3I78A

35/99/170/186/220-loops of fxa in sgt
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
229
structure length
229
Chain Sequence
VVGGTRAAQGEFPFMVRLINEENEGFCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSSSSFILVANEMICAGYDTKQEDTCQGDSGGPMFRKDNADEWVQVGIVSWGEGCARKGKYGVYTEVSTFASAIASAARTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Combinatorial Enzyme Design Probes Allostery and Cooperativity in the Trypsin Fold.
pubmed doi rcsb
source organism Streptomyces griseus
total genus 56
structure length 229
sequence length 229
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i78A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i78A02
4KTCA 3A81A 3RXQA 2HPQH 1G37A 2TIOA 1G3BA 1O3AA 1P12E 1NROH 4D7GA 1E38B 1A3EH 1TA2A 1BDAA 3SORA 4CHAB 4DJZB 3F9HA 4JK5A 1W7GH 3EE0B 3TH2H 1A5GH 1K21H 3PWBA 2JH0D 2C3SA 2XWBI 1SFIA 3M7QA 1D3QB 1K1LA 1AB9C 1L1JA 4FU9A 1C5SA 4UD9H 1CA0B 1GBJA 1TA6A 3MNCA 1HAZB 3BSQA 3VB4A 2F3CE 4BOHA 1YKTA 1QQUA 1THPB 1G3EA 1Z8IB 1BT7A 5JB9S 1WBGB 2BD7A 2GMTB 1HAYB 2XBVA 4FUJA 5EXNA 1SHHB 4BTTB 1ELAA 5HMAA 1OYQA 1GJ9B 1YCPM 3KHVA 3A83A 1C1NA 4E7NA 3S0NA 3ITIA 1O2SA 3GY5A 3ZZDA 3DUXH 1LHGH 1O5CB 3O8DA 3SV7A 2G52A 1F2SE 1O2JA 4TY6A 1GBIA 4TWWA 5C1YA 1Z7KA 1OWIA 5JDUB 4WH8A 2ZKSA 1O0DH 1UTMA 1J15A 5C3NA 1L1NA 3AW0A 1OPHB 1NC6A 4O97A 4I8GA 2H2ZA 4BAHB 2PKAA 1FJSA 1TBQH 2PGQB 5DPAA 1P2NA 1O2QA 1S0RA 1IQMA 2GCTC 2A5AA 1QFKH 2WPIS 1YCPH 2WUBA 3OU0A 2K1QA 3RMOH 3FP7E 2HPPH 1LKBA 3E6PH 3RLYH 1XKBC 3LH3A 1P05A 1EPTA 4CRGA 1IQEA 1MKXK 2JH6D 1GDNA 3SV9A 2Z9KA 3ODFA 1D3TB 1PYTD 3K6YA 1OSSA 1Z8GA 1ANCA 3EA7A 1YLDA 1FN6A 1TALA 4NWKA 4Z0KA 3TGIE 4FVBA 1U6QA 2FI5E 1FUJA 3O8BA 1DT2A 3Q00A 1TX7A 2A4QA 2ZO3H 3MI4A 2OD3B 5DP5A 1YF4A 5EOKA 1P2JA 1O37A 4CR5A 3OY6U 1GMCG 2P3UB 2ZU1A 3M61U 1C2LA 3STIA 1ZRKA 1QY6A 1S83A 2J95A 4K1SA 1V2KT 1GI8B 1GBBA 3VXEH 1ZTLA 1V2NT 3B8JA 1BTUA 3LGWA 3PMHB 1O2HA 1C2FA 1SGRE 1QTFA 2FTLE 3H7OA 3SHAH 3LH1A 1MCTA 1C5RA 4MVNA 1CSOE 1AIXH 3TNSA 4JZ1A 3DFLA 5GDSH 1ABIH 3FVFB 5DP8A 3ZZCA 3MFJA 1GG6C 1ZPCA 1THRH 1WTGH 2TBSA 1GDQA 1T4UH 4X2YA 3GCHC 1O3EA 1SVPA 2FPZA 3CS7A 1Y5BT 3U8RH 3NXPA 3UFAA 1GVKB 1TAWA 3MHWU 1SGFA 1AGJA 2B9LA 2D8WA 2WPHS 4A7IB 1UTKA 3QX5H 4JZDH 2BB4A 1HAIH 3FAOA 4RKOB 4MNWA 1ARCA 2VINA 1C1UH 1AKSB 2V6NA 3RXUA 1Q2WA 5F6MA 1P9SA 1EZQA 1H9LB 3NK8A 3E0PB 3NPSA 5CMXH 2DE9A 5A0CA 2FM2A 4NZLA 4CBOA 3LOXA 4I33A 5E2PA 1EZXC 3NZIA 1EAUA 1FN8A 2VWNA 3A8CA 4K60A 3KCGH 4ZKRU 2Z3DA 4X8SH 3U69H 1OS8A 1EZSC 1VJ9U 3GY8A 1LVBA 3S7HB 3BEIB 3T25A 4DIHH 1W12U 2W3KA 1TRMA 3MO3A 1GCTB 1AZ8A 1DY9A 1NU9A 1XUGA 1K9OE 1CQQA 2ZU3A 5FPSA 4FUIA 1SQAA 4NWLA 3CS0A 2RA3A 4KP0A 1HRTH 5C5OA 1E0FD 4ZKNU 1AU8A 4SGAE 1F0SA 1PPFE 1BZXE 1QCPA 1O3PB 1GMCF 2GT8A 1O2UA 1DICA 2GX4A 1MTNB 1P8VC 2W5EA 1C5ZB 1BQYA 3L33A 1C2JA 2D26C 3TH4H 4K1TA 4BXWA 4ISNA 3PM3A 1O2XA 2XYAA 4Y0YE 1WQVH 2QA9E 1BBRH 1V2QT 2I6SA 2DUCA 3GCNA 3S7KB 2H9HA 1C5WB 2QN5T 3TH3H 5CE1A 2VB0A 3A84A 1TBZH 1Z1JA 3FANA 4Y11E 1BCUH 3KF2A 1AUTC 3A87A 1QL8A 3I29A 1GHZA 1MTSA 1TNGA 1UTJA 1C1VH 3GDUA 1GHAG 5L6NH 2C8YB 2GDEH 1WV7H 1PQ8A 1FY3A 2PTNA 2VWLA 3ATKA 2STAE 3PYHA 1MZAA 1DANH 1KLJH 2OBOA 3M5LA 5T6GA 1O36A 1VJAU 2Q6DA 2BDBA 2XC5A 5AVDA 2PTCE 1VITH 2Q6FA 5FX6A 5DO4H 4H4FA 1O2LA 2G4UA 1RIWC 1ZHPA 1ESTA 1EJAA 2XC4A 4GSOA 1A4WH 3BG4C 1EJNA 1EX3A 1YPGH 4MPXA 4ISIH 5IDKA 1RD3B 2VH6A 3SNDA 4K8BA 1K1NA 3LGYA 3ZYDA 4WWYA 1KTTB 1UVOA 1C2DA 1LCYA 5L2YH 1NM6A 8KME2 1YPHC 1XUIA 3QZQA 4JYVH 3A8AA 3UNRA 1LHEH 3ZZ8A 1QGFA 3OY5U 3PTNA 3ZVBA 2Y5GA 1YLCA 1ELEE 1GI1A 5TCAA 1DWBH 1O2IA 5JB8S 3RU4T 3RM0H 3LPRA 1AQ7A 1T8OA 3D65E 4NIXA 1QB6A 1V2OT 1EAXA 4BANB 2YNBA 2VH0A 3PV4A 3A89A 3GDSA 2CGAA 1C4U2 3IITA 1KXDA 1GJ4H 1T31A 3T28A 2OBQA 2AS9A 3ZV8A 3UNSA 1RTKA 3SGBE 3BIUH 1O2KA 1FDPA 1SOZA 1TE0A 3SHCH 3L6PA 2FMJA 2OTVA 3QTVH 2PWXA 1ETTH 2A2XH 2XCFA 4Q7YA 1HAOH 1VGCB 3UQOA 4X1SU 1GHBG 1A2CH 1BTHH 1Y3XA 2XW9A 3SV6A 5DP3A 2CJIA 3BTFE 5LGOA 1Y3YA 2O8UA 1TX8A 2P95A 4I7YH 1CT0E 4IS5A 3SNCA 1GHAF 3SNAA 1ZTKA 1O3FA 2A7CA 2G4TA 1NN6A 3LC3A 4D9RA 3MTYA 1TRNA 2O8WA 3P17H 2WPJS 4I8HA 2BD9A 3LGVA 2FWWA 1ELTA 2HWLB 4H6SB 1T4VH 3BF6H 1KLIH 1QJ7B 2BDHA 2PKAB 3EA8A 2HNTE 1BMMH 4TYDA 2PFEA 5EGMA 4AG1A 1PPEE 1C1WH 2J9NA 3R0FA 4ZAEA 3SU2A 1H1BA 3BTHE 1BTPA 3BN9A 4X8VH 5DGJA 1EPTB 3SQEE 3SNEA 4ABFA 3SQHE 2BDIA 1SGTA 1BRCE 1LPKB 1ZPZA 2P16A 5F8TA 1Y8TA 3S9CA 2GV6A 1V2WT 1J16A 1FY8E 1QB1A 3F1SB 4NGAH 5GCHG 4CRDA 2A32A 1PPHE 1DLEA 4CRAA 1GJCB 2XBXA 4NIVA 2ZECA 3ZVGA 1AD8H 3UOUA 1TPPA 3RMMH 2Y81A 1HPGA 5CHAB 1AUJA 2FYQA 3LIWA 4WVPE 1IQIA 5E0GA 5FPTA 1GJ6A 2BD4A 5A2MH 1SL3A 1GHBF 1G32B 1EATA 3A82A 1NRPH 1QRXA 2VGCC 5EQSA 1O3MA 3DFJA 4XBBA 1O3OA 4JMYA 2VNTA 3SJIA 3MNSA 5DP9A 2O8MA 3T62A 3ZZ9A 2FOGA 1NESE 5DK1A 4FVDA 4B75A 1Z8JB 5F8ZA 2HALA 1V2VT 3UR9A 2PW8H 4U30A 1O3BA 1P06A 4DY7B 1FY5A 6CHAB 3RMNH 5J4SA 1TNIA 4IMQA 4X6PA 3RC5A 1ZHRA 3M5MA 4X1RU 1EAWA 1ZOMA 3A7WA 1GJBB 1SLXB 3QLPH 2C8XB 3NKKA 1NPMA 1ZRBA 2CXVA 4FUHA 1F5KU 4JZIA 3BEUA 1ZGIA 3M3VA 1C2EA 1YBWA 2A31A 2HRVA 4X6OA 5DJ7A 1ZSLA 4AGKA 1NTPA 1VZQH 1IQLA 1AE8H 2CMYA 2XBWA 4Y71A 2F9VA 1GBLA 1Y5AT 2GZ8A 1C5XB 4MQAA 1JRSA 2BMGB 1MUEB 3LJOA 4YLQH 3VFEA 2ZFQH 1INCA 1O32A 3AAVA 1NFXA 6LPRA 3MU5A 1QR3E 4DIIH 1P2OA 1EP6A 1P3CA 3LGUA 2RG3A 1VCQA 2FIRH 2UWOA 2EA3A 3AASA 5GCHF 2Z9JA 3RXEA 2C4FH 2PKSB 3UWIA 4GCHG 4HFPB 1GGDB 1L4DA 3P70B 1BMNH 1DVAH 1JWTA 5HM2A 2NU1E 4BAKB 3D23A 1QL7A 1YP9A 4J2YB 2SGFE 2VIPA 3I77A 1DWDH 2ALPA 4MG3A 2BY6X 3UOPA 1SGQE 3VGCC 3RLWH 2ZIQH 2Z9IA 3SJKA 3BIVH 1DUAA 4INHA 1W13U 2TRMA 1F5RA 1DE7H 1TOCB 1TLDA 2ZHEH 3PMAB 8LPRA 2GD4B 1H9IE 3JZ1B 1EB1H 1K22H 1N8OB 4CRFA 1E37B 1UHBB 2SGPE 1T7CA 5EPNA 4DT7B 1UK4A 1O3LA 5C5NA 4JYTA 2TGPZ 4KKDA 3BTQE 2J38A 1O2GH 2YOLA 5ETXA 1NFWA 1B0FA 3MU0A 3SGAE 2ZPQA 1DM4B 1C1QA 1JIRA 4I8KA 5JYIA 3MYWA 2ZFPH 1TGBA 1OP2A 3EGKH 3H7TA 1UJ1A 1SMFE 1C5LH 3RXCA 1JIMA 1SQOA 1AFQB 4ISLA 1KXBA 1LTOA 2ZGJA 2ZCLP 2RDLA 2NWNA 2CV3A 2BVXH 1DDJA 5JBBS 1W14U 1D4PB 5A8ZA 1PPZA 2VIWA 2W7UA 1GI9B 4IMZA 1OOKB 5TCCA 1LKAA 2GDDA 1IQHA 2VIVA 3V13A 1S0QA 2ANKH 2NU0E 1MAYA 1BHXB 1MZDA 5C2ZA 1UTQA 3P92A 1C5YB 2ZHWH 1G3CA 2CHAC 3MH6A 4HTCH 3E91A 1JXPA 1MD8A 1MKWK 1TX6A 2VIOA 2VU8E 4GCHF 3TGJE 2WPKS 1FI8A 3SGQE 1GBMA 5JBTA 4R8TB 2B7DH 4JZFH 3P8GA 1OXGA 1T8NA 3W95A 2WV5A 1G30B 5DP6A 4A5TS 4KGAA 3SI4H 1ZMNA 2FS9A 1X7AC 1BTYA 3PROA 1BA8B 4FUCA 1WU1A 4ASHA 1O38A 1MQ5A 1SG8B 2WYJA 2P8OB 1H8DH 1O30A 1ZHMA 3E16B 3F9FA 1BTWA 3U9AH 4HGCA 2PHBA 2P93A 2RA0A 3MNBA 1W0ZU 2TGTA 1P10A 3RDZA 1HJAC 2EI7A 1VCWA 1BITA 3TPIZ 1CBWB 2J2UA 3C27B 4CH8B 2W3IA 4FUEA 1ELBA 1V2LT 2P94A 2FX4A 2Y6TA 3M36A 1LVYA 3HKJB 1IHTH 1A3BH 3CENA 3M7UA 3FP6E 3RXJA 4DOQA 1CGIE 3GY6A 5FHTA 5EQRA 2F9UA 1WOFA 1SI5H 2O8LA 1SC8U 3IG6B 2BLOA 4A92A 3RXKA 1Y3VA 2SGDE 3F9EA 1TGTA 1A0JA 1C2KA 1HAHH 1DSTA 2SNWA 1O2PA 5AHGH 2Y82A 1E36B 1GPZA 4AYYB 3RXSA 2VIQA 3LU9B 1IOEA 2BQ7B 4NFEA 1P2IA 3ELAH 1SPJA 3LGIA 3K9XB 5GJ4B 4D7FA 4ZHLU 4AN7A 1TNLA 3DD2H 1SGYE 1SR5C 2QV1A 3M5OA 1B0EA 4XFQA 2A1DB 1JBUH 4Y8XA 3VB3A 3NCLA 1WCZA 2KAIA 2F91A 3HPTB 1N6XA 2WUCA 2ZC9H 1O5GH 3TJNA 5LH8A 3A85A 3OSYA 1DY8A 1ZJKA 2ZU5A 4WMDA 4X1NU 3MU4A 1DLKB 2RCEA 3HGPA 1ZGVA 2FYRA 5EW1H 3M3TA 1GHYH 1GI3A 3TU7H 1S81A 1XUFA 1QJ6B 3VEQB 4UONA 4LXBH 1BBRE 1C1PA 1F0TA 2BD2A 2H9EH 4NA7A 4OS5A 3E1XB 5EPYA 1TIOA 1CA8B 5I46H 1Z1IA 2G51A 3ZZ6A 1EKBB 1QNJA 4YOJA 2AIQA 3SJOA 1C5MD 2QF0A 2AERH 2WPLS 3FZZA 1C2IA 4J1YA 1FNIA 4NZQA 4FUFA 1QQ4A 1TNKA 2A7JA 2GKVE 4DGJA 3UPEA 4GPGA 4NFFA 3TITA 1ZR0A 1YC0A 3OYPA 1AI8H 3MOCA 1V6DA 4OS1A 3GYLB 2JETC 3MU8A 1CVWH 3EAJA 3QK1A 1GBFA 1UO6A 4X2WA 1TRYA 4VGCC 3BTKE 4Y6DA 3PO1C 1V2MT 3W94A 1C5QA 2Y7XA 2BX3A 4AG2A 2BY8X 3RU4E 5BPEA 1P9UA 2OC1A 2R2WU 3MNXA 1HBTH 5E0HA 1A61H 1ABJH 2ZGHA 4IGDA 4I8LA 4UFDH 3RM2H 3QN7A 3S9BA 3PMBB 4ZKOU 2SGAA 2BD8A 4BAMB 1HNEE 4MLFB 1PJPA 1N1LA 4YT6H 3UQVA 1TGSZ 5FBIA 1EP5A 2H1UA 2FOEA 4E7RG 2FLBH 3GISB 1PYTC 1O2YA 1KDQB 1KXCA 2A4RA 1LPGB 2BX4A 2QC2A 3PWCA 5FPYA 3STJA 3TVJB 2QXJA 2XNIA 5JBAS 1GDUA 3ZZ4A 1GBDA 1GBTA 1GBCA 4SGBE 2ZCHP 3BTME 1HAVA 4Y8ZA 1GWAA 2IPHA 1MBMA 1AB9B 3IWMA 4ZXYH 4YOIA 2FXRA 4X6MA 3B9FH 4GLYA 4AFUA 2ZFSA 1C5PA 4UE7H 2R0KA 4X8TH 4X0WU 1GJDB 5EXMA 3SU5A 3BTWE 3DA9B 4XDEA 3KIDU 5ESTE 3SNBA 4B2AA 4ABDA 5DG6A 3PLPA 1P11E 2OQ5A 5A0BA 5EU8A 3Q77A 1C2HA 4AOQA 1FPCH 1EZUC 1YGCH 1PPBH 2VJ1A 1UVTH 1TNJA 3GCTF 1O34A 1VR1H 1WSSH 1MQ6A 3LC5A 1GVZA 1HB0B 2Z3CA 4ZHAA 4H6TA 5A09A 1QHRB 2VVCA 3ZVAA 3U1JB 2W26A 1F7ZA 1L2EA 2FDAA 1SGDE 1C5TA 1TMBH 1O2WA 3SBKA 1DWEH 2GCTB 2Z7FE 1HXFH 2IN2A 4DVAU 3A80A 3DHKH 1ESBA 1TQ0B 1O3GA 4PROA 3A7YA 2BOHB 1BBRK 1AVGH 5LPFA 5DP7A 3SV2H 1AWFH 1NFYA 4Y76A 4Q7XA 4Y0ZE 1SLVB 2OQUA 2ZU2A 1QB9A 4WXVA 2A4GA 2VWOA 2FI3E 1C1OA 1OWJA 3ZZAA 1OP8A 1EASA 2UUJB 2V3HH 2F9PA 1ELDE 3MO9A 3KGPA 1P03A 4CBNA 4CH2B 1ACBE 1O5FH 1S85A 1Y59T 2EC9H 4XBDA 1BB0B 4GAWA 2BZ6H 7ESTE 4K2YA 3TJVA 4UDWH 1P57B 5L2ZH 1HIAA 3N7OA 1GMHG 1UK3A 3WY8A 3GYMA 4FUDA 2FOCA 4R0IA 1O3CA 1TWXB 1WAYB 2XXLA 4NIYA 1J9CH 2GZ9A 4A1XA 3S9AA 4CHAC 2ANYA 2F9BH 3UREA 1XM1A 1BRBE 3A7TA 4KELA 1FAKH 2J92A 3SUFA 1ZTJA 2GP9B 4AYVB 2F9NA 3OX7U 4OS2A 1K28D 1OWEA 2ZA5A 2CF8H 1C1RA 1AO5A 1CA0C 2ZPSA 1GG6B 1EJMA 5JBCS 1Z71A 2PUQH 3EA9A 3GCHB 3SW2B 3VXFH 4AGJA 4ZMAH 5ABWA 3MO6A 2GMTC 1K1MA 1OX1A 3E90B 1YPEH 3G01A 3ZVDA 1GBAA 4IN1A 1TPOA 2AIPA 1MH0A 3QZRA 4YT7H 2OUAA 1TMUH 1OWDA 1PPCE 3ZYEA 1FQ3A 3UTUH 2ZHFH 7KMEH 4Y7BA 2H6MA 4AB9A 1HAXB 3KQBA 5HM9A 3Q3YA 4ABGA 3RU4D 1ARBA 1C5VA 1O33A 1F92A 1ZMLA 2BOKA 3VB7A 2UUYA 4XSKU 4AFQA 2KAIB 1YPMH 3M35A 1W0YH 1MU6B 2BD3A 1PQ7A 3U98H 3PMJA 2FEQH 1UTNA 2ULLA 3AW1A 4OS7A 3P8FA 2CF9H 2ZCKP 1D9IA 2HGTH 2Y5FA 1XXDA 2XC0A 5HGGA 1SGEE 3P95A 5C1XA 2SGEE 4DW2U 4E05H 4LZ1H 1ORFA 1SGCA 5E2OA 1GMHF 2BM2A 1GHWH 2AFQB 1XKAC 3TLOA 4BXSA 1OYTH 2ZU4A 2ZDKA 1DXWA 5F8XA 4ESTE 2QIQA 1HCGA 4BTUB 3ZVFA 1BMLA 1WTHD 2R2MB 5EXLA 2F9OA 1TQ7B 1GI4A 2FO9A 1LMWB 3AVZA 1XVOA 4WY3A 1P2QA 1DS2E 1GI2A 3SU6A 4X2XA 3D62A 1O3KA 2BLVA 3QO6A 5C20A 1SOTA 1BJVA 4AFSA 4KTUA 1GBKA 3ATMA 1ANEA 4XE4A 1ELGA 2XTTB 1UTLM 4YM9A 2ZZUH 3GCOA 5AFZH 1UCYH 2A45B 5FXLA 2PSYA 1ELCA 4TPYA 1C1SA 2J94A 2FOHA 4NA8A 4DCDA 1Q3XA 1EQ9A 4WXIA 3UIRA 1Q31A 7GCHG 4U01A 1RIWB 1LVOA 1HDTH 2BTCE 3BG4B 5C67A 4MNYA 8GCHG 1O2NA 2ZWLH 3BEFB 2FOBA 1UK2A 2ZGCA 3RXAA 4LOYH 1MMJN 3A7XA 1YPHE 3QDZB 3MMGA 4Y79A 2G5VA 2ZPRA 1C9PA 2AGGX 1XXFA 2BLQA 5E0JA 4AX9H 4Z6AH 1LHCH 1NZQH 4NIWA 4CR9A 1IQJA 5F03A 4YTAA 3NWUA 4ZUHA 2ZTXA 1FY4A 1O3IA 2P3FH 1MKWH 2GVFA 1O2MA 1O31A 2OXSA 1DUEA 2H9TH 2OINA 2OLGA 4X6NA 2FLRH 3MU1A 5LPRA 4DG4A 4TY7A 4M7GA 1O2TA 2R9PA 4ZH8A 2V0BA 2ODYB 3FP8E 3RC4A 3TK9A 4OS4A 1GCTC 1A0LA 4E06H 1ELVA 2VIDA 1MBQA 3SUGA 4BAQB 2G5NA 4YOGA 5TJXA 3VB5A 3MH4A 4FXGH 4BTIB 1TABE 1IQNA 2P3TB 2FOFA 3URDA 1UTPA 2ZFFH 3M3SA 3C1KA 1MTNC 3A7VA 1EOLA 1C5NH 6ESTA 5B6OA 1O39A 1SGFG 4UFGH 4O3TA 3PTBA 2F83A 4ABEA 1F0UA 5FBEA 2ZTZA 4ISHH 5E8EH 5IYTA 4ABAA 1E35B 2VVUA 1RXPA 4K8YA 4TWYA 4ABHA 1S84A 2ZNKH 1PPGE 2V3OH 4Y8YA 3P6ZB 1V2JT 1A1RA 1BIOA 3ATWA 4TPIZ 2XBYA 4X1QU 1MKXH 3QGJA 1AE5A 1FAXA 3E0NB 1AZZA 1P02A 3ZZ3A 1SBWA 1EB2A 1NU7B 2HNTF 3BTEE 2AMDA 3QGNB 1CU1A 1ANDA 1FY1A 3D49H 1C1TA 1RJXB 5HXFA 2FZZA 2NU3E 2ZEBA 3MH5A 3KQDA 4YLUA 1YM0A 1QJ1B 7GCHF 2VVVA 2WV4A 8GCHF 2WINI 1BRUP 2BQ6B 3ODDA 2ASUB 2FX6A 3UNQA 1FIZA 1YPKH 4K69A 3HK3B 4BNRA 4X8UH 3GOVB 3SV8A 1HFDA 1PQ5A 2BLWA 4AB8A 1T8LA 3DT0H 3GDVA 1A5IA 2QXGA 1UMAH 1FIWA 1O3HA 1E34B 4MNVA 1Y3UA 1BTZA 4A1TA 5LPEA 2QXHA 2Y80A 1HLTH 2PLXA 1ETSH 4INKA 3KQEA 2G00A 1QBNA 5AFYH 4MPWA 3E3TA 1FLEE 1FMGA 5EQQA 1HIAB 4MDSA 1EOJA 1P3EA 5C1UA 1Z8RA 3OTJE 4ABIA 2C8WB 2GT7A 1P09A 1NRSH 4LZ4B 2R3YA 4BAOB 2QCYA 1GJ8B 3JZ2B 3M7TA 1NRRH 5GWZA 4WMFA 1V2TT 2ZHQH 1AHTH 2AEIH 3QWCH 2ZI2H 1GJ5H 1Z6EA 1JOUB 1QA7A 1T32A 2VGCB 2I6QA 1CHGA 1T8MA 4FUGA 1VGCC 3P8OA 1O2RA 4GUXA 1XMNB 3HKIB 2LNCA 4B74A 5HYOA 3A88A 3F9GA 3RXGA 4IBLH 3SZNA 3TJOA 4JZEH 2B5TB 4B2CA 1A0HB 5I25A 1MTVA 3SU4A 1C1MA 1AY6H 4LK4A 4Y7AA 1MU8B 1K2I1 1H9HE 3SU1A 3RXOA 3S69A 2WPMS 2ZF0H 4OS6A 2FESH 1GVLA 3UWJH 2AMQA 1L1GA 2QGRA 3E8LA 1QRWA 4UEHH 3RXIA 5T6FA 3KL6A 3RXMA 1GBEA 2BYAX 1CO7E 5K0HA 1QBOA 1WYKA 2HNTC 1PFXC 3RMLH 2Z9LA 1KXEA 1IHSH 1ZJDA 2BY7X 1SHYA 1Y5UT 2THFB 1TB6H 3R3GB 1MCVA 1EPTC 1LQDB 2C93B 2BDCA 3PB1E 1M9UA 1WUNH 4O9VA 3T5FH 2AH4X 1QRZA 3BTGE 1YCPK 3ENSB 1G9IE 2BXTH 3V7TA 1B7XB 1CE5A 1W3CA 1S6FA 3HATH 5DKMA 4OGXA 1NS3A 1TGCA 1LHFH 4XBCA 1QBVH 3KQCA 2HLCA 2ZDAH 2GV7A 1UVSH 2UUFB 2SFAA 4NCYA 2GCHG 2BY9X 4A1VA 2AMPA 2A2QH 2B8OH 1XX9A 6GCHG 3MH7A 1HYLA 3BTDE 2Y5HA 1V2PT 2BVSH 3GCTG 3ZVCA 3T29A 3VGCB 5CHAC 1H8IH 3ZZBA 3HGNA 2Z3EA 1BJUA 1CT4E 2PV9B 1ZYOA 1DSUA 2Z9GA 5FAHA 4U32A 3LGTA 4ABBA 1ZPBA 1W11U 2ALVA 2ESTE 4GHTA 3VB6A 4GHQA 3EYDA 1GHVH 1ID5H 1K1IA 3BV9B 4U2WA 5T3HA 1BOQA 1G36A 2H5DA 5L30H 1HGTH 2ZFTA 1FONA 1O5AB 3Q3XA 2SNVA 2PSXA 5A8YA 1W8BH 1MTWA 4Y10E 1MD7A 3A8BA 3SU3A 3FFGA 3ZZ7A 3EDXB 1BMAA 1LHDH 3ATIA 3UR6A 1GI0A 3F68H 4KTSA 2BDYA 1KLTA 3LJJA 6CHAC 1N6YA 2SGQE 1O3JA 1RFNA 1XVMA 1D6RA 2ZDVH 3RXRA 1BHXF 4K1EA 1TMTH 5GXPA 3HK6B 1G3DA 2GTBA 3QTOH 3Q3KA 3K2UA 1JRTA 5K7RA 1OP0A 1CHOG 1DFPA 1K1OA 4AZ2B 1BUIA 5FCRA 2ZTYA 1ESAA 2Y7ZA 3A8DA 3TNTA 1GJAB 4O03A 2G81E 1KYNA 2TGAA 4B71A 1W7XH 1THSH 1TONA 5EODA 1IQFA 2B0FA 1UHBA 1O35A 2CHAB 1EUFA 3SOSA 1TPSA 1GL1A 4WJG2 2EI8A 2PUXB 2FOMB 3RC6A 2EI6A 1HAGE 1O2OA 5DP4A 1Y3WA 2ZHDA 2QF3A 3RXVA 1NT1A 3L3TA 3RUOA 1ZLRA 4AORA 1KXFA 2ZDLA 2FTMA 2GCHF 2XWAA 3AAUA 3GICB 3SI3H 1LDTT 2BDGA 1FV9A 2PKSC 1GI7B 6GCHF 3M5NA 1GGDC 1D3PB 2FI4E 1A7SA 3ZVEA 2ANWA 2OCVB 1W10U 4IN2A 2OC0A 1NY22 1XUJA 2A0QB 4B2BA 1C2GA 1GMDG 1KSNA 4MNXA 2VWMA 4IC5A 2BZAA 3A7ZA 4X2VA 1XUKA 4INLA 1S82A 2C8ZB 2Z94A 3F6UH 1H4WA 1V2ST 2D1JA 4B1TA 2PR3A 3SUDA 3LDXH 3TGKE 1F0RA 3UY9A 4ABJA 2ODPA 2R0LA 1LQEA 1HJAB 4A6LA 1YYY1 1N8OC 2BVRH 2STBE 4THNH 1J14A 1BRAA 1VITG 2G8TA 1SSXA 1LVMA 1PQAA 1C4V2 1FPHH 2HOBA 1TYNA 2IJOB 3O8RA 1TBRH 4WF8A 4MTBA 4F49A 1TFXA 1G2LA 5G4BA 1O5EH 3KN2A 3GY2A 2H5CA 4B73A 3QUMP 1OWKA 4NG9H 1GJ7B 4XOJA 1SGPE 2G55A 2ZDMA 3BTTE 1AVWA 4FUBA 2BHGA 1CHOF 2WYGA 2ZDNA 1A46H 3KNXA 5PTPA 1J8AA 1AFQC 2BXUH 1HXEH 1GCDA 1KIGH 2DE8A 4JK6A 2UWLA 3U1IB 2ZQ1A 1TNHA 2FS8A 2TGDA 1UVPA 2OP9A 3V0XA 1ANBA 1B5GH 2UWPA 2J4IA 3A86A 1KTSB 4RKJB 1AN1E 1RTFB 4HI3A 3RXDA 8ESTE 1O5DH 1L0ZA 1HJ8A 4I8JA 5T6DA 1VCPA 1MAXA 1ZSKA 4JYUH 2GZ7A 1TOMH 3K65B 3ESTA 3SJ8A 1G2MA 1SLUB 2ZFRH 2GGVB 4FU8A 1W2KH 3TK6A 4MPUA 2HVXA 4HZHA 5GIBA 4YESB 1J17T 1GI6A 1L4ZA 1SQTA 1DITH 2NU4E 4WH6A 1Z6JH 4QT8C 1ZSJA 1HV7A 3ZZ5A 4FU7A 1AFEH 4ZHMU 1WQSA 1GMDF 4RN6A 4IW4E 4Q2KA 5EG4A 2JKHA 1SLWB 2CN0H 3B23B 2M5TA 4JCNA 1ZMJA 4AFZA 5H4IB 4D9QA 1TPAE 2Q6GA 3TK5A 4K5ZA 4GVUA 3SU0A 5GPIB 1C5UA 1P0SH 4ZROA 1QA0A 4Q80A 1OKXA 3ATLA 5FX5A 2LPRA 2ZG0H 4I31A 1P01A 2Z6BD 4NA9H 2P8OC 9ESTA 1KY9A 1RRKA 2Q1JA 1KXAA 1VITF 4Q7ZA 1V2RT 3URCA 1UCYE 1SB1H 3V12A 1ELFA 2A7HA 2ZGBH 1SGNE 2JETB 4NSVA 3O8CA 4WMEA 3H5CB 2PGBB 1CBWC 1DWCH 1IQKA 1O3DA 1UVUH 4K3JA 4RSPA 5SGAE 4VGCB 2BY5X 3PO1B 4UFFH 1IAUA 1NO9H 3KEEA 4CRBA 1GL0E 4OGYA 3U8OH 5A8XA 2QXIA 2TPIZ 1EAIA 2FOAA 1C2MA 1AKSA 2NU2E 3RP2A 2AGEX 1HUTH 1GI5A 2ZP0H 4D76A 1FXYA 1CT2E 3VPKA 1SFQB 1P04A 3LONA 2XRCA 2YNAA 4UFEH 1YPLH 2D2DA 2UUKB 1QL9A 1O2ZA 2OC7A 1AMHA 2BDAA 1FZZA 3GY4A 4F4OC 2ODQA 2QY0B 1HJ9A 3RXFA 5JPMH 3RXTA 1UTOA 2ANMH 4DURA 1LPZB 1CGJE 2IOTA 5A0AE 4I32A 1IQGA 4IC6A 2BQWB 2W7SA 2QYIA 1CGHA 2JH5D 2BD5A 5J4QA 3MWIU 3PLBA 1HAPH 3SUEA 3EQ0H 1SGIB 4O3UA 2AGIX 5BRRE 2QAAA 3GY7A 1QURH 4X1PU 1S5SA 3FZDA 5AF9H 3K6ZA 3NUMA 3T26A 1K1JA 1TGNA 1DX5M 1DOJA 1AWHB 2P59A 3ZV9A 1XUHA 1ZZZA 3CP7A 2R3UA 1O5BB 4YO9A 1K1PA 1S6HA 1JMOH 1ETRH 1D6WA 3Q76A 1V3XA 1MTUA 4H42U 3T27A 3M37A 2FP7B 2OC8A 1AVXA 2O9QA 1BTXA 2A5IA 1C4Y2 2EEKA 3I78A 1RS0A 2AYWA 2V35A 3SO3A 3U8TH 1KDQA 3RXLA 1P2KA 4NSYA 3LKWA 3RXBA 2J34A 5FCKA 4D8NA 4ZKSU 2ILNA 4YZUA 1DXPA 3T2NA 1OWHA 1GBHA 3BG8A 4CREA 2ZGXH 1HAVB 1LO6A 1NRQH 2ZQ2A 1F5LA 3GY3A 3LT3A 4ZXXH 5EW2H 3PLKA 3RXPA 2XCNA 1D3DB 4ISOA 1C5OH 1P2MA 4B76A 1EXFA 1QIXB 1NFUA 1GHXH 1O2VA 7LPRA 1RGQA 2A4OA 3V3MA 5ESBA 1V2UT 1RTLA 1A5HA 1YPJH 1DPOA 2O8TA 2C90B 4CRCA 2FODA 3SJ9A 3TJUA 2A5KA 1UCYK 3P8NA 3UUZA 4MPVA 1NRNH 3RXHA 9LPRA 3SN8A 3TIUA 1O3NA 1C9TA
chains in the Genus database with same CATH superfamily
4KTCA 1KMHB 3A81A 3RXQA 2HPQH 1G37A 2TIOA 1G3BA 1O3AA 1P12E 1NROH 4D7GA 1E38B 1A3EH 1TA2A 1BDAA 3SORA 4CHAB 4DJZB 3F9HA 4JK5A 1W7GH 3EE0B 3TH2H 1A5GH 1K21H 3PWBA 2JH0D 2C3SA 2XWBI 1SFIA 3M7QA 1D3QB 1K1LA 1AB9C 1L1JA 4FU9A 1C5SA 4UD9H 1CA0B 5EIYA 2JDID 1GBJA 1TA6A 3MNCA 1HAZB 3BSQA 3VB4A 2F3CE 4BOHA 1YKTA 1QQUA 1THPB 1G3EA 1Z8IB 1BT7A 5JB9S 1WBGB 2BD7A 2GMTB 1HAYB 2XBVA 4FUJA 5EXNA 1SHHB 4BTTB 1ELAA 5HMAA 1OYQA 1GJ9B 1YCPM 3KHVA 3A83A 1C1NA 4E7NA 3S0NA 3ITIA 1O2SA 3GY5A 3ZZDA 3DUXH 1LHGH 1O5CB 3O8DA 3SV7A 2G52A 1F2SE 1O2JA 4TY6A 1GBIA 4TWWA 5C1YA 1Z7KA 1OWIA 5JDUB 4WH8A 2ZKSA 3OEED 1O0DH 1UTMA 1J15A 5C3NA 1L1NA 3AW0A 1OPHB 1NC6A 4O97A 4I8GA 2H2ZA 4BAHB 3OEHD 2PKAA 1FJSA 1TBQH 2PGQB 3OFND 5DPAA 1P2NA 1O2QA 1S0RA 1IQMA 2GCTC 2A5AA 1QFKH 2WPIS 1YCPH 2WUBA 3OU0A 2K1QA 3RMOH 3FP7E 2HPPH 1LKBA 3E6PH 3RLYH 1XKBC 3LH3A 1P05A 1EPTA 4CRGA 1IQEA 1MKXK 2JH6D 1GDNA 3SV9A 3UAIC 2Z9KA 3ODFA 3W1EA 1D3TB 1PYTD 1YLNA 3K6YA 1OSSA 1Z8GA 1ANCA 3EA7A 1YLDA 1FN6A 1TALA 4NWKA 4Z0KA 3TGIE 4FVBA 1U6QA 2FI5E 1FUJA 3O8BA 1DT2A 3Q00A 1TX7A 2A4QA 2ZO3H 3MI4A 2OD3B 5DP5A 1YF4A 5EOKA 1P2JA 1O37A 4CR5A 3OY6U 1GMCG 2P3UB 2ZU1A 3M61U 1C2LA 5GNDA 3STIA 1ZRKA 1QY6A 1S83A 2J95A 4K1SA 1V2KT 1GI8B 1GBBA 3VXEH 1ZTLA 1V2NT 3B8JA 1BTUA 3LGWA 3PMHB 3DCLA 1O2HA 1C2FA 1SGRE 1QTFA 2FTLE 3H7OA 3SHAH 3LH1A 1MCTA 1C5RA 4MVNA 1CSOE 1AIXH 3TNSA 4JZ1A 3DFLA 5GDSH 1ABIH 3FVFB 5DP8A 3ZZCA 3MFJA 1GG6C 1ZPCA 1THRH 1WTGH 2TBSA 1GDQA 1T4UH 4X2YA 3GCHC 1O3EA 1SVPA 2FPZA 3CS7A 1Y5BT 3U8RH 3NXPA 3UFAA 1GVKB 1TAWA 3MHWU 1SGFA 1AGJA 2B9LA 2D8WA 2WPHS 4A7IB 1UTKA 3QX5H 4JZDH 2BB4A 1HAIH 3FAOA 4RKOB 4MNWA 1ARCA 2VINA 1C1UH 1AKSB 2V6NA 3RXUA 1Q2WA 5F6MA 1P9SA 1EZQA 1H9LB 3NK8A 3E0PB 3NPSA 5CMXH 2DE9A 5A0CA 2F4LA 2FM2A 4NZLA 4CBOA 3LOXA 4I33A 5E2PA 1EZXC 3NZIA 1EAUA 1FN8A 2VWNA 3A8CA 4K60A 3KCGH 4ZKRU 5KEDA 2Z3DA 4X8SH 3U69H 1OS8A 2LP6A 1EZSC 1VJ9U 3GY8A 1LVBA 3S7HB 3BEIB 3T25A 4DIHH 1W12U 2W3KA 3OAAD 1TRMA 3MO3A 1GCTB 1AZ8A 1DY9A 1NU9A 1XUGA 1K9OE 1CQQA 2ZU3A 5FPSA 4FUIA 4B6FA 1SQAA 4NWLA 3CS0A 2RA3A 4KP0A 1HRTH 5C5OA 1E0FD 4ZKNU 1AU8A 1COWD 4SGAE 1F0SA 1PPFE 1BZXE 1QCPA 1O3PB 1GMCF 2GT8A 1MABB 1DICA 1O2UA 2GX4A 1MTNB 1P8VC 2W5EA 3FN8A 1C5ZB 1BQYA 3L33A 1C2JA 2D26C 3TH4H 4K1TA 3KYFA 1S6LA 4BXWA 4ISNA 3PM3A 1O2XA 2XYAA 4Y0YE 1WQVH 2QA9E 3VG8A 1BBRH 1V2QT 2I6SA 2DUCA 3GCNA 3PV2A 3S7KB 2H9HA 1C5WB 2QN5T 3TH3H 5CE1A 2VB0A 3A84A 1TBZH 1Z1JA 3MQKC 3FANA 4Y11E 1BCUH 3KF2A 1AUTC 3A87A 1QL8A 3I29A 1GHZA 1MTSA 1TNGA 1UTJA 1C1VH 3GDUA 1GHAG 5L6NH 2C8YB 2GDEH 1WV7H 1PQ8A 1FY3A 2PTNA 2VWLA 3ATKA 2STAE 3PYHA 1MZAA 1DANH 1KLJH 2OBOA 3M5LA 5T6GA 1O36A 1VJAU 2Q6DA 2BDBA 2XC5A 5AVDA 2PTCE 1VITH 2Q6FA 5FX6A 5DO4H 4H4FA 1O2LA 2G4UA 1RIWC 1ZHPA 1ESTA 1EJAA 2XC4A 4GSOA 1A4WH 3BG4C 1EJNA 1EX3A 1YPGH 4MPXA 4ISIH 5IDKA 1RD3B 2VH6A 3SNDA 4K8BA 1K1NA 3LGYA 3ZYDA 4WWYA 1KTTB 1UVOA 1C2DA 1LCYA 5L2YH 4Q4LA 1NM6A 8KME2 1YPHC 1XUIA 3QZQA 4JYVH 3A8AA 3UNRA 1LHEH 3ZZ8A 1QGFA 3OY5U 3PTNA 3ZVBA 2Y5GA 1YLCA 1ELEE 1GI1A 5TCAA 1DWBH 1O2IA 5JB8S 3RU4T 3RM0H 1QZ8A 3LPRA 1AQ7A 1T8OA 3D65E 4NIXA 1QB6A 1V2OT 1EAXA 4BANB 2YNBA 2VH0A 3PV4A 3A89A 3GDSA 2CGAA 1C4U2 3IITA 1KXDA 1GJ4H 1T31A 3T28A 2OBQA 2AS9A 3ZV8A 3UNSA 1RTKA 4ACAA 3SGBE 3BIUH 1O2KA 1FDPA 1SOZA 1TE0A 3SHCH 3L6PA 2FMJA 2QF5A 2OTVA 3QTVH 2PWXA 1ETTH 2A2XH 2XCFA 4Q7YA 1HAOH 1VGCB 4F55A 3UQOA 4X1SU 1GHBG 1A2CH 1BTHH 1Y3XA 2XW9A 3SV6A 5DP3A 2CJIA 3BTFE 5LGOA 1Y3YA 2O8UA 1TX8A 2P95A 4I7YH 1CT0E 3DSOA 4IS5A 3SNCA 1GHAF 3SNAA 1ZTKA 1O3FA 2A7CA 2G4TA 1E1QD 1SQRA 4RT0A 1NN6A 3LC3A 4D9RA 3MTYA 3WW7A 1TRNA 2O8WA 3P17H 2WPJS 4I8HA 2BD9A 3LGVA 2FWWA 1ELTA 2HWLB 1UW7A 2EY4C 4H6SB 1T4VH 3BF6H 1KLIH 2F43B 1QJ7B 5HIZA 2BDHA 4YXWD 2PKAB 3EA8A 2HNTE 1BMMH 4TYDA 2PFEA 5EGMA 4AG1A 1PPEE 1C1WH 2J9NA 1BMFD 3R0FA 4ZAEA 1H1BA 3SU2A 3BTHE 1BTPA 1E1RD 3BN9A 2PP6A 4X8VH 5DGJA 2WHXA 1EPTB 3SQEE 3SNEA 4ABFA 3SQHE 2BDIA 1SGTA 1BRCE 1LPKB 1ZPZA 2P16A 5F8TA 1Y8TA 3S9CA 2GV6A 1V2WT 1J16A 1FY8E 1QB1A 3F1SB 4NGAH 5GCHG 4CRDA 2A32A 1PPHE 1DLEA 4DT4A 4CRAA 1GJCB 2XBXA 4NIVA 2ZECA 3ZVGA 1AD8H 3UOUA 1TPPA 3RMMH 5CHBA 2Y81A 1HPGA 5CHAB 1AUJA 2FYQA 3LIWA 4WVPE 1IQIA 5E0GA 5FPTA 1GJ6A 2J97A 2BD4A 5A2MH 1SL3A 1GHBF 1G32B 4M9FA 1EATA 3A82A 1NRPH 1QRXA 2VGCC 5EQSA 1O3MA 3DFJA 4XBBA 1O3OA 4JMYA 2J98A 2VNTA 3SJIA 2EQNA 3MNSA 5DP9A 2JIZD 2O8MA 2WZQA 3T62A 3PRBA 3ZZ9A 2FOGA 1NESE 5DK1A 4FVDA 4B75A 1Z8JB 5F8ZA 2HALA 1V2VT 3UR9A 2PW8H 4U30A 1O3BA 1P06A 4DY7B 1FY5A 6CHAB 3RMNH 1H8ED 5J4SA 1TNIA 4IMQA 4X6PA 3RC5A 1ZHRA 3M5MA 4X1RU 1EAWA 1ZOMA 3A7WA 1GJBB 1SLXB 3QLPH 2C8XB 3NKKA 1NPMA 1H8HD 1ZRBA 2CXVA 4FUHA 1F5KU 4JZIA 3BEUA 1ZGIA 3M3VA 1C2EA 1YBWA 2A31A 2HLDD 2HRVA 2V3MA 4X6OA 5DJ7A 1ZSLA 4AGKA 1NTPA 1VZQH 1IQLA 1AE8H 2CMYA 2XBWA 3F0OA 4Y71A 2F9VA 1GBLA 1Y5AT 2GZ8A 1C5XB 4MQAA 1JRSA 2BMGB 3N7EA 1MUEB 3LJOA 4YLQH 3VFEA 2ZFQH 1INCA 1O32A 3AAVA 1NFXA 6LPRA 3MU5A 1QR3E 4DIIH 1P2OA 1EP6A 1P3CA 3LGUA 2RG3A 2V7QD 1VCQA 2FIRH 2UWOA 2EA3A 3AASA 5GCHF 2Z9JA 3RXEA 2C4FH 1OHHD 2PKSB 3UWIA 4GCHG 4HFPB 1GGDB 1L4DA 3P70B 1BMNH 1DVAH 1JWTA 5HM2A 2NU1E 4BAKB 3D23A 4TSFD 1QL7A 3SYJA 1YP9A 4J2YB 2SGFE 2VIPA 3I77A 1DWDH 5C0UA 2ALPA 4MG3A 1W0KD 2BY6X 3UOPA 2YMSB 1SGQE 3VGCC 3RLWH 2ZIQH 2Z9IA 3SJKA 3BIVH 1DUAA 4INHA 1W13U 2TRMA 1F5RA 1EFRD 1DE7H 1TOCB 1TLDA 2ZHEH 3PMAB 8LPRA 2GD4B 1H9IE 3JZ1B 1EB1H 1K22H 1N8OB 4CRFA 1E37B 1UHBB 2SGPE 1T7CA 5EPNA 4DT7B 1UK4A 1O3LA 5C5NA 5HKKD 4JYTA 2K0QA 2TGPZ 4KKDA 3BTQE 2J38A 1O2GH 2YOLA 5ETXA 3KYGA 1NFWA 1B0FA 3MU0A 3SGAE 2ZPQA 1DM4B 1C1QA 1JIRA 4I8KA 5JYIA 3MYWA 2ZFPH 1TGBA 1OP2A 3EGKH 3H7TA 1UJ1A 1SMFE 1C5LH 3RXCA 1JIMA 1SQOA 1AFQB 4ISLA 1KXBA 1LTOA 2ZGJA 2ZCLP 2RDLA 2GJGA 2NWNA 2CV3A 2BVXH 1DDJA 5JBBS 1W14U 1D4PB 5A8ZA 1PPZA 2VIWA 2W7UA 1GI9B 4IMZA 1OOKB 5TCCA 1LKAA 2GDDA 1IQHA 2VIVA 4I86A 3V13A 1S0QA 2ANKH 2NU0E 1MAYA 1BHXB 1MZDA 5C2ZA 1UTQA 3P92A 1C5YB 2ZHWH 1G3CA 2CHAC 3MH6A 4HTCH 3E91A 1JXPA 1MD8A 1MKWK 1TX6A 2VIOA 2VU8E 4GCHF 3TGJE 2WPKS 1FI8A 3SGQE 1GBMA 5JBTA 4R8TB 2B7DH 4JZFH 3NRLA 3P8GA 1OXGA 1T8NA 3W95A 2WV5A 1G30B 5DP6A 4A5TS 4KGAA 3SI4H 1ZMNA 2FS9A 1X7AC 1BTYA 3PROA 1BA8B 4FUCA 1WU1A 4ASHA 1O38A 1MQ5A 1SG8B 2WYJA 1H8DH 1O30A 1ZHMA 2P8OB 3E16B 3F9FA 1BTWA 3U9AH 4HGCA 2PHBA 2P93A 2RA0A 3MNBA 1W0ZU 2TGTA 1P10A 3RDZA 1HJAC 2EI7A 1VKYA 1BITA 1VCWA 1YWUA 3TPIZ 1CBWB 2J2UA 3C27B 4CH8B 2W3IA 4FUEA 1ELBA 1V2LT 2P94A 2FX4A 3EE7A 2JJ1D 2Y6TA 3M36A 1LVYA 3HKJB 1IHTH 1A3BH 3CENA 3M7UA 2XOKD 3FP6E 3RXJA 4DOQA 1CGIE 3GY6A 5FHTA 5EQRA 2F9UA 1WOFA 1SI5H 2O8LA 1SC8U 3IG6B 2BLOA 4A92A 3RXKA 1Y3VA 2SGDE 3F9EA 2L74A 1TGTA 1A0JA 1C2KA 1HAHH 1DSTA 2SNWA 1O2PA 5AHGH 2Y82A 1E36B 1GPZA 4AYYB 3RXSA 2VIQA 3LU9B 1IOEA 2BQ7B 4NFEA 5C94A 1P2IA 3U28C 3ELAH 1SPJA 3LGIA 3K9XB 5GJ4B 4D7FA 4ZHLU 4AN7A 1TNLA 3DD2H 1SGYE 1SR5C 2QV1A 3M5OA 2RFKC 1B0EA 4XFQA 2A1DB 1JBUH 4Y8XA 3VB3A 3NCLA 1WCZA 5EJZA 2KAIA 2F91A 3HPTB 1N6XA 2WUCA 2ZC9H 1O5GH 3TJNA 5LH8A 3A85A 3OSYA 1DY8A 1ZJKA 2ZU5A 4WMDA 4X1NU 3MU4A 1DLKB 2RCEA 3HGPA 1ZGVA 2FYRA 5EW1H 3M3TA 1GHYH 1GI3A 3TU7H 1S81A 1XUFA 1QJ6B 3VEQB 4UONA 2KCYA 2YMSD 4LXBH 2J98B 3FOAA 1BBRE 1C1PA 1F0TA 2BD2A 2H9EH 4NA7A 4OS5A 3E1XB 5EPYA 1TIOA 1CA8B 4TT3D 5I46H 1Z1IA 2G51A 3ZZ6A 1EKBB 1QNJA 4YOJA 2AIQA 3SJOA 1C5MD 2QF0A 2AERH 2WPLS 3FZZA 1C2IA 4J1YA 1FNIA 4NZQA 4FUFA 1QQ4A 1TNKA 2A7JA 2KR7A 2GKVE 4DGJA 3UPEA 4GPGA 4NFFA 3TITA 1ZR0A 1YC0A 3OYPA 1AI8H 3MOCA 1V6DA 4OS1A 3GYLB 2JETC 3MU8A 1CVWH 3EAJA 3QK1A 1GBFA 1UO6A 3N99A 4X2WA 1TRYA 4VGCC 3BTKE 4Y6DA 3PO1C 1V2MT 3W94A 1C5QA 2Y7XA 2BX3A 4AG2A 2BY8X 3RU4E 2KZ4A 5DSFA 5BPEA 1P9UA 2OC1A 2R2WU 3MNXA 1HBTH 5E0HA 1A61H 1ABJH 2ZGHA 4IGDA 4I8LA 4UFDH 3RM2H 3QN7A 3S9BA 3PMBB 4ZKOU 2SGAA 3N7DA 2BD8A 4BAMB 1HNEE 1WXRA 4MLFB 1PJPA 1N1LA 4YT6H 3UQVA 1TGSZ 5FBIA 1EP5A 2H1UA 2FOEA 4E7RG 2FLBH 3GISB 1PYTC 1O2YA 1KDQB 1KXCA 2A4RA 3FKSD 1LPGB 2BX4A 2QC2A 3PWCA 5FPYA 3STJA 3TVJB 2QXJA 2XNIA 5JBAS 1GDUA 2K8IA 3ZZ4A 1GBDA 1GBTA 1GBCA 4SGBE 2ZCHP 3WWFA 3BTME 1HAVA 4Y8ZA 3H09A 1GWAA 2IPHA 1MBMA 1AB9B 3OTPA 3IWMA 4ZXYH 4YOIA 2FXRA 4X6MA 3B9FH 4GLYA 4AFUA 2ZFSA 1C5PA 4UE7H 2R0KA 4X8TH 4X0WU 1GJDB 5EXMA 3SU5A 3BTWE 3DA9B 1NBME 4XDEA 3KIDU 5ESTE 3SNBA 1FX0B 4B2AA 4ABDA 5DG6A 3PLPA 1P11E 2OQ5A 2QE7D 5A0BA 2W6ID 5EU8A 3Q77A 1C2HA 4AOQA 1FPCH 1EZUC 1YGCH 1PPBH 2VJ1A 1UVTH 1TNJA 3GCTF 1O34A 1VR1H 1WSSH 1MQ6A 3LC5A 1GVZA 1HB0B 2Z3CA 4ZHAA 4H6TA 5A09A 1QHRB 2VVCA 3ZVAA 3U1JB 2W26A 1F7ZA 1L2EA 2FDAA 1SGDE 2YMSC 1C5TA 1TMBH 1O2WA 3SBKA 1DWEH 2GCTB 2Z7FE 1HXFH 2IN2A 4DVAU 3A80A 3DHKH 1ESBA 1TQ0B 1O3GA 4PROA 3A7YA 2BOHB 1BBRK 1AVGH 5LPFA 5DP7A 3SV2H 1AWFH 1NFYA 4Y76A 4Q7XA 4Y0ZE 1SLVB 2OQUA 2ZU2A 1QB9A 4WXVA 2A4GA 2VWOA 2FI3E 1C1OA 1OWJA 3ZZAA 1OP8A 1EASA 2UUJB 2V3HH 2F9PA 1ELDE 3MO9A 3KGPA 1P03A 4CBNA 4CH2B 1ACBE 1O5FH 1S85A 1Y59T 2EC9H 4XBDA 1BB0B 4GAWA 2BZ6H 7ESTE 4K2YA 3TJVA 4UDWH 1P57B 5L2ZH 1HIAA 3N7OA 1GMHG 1UK3A 3F0PA 3WY8A 3GYMA 4FUDA 2FOCA 4R0IA 1O3CA 1TWXB 1WAYB 2XXLA 4NIYA 1J9CH 2GZ9A 4A1XA 3S9AA 4CHAC 2ANYA 2F9BH 3UREA 1XM1A 1BRBE 3A7TA 4KELA 1FAKH 2J92A 3SUFA 1ZTJA 2GP9B 4AYVB 2F9NA 3OX7U 4OS2A 1K28D 1OWEA 2ZA5A 2CF8H 1C1RA 1AO5A 1SKYE 1CA0C 2ZPSA 1GG6B 1EJMA 5JBCS 1Z71A 2PUQH 3EA9A 3GCHB 3SW2B 3VXFH 4AGJA 4ZMAH 5ABWA 3MO6A 2GMTC 1K1MA 2M2AA 1OX1A 3E90B 1YPEH 3G01A 3ZVDA 1GBAA 4IN1A 1TPOA 2AIPA 1MH0A 3QZRA 4YT7H 2OUAA 1TMUH 1OWDA 1PPCE 3ZYEA 1FQ3A 3UTUH 2ZHFH 7KMEH 4Y7BA 2H6MA 4AB9A 1HAXB 3KQBA 3KQ5A 5HM9A 3Q3YA 4ABGA 3RU4D 1ARBA 1C5VA 1O33A 1F92A 1ZMLA 2BOKA 3VB7A 2UUYA 4XSKU 4Q63A 4AFQA 2KAIB 1YPMH 3M35A 1W0YH 1MU6B 2BD3A 1PQ7A 3U98H 2KM0A 3PMJA 2FEQH 1UTNA 2ULLA 3AW1A 4OS7A 2OK5A 3P8FA 2CF9H 2ZCKP 1D9IA 2HGTH 2Y5FA 1XXDA 2XC0A 5HGGA 1SGEE 3P95A 5C1XA 2SGEE 4DW2U 4E05H 4LZ1H 1ORFA 1SGCA 5E2OA 1GMHF 2BM2A 1GHWH 2AFQB 1XKAC 3TLOA 4BXSA 1OYTH 2LELA 2ZU4A 2ZDKA 1DXWA 5F8XA 4ESTE 2QIQA 1HCGA 4BTUB 3ZVFA 1BMLA 1WTHD 2R2MB 5EXLA 2F9OA 1TQ7B 1GI4A 2FO9A 1LMWB 3AVZA 1XVOA 4WY3A 1P2QA 1DS2E 1GI2A 3SU6A 4X2XA 3D62A 1O3KA 2BLVA 4FOUC 3QO6A 5C20A 3F2GA 1SOTA 1BJVA 4AFSA 4KTUA 1GBKA 3ATMA 1ANEA 4XE4A 1ELGA 2XTTB 1UTLM 4YM9A 2ZZUH 3GCOA 5AFZH 1UCYH 1NBMD 2A45B 5FXLA 3DSGA 2PSYA 1ELCA 4TPYA 1C1SA 2J94A 2FOHA 4NA8A 4DCDA 1Q3XA 1EQ9A 4WXIA 3UIRA 1Q31A 7GCHG 4U01A 1RIWB 1LVOA 1HDTH 2BTCE 3BG4B 5C67A 4MNYA 8GCHG 1O2NA 2ZWLH 3BEFB 2FOBA 1UK2A 2KFWA 2ZGCA 4LOYH 3RXAA 1MMJN 3A7XA 1YPHE 3QDZB 3MMGA 4Y79A 2G5VA 2ZPRA 1C9PA 2AGGX 1XXFA 2BLQA 5E0JA 4AX9H 4Z6AH 1LHCH 1NZQH 4NIWA 4CR9A 1IQJA 5F03A 4YTAA 3CNRA 3NWUA 4ZUHA 2ZTXA 1FY4A 1O3IA 2P3FH 1MKWH 4RI0A 2GVFA 1O2MA 1O31A 2H9TH 1DUEA 2OXSA 2OINA 2KCAA 2OLGA 4X6NA 2FLRH 3MU1A 5LPRA 4DG4A 4TY7A 4M7GA 1O2TA 2R9PA 4ZH8A 2V0BA 2ODYB 3FP8E 4FETA 3RC4A 3TK9A 4OS4A 1GCTC 5DN6D 1A0LA 4E06H 1ELVA 2VIDA 1MBQA 3SUGA 4BAQB 2G5NA 4YOGA 5TJXA 3VB5A 3MH4A 4FXGH 4BTIB 1TABE 1IQNA 2P3TB 2FOFA 2KX4A 3URDA 1UTPA 2ZFFH 3M3SA 3C1KA 1MTNC 3A7VA 1EOLA 1C5NH 6ESTA 5B6OA 1O39A 1SGFG 4UFGH 4O3TA 3PTBA 2F83A 4ABEA 1F0UA 3PV5A 5FBEA 2ZTZA 4ISHH 5E8EH 5IYTA 5EJ1A 4ABAA 1E35B 2VVUA 1RXPA 4K8YA 4TWYA 4ABHA 1S84A 2ZNKH 1PPGE 2V3OH 4Y8YA 3P6ZB 1V2JT 5KECA 1A1RA 1BIOA 3ATWA 4TPIZ 2XBYA 4X1QU 1MKXH 3QGJA 1AE5A 1FAXA 3E0NB 1AZZA 1P02A 3ZZ3A 1SBWA 1EB2A 1NU7B 2HNTF 3BTEE 2AMDA 3QGNB 1CU1A 1ANDA 1FY1A 3D49H 1C1TA 1RJXB 5HXFA 2FZZA 2NU3E 2ZEBA 3MH5A 3KQDA 4YLUA 1YM0A 1QJ1B 7GCHF 2VVVA 2WV4A 3F2FA 8GCHF 2WINI 1BRUP 2BQ6B 3ODDA 2ASUB 2FX6A 5IK2D 3UNQA 1FIZA 5FL7D 1YPKH 4K69A 3HK3B 4BNRA 4X8UH 3GOVB 3SV8A 1HFDA 1PQ5A 2BLWA 4AB8A 1T8LA 3DT0H 3GDVA 5EJLA 1A5IA 2QXGA 1UMAH 1FIWA 1O3HA 1E34B 4MNVA 1Y3UA 1BTZA 4A1TA 5LPEA 2QXHA 2Y80A 3AK5A 1HLTH 2PLXA 1ETSH 4INKA 3KQEA 3UB0A 2G00A 1QBNA 5AFYH 4MPWA 3E3TA 1FLEE 1WDIA 1FMGA 5EQQA 1HIAB 4MDSA 1EOJA 1P3EA 5C1UA 1Z8RA 3OTJE 4ABIA 2C8WB 2GT7A 1P09A 1NRSH 4LZ4B 2R3YA 4BAOB 2QCYA 1GJ8B 3FO8D 3JZ2B 3M7TA 1NRRH 5GWZA 4WMFA 1V2TT 2ZHQH 1AHTH 2AEIH 3QWCH 2ZI2H 1GJ5H 1Z6EA 1JOUB 1QA7A 1T32A 2VGCB 2I6QA 1CHGA 1T8MA 4FUGA 1VGCC 3P8OA 1O2RA 4GUXA 1XMNB 3HKIB 2LNCA 4B74A 5HYOA 3A88A 3F9GA 3RXGA 4IBLH 3SZNA 3TJOA 4JZEH 2B5TB 4B2CA 1A0HB 5I25A 1MTVA 3SU4A 1C1MA 1AY6H 2L6OA 4LK4A 4Y7AA 1MU8B 1K2I1 1H9HE 4P02A 3SU1A 3RXOA 4ASUD 3S69A 2WPMS 2ZF0H 4OS6A 2FESH 1GVLA 2AHME 3UWJH 2AMQA 1L1GA 2QGRA 3E8LA 1QRWA 4UEHH 3RXIA 5T6FA 3KL6A 3ZIAD 3RXMA 1GBEA 2BYAX 1CO7E 5K0HA 1QBOA 1WYKA 2HNTC 1PFXC 3RMLH 4P00A 2Z9LA 1KXEA 1IHSH 1ZJDA 2BY7X 1SHYA 1Y5UT 2THFB 1TB6H 3R3GB 1MCVA 1EPTC 1LQDB 2C93B 2QF4A 2BDCA 3PB1E 1M9UA 1WUNH 4O9VA 3T5FH 2AH4X 1QRZA 2J5UA 3BTGE 1YCPK 3ENSB 1G9IE 2BXTH 3V7TA 1B7XB 1CE5A 4AC9A 1W3CA 1S6FA 3HATH 5DKMA 4OGXA 1NS3A 1TGCA 1LHFH 4XBCA 1QBVH 3KQCA 2HLCA 2ZDAH 2GV7A 1UVSH 2UUFB 3F2HA 2SFAA 4NCYA 1K0HA 2GCHG 2BY9X 4A1VA 2AMPA 2A2QH 2B8OH 1XX9A 5F53A 3MH7A 6GCHG 1HYLA 3BTDE 2Y5HA 1V2PT 2BVSH 3GCTG 3ZVCA 3T29A 3VGCB 4HG6A 5CHAC 1H8IH 3ZZBA 3HGNA 2Z3EA 1BJUA 1CT4E 2PV9B 1ZYOA 1DSUA 2Z9GA 5FAHA 4U32A 3LGTA 4ABBA 1ZPBA 1W11U 2ALVA 2ESTE 5T1VA 4GHTA 3VB6A 4GHQA 3SZEA 4Z1MD 3EYDA 1GHVH 1ID5H 1K1IA 3BV9B 4U2WA 5T3HA 1BOQA 4F48B 1G36A 2H5DA 5L30H 1HGTH 2ZFTA 1FONA 1O5AB 3Q3XA 2SNVA 2PSXA 5A8YA 1W8BH 1MTWA 4Y10E 1MD7A 3A8BA 3SU3A 3FFGA 3ZZ7A 3EDXB 1BMAA 1LHDH 3ATIA 3UR6A 1GI0A 3F68H 4KTSA 3DSPA 2BDYA 1KLTA 3LJJA 6CHAC 1N6YA 5KGOA 2SGQE 1O3JA 1RFNA 4XRNA 1XVMA 1D6RA 2ZDVH 3RXRA 1BHXF 4K1EA 1TMTH 3PRDA 5GXPA 3HK6B 1G3DA 2GTBA 3QTOH 3Q3KA 3K2UA 1JRTA 5K7RA 1W0JD 1OP0A 1CHOG 1DFPA 1K1OA 4AZ2B 1BUIA 5FCRA 2ZTYA 1ESAA 2Y7ZA 3A8DA 3TNTA 1GJAB 4O03A 2G81E 1KYNA 2TGAA 5B6LA 4B71A 1W7XH 1THSH 1TONA 5EODA 1IQFA 2B0FA 1UHBA 1O35A 2CHAB 1EUFA 3SOSA 1TPSA 1GL1A 4WJG2 2EI8A 2PUXB 2FOMB 3RC6A 2EI6A 1HAGE 1O2OA 5DP4A 1Y3WA 2ZHDA 2QF3A 3RXVA 1E79D 1NT1A 4OM9A 3L3TA 3RUOA 1ZLRA 4AORA 1KXFA 2ZDLA 2FTMA 2GCHF 5HIYA 2XWAA 3AAUA 3GICB 3SI3H 1LDTT 2BDGA 1FV9A 2PKSC 1GI7B 6GCHF 3M5NA 1GGDC 1D3PB 2FI4E 1A7SA 3ZVEA 2ANWA 2OCVB 1W10U 4IN2A 2OC0A 1NY22 1XUJA 2A0QB 4B2BA 1C2GA 1GMDG 1KSNA 4MNXA 2VWMA 4IC5A 2BZAA 3A7ZA 4X2VA 1XUKA 4INLA 1S82A 2C8ZB 2Z94A 3F6UH 1H4WA 1V2ST 2D1JA 2KCOA 4ACBA 4B1TA 2PR3A 3SUDA 3LDXH 3TGKE 1F0RA 3UY9A 4ABJA 2ODPA 2R0LA 1LQEA 1HJAB 4A6LA 1YYY1 1N8OC 2BVRH 2STBE 4THNH 1J14A 1BRAA 1VITG 2G8TA 1SSXA 1LVMA 1PQAA 1C4V2 1FPHH 2HOBA 1TYNA 2IJOB 3O8RA 1TBRH 4WF8A 4MTBA 4F49A 2JJ2D 1TFXA 1G2LA 5G4BA 1O5EH 3KN2A 3GY2A 2H5CA 4B73A 3QUMP 1OWKA 4NG9H 1GJ7B 4XOJA 1SGPE 2G55A 2ZDMA 3BTTE 1AVWA 4FUBA 2BHGA 1CHOF 2WYGA 2ZDNA 1A46H 3KNXA 5PTPA 1J8AA 1AFQC 2BXUH 1HXEH 1GCDA 1KIGH 2DE8A 4JK6A 2UWLA 3U1IB 2ZQ1A 1TNHA 2FS8A 2TGDA 1UVPA 2OP9A 3V0XA 1ANBA 1B5GH 2UWPA 2J4IA 3A86A 1KTSB 4RKJB 1AN1E 1RTFB 4B6EA 4HI3A 3RXDA 8ESTE 1O5DH 1L0ZA 1HJ8A 4I8JA 5T6DA 1VCPA 1MAXA 1ZSKA 4JYUH 2GZ7A 1TOMH 3K65B 3ESTA 3SJ8A 4ZCNA 1G2MA 1SLUB 2ZFRH 2GGVB 4FU8A 1W2KH 3TK6A 4MPUA 2HVXA 4HZHA 5GIBA 4YESB 1J17T 1GI6A 1L4ZA 1SQTA 1DITH 2NU4E 4WH6A 1Z6JH 4QT8C 1ZSJA 1HV7A 3ZZ5A 3OE7D 4FU7A 1AFEH 4ZHMU 1WQSA 2WPDD 5CDFE 1GMDF 4RN6A 4IW4E 4Q2KA 5EG4A 2IJD1 2JKHA 1SLWB 2CN0H 3B23B 2M5TA 4JCNA 1ZMJA 4AFZA 5H4IB 4D9QA 1TPAE 2Q6GA 3TK5A 4K5ZA 4GVUA 3SU0A 2WV9A 5GPIB 1C5UA 1P0SH 3WWBA 4ZROA 1QA0A 4Q80A 1OKXA 3ATLA 5FX5A 2LPRA 2ZG0H 4I31A 1P01A 2Z6BD 4NA9H 2P8OC 9ESTA 1KY9A 2VBCA 1RRKA 2Q1JA 1KXAA 1VITF 4Q7ZA 1V2RT 4RT1A 3URCA 1UCYE 5C0TA 1SB1H 2CK3D 3V12A 1ELFA 2A7HA 2ZGBH 1SGNE 2JETB 4NSVA 3O8CA 4WMEA 3H5CB 2PGBB 1CBWC 1DWCH 1IQKA 1O3DA 1UVUH 4K3JA 4RSPA 5SGAE 4VGCB 2BY5X 3PO1B 4UFFH 1IAUA 1NO9H 3KEEA 4CRBA 1GL0E 4OGYA 3U8OH 5A8XA 2QXIA 2TPIZ 1EAIA 2FOAA 1C2MA 1AKSA 2NU2E 3RP2A 2AGEX 1HUTH 1GI5A 2ZP0H 4D76A 1FXYA 1CT2E 3VPKA 1SFQB 1P04A 3LONA 2XRCA 2YNAA 4UFEH 1YPLH 2D2DA 2UUKB 1QL9A 1O2ZA 2OC7A 1AMHA 2BDAA 1FZZA 3GY4A 4F4OC 2ODQA 2QY0B 1HJ9A 3RXFA 5JPMH 3RXTA 1UTOA 2ANMH 4DURA 1LPZB 1CGJE 1YY3A 2IOTA 5A0AE 4I32A 1IQGA 4IC6A 2BQWB 2W7SA 2QYIA 1CGHA 2JH5D 2BD5A 5J4QA 3MWIU 3PLBA 1HAPH 3SUEA 2XNDD 1SGIB 3EQ0H 4O3UA 2AGIX 5BRRE 2RDEA 2QAAA 3GY7A 1QURH 4X1PU 1S5SA 3FZDA 5AF9H 3K6ZA 3NUMA 3T26A 1K1JA 1TGNA 1DX5M 1DOJA 1AWHB 4XD7D 2P59A 3ZV9A 1XUHA 2KCPA 1ZZZA 2WSSD 2IPQX 3CP7A 2R3UA 1O5BB 4YO9A 1K1PA 1S6HA 1JMOH 1ETRH 1D6WA 3Q76A 1V3XA 1MTUA 4H42U 3T27A 3M37A 2FP7B 2OC8A 1AVXA 2O9QA 2W6JD 1BTXA 2A5IA 3GS9A 1C4Y2 2EEKA 3I78A 1RS0A 2AYWA 2V35A 3SO3A 3U8TH 1KDQA 3RXLA 1P2KA 4NSYA 3LKWA 3RXBA 2J34A 5FCKA 4D8NA 4ZKSU 2ILNA 4YZUA 1DXPA 3T2NA 1OWHA 1GBHA 3BG8A 4CREA 2HVYB 2ZGXH 1HAVB 5C17A 1LO6A 1NRQH 2ZQ2A 1F5LA 3GY3A 3LT3A 4ZXXH 5EW2H 3PLKA 3RXPA 2XCNA 1D3DB 4ISOA 1C5OH 1P2MA 4B76A 1EXFA 1QIXB 1NFUA 1GHXH 1O2VA 7LPRA 1RGQA 2A4OA 3V3MA 5ESBA 1V2UT 1RTLA 1A5HA 1YPJH 1DPOA 2O8TA 2C90B 4CRCA 2FODA 3SJ9A 3TJUA 2A5KA 3F3BA 1UCYK 3P8NA 3UUZA 4MPVA 1NRNH 3RXHA 9LPRA 3SN8A 3TIUA 1O3NA 1C9TA
chains in the Genus database with same CATH topology
4KTCA 3A81A 3RXQA 2HPQH 1G37A 2TIOA 1G3BA 1O3AA 1P12E 1NROH 4D7GA 1E38B 1A3EH 1TA2A 1BDAA 3SORA 4CHAB 4DJZB 3F9HA 4JK5A 1W7GH 3EE0B 3TH2H 1A5GH 1K21H 3PWBA 2JH0D 2C3SA 2XWBI 1SFIA 3M7QA 1D3QB 1K1LA 1AB9C 1L1JA 4FU9A 1C5SA 4UD9H 1CA0B 1GBJA 1TA6A 3MNCA 1HAZB 3BSQA 3VB4A 2F3CE 4BOHA 1YKTA 1QQUA 1THPB 1G3EA 1Z8IB 1BT7A 5JB9S 1WBGB 2BD7A 2GMTB 1HAYB 2XBVA 4FUJA 5EXNA 1SHHB 4BTTB 1ELAA 5HMAA 1OYQA 1GJ9B 1YCPM 3KHVA 3A83A 1C1NA 4E7NA 3S0NA 3ITIA 1O2SA 3GY5A 3ZZDA 3DUXH 1LHGH 1O5CB 3O8DA 3SV7A 2G52A 1F2SE 1O2JA 4TY6A 1GBIA 4TWWA 5C1YA 1Z7KA 1OWIA 5JDUB 4WH8A 2ZKSA 1O0DH 1UTMA 1J15A 5C3NA 1L1NA 3AW0A 1OPHB 1NC6A 4O97A 4I8GA 2H2ZA 4BAHB 2PKAA 1FJSA 1TBQH 2PGQB 5DPAA 1P2NA 1O2QA 1S0RA 1IQMA 2GCTC 2A5AA 1QFKH 2WPIS 1YCPH 2WUBA 3OU0A 2K1QA 3RMOH 3FP7E 2HPPH 1LKBA 3E6PH 3RLYH 1XKBC 3LH3A 1P05A 1EPTA 4CRGA 1IQEA 1MKXK 2JH6D 1GDNA 3SV9A 2Z9KA 3ODFA 1D3TB 1PYTD 3K6YA 1OSSA 1Z8GA 1ANCA 3EA7A 1YLDA 1FN6A 1TALA 4NWKA 4Z0KA 3TGIE 4FVBA 1U6QA 2FI5E 1FUJA 3O8BA 1DT2A 3Q00A 1TX7A 2A4QA 2ZO3H 3MI4A 2OD3B 5DP5A 1YF4A 5EOKA 1P2JA 1O37A 4CR5A 3OY6U 1GMCG 2P3UB 2ZU1A 3M61U 1C2LA 3STIA 1ZRKA 1QY6A 1S83A 2J95A 4K1SA 1V2KT 1GI8B 1GBBA 3VXEH 1ZTLA 1V2NT 3B8JA 1BTUA 3LGWA 3PMHB 1O2HA 1C2FA 1SGRE 1QTFA 2FTLE 3H7OA 3SHAH 3LH1A 1MCTA 1C5RA 4MVNA 1CSOE 1AIXH 3TNSA 4JZ1A 3DFLA 5GDSH 1ABIH 3FVFB 5DP8A 3ZZCA 3MFJA 1GG6C 1ZPCA 1THRH 1WTGH 2TBSA 1GDQA 1T4UH 4X2YA 3GCHC 1O3EA 1SVPA 2FPZA 3CS7A 1Y5BT 3U8RH 3NXPA 3UFAA 1GVKB 1TAWA 3MHWU 1SGFA 1AGJA 2B9LA 2D8WA 2WPHS 4A7IB 1UTKA 3QX5H 4JZDH 2BB4A 1HAIH 3FAOA 4RKOB 4MNWA 1ARCA 2VINA 1C1UH 1AKSB 2V6NA 3RXUA 1Q2WA 5F6MA 1P9SA 1EZQA 1H9LB 3NK8A 3E0PB 3NPSA 5CMXH 2DE9A 5A0CA 2FM2A 4NZLA 4CBOA 3LOXA 4I33A 5E2PA 1EZXC 3NZIA 1EAUA 1FN8A 2VWNA 3A8CA 4K60A 3KCGH 4ZKRU 2Z3DA 4X8SH 3U69H 1OS8A 1EZSC 1VJ9U 3GY8A 1LVBA 3S7HB 3BEIB 3T25A 4DIHH 1W12U 2W3KA 1TRMA 3MO3A 1GCTB 1AZ8A 1DY9A 1NU9A 1XUGA 1K9OE 1CQQA 2ZU3A 5FPSA 4FUIA 1SQAA 4NWLA 3CS0A 2RA3A 4KP0A 1HRTH 5C5OA 1E0FD 4ZKNU 1AU8A 4SGAE 1F0SA 1PPFE 1BZXE 1QCPA 1O3PB 1GMCF 2GT8A 1O2UA 1DICA 2GX4A 1MTNB 1P8VC 2W5EA 1C5ZB 1BQYA 3L33A 1C2JA 2D26C 3TH4H 4K1TA 4BXWA 4ISNA 3PM3A 1O2XA 2XYAA 4Y0YE 1WQVH 2QA9E 1BBRH 1V2QT 2I6SA 2DUCA 3GCNA 3S7KB 2H9HA 1C5WB 2QN5T 3TH3H 5CE1A 2VB0A 3A84A 1TBZH 1Z1JA 3FANA 4Y11E 1BCUH 3KF2A 1AUTC 3A87A 1QL8A 3I29A 1GHZA 1MTSA 1TNGA 1UTJA 1C1VH 3GDUA 1GHAG 5L6NH 2C8YB 2GDEH 1WV7H 1PQ8A 1FY3A 2PTNA 2VWLA 3ATKA 2STAE 3PYHA 1MZAA 1DANH 1KLJH 2OBOA 3M5LA 5T6GA 1O36A 1VJAU 2Q6DA 2BDBA 2XC5A 5AVDA 2PTCE 1VITH 2Q6FA 5FX6A 5DO4H 4H4FA 1O2LA 2G4UA 1RIWC 1ZHPA 1ESTA 1EJAA 2XC4A 4GSOA 1A4WH 3BG4C 1EJNA 1EX3A 1YPGH 4MPXA 4ISIH 5IDKA 1RD3B 2VH6A 3SNDA 4K8BA 1K1NA 3LGYA 3ZYDA 4WWYA 1KTTB 1UVOA 1C2DA 1LCYA 5L2YH 1NM6A 8KME2 1YPHC 1XUIA 3QZQA 4JYVH 3A8AA 3UNRA 1LHEH 3ZZ8A 1QGFA 3OY5U 3PTNA 3ZVBA 2Y5GA 1YLCA 1ELEE 1GI1A 5TCAA 1DWBH 1O2IA 5JB8S 3RU4T 3RM0H 3LPRA 1AQ7A 1T8OA 3D65E 4NIXA 1QB6A 1V2OT 1EAXA 4BANB 2YNBA 2VH0A 3PV4A 3A89A 3GDSA 2CGAA 1C4U2 3IITA 1KXDA 1GJ4H 1T31A 3T28A 2OBQA 2AS9A 3ZV8A 3UNSA 1RTKA 3SGBE 3BIUH 1O2KA 1FDPA 1SOZA 1TE0A 3SHCH 3L6PA 2FMJA 2OTVA 3QTVH 2PWXA 1ETTH 2A2XH 2XCFA 4Q7YA 1HAOH 1VGCB 3UQOA 4X1SU 1GHBG 1A2CH 1BTHH 1Y3XA 2XW9A 3SV6A 5DP3A 2CJIA 3BTFE 5LGOA 1Y3YA 2O8UA 1TX8A 2P95A 4I7YH 1CT0E 4IS5A 3SNCA 1GHAF 3SNAA 1ZTKA 1O3FA 2A7CA 2G4TA 1NN6A 3LC3A 4D9RA 3MTYA 1TRNA 2O8WA 3P17H 2WPJS 4I8HA 2BD9A 3LGVA 2FWWA 1ELTA 2HWLB 4H6SB 1T4VH 3BF6H 1KLIH 1QJ7B 2BDHA 2PKAB 3EA8A 2HNTE 1BMMH 4TYDA 2PFEA 5EGMA 4AG1A 1PPEE 1C1WH 2J9NA 3R0FA 4ZAEA 3SU2A 1H1BA 3BTHE 1BTPA 3BN9A 4X8VH 5DGJA 1EPTB 3SQEE 3SNEA 4ABFA 3SQHE 2BDIA 1SGTA 1BRCE 1LPKB 1ZPZA 2P16A 5F8TA 1Y8TA 3S9CA 2GV6A 1V2WT 1J16A 1FY8E 1QB1A 3F1SB 4NGAH 5GCHG 4CRDA 2A32A 1PPHE 1DLEA 4CRAA 1GJCB 2XBXA 4NIVA 2ZECA 3ZVGA 1AD8H 3UOUA 1TPPA 3RMMH 2Y81A 1HPGA 5CHAB 1AUJA 2FYQA 3LIWA 4WVPE 1IQIA 5E0GA 5FPTA 1GJ6A 2BD4A 5A2MH 1SL3A 1GHBF 1G32B 1EATA 3A82A 1NRPH 1QRXA 2VGCC 5EQSA 1O3MA 3DFJA 4XBBA 1O3OA 4JMYA 2VNTA 3SJIA 3MNSA 5DP9A 2O8MA 3T62A 3ZZ9A 2FOGA 1NESE 5DK1A 4FVDA 4B75A 1Z8JB 5F8ZA 2HALA 1V2VT 3UR9A 2PW8H 4U30A 1O3BA 1P06A 4DY7B 1FY5A 6CHAB 3RMNH 5J4SA 1TNIA 4IMQA 4X6PA 3RC5A 1ZHRA 3M5MA 4X1RU 1EAWA 1ZOMA 3A7WA 1GJBB 1SLXB 3QLPH 2C8XB 3NKKA 1NPMA 1ZRBA 2CXVA 4FUHA 1F5KU 4JZIA 3BEUA 1ZGIA 3M3VA 1C2EA 1YBWA 2A31A 2HRVA 4X6OA 5DJ7A 1ZSLA 4AGKA 1NTPA 1VZQH 1IQLA 1AE8H 2CMYA 2XBWA 4Y71A 2F9VA 1GBLA 1Y5AT 2GZ8A 1C5XB 4MQAA 1JRSA 2BMGB 1MUEB 3LJOA 4YLQH 3VFEA 2ZFQH 1INCA 1O32A 3AAVA 1NFXA 6LPRA 3MU5A 1QR3E 4DIIH 1P2OA 1EP6A 1P3CA 3LGUA 2RG3A 1VCQA 2FIRH 2UWOA 2EA3A 3AASA 5GCHF 2Z9JA 3RXEA 2C4FH 2PKSB 3UWIA 4GCHG 4HFPB 1GGDB 1L4DA 3P70B 1BMNH 1DVAH 1JWTA 5HM2A 2NU1E 4BAKB 3D23A 1QL7A 1YP9A 4J2YB 2SGFE 2VIPA 3I77A 1DWDH 2ALPA 4MG3A 2BY6X 3UOPA 1SGQE 3VGCC 3RLWH 2ZIQH 2Z9IA 3SJKA 3BIVH 1DUAA 4INHA 1W13U 2TRMA 1F5RA 1DE7H 1TOCB 1TLDA 2ZHEH 3PMAB 8LPRA 2GD4B 1H9IE 3JZ1B 1EB1H 1K22H 1N8OB 4CRFA 1E37B 1UHBB 2SGPE 1T7CA 5EPNA 4DT7B 1UK4A 1O3LA 5C5NA 4JYTA 2TGPZ 4KKDA 3BTQE 2J38A 1O2GH 2YOLA 5ETXA 1NFWA 1B0FA 3MU0A 3SGAE 2ZPQA 1DM4B 1C1QA 1JIRA 4I8KA 5JYIA 3MYWA 2ZFPH 1TGBA 1OP2A 3EGKH 3H7TA 1UJ1A 1SMFE 1C5LH 3RXCA 1JIMA 1SQOA 1AFQB 4ISLA 1KXBA 1LTOA 2ZGJA 2ZCLP 2RDLA 2NWNA 2CV3A 2BVXH 1DDJA 5JBBS 1W14U 1D4PB 5A8ZA 1PPZA 2VIWA 2W7UA 1GI9B 4IMZA 1OOKB 5TCCA 1LKAA 2GDDA 1IQHA 2VIVA 3V13A 1S0QA 2ANKH 2NU0E 1MAYA 1BHXB 1MZDA 5C2ZA 1UTQA 3P92A 1C5YB 2ZHWH 1G3CA 2CHAC 3MH6A 4HTCH 3E91A 1JXPA 1MD8A 1MKWK 1TX6A 2VIOA 2VU8E 4GCHF 3TGJE 2WPKS 1FI8A 3SGQE 1GBMA 5JBTA 4R8TB 2B7DH 4JZFH 3P8GA 1OXGA 1T8NA 3W95A 2WV5A 1G30B 5DP6A 4A5TS 4KGAA 3SI4H 1ZMNA 2FS9A 1X7AC 1BTYA 3PROA 1BA8B 4FUCA 1WU1A 4ASHA 1O38A 1MQ5A 1SG8B 2WYJA 2P8OB 1H8DH 1O30A 1ZHMA 3E16B 3F9FA 1BTWA 3U9AH 4HGCA 2PHBA 2P93A 2RA0A 3MNBA 1W0ZU 2TGTA 1P10A 3RDZA 1HJAC 2EI7A 1VCWA 1BITA 3TPIZ 1CBWB 2J2UA 3C27B 4CH8B 2W3IA 4FUEA 1ELBA 1V2LT 2P94A 2FX4A 2Y6TA 3M36A 1LVYA 3HKJB 1IHTH 1A3BH 3CENA 3M7UA 3FP6E 3RXJA 4DOQA 1CGIE 3GY6A 5FHTA 5EQRA 2F9UA 1WOFA 1SI5H 2O8LA 1SC8U 3IG6B 2BLOA 4A92A 3RXKA 1Y3VA 2SGDE 3F9EA 1TGTA 1A0JA 1C2KA 1HAHH 1DSTA 2SNWA 1O2PA 5AHGH 2Y82A 1E36B 1GPZA 4AYYB 3RXSA 2VIQA 3LU9B 1IOEA 2BQ7B 4NFEA 1P2IA 3ELAH 1SPJA 3LGIA 3K9XB 5GJ4B 4D7FA 4ZHLU 4AN7A 1TNLA 3DD2H 1SGYE 1SR5C 2QV1A 3M5OA 1B0EA 4XFQA 2A1DB 1JBUH 4Y8XA 3VB3A 3NCLA 1WCZA 2KAIA 2F91A 3HPTB 1N6XA 2WUCA 2ZC9H 1O5GH 3TJNA 5LH8A 3A85A 3OSYA 1DY8A 1ZJKA 2ZU5A 4WMDA 4X1NU 3MU4A 1DLKB 2RCEA 3HGPA 1ZGVA 2FYRA 5EW1H 3M3TA 1GHYH 1GI3A 3TU7H 1S81A 1XUFA 1QJ6B 3VEQB 4UONA 4LXBH 1BBRE 1C1PA 1F0TA 2BD2A 2H9EH 4NA7A 4OS5A 3E1XB 5EPYA 1TIOA 1CA8B 5I46H 1Z1IA 2G51A 3ZZ6A 1EKBB 1QNJA 4YOJA 2AIQA 3SJOA 1C5MD 2QF0A 2AERH 2WPLS 3FZZA 1C2IA 4J1YA 1FNIA 4NZQA 4FUFA 1QQ4A 1TNKA 2A7JA 2GKVE 4DGJA 3UPEA 4GPGA 4NFFA 3TITA 1ZR0A 1YC0A 3OYPA 1AI8H 3MOCA 1V6DA 4OS1A 3GYLB 2JETC 3MU8A 1CVWH 3EAJA 3QK1A 1GBFA 1UO6A 4X2WA 1TRYA 4VGCC 3BTKE 4Y6DA 3PO1C 1V2MT 3W94A 1C5QA 2Y7XA 2BX3A 4AG2A 2BY8X 3RU4E 5BPEA 1P9UA 2OC1A 2R2WU 3MNXA 1HBTH 5E0HA 1A61H 1ABJH 2ZGHA 4IGDA 4I8LA 4UFDH 3RM2H 3QN7A 3S9BA 3PMBB 4ZKOU 2SGAA 2BD8A 4BAMB 1HNEE 4MLFB 1PJPA 1N1LA 4YT6H 3UQVA 1TGSZ 5FBIA 1EP5A 2H1UA 2FOEA 4E7RG 2FLBH 3GISB 1PYTC 1O2YA 1KDQB 1KXCA 2A4RA 1LPGB 2BX4A 2QC2A 3PWCA 5FPYA 3STJA 3TVJB 2QXJA 2XNIA 5JBAS 1GDUA 3ZZ4A 1GBDA 1GBTA 1GBCA 4SGBE 2ZCHP 3BTME 1HAVA 4Y8ZA 1GWAA 2IPHA 1MBMA 1AB9B 3IWMA 4ZXYH 4YOIA 2FXRA 4X6MA 3B9FH 4GLYA 4AFUA 2ZFSA 1C5PA 4UE7H 2R0KA 4X8TH 4X0WU 1GJDB 5EXMA 3SU5A 3BTWE 3DA9B 4XDEA 3KIDU 5ESTE 3SNBA 4B2AA 4ABDA 5DG6A 3PLPA 1P11E 2OQ5A 5A0BA 5EU8A 3Q77A 1C2HA 4AOQA 1FPCH 1EZUC 1YGCH 1PPBH 2VJ1A 1UVTH 1TNJA 3GCTF 1O34A 1VR1H 1WSSH 1MQ6A 3LC5A 1GVZA 1HB0B 2Z3CA 4ZHAA 4H6TA 5A09A 1QHRB 2VVCA 3ZVAA 3U1JB 2W26A 1F7ZA 1L2EA 2FDAA 1SGDE 1C5TA 1TMBH 1O2WA 3SBKA 1DWEH 2GCTB 2Z7FE 1HXFH 2IN2A 4DVAU 3A80A 3DHKH 1ESBA 1TQ0B 1O3GA 4PROA 3A7YA 2BOHB 1BBRK