3I78A

35/99/170/186/220-loops of fxa in sgt
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
229
structure length
229
Chain Sequence
b'VVGGTRAAQGEFPFMVRLINEENEGFCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSSSSFILVANEMICAGYDTKQEDTCQGDSGGPMFRKDNADEWVQVGIVSWGEGCARKGKYGVYTEVSTFASAIASAARTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Combinatorial Enzyme Design Probes Allostery and Cooperativity in the Trypsin Fold.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase
total genus 56
structure length 229
sequence length 229
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i78A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i78A02
4M7GA 4CREA 2QIQA 5AHGH 4ZHMU 2R0KA 2A31A 2P3TB 1MD7A 1G3DA 3VXEH 3RXTA 2J38A 1T32A 1YPMH 1O3AA 1MKXK 1IQGA 2JETB 2DE9A 5T6FA 3MO3A 1PPZA 1C1RA 3GCNA 1GJ9B 2QXGA 1AVWA 3PO1B 4H4FA 3LIWA 1QA0A 3H7TA 3B8JA 2BD8A 3PLPA 5T6DA 2GV7A 1GI1A 1WBGB 2GGVB 1INCA 1UJ1A 1EP5A 4I8GA 3TLOA 3ZVDA 3MOCA 1NRNH 1THRH 1O5AB 3PLBA 1EZUC 1GBFA 1P05A 4X6PA 4Z6AH 4Y8YA 3TNTA 4DURA 3RUOA 1HAPH 1JWTA 2Q1JA 3MI4A 3H7OA 4DGJA 2BDCA 3BG8A 2OBOA 1LQDB 1P2JA 3TNSA 1TRYA 2OLGA 1SGIB 2BOKA 4X6OA 2FTMA 1YBWA 1NROH 1OYQA 4ZKOU 1EKBB 3SHAH 4F4OC 2H1UA 1AHTH 3SNEA 1IQFA 1SGRE 2OC1A 4Y79A 1BTZA 6GCHF 2FEQH 1TYNA 2Z94A 4JZ1A 3SV8A 2GDDA 3A82A 4WJG2 3EAJA 1GVLA 1SBWA 1AE5A 1TA6A 1UTNA 2PSXA 1O35A 2VU8E 2O8WA 2C8XB 1G37A 1ZTKA 3SI4H 5E8EH 1AKSB 3V3MA 1BBRE 1HJ9A 3A88A 4ZKNU 1P01A 1ZR0A 2FODA 4YM9A 2G81E 3FFGA 1UCYH 3RXFA 5FPSA 1PPEE 4XDEA 1GBDA 1ZHPA 3T29A 1MTUA 4DT7B 1GDQA 3GCTF 4YT7H 4LZ4B 2O8MA 1P11E 2Q6DA 4ISNA 5EXNA 1ELCA 1SI5H 1A3BH 3LDXH 2R2MB 1AB9C 1O33A 3SUDA 1BZXE 1KSNA 3M7UA 1P02A 4NWKA 2Z9IA 4MNWA 4K1SA 1AKSA 2BLOA 3RM0H 4Y0ZE 3A86A 2VB0A 3BIUH 1C4U2 4Y8ZA 1F0TA 5L6NH 5PTPA 4E7NA 1F5RA 1N1LA 1Y3UA 3QZQA 1G9IE 1QGFA 2BLQA 1D3TB 3MU1A 4X6MA 1RD3B 1O3MA 2AIQA 1O32A 2ASUB 2VIWA 1A2CH 2CJIA 1EPTB 7GCHG 2SFAA 4TYDA 3BTFE 3SW2B 2BY8X 1ETRH 3M3TA 3BV9B 3ZZDA 5K0HA 1O31A 1NC6A 1FNIA 4TY7A 2VJ1A 2HRVA 4A92A 3GISB 1SGNE 2AS9A 1DT2A 1C2FA 1C5MD 4WH8A 2C3SA 1MZAA 5IYTA 5FX5A 2ULLA 4NGAH 2Y7ZA 2AGIX 4YLQH 5EW1H 2ZDLA 5A8YA 2ZCLP 5E0JA 1OOKB 4Y7BA 1LPZB 4B2AA 3TPIZ 3HPTB 4KTCA 3LGUA 1ARCA 1AU8A 4ABJA 1AWFH 1Q2WA 2H9EH 3M5NA 1TOCB 4INLA 1GI9B 2P16A 1CHOF 2WYGA 1GBKA 3UTUH 2UUYA 3LKWA 1LPGB 4IN2A 1GI4A 1TMUH 4AOQA 3LC3A 3E90B 2FI5E 1DE7H 5AFZH 3T28A 3QUMP 5C3NA 3NUMA 1HAOH 4AORA 1C1QA 4Q2KA 1V2RT 4ZHLU 1TB6H 4X1RU 4BOHA 3LT3A 1T4UH 2F83A 2VINA 5F8XA 1B5GH 3RXOA 3A87A 2ZTYA 3RXHA 2GCHG 4FU9A 4O3UA 3AASA 1GMHF 1ELEE 3CS7A 5JYIA 1VITG 5A0AE 1NPMA 1TGCA 1TRMA 2JH6D 1BHXB 3M35A 1GHAF 1DXWA 1TPAE 4IMZA 2R9PA 1C1MA 3K65B 1D6RA 4B71A 2BQWB 1ZRKA 1O2GH 1P9UA 1A3EH 3IWMA 3QLPH 2ZU5A 2G51A 3CS0A 2FYRA 1C5OH 4KELA 1HJ8A 1A46H 5A2MH 3M61U 3CP7A 4ZXXH 1AB9B 1XXDA 3ATMA 1IQLA 2XBYA 3RMOH 3P8NA 1OWEA 1TMBH 1O2LA 4Y8XA 3TH2H 3M7TA 3C27B 3QX5H 3VFEA 1DSTA 2Y80A 4X1PU 1EJNA 1UK3A 3L6PA 3QWCH 2ZU2A 1L1GA 1HDTH 1ZOMA 1IQIA 3OYPA 2C4FH 3OTJE 1CO7E 3ZVEA 1P2NA 2STAE 1MKWH 1Y5UT 1ANEA 1NO9H 3VEQB 1HLTH 1V2ST 2C8YB 4I32A 1W3CA 5GPIB 4AB9A 2BTCE 1XXFA 4CR9A 2W3KA 1EOLA 4U30A 1TNJA 5DGJA 4GHTA 1C4V2 2HOBA 5A09A 3GY6A 3O8RA 1E36B 2ZP0H 3TU7H 2WPHS 1V6DA 3MNBA 1UVSH 3A8AA 1EASA 1MU8B 4OS2A 3A84A 5FX6A 2BB4A 1VCWA 2FMJA 4H6SB 1IQEA 1VZQH 3LJJA 1EXFA 5LPFA 1Q3XA 1LMWB 2UUKB 2XCNA 1L1NA 4KKDA 1AO5A 2Z3CA 3QTOH 1P2OA 3TJVA 1YGCH 5TJXA 4BTUB 1VJ9U 1PPHE 2A5IA 2FTLE 5DP6A 2OBQA 1P3EA 5FAHA 3ODDA 1V3XA 1Z7KA 3RDZA 1WQVH 3SGBE 2F9NA 2D26C 1W2KH 1LCYA 1O3GA 3P95A 1SLWB 5DP9A 3HATH 1SGFA 1WQSA 2VVUA 2BX4A 3I77A 1ETTH 1L4ZA 3LC5A 4FUHA 4DW2U 2GD4B 1IQKA 1VITH 2EA3A 1GMCF 5HXFA 4ISLA 2TBSA 1O0DH 1TQ0B 2BY7X 2P3FH 5IDKA 6GCHG 3S7HB 2J94A 2Z9KA 1UHBB 2A32A 3KHVA 1P2MA 3A7WA 1O36A 2BZAA 2G5NA 4JYTA 1C1VH 1QA7A 2O9QA 1YPHC 1TAWA 2P93A 1Y3XA 3SZNA 4XBDA 2O8TA 2FWWA 1WV7H 4ISIH 2Y7XA 1JRTA 9LPRA 3PWCA 1H8DH 1OYTH 1UTQA 3A8CA 1Q31A 3RC4A 2PUQH 3M5MA 2BVRH 2J9NA 1CU1A 1UHBA 1LPKB 2XBXA 3MU8A 4BANB 1GBBA 1GJ5H 3KGPA 4AGJA 3ZZAA 1C5XB 1TPOA 3SNAA 3LH3A 3EA8A 5FCRA 1C5VA 1DICA 1THPB 3MO6A 1YCPK 1AUTC 1SC8U 4JZFH 2Q6GA 4KGAA 2SNWA 3RP2A 3RXAA 3D23A 3EQ0H 1EOJA 1KXAA 1NFXA 1ZTLA 3PV4A 5C1YA 3Q77A 4GHQA 3GY7A 2V0BA 3T62A 1JMOH 1TFXA 3VB7A 3SNDA 3MH4A 1AI8H 2GT8A 4DIHH 1C5ZB 3DFJA 1L1JA 2D1JA 4ZROA 1GHVH 2GVFA 1WTHD 1ELVA 5DP4A 3VB6A 4AG1A 3LONA 2ZCHP 1DITH 3TH3H 1RFNA 1K1OA 1RXPA 4IN1A 1TGTA 2FOAA 3UUZA 2ZO3H 1KXFA 4H6TA 2BM2A 4FU7A 5JBBS 2EEKA 2ZFQH 1TBQH 1WOFA 1O2JA 2BD4A 4X1NU 3RXQA 3FZDA 3U69H 1HBTH 1TGBA 3SJIA 1FY4A 5DP5A 2BMGB 1OWHA 1F0SA 3MWIU 1NY22 4MPXA 1BIOA 1UVOA 3U98H 4AN7A 3SGAE 1C1PA 2WUBA 1UMAH 1BMLA 1ELTA 1O2VA 1A1RA 2Y5HA 2WPLS 2GKVE 1XVOA 3KQDA 4GVUA 3SUGA 3BTKE 2JKHA 1O2QA 2F3CE 1BTUA 1C1NA 1MKXH 4HFPB 3NCLA 3RC5A 1PQ7A 1ZTJA 1C2LA 2UWLA 4NG9H 1TA2A 1J8AA 1HAZB 2QXHA 1VGCC 1P06A 1WSSH 1ABJH 3MFJA 3S0NA 5EQRA 4OGYA 1OXGA 4A1XA 1DDJA 4TPIZ 3L33A 1ESBA 1O2SA 4BXSA 1HXEH 1QBNA 1FPHH 4JK6A 2BDYA 5GIBA 1M9UA 2ZNKH 1HB0B 1F5KU 4GCHF 3HKJB 3SU4A 1GHAG 4MVNA 1BRCE 1NU7B 1GJCB 1A61H 2ZFRH 5DO4H 3MH5A 4WMFA 2Y81A 3NWUA 3MU0A 1JBUH 1O2OA 1P57B 2H5DA 1ESTA 5ESBA 1YPJH 2BVXH 1ANCA 5TCCA 2ZQ2A 3AW0A 4K8BA 1C5NH 3HGNA 5C5OA 4YESB 1PQ8A 2VGCC 3Q00A 1PQ5A 1V2TT 1K9OE 4GUXA 1P12E 1FN6A 1SQOA 3RMLH 2ZFSA 3MU4A 4ZHAA 2ZDAH 1Z8RA 2QY0B 2TPIZ 4R0IA 1XUIA 1D9IA 2PKAB 2FLRH 1SFIA 2V3HH 5JB8S 3KEEA 4J2YB 1K28D 1SLVB 4FU8A 1GJAB 2XXLA 1SGFG 1UTLM 3VB4A 1GL1A 4CH2B 2EI8A 2Y5GA 1MAYA 1T7CA 3ZZ4A 1O3CA 5GCHG 3ZVGA 4CRBA 3QZRA 4OS7A 4K2YA 3SOSA 1TPSA 1QQUA 1TGNA 4X8TH 1J15A 1Y5BT 1TONA 2ALPA 2PKAA 4ABEA 1RRKA 4B2CA 4IC5A 1DX5M 5DP3A 4MNXA 4XFQA 2A4GA 3MNXA 1DLEA 2TGAA 5T6GA 1RJXB 5LH8A 1TGSZ 8GCHG 2ZF0H 5GXPA 3RMMH 4NA9H 1E0FD 1V2NT 5DPAA 1S83A 1FN8A 1EAIA 1O2KA 4Z0KA 1E38B 3GDVA 1C5RA 1AE8H 4ZKSU 3WY8A 2KAIB 1AN1E 1SOTA 4Y6DA 3ATWA 1W12U 2LNCA 1GVKB 1PPBH 1O3IA 3TK5A 1XKAC 3QO6A 3W94A 1ZLRA 2BD9A 1EJAA 3LPRA 4LZ1H 2QC2A 2NU2E 2FP7B 3ZZ9A 4I31A 1SFQB 1GBHA 2G00A 1W8BH 1P09A 4WXIA 4IC6A 3F1SB 4D9RA 2AMDA 3P6ZB 1IAUA 2J2UA 2CGAA 1O2UA 4MPWA 2P95A 1VGCB 2XWBI 4CRAA 3A7TA 1LVYA 2UUFB 2Y82A 1O34A 1D6WA 1YM0A 2G55A 1QJ7B 2KAIA 5HMAA 1MH0A 2R3YA 1MMJN 3GY8A 1GHZA 5EODA 5AVDA 1G2MA 3M3SA 2AEIH 1MUEB 1QJ1B 4O3TA 1C1TA 1UTMA 1SG8B 1CT0E 1DUEA 5J4QA 1K1PA 1HJAC 3IITA 4Y76A 4JZIA 2H9TH 4JMYA 4D7GA 4I7YH 4AX9H 1UCYE 3VB3A 1YPGH 1ZRBA 1AY6H 3H5CB 3RU4T 1LVMA 1UVUH 1C5QA 4K69A 3TJNA 2FOHA 1NS3A 3LGYA 3ELAH 1V2LT 1ARBA 1EX3A 2DE8A 2HNTE 3KQBA 2ZG0H 1T8LA 1BUIA 1K1MA 2VGCB 3Q3XA 1DVAH 1HRTH 1HXFH 1O30A 1WTGH 3TK9A 1P2IA 1RS0A 2IJOB 1O2IA 1ACBE 2W26A 1YPKH 5BRRE 3F9EA 4AFSA 1UTPA 2RCEA 1HFDA 1NT1A 2ZA5A 3PTNA 4IW4E 2PFEA 1O2HA 5FPTA 2A2XH 3SV7A 1SPJA 1AD8H 1EB1H 1HAGE 1GBJA 3V0XA 2XNIA 4AFUA 3A7VA 7ESTE 6CHAC 1LKAA 2FS8A 4X8SH 3U8TH 1GBLA 3F68H 1SR5C 3LJOA 4A1VA 1WCZA 3MYWA 3Q76A 1ZSJA 4ABIA 1QNJA 3M5OA 1T31A 1YKTA 2HPPH 3UQVA 3OY5U 2ZU1A 3RXUA 1N6YA 2ZHWH 2GCTC 5JBCS 2OC7A 4Q80A 1CA0C 1SGPE 3AAVA 2WUCA 2BLWA 2C93B 1K1JA 1P10A 3ZVCA 3NZIA 3SV2H 1GPZA 3MHWU 4FUEA 4NZQA 3ZZCA 2RA3A 1GL0E 2FXRA 3GOVB 1GHBF 3SU2A 1DM4B 3ZV9A 1GI7B 1H9HE 2ZHEH 1GBAA 2DUCA 3R3GB 3B9FH 1FY1A 1GI8B 1TNKA 3KNXA 3ZZ8A 1EQ9A 3RXKA 7KMEH 1LVBA 6LPRA 1EPTA 1QJ6B 3ZZ3A 3P8GA 1DUAA 1FMGA 1P0SH 4E7RG 2OQ5A 4FUGA 4CBNA 3S69A 1J16A 3K6YA 8KME2 2OC0A 2QA9E 1XM1A 2ZFPH 2XBVA 1GBIA 1RTLA 2NWNA 2Z9GA 3T25A 3ZVAA 4ABAA 3M36A 1XUKA 4YOJA 3EA7A 1CT2E 1XUJA 3FAOA 1B0FA 3S9AA 5T3HA 3DUXH 1CBWC 4MNVA 3QGJA 5LPEA 1S85A 1UVPA 2BD5A 1O2XA 1TNHA 1J9CH 2CF9H 3P8OA 3SU0A 4GCHG 2JH0D 4RSPA 5AFYH 1HJAB 2GDEH 3DFLA 4LXBH 5C5NA 2C8ZB 2QXJA 3ZZ6A 2B0FA 2FO9A 1G3BA 1YLDA 1DOJA 5DP7A 2FI3E 3KCGH 3SNCA 3NPSA 4DG4A 1SL3A 5HGGA 1BQYA 4CRDA 3STIA 1UO6A 3MTYA 4X8VH 4X1SU 3F6UH 2QV1A 1O3DA 2PHBA 2F9OA 1P2KA 4DIIH 1BBRK 2YNAA 3BF6H 2A5AA 3JZ2B 1DWBH 4KTUA 3UR9A 1EZQA 4A6LA 3RXCA 2ZC9H 1K2I1 3SUFA 3T5FH 4ASHA 5A0CA 1DWCH 5E2PA 3SI3H 2ZQ1A 3PMJA 3MMGA 1P8VC 3PYHA 1Y3VA 1UK4A 2VH0A 1BJUA 1L4DA 2VWMA 6CHAB 4XBBA 1ZSKA 1B7XB 3TGKE 1B0EA 2PLXA 1WUNH 1XUHA 1MZDA 2GZ9A 4O03A 4FUBA 5B6OA 2A4RA 1BTHH 4ABGA 2AGEX 4H42U 2Z3EA 4YTAA 8LPRA 3SU6A 1HPGA 3JZ1B 2CV3A 2ILNA 4NIWA 1J17T 3SJ8A 1LO6A 1SQTA 1YPHE 2AERH 2GCTB 1W13U 2BX3A 1V2JT 1YCPH 2XRCA 3ATIA 1CA0B 5DKMA 2QYIA 5I25A 1QIXB 4IMQA 1MTNC 1EAWA 3HK3B 3W95A 2VIDA 1OP0A 2IPHA 4WWYA 1GGDC 1O5DH 2XWAA 1MBQA 2XC5A 1Y5AT 3PMHB 2UWPA 4X0WU 5FBEA 3SJ9A 1GMDF 4I33A 4WMEA 1SVPA 1GBMA 1QRWA 1LHGH 3A80A 1WU1A 2FOEA 3UWIA 1FJSA 1YCPM 4O9VA 4D8NA 5TCAA 2AFQB 2ZPRA 2A45B 2UWOA 1Z8IB 5A8XA 5GJ4B 3PTBA 4ABHA 2G52A 2A7JA 1OSSA 4X1QU 4GSOA 1ZHMA 5E2OA 3SN8A 1LHDH 1C1SA 1CBWB 2HVXA 2HPQH 3ZZ5A 1DWEH 2H9HA 3KL6A 5EXLA 2ANYA 4AZ2B 1ZMLA 3SNBA 2BXUH 4B2BA 1GJDB 2ZPQA 5DK1A 1ELAA 3F9FA 1BMMH 1GBTA 1SLXB 2NU0E 1ANBA 1IQMA 1MTVA 1BCUH 3ENSB 1PYTC 5AF9H 2B8OH 1TPPA 4DOQA 5EPNA 1IQJA 3VXFH 4A1TA 2WPIS 1NFYA 1ZJKA 2Z3DA 1SQAA 3S7KB 3RU4E 9ESTA 1FI8A 4NA8A 1UTOA 1JRSA 3BIVH 4UEHH 6ESTA 4WVPE 3OY6U 2A7CA 4OS6A 2TIOA 2SGPE 1F0UA 1A5IA 1DLKB 2A4QA 3V13A 1TNLA 1NU9A 4CHAC 4D76A 2C8WB 2FOGA 4X2WA 1TBRH 3GCTG 4BXWA 1KLTA 1BMAA 2H2ZA 1BJVA 2SGDE 1YYY1 2STBE 1OPHB 5LPRA 3S9BA 2GP9B 1NFWA 1C2EA 2F9VA 3UNQA 1O2NA 4GLYA 1MAXA 1JOUB 3PB1E 1MD8A 3RC6A 2QF3A 4AFQA 2BVSH 1C5TA 4MLFB 1O3BA 1ANDA 1QFKH 3AW1A 4B76A 4RKOB 1MKWK 3A8BA 3E6PH 3SV6A 3DHKH 4OS1A 4UFEH 3UWJH 2A7HA 1FUJA 1AUJA 4JYVH 1LDTT 1BTWA 1MTNB 4SGAE 1QRZA 2EI6A 3D49H 4CBOA 3M5LA 1UTJA 2ZU4A 1HNEE 1GGDB 1G36A 1ETSH 2PW8H 2VWLA 1CVWH 3GY5A 2FZZA 2Z7FE 1Z6JH 1QB9A 4ZXYH 4CRCA 1A0LA 3RXIA 2YOLA 1X7AC 4A7IB 1W14U 1O3PB 2BY5X 1KTSB 3TITA 4ZKRU 3P8FA 2R3UA 1BTXA 1SHYA 1F5LA 1F0RA 1C2KA 4THNH 1BITA 2GZ7A 4IGDA 4AGKA 3TGIE 4Y10E 5FPYA 1EAXA 3SBKA 1CHOG 2D2DA 4Y11E 5G4BA 3BTQE 1O2YA 2XTTB 2AH4X 1GG6C 4XE4A 1C5PA 1G32B 1O2WA 4DJZB 1G2LA 4ABFA 1GI3A 4WF8A 3ZYEA 4FUFA 2OCVB 4AG2A 2Z9JA 1ZGVA 3PROA 2CN0H 1O3LA 4ESTE 4Y0YE 1HAYB 4YO9A 5A8ZA 3A8DA 3D65E 1QL8A 1D4PB 3UIRA 1VCPA 1DXPA 4KP0A 1Z6EA 1GMHG 4JK5A 2ZECA 1DSUA 1Z8JB 1TWXB 2FOFA 1KYNA 3K2UA 4E05H 1LQEA 2BDAA 3VB5A 3GDUA 1CT4E 4CH8B 2VNTA 1TX8A 2WPJS 1FIWA 4CHAB 1GI0A 4E06H 3EDXB 2HGTH 3O8DA 1LKBA 1XUGA 4NIVA 1LHCH 2GT7A 4X2VA 3BG4C 2ZHFH 1C1UH 3Q3YA 1RIWC 2BDHA 1QCPA 1PQAA 1RTFB 1O5CB 4K8YA 1TNGA 2LPRA 2VIOA 5E0HA 2ZHQH 1GHYH 3RM2H 3TJOA 1OWJA 2O8LA 1GJBB 1TX7A 2VH6A 4HI3A 3T27A 3C1KA 1LHEH 2OD3B 2GCHF 1L2EA 2PTCE 1VITF 1WAYB 3BTEE 2BDBA 3AVZA 3M37A 1XVMA 4MQAA 1CE5A 2VIPA 3N7OA 3SGQE 4BNRA 1W10U 2CXVA 5DP8A 1CA8B 1W0ZU 4JYUH 5FBIA 4BAMB 1P04A 1S84A 1GCTC 1SGYE 2ZGJA 3LU9B 2WV4A 2ZDMA 4MPVA 1GCDA 3BN9A 3BTDE 5HYOA 1T4VH 3FZZA 1S0QA 4I8JA 1ELBA 1A0HB 1GDUA 3RMNH 1C1WH 1E35B 1MTWA 1TMTH 1O5FH 1THSH 2QAAA 4K60A 2JH5D 4GPGA 5L2YH 3GYMA 3QTVH 1GI6A 1GMDG 2PUXB 3E1XB 1H4WA 1AIXH 1CGJE 1L0ZA 2HLCA 3I29A 4BTTB 2PGBB 1FQ3A 1T8OA 1O3JA 3LH1A 1MU6B 1NZQH 2RDLA 1OX1A 1SLUB 2ZTXA 3QN7A 5LGOA 3RXBA 1PJPA 4B75A 1J14A 3KF2A 1AGJA 3QGNB 2YNBA 2Z6BD 3QK1A 3HK6B 1GJ6A 5F8TA 1HAIH 2ANMH 1OWKA 1O3EA 3IG6B 3TJUA 1GG6B 2W3IA 3TK6A 4AFZA 1QL7A 5ETXA 3V7TA 3VGCC 3UPEA 1GMCG 1G3EA 5HM2A 1O3OA 3ZZ7A 1HUTH 2SGFE 2FYQA 1FAXA 1N8OC 2J92A 1FAKH 2SGAA 5EPYA 1OP8A 5C1XA 3BTHE 4MDSA 1KLIH 2FM2A 3F9HA 1W7GH 1A0JA 2F9UA 3LOXA 3RU4D 4BAOB 2RG3A 1C9PA 4UDWH 1SSXA 2WPKS 3E8LA 1BRUP 3ZZBA 1QL9A 2HWLB 3B23B 3FANA 2WV5A 2ANKH 1MCVA 1CQQA 2XW9A 5ESTE 1IHSH 1FY8E 1DY9A 2ZEBA 4Y7AA 2BQ6B 1FONA 1OWIA 4A5TS 2XYAA 2FOCA 4ISHH 1DS2E 1AFEH 2AMQA 2J95A 3OSYA 1FY3A 4K1EA 1ZZZA 3ATLA 4ZUHA 1FV9A 1O2MA 3BG4B 4X8UH 4Y71A 2D8WA 1RIWB 1AWHB 4FUCA 3TVJB 1G3CA 1UVTH 3RXPA 1D3QB 1H9LB 1BOQA 3UREA 1KDQB 1XX9A 1AFQC 1C5WB 1TX6A 3UY9A 1FDPA 2FOMB 2I6QA 1YF4A 1HCGA 2VVCA 1A5GH 3G01A 1C9TA 4B74A 2BD2A 3R0FA 3FVFB 5CHAC 1QB6A 3URDA 4WH6A 1TRNA 1XKBC 1OKXA 2CMYA 1GCTB 2XBWA 3PMBB 1K1IA 4YOGA 3ODFA 2BDIA 1O5BB 1O2ZA 1D3PB 1C5LH 1MTSA 2AYWA 4X2XA 3NK8A 1BBRH 1PPGE 1P9SA 4RN6A 2PKSC 2F91A 5EG4A 2FX4A 1C2GA 1KDQA 5F8ZA 3SORA 5F03A 2WINI 3QDZB 1YPLH 3RXEA 3PWBA 5C67A 2PWXA 1SGDE 3D62A 1O2PA 2ODYB 1TIOA 3SQHE 5DJ7A 1TBZH 2QN5T 3PMAB 2BQ7B 1OP2A 1O3KA 1KY9A 1HAXB 2FPZA 2ANWA 2NU1E 2F9BH 2VIQA 4NWLA 1BTYA 3LGVA 1N6XA 2WYJA 2A4OA 1C2JA 5C2ZA 1LTOA 3P92A 3ZVFA 1ZYOA 4JCNA 1ORFA 1BTPA 1QB1A 2TGDA 4K3JA 1QY6A 2G4UA 3E0NB 2ZFTA 1LVOA 4NIYA 4UONA 3RLWH 4OS5A 2OXSA 1GVZA 5EW2H 1O2TA 3VGCB 5GWZA 5E0GA 4HGCA 1CGIE 1HAVB 1N8OB 1ELGA 2B7DH 4XSKU 3F9GA 2G4TA 4O97A 4AYYB 4U01A 2HNTC 1BB0B 1LHFH 1TOMH 1BRAA 1DFPA 3U9AH 2P8OC 2C90B 3EE0B 4UFDH 3UQOA 2GTBA 2ZFFH 2NU3E 2CF8H 3E91A 5FXLA 2XC0A 1C5UA 1C2HA 1NRRH 1TLDA 2QCYA 4TWWA 4MG3A 4I8HA 1GWAA 3SHCH 2J34A 1HIAB 3RXJA 1H8IH 1HAVA 5H4IB 3CENA 4DY7B 3SU1A 1KLJH 1O39A 3BEUA 1ZSLA 4XOJA 4F49A 1ELFA 3FP7E 4Q7ZA 1BHXF 4YT6H 1SGTA 5EU8A 4TPYA 1UCYK 1T8MA 1IQHA 1ZJDA 3GCOA 1XMNB 4KTSA 1TE0A 1V2UT 2FLBH 3DD2H 3OX7U 3U1IB 1IQNA 4AB8A 1AFQB 1O5GH 1PFXC 2ZGCA 1ABIH 1EJMA 2EC9H 2R0LA 1HIAA 2OP9A 2BLVA 1E37B 3RLYH 1BDAA 3KQEA 2BYAX 5CHAB 3BEIB 3FP8E 5FHTA 5A0BA 3LGWA 3RXSA 1KXDA 4UFFH 2AIPA 1S82A 2VWNA 3MO9A 3E0PB 2W5EA 1K21H 1C1OA 2ZHDA 2PSYA 1FPCH 1S6FA 1SGCA 4INHA 4CR5A 3SU5A 1G30B 1TABE 1Y59T 1HAHH 3S9CA 3RXGA 3TGJE 1JIRA 1PPFE 1TALA 4NFEA 3T26A 2PKSB 2V35A 2AGGX 4FXGH 1ZPZA 4MTBA 3SJKA 1MQ6A 4ABBA 4U32A 2G8TA 3A7ZA 1AMHA 5DG6A 1CSOE 1V2PT 5JBAS 4K5ZA 1T8NA 1EAUA 3UOPA 1S81A 5J4SA 1ZHRA 2GMTC 2ZZUH 1NRPH 2IN2A 4I8LA 4PROA 2B5TB 1K1LA 2ZI2H 1MBMA 4ZMAH 1GBEA 3A7YA 5EGMA 5JBTA 1C5YB 1P2QA 2OC8A 2G5VA 2W7SA 2SNVA 3VPKA 3U8RH 4K1TA 2M5TA 1DANH 4VGCC 1PPCE 1GI5A 2ZDVH 4HZHA 3DA9B 2B9LA 1NESE 5BPEA 1UTKA 5EQQA 4NCYA 4WY3A 2HNTF 3HKIB 1TNIA 2VWOA 3GCHC 2XC4A 4YZUA 3V12A 4NSVA 1EATA 4QT8C 1GJ8B 5GCHF 1BMNH 3BTWE 4ZH8A 3BTTE 3RXVA 3ZVBA 3ESTA 1SHHB 4UFGH 3ZV8A 1HV7A 5CE1A 4OS4A 3BEFB 1GJ7B 3BTME 2BY6X 4DCDA 2Y6TA 2F9PA 5SGAE 1QQ4A 4WXVA 1K22H 4NZLA 1A7SA 4BAHB 1A5HA 2P8OB 1UK2A 2ZDKA 3U1JB 1YLCA 1P03A 2Q6FA 3NXPA 2BXTH 8GCHF 2OTVA 3PLKA 2GZ8A 5HM9A 1QURH 4FVBA 3L3TA 1AVGH 3UFAA 1KTTB 5CMXH 2FDAA 2PGQB 2XCFA 1W0YH 1H9IE 4TWYA 1ZMNA 2BD7A 1C4Y2 2A0QB 2CHAC 4MPUA 1QRXA 2H6MA 4ISOA 2A2QH 4FVDA 5GDSH 1OWDA 1A4WH 2PV9B 3MU5A 1D3DB 1AVXA 1RGQA 5K7RA 1BRBE 2ZKSA 2ZGXH 4Q7YA 1O2RA 2FOBA 1O3HA 1Z1IA 3P70B 4UE7H 1RTKA 4OGXA 1YP9A 4BAQB 5ABWA 1GJ4H 3A89A 2ZU3A 4JZDH 2O8UA 1GHXH 1ESAA 3O8CA 3TIUA 1AZ8A 1QHRB 1QR3E 1BA8B 2TGPZ 2Z9LA 3EYDA 1Z8GA 1DY8A 3U8OH 2QXIA 4DVAU 2P3UB 3NKKA 3GY3A 1EZSC 2V3OH 2FIRH 4HTCH 3SV9A 5JPMH 4NSYA 2FS9A 1E34B 1F92A 1WYKA 4R8TB 1ZGIA 5EXMA 3AAUA 4WMDA 2H5CA 3SJOA 1IOEA 3A83A 1SB1H 4YOIA 1C2DA 2FX6A 2GMTB 2VVVA 4XBCA 5F6MA 4MNYA 2PTNA 1F7ZA 3STJA 1NFUA 1MCTA 1QBOA 1EP6A 1EZXC 1SGEE 1Y8TA 1FY5A 3SO3A 3K6ZA 1GHBG 1AZZA 3SUEA 1VR1H 2ESTE 4NFFA 1FLEE 1SMFE 4VGCB 3OU0A 2ODQA 2P59A 4BTIB 1CGHA 1EUFA 2ZIQH 2R2WU 3UNRA 3ITIA 3Q3KA 3GCHB 4IBLH 2J4IA 3A81A 2ZTZA 1S5SA 4IS5A 3RXMA 2BZ6H 4JZEH 1FZZA 2V6NA 5EQSA 3UOUA 1QTFA 2A1DB 1AQ7A 7GCHF 1O3FA 2BY9X 2HALA 1JXPA 1W7XH 2ZCKP 3SQEE 2BD3A 3T2NA 3MNSA 2EI7A 5L30H 2IOTA 2FESH 1Z1JA 4CRFA 4I8KA 4AYVB 7LPRA 2ZDNA 5EOKA 1P3CA 1W11U 4B73A 1O5EH 2JETC 1VCQA 1C2MA 1V2VT 1TQ7B 2TGTA 2Y5FA 3RXLA 1OS8A 3PO1C 2CHAB 1SOZA 2K1QA 1Z71A 3A85A 1BT7A 3K9XB 1YPEH 2OINA 3SU3A 4BAKB 3KQCA 1EB2A 3BSQA 3EA9A 3URCA 2WPMS 2GV6A 5FCKA 3UR6A 4LK4A 1NM6A 1FXYA 1SGQE 3EGKH 4D7FA 4FUJA 3RXRA 1F2SE 1KXCA 2ODPA 2PR3A 2I6SA 3PM3A 4J1YA 5I46H 1U6QA 2SGEE 2W7UA 3RXDA 1ELDE 4FUDA 2BHGA 2BOHB 1O37A 3A7XA 2NU4E 4LOYH 1ID5H 5L2ZH 2ALVA 1MQ5A 3MNCA 4X2YA 2TRMA 1K1NA 3M3VA 3GY4A 2THFB 1DPOA 3M7QA 8ESTE 3KN2A 1NRSH 1HYLA 1YC0A 1ZPBA 1PYTD 2ZGHA 1C2IA 1S6HA 2OUAA 4U2WA 1GBCA 5C20A 4FUIA 3TH4H 1V2MT 4X6NA 1ZMJA 3LGIA 4D9QA 1QBVH 2RA0A 4TY6A 3I78A 1CHGA 3KIDU 1NN6A 1NTPA 4GAWA 2OQUA 4SGBE 2A5KA 1ZPCA 3UNSA 3GY2A 1V2KT 4B1TA 1GDNA 1V2QT 2UUJB 3E16B 3BTGE 4INKA 1DWDH 1JIMA 1O38A 3HGPA 3O8BA 1XUFA 1HGTH 1GI2A 5JDUB 1H1BA 2AMPA 3GDSA 4YLUA 3ATKA 3MH7A 1Y3WA 4ZAEA 1FIZA 2FI4E 3GICB 3DT0H 2QF0A 5C1UA 1V2WT 4ABDA 2BDGA 1O3NA 1GHWH 3ZYDA 1KXBA 1IHTH 3MH6A 4NA7A 1KIGH 2SGQE 1NRQH 1V2OT 1Y3YA 3E3TA 5JB9S 4CRGA 2QGRA 2ZWLH 2ZPSA 1KXEA 3GYLB 4UD9H 3FP6E 1C5SA 2GX4A 2VIVA 4Q7XA 3P17H 1EPTC 3LGTA 4RKJB 1VJAU 1S0RA 4NIXA 2P94A 2ZGBH
chains in the Genus database with same CATH superfamily
4M7GA 4CREA 2QIQA 5AHGH 4ZHMU 2R0KA 2A31A 2P3TB 1MD7A 1G3DA 3VXEH 3RXTA 2J38A 2WHXA 1T32A 1YPMH 1O3AA 1MKXK 1IQGA 1NBMD 2JETB 2DE9A 5T6FA 3MO3A 1PPZA 1C1RA 3GCNA 1GJ9B 2QXGA 1AVWA 1OHHD 3PO1B 4H4FA 3LIWA 1QA0A 3H7TA 3B8JA 2BD8A 3PLPA 5T6DA 2GV7A 1GI1A 1WBGB 2GGVB 1INCA 1UJ1A 1EP5A 4I8GA 3TLOA 3ZVDA 3MOCA 1NRNH 5GNDA 1THRH 1O5AB 3PLBA 1EZUC 1GBFA 1P05A 4X6PA 4Z6AH 4Y8YA 3TNTA 4DURA 3RUOA 1HAPH 1JWTA 2Q1JA 3MI4A 3H7OA 4DGJA 2BDCA 3BG8A 2OBOA 1LQDB 1P2JA 3TNSA 1TRYA 2OLGA 1SGIB 2BOKA 4X6OA 2FTMA 1YBWA 1NROH 1OYQA 4ZKOU 1EKBB 3SHAH 4F4OC 2H1UA 1AHTH 3SNEA 3VG8A 1IQFA 1SGRE 2OC1A 4Y79A 1BTZA 6GCHF 2FEQH 1TYNA 2Z94A 4JZ1A 3SV8A 2GDDA 3A82A 2M2AA 4WJG2 3EAJA 1GVLA 1SBWA 1AE5A 1TA6A 1UTNA 2PSXA 1O35A 2VU8E 2O8WA 2C8XB 1G37A 1ZTKA 3SI4H 5E8EH 1AKSB 3V3MA 1BBRE 1HJ9A 3A88A 4ZKNU 1P01A 1ZR0A 2FODA 4YM9A 2G81E 3FFGA 1UCYH 3RXFA 5FPSA 1PPEE 1VKYA 4XDEA 1GBDA 1ZHPA 3T29A 1MTUA 4DT7B 1GDQA 3GCTF 4YT7H 4LZ4B 2O8MA 1P11E 2Q6DA 4ISNA 5EXNA 1ELCA 1SI5H 1A3BH 2KR7A 3LDXH 2R2MB 1AB9C 1O33A 3SUDA 1BZXE 1KSNA 3M7UA 1P02A 4NWKA 2Z9IA 4MNWA 4K1SA 1AKSA 2BLOA 3RM0H 4Y0ZE 3A86A 2VB0A 3BIUH 4AC9A 1C4U2 4Y8ZA 1F0TA 5L6NH 5PTPA 4E7NA 1F5RA 1N1LA 1Y3UA 3QZQA 1G9IE 1QGFA 2BLQA 1D3TB 3MU1A 4X6MA 1RD3B 1O3MA 2AIQA 1O32A 2ASUB 2VIWA 1A2CH 2CJIA 1EPTB 7GCHG 2SFAA 4TYDA 3BTFE 3SW2B 2BY8X 1ETRH 3M3TA 3BV9B 3ZZDA 5K0HA 1O31A 1NC6A 1FNIA 4TY7A 2VJ1A 2HRVA 4A92A 1MABB 3GISB 1SGNE 2AS9A 1DT2A 1C2FA 1C5MD 4WH8A 2C3SA 1MZAA 5IYTA 5FX5A 4OM9A 2ULLA 4NGAH 2Y7ZA 2AGIX 2XOKD 4ACAA 4YLQH 5EW1H 2ZDLA 5A8YA 2ZCLP 5E0JA 1OOKB 4Y7BA 1LPZB 4B2AA 3TPIZ 3HPTB 4KTCA 3LGUA 4RT1A 1ARCA 1AU8A 4ABJA 1AWFH 1Q2WA 2H9EH 3FOAA 3M5NA 1TOCB 4INLA 4ASUD 4I86A 1GI9B 2P16A 1CHOF 2WYGA 2LP6A 1GBKA 3UTUH 2UUYA 3LKWA 1LPGB 4IN2A 1GI4A 1TMUH 4AOQA 3LC3A 3E90B 2FI5E 1DE7H 5AFZH 3T28A 3QUMP 5C3NA 3NUMA 1HAOH 4AORA 1C1QA 4Q2KA 1V2RT 4ZHLU 1TB6H 4X1RU 5KECA 4BOHA 3LT3A 1T4UH 2F83A 2VINA 5F8XA 1B5GH 3RXOA 3A87A 2ZTYA 3RXHA 2GCHG 4FU9A 4O3UA 3AASA 2V3MA 1GMHF 1ELEE 3CS7A 5JYIA 1VITG 5A0AE 1NPMA 1TGCA 1TRMA 2JH6D 1BHXB 2JJ1D 3M35A 1GHAF 1DXWA 1TPAE 4IMZA 2R9PA 1C1MA 3K65B 1D6RA 4B71A 2BQWB 1ZRKA 1O2GH 1P9UA 1A3EH 3IWMA 3QLPH 2ZU5A 2G51A 3CS0A 2FYRA 1C5OH 4KELA 1HJ8A 1A46H 5A2MH 3M61U 3CP7A 4ZXXH 1AB9B 1XXDA 3ATMA 1IQLA 2XBYA 3RMOH 3P8NA 1OWEA 1TMBH 1O2LA 1WDIA 4Y8XA 3TH2H 3M7TA 3C27B 3QX5H 3VFEA 1DSTA 2Y80A 1QZ8A 1EJNA 4X1PU 1UK3A 3L6PA 3QWCH 2ZU2A 1L1GA 1HDTH 1ZOMA 2J5UA 1IQIA 3OYPA 2C4FH 3OTJE 3CNRA 1CO7E 3ZVEA 1P2NA 2STAE 1MKWH 1Y5UT 1ANEA 1NO9H 3VEQB 1HLTH 1V2ST 2C8YB 4I32A 1W3CA 5GPIB 4AB9A 2BTCE 1XXFA 4CR9A 2W3KA 1EOLA 4U30A 1TNJA 5DGJA 4GHTA 1C4V2 2HOBA 5A09A 3GY6A 3O8RA 1E36B 2ZP0H 3TU7H 2WPHS 1V6DA 1YWUA 3MNBA 1UVSH 3A8AA 1EASA 1MU8B 4OS2A 5B6LA 3A84A 5FX6A 2BB4A 1VCWA 2FMJA 4H6SB 1IQEA 1VZQH 3LJJA 1EXFA 5LPFA 3OEHD 4B6EA 1Q3XA 1LMWB 2UUKB 2XCNA 5C94A 1L1NA 4KKDA 4M9FA 1AO5A 2Z3CA 3QTOH 1P2OA 3TJVA 1YGCH 5TJXA 4BTUB 1VJ9U 1PPHE 2A5IA 2FTLE 5DP6A 2OBQA 1P3EA 5FAHA 3ODDA 1V3XA 1Z7KA 2QF4A 3RDZA 1WQVH 3SGBE 2F9NA 2D26C 1W2KH 1LCYA 3N99A 1O3GA 3P95A 1SLWB 5DP9A 3HATH 1SGFA 1WQSA 2VVUA 2BX4A 3I77A 1ETTH 1L4ZA 3LC5A 4FUHA 4DW2U 2GD4B 1IQKA 1E1RD 1VITH 2EA3A 1GMCF 5HXFA 4ISLA 2TBSA 1O0DH 1TQ0B 2BY7X 2P3FH 5IDKA 6GCHG 3S7HB 2J94A 2Z9KA 1UHBB 5C17A 2A32A 3KHVA 1P2MA 3A7WA 1O36A 2BZAA 2G5NA 4JYTA 1C1VH 1QA7A 2O9QA 1YPHC 1TAWA 2P93A 1Y3XA 3SZNA 4XBDA 2O8TA 2FWWA 1WV7H 3F0OA 4ISIH 2Y7XA 1JRTA 9LPRA 3PWCA 1H8DH 1OYTH 1UTQA 1YLNA 1Q31A 3A8CA 3RC4A 2PUQH 2EQNA 3M5MA 2BVRH 2J9NA 1CU1A 1UHBA 1LPKB 2XBXA 3MU8A 4BANB 1GBBA 1GJ5H 3KGPA 4AGJA 3ZZAA 1C5XB 1TPOA 3SNAA 3LH3A 3EA8A 5FCRA 1C5VA 1DICA 1THPB 1W0KD 3MO6A 1YCPK 1AUTC 1SC8U 4JZFH 2Q6GA 4KGAA 2SNWA 3RP2A 3RXAA 3D23A 3EQ0H 1EOJA 1KXAA 1NFXA 1ZTLA 3PV4A 5C1YA 3Q77A 4GHQA 1EFRD 3H09A 3GY7A 2V0BA 3T62A 1JMOH 1TFXA 3VB7A 3PV5A 3SNDA 3MH4A 1AI8H 2GT8A 4DIHH 1C5ZB 3DFJA 1L1JA 5DN6D 2D1JA 4ZROA 1GHVH 2GVFA 1WTHD 1ELVA 5DP4A 3VB6A 4AG1A 3LONA 5EJZA 2ZCHP 1DITH 3TH3H 1RFNA 1K1OA 1RXPA 4IN1A 1TGTA 2FOAA 3UUZA 2ZO3H 1KXFA 4H6TA 4FOUC 2BM2A 4FU7A 5JBBS 2EEKA 2ZFQH 4XRNA 1TBQH 2YMSD 1WOFA 1O2JA 2BD4A 4X1NU 3RXQA 3FZDA 3U69H 1HBTH 1TGBA 3SJIA 3F2HA 1FY4A 5DP5A 2BMGB 4DT4A 1OWHA 1F0SA 3MWIU 1NY22 4MPXA 1BIOA 1UVOA 3U98H 4AN7A 3SGAE 1C1PA 2WUBA 1UMAH 1BMLA 1ELTA 1O2VA 1A1RA 2Y5HA 2WPLS 2GKVE 1XVOA 3KQDA 4GVUA 3SUGA 3BTKE 2JKHA 1O2QA 2F3CE 3GS9A 1BTUA 1C1NA 1MKXH 4HFPB 3NCLA 3RC5A 1PQ7A 1BMFD 1ZTJA 1C2LA 2UWLA 4NG9H 1TA2A 1J8AA 1HAZB 2QXHA 1VGCC 1P06A 1WSSH 1ABJH 3MFJA 4Q63A 5EQRA 4OGYA 3S0NA 2KZ4A 1OXGA 4A1XA 1DDJA 4TPIZ 3L33A 1ESBA 1O2SA 4BXSA 3PV2A 2W6ID 1HXEH 1QBNA 1FPHH 4JK6A 2BDYA 5GIBA 1M9UA 2ZNKH 5HIZA 1HB0B 1F5KU 4GCHF 3HKJB 3SU4A 1GHAG 4MVNA 1BRCE 1NU7B 1GJCB 1A61H 2ZFRH 5DO4H 3MH5A 4WMFA 2Y81A 1K0HA 3NWUA 3MU0A 1JBUH 1O2OA 1P57B 2XNDD 2H5DA 2WSSD 1ESTA 5ESBA 1YPJH 2BVXH 1ANCA 5TCCA 2JDID 2ZQ2A 3AW0A 4K8BA 1C5NH 3HGNA 5C5OA 4YESB 1PQ8A 2VGCC 3Q00A 1PQ5A 1V2TT 1K9OE 4GUXA 1P12E 1FN6A 1SQOA 3RMLH 2ZFSA 3MU4A 4ZHAA 2ZDAH 2HVYB 1Z8RA 2QY0B 2TPIZ 4R0IA 1XUIA 1D9IA 2PKAB 2FLRH 1SFIA 2V3HH 5JB8S 3KEEA 4J2YB 1K28D 1SLVB 4FU8A 1GJAB 2XXLA 1SGFG 1UTLM 3VB4A 1GL1A 4CH2B 2EI8A 2Y5GA 1MAYA 1T7CA 3ZZ4A 1O3CA 5GCHG 3ZVGA 4CRBA 3QZRA 5CDFE 4OS7A 4K2YA 3SOSA 1TPSA 1QQUA 1TGNA 4X8TH 1J15A 1Y5BT 1TONA 2ALPA 2PKAA 4ABEA 1RRKA 4B2CA 4IC5A 1DX5M 2IJD1 5DP3A 4MNXA 4XFQA 2A4GA 3MNXA 1DLEA 2TGAA 1H8ED 5T6GA 1RJXB 5LH8A 1TGSZ 8GCHG 2ZF0H 5GXPA 3RMMH 4NA9H 1E0FD 1V2NT 5DPAA 1S83A 1FN8A 1EAIA 1O2KA 1E1QD 4Z0KA 1E38B 3GDVA 1C5RA 2PP6A 1AE8H 4ZKSU 3WY8A 2KAIB 1AN1E 1SOTA 4Y6DA 3ATWA 1W12U 2LNCA 1GVKB 1PPBH 1O3IA 3TK5A 1XKAC 3QO6A 3W94A 1ZLRA 2BD9A 1EJAA 3LPRA 4LZ1H 2QC2A 2NU2E 2FP7B 3ZZ9A 4I31A 1SFQB 1GBHA 2G00A 1W8BH 1P09A 4WXIA 4IC6A 3F1SB 4D9RA 2AMDA 3P6ZB 1IAUA 2J2UA 2CGAA 1O2UA 4MPWA 2P95A 1VGCB 2XWBI 4CRAA 3A7TA 1LVYA 2UUFB 2Y82A 2W6JD 1O34A 1D6WA 1YM0A 2G55A 1QJ7B 2KAIA 5HMAA 1MH0A 2R3YA 1MMJN 3GY8A 1GHZA 5EODA 5AVDA 1G2MA 2KCYA 3M3SA 2AEIH 1MUEB 1QJ1B 4O3TA 3ZIAD 1C1TA 1UTMA 1SG8B 1CT0E 1DUEA 5J4QA 1K1PA 1HJAC 3IITA 4Y76A 4JZIA 2H9TH 4JMYA 4D7GA 4I7YH 4AX9H 1UCYE 3VB3A 1YPGH 1ZRBA 1AY6H 3H5CB 3RU4T 1LVMA 1UVUH 1C5QA 4K69A 3TJNA 2FOHA 1NS3A 3LGYA 5HKKD 3ELAH 1V2LT 1ARBA 1EX3A 2DE8A 2HNTE 3KQBA 2ZG0H 2JJ2D 1T8LA 1BUIA 1K1MA 2VGCB 3Q3XA 1DVAH 1HRTH 1HXFH 1O30A 1WTGH 3TK9A 1P2IA 1RS0A 2IJOB 1O2IA 1ACBE 2W26A 1YPKH 5BRRE 3F9EA 4AFSA 1UTPA 2RCEA 1HFDA 1NT1A 2ZA5A 3OAAD 3PTNA 4IW4E 4FETA 2PFEA 1O2HA 5FPTA 2A2XH 3SV7A 1SPJA 1AD8H 1EB1H 1HAGE 1GBJA 3V0XA 2XNIA 4AFUA 3A7VA 7ESTE 3KYGA 6CHAC 1LKAA 2FS8A 4X8SH 3U8TH 1GBLA 3F68H 1SR5C 3LJOA 4A1VA 1WCZA 3MYWA 3U28C 3Q76A 1ZSJA 4ABIA 1QNJA 3M5OA 1T31A 1YKTA 2HPPH 3UQVA 3OY5U 2ZU1A 3RXUA 5T1VA 1N6YA 3PRBA 2ZHWH 2GCTC 5JBCS 2OC7A 4Q80A 1CA0C 1SGPE 3AAVA 2WUCA 2BLWA 2C93B 1K1JA 1P10A 3ZVCA 3NZIA 2CK3D 3SV2H 1GPZA 3MHWU 4FUEA 4NZQA 3ZZCA 2RA3A 1GL0E 2FXRA 3GOVB 2KCAA 1GHBF 3SU2A 1DM4B 3ZV9A 1GI7B 1H9HE 2ZHEH 1GBAA 2DUCA 3R3GB 3F0PA 3B9FH 1FY1A 1GI8B 1TNKA 3KNXA 3ZZ8A 1EQ9A 3RXKA 7KMEH 1LVBA 2OK5A 6LPRA 1EPTA 1QJ6B 3ZZ3A 3P8GA 1DUAA 1FMGA 1P0SH 4B6FA 4E7RG 2OQ5A 4FUGA 4CBNA 3S69A 1J16A 3K6YA 8KME2 2OC0A 2QA9E 1XM1A 2ZFPH 2XBVA 1GBIA 1RTLA 2NWNA 2Z9GA 3T25A 3ZVAA 4ABAA 3M36A 1XUKA 4YOJA 3EA7A 1CT2E 1XUJA 3FAOA 1B0FA 3S9AA 5T3HA 3DUXH 1CBWC 4MNVA 3QGJA 5LPEA 1S85A 1UVPA 2BD5A 1O2XA 1TNHA 1J9CH 2CF9H 2F4LA 3P8OA 3SU0A 4GCHG 2JH0D 4RSPA 5AFYH 1HJAB 2GDEH 3DFLA 4LXBH 5C5NA 2C8ZB 2QXJA 3ZZ6A 2B0FA 2FO9A 1G3BA 1YLDA 1DOJA 5DP7A 2FI3E 3KCGH 3SNCA 3NPSA 4DG4A 1SL3A 5HGGA 1BQYA 4CRDA 3STIA 1UO6A 3MTYA 4X8VH 4X1SU 3F6UH 2QV1A 1O3DA 2PHBA 2F9OA 1P2KA 4DIIH 1BBRK 2YNAA 3BF6H 2A5AA 3JZ2B 1DWBH 4KTUA 3UR9A 1EZQA 4A6LA 3RXCA 2ZC9H 1K2I1 3SUFA 3T5FH 4ASHA 5A0CA 1DWCH 5E2PA 3SI3H 2ZQ1A 3PMJA 3MMGA 1P8VC 3PYHA 3UAIC 1Y3VA 1UK4A 2VH0A 1BJUA 1L4DA 2VWMA 6CHAB 4XBBA 5EJ1A 1ZSKA 1B7XB 3TGKE 1B0EA 2PLXA 1WUNH 1XUHA 1MZDA 2GZ9A 4O03A 4FUBA 5B6OA 2A4RA 1BTHH 4ABGA 2AGEX 4H42U 2Z3EA 4YTAA 8LPRA 3SU6A 1HPGA 3JZ1B 2CV3A 2ILNA 4NIWA 1J17T 3SJ8A 1LO6A 1SQTA 1YPHE 2AERH 2GCTB 1W13U 2BX3A 1V2JT 1YCPH 2XRCA 3ATIA 1CA0B 5DKMA 2QYIA 5I25A 1QIXB 4IMQA 1MTNC 1EAWA 3HK3B 3W95A 2VIDA 1OP0A 2IPHA 1KMHB 4WWYA 3KYFA 1GGDC 1O5DH 2XWAA 1MBQA 2XC5A 1Y5AT 3PMHB 2UWPA 4X0WU 5FBEA 3SJ9A 1GMDF 4I33A 4WMEA 1SVPA 1GBMA 1QRWA 1LHGH 3A80A 1WU1A 2FOEA 3UWIA 1FJSA 3FO8D 1YCPM 4O9VA 4D8NA 5TCAA 2AFQB 2ZPRA 2A45B 2UWOA 1Z8IB 5A8XA 5GJ4B 3PTBA 4ABHA 2G52A 2A7JA 1OSSA 4X1QU 4GSOA 1SKYE 1ZHMA 5E2OA 3SN8A 1LHDH 1C1SA 1CBWB 2HVXA 2RFKC 2HPQH 3ZZ5A 1DWEH 2H9HA 3KL6A 5EXLA 2ANYA 4AZ2B 1ZMLA 3SNBA 2BXUH 4B2BA 1GJDB 2ZPQA 5DK1A 1S6LA 1ELAA 3F9FA 1BMMH 1GBTA 1SLXB 2NU0E 1ANBA 1IQMA 3AK5A 1MTVA 1BCUH 3ENSB 1PYTC 5AF9H 2B8OH 1TPPA 4DOQA 5EPNA 1IQJA 3VXFH 4A1TA 1UW7A 2WPIS 1NFYA 1ZJKA 2Z3DA 1SQAA 3S7KB 3RU4E 9ESTA 1FI8A 4NA8A 1UTOA 1JRSA 3BIVH 4UEHH 6ESTA 5KGOA 4WVPE 3OY6U 2A7CA 4OS6A 2TIOA 4Q4LA 2SGPE 1F0UA 1A5IA 1DLKB 2A4QA 3V13A 1TNLA 1NU9A 4CHAC 4D76A 2C8WB 2FOGA 4X2WA 1TBRH 3GCTG 4BXWA 1KLTA 1BMAA 2H2ZA 1BJVA 2SGDE 1YYY1 2STBE 1OPHB 5LPRA 3S9BA 2GP9B 1NFWA 1C2EA 2F9VA 3UNQA 1O2NA 4GLYA 3DSOA 1MAXA 1JOUB 3N7EA 3PB1E 1MD8A 3RC6A 4P00A 2QF3A 4AFQA 4F55A 2BVSH 1C5TA 4MLFB 1O3BA 1ANDA 1QFKH 3AW1A 4B76A 2RDEA 1MKWK 3A8BA 4RKOB 2GJGA 3E6PH 3SV6A 3DHKH 4OS1A 4UFEH 3UWJH 2A7HA 2K8IA 3SZEA 1FUJA 1AUJA 4JYVH 1LDTT 1BTWA 1MTNB 4SGAE 1QRZA 2EI6A 3D49H 4CBOA 3M5LA 1UTJA 2ZU4A 1HNEE 1GGDB 1G36A 1ETSH 4ACBA 2PW8H 2KFWA 2VWLA 1CVWH 3GY5A 2FZZA 2Z7FE 1Z6JH 1QB9A 4ZXYH 4CRCA 1A0LA 3RXIA 2YOLA 1X7AC 4A7IB 1W14U 1O3PB 2BY5X 1KTSB 3TITA 4ZKRU 3P8FA 2R3UA 1BTXA 1SQRA 1SHYA 1F5LA 1F0RA 1C2KA 4THNH 1BITA 2GZ7A 4IGDA 4AGKA 3TGIE 4Y10E 5FPYA 1EAXA 3SBKA 1CHOG 2D2DA 4Y11E 5G4BA 3BTQE 1O2YA 2XTTB 3DSPA 2AH4X 2KX4A 1GG6C 4XE4A 1C5PA 1G32B 1O2WA 4DJZB 1G2LA 4ABFA 1GI3A 4WF8A 3ZYEA 4FUFA 2OCVB 4AG2A 2Z9JA 1ZGVA 3PROA 2CN0H 1O3LA 4ESTE 4Y0YE 1HAYB 4YO9A 5A8ZA 3A8DA 3D65E 1QL8A 1D4PB 3UIRA 1VCPA 1DXPA 4KP0A 1Z6EA 1GMHG 4JK5A 2ZECA 1DSUA 1Z8JB 1TWXB 2FOFA 1KYNA 3K2UA 4E05H 1LQEA 1FX0B 2BDAA 3VB5A 1COWD 3GDUA 1CT4E 4CH8B 2VNTA 1TX8A 2WPJS 3FN8A 1FIWA 4CHAB 1GI0A 4E06H 3EDXB 2HGTH 3O8DA 1LKBA 1XUGA 4NIVA 1LHCH 2GT7A 4X2VA 3BG4C 2ZHFH 1C1UH 3Q3YA 1RIWC 2BDHA 1QCPA 1PQAA 1RTFB 1O5CB 4K8YA 1TNGA 2LPRA 2VIOA 5E0HA 2ZHQH 1GHYH 3RM2H 3TJOA 1OWJA 2O8LA 1GJBB 1TX7A 2VH6A 4HI3A 3T27A 3C1KA 1LHEH 2OD3B 2GCHF 2L74A 1L2EA 2PTCE 1VITF 1WAYB 2LELA 2BDBA 3BTEE 3AVZA 3M37A 1XVMA 4MQAA 1CE5A 2VIPA 3N7OA 5HIYA 3SGQE 4BNRA 1W10U 2CXVA 5DP8A 1CA8B 1W0ZU 4JYUH 5FBIA 4BAMB 1P04A 1S84A 1GCTC 1SGYE 1YY3A 2ZGJA 3LU9B 2WV4A 2ZDMA 4MPVA 1GCDA 3BN9A 3BTDE 5HYOA 1T4VH 3FZZA 5F53A 1S0QA 4I8JA 1ELBA 1A0HB 1GDUA 3RMNH 1C1WH 1E35B 1MTWA 1TMTH 1O5FH 1THSH 2QAAA 4K60A 2JH5D 4F48B 4GPGA 5L2YH 2IPQX 3GYMA 3QTVH 1GI6A 1GMDG 2V7QD 2PUXB 3E1XB 1H4WA 1AIXH 1CGJE 1L0ZA 2HLCA 3I29A 4BTTB 2PGBB 1FQ3A 1T8OA 1O3JA 3KQ5A 3LH1A 1MU6B 1NZQH 2RDLA 1OX1A 1SLUB 2ZTXA 3QN7A 5LGOA 3RXBA 1PJPA 4B75A 1J14A 3KF2A 1AGJA 3QGNB 2YNBA 2Z6BD 3QK1A 3HK6B 1GJ6A 5F8TA 1HAIH 2ANMH 1OWKA 1O3EA 3IG6B 3TJUA 1GG6B 2W3IA 3TK6A 4AFZA 1QL7A 5ETXA 3V7TA 3VGCC 3UPEA 1GMCG 1G3EA 5HM2A 1O3OA 3ZZ7A 1HUTH 2SGFE 2FYQA 1FAXA 1N8OC 2J92A 1FAKH 2SGAA 5EPYA 1OP8A 5C1XA 4P02A 3BTHE 4MDSA 1KLIH 2FM2A 3F9HA 1W7GH 1A0JA 2F9UA 3LOXA 3RU4D 4BAOB 2RG3A 1C9PA 4UDWH 1SSXA 2WPKS 3E8LA 1BRUP 3ZZBA 1QL9A 2HWLB 3B23B 3FANA 3N7DA 2WV5A 2ANKH 1MCVA 1CQQA 3OE7D 2XW9A 5ESTE 1IHSH 1FY8E 1DY9A 2ZEBA 4Y7AA 2BQ6B 1FONA 1OWIA 4A5TS 2XYAA 2FOCA 3PRDA 4ISHH 1DS2E 1AFEH 2AMQA 2J95A 3OSYA 1FY3A 4K1EA 1ZZZA 3ATLA 4ZUHA 1FV9A 1O2MA 3BG4B 4X8UH 4Y71A 2D8WA 1RIWB 1AWHB 4FUCA 3TVJB 1G3CA 1UVTH 3RXPA 1D3QB 1H9LB 1BOQA 3UREA 1KDQB 1XX9A 1AFQC 1C5WB 1TX6A 3UY9A 1FDPA 4XD7D 2FOMB 2I6QA 1YF4A 1HCGA 2VVCA 1A5GH 3G01A 1C9TA 4B74A 2BD2A 3R0FA 3FVFB 5CHAC 1QB6A 3URDA 4WH6A 1TRNA 1XKBC 1OKXA 2CMYA 1GCTB 2XBWA 3PMBB 1K1IA 4YOGA 3ODFA 2BDIA 1O5BB 1O2ZA 1D3PB 1C5LH 1MTSA 2AYWA 4X2XA 3NK8A 4TT3D 3SYJA 1BBRH 1PPGE 1P9SA 4RN6A 2PKSC 2F91A 5EG4A 5C0UA 2FX4A 1C2GA 1KDQA 5F8ZA 3SORA 5F03A 2WINI 3QDZB 1YPLH 3RXEA 3PWBA 5C67A 2L6OA 2PWXA 1SGDE 3D62A 1O2PA 2ODYB 1TIOA 3SQHE 5DJ7A 1TBZH 2QN5T 3PMAB 2BQ7B 3WWBA 1OP2A 1O3KA 3WW7A 1KY9A 1HAXB 2FPZA 2ANWA 2NU1E 2F9BH 2VIQA 4NWLA 1BTYA 3LGVA 1N6XA 2WYJA 2A4OA 1C2JA 5C2ZA 1LTOA 3P92A 3ZVFA 1ZYOA 4JCNA 1ORFA 1BTPA 1QB1A 2TGDA 4K3JA 1QY6A 2G4UA 3E0NB 2ZFTA 1LVOA 4NIYA 4UONA 2KM0A 3RLWH 4OS5A 2OXSA 1GVZA 5EW2H 1O2TA 3VGCB 5GWZA 5E0GA 4HGCA 1CGIE 3EE7A 1HAVB 1N8OB 1ELGA 2B7DH 4XSKU 3F9GA 2G4TA 4O97A 4AYYB 4U01A 2HNTC 1BB0B 1LHFH 1TOMH 1BRAA 1DFPA 3U9AH 2P8OC 2C90B 3EE0B 4UFDH 3UQOA 2GTBA 2ZFFH 5EJLA 2NU3E 2CF8H 3E91A 5FXLA 2XC0A 1C5UA 1C2HA 1NRRH 1TLDA 2QCYA 4TWWA 2WPDD 4MG3A 3DSGA 4I8HA 1GWAA 3SHCH 2J34A 1HIAB 3RXJA 1H8IH 1HAVA 4TSFD 5H4IB 3CENA 4DY7B 3SU1A 1KLJH 1O39A 3BEUA 1ZSLA 4XOJA 4F49A 1ELFA 3FP7E 4Q7ZA 1BHXF 4YT6H 1SGTA 5EU8A 4TPYA 1UCYK 1T8MA 1IQHA 1ZJDA 3GCOA 1XMNB 4KTSA 1TE0A 1V2UT 2FLBH 3DD2H 3OX7U 3U1IB 1IQNA 4AB8A 1AFQB 3DCLA 1O5GH 1PFXC 2J97A 2ZGCA 1ABIH 1EJMA 2EC9H 2R0LA 1HIAA 2OP9A 2BLVA 1E37B 3RLYH 1BDAA 3KQEA 2BYAX 5CHAB 3BEIB 3FP8E 5FHTA 5A0BA 3LGWA 3RXSA 1KXDA 4UFFH 2AIPA 1S82A 2VWNA 3MO9A 3E0PB 2W5EA 1K21H 1C1OA 2ZHDA 2PSYA 1FPCH 1S6FA 1SGCA 4INHA 4CR5A 3SU5A 1G30B 1TABE 1Y59T 1HAHH 3S9CA 3RXGA 3TGJE 1JIRA 1PPFE 1TALA 2YMSC 4NFEA 2PKSB 2V35A 3T26A 2AGGX 4FXGH 1ZPZA 4MTBA 3SJKA 1MQ6A 4ABBA 4U32A 2G8TA 3A7ZA 1AMHA 5DG6A 1CSOE 1V2PT 5JBAS 4K5ZA 1T8NA 1EAUA 3UOPA 1S81A 2EY4C 5J4SA 1ZHRA 2GMTC 2J98B 2ZZUH 1NRPH 2IN2A 4I8LA 4PROA 2B5TB 1K1LA 2ZI2H 1MBMA 4ZMAH 1GBEA 3A7YA 5EGMA 5JBTA 1C5YB 1P2QA 2OC8A 2G5VA 2W7SA 2SNVA 3VPKA 3U8RH 4K1TA 2M5TA 1DANH 4VGCC 1PPCE 1GI5A 2ZDVH 4HZHA 3DA9B 2B9LA 1W0JD 1NESE 5BPEA 1UTKA 5EQQA 3MQKC 4NCYA 4WY3A 2HNTF 3HKIB 1TNIA 2VWOA 3OTPA 3GCHC 2XC4A 4YZUA 3V12A 4NSVA 1EATA 4QT8C 1GJ8B 5GCHF 1BMNH 3BTWE 4ZH8A 2J98A 3BTTE 3RXVA 3ZVBA 3ESTA 1SHHB 4UFGH 3ZV8A 1HV7A 5CE1A 4OS4A 3BEFB 1GJ7B 3BTME 2BY6X 2WV9A 4DCDA 3FKSD 2Y6TA 2F9PA 5SGAE 1QQ4A 4YXWD 4WXVA 1K22H 4NZLA 1A7SA 4BAHB 1A5HA 2P8OB 1UK2A 2ZDKA 3U1JB 1YLCA 1P03A 2Q6FA 3NXPA 2BXTH 8GCHF 2OTVA 3PLKA 2GZ8A 5HM9A 1QURH 4FVBA 3L3TA 1AVGH 3UFAA 1KTTB 5CMXH 1NBME 2FDAA 2PGQB 3NRLA 2XCFA 1W0YH 1H9IE 4TWYA 4RT0A 1ZMNA 2BD7A 1C4Y2 2A0QB 2CHAC 4MPUA 1QRXA 2H6MA 3UB0A 4ISOA 2A2QH 4FVDA 5GDSH 1OWDA 1A4WH 2PV9B 3MU5A 1D3DB 1AVXA 1RGQA 5K7RA 1BRBE 2ZKSA 2ZGXH 4Q7YA 1O2RA 2FOBA 1O3HA 1Z1IA 3P70B 4UE7H 1RTKA 4OGXA 1YP9A 4BAQB 5ABWA 1GJ4H 3A89A 2ZU3A 4JZDH 2O8UA 1GHXH 1ESAA 3O8CA 3TIUA 2F43B 1AZ8A 1QHRB 1QR3E 1BA8B 2TGPZ 2Z9LA 3EYDA 1Z8GA 1DY8A 3U8OH 2QXIA 4DVAU 2P3UB 3NKKA 3GY3A 1EZSC 2V3OH 2FIRH 4HTCH 2YMSB 3SV9A 5JPMH 4NSYA 2FS9A 2WZQA 1E34B 1F92A 1WYKA 4R8TB 1ZGIA 5EXMA 3AAUA 4WMDA 2H5CA 3SJOA 1IOEA 2QE7D 3A83A 4Z1MD 1SB1H 4YOIA 1C2DA 2FX6A 2GMTB 2VVVA 4XBCA 2KCPA 5F6MA 4MNYA 2PTNA 1F7ZA 3STJA 1NFUA 1MCTA 1QBOA 1EP6A 1EZXC 1SGEE 1Y8TA 1FY5A 3SO3A 3K6ZA 1GHBG 1AZZA 3SUEA 1VR1H 2ESTE 4NFFA 1FLEE 1SMFE 4VGCB 3OU0A 2ODQA 2P59A 4BTIB 3OEED 1CGHA 1EUFA 2ZIQH 4RI0A 2R2WU 3UNRA 3ITIA 3Q3KA 3GCHB 4IBLH 2J4IA 4HG6A 3A81A 2ZTZA 1S5SA 4IS5A 3RXMA 2BZ6H 4JZEH 1FZZA 2V6NA 5EQSA 3UOUA 1QTFA 2A1DB 1AQ7A 7GCHF 2AHME 1O3FA 2BY9X 2HALA 1JXPA 1W7XH 2ZCKP 3SQEE 2BD3A 3T2NA 3MNSA 2EI7A 5L30H 2IOTA 2FESH 1H8HD 1Z1JA 4CRFA 4I8KA 4AYVB 7LPRA 2ZDNA 5EOKA 1P3CA 1W11U 5EIYA 4B73A 1O5EH 2JETC 1VCQA 1C2MA 1V2VT 1TQ7B 2TGTA 2Y5FA 3RXLA 1OS8A 3PO1C 2CHAB 1SOZA 2K1QA 2JIZD 1Z71A 3A85A 1BT7A 3K9XB 1YPEH 2OINA 3SU3A 5KEDA 4BAKB 4ZCNA 3KQCA 1EB2A 3BSQA 3EA9A 3URCA 3W1EA 2WPMS 2GV6A 5C0TA 3WWFA 5FCKA 3UR6A 4LK4A 1NM6A 5CHBA 1FXYA 1SGQE 3EGKH 4D7FA 4FUJA 3RXRA 1F2SE 1KXCA 5FL7D 2ODPA 2HLDD 2PR3A 2I6SA 3PM3A 4J1YA 5I46H 1U6QA 2SGEE 2W7UA 3RXDA 2KCOA 1ELDE 4FUDA 2BHGA 2BOHB 1O37A 3A7XA 5IK2D 2NU4E 4LOYH 3F3BA 1E79D 1ID5H 5L2ZH 2ALVA 1MQ5A 3MNCA 4X2YA 2TRMA 1K1NA 3M3VA 3GY4A 2THFB 1DPOA 3M7QA 8ESTE 3KN2A 1NRSH 1HYLA 1YC0A 1ZPBA 1PYTD 2ZGHA 1C2IA 1S6HA 2OUAA 4U2WA 1GBCA 5C20A 4FUIA 3TH4H 1V2MT 4X6NA 1ZMJA 3LGIA 4D9QA 1QBVH 5DSFA 2RA0A 4TY6A 3I78A 1CHGA 3KIDU 1NN6A 1NTPA 4GAWA 2OQUA 4SGBE 2A5KA 1ZPCA 3UNSA 3GY2A 1V2KT 3OFND 4B1TA 1GDNA 1V2QT 2UUJB 3E16B 3BTGE 4INKA 1DWDH 3F2FA 1JIMA 1O38A 3HGPA 3O8BA 1XUFA 1HGTH 1GI2A 5JDUB 1H1BA 2AMPA 3GDSA 4YLUA 3ATKA 2QF5A 3MH7A 1Y3WA 2K0QA 4ZAEA 1FIZA 2FI4E 3GICB 3DT0H 2QF0A 5C1UA 1V2WT 4ABDA 2BDGA 1O3NA 1GHWH 3ZYDA 1KXBA 2VBCA 1IHTH 3MH6A 4NA7A 1KIGH 2SGQE 1NRQH 1V2OT 1Y3YA 3E3TA 5JB9S 4CRGA 2QGRA 2ZWLH 2ZPSA 3F2GA 1KXEA 3GYLB 4UD9H 3FP6E 1C5SA 2GX4A 2VIVA 4Q7XA 3P17H 1EPTC 1WXRA 3LGTA 4RKJB 1VJAU 1S0RA 4NIXA 2P94A 2ZGBH
chains in the Genus database with same CATH topology
4M7GA 4CREA 2QIQA 5AHGH 4ZHMU 2R0KA 2A31A 2P3TB 1MD7A 1G3DA 3VXEH 3RXTA 2J38A 1T32A 1YPMH 1O3AA 1MKXK 1IQGA 2JETB 2DE9A 5T6FA 3MO3A 1PPZA 1C1RA 3GCNA 1GJ9B 2QXGA 1AVWA 3PO1B 4H4FA 3LIWA 1QA0A 3H7TA 3B8JA 2BD8A 3PLPA 5T6DA 2GV7A 1GI1A 1WBGB 2GGVB 1INCA 1UJ1A 1EP5A 4I8GA 3TLOA 3ZVDA 3MOCA 1NRNH 1THRH 1O5AB 3PLBA 1EZUC 1GBFA 1P05A 4X6PA 4Z6AH 4Y8YA 3TNTA 4DURA 3RUOA 1HAPH 1JWTA 2Q1JA 3MI4A 3H7OA 4DGJA 2BDCA 3BG8A 2OBOA 1LQDB 1P2JA 3TNSA 1TRYA 2OLGA 1SGIB 2BOKA 4X6OA 2FTMA 1YBWA 1NROH 1OYQA 4ZKOU 1EKBB 3SHAH 4F4OC 2H1UA 1AHTH 3SNEA 1IQFA 1SGRE 2OC1A 4Y79A 1BTZA 6GCHF 2FEQH 1TYNA 2Z94A 4JZ1A 3SV8A 2GDDA 3A82A 4WJG2 3EAJA 1GVLA 1SBWA 1AE5A 1TA6A 1UTNA 2PSXA 1O35A 2VU8E 2O8WA 2C8XB 1G37A 1ZTKA 3SI4H 5E8EH 1AKSB 3V3MA 1BBRE 1HJ9A 3A88A 4ZKNU 1P01A 1ZR0A 2FODA 4YM9A 2G81E 3FFGA 1UCYH 3RXFA 5FPSA 1PPEE 4XDEA 1GBDA 1ZHPA 3T29A 1MTUA 4DT7B 1GDQA 3GCTF 4YT7H 4LZ4B 2O8MA 1P11E 2Q6DA 4ISNA 5EXNA 1ELCA 1SI5H 1A3BH 3LDXH 2R2MB 1AB9C 1O33A 3SUDA 1BZXE 1KSNA 3M7UA 1P02A 4NWKA 2Z9IA 4MNWA 4K1SA 1AKSA 2BLOA 3RM0H 4Y0ZE 3A86A 2VB0A 3BIUH 1C4U2 4Y8ZA 1F0TA 5L6NH 5PTPA 4E7NA 1F5RA 1N1LA 1Y3UA 3QZQA 1G9IE 1QGFA 2BLQA 1D3TB 3MU1A 4X6MA 1RD3B 1O3MA 2AIQA 1O32A 2ASUB 2VIWA 1A2CH 2CJIA 1EPTB 7GCHG 2SFAA 4TYDA 3BTFE 3SW2B 2BY8X 1ETRH 3M3TA 3BV9B 3ZZDA 5K0HA 1O31A 1NC6A 1FNIA 4TY7A 2VJ1A 2HRVA 4A92A 3GISB 1SGNE 2AS9A 1DT2A 1C2FA 1C5MD 4WH8A 2C3SA 1MZAA 5IYTA 5FX5A 2ULLA 4NGAH 2Y7ZA 2AGIX 4YLQH 5EW1H 2ZDLA 5A8YA 2ZCLP 5E0JA 1OOKB 4Y7BA 1LPZB 4B2AA 3TPIZ 3HPTB 4KTCA 3LGUA 1ARCA 1AU8A 4ABJA 1AWFH 1Q2WA 2H9EH 3M5NA 1TOCB 4INLA 1GI9B 2P16A 1CHOF 2WYGA 1GBKA 3UTUH 2UUYA 3LKWA 1LPGB 4IN2A 1GI4A 1TMUH 4AOQA 3LC3A 3E90B 2FI5E 1DE7H 5AFZH 3T28A 3QUMP 5C3NA 3NUMA 1HAOH 4AORA 1C1QA 4Q2KA 1V2RT 4ZHLU 1TB6H 4X1RU 4BOHA 3LT3A 1T4UH 2F83A 2VINA 5F8XA 1B5GH 3RXOA 3A87A 2ZTYA 3RXHA 2GCHG 4FU9A 4O3UA 3AASA 1GMHF 1ELEE 3CS7A 5JYIA 1VITG 5A0AE 1NPMA 1TGCA 1TRMA 2JH6D 1BHXB 3M35A 1GHAF 1DXWA 1TPAE 4IMZA 2R9PA 1C1MA 3K65B 1D6RA 4B71A 2BQWB 1ZRKA 1O2GH 1P9UA 1A3EH 3IWMA 3QLPH 2ZU5A 2G51A 3CS0A 2FYRA 1C5OH 4KELA 1HJ8A 1A46H 5A2MH 3M61U 3CP7A 4ZXXH 1AB9B 1XXDA 3ATMA 1IQLA 2XBYA 3RMOH 3P8NA 1OWEA 1TMBH 1O2LA 4Y8XA 3TH2H 3M7TA 3C27B 3QX5H 3VFEA 1DSTA 2Y80A 4X1PU 1EJNA 1UK3A 3L6PA 3QWCH 2ZU2A 1L1GA 1HDTH 1ZOMA 1IQIA 3OYPA 2C4FH 3OTJE 1CO7E 3ZVEA 1P2NA 2STAE 1MKWH 1Y5UT 1ANEA 1NO9H 3VEQB 1HLTH 1V2ST 2C8YB 4I32A 1W3CA 5GPIB 4AB9A 2BTCE 1XXFA 4CR9A 2W3KA 1EOLA 4U30A 1TNJA 5DGJA 4GHTA 1C4V2 2HOBA 5A09A 3GY6A 3O8RA 1E36B 2ZP0H 3TU7H 2WPHS 1V6DA 3MNBA 1UVSH 3A8AA 1EASA 1MU8B 4OS2A 3A84A 5FX6A 2BB4A 1VCWA 2FMJA 4H6SB 1IQEA 1VZQH 3LJJA 1EXFA 5LPFA 1Q3XA 1LMWB 2UUKB 2XCNA 1L1NA 4KKDA 1AO5A 2Z3CA 3QTOH 1P2OA 3TJVA 1YGCH 5TJXA 4BTUB 1VJ9U 1PPHE 2A5IA 2FTLE 5DP6A 2OBQA 1P3EA 5FAHA 3ODDA 1V3XA 1Z7KA 3RDZA 1WQVH 3SGBE 2F9NA 2D26C 1W2KH 1LCYA 1O3GA 3P95A 1SLWB 5DP9A 3HATH 1SGFA 1WQSA 2VVUA 2BX4A 3I77A 1ETTH 1L4ZA 3LC5A 4FUHA 4DW2U 2GD4B 1IQKA 1VITH 2EA3A 1GMCF 5HXFA 4ISLA 2TBSA 1O0DH 1TQ0B 2BY7X 2P3FH 5IDKA 6GCHG 3S7HB 2J94A 2Z9KA 1UHBB 2A32A 3KHVA 1P2MA 3A7WA 1O36A 2BZAA 2G5NA 4JYTA 1C1VH 1QA7A 2O9QA 1YPHC 1TAWA 2P93A 1Y3XA 3SZNA 4XBDA 2O8TA 2FWWA 1WV7H 4ISIH 2Y7XA 1JRTA 9LPRA 3PWCA 1H8DH 1OYTH 1UTQA 3A8CA 1Q31A 3RC4A 2PUQH 3M5MA 2BVRH 2J9NA 1CU1A 1UHBA 1LPKB 2XBXA 3MU8A 4BANB 1GBBA 1GJ5H 3KGPA 4AGJA 3ZZAA 1C5XB 1TPOA 3SNAA 3LH3A 3EA8A 5FCRA 1C5VA 1DICA 1THPB 3MO6A 1YCPK 1AUTC 1SC8U 4JZFH 2Q6GA 4KGAA 2SNWA 3RP2A 3RXAA 3D23A 3EQ0H 1EOJA 1KXAA 1NFXA 1ZTLA 3PV4A 5C1YA 3Q77A 4GHQA 3GY7A 2V0BA 3T62A 1JMOH 1TFXA 3VB7A 3SNDA 3MH4A 1AI8H 2GT8A 4DIHH 1C5ZB 3DFJA 1L1JA 2D1JA 4ZROA 1GHVH 2GVFA 1WTHD 1ELVA 5DP4A 3VB6A 4AG1A 3LONA 2ZCHP 1DITH 3TH3H 1RFNA 1K1OA 1RXPA 4IN1A 1TGTA 2FOAA 3UUZA 2ZO3H 1KXFA 4H6TA 2BM2A 4FU7A 5JBBS 2EEKA 2ZFQH 1TBQH 1WOFA 1O2JA 2BD4A 4X1NU 3RXQA 3FZDA 3U69H 1HBTH 1TGBA 3SJIA 1FY4A 5DP5A 2BMGB 1OWHA 1F0SA 3MWIU 1NY22 4MPXA 1BIOA 1UVOA 3U98H 4AN7A 3SGAE 1C1PA 2WUBA 1UMAH 1BMLA 1ELTA 1O2VA 1A1RA 2Y5HA 2WPLS 2GKVE 1XVOA 3KQDA 4GVUA 3SUGA 3BTKE 2JKHA 1O2QA 2F3CE 1BTUA 1C1NA 1MKXH 4HFPB 3NCLA 3RC5A 1PQ7A 1ZTJA 1C2LA 2UWLA 4NG9H 1TA2A 1J8AA 1HAZB 2QXHA 1VGCC 1P06A 1WSSH 1ABJH 3MFJA 3S0NA 5EQRA 4OGYA 1OXGA 4A1XA 1DDJA 4TPIZ 3L33A 1ESBA 1O2SA 4BXSA 1HXEH 1QBNA 1FPHH 4JK6A 2BDYA 5GIBA 1M9UA 2ZNKH 1HB0B 1F5KU 4GCHF 3HKJB 3SU4A 1GHAG 4MVNA 1BRCE 1NU7B 1GJCB 1A61H 2ZFRH 5DO4H 3MH5A 4WMFA 2Y81A 3NWUA 3MU0A 1JBUH 1O2OA 1P57B 2H5DA 1ESTA 5ESBA 1YPJH 2BVXH 1ANCA 5TCCA 2ZQ2A 3AW0A 4K8BA 1C5NH 3HGNA 5C5OA 4YESB 1PQ8A 2VGCC 3Q00A 1PQ5A 1V2TT 1K9OE 4GUXA 1P12E 1FN6A 1SQOA 3RMLH 2ZFSA 3MU4A 4ZHAA 2ZDAH 1Z8RA 2QY0B 2TPIZ 4R0IA 1XUIA 1D9IA 2PKAB 2FLRH 1SFIA 2V3HH 5JB8S 3KEEA 4J2YB 1K28D 1SLVB 4FU8A 1GJAB 2XXLA 1SGFG 1UTLM 3VB4A 1GL1A 4CH2B 2EI8A 2Y5GA 1MAYA 1T7CA 3ZZ4A 1O3CA 5GCHG 3ZVGA 4CRBA 3QZRA 4OS7A 4K2YA 3SOSA 1TPSA 1QQUA 1TGNA 4X8TH 1J15A 1Y5BT 1TONA 2ALPA 2PKAA 4ABEA 1RRKA 4B2CA 4IC5A 1DX5M 5DP3A 4MNXA 4XFQA 2A4GA 3MNXA 1DLEA 2TGAA 5T6GA 1RJXB 5LH8A 1TGSZ 8GCHG 2ZF0H 5GXPA 3RMMH 4NA9H 1E0FD 1V2NT 5DPAA 1S83A 1FN8A 1EAIA 1O2KA 4Z0KA 1E38B 3GDVA 1C5RA 1AE8H 4ZKSU 3WY8A 2KAIB 1AN1E 1SOTA 4Y6DA 3ATWA 1W12U 2LNCA 1GVKB 1PPBH 1O3IA 3TK5A 1XKAC 3QO6A 3W94A 1ZLRA 2BD9A 1EJAA 3LPRA 4LZ1H 2QC2A 2NU2E 2FP7B 3ZZ9A 4I31A 1SFQB 1GBHA 2G00A 1W8BH 1P09A 4WXIA 4IC6A 3F1SB 4D9RA 2AMDA 3P6ZB 1IAUA 2J2UA 2CGAA 1O2UA 4MPWA 2P95A 1VGCB 2XWBI 4CRAA 3A7TA 1LVYA 2UUFB 2Y82A 1O34A 1D6WA 1YM0A 2G55A 1QJ7B 2KAIA 5HMAA 1MH0A 2R3YA 1MMJN 3GY8A 1GHZA 5EODA 5AVDA 1G2MA 3M3SA 2AEIH 1MUEB 1QJ1B 4O3TA 1C1TA 1UTMA 1SG8B 1CT0E 1DUEA 5J4QA 1K1PA 1HJAC 3IITA 4Y76A 4JZIA 2H9TH 4JMYA 4D7GA 4I7YH 4AX9H 1UCYE 3VB3A 1YPGH 1ZRBA 1AY6H 3H5CB 3RU4T 1LVMA 1UVUH 1C5QA 4K69A 3TJNA 2FOHA 1NS3A 3LGYA 3ELAH 1V2LT 1ARBA 1EX3A 2DE8A 2HNTE 3KQBA 2ZG0H 1T8LA 1BUIA 1K1MA 2VGCB 3Q3XA 1DVAH 1HRTH 1HXFH 1O30A 1WTGH 3TK9A 1P2IA 1RS0A 2IJOB 1O2IA 1ACBE 2W26A 1YPKH 5BRRE 3F9EA 4AFSA 1UTPA 2RCEA 1HFDA 1NT1A 2ZA5A 3PTNA 4IW4E 2PFEA 1O2HA 5FPTA 2A2XH 3SV7A 1SPJA 1AD8H 1EB1H 1HAGE 1GBJA 3V0XA 2XNIA 4AFUA 3A7VA 7ESTE 6CHAC 1LKAA 2FS8A 4X8SH 3U8TH 1GBLA 3F68H 1SR5C 3LJOA 4A1VA 1WCZA 3MYWA 3Q76A 1ZSJA 4ABIA 1QNJA 3M5OA 1T31A 1YKTA 2HPPH 3UQVA 3OY5U 2ZU1A 3RXUA 1N6YA 2ZHWH 2GCTC 5JBCS 2OC7A 4Q80A 1CA0C 1SGPE 3AAVA 2WUCA 2BLWA 2C93B 1K1JA 1P10A 3ZVCA 3NZIA 3SV2H 1GPZA 3MHWU 4FUEA 4NZQA 3ZZCA 2RA3A 1GL0E 2FXRA 3GOVB 1GHBF 3SU2A 1DM4B 3ZV9A 1GI7B 1H9HE 2ZHEH 1GBAA 2DUCA 3R3GB 3B9FH 1FY1A 1GI8B 1TNKA 3KNXA 3ZZ8A 1EQ9A 3RXKA 7KMEH 1LVBA 6LPRA 1EPTA 1QJ6B 3ZZ3A 3P8GA 1DUAA 1FMGA 1P0SH 4E7RG 2OQ5A 4FUGA 4CBNA 3S69A 1J16A 3K6YA 8KME2 2OC0A 2QA9E 1XM1A 2ZFPH 2XBVA 1GBIA 1RTLA 2NWNA 2Z9GA 3T25A 3ZVAA 4ABAA 3M36A 1XUKA 4YOJA 3EA7A 1CT2E 1XUJA 3FAOA 1B0FA 3S9AA 5T3HA 3DUXH 1CBWC 4MNVA 3QGJA 5LPEA 1S85A 1UVPA 2BD5A 1O2XA 1TNHA 1J9CH 2CF9H 3P8OA 3SU0A 4GCHG 2JH0D 4RSPA 5AFYH 1HJAB 2GDEH 3DFLA 4LXBH 5C5NA 2C8ZB 2QXJA 3ZZ6A 2B0FA 2FO9A 1G3BA 1YLDA 1DOJA 5DP7A 2FI3E 3KCGH 3SNCA 3NPSA 4DG4A 1SL3A 5HGGA 1BQYA 4CRDA 3STIA 1UO6A 3MTYA 4X8VH 4X1SU 3F6UH 2QV1A 1O3DA 2PHBA 2F9OA 1P2KA 4DIIH 1BBRK 2YNAA 3BF6H 2A5AA 3JZ2B 1DWBH 4KTUA 3UR9A 1EZQA 4A6LA 3RXCA 2ZC9H 1K2I1 3SUFA 3T5FH 4ASHA 5A0CA 1DWCH 5E2PA 3SI3H 2ZQ1A 3PMJA 3MMGA 1P8VC 3PYHA 1Y3VA 1UK4A 2VH0A 1BJUA 1L4DA 2VWMA 6CHAB 4XBBA 1ZSKA 1B7XB 3TGKE 1B0EA 2PLXA 1WUNH 1XUHA 1MZDA 2GZ9A 4O03A 4FUBA 5B6OA 2A4RA 1BTHH 4ABGA 2AGEX 4H42U 2Z3EA 4YTAA 8LPRA 3SU6A 1HPGA 3JZ1B 2CV3A 2ILNA 4NIWA 1J17T 3SJ8A 1LO6A 1SQTA 1YPHE 2AERH 2GCTB 1W13U 2BX3A 1V2JT 1YCPH 2XRCA 3ATIA 1CA0B 5DKMA 2QYIA 5I25A 1QIXB 4IMQA 1MTNC 1EAWA 3HK3B 3W95A 2VIDA 1OP0A 2IPHA 4WWYA 1GGDC 1O5DH 2XWAA 1MBQA 2XC5A 1Y5AT 3PMHB 2UWPA 4X0WU 5FBEA 3SJ9A 1GMDF 4I33A 4WMEA 1SVPA 1GBMA 1QRWA 1LHGH 3A80A 1WU1A 2FOEA 3UWIA 1FJSA 1YCPM 4O9VA 4D8NA 5TCAA 2AFQB 2ZPRA 2A45B 2UWOA 1Z8IB 5A8XA 5GJ4B 3PTBA 4ABHA 2G52A 2A7JA