 2OC0A 1O3LA 4RT1A 4CRDA 2A2QH 2WYJA 1BRCE 1C2IA 1LVMA 5GCHF 1WXRA 1THPB 4JZ1A 1NZQH 1O2JA 3VGCB 1NROH 2P95A 1KXBA 1TA6A 2BZ6H 2AEIH 1V2NT 2ODQA 1O36A 1V2PT 1C4Y2 2GCTB 1THRH 1ORFA 5AFZH 3ITIA 1OWDA 1QJ7B 1S85A 1ZJDA 5GIBA 1UVOA 2EQNA 2A7JA 3SU1A 2LP6A 3SGBE 1NBME 1VCWA 1QRZA 1SQRA 1KY9A 3GICB 4O3TA 3TITA 1O3NA 1DS2E 3ZYEA 2G4TA 5JDUB 1GJ8B 1B5GH 2BD3A 4NWKA 1XUJA 2ANMH 1EPTA 1NRPH 3LT3A 4YXWD 3CNRA 2FTMA 3TJOA 1Y5AT 5DG6A 3VFEA 1SPJA 1HYLA 1VJ9U 1GCTB 1CSOE 3SJ8A 2OBQA 2WUCA 2GD4B 4AGJA 5H4IB 5FCRA 1EJMA 1EZXC 1VJAU 3SV6A 4AFSA 1C2FA 1OWKA 3MH7A 1OKXA 1MKWK 1FI8A 3D23A 1CGIE 4MNXA 1YP9A 3KGPA 3OY5U 1P0SH 3KNXA 3ZZBA 3A7TA 1TOMH 1EAXA 3GY6A 1V2RT 1DXWA 2Z7FE 2IJD1 4UD9H 2BY9X 1TNIA 4IBLH 1T8NA 1XKBC 1MTSA 3T28A 1J16A 2ZFRH 4DVAU 1KDQB 3T27A 4ZHAA 1WYKA 1TQ0B 8KME2 1DICA 4AFQA 1CT0E 2AIPA 1RD3B 3F0PA 4AORA 1YM0A 4Y76A 3EE0B 1ZSLA 2ZGBH 2PKAB 1UCYK 1GVKB 2BX3A 2QA9E 1G3EA 2WV5A 4Y8ZA 3BN9A 4AZ2B 4FXGH 3MYWA 2JH0D 3A84A 3GCHB 4R8TB 6CHAB 5A09A 1RIWC 5HM9A 1THSH 2F9PA 4HFPB 1NM6A 1O3HA 1G2LA 3B23B 3AAUA 1KTSB 5CHAB 3ZZ3A 4ZKNU 1ZGIA 2W26A 3PV4A 2Z9LA 1T4UH 5E2OA 3GY5A 1AIXH 2B5TB 5C17A 3TGJE 1P12E 3M5NA 5J4QA 2Y5HA 1NC6A 4ZKOU 1PQ5A 3T62A 9ESTA 2ZU5A 3O8BA 4ABFA 4DY7B 1P09A 2ZTXA 5I25A 4GSOA 2CK3D 3P6ZB 3FN8A 3TU7H 3ELAH 2J94A 4NSYA 2PWXA 2EC9H 5L30H 1MTVA 4YLQH 3A7WA 4CH8B 2ZPQA 4YM9A 1QBNA 1ELDE 1O30A 2KZ4A 3D49H 1H8HD 1P8VC 1V2MT 2EI6A 2NU1E 1NRQH 2ANWA 1BRUP 1BCUH 3PMAB 3WWFA 3UQVA 2VWMA 4AX9H 2FIRH 3QTVH 3HGNA 2J97A 1EATA 5DP3A 3LGYA 2ZCKP 5DP8A 1YPHE 2CJIA 1D3QB 1SI5H 3RXVA 1GBHA 2R3UA 2ZFTA 3A88A 3TNSA 3WW7A 1ACBE 1QRXA 1V2KT 2A7CA 5T6FA 3BTHE 1WQVH 2TIOA 4O9VA 5GWZA 4FU8A 3ATLA 5IYTA 3EA7A 1JMOH 3QLPH 3A8CA 1FPHH 1LVYA 1TA2A 1O2MA 1E38B 4WMEA 5BPEA 2RCEA 1F5RA 4ZKRU 3HKIB 1C5VA 1ZPCA 2ZPRA 2ANKH 2R3YA 4FOUC 3RUOA 3PTBA 4K8YA 1FXYA 3BTEE 2GTBA 1NT1A 5C2ZA 1XXDA 2FI5E 1P02A 2H1UA 2AGEX 3A7YA 1QB1A 2HNTE 4ISOA 1HAZB 2OP9A 1E35B 4KGAA 3RLYH 1V3XA 1O34A 1P11E 1TNLA 1YPEH 1ZMJA 3E8LA 4FVDA 5C1XA 1CU1A 1B0FA 2CXVA 3ZVCA 1UW7A 3VEQB 1TPPA 1Z8RA 4ZHMU 3MU8A 2J98A 3N7DA 1S6LA 2A4RA 2ZHDA 5L6NH 2FS8A 1C1WH 1A0HB 1J17T 1SGFG 1O32A 4B2CA 2PFEA 2F9NA 1C1TA 5T6DA 3M3SA 1VZQH 4GUXA 3QGNB 5CHBA 4Z6AH 3F6UH 3URCA 4FUFA 2ZIQH 2EI8A 4A1VA 4DT4A 3OFND 3FAOA 5EU8A 2PTCE 1QURH 1OS8A 1D4PB 1Y3VA 5TJXA 1IQHA 1P04A 3PWCA 2G5VA 3A83A 3B8JA 4DURA 1SLVB 1O2HA 1DY9A 1HV7A 1YF4A 3UAIC 2OC7A 1EPTC 3NK8A 2P94A 1DUAA 3I77A 1CA8B 1ELFA 2H5DA 1TNGA 1OSSA 1W11U 1HIAA 1Z1IA 4IS5A 2AS9A 1C5RA 1QR3E 3OX7U 2AHME 1SR5C 1CHOF 2FLBH 3RXEA 1LMWB 1V2QT 1D3TB 1DFPA 1Y3XA 2C8XB 4INHA 1MCTA 4XFQA 2CHAB 5IDKA 1BHXB 1BTPA 2P3UB 4GHTA 3F1SB 1QGFA 3GY4A 2ULLA 3RXRA 4ACAA 4ZMAH 4MQAA 4ABAA 1ZYOA 1XUGA 1GBCA 1OXGA 2JETC 1WDIA 2WZQA 3ZVFA 1Z1JA 4BAHB 1V2WT 3OAAD 3L3TA 2NU2E 1NTPA 3EE7A 2BD8A 1BJVA 1YPHC 4B2BA 1DUEA 4VGCC 4MNVA 1GI9B 4F48B 4X1PU 1E1QD 4CR5A 5EXNA 1YLDA 3U8RH 2V3OH 2FI4E 3U98H 1JOUB 1TRNA 1ANDA 4MTBA 1GHBF 2WHXA 1YPKH 2XOKD 1DM4B 3LH1A 1GG6C 4FUHA 3E16B 4IN1A 4IC6A 5E0HA 2XC0A 1ZJKA 1FNIA 4ZKSU 3SI3H 1GI4A 2EI7A 1PYTD 1ANCA 3LIWA 1H9LB 1DWEH 5A0BA 5CHAC 1JBUH 3VB6A 3I78A 4AYYB 4GLYA 2DE9A 4X1QU 3UUZA 1ID5H 1GWAA 1C1OA 3M7QA 5EQSA 3P70B 1KLTA 3LGVA 4I7YH 1MU8B 1LCYA 2ZKSA 4MNWA 1KXDA 5A2MH 4NA8A 1GMHG 3OEHD 4A7IB 5EOKA 2O8WA 2A2XH 1VCQA 1ELCA 1FMGA 1FLEE 3QN7A 2QY0B 2ZDAH 1FIWA 1ELEE 1F5LA 2JJ2D 1LO6A 1WCZA 2ZU2A 2BQ7B 4AYVB 2OBOA 2GMTB 1IQFA 1SGYE 1A4WH 1SGQE 1AKSA 5EPYA 2ALVA 1EJNA 1W2KH 2W7UA 4GVUA 1XUHA 3MU1A 2W3IA 3SW2B 2HRVA 2TGAA 3V3MA 4INKA 1ZTKA 2D1JA 3SHAH 1WTGH 3QTOH 4HI3A 4NFEA 4NWLA 4K60A 2AFQB 4F55A 2Z9KA 1BMMH 1GL0E 2H2ZA 3KF2A 3PMJA 1XUKA 2BXTH 1O2SA 2OUAA 1GHAG 1TGTA 3UWJH 4J1YA 3P8FA 2OK5A 1ARBA 1Y5BT 2C93B 4CRAA 3B9FH 1WOFA 2PGBB 1G2MA 1YPMH 4UFEH 4NA9H 3RC6A 1C5LH 3O8RA 3BSQA 5HMAA 3EQ0H 2WINI 3M37A 2WPLS 1HJAC 2VGCB 2VIQA 1TGCA 2GKVE 3SU4A 2BY7X 2BD9A 2Y5FA 4GAWA 1PPHE 4GHQA 4NZLA 3UWIA 1ARCA 2FTLE 1FJSA 2ZP0H 1BTZA 1T8OA 3D62A 1C1QA 1LVBA 1TMTH 2XBYA 3RXBA 1HAHH 2RG3A 4WJG2 4ABEA 5E8EH 4B76A 5CE1A 1GBBA 2ZNKH 2ZPSA 3MU5A 3GDVA 3PM3A 2XWAA 3PTNA 3P8GA 1E0FD 3BG8A 2R0LA 3RXQA 2BD2A 4Q4LA 2H6MA 2FWWA 2UWLA 2VIVA 2BTCE 3M7TA 2ESTE 1OWJA 4NGAH 2UUFB 2AMPA 1F5KU 2B7DH 4B2AA 1EXFA 3TNTA 3NPSA 2ZC9H 3UNRA 1PQAA 1HIAB 2QXJA 1KLJH 4JCNA 3A8DA 1C4V2 3A7XA 3RC4A 1BTWA 3MI4A 3H7TA 1HB0B 3SV9A 1YC0A 5JBTA 2Z9IA 1GDQA 2V3HH 3F9FA 2BM2A 5C94A 1O2PA 2QIQA 1GJ9B 6CHAC 2BXUH 1SFQB 1A3BH 2J92A 5KECA 1SGIB 3GY3A 3S0NA 1ETRH 2O8LA 5CMXH 4OS7A 1K1NA 1OWIA 2A4GA 3Q3KA 4TYDA 5ABWA 1UTJA 1E36B 2UUKB 4ABHA 1EPTB 4X6NA 4XBCA 3PLBA 4LOYH 4X1SU 8LPRA 2XYAA 1ESBA 1JIMA 4OGYA 3ZZCA 4FUEA 4INLA 4K2YA 1GI5A 1O38A 1YKTA 1MMJN 2ZQ1A 1O3DA 3SUDA 2SGPE 1HXFH 2K0QA 1GJAB 1NBMD 5HM2A 4UFDH 1H8ED 1T4VH 2STBE 7LPRA 1BOQA 2HALA 3OEED 2Y5GA 4PROA 1HCGA 3T29A 5DJ7A 1HAIH 1HPGA 1YPJH 1C5OH 4JMYA 1FDPA 1SFIA 1QJ6B 2WPIS 2ZDKA 1DSTA 3SN8A 2ZECA 2HLCA 4MLFB 2C3SA 1W0ZU 3R0FA 1WTHD 2PHBA 4ABIA 2A7HA 2IOTA 4ZXXH 2ZDLA 3RXKA 1EB2A 4JK6A 4H4FA 4Y7AA 3TVJB 4BAMB 1AI8H 1TGSZ 1SGPE 1N8OC 4BNRA 1ESAA 4XBDA 2PKAA 2SGQE 4JK5A 3VXEH 1P3EA 1OYTH 1GHAF 2YNAA 3RMMH 3A7VA 2FESH 5LPEA 1B7XB 1O2UA 1XKAC 4K1TA 3SNEA 2VNTA 1AO5A 3GY8A 2J2UA 4WMFA 4O3UA 1L4ZA 1S6FA 3DFLA 1QIXB 2BD7A 2XTTB 1C2DA 1PPEE 4MPVA 1Y8TA 3H7OA 4E05H 3ZV8A 4B73A 1Z6JH 1PQ7A 2AMDA 1QY6A 2P3FH 3NRLA 1K28D 1BZXE 2HPPH 1UK3A 2UUYA 5JYIA 4OS5A 2FOHA 3WY8A 1F92A 2ZTZA 3TK6A 4M9FA 1D6WA 1A5HA 1MAYA 1QB6A 2KCPA 2G81E 4I8HA 3DSGA 2HVYB 1S0QA 1OHHD 1C5QA 4B75A 1DANH 3E0NB 2D8WA 3UNSA 3KQ5A 4WWYA 3V0XA 1O5GH 4ABBA 1Y3UA 4X2WA 8ESTE 4WXVA 3SGAE 1TBZH 2ZFSA 3IITA 4B71A 1C1NA 1K9OE 1GPZA 1BUIA 1GBEA 1BMLA 3SUGA 1TOCB 3PRBA 5EJLA 5G4BA 1MD8A 3M5OA 5E0GA 1T7CA 1MQ6A 1J9CH 1NFWA 1ZMLA 2ANYA 4BTTB 1VKYA 3RMLH 4OM9A 2VIPA 2Y80A 1BDAA 1SHYA 1EZSC 1O33A 4SGBE 3JZ1B 3H09A 1UMAH 3TIUA 1FQ3A 1O5FH 2W6JD 3ODFA 1W8BH 1GBJA 1YY3A 1Z8GA 2C90B 3BIVH 4AC9A 3URDA 4CHAB 2WPHS 1LQDB 1UTOA 1XVOA 3BTWE 3EYDA 3U1IB 4FU9A 3UPEA 2VH0A 1EP5A 3ATMA 1A7SA 4BAKB 2DUCA 3LC3A 1E37B 2ZTYA 3LDXH 1ELTA 1W13U 2OQUA 1NU7B 1SMFE 2XBWA 2FOAA 1TBRH 1Z7KA 2L74A 3HK3B 1MTNC 4E7NA 2W3KA 4NIVA 2V3MA 2HLDD 1GI6A 1O2KA 1UCYE 4LXBH 1ZPBA 1K1PA 3LJJA 1W3CA 5C20A 3UR9A 1SGCA 2KCAA 2Y7ZA 3VB7A 2G4UA 3AK5A 4X8TH 3PROA 2BY6X 3V7TA 2TGPZ 2Q6DA 3SU3A 2XXLA 5EW1H 4BTIB 2O8TA 3TJVA 3TH3H 1HAPH 4Y10E 1RFNA 5DO4H 2BYAX 1QZ8A 5DSFA 1W7XH 2AGIX 1EUFA 2QF0A 2GV7A 1TNKA 2P59A 2KAIB 1YCPK 2QYIA 1C1MA 3VPKA 4KTCA 1P10A 2CV3A 4F4OC 1BBRE 1BBRK 2W5EA 6GCHG 2BD4A 2PR3A 4I86A 1EB1H 1YYY1 2ZCLP 2AERH 1KIGH 2ZFFH 1AQ7A 1GCDA 1MAXA 1DWBH 3RMNH 5FBEA 1C2LA 2BOHB 1AVXA 2A4OA 3RXUA 3BTDE 3TK5A 2BDBA 3KHVA 2UWOA 1ZLRA 4AB8A 1PPCE 3SNCA 1UTQA 5GPIB 1E79D 2GDDA 1RS0A 1O5EH 1Q2WA 2PKSC 1J15A 1ZMNA 1LKAA 2HPQH 1G36A 3S9CA 5L2ZH 2IN2A 1NFXA 3W1EA 1O2OA 5DN6D 3GISB 2OD3B 2PTNA 1D3PB 3E3TA 1YGCH 1TX7A 3GDUA 2R0KA 2K8IA 1A0LA 1MTNB 2GCTC 4WY3A 2J5UA 4BANB 1O5AB 2FOMB 1FIZA 1BTXA 2BB4A 3BTGE 1K1IA 1YLCA 2PGQB 2BLWA 1W7GH 2ZHQH 5KEDA 1UK2A 5K7RA 1V2UT 1QL8A 1PYTC 1Y3YA 3LU9B 3TGKE 1BITA 2F9OA 1MTUA 1C2MA 4OS1A 3U28C 4D9QA 1BT7A 1IQIA 1GVLA 1X7AC 5EJ1A 3AAVA 1FPCH 3QX5H 1MZDA 3VXFH 1WUNH 1DVAH 2GGVB 4DT7B 5GXPA 4M7GA 1TPSA 2QF4A 4THNH 1PPFE 1ZHMA 5A8ZA 1MCVA 1P9UA 5C5OA 3P8OA 1AY6H 2BDHA 1C9TA 2FOBA 3TH2H 5GCHG 1BBRH 2F9VA 2Z94A 1UHBA 4R0IA 2AGGX 1UVPA 3RXDA 1FAKH 1YCPH 2BOKA 2EEKA 1VITG 1HJ9A 1C2GA 2GV6A 2BLVA 4TY7A 2V6NA 5C67A 3EA9A 1O3FA 2IPQX 1GJ5H 1AB9B 1HAXB 2ZDNA 4Q7XA 2GCHF 1P2IA 8GCHF 1NPMA 2ASUB 1GJCB 3Q3XA 4DJZB 1GHZA 3N99A 3ZV9A 1RXPA 2M5TA 3OU0A 3QK1A 3P95A 2FEQH 2BDCA 2KCOA 4A1TA 3HKJB 1BHXF 4IN2A 3SU0A 1HGTH 1E34B 3UFAA 3A7ZA 4YT6H 3P17H 1NO9H 2QXHA 4BXSA 2FM2A 4FVBA 2SGDE 1UCYH 3RXMA 1ZZZA 1ELBA 2XBVA 1C1SA 1P9SA 3AW0A 1SLXB 1P2OA 2Z3DA 4XE4A 2WPKS 3STIA 5LH8A 2B8OH 3DHKH 4DIIH 1CQQA 4B1TA 2QXIA 3S9AA 3PRDA 1BJUA 2BD5A 3VGCC 4ZUHA 5DP4A 1CT2E 5J4SA 5EIYA 5F8XA 3SQEE 4YT7H 2A0QB 2STAE 3VG8A 1TGBA 2OCVB 1LPZB 3RMOH 1IQLA 1MKWH 2A32A 3BF6H 3UOUA 2RA0A 1CBWB 1ZHPA 1P05A 1LHDH 3NKKA 4Q2KA 2HOBA 3KQEA 1FY5A 2FX4A 2Q6GA 1PPZA 4KTSA 1WBGB 1HJAB 4X0WU 2F91A 3SJIA 1AN1E 1DE7H 3UOPA 4F49A 4Q80A 2FX6A 1A46H 4NIXA 2A1DB 4YOGA 2V7QD 2VJ1A 3W95A 4GPGA 1ZSKA 4B6FA 1QHRB 5AFYH 3RDZA 1XUIA 2FXRA 1TAWA 3LGUA 2J38A 3M3TA 1V2VT 5F53A 2QF3A 1YWUA 1DX5M 1H8IH 1AFEH 1RTKA 1O2YA 2ODPA 2OQ5A 1C1PA 3UB0A 3BEIB 3L33A 3RLWH 1C5MD 1RTFB 4WVPE 3M61U 4U2WA 2KR7A 1D6RA 1K21H 2TGTA 1A5GH 3BEFB 2VIOA 4KKDA 1WU1A 3U8TH 2G8TA 3GOVB 4TSFD 1W12U 2TPIZ 1GHXH 3F2FA 1O2XA 3M5MA 1LDTT 1QL9A 3VB4A 2YOLA 5FHTA 1CVWH 2GT7A 3F2GA 1SOZA 5L2YH 1CHGA 3A80A 2RDLA 3KEEA 5LGOA 1HAVA 1LPGB 5C1UA 1UJ1A 1SL3A 1N6YA 2ZDMA 4E06H 1QQ4A 5EGMA 5FX6A 1T8MA 2Z3CA 4CR9A 4LK4A 3S9BA 1S84A 2A31A 1ZTLA 1AB9C 3UIRA 6GCHF 4DCDA 5C5NA 3ZVBA 3FANA 1MU6B 2FI3E 1P06A 3K2UA 2H9EH 3MU0A 1PPBH 2ZFQH 1IQEA 2JJ1D 4CRCA 3RXAA 3F9GA 1SQTA 3FO8D 1GMCF 3DCLA 1KYNA 2F9UA 2VGCC 4LZ4B 3UQOA 1OP2A 3A87A 4TY6A 2F9BH 1EZQA 3KIDU 3RXGA 1U6QA 1AWFH 2VH6A 2EA3A 1O2NA 1TWXB 2ALPA 3BTQE 3HGPA 4X2YA 4JZFH 2ZA5A 1EFRD 4FUCA 4RKJB 1ABIH 3NUMA 1Z71A 4DW2U 4BAOB 3GCTF 2ZGCA 2GZ8A 3HK6B 1VGCB 1CO7E 1Z6EA 4ACBA 5JPMH 2P3TB 3QZQA 2RFKC 1SSXA 4Y11E 1IHSH 4K1EA 4D7GA 4BAQB 1N1LA 3T5FH 2QE7D 2F83A 5T3HA
chains in the Genus database with same CATH topology
1Z8JB 3KL6A 1F0SA 4LZ1H 2GZ7A 2R2WU 1SGRE 2ZI2H 3STJA 3V13A 2BLOA 4OS2A 4RKOB 3RU4D 1HUTH 1SQAA 4UONA 5F8ZA 4HTCH 1K1OA 3I29A 4GCHG 1L1JA 1HFDA 1RJXB 2ZQ2A 3QDZB 1NRSH 3LJOA 1YPLH 3FP6E 3SNDA 3MO3A 2JH6D 2SNWA 3UREA 3NCLA 3A89A 4AOQA 1O3JA 3LOXA 1LHGH 1V2LT 1YCPM 1RIWB 4TPIZ 3T26A 1V6DA 1GI7B 2UUJB 1O2WA 1IHTH 1MZAA 4CBOA 2ILNA 1AHTH 1WSSH 1F0TA 2HGTH 3UY9A 1AFQC 3RXTA 1FV9A 3MO9A 1ETTH 2R2MB 1AUJA 1BMAA 1Y3WA 4Y0ZE 4UDWH 1K1MA 2A5KA 5GDSH 1KXFA 2ZGHA 2P16A 2Z6BD 3KN2A 1O3MA 2Y81A 3E90B 1OX1A 3AVZA 3OYPA 1T8LA 1ZHRA 1W10U 2P93A 2ZU4A 5DP7A 1GBKA 1O2IA 1NRNH 2OXSA 2VVUA 5PTPA 3RP2A 4E7RG 4ZH8A 4ESTE 1TX8A 2IPHA 3DT0H 2BDAA 3MU4A 2ZO3H 5HGGA 2D26C 1BB0B 3RXPA 3RXJA 1EAUA 4MPXA 4X8UH 1DWCH 1CT4E 3TK9A 1MUEB 2BVSH 2GDEH 1H8DH 3C1KA 1SQOA 1C5XB 5F8TA 3EA8A 1MBMA 3JZ2B 3ZVDA 3CP7A 1GBAA 3MH5A 3FZDA 2FLRH 4D9RA 1O5DH 2LNCA 3F9EA 1A2CH 1O35A 4K69A 2SGAA 3OTJE 2ZGXH 2C4FH 1Q3XA 4XBBA 3RXHA 1A5IA 3MNBA 1NFUA 1NU9A 1TX6A 3BTFE 3R3GB 4AFUA 1JWTA 4SGAE 4UFGH 3ZZDA 2BZAA 4CRGA 3BTME 2VIDA 1UTPA 2RA3A 4YZUA 1L1NA 5A0CA 4YOIA 3GCOA 2G52A 1CE5A 1GBLA 2TGDA 3FP8E 1SGNE 4XOJA 3PO1B 2FZZA 1HXEH 2AYWA 1UVSH 2THFB 3HPTB 1O0DH 2J95A 1AFQB 1PPGE 3PB1E 2XCNA 5FBIA 3EDXB 1UO6A 3A82A 1DPOA 1XUFA 4Q7ZA 1C5WB 1C1RA 1WV7H 5FCKA 1ANEA 1TPOA 3TH4H 1C2HA 1UVTH 1C5TA 1C2JA 3OY6U 1O3KA 1MBQA 2HVXA 2BHGA 3KCGH 4AFZA 2VIWA 2ZEBA 1A1RA 4HGCA 2GMTC 4Y0YE 4WF8A 1HAGE 1C5YB 1GMHF 3O8DA 4CRBA 2OC1A 1HNEE 4ZXYH 3SV8A 1F7ZA 5E2PA 2K1QA 3SU5A 4NCYA 3SOSA 3RC5A 2C8YB 3A8BA 1S83A 4I33A 1FAXA 2CGAA 1ANBA 1J14A 2WPJS 3GYMA 2GT8A 1HAYB 5DP5A 4TPYA 3K6ZA 1KDQA 1TIOA 1HBTH 2P8OC 1KSNA 1GJBB 1P01A 1Q31A 3SV2H 1H9IE 3A81A 1GHVH 1QA7A 1AMHA 2D2DA 1VITH 4I8LA 1P2QA 4X6OA 1HJ8A 4X1NU 1BA8B 2FOEA 1XVMA 2G5NA 3K6YA 1O2ZA 1QRWA 3SI4H 1O2GH 3GDSA 1QTFA 3SBKA 3QZRA 2CMYA 4J2YB 4OS6A 3UNQA 1IAUA 3V12A 1ZGVA 1CGHA 3Q77A 4RSPA 4X8SH 3VB3A 3RXCA 2OINA 1INCA 1WQSA 1SGEE 1BRAA 4U01A 4I8KA 4Y79A 1O2TA 4AB9A 1DXPA 8GCHG 3PMBB 4HZHA 3KQCA 3N7OA 5JB8S 4YOJA 2A45B 3Q76A 1OOKB 4MPUA 1CA0B 3A86A 3MWIU 1QNJA 1GI0A 5I46H 2QC2A 1HDTH 1SHHB 2BDGA 4K5ZA 1AZ8A 1K22H 1GMCG 1SB1H 2XBXA 3PYHA 1P2NA 1UTLM 1GDUA 1TQ7B 7GCHG 5FPYA 4I8JA 5FPSA 3U8OH 2GP9B 5BRRE 1EP6A 4DGJA 3QGJA 1CBWC 3S69A 1FY3A 1P2MA 2Y6TA 3ZZ7A 1C5SA 3CENA 5B6OA 1P03A 2C8ZB 1GI1A 1GHBG 2FP7B 3RM2H 1GBMA 1GMDF 3A85A 3GCTG 1YBWA 1FY1A 2PUQH 1UTNA 1UTMA 3MH4A 4DIHH 4D7FA 3G01A 1SGTA 4X1RU 3SV7A 2FOFA 3BTKE 1LQEA 1QCPA 1ZRBA 2Y82A 4WH6A 1ELVA 4Y6DA 1V2OT 1C9PA 1TBQH 3S7HB 1O3BA 2W7SA 3ZVAA 1L1GA 2OTVA 1N6XA 2ZZUH 3T25A 4WXIA 1TLDA 3D65E 2QGRA 1EAIA 1TPAE 3SQHE 3RU4T 1TGNA 2IJOB 3RU4E 4ZHLU 2FDAA 1MTWA 3MFJA 4Y8YA 1UTKA 4U30A 3ZVGA 4H6TA 5C3NA 5HXFA 5C1YA 1O2QA 5EW2H 4Y7BA 3M7UA 1G37A 3IWMA 4CHAC 2ZHFH 2J34A 4NIWA 3NZIA 1TYNA 2WUBA 4JYUH 2ZU3A 4YTAA 4K8BA 2ZWLH 5FXLA 5JBCS 1TFXA 4MNYA 1O2LA 1HAVB 4H6SB 1LTOA 3LKWA 2NU3E 4I32A 3FVFB 4FUJA 1Z8IB 4JZIA 2FS9A 3S7KB 1D3DB 2PKSB 4X8VH 4I8GA 1ETSH 3SU2A 1H1BA 2CF8H 1ZTJA 1GG6B 2FPZA 4D76A 3LH3A 1C5UA 1KLIH 1GI3A 3DD2H 2G51A 3NWUA 1VITF 2AH4X 3BV9B 1A0JA 2ZDVH 2VINA 4MPWA 1G3CA 1BTHH 2BDIA 1AVWA 2H9HA 5DK1A 4K3JA 5T6GA 3QWCH 2XC4A 4H42U 2WV4A 4JZEH 4UFFH 9LPRA 3GY2A 6LPRA 4BOHA 3LGTA 2XWBI 4A6LA 1AE8H 1L4DA 1ZOMA 2Q1JA 1BMNH 5EQRA 1AKSB 1EOJA 3PLPA 4ISLA 4ABGA 1EAWA 1G32B 2AIQA 1GHWH 2O8MA 3BIUH 1C5NH 4D8NA 2A5AA 2FYRA 1GCTC 2QCYA 3ATWA 5EPNA 1ABJH 2KAIA 1DSUA 1WAYB 1GDNA 1OPHB 1NN6A 4JYVH 1IOEA 1DLKB 4ABDA 2XCFA 7GCHF 5K0HA 1JRSA 1LPKB 1OWHA 5AF9H 2GCHG 1L2EA 1SLUB 1AU8A 4YLUA 3SUEA 2BY8X 1P2KA 4JZDH 1O2RA 1UHBB 1P2JA 2B0FA 2ZG0H 3SO3A 3K9XB 2Y7XA 2ODYB 3ATKA 2BQWB 3M3VA 5ESBA 2ZGJA 3F9HA 3PWBA 5A8XA 4NSVA 4UEHH 3LGIA 4Y8XA 3P8NA 5DGJA 5F03A 2PW8H 2DE8A 3SUFA 1L0ZA 1C2KA 2TRMA 1IQGA 1N8OB 2G00A 3RM0H 1A3EH 1C5ZB 3GCHC 1OP8A 4AG2A 4CBNA 1BTYA 3EGKH 1QJ1B 4ZAEA 1GGDC 1CHOG 2P8OB 2I6SA 3TLOA 1OYQA 3FP7E 5HYOA 1SC8U 4B74A 4X2VA 2PLXA 5LPFA 2QV1A 1EJAA 2FOCA 3BEUA 1FY8E 1GJ6A 1DDJA 4IMZA 4U32A 3ZZ4A 1V2JT 3AW1A 1TNHA 2C8WB 4FUDA 1O5CB 2F3CE 2VB0A 3RXSA 3FZZA 1QA0A 1MD7A 1XXFA 1HRTH 1EKBB 1GGDB 1SG8B 4AG1A 5SGAE 2FOGA 3M35A 2QAAA 1P57B 4CRFA 1O37A 4MG3A 1O3PB 1NRRH 3BTTE 1TALA 1GHYH 1AVGH 2LPRA 5DP9A 1S81A 2Q6FA 1K2I1 4IC5A 3QO6A 2BLQA 2VWLA 1TNJA 3OSYA 1LHFH 2SFAA 2XC5A 1JRTA 1MKXH 1ZR0A 4X2XA 3MO6A 1LKBA 2CHAC 4MDSA 1O3OA 4O97A 2VU8E 3PMHB 1DOJA 1H4WA 1FY4A 1G30B 1GI2A 2UWPA 3T2NA 1VR1H 2NWNA 5FAHA 4A5TS 3M36A 2BQ6B 1TRYA 4YESB 3SNAA 1TABE 4ISHH 1M9UA 3GCNA 1YPGH 3P92A 1EASA 3QUMP 3ZYDA 1W0YH 5DKMA 1V2ST 1DT2A 1O3EA 1FN6A 1O3AA 3TJNA 2CN0H 2WPMS 5TCCA 2WYGA 1FZZA 1QL7A 2GVFA 5DPAA 1DWDH 3ZZAA 3CS0A 1G3BA 2YNBA 1XX9A 1ZPZA 4I31A 3ZZ6A 3NXPA 3U1JB 1GI8B 3SORA 3GY7A 3DFJA 1GJ4H 1CGJE 2FMJA 3E6PH 1C5PA 1SBWA 2O8UA 3TJUA 1G9IE 1FONA 3H5CB 1C2EA 2SGEE 1V2TT 1CA0C 4NIYA 1O3IA 1ESTA 1C4U2 1RRKA 2GX4A 7ESTE 3MMGA 3MOCA 1O3GA 2V35A 1NS3A 2H5CA 3F68H 4K1SA 1KXAA 3SJ9A 1BIOA 2ZU1A 4O03A 2VVCA 1QB9A 2SGFE 2PSXA 1KTTB 5TCAA 3LPRA 4Q7YA 4XDEA 2XRCA 3MHWU 1GMDG 2FODA 1SVPA 5EXLA 1HLTH 1K1LA 1O5BB 3MNXA 4KELA 4FUGA 1B0EA 3PLKA 4TWWA 4XSKU 1PJPA 6ESTA 3MNSA 2BX4A 2JKHA 1GJ7B 3A8AA 1P3CA 4AN7A 4RN6A 1AD8H 3MTYA 3W94A 4DG4A 3HATH 1QFKH 2ZHEH 4KP0A 1MH0A 4WMDA 3TPIZ 2JH5D 3O8CA 1GBDA 3ATIA 2I6QA 4KTUA 1F0UA 3M5LA 5DP6A 3LC5A 2HNTC 2AMQA 5JB9S 1NY22 2BVRH 5ETXA 1AE5A 1S82A 1F0RA 2R9PA 3RXIA 1S5SA 2BY5X 3MH6A 2NU4E 3LGWA 3SJOA 1BQYA 4ABJA 5JBAS 2Z9GA 3Q3YA 2PSYA 2TBSA 1MKXK 5FX5A 5GJ4B 1F2SE 4MVNA 1PQ8A 3KQDA 1EX3A 5JBBS 5F6MA 1LHEH 1VGCC 1BTUA 1QBVH 3L6PA 2G55A 1H9HE 1LHCH 2NU0E 1O3CA 1TMBH 4UE7H 1J8AA 2PUXB 2FYQA 1O2VA 5EXMA 3Q00A 3RXLA 1UVUH 2CF9H 2SNVA 4ASHA 4GCHF 3ZZ5A 5A8YA 1RGQA 4ISIH 4BTUB 1AUTC 2JETB 1UK4A 2XNIA 3KQBA 3E91A 3SU6A 3U9AH 4Z0KA 4CH2B 2O9QA 3DA9B 1C1VH 2QN5T 4IMQA 4FUBA 5LPRA 3ZVEA 1TE0A 1GBFA 3TGIE 3GYLB 1EZUC 3RXOA 3U69H 3ZZ9A 1IQKA 1O31A 1FN8A 1AGJA 5AHGH 5ESTE 1XM1A 4WH8A 4X6PA 1TMUH 3SNBA 3LONA 3CS7A 1W14U 5E0JA 2ZF0H 1S6HA 4OGXA 1MQ5A 4ZROA 1SGFA 1SLWB 3SHCH 4NZQA 5EG4A 1OP0A 2J4IA 1TB6H 3ENSB 4BXWA 3IG6B 2OC8A 1NFYA 1D9IA 3ESTA 1KXEA 2J9NA 5A0AE 1JXPA 1EQ9A 4Y71A 3E0PB 4DOQA 3AASA 4NA7A 2VVVA 2GZ9A 1TONA 3MNCA 1QBOA 2A4QA 1QQUA 2OLGA 1VCPA 1FUJA 3K65B 3SZNA 1GVZA 1K1JA 1G3DA 1HAOH 5EQQA 1NESE 7KMEH 1GBTA 1GJDB 1SGDE 1ZRKA 2ZFPH 1AZZA 1DLEA 1ZSJA 3BG4B 2VWNA 1PFXC 3PO1C 4IW4E 1EOLA 3VB5A 2PV9B 4A92A 1IQNA 4ISNA 3RXFA 3UR6A 3ZZ8A 1IQJA 4IGDA 2BMGB 3SGQE 1T32A 4QT8C 3EAJA 1A61H 1C1UH 1SOTA 2FO9A 4OS4A 3FFGA 1ELAA 1Y5UT 2VWOA 4VGCB 1TRMA 2A5IA 1T31A 1ELGA 3DUXH 2XW9A 2ZCHP 1LVOA 4FUIA 1JIRA 1IQMA 4AGKA 4FU7A 4NG9H 1DITH 5EODA 4YO9A 2HWLB 1XMNB 3BG4C 1RTLA 4X6MA 3UTUH 2Z3EA 1O39A 3ODDA 1OWEA 2V0BA 1S0RA 3C27B 1GBIA 2HNTF 4NFFA 4TWYA 2QXGA 4JYTA 5AVDA 1AWHB 1Y59T 2BVXH 2H9TH 4CREA 1DY8A 5FPTA 2B9LA 3SJKA 2BDYA 4A1XA 1KXCA 2Z9JA 1BRBE 1GL1A 2ZHWH 3E1XB 2OC0A 1O3LA 4CRDA 2A2QH 2WYJA 1BRCE 1C2IA 1LVMA 5GCHF 1THPB 4JZ1A 1NZQH 1O2JA 3VGCB 1NROH 2P95A 1KXBA 1TA6A 2BZ6H 2AEIH 1V2NT 2ODQA 1O36A 1V2PT 1C4Y2 2GCTB 1THRH 1ORFA 5AFZH 3ITIA 1OWDA 1QJ7B 1S85A 1ZJDA 5GIBA 1UVOA 2A7JA 3SU1A 3SGBE 1VCWA 1QRZA 1KY9A 3GICB 4O3TA 3TITA 1O3NA 1DS2E 3ZYEA 2G4TA 5JDUB 1GJ8B 1B5GH 2BD3A 4NWKA 1XUJA 2ANMH 1EPTA 1NRPH 3LT3A 2FTMA 3TJOA 1Y5AT 5DG6A 3VFEA 1SPJA 1HYLA 1VJ9U 1GCTB 1CSOE 3SJ8A 2OBQA 2WUCA 2GD4B 4AGJA 5H4IB 5FCRA 1EJMA 1EZXC 1VJAU 3SV6A 4AFSA 1C2FA 1OWKA 3MH7A 1OKXA 1MKWK 1FI8A 3D23A 1CGIE 4MNXA 1YP9A 3KGPA 3OY5U 1P0SH 3KNXA 3ZZBA 3A7TA 1TOMH 1EAXA 3GY6A 1V2RT 1DXWA 2Z7FE 4UD9H 2BY9X 1TNIA 4IBLH 1T8NA 1XKBC 1MTSA 3T28A 1J16A 2ZFRH 4DVAU 1KDQB 3T27A 4ZHAA 1WYKA 1TQ0B 8KME2 1DICA 4AFQA 1CT0E 2AIPA 1RD3B 4AORA 1YM0A 4Y76A 3EE0B 1ZSLA 2ZGBH 2PKAB 1UCYK 1GVKB 2BX3A 2QA9E 1G3EA 2WV5A 4Y8ZA 3BN9A 4AZ2B 4FXGH 3MYWA 2JH0D 3A84A 3GCHB 4R8TB 6CHAB 5A09A 1RIWC 5HM9A 1THSH 2F9PA 4HFPB 1NM6A 1O3HA 1G2LA 3B23B 3AAUA 1KTSB 5CHAB 3ZZ3A 4ZKNU 1ZGIA 2W26A 3PV4A 2Z9LA