3I78A

35/99/170/186/220-loops of fxa in sgt
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
229
structure length
229
Chain Sequence
VVGGTRAAQGEFPFMVRLINEENEGFCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSSSSFILVANEMICAGYDTKQEDTCQGDSGGPMFRKDNADEWVQVGIVSWGEGCARKGKYGVYTEVSTFASAIASAARTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combinatorial Enzyme Design Probes Allostery and Cooperativity in the Trypsin Fold.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase
molecule keywords Trypsin
total genus 56
structure length 229
sequence length 229
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i78A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i78A02
1CBWC 4YZUA 2H9TH 3ATKA 2BQ7B 1V2VT 3MNCA 3A8DA 1GBIA 1QBOA 4A7IB 4JZDH 2PW8H 2OC1A 4ABFA 1TABE 3GY4A 1O3OA 5LH8A 9LPRA 4I31A 4DIIH 2G51A 1DE7H 2OQUA 5FPSA 3P70B 4NGAH 4ABIA 3BTQE 3LJJA 4ZKNU 1XVMA 4NFFA 4Y79A 4B71A 5K7RA 1XUFA 1WQSA 1QB6A 4NSVA 2RDLA 2ZHQH 1DLKB 3LONA 3RC6A 1NRNH 1P12E 4WXIA 1FLEE 2PTCE 3U1JB 4ISOA 2BD3A 1TGNA 2FYQA 1YF4A 2PGQB 4MTBA 5I25A 1UTNA 1H9LB 1K9OE 4TY7A 1ETSH 1P06A 3VFEA 1RTLA 1AUTC 1GJ7B 3ZVFA 2OC0A 1RFNA 1GI8B 2F9OA 3F68H 1C2FA 1P57B 1XUHA 5LPRA 1Y5UT 1BTPA 1EATA 1C4Y2 2AFQB 1XUJA 2V3OH 2A2QH 2F91A 1OWIA 1C2GA 1TAWA 2ZDAH 5F6MA 1TIOA 1XM1A 4K5ZA 2GZ7A 3LC5A 2Y5FA 4I7YH 4B1TA 3T26A 1TNLA 1SFIA 2ZCLP 1FQ3A 5EGMA 1PQ8A 8GCHF 3VB4A 4INHA 1MTNC 2PWXA 3STIA 1D6WA 1Y59T 2GCHF 1W7XH 3RXGA 1MKXH 3RU4E 5DP6A 1S84A 3A89A 4Z0KA 1HRTH 2GDEH 2OLGA 2J95A 3BV9B 1IHTH 1HPGA 1ZGIA 4AB8A 3ZZBA 2NU3E 3SU3A 1A3BH 1OS8A 2A5AA 2P3TB 2ZFSA 3DA9B 2NWNA 1T4VH 1O35A 1NTPA 2Z7FE 1AKSA 5HYOA 4YOJA 1TA6A 1K21H 2P8OB 4HTCH 1U6QA 2AERH 5EQQA 3ENSB 5A8ZA 3V3MA 3ZZ3A 4RN6A 2BXTH 1ZJKA 5C1YA 4GVUA 1RS0A 1DANH 2HPQH 1BTYA 2ZP0H 4Y0ZE 1QBVH 2XWBI 3VXFH 1ZMLA 2OC7A 1YPKH 3ESTA 2Z3DA 3TJOA 1ZMJA 2QY0B 5C1XA 2OD3B 4JZ1A 1WBGB 1DUAA 1JMOH 2ZCKP 4X8TH 2BDCA 3Q77A 1A1RA 2FI4E 2GV7A 2PLXA 1SQTA 3T28A 1FY5A 2ANWA 3BTEE 5L2ZH 2OQ5A 3BEUA 1QRZA 2AGEX 1ZTJA 1EPTC 3GICB 2SGQE 3RDZA 1L1NA 1SR5C 2STBE 3SV8A 1BJVA 7ESTE 1TNJA 2ZHWH 1ACBE 3MWIU 3QGJA 1HGTH 1QL9A 2HWLB 5E2PA 3FANA 3K9XB 4WXVA 1FY3A 2RA0A 3L3TA 1GBHA 1LCYA 4AN7A 4XSKU 4XBCA 1C1PA 3BTFE 1UJ1A 1HAYB 3U8RH 1C1UH 2Q6DA 1MKXK 1AVGH 3BTDE 1T4UH 3P8OA 1MKWH 1PFXC 1TA2A 1KXFA 4YT6H 3QN7A 3KQBA 2J34A 4Q2KA 1O2TA 4JMYA 1O3HA 5BRRE 1K1PA 4E7NA 4D76A 1Y3WA 1O3KA 2THFB 4Q80A 1WQVH 1A2CH 5DO4H 2ZCHP 4CREA 3NWUA 4U2WA 3VB7A 2XBYA 1LVMA 2AH4X 3LGWA 3TH4H 5FHTA 1BBRE 1AFQC 1WV7H 4AGKA 1O2XA 3UR6A 1SLVB 1C5XB 1GI5A 2GZ8A 4YO9A 2QC2A 2FODA 5JYIA 4IC6A 2ZHEH 1D3DB 1XKBC 3SNCA 1O2GH 2BDGA 3ITIA 3NPSA 3PLBA 5C67A 3M3TA 5IDKA 1J14A 1SGPE 2VIVA 2ZU3A 2Z6BD 1O2SA 1OPHB 4UE7H 1C2EA 1O33A 2A0QB 1EP6A 3PLKA 3GDSA 3MH7A 4XOJA 4GHTA 1W2KH 1ZR0A 3GCOA 3T29A 1FV9A 2FS8A 1T32A 1LHEH 2UWOA 4ISIH 5EU8A 1GHBG 4TYDA 3KHVA 1BT7A 4ZMAH 3Q76A 1O5CB 1IQJA 1MBQA 2AIPA 1QGFA 2D1JA 4ABHA 1KTTB 1ELCA 1HAIH 1SGDE 2YOLA 3AASA 5DP9A 3GISB 4X2XA 1O32A 4E06H 2VB0A 3ZVBA 1OYTH 1S83A 4GUXA 2P94A 1Y3YA 4X6NA 5EW2H 1QA7A 4HGCA 5GCHF 1QJ7B 3UOUA 3GY2A 4I32A 1WTHD 4WH6A 3A7TA 5ESTE 5J4SA 1P9SA 2G55A 1IQLA 2PKAA 3TVJB 2TBSA 5E0GA 3D23A 1QIXB 1WTGH 2GX4A 3SV2H 4ABGA 5A09A 5TCCA 2BTCE 3TK6A 1N1LA 1UTLM 2XC0A 2BD8A 1EUFA 5A8YA 4IGDA 4GHQA 5PTPA 2ANMH 4Y71A 4UFDH 4ZAEA 5FX5A 4IMQA 4B73A 5L30H 4MNWA 4CBNA 4SGAE 1UO6A 1QB1A 4INLA 2G8TA 3M35A 3MO9A 4X1PU 1OP8A 5LPEA 3HATH 3H7TA 1ZYOA 4VGCB 1TWXB 1DLEA 3RXIA 5C3NA 2GCTB 1A0HB 1O0DH 5AFZH 1ZJDA 3SNEA 2G4UA 3SNBA 3CS0A 4YESB 2A5KA 4GAWA 3HK3B 7GCHF 3WY8A 3BEIB 1AB9B 3Q3XA 2ZGCA 1C1NA 1JRTA 2VWLA 3HPTB 2WPMS 3U69H 2ZTYA 2AMQA 3A82A 5JBBS 1O2KA 1YPEH 4I8LA 1EXFA 3SNDA 2GDDA 3BG8A 1N8OC 5FCKA 1K1JA 3UOPA 3QO6A 1TOMH 1VGCB 2XRCA 1P10A 1UTJA 4BAOB 3T62A 2UUKB 3RLWH 2BB4A 3F9FA 4TWWA 1T8MA 1QL7A 4YOIA 2ZZUH 1SPJA 2VH6A 1MTSA 4F49A 1NESE 1TPAE 2VH0A 1YPMH 3SU0A 1KXDA 1BJUA 1E0FD 3T27A 1O2WA 1O2OA 3O8CA 2ZC9H 4MVNA 5EQRA 1AN1E 3ZZ9A 2J4IA 1YBWA 1HAGE 2P3UB 3MU0A 3LT3A 3EYDA 3E90B 5DJ7A 1QR3E 4JCNA 3RMMH 3DUXH 1GJAB 1UMAH 4O3TA 2QXIA 5GXPA 4WVPE 1SGNE 2AGGX 8KME2 1UTMA 1NS3A 1C5TA 1EZSC 2ZI2H 1H9IE 3V0XA 3UY9A 2C8WB 3MOCA 4WMFA 1SG8B 3LOXA 3RMNH 1K1NA 4CR5A 3SJOA 1LMWB 5C5OA 2TIOA 4FU9A 1DFPA 1GBCA 2HVXA 2PR3A 2IPHA 2A7JA 4BAQB 2J92A 1NFXA 1TBZH 4MPVA 1SC8U 2B0FA 1SGIB 3SQHE 3A85A 1ZOMA 2VVCA 2G5VA 1MH0A 3TITA 1AHTH 1DSTA 1O2QA 1ELDE 1NRRH 1V2WT 4NIXA 4NZQA 3M7UA 1AQ7A 2R3UA 1HAOH 2FX6A 2VWMA 4ABEA 1L4ZA 2Z9GA 3OY5U 1FXYA 1Z8RA 2A5IA 3SU6A 1O3MA 2DE9A 3BTHE 3QX5H 4ZHLU 4DY7B 4E05H 5A2MH 1C2MA 2G81E 4UFFH 3PV4A 4FU8A 1EASA 1ZGVA 2GTBA 4K3JA 3QTOH 1DDJA 1OP2A 3URCA 1P2JA 4JK6A 1THPB 1P01A 1JRSA 1JOUB 2H2ZA 4DURA 2TGPZ 1GGDB 5L2YH 4CR9A 1Y3VA 2F9PA 1GBAA 1YPLH 4NA8A 2FYRA 1C5QA 3ZYDA 3QWCH 1UCYH 1W12U 3U8TH 5TJXA 1HUTH 4I33A 2UWLA 1BRUP 4MQAA 4B74A 2AGIX 5HGGA 3PO1C 3GOVB 1V2ST 4Y8YA 1SFQB 4LZ4B 1UCYE 4ZXXH 1C5OH 4ZKRU 1T8NA 1AMHA 1ANCA 3UNSA 1C5LH 3STJA 1QCPA 2FS9A 2NU1E 4XE4A 4KGAA 1O3PB 1LHCH 3QTVH 4RKOB 4I8JA 1N6YA 1DWBH 4AGJA 1O2RA 3P95A 1CGIE 1YPHC 5FBEA 1UCYK 5EXNA 2OBOA 1Q2WA 2BD2A 4FXGH 3RU4T 5F8XA 1AU8A 5GCHG 1DUEA 1ESAA 4ZXYH 1W7GH 3RXTA 1TYNA 5G4BA 1KXAA 2UUYA 4ABAA 3EGKH 7GCHG 5JBCS 1AUJA 2P59A 2H5DA 1IHSH 2C8XB 1A0LA 2NU2E 2F83A 2R2MB 1MD7A 1F2SE 3ATLA 3GDUA 1WOFA 1KXCA 1VITG 1RD3B 3TH2H 1HJ9A 3DT0H 3M61U 1GBLA 4UEHH 2ZU4A 3ZVGA 3T2NA 3RM2H 1NFYA 1O5FH 5E2OA 2PUXB 1Y5AT 3QZQA 4NWLA 2A45B 2XCNA 4OS1A 2Y5GA 4ABBA 2FOMB 1FIWA 1TBRH 1GHAF 4YOGA 5EW1H 1PQAA 2ZDKA 1CHOG 3PMAB 2J2UA 1BMLA 4NA7A 1CA0B 3SGQE 1CU1A 3SJ9A 1G30B 3I78A 1GDNA 2SFAA 1W13U 1KLTA 3RC5A 3MH4A 2VGCB 2BLOA 4CH8B 7LPRA 3SJKA 2WPIS 1AZ8A 5K0HA 2Y5HA 4ZUHA 3EQ0H 1HAHH 1P2KA 2ESTE 1IQFA 1ARCA 2VIDA 1UVOA 2UUFB 5DGJA 3SJ8A 1SL3A 1O2LA 3SHAH 1TX7A 2ZFRH 1AE8H 2EC9H 1FN6A 3LGUA 3MH6A 1UHBA 1A0JA 1L0ZA 1KDQB 2XCFA 2P16A 3OTJE 4WH8A 3BTTE 2GMTC 1D6RA 4XFQA 1MTNB 4TWYA 1BMNH 3OX7U 1MU6B 3TLOA 3GCTG 1K22H 3PO1B 4YLUA 1LQDB 5JPMH 1K1LA 1K2I1 3PM3A 1O3FA 1F0RA 4Y8ZA 4F4OC 2BZ6H 3UNQA 1CE5A 1FN8A 1LPKB 3M5OA 3MNXA 4OS2A 5ETXA 4X2WA 2QXHA 1G3EA 3TPIZ 1TMUH 1BMAA 5F03A 1C2IA 1MCTA 5IYTA 3LGVA 1QA0A 3ZV8A 4AFZA 3TIUA 4K8BA 2B9LA 1GMHF 3P8GA 1HAZB 2HALA 1XUKA 3SBKA 1VGCC 2VIOA 3M3SA 1D3QB 5A0AE 1KDQA 2PGBB 3SU1A 2SGDE 1GI2A 3M7QA 3SZNA 1GHWH 1O5GH 1GBFA 2AMPA 4CRDA 2BY5X 4JYVH 1FIZA 3OSYA 1V2OT 3ZVEA 1QL8A 1KXBA 1CSOE 1C1MA 1V2UT 1CBWB 5DP5A 2G4TA 4E7RG 1EAXA 2AMDA 1EP5A 3RXJA 3KQEA 2BM2A 2PFEA 2O8TA 1GMDF 1SMFE 1TNKA 2O8LA 2Z3EA 5DP4A 3VPKA 2HLCA 3S9CA 3UR9A 3L6PA 1RIWC 1CVWH 1XMNB 3SU4A 1Z6JH 2EEKA 3TJVA 3BTKE 4UDWH 2AEIH 3MMGA 4FUGA 4AB9A 1O5AB 1VJAU 3FFGA 1IQGA 4B2CA 1JIRA 1H4WA 4R0IA 5JB9S 2A4GA 1Z8JB 1KYNA 1C1SA 3A7VA 6GCHG 1JIMA 4MNYA 2H9EH 1V2QT 3BSQA 1UHBB 1VJ9U 1Z8IB 3KN2A 3SV9A 2ZPRA 3BIVH 3BG4B 2F9UA 3KIDU 3N7OA 1RJXB 3PTBA 1S5SA 3C27B 2F3CE 4H6TA 1ZRKA 4LXBH 1W14U 4IW4E 2Z9IA 3VXEH 4O03A 2ALVA 1MU8B 1V2JT 1HBTH 1C5UA 2R0KA 3LH1A 1O5EH 4IN1A 4J2YB 4H42U 1ZHMA 2WV5A 3A7XA 1ZPBA 4NIWA 2KAIB 1G3DA 1GHAG 2RCEA 3AVZA 1ARBA 3QK1A 4ZROA 3RXVA 2SGEE 3FP7E 1TBQH 1QJ6B 1AY6H 1O37A 1ELBA 2QXGA 1AFQB 1SGTA 1O3NA 1V2LT 4WY3A 1TPOA 1YYY1 2WYGA 3LPRA 2J9NA 2ZGJA 1O31A 2BLWA 5AF9H 2GCTC 1P03A 2WUCA 2GKVE 1ID5H 3RXFA 3TK5A 4H6SB 1C9TA 1BMMH 3Q3YA 1Y3XA 1ZPZA 1GI0A 1PQ5A 1VCWA 3LH3A 5AHGH 2TGAA 3MU1A 1GJ5H 2I6SA 1QBNA 2XC5A 3M7TA 5E0HA 3G01A 2Y81A 1CGJE 5L6NH 1YLCA 3ELAH 4X6OA 4AOQA 4MNVA 3URDA 3UREA 1DS2E 1AZZA 3ATIA 1KSNA 1AWFH 2P8OC 1BTUA 1XVOA 2CV3A 2QA9E 1TRMA 2H1UA 3ZYEA 5J4QA 1ELGA 1J8AA 1ANDA 1GBDA 1NRPH 4FUEA 1CQQA 2FLRH 5DKMA 1C1WH 2ZF0H 3P17H 2A7CA 1FONA 2OXSA 2ODQA 1NPMA 1W0ZU 1PPEE 1SLXB 1DPOA 1TOCB 1GI4A 1UTOA 3ZZ8A 4BAHB 1OOKB 1NZQH 4Y0YE 3SNAA 1EOJA 3BEFB 4THNH 2FOEA 2VVUA 3KF2A 1IAUA 2ZDNA 1T8LA 3LJOA 4HZHA 2JH6D 1EAIA 6ESTA 4CRFA 1C1RA 4X1RU 2BXUH 1TQ0B 2VVVA 1XXDA 1OSSA 3SN8A 4X6MA 1K1MA 3IG6B 2TGDA 1RIWB 3ZZ6A 2VWOA 1P9UA 1MTVA 1A7SA 1DVAH 2BDHA 2FM2A 2J94A 2YNBA 2H6MA 2PSYA 2G5NA 3FZDA 3LGTA 3GY7A 1KXEA 2I6QA 1GCTC 2Q6GA 1RGQA 2QV1A 3GYLB 1MKWK 2O9QA 6CHAB 1NFUA 1BQYA 1S0RA 1YC0A 3W94A 1IOEA 1NY22 5CHAB 4D7FA 2HNTF 4KKDA 1XUIA 1Z71A 4OGXA 3M5LA 1MTWA 4VGCC 1IQNA 3E8LA 2AIQA 1OWJA 3MNSA 1TALA 1V2PT 2CJIA 1ZHRA 2BD4A 2OBQA 1D3PB 2W3IA 2SNVA 3I29A 3O8BA 2B7DH 3AW0A 2XC4A 2ZQ2A 3AW1A 1ANEA 2GD4B 1MZDA 1C1VH 3RXBA 6LPRA 3H5CB 3NKKA 4FVBA 2BLQA 1SGFG 1AIXH 2V35A 3FP6E 3TJNA 3A7ZA 2FX4A 2J38A 1D9IA 4KELA 1OWEA 2JETC 4XBDA 2FIRH 2H9HA 2ZHDA 5FPYA 3ZZ7A 2PKSC 1GI6A 2BVSH 5T6DA 3M36A 2BLVA 4CRGA 3LC3A 2R3YA 1O2VA 2ODPA 1SQOA 1TNHA 1EJNA 1ABIH 5DG6A 1OXGA 1O5DH 3MHWU 2C90B 2KAIA 3RM0H 4AFUA 4H4FA 4A6LA 3RXKA 2RA3A 4YTAA 1YGCH 1Z8GA 5GPIB 2BDIA 2NU0E 4DVAU 2BY9X 1J9CH 1GBEA 1F0UA 2FMJA 2FP7B 2ZPSA 2FOHA 1UVUH 1TPPA 1ELAA 1NROH 3A87A 4CHAC 1H1BA 1WU1A 3VGCC 9ESTA 1GL1A 3MH5A 5GJ4B 3UIRA 1AO5A 2WINI 2O8MA 4A92A 1O3EA 3M5NA 1GHVH 3L33A 1FPHH 1P2IA 1L2EA 1H8DH 1MUEB 1SOTA 2ILNA 4NZLA 5EPYA 1YP9A 2OCVB 3GY5A 2R2WU 1HCGA 1ETTH 2Z94A 1AVWA 1NC6A 3KQDA 2FTLE 4KTUA 2ZFPH 4O3UA 2DUCA 1GJBB 2VU8E 2WPHS 1TX8A 1MBMA 3MNBA 1F5RA 2QF3A 3KQCA 3R0FA 1CO7E 3GCTF 2WUBA 2XWAA 4IBLH 1DXWA 5JB8S 4IN2A 5A0CA 3MYWA 3S7KB 2IN2A 1P02A 3S7HB 1C4V2 2PV9B 3ODFA 1K28D 3S69A 3RXPA 4TY6A 1A5HA 2HNTC 1CT0E 1EJAA 1UVSH 4WF8A 4NWKA 3A7YA 2VIWA 7KMEH 1JBUH 1C5RA 1FY8E 3LIWA 5EODA 1VITH 1A4WH 4AYYB 1BTHH 1GVZA 1DWDH 3SOSA 3E0PB 3S9BA 5I46H 1GI9B 1W10U 1V6DA 4ABJA 1HXEH 1SGYE 1TFXA 2CF8H 4MPUA 4FUFA 1BITA 3TGKE 1GHYH 2O8WA 3NZIA 1GHXH 4NFEA 5DP7A 3TGJE 4A1TA 3HGNA 1INCA 1GCTB 1THSH 4K69A 3A83A 1SB1H 1B0FA 3E1XB 1SGCA 4QT8C 3ZZDA 3CP7A 3RP2A 1O3CA 4BTIB 4LOYH 4AZ2B 2BX3A 1PYTC 2QYIA 4AFQA 1ZSJA 1FY4A 2ASUB 2VNTA 1EB1H 2C93B 1NU9A 1Z7KA 4WMDA 1MZAA 2HOBA 1LTOA 1KLJH 2GZ9A 4O9VA 2GP9B 5E0JA 1XUGA 4JZEH 4KTSA 1QTFA 2HNTE 4UFGH 1C5SA 4AX9H 2Y6TA 3KEEA 2ZEBA 1XKAC 3F6UH 1G2LA 4FVDA 5FAHA 3V7TA 5GWZA 3SU5A 2PTNA 1UTPA 1GMCG 2B5TB 4XBBA 1ELFA 4BNRA 2JETB 4IS5A 2XTTB 2ZTXA 4MDSA 1QNJA 4CRAA 3F1SB 1P3CA 2ZTZA 1CT4E 3MI4A 3MU4A 1EAUA 3U1IB 1SOZA 1EQ9A 4Y11E 5A8XA 1GI3A 3U8OH 1QFKH 2BDYA 4X0WU 1MQ6A 1P2MA 1G2MA 1GJ9B 3GCHB 1CHGA 2W5EA 5T3HA 1GWAA 2C8YB 5A0BA 1TNGA 1WYKA 2ZDLA 3RMLH 1P2OA 3TH3H 2OTVA 1LHGH 2ZFQH 4NA9H 1GPZA 3QZRA 1GI7B 3RXDA 4A5TS 1FPCH 4CHAB 1G36A 1BZXE 1WUNH 1TLDA 4X8SH 3R3GB 2Z9LA 2WPLS 2B8OH 2FOGA 4B2AA 3ZVDA 2A32A 2FZZA 3IITA 5E8EH 2OUAA 5T6FA 3RXMA 1UVPA 1C5ZB 1HNEE 1DXPA 4K1EA 1UK4A 1C5WB 1V2KT 1L4DA 1K1OA 1LVBA 2TPIZ 4JYUH 5FPTA 2FOFA 4BAKB 1SGQE 2QXJA 1M9UA 1PPFE 2GT7A 4GLYA 4LK4A 2BOHB 4DIHH 5BPEA 1W8BH 4BANB 3F9HA 2ZQ1A 4X2VA 1S0QA 4ZHMU 1Q31A 5T6GA 1QJ1B 3V13A 4BTUB 4TPYA 3GYMA 1GBKA 1ORFA 3KNXA 4YM9A 5C1UA 2ANKH 2LNCA 1MTUA 4X2YA 1YM0A 2EA3A 2Q1JA 4I8HA 2BQ6B 2ZU1A 4K60A 4ISHH 1TB6H 5HM9A 3SUDA 2Z9KA 2VIQA 4WJG2 1SQAA 1ZLRA 4MG3A 1SGRE 1PPHE 1VZQH 1QRXA 1BUIA 3DD2H 3LGYA 3V12A 1E37B 1O34A 2BOKA 2CHAC 1LHFH 3M3VA 2XNIA 1V2TT 5B6OA 2STAE 3OU0A 2GV6A 3RXAA 5EG4A 1EPTB 3O8RA 3GCHC 1F0SA 3RXRA 1ESBA 1DX5M 1O2NA 1GGDC 2YNAA 2ZU2A 3A84A 2XXLA 2GGVB 1K1IA 4RSPA 1QY6A 3DFJA 1C5YB 2A7HA 1ZRBA 8GCHG 4NIVA 3HKJB 1CGHA 2JH0D 3JZ1B 4A1XA 1GHZA 3SV6A 4X8UH 2QGRA 4Q7ZA 2VJ1A 2WV4A 3SI4H 4DOQA 1MAYA 1LKBA 2ZGHA 1IQIA 3HK6B 1SSXA 2CF9H 1GDUA 4JZFH 4NIYA 1QQ4A 5AFYH 1A5IA 1P3EA 2Y7ZA 5AVDA 2NU4E 1WSSH 3GDVA 1G3CA 1NT1A 4A1VA 2A4OA 1OYQA 3P8FA 1DICA 3B8JA 2FO9A 1FAKH 1UVTH 1O2HA 3ZZ4A 4IC5A 4HI3A 1E34B 1O2YA 1MD8A 1T31A 3D62A 1CHOF 2BYAX 1D3TB 1B0EA 1L1GA 1IQHA 1O3GA 5GDSH 1O5BB 1HYLA 2IOTA 4Y7AA 2OC8A 1BHXB 5HM2A 1NO9H 2A4RA 3UWIA 2FI5E 3SI3H 3SJIA 1YPHE 2D8WA 2XYAA 4KP0A 4K8YA 2ZA5A 1JXPA 1SLWB 3UPEA 1EZXC 1GMHG 1G32B 1O2PA 1C5MD 1GJ6A 1TX6A 5EQSA 3A8BA 1FZZA 1O2ZA 4ABDA 2W7UA 1BA8B 1HLTH 1Z6EA 3SUFA 2A31A 3AAVA 1TGBA 3Q00A 3CS7A 5CE1A 4KTCA 4OS6A 1ESTA 1EX3A 2HGTH 4K1SA 2D26C 2UWPA 3PROA 4BXSA 4J1YA 1VCPA 3K2UA 1FDPA 1V2MT 1EPTA 5F8TA 5LGOA 2Z3CA 1BHXF 2ZGBH 4DGJA 3VEQB 1G37A 1CA8B 1CT2E 2SNWA 2ZU5A 1SVPA 1UK3A 2CHAB 4FUDA 1HDTH 1PJPA 1P2NA 2GCHG 3UQOA 1GCDA 1HAXB 2QF0A 3SO3A 1DT2A 1TRNA 4INKA 2BMGB 1TMBH 2R9PA 1PPZA 5TCAA 1YLDA 4ASHA 3PYHA 1KLIH 3VB6A 1T8OA 4MLFB 1OKXA 1SGFA 1RXPA 1SHHB 5HXFA 1TGCA 4ZKSU 1Y3UA 1WCZA 1AFEH 2C4FH 2FXRA 3TJUA 3GY8A 2FLBH 2BD5A 2K1QA 2Z9JA 4B2BA 1C1QA 1E35B 1P8VC 1G9IE 2A4QA 2W26A 3SU2A 6GCHF 3LGIA 4FU7A 1S6HA 4CRCA 1FUJA 4NSYA 2ZG0H 3E3TA 4U01A 1O3AA 1B7XB 5FCRA 3VGCB 2FESH 3MFJA 1GJ8B 1YCPH 1O3BA 1Q3XA 2ZGXH 1LQEA 2BZAA 3TU7H 1VCQA 3MU8A 5C20A 3TNSA 1HV7A 4Y10E 2HPPH 4X1QU 1PYTD 1BCUH 4SGBE 4D9RA 2VINA 3QGNB 2BQWB 4FUHA 3LU9B 2TRMA 1B5GH 3EA7A 1ELEE 1BTXA 1LVYA 1GG6C 3GY3A 1GMDG 5CHAC 2UUJB 3RXCA 1GHBF 1IQMA 3BTGE 3NCLA 1OP0A 4FUJA 3PMHB 3PTNA 3S0NA 1YPJH 1C2LA 2G00A 2M5TA 3I77A 4WMEA 3SHCH 2TGTA 4NG9H 2LPRA 3TGIE 2W3KA 2XBXA 3FAOA 2ANYA 1TQ7B 1LO6A 4AG2A 2EI7A 3UQVA 1PQ7A 1C5VA 1HAVA 3EAJA 2ZFFH 5C2ZA 1CA0C 2CGAA 4I8GA 3B23B 1HJ8A 3NUMA 3ODDA 4X8VH 1FY1A 3RXUA 1O3DA 2BVXH 1UK2A 3D49H 1H9HE 1HAPH 1DY9A 2FDAA 2JKHA 2ZDMA 3KCGH 1ZMNA 2BDAA 3P6ZB 1X7AC 4OGYA 4BXWA 1L1JA 1F5KU 1V2RT 1JWTA 3SQEE 1J17T 4BTTB 5GIBA 4ISNA 4AYVB 3P92A 2D2DA 2A2XH 4LZ1H 3PMJA 1ZSKA 3Q3KA 1Y8TA 3VB5A 2F9NA 3BTME 1OWHA 1DY8A 1W11U 1FAXA 2FTMA 3JZ2B 1AWHB 2AYWA 2DE8A 3QDZB 1P04A 1O2UA 2G52A 1PPBH 2SGFE 2QIQA 1F7ZA 3GCNA 1KY9A 1GL0E 1W0YH 3C1KA 3K65B 1P09A 1AVXA 2EI8A 2GMTB 2C8ZB 2SGAA 4B76A 1HAVB 1TGTA 1SLUB 4UONA 4AG1A 2H5CA 2VIPA 8ESTE 1KIGH 1YCPK 1ZPCA 2V6NA 3D65E 3K6ZA 5FXLA 4Z6AH 5CMXH 2ZECA 1LVOA 2AS9A 2WPJS 5FBIA 4FUIA 2QCYA 5H4IB 2BHGA 1MAXA 3PB1E 3RXSA 1S6FA 3A81A 5DP8A 4FUCA 1NRQH 3W95A 3UTUH 3A8AA 3RMOH 2FEQH 3RXLA 2F9VA 5DPAA 1Y5BT 1O2IA 1AD8H 1C9PA 4JK5A 3HKIB 3BTWE 2ZWLH 3P8NA 1DITH 3UUZA 4Q7YA 5F8ZA 1XX9A 2BX4A 3TNTA 4JZIA 4Q7XA 3ZZCA 5LPFA 1DWEH 1N6XA 2BY8X 5SGAE 3FP8E 4B75A 2FWWA 3DFLA 3RLYH 2CN0H 2PKSB 4GCHG 1E36B 1ETRH 1N8OB 3E91A 1ZHPA 1DOJA 2FI3E 3FVFB 1EB2A 2ZFTA 5JBAS 1AGJA 1ABJH 4ISLA 1BDAA 1IQEA 1A3EH 1TONA 2P93A 3QUMP 2XBWA 3MU5A 2WYJA 1RTKA 1TRYA 1AB9C 1P2QA 1NN6A 1C1TA 1GI1A 4NCYA 1J15A 3MTYA 2W7SA 1BBRH 3O8DA 3T25A 3UNRA 2ZDVH 1SHYA 2V0BA 2WPKS 1GBMA 4GSOA 2P95A 3ZZAA 1ELTA 1NU7B 2EI6A 1C2DA 1BRBE 1BOQA 1GVLA 3ZVCA 1TNIA 2VWNA 1F5LA 1GVKB 4FUBA 4OS4A 2ZO3H 1NRSH 3SUEA 1HIAA 4X1SU 3H7OA 1HJAB 3LDXH 2F9BH 1AKSB 1HB0B 1TGSZ 5EPNA 2PUQH 1E38B 1D4PB 1ZZZA 3BG4C 4D9QA 2BD9A 2JH5D 5ABWA 3KL6A 1GG6B 1BBRK 2FOCA 1O30A 1F0TA 4CRBA 4IMZA 1ELVA 1BRCE 1S85A 4ZHAA 1LHDH 1GJCB 3NXPA 1UTQA 3AAUA 1C2JA 1O39A 1O3LA 4X1NU 3RXEA 3RUOA 2Y80A 5EXLA 3A86A 3ATWA 2FOBA 4UFEH 1G3BA 3IWMA 2Y82A 3LKWA 5EXMA 3RXOA 4AORA 1UTKA 1ZTLA 2GT8A 4CH2B 3RC4A 2GVFA 2P3FH 4MNXA 1TMTH 3U98H 3F9GA 3DHKH 4X6PA 4UD9H 1O3JA 3UFAA 4Y6DA 1MMJN 1IQKA 1O2JA 4DJZB 4K1TA 1EAWA 1VITF 3M37A 4OS7A 1A61H 1EZQA 1SGEE 3CENA 5EOKA 1BB0B 3EA8A 3A88A 3SGAE 4DW2U 5JDUB 2ODYB 2ALPA 1QURH 1PPGE 3E6PH 1PPCE 1KTSB 3SORA 5DK1A 1P05A 2ZHFH 1BTWA 3MO6A 3F9EA 1OWKA 4MPXA 3S9AA 3UWJH 1LDTT 4Y8XA 1J16A 1QHRB 1HFDA 1HJAC 1EJMA 3ATMA 1MCVA 1FJSA 1LKAA 2QAAA 3QLPH 5FX6A 3PMBB 3RXHA 3E0NB 1QRWA 4R8TB 2ULLA 1GBJA 1ZTKA 1THRH 1HXFH 1P11E 3T5FH 4RKJB 4AFSA 1DWCH 4JYTA 5HMAA 1QQUA 1OX1A 4ZKOU 1LPGB 4YLQH 1SBWA 1AE5A 2ZIQH 3FZZA 3OYPA 1XXFA 4TPIZ 3PWCA 4CBOA 5C5NA 1HIAB 3VB3A 3K6YA 2BY6X 2OINA 2A1DB 1C5NH 4GCHF 1ZSLA 1GMCF 3SGBE 3HGPA 1S81A 2VGCC 1FI8A 4I8KA 4U30A 1V2NT 2R0LA 2XBVA 2ZKSA 6CHAC 1EKBB 3B9FH 1S82A 1T7CA 2BVRH 1C2KA 8LPRA 2IJOB 2SGPE 3TK9A 4WWYA 3EE0B 1GJDB 1BIOA 3BIUH 3SUGA 3U9AH 1GJ4H 1QB9A 1NM6A 1TPSA 1O3IA 2ZNKH 1TE0A 3PWBA 4XDEA 1RTFB 2OP9A 1GBBA 1C2HA 4D7GA 1SI5H 3KGPA 1BRAA 3M5MA 1DM4B 4ESTE 4YT7H 4M7GA 3GY6A 4MPWA 4D8NA 3OY6U 1EOLA 4Y76A 3ZV9A 3NK8A 1A46H 4BOHA 4U32A 1C5PA 4O97A 1OWDA 1EZUC 1FMGA 1H8IH 2BDBA 4HFPB 2FPZA 1A5GH 2RG3A 1C1OA 3BN9A 3ZVAA 1RRKA 2PHBA 4OS5A 4ZH8A 1YCPM 1Z1JA 2CXVA 2Y7XA 3EDXB 2BY7X 3RU4D 3BF6H 3MO3A 5ESBA 1FNIA 2FOAA 2BD7A 1WAYB 3A7WA 1BTZA 4BAMB 2PKAB 1GDQA 3SV7A 2O8UA 3A80A 3A8CA 1MQ5A 1NFWA 2C3SA 2V3HH 1ANBA 3E16B 4DT7B 4DCDA 1LPZB 1Z1IA 1AI8H 2PSXA 1V3XA 3EA9A 2CMYA 2QN5T 5DP3A 1DSUA 1O36A 1P0SH 4PROA 5JBTA 4Y7BA 1O2MA 1VR1H 3ZZ5A 2HRVA 1O38A 2XW9A 1YKTA 3PLPA 3RXQA 1GBTA 1W3CA 4GPGA 3SW2B 2ZPQA 2Q6FA 1YPGH 1C4U2 4K2YA 4DG4A 1F92A
chains in the Genus database with same CATH superfamily
1CBWC 4YZUA 2H9TH 3ATKA 2BQ7B 1V2VT 3MNCA 3A8DA 1GBIA 1QBOA 4A7IB 4JZDH 3PRDA 2PW8H 2OC1A 4ABFA 1TABE 3GY4A 1O3OA 5LH8A 9LPRA 4I31A 4DIIH 2G51A 1DE7H 2OQUA 5FPSA 3P70B 4NGAH 4ABIA 3BTQE 3LJJA 4ZKNU 1XVMA 4NFFA 4Y79A 4B71A 5K7RA 1XUFA 1WQSA 1QB6A 4NSVA 2RDLA 2ZHQH 1DLKB 3LONA 3RC6A 1NRNH 3VG8A 1P12E 4WXIA 1FLEE 3UAIC 2PTCE 3U1JB 4ISOA 2BD3A 1TGNA 2FYQA 1YF4A 2PGQB 4MTBA 5I25A 1UTNA 1H9LB 1K9OE 4TY7A 1ETSH 1P06A 3VFEA 5EJZA 1RTLA 1AUTC 1GJ7B 3ZVFA 2OC0A 1RFNA 1GI8B 2F9OA 3F68H 1C2FA 1P57B 1XUHA 5T1VA 5LPRA 1Y5UT 1BTPA 1EATA 2WPDD 1C4Y2 2AFQB 1XUJA 2V3OH 2A2QH 2F91A 1OWIA 1C2GA 1TAWA 2ZDAH 5F6MA 1TIOA 1XM1A 4K5ZA 2GZ7A 3LC5A 2Y5FA 2JIZD 4B1TA 4I7YH 3T26A 1TNLA 1SFIA 2ZCLP 1FQ3A 5EGMA 1PQ8A 8GCHF 3VB4A 4INHA 1MTNC 2PWXA 3STIA 5C0TA 1D6WA 1Y59T 2GCHF 1W7XH 3RXGA 1MKXH 3RU4E 5DP6A 1S84A 3A89A 4Z0KA 1HRTH 2GDEH 2OLGA 2J95A 3BV9B 1IHTH 2IJD1 1HPGA 1ZGIA 3KYFA 4AB8A 3ZZBA 2NU3E 3SU3A 1A3BH 1OS8A 1FX0B 2A5AA 2P3TB 2ZFSA 3DA9B 2NWNA 1T4VH 5IK2D 1O35A 1NTPA 2Z7FE 1AKSA 5HYOA 4YOJA 1TA6A 1K21H 2P8OB 4HTCH 1U6QA 2AERH 5EQQA 3ENSB 5A8ZA 3V3MA 3ZZ3A 4RN6A 2KM0A 2BXTH 1ZJKA 5C1YA 4GVUA 1RS0A 1DANH 2HPQH 1BTYA 2ZP0H 4Y0ZE 1QBVH 2XWBI 3VXFH 1ZMLA 2OC7A 1YPKH 3ESTA 2Z3DA 3TJOA 1ZMJA 2QY0B 5C1XA 2OD3B 4JZ1A 3OEED 1WBGB 1DUAA 1JMOH 2ZCKP 4X8TH 2BDCA 3Q77A 1A1RA 2FI4E 2GV7A 2PLXA 1SQTA 3T28A 1FY5A 2ANWA 3BTEE 1S6LA 5L2ZH 2OQ5A 3BEUA 1QRZA 2AGEX 1ZTJA 1EPTC 3F0PA 3GICB 2SGQE 3RDZA 1L1NA 1SR5C 2STBE 3SV8A 2V7QD 1BJVA 2KCOA 7ESTE 1TNJA 2J5UA 2ZHWH 1ACBE 3MWIU 3QGJA 1HGTH 1QL9A 2HWLB 5E2PA 5HIYA 3FANA 5CHBA 3K9XB 4WXVA 1FY3A 2RA0A 3L3TA 1GBHA 1LCYA 4AN7A 4XSKU 4XBCA 1C1PA 3BTFE 1UJ1A 1HAYB 3U8RH 1C1UH 2Q6DA 1MKXK 1AVGH 3BTDE 1T4UH 3P8OA 1MKWH 4AC9A 1PFXC 1TA2A 1KXFA 4YT6H 3QN7A 3KQBA 2J34A 4Q2KA 1O2TA 4JMYA 1O3HA 5BRRE 1K1PA 4E7NA 4D76A 1Y3WA 1O3KA 2THFB 4ACAA 4Q80A 1WQVH 1A2CH 5DO4H 2ZCHP 4CREA 3NWUA 4U2WA 3VB7A 2XBYA 1LVMA 2AH4X 3LGWA 3TH4H 5FHTA 1BBRE 1AFQC 1WV7H 4AGKA 1O2XA 3UR6A 1SLVB 1C5XB 1GI5A 2GZ8A 4YO9A 2QC2A 2FODA 5JYIA 4IC6A 2ZHEH 5DN6D 1D3DB 1XKBC 3SNCA 1O2GH 2BDGA 3ITIA 3NPSA 3PLBA 5C67A 3M3TA 5IDKA 1J14A 2J98B 1SGPE 2VIVA 2ZU3A 2Z6BD 1O2SA 1OPHB 4UE7H 1C2EA 1O33A 2WHXA 2A0QB 1EP6A 3PLKA 3GDSA 1NBMD 3MH7A 4XOJA 4GHTA 1W2KH 1ZR0A 3GCOA 3T29A 1FV9A 2FS8A 1T32A 1LHEH 2UWOA 4ISIH 5EU8A 4ASUD 1GHBG 4TYDA 3KHVA 1BT7A 4ZMAH 3Q76A 1O5CB 1IQJA 1MBQA 2AIPA 1QGFA 2D1JA 4ABHA 1KTTB 1ELCA 1HAIH 1SGDE 2YOLA 3AASA 5DP9A 3GISB 4X2XA 1O32A 4E06H 2VB0A 3ZVBA 1OYTH 1S83A 4GUXA 2P94A 1Y3YA 4X6NA 5EW2H 1QA7A 4HGCA 5GCHF 1QJ7B 3UOUA 3GY2A 2VBCA 4I32A 1WTHD 4WH6A 3A7TA 5ESTE 5J4SA 1P9SA 2G55A 1IQLA 2PKAA 3TVJB 2JJ2D 2TBSA 5E0GA 2CK3D 3D23A 1QIXB 1WTGH 2GX4A 3SV2H 4ABGA 5A09A 5TCCA 2BTCE 3TK6A 1N1LA 1UTLM 2XC0A 2BD8A 1EUFA 5A8YA 4IGDA 4GHQA 2K0QA 5PTPA 2ANMH 4Y71A 4UFDH 4ZAEA 5FX5A 4IMQA 4B73A 5L30H 1VKYA 4MNWA 4CBNA 4SGAE 1UO6A 1QB1A 4INLA 2G8TA 3M35A 3AK5A 3MO9A 4X1PU 1OP8A 5LPEA 3HATH 3H7TA 1ZYOA 4VGCB 1TWXB 1DLEA 3RXIA 2L6OA 2GCTB 5C3NA 1A0HB 1O0DH 5AFZH 1ZJDA 3SNEA 2G4UA 3SNBA 3CS0A 4YESB 2A5KA 4GAWA 3HK3B 7GCHF 3WW7A 3WY8A 3BEIB 1AB9B 3Q3XA 2ZGCA 1C1NA 1JRTA 2VWLA 3HPTB 2WPMS 3U69H 2ZTYA 2AMQA 3A82A 5JBBS 1O2KA 1YPEH 4I8LA 2HVYB 1EXFA 3SNDA 2GDDA 3BG8A 1N8OC 4Q4LA 5FCKA 1K1JA 3UOPA 3QO6A 1TOMH 1VGCB 2XRCA 1P10A 1UTJA 4BAOB 3T62A 2UUKB 3RLWH 2BB4A 3F9FA 4TWWA 1T8MA 1QL7A 4YOIA 2ZZUH 1SPJA 2VH6A 1MTSA 4F49A 1NESE 1TPAE 2VH0A 1YPMH 3SU0A 1KXDA 1BJUA 1E0FD 3T27A 1O2WA 1O2OA 3O8CA 2ZC9H 4MVNA 5EQRA 1AN1E 3ZZ9A 2J4IA 1YBWA 1HAGE 2P3UB 3MU0A 3LT3A 3EYDA 3E90B 5DJ7A 1QR3E 4DT4A 4JCNA 3RMMH 3DUXH 1GJAB 1UMAH 4O3TA 2QXIA 5GXPA 3F2HA 4WVPE 1SGNE 2AGGX 8KME2 1UTMA 1NS3A 1C5TA 1EZSC 2ZI2H 1H9IE 3V0XA 3UY9A 2C8WB 3MOCA 4WMFA 1SG8B 3LOXA 3RMNH 1K1NA 4CR5A 3SJOA 1LMWB 5C5OA 2TIOA 4FU9A 1DFPA 1GBCA 2HVXA 2PR3A 2IPHA 3WWFA 2A7JA 4BAQB 2J92A 1NFXA 1TBZH 4MPVA 1SC8U 2B0FA 1SGIB 3SQHE 3A85A 1ZOMA 2VVCA 2G5VA 1MH0A 3TITA 1AHTH 1DSTA 1O2QA 1ELDE 1NRRH 1V2WT 3FO8D 4NIXA 4NZQA 3M7UA 1AQ7A 2R3UA 1HAOH 2FX6A 2VWMA 4ABEA 1L4ZA 2Z9GA 1W0JD 3OY5U 1FXYA 1Z8RA 2A5IA 3SU6A 1O3MA 2DE9A 3BTHE 3QX5H 4ZHLU 4DY7B 4E05H 3WWBA 5A2MH 1C2MA 2G81E 4UFFH 3PV4A 4FU8A 1EASA 1ZGVA 2GTBA 4K3JA 3QTOH 1DDJA 1OP2A 3URCA 1P2JA 4JK6A 1THPB 1P01A 1JRSA 1JOUB 2H2ZA 4DURA 2TGPZ 1GGDB 5L2YH 4CR9A 1Y3VA 2F9PA 1GBAA 1YY3A 1YPLH 4NA8A 2FYRA 1C5QA 3ZYDA 3QWCH 1UCYH 2KR7A 1W12U 3U8TH 4TT3D 5TJXA 1HUTH 4I33A 2UWLA 1BRUP 4MQAA 4B74A 2AGIX 2IPQX 5HGGA 4XRNA 3PO1C 3GOVB 1V2ST 4Y8YA 1SFQB 4LZ4B 1UCYE 4ZXXH 1C5OH 4ZKRU 1T8NA 1AMHA 1ANCA 3UNSA 1C5LH 3STJA 1QCPA 2FS9A 2NU1E 4XE4A 4KGAA 1O3PB 1LHCH 3QTVH 4RKOB 4I8JA 1N6YA 1DWBH 4AGJA 1O2RA 3P95A 1CGIE 1YPHC 5FBEA 3N99A 1UCYK 5EXNA 2OBOA 1Q2WA 2BD2A 4FXGH 3RU4T 5F8XA 1AU8A 5GCHG 1DUEA 1ESAA 4ZXYH 2KCPA 1W7GH 3RXTA 1TYNA 5G4BA 1KXAA 2UUYA 4ABAA 3MQKC 3EGKH 7GCHG 5JBCS 1AUJA 2P59A 2H5DA 1IHSH 2C8XB 1A0LA 2NU2E 3EE7A 2F83A 2R2MB 1MD7A 1F2SE 3ATLA 3GDUA 1WOFA 1KXCA 1VITG 1RD3B 3TH2H 2M2AA 1HJ9A 3DT0H 3M61U 1GBLA 4UEHH 2ZU4A 3ZVGA 3T2NA 4RI0A 3RM2H 1NFYA 1O5FH 5E2OA 2PUXB 1Y5AT 2RDEA 3QZQA 4NWLA 2A45B 2XCNA 4OS1A 2Y5GA 4ABBA 2FOMB 1FIWA 1TBRH 1GHAF 4YOGA 5EW1H 1PQAA 2ZDKA 1CHOG 3PMAB 2J2UA 1BMLA 3DCLA 4NA7A 1CA0B 3SGQE 1CU1A 3SJ9A 1G30B 3I78A 1GDNA 2SFAA 1W13U 1KLTA 3RC5A 3MH4A 2VGCB 2BLOA 4CH8B 7LPRA 3SJKA 2WPIS 1AZ8A 5K0HA 2Y5HA 2YMSB 4ZUHA 3EQ0H 1HAHH 1P2KA 2ESTE 1IQFA 1ARCA 2VIDA 1UVOA 2UUFB 5DGJA 3SJ8A 1SL3A 4HG6A 1O2LA 3SHAH 1TX7A 2ZFRH 1AE8H 2EC9H 1FN6A 3LGUA 3MH6A 1UHBA 1A0JA 1L0ZA 1KDQB 2XCFA 1MABB 2P16A 3OTJE 4WH8A 2W6ID 3BTTE 2GMTC 1D6RA 1KMHB 4XFQA 1MTNB 4TWYA 1BMNH 5C94A 3OX7U 1MU6B 3TLOA 3GCTG 1K22H 3PO1B 4YLUA 1LQDB 5JPMH 1K1LA 1K2I1 3PM3A 1O3FA 1F0RA 4Y8ZA 4F4OC 2BZ6H 3UNQA 1CE5A 1FN8A 1LPKB 3M5OA 3MNXA 4OS2A 5ETXA 4X2WA 2QXHA 1G3EA 3TPIZ 1TMUH 1BMAA 5F03A 1C2IA 1MCTA 5IYTA 3LGVA 1QA0A 3ZV8A 4AFZA 3TIUA 4K8BA 2B9LA 1GMHF 3P8GA 1HAZB 2HALA 1XUKA 3SBKA 1VGCC 2VIOA 3M3SA 1D3QB 5A0AE 1KDQA 2PGBB 3SU1A 5CDFE 2SGDE 1GI2A 3M7QA 3SZNA 1GHWH 1O5GH 1GBFA 2AMPA 2HLDD 4CRDA 2BY5X 4JYVH 1FIZA 3OSYA 1V2OT 3ZVEA 1OHHD 1QL8A 1KXBA 1CSOE 1C1MA 1V2UT 1CBWB 5DP5A 2G4TA 4E7RG 1EAXA 2AMDA 1EP5A 3PV5A 3RXJA 3KQEA 2BM2A 1QZ8A 2PFEA 2O8TA 1GMDF 1SMFE 1TNKA 2O8LA 2Z3EA 5DP4A 3VPKA 2HLCA 3S9CA 3UR9A 3L6PA 1RIWC 1CVWH 1XMNB 3SU4A 1Z6JH 2EEKA 3TJVA 3BTKE 4UDWH 2AEIH 3MMGA 4FUGA 4AB9A 1O5AB 1VJAU 3FFGA 4I86A 1IQGA 4B2CA 1JIRA 1H4WA 4R0IA 5JB9S 2A4GA 1Z8JB 1KYNA 3UB0A 1C1SA 3A7VA 6GCHG 1JIMA 4MNYA 2H9EH 1V2QT 3BSQA 1UHBB 1VJ9U 1Z8IB 3KN2A 3SV9A 2ZPRA 3BIVH 3BG4B 5DSFA 2F9UA 3KIDU 3N7OA 1RJXB 3PTBA 1S5SA 3C27B 2F3CE 4H6TA 1ZRKA 4LXBH 1W14U 4IW4E 2Z9IA 3VXEH 4O03A 2ALVA 1MU8B 1V2JT 1HBTH 1C5UA 2R0KA 3LH1A 1O5EH 4IN1A 4J2YB 4H42U 1ZHMA 2WV5A 3A7XA 1ZPBA 4NIWA 2KAIB 1G3DA 1GHAG 2RCEA 4ZCNA 3AVZA 1ARBA 3QK1A 4ZROA 3RXVA 2SGEE 3FP7E 3OE7D 1TBQH 1QJ6B 1AY6H 1O37A 2F43B 1ELBA 2QXGA 3OEHD 1AFQB 1SGTA 5HKKD 1O3NA 1V2LT 4WY3A 1TPOA 1YYY1 2WYGA 3LPRA 2J9NA 2ZGJA 3DSOA 1O31A 2BLWA 5AF9H 2GCTC 1P03A 2WUCA 2GKVE 1ID5H 3RXFA 3TK5A 4H6SB 1C9TA 1BMMH 3Q3YA 1Y3XA 1ZPZA 1GI0A 2AHME 1PQ5A 1VCWA 3LH3A 5AHGH 2TGAA 3MU1A 1GJ5H 2I6SA 1QBNA 2XC5A 3M7TA 5E0HA 3G01A 2Y81A 1CGJE 5L6NH 1YLCA 3ELAH 4X6OA 4AOQA 4MNVA 3URDA 3UREA 1DS2E 1AZZA 3ATIA 1KSNA 1AWFH 2P8OC 1BTUA 1XVOA 2CV3A 2QA9E 1TRMA 2H1UA 3ZYEA 5J4QA 1ELGA 1J8AA 3PRBA 1ANDA 1GBDA 1NRPH 4FUEA 1CQQA 2OK5A 2FLRH 5DKMA 1C1WH 2ZF0H 3P17H 2A7CA 4Z1MD 1FONA 2OXSA 2ODQA 1NPMA 1W0ZU 1PPEE 1SLXB 1DPOA 1TOCB 1GI4A 1UTOA 3ZZ8A 4BAHB 1OOKB 1NZQH 4Y0YE 3SNAA 1EOJA 3BEFB 4THNH 2FOEA 3F2FA 2VVUA 3KF2A 1IAUA 2ZDNA 1T8LA 3LJOA 4HZHA 2JH6D 1EAIA 6ESTA 4CRFA 1C1RA 4X1RU 2BXUH 1TQ0B 2VVVA 1XXDA 1OSSA 3SN8A 4X6MA 1K1MA 3IG6B 2TGDA 2J98A 1RIWB 3ZZ6A 2VWOA 1P9UA 1MTVA 1A7SA 1DVAH 2BDHA 2FM2A 2J94A 2JJ1D 2YNBA 2H6MA 2PSYA 2G5NA 3FZDA 3LGTA 3GY7A 1KXEA 2I6QA 1GCTC 2Q6GA 1RGQA 2QV1A 3GYLB 1MKWK 2O9QA 6CHAB 1NFUA 1BQYA 1S0RA 1SKYE 1YC0A 3W94A 1IOEA 1NY22 5CHAB 4D7FA 2HNTF 4KKDA 1XUIA 1Z71A 4OGXA 3M5LA 1MTWA 4VGCC 1IQNA 3E8LA 2AIQA 1OWJA 3MNSA 3F0OA 1TALA 1V2PT 2CJIA 1ZHRA 2BD4A 2OBQA 1D3PB 2W3IA 2SNVA 3I29A 3O8BA 2B7DH 3AW0A 2XC4A 2ZQ2A 3AW1A 1ANEA 2GD4B 1MZDA 1C1VH 3RXBA 6LPRA 3H5CB 3NKKA 4FVBA 2BLQA 1SGFG 1AIXH 2V35A 3FP6E 3TJNA 3A7ZA 2FX4A 2J38A 4FETA 1D9IA 4KELA 1OWEA 2JETC 4FOUC 4XBDA 2FIRH 2H9HA 2ZHDA 5FPYA 3ZZ7A 2PKSC 1GI6A 2BVSH 5T6DA 3M36A 2BLVA 4CRGA 3LC3A 2R3YA 1O2VA 2ODPA 1SQOA 1TNHA 1EJNA 1ABIH 5DG6A 1OXGA 1O5DH 3MHWU 2C90B 2KAIA 3RM0H 4AFUA 4H4FA 4A6LA 3RXKA 2RA3A 4YTAA 1YGCH 1Z8GA 5GPIB 2BDIA 2NU0E 4DVAU 2BY9X 2WZQA 1J9CH 1GBEA 1F0UA 2FMJA 2FP7B 2ZPSA 2FOHA 2GJGA 1UVUH 1TPPA 2KCYA 1ELAA 1NROH 3A87A 4CHAC 1H1BA 1WU1A 3VGCC 9ESTA 1GL1A 3MH5A 5GJ4B 3UIRA 1AO5A 2WINI 2O8MA 4A92A 1O3EA 3M5NA 1GHVH 3L33A 1FPHH 1P2IA 1L2EA 1H8DH 1MUEB 1SOTA 2ILNA 4NZLA 5EPYA 1YP9A 2OCVB 3GY5A 2KX4A 2R2WU 1HCGA 1ETTH 2Z94A 1AVWA 1NC6A 3KQDA 2FTLE 4KTUA 3KQ5A 2ZFPH 3DSGA 4O3UA 2DUCA 1GJBB 2VU8E 2WPHS 1TX8A 1MBMA 3MNBA 1F5RA 2QF3A 3KQCA 3R0FA 1CO7E 3GCTF 2WUBA 2XWAA 4IBLH 1DXWA 5JB8S 4IN2A 5A0CA 3MYWA 3S7KB 2IN2A 1P02A 5C0UA 3S7HB 1C4V2 2PV9B 3ODFA 1K28D 3S69A 3RXPA 4TY6A 1A5HA 2HNTC 1CT0E 1EJAA 1UVSH 4WF8A 4NWKA 3A7YA 2VIWA 4RT0A 7KMEH 1JBUH 1C5RA 1FY8E 3LIWA 5EODA 1VITH 1A4WH 4AYYB 5EIYA 1BTHH 1GVZA 1DWDH 3SOSA 3E0PB 3S9BA 5I46H 1GI9B 1W10U 1V6DA 4F48B 4ABJA 1HXEH 1SGYE 1TFXA 2CF8H 4MPUA 4FUFA 1BITA 3TGKE 1GHYH 2O8WA 3NZIA 1GHXH 4NFEA 5DP7A 3TGJE 4A1TA 3HGNA 3DSPA 1INCA 1GCTB 1THSH 4K69A 3A83A 1SB1H 1B0FA 3E1XB 1SGCA 4QT8C 3ZZDA 3CP7A 2LELA 3RP2A 1O3CA 4BTIB 4LOYH 4AZ2B 2BX3A 1PYTC 2QYIA 4AFQA 1ZSJA 1FY4A 2ASUB 2VNTA 1EB1H 2C93B 1NU9A 2J97A 1Z7KA 5C17A 4WMDA 1MZAA 2HOBA 1LTOA 1KLJH 2GZ9A 4O9VA 2GP9B 5E0JA 1XUGA 4JZEH 4KTSA 1QTFA 2HNTE 4UFGH 1C5SA 4AX9H 2Y6TA 3KEEA 2ZEBA 1XKAC 3F6UH 1G2LA 4FVDA 5FAHA 3V7TA 5GWZA 3SU5A 2PTNA 1UTPA 1GMCG 2B5TB 4XBBA 1ELFA 4BNRA 2JETB 4IS5A 2XTTB 2ZTXA 4MDSA 1QNJA 4CRAA 3F1SB 1P3CA 2ZTZA 1CT4E 3MI4A 3MU4A 1EAUA 1E79D 3U1IB 1SOZA 1EQ9A 4Y11E 5A8XA 1GI3A 3U8OH 1QFKH 2BDYA 4X0WU 1MQ6A 1P2MA 1UW7A 1G2MA 1GJ9B 3GCHB 1CHGA 2W5EA 5T3HA 1GWAA 2C8YB 5A0BA 1TNGA 1WYKA 2ZDLA 3RMLH 1P2OA 3TH3H 2OTVA 1LHGH 2ZFQH 4NA9H 4YXWD 1GPZA 3QZRA 3N7DA 1GI7B 3RXDA 4A5TS 1FPCH 4CHAB 1G36A 1BZXE 1WUNH 1TLDA 4X8SH 3R3GB 2Z9LA 2WPLS 2B8OH 2FOGA 4B2AA 2XOKD 3ZVDA 2A32A 2FZZA 3IITA 5E8EH 2OUAA 5T6FA 3RXMA 2RFKC 1UVPA 1C5ZB 1HNEE 1DXPA 4K1EA 1UK4A 1C5WB 1V2KT 1L4DA 2V3MA 1K1OA 1LVBA 2TPIZ 4JYUH 5FPTA 2FOFA 4BAKB 2W6JD 4P02A 1SGQE 2QXJA 1M9UA 1PPFE 2GT7A 4GLYA 4LK4A 2BOHB 4DIHH 5BPEA 1W8BH 4BANB 3F9HA 2ZQ1A 4X2VA 1S0QA 4ZHMU 1Q31A 5HIZA 5T6GA 1QJ1B 3V13A 4BTUB 4TPYA 3GYMA 1GBKA 1ORFA 3KNXA 4YM9A 2KCAA 5C1UA 2ANKH 2LNCA 1MTUA 4X2YA 1YM0A 2EA3A 2Q1JA 4I8HA 2BQ6B 2ZU1A 4K60A 4ISHH 1TB6H 5KEDA 5HM9A 3SUDA 2Z9KA 2VIQA 4WJG2 1SQAA 1ZLRA 4MG3A 1SGRE 1PPHE 1VZQH 1QRXA 1BUIA 3DD2H 3LGYA 3V12A 1SQRA 1E37B 1O34A 2BOKA 2CHAC 1LHFH 2QF4A 3M3VA 2XNIA 1V2TT 5B6OA 2STAE 3OU0A 2GV6A 3RXAA 5EG4A 1EPTB 5KGOA 3O8RA 3GCHC 5FL7D 1F0SA 3RXRA 1ESBA 1DX5M 1O2NA 1GGDC 2YNAA 2ZU2A 3A84A 2XXLA 2GGVB 1K1IA 4RSPA 1QY6A 3DFJA 1C5YB 2A7HA 3PV2A 1ZRBA 8GCHG 4NIVA 3HKJB 4Q63A 1COWD 1CGHA 2JH0D 3JZ1B 4A1XA 1GHZA 3SV6A 4X8UH 2QGRA 4Q7ZA 2VJ1A 2WV4A 3SI4H 4DOQA 1MAYA 1LKBA 2ZGHA 1IQIA 3HK6B 1SSXA 2CF9H 1GDUA 4JZFH 4NIYA 1QQ4A 5AFYH 1A5IA 1P3EA 1YWUA 2Y7ZA 5AVDA 2NU4E 1WSSH 3GDVA 1G3CA 1NT1A 4A1VA 2A4OA 1OYQA 3P8FA 1DICA 3B8JA 2FO9A 1FAKH 1UVTH 1O2HA 3ZZ4A 4IC5A 4HI3A 1E34B 1O2YA 1MD8A 1T31A 3D62A 1CHOF 2BYAX 1D3TB 1B0EA 1L1GA 1IQHA 1O3GA 5GDSH 1O5BB 1HYLA 2IOTA 4Y7AA 2OC8A 1BHXB 5HM2A 1NO9H 2A4RA 3UWIA 2FI5E 3SI3H 3SJIA 1YPHE 2D8WA 2XYAA 4KP0A 4K8YA 2ZA5A 1JXPA 1SLWB 3UPEA 1EZXC 1GMHG 1G32B 1O2PA 1C5MD 1GJ6A 1TX6A 5EQSA 3A8BA 1E1RD 1FZZA 2XNDD 1O2ZA 4ABDA 2W7UA 3ZIAD 1BA8B 1HLTH 4P00A 1Z6EA 3SUFA 2A31A 3AAVA 1E1QD 1TGBA 3Q00A 3CS7A 5CE1A 4KTCA 4OS6A 1ESTA 1EX3A 2HGTH 4K1SA 2D26C 2UWPA 3PROA 4XD7D 4J1YA 4BXSA 4F55A 3KYGA 1VCPA 3K2UA 1FDPA 1V2MT 1EPTA 5F8TA 5LGOA 2Z3CA 1BHXF 2ZGBH 4DGJA 3VEQB 1G37A 1CA8B 1CT2E 2SNWA 2ZU5A 1SVPA 1UK3A 2CHAB 4FUDA 1HDTH 1PJPA 1P2NA 2GCHG 3UQOA 1GCDA 4M9FA 1HAXB 2QF0A 5EJ1A 3SO3A 1DT2A 1TRNA 4INKA 2BMGB 1W0KD 1TMBH 2R9PA 5EJLA 1PPZA 5TCAA 1YLDA 4ASHA 3PYHA 1KLIH 3VB6A 1T8OA 4MLFB 1OKXA 1SGFA 1RXPA 1SHHB 5HXFA 1TGCA 4ZKSU 1Y3UA 1WCZA 1AFEH 2C4FH 2FXRA 3TJUA 3GY8A 2FLBH 2L74A 2BD5A 2K1QA 2Z9JA 4B2BA 1C1QA 1E35B 1P8VC 1G9IE 2A4QA 2W26A 3SU2A 6GCHF 3LGIA 4B6FA 4FU7A 1S6HA 4CRCA 1FUJA 4NSYA 2ZG0H 3E3TA 4U01A 1O3AA 1B7XB 5FCRA 3VGCB 2FESH 3MFJA 1GJ8B 1YCPH 1O3BA 1Q3XA 2ZGXH 1LQEA 2BZAA 3TU7H 1VCQA 3MU8A 5C20A 3TNSA 1HV7A 1WDIA 3N7EA 4Y10E 2HPPH 4X1QU 1PYTD 1BCUH 4SGBE 4D9RA 2VINA 3QGNB 2BQWB 4FUHA 3LU9B 2TRMA 1B5GH 3EA7A 1ELEE 1BTXA 1LVYA 1GG6C 3GY3A 1GMDG 5CHAC 2UUJB 3RXCA 1GHBF 1IQMA 3BTGE 3NCLA 1OP0A 4FUJA 3PMHB 3OFND 3PTNA 3S0NA 1YPJH 1K0HA 1C2LA 2G00A 2M5TA 3I77A 4WMEA 3SHCH 2TGTA 4NG9H 2LPRA 3TGIE 2W3KA 2XBXA 3FAOA 2ANYA 1TQ7B 1LO6A 4AG2A 2EI7A 3UQVA 1PQ7A 1C5VA 1HAVA 3EAJA 2ZFFH 5B6LA 5C2ZA 1CA0C 2CGAA 4I8GA 3B23B 1HJ8A 3NUMA 3ODDA 4X8VH 1FY1A 3RXUA 1O3DA 2BVXH 1UK2A 3D49H 1H9HE 1HAPH 1DY9A 2FDAA 2JKHA 2K8IA 2ZDMA 1ZMNA 2BDAA 3KCGH 3P6ZB 3FKSD 1X7AC 4OGYA 4BXWA 1L1JA 2YMSC 1F5KU 1V2RT 2YMSD 1JWTA 3SQEE 1J17T 4BTTB 5GIBA 3OTPA 4ISNA 4AYVB 2QE7D 3P92A 2D2DA 2A2XH 4LZ1H 3PMJA 1ZSKA 3Q3KA 1Y8TA 3VB5A 2F9NA 3BTME 1OWHA 1DY8A 1W11U 1FAXA 2FTMA 3JZ2B 1AWHB 2AYWA 2DE8A 3QDZB 1P04A 1O2UA 2G52A 1PPBH 2SGFE 2QIQA 1F7ZA 3GCNA 1KY9A 3H09A 1GL0E 1W0YH 3C1KA 5GNDA 3K65B 1P09A 1AVXA 2EI8A 2GMTB 2C8ZB 2SGAA 4B76A 1HAVB 1TGTA 1SLUB 4UONA 4AG1A 2H5CA 2VIPA 8ESTE 1KIGH 1YCPK 1ZPCA 2V6NA 3D65E 3K6ZA 5FXLA 4Z6AH 5CMXH 2ZECA 1LVOA 2AS9A 2WPJS 5FBIA 3SZEA 5KECA 4FUIA 2QCYA 5H4IB 2BHGA 1MAXA 3PB1E 3RXSA 1S6FA 3A81A 3W1EA 5DP8A 4FUCA 1NRQH 3W95A 2JDID 3UTUH 3A8AA 3RMOH 2FEQH 3RXLA 2F9VA 5DPAA 1Y5BT 1O2IA 1AD8H 1C9PA 4JK5A 3HKIB 3BTWE 2ZWLH 3P8NA 1DITH 3UUZA 4Q7YA 5F8ZA 1XX9A 2BX4A 3TNTA 4JZIA 4Q7XA 3ZZCA 5LPFA 1DWEH 1N6XA 2BY8X 5SGAE 3FP8E 4B75A 2FWWA 3DFLA 3RLYH 2CN0H 2PKSB 4GCHG 1E36B 1ETRH 1N8OB 3E91A 1ZHPA 1DOJA 2FI3E 3FVFB 1EB2A 2ZFTA 5JBAS 1AGJA 1ABJH 4ISLA 1BDAA 1IQEA 1A3EH 1TONA 2P93A 3QUMP 2XBWA 3MU5A 2WYJA 1RTKA 1TRYA 1AB9C 1P2QA 1NN6A 1C1TA 1GI1A 4NCYA 1J15A 3MTYA 2W7SA 1BBRH 3O8DA 3T25A 3UNRA 2ZDVH 1SHYA 2V0BA 2WPKS 3SYJA 1GBMA 4GSOA 2P95A 3ZZAA 1ELTA 1NU7B 2EI6A 1C2DA 1BRBE 1BOQA 1GVLA 3ZVCA 1TNIA 1WXRA 2VWNA 1F5LA 1GVKB 4FUBA 4OS4A 2ZO3H 1NRSH 3SUEA 1HIAA 4X1SU 3GS9A 3H7OA 1HJAB 3LDXH 2F9BH 1AKSB 1HB0B 1TGSZ 5EPNA 2PUQH 1E38B 1D4PB 1ZZZA 3BG4C 4D9QA 2BD9A 2JH5D 5ABWA 3KL6A 1GG6B 1BMFD 1BBRK 2FOCA 3U28C 1O30A 1F0TA 4CRBA 4IMZA 1ELVA 1BRCE 1S85A 4ZHAA 1LHDH 1GJCB 3NXPA 1UTQA 3AAUA 5F53A 1C2JA 1O39A 1O3LA 4X1NU 3RXEA 3RUOA 2Y80A 5EXLA 3A86A 3ATWA 2FOBA 4UFEH 1G3BA 3IWMA 2Y82A 3LKWA 5EXMA 3RXOA 4AORA 1UTKA 1ZTLA 2GT8A 4CH2B 3OAAD 3RC4A 2GVFA 2P3FH 4MNXA 1TMTH 3U98H 1H8HD 3F9GA 3DHKH 4X6PA 2LP6A 4UD9H 1O3JA 3UFAA 4Y6DA 2EQNA 1MMJN 1IQKA 2EY4C 3FN8A 1O2JA 4DJZB 4K1TA 1EAWA 1VITF 3M37A 4OS7A 1A61H 1EZQA 1SGEE 2QF5A 3CENA 4B6EA 5EOKA 1BB0B 3EA8A 3A88A 3SGAE 4DW2U 5JDUB 2ODYB 2ALPA 1QURH 1PPGE 3E6PH 1PPCE 1KTSB 3SORA 5DK1A 1P05A 2ZHFH 1BTWA 3MO6A 3F9EA 1OWKA 4MPXA 3S9AA 3UWJH 1LDTT 4Y8XA 1J16A 1QHRB 1HFDA 1HJAC 1EJMA 3ATMA 1MCVA 1FJSA 1LKAA 2QAAA 3QLPH 5FX6A 3PMBB 3RXHA 3E0NB 1QRWA 4R8TB 2ULLA 1GBJA 1ZTKA 1THRH 1HXFH 1P11E 3NRLA 3T5FH 4RKJB 4TSFD 4AFSA 1DWCH 4JYTA 5HMAA 1QQUA 1OX1A 4ZKOU 1LPGB 4YLQH 1EFRD 1SBWA 1AE5A 2ZIQH 3FZZA 3OYPA 1XXFA 4TPIZ 3PWCA 2WV9A 5C5NA 4CBOA 1HIAB 3VB3A 3K6YA 2BY6X 2OINA 2A1DB 1C5NH 4GCHF 1ZSLA 1GMCF 3SGBE 3HGPA 1S81A 2VGCC 1FI8A 4I8KA 4U30A 1V2NT 2R0LA 2XBVA 2ZKSA 2F4LA 3F2GA 6CHAC 1EKBB 3B9FH 1S82A 1T7CA 2BVRH 1C2KA 8LPRA 2IJOB 2SGPE 3TK9A 4WWYA 3F3BA 3EE0B 1GJDB 1BIOA 3BIUH 4OM9A 3SUGA 3U9AH 1GJ4H 1QB9A 1NM6A 2KZ4A 1TPSA 1O3IA 2ZNKH 1TE0A 3PWBA 4XDEA 1RTFB 2OP9A 1GBBA 1C2HA 4D7GA 1SI5H 3KGPA 1BRAA 3M5MA 1DM4B 4ESTE 4YT7H 4M7GA 3GY6A 4MPWA 4D8NA 3OY6U 1EOLA 4Y76A 3ZV9A 3NK8A 1A46H 4BOHA 4U32A 1C5PA 4O97A 1OWDA 1EZUC 1FMGA 1H8IH 2BDBA 3FOAA 4HFPB 2FPZA 1A5GH 2RG3A 1C1OA 3BN9A 3ZVAA 1RRKA 2PHBA 2WSSD 4OS5A 4ZH8A 1YCPM 1Z1JA 2PP6A 2CXVA 2Y7XA 3EDXB 2BY7X 3RU4D 3BF6H 3MO3A 5ESBA 1FNIA 2FOAA 2BD7A 1WAYB 3A7WA 1BTZA 4BAMB 1YLNA 2PKAB 1GDQA 3SV7A 2O8UA 3A80A 3A8CA 1MQ5A 2KFWA 1NFWA 2C3SA 2V3HH 1ANBA 3E16B 1NBME 4DT7B 4DCDA 1LPZB 1H8ED 4ACBA 1Z1IA 1AI8H 2PSXA 3CNRA 4RT1A 1V3XA 3EA9A 2CMYA 2QN5T 5DP3A 1DSUA 1O36A 1P0SH 4PROA 5JBTA 4Y7BA 1O2MA 1VR1H 3ZZ5A 2HRVA 1O38A 2XW9A 1YKTA 3PLPA 3RXQA 1GBTA 1W3CA 4GPGA 3SW2B 2ZPQA 2Q6FA 1YPGH 1C4U2 4K2YA 4DG4A 1F92A
chains in the Genus database with same CATH topology
1CBWC 4YZUA 2H9TH 3ATKA 2BQ7B 1V2VT 3MNCA 3A8DA 1GBIA 1QBOA 4A7IB 4JZDH 2PW8H 2OC1A 4ABFA 1TABE 3GY4A 1O3OA 5LH8A 9LPRA 4I31A 4DIIH 2G51A 1DE7H 2OQUA 5FPSA 3P70B 4NGAH 4ABIA 3BTQE 3LJJA 4ZKNU 1XVMA 4NFFA 4Y79A 4B71A 5K7RA 1XUFA 1WQSA 1QB6A 4NSVA 2RDLA 2ZHQH 1DLKB 3LONA 3RC6A 1NRNH 1P12E 4WXIA 1FLEE 2PTCE 3U1JB 4ISOA 2BD3A 1TGNA 2FYQA 1YF4A 2PGQB 4MTBA 5I25A 1UTNA 1H9LB 1K9OE 4TY7A 1ETSH 1P06A 3VFEA 1RTLA 1AUTC 1GJ7B 3ZVFA 2OC0A 1RFNA 1GI8B 2F9OA 3F68H 1C2FA 1P57B 1XUHA 5LPRA 1Y5UT 1BTPA 1EATA 1C4Y2 2AFQB 1XUJA 2V3OH 2A2QH 2F91A 1OWIA 1C2GA 1TAWA 2ZDAH 5F6MA 1TIOA 1XM1A 4K5ZA 2GZ7A 3LC5A 2Y5FA 4I7YH 4B1TA 3T26A 1TNLA 1SFIA 2ZCLP 1FQ3A 5EGMA 1PQ8A 8GCHF 3VB4A 4INHA 1MTNC 2PWXA 3STIA 1D6WA 1Y59T 2GCHF 1W7XH 3RXGA 1MKXH 3RU4E 5DP6A 1S84A 3A89A 4Z0KA 1HRTH 2GDEH 2OLGA 2J95A 3BV9B 1IHTH 1HPGA 1ZGIA 4AB8A 3ZZBA 2NU3E 3SU3A 1A3BH 1OS8A 2A5AA 2P3TB 2ZFSA 3DA9B 2NWNA 1T4VH 1O35A 1NTPA 2Z7FE 1AKSA 5HYOA 4YOJA 1TA6A 1K21H 2P8OB 4HTCH 1U6QA 2AERH 5EQQA 3ENSB 5A8ZA 3V3MA 3ZZ3A 4RN6A 2BXTH 1ZJKA 5C1YA 4GVUA 1RS0A 1DANH 2HPQH 1BTYA 2ZP0H 4Y0ZE 1QBVH 2XWBI 3VXFH 1ZMLA 2OC7A 1YPKH 3ESTA 2Z3DA 3TJOA 1ZMJA 2QY0B 5C1XA 2OD3B 4JZ1A 1WBGB 1DUAA 1JMOH 2ZCKP 4X8TH 2BDCA 3Q77A 1A1RA 2FI4E 2GV7A 2PLXA 1SQTA 3T28A 1FY5A 2ANWA 3BTEE 5L2ZH 2OQ5A 3BEUA 1QRZA 2AGEX 1ZTJA 1EPTC 3GICB 2SGQE 3RDZA 1L1NA 1SR5C 2STBE 3SV8A 1BJVA 7ESTE 1TNJA 2ZHWH 1ACBE 3MWIU 3QGJA 1HGTH 1QL9A 2HWLB 5E2PA 3FANA 3K9XB 4WXVA 1FY3A 2RA0A 3L3TA 1GBHA 1LCYA 4AN7A 4XSKU 4XBCA 1C1PA 3BTFE 1UJ1A 1HAYB 3U8RH 1C1UH 2Q6DA 1MKXK 1AVGH 3BTDE 1T4UH 3P8OA 1MKWH 1PFXC 1TA2A 1KXFA 4YT6H 3QN7A 3KQBA 2J34A 4Q2KA 1O2TA 4JMYA 1O3HA 5BRRE 1K1PA 4E7NA 4D76A 1Y3WA 1O3KA 2THFB 4Q80A 1WQVH 1A2CH 5DO4H 2ZCHP 4CREA 3NWUA 4U2WA 3VB7A 2XBYA 1LVMA 2AH4X 3LGWA 3TH4H 5FHTA 1BBRE 1AFQC 1WV7H 4AGKA 1O2XA 3UR6A 1SLVB 1C5XB 1GI5A 2GZ8A 4YO9A 2QC2A 2FODA 5JYIA 4IC6A 2ZHEH 1D3DB 1XKBC 3SNCA 1O2GH 2BDGA 3ITIA 3NPSA 3PLBA 5C67A 3M3TA 5IDKA 1J14A 1SGPE 2VIVA 2ZU3A 2Z6BD 1O2SA 1OPHB 4UE7H 1C2EA 1O33A 2A0QB 1EP6A 3PLKA 3GDSA 3MH7A 4XOJA 4GHTA 1W2KH 1ZR0A 3GCOA 3T29A 1FV9A 2FS8A 1T32A 1LHEH 2UWOA 4ISIH 5EU8A 1GHBG 4TYDA 3KHVA 1BT7A 4ZMAH 3Q76A 1O5CB 1IQJA 1MBQA 2AIPA 1QGFA 2D1JA 4ABHA 1KTTB 1ELCA 1HAIH 1SGDE 2YOLA 3AASA 5DP9A 3GISB 4X2XA 1O32A 4E06H 2VB0A 3ZVBA 1OYTH 1S83A 4GUXA 2P94A 1Y3YA 4X6NA 5EW2H 1QA7A 4HGCA 5GCHF 1QJ7B 3UOUA 3GY2A 4I32A 1WTHD 4WH6A 3A7TA 5ESTE 5J4SA 1P9SA 2G55A 1IQLA 2PKAA 3TVJB 2TBSA 5E0GA 3D23A 1QIXB 1WTGH 2GX4A 3SV2H 4ABGA 5A09A 5TCCA 2BTCE 3TK6A 1N1LA 1UTLM 2XC0A 2BD8A 1EUFA 5A8YA 4IGDA 4GHQA 5PTPA 2ANMH 4Y71A 4UFDH 4ZAEA 5FX5A 4IMQA 4B73A 5L30H 4MNWA 4CBNA 4SGAE 1UO6A 1QB1A 4INLA 2G8TA 3M35A 3MO9A 4X1PU 1OP8A 5LPEA 3HATH 3H7TA 1ZYOA 4VGCB 1TWXB 1DLEA 3RXIA 5C3NA 2GCTB 1A0HB 1O0DH 5AFZH 1ZJDA 3SNEA 2G4UA 3SNBA 3CS0A 4YESB 2A5KA 4GAWA 3HK3B 7GCHF 3WY8A 3BEIB 1AB9B 3Q3XA 2ZGCA 1C1NA 1JRTA 2VWLA 3HPTB 2WPMS 3U69H 2ZTYA 2AMQA 3A82A 5JBBS 1O2KA 1YPEH 4I8LA 1EXFA 3SNDA 2GDDA 3BG8A 1N8OC 5FCKA 1K1JA 3UOPA 3QO6A 1TOMH 1VGCB 2XRCA 1P10A 1UTJA 4BAOB 3T62A 2UUKB 3RLWH 2BB4A 3F9FA 4TWWA 1T8MA 1QL7A 4YOIA 2ZZUH 1SPJA 2VH6A 1MTSA 4F49A 1NESE 1TPAE 2VH0A 1YPMH 3SU0A 1KXDA 1BJUA 1E0FD 3T27A 1O2WA 1O2OA 3O8CA 2ZC9H 4MVNA 5EQRA 1AN1E 3ZZ9A 2J4IA 1YBWA 1HAGE 2P3UB 3MU0A 3LT3A 3EYDA 3E90B 5DJ7A 1QR3E 4JCNA 3RMMH 3DUXH 1GJAB 1UMAH 4O3TA 2QXIA 5GXPA 4WVPE 1SGNE 2AGGX 8KME2 1UTMA 1NS3A 1C5TA 1EZSC 2ZI2H 1H9IE 3V0XA 3UY9A 2C8WB 3MOCA 4WMFA 1SG8B 3LOXA 3RMNH 1K1NA 4CR5A 3SJOA 1LMWB 5C5OA 2TIOA 4FU9A 1DFPA 1GBCA 2HVXA 2PR3A 2IPHA 2A7JA 4BAQB 2J92A 1NFXA 1TBZH 4MPVA 1SC8U 2B0FA 1SGIB 3SQHE 3A85A 1ZOMA 2VVCA 2G5VA 1MH0A 3TITA 1AHTH 1DSTA 1O2QA 1ELDE 1NRRH 1V2WT 4NIXA 4NZQA 3M7UA 1AQ7A 2R3UA 1HAOH 2FX6A 2VWMA 4ABEA 1L4ZA 2Z9GA 3OY5U 1FXYA 1Z8RA 2A5IA 3SU6A 1O3MA 2DE9A 3BTHE 3QX5H 4ZHLU 4DY7B 4E05H 5A2MH 1C2MA 2G81E 4UFFH 3PV4A 4FU8A 1EASA 1ZGVA 2GTBA 4K3JA 3QTOH 1DDJA 1OP2A 3URCA 1P2JA 4JK6A 1THPB 1P01A 1JRSA 1JOUB 2H2ZA 4DURA 2TGPZ 1GGDB 5L2YH 4CR9A 1Y3VA 2F9PA 1GBAA 1YPLH 4NA8A 2FYRA 1C5QA 3ZYDA 3QWCH 1UCYH 1W12U 3U8TH 5TJXA 1HUTH 4I33A 2UWLA 1BRUP 4MQAA 4B74A 2AGIX 5HGGA 3PO1C 3GOVB 1V2ST 4Y8YA 1SFQB 4LZ4B 1UCYE 4ZXXH 1C5OH 4ZKRU 1T8NA 1AMHA 1ANCA 3UNSA 1C5LH 3STJA 1QCPA 2FS9A 2NU1E 4XE4A 4KGAA 1O3PB 1LHCH 3QTVH 4RKOB 4I8JA 1N6YA 1DWBH 4AGJA 1O2RA 3P95A 1CGIE 1YPHC 5FBEA 1UCYK 5EXNA 2OBOA 1Q2WA 2BD2A 4FXGH 3RU4T 5F8XA 1AU8A 5GCHG 1DUEA 1ESAA 4ZXYH 1W7GH 3RXTA 1TYNA 5G4BA 1KXAA 2UUYA 4ABAA 3EGKH 7GCHG 5JBCS 1AUJA 2P59A 2H5DA 1IHSH 2C8XB 1A0LA 2NU2E 2F83A 2R2MB 1MD7A 1F2SE 3ATLA 3GDUA 1WOFA 1KXCA 1VITG 1RD3B 3TH2H 1HJ9A 3DT0H 3M61U 1GBLA 4UEHH 2ZU4A 3ZVGA 3T2NA 3RM2H 1NFYA 1O5FH 5E2OA 2PUXB 1Y5AT 3QZQA 4NWLA 2A45B 2XCNA 4OS1A 2Y5GA 4ABBA 2FOMB 1FIWA 1TBRH 1GHAF 4YOGA 5EW1H 1PQAA 2ZDKA 1CHOG 3PMAB 2J2UA 1BMLA 4NA7A 1CA0B 3SGQE 1CU1A 3SJ9A 1G30B 3I78A 1GDNA 2SFAA 1W13U 1KLTA 3RC5A 3MH4A 2VGCB 2BLOA 4CH8B 7LPRA 3SJKA 2WPIS 1AZ8A 5K0HA 2Y5HA 4ZUHA 3EQ0H 1HAHH 1P2KA 2ESTE 1IQFA 1ARCA 2VIDA 1UVOA 2UUFB 5DGJA 3SJ8A 1SL3A 1O2LA 3SHAH 1TX7A 2ZFRH 1AE8H 2EC9H 1FN6A 3LGUA 3MH6A 1UHBA 1A0JA 1L0ZA 1KDQB 2XCFA 2P16A 3OTJE 4WH8A 3BTTE 2GMTC 1D6RA 4XFQA 1MTNB 4TWYA 1BMNH 3OX7U 1MU6B 3TLOA 3GCTG 1K22H 3PO1B 4YLUA 1LQDB 5JPMH 1K1LA 1K2I1 3PM3A 1O3FA 1F0RA 4Y8ZA 4F4OC 2BZ6H 3UNQA 1CE5A 1FN8A 1LPKB 3M5OA 3MNXA 4OS2A 5ETXA 4X2WA 2QXHA 1G3EA 3TPIZ 1TMUH 1BMAA 5F03A 1C2IA 1MCTA 5IYTA 3LGVA 1QA0A 3ZV8A 4AFZA 3TIUA 4K8BA 2B9LA 1GMHF 3P8GA 1HAZB 2HALA 1XUKA 3SBKA 1VGCC 2VIOA 3M3SA 1D3QB 5A0AE 1KDQA 2PGBB 3SU1A 2SGDE 1GI2A 3M7QA 3SZNA 1GHWH 1O5GH 1GBFA 2AMPA 4CRDA 2BY5X 4JYVH 1FIZA 3OSYA 1V2OT 3ZVEA 1QL8A 1KXBA 1CSOE 1C1MA 1V2UT 1CBWB 5DP5A 2G4TA 4E7RG 1EAXA 2AMDA 1EP5A 3RXJA 3KQEA 2BM2A 2PFEA 2O8TA 1GMDF 1SMFE 1TNKA 2O8LA 2Z3EA 5DP4A 3VPKA 2HLCA 3S9CA 3UR9A 3L6PA 1RIWC 1CVWH 1XMNB 3SU4A 1Z6JH 2EEKA 3TJVA 3BTKE 4UDWH 2AEIH 3MMGA 4FUGA 4AB9A 1O5AB 1VJAU 3FFGA 1IQGA 4B2CA 1JIRA 1H4WA 4R0IA 5JB9S 2A4GA 1Z8JB 1KYNA 1C1SA 3A7VA 6GCHG 1JIMA 4MNYA 2H9EH 1V2QT 3BSQA 1UHBB 1VJ9U 1Z8IB 3KN2A 3SV9A 2ZPRA 3BIVH 3BG4B 2F9UA 3KIDU 3N7OA 1RJXB 3PTBA 1S5SA 3C27B 2F3CE 4H6TA 1ZRKA 4LXBH 1W14U 4IW4E 2Z9IA 3VXEH 4O03A 2ALVA 1MU8B 1V2JT 1HBTH 1C5UA 2R0KA 3LH1A 1O5EH 4IN1A 4J2YB 4H42U 1ZHMA 2WV5A 3A7XA 1ZPBA 4NIWA 2KAIB 1G3DA 1GHAG 2RCEA 3AVZA 1ARBA 3QK1A 4ZROA 3RXVA 2SGEE 3FP7E 1TBQH 1QJ6B 1AY6H 1O37A 1ELBA 2QXGA 1AFQB 1SGTA 1O3NA 1V2LT 4WY3A 1TPOA 1YYY1 2WYGA 3LPRA 2J9NA 2ZGJA 1O31A 2BLWA 5AF9H 2GCTC 1P03A 2WUCA 2GKVE 1ID5H 3RXFA 3TK5A 4H6SB 1C9TA 1BMMH 3Q3YA 1Y3XA 1ZPZA 1GI0A 1PQ5A 1VCWA 3LH3A 5AHGH 2TGAA 3MU1A 1GJ5H 2I6SA 1QBNA 2XC5A 3M7TA 5E0HA 3G01A 2Y81A 1CGJE 5L6NH 1YLCA 3ELAH 4X6OA 4AOQA 4MNVA 3URDA 3UREA 1DS2E 1AZZA 3ATIA 1KSNA 1AWFH 2P8OC 1BTUA 1XVOA 2CV3A 2QA9E 1TRMA 2H1UA 3ZYEA 5J4QA 1ELGA 1J8AA 1ANDA 1GBDA 1NRPH 4FUEA 1CQQA 2FLRH 5DKMA 1C1WH 2ZF0H 3P17H 2A7CA 1FONA 2OXSA 2ODQA 1NPMA 1W0ZU 1PPEE 1SLXB 1DPOA 1TOCB 1GI4A 1UTOA 3ZZ8A 4BAHB 1OOKB 1NZQH 4Y0YE 3SNAA 1EOJA 3BEFB 4THNH 2FOEA 2VVUA 3KF2A 1IAUA 2ZDNA 1T8LA 3LJOA 4HZHA 2JH6D 1EAIA 6ESTA 4CRFA 1C1RA 4X1RU 2BXUH 1TQ0B 2VVVA 1XXDA 1OSSA 3SN8A 4X6MA 1K1MA 3IG6B 2TGDA 1RIWB 3ZZ6A 2VWOA 1P9UA 1MTVA 1A7SA 1DVAH 2BDHA 2FM2A 2J94A 2YNBA 2H6MA 2PSYA 2G5NA 3FZDA 3LGTA 3GY7A 1KXEA 2I6QA 1GCTC 2Q6GA 1RGQA 2QV1A 3GYLB 1MKWK 2O9QA 6CHAB 1NFUA 1BQYA 1S0RA 1YC0A 3W94A 1IOEA 1NY22 5CHAB 4D7FA 2HNTF 4KKDA 1XUIA 1Z71A 4OGXA 3M5LA 1MTWA 4VGCC 1IQNA 3E8LA 2AIQA 1OWJA 3MNSA 1TALA 1V2PT 2CJIA 1ZHRA 2BD4A 2OBQA 1D3PB 2W3IA 2SNVA 3I29A 3O8BA 2B7DH 3AW0A 2XC4A 2ZQ2A 3AW1A 1ANEA 2GD4B 1MZDA 1C1VH 3RXBA 6LPRA 3H5CB 3NKKA 4FVBA 2BLQA 1SGFG 1AIXH 2V35A 3FP6E 3TJNA 3A7ZA 2FX4A 2J38A 1D9IA 4KELA 1OWEA 2JETC 4XBDA 2FIRH 2H9HA 2ZHDA 5FPYA 3ZZ7A 2PKSC 1GI6A 2BVSH 5T6DA 3M36A 2BLVA 4CRGA 3LC3A 2R3YA 1O2VA 2ODPA 1SQOA 1TNHA 1EJNA 1ABIH 5DG6A 1OXGA 1O5DH 3MHWU 2C90B