3SJ9A

Crystal structure of the c147a mutant 3c of cva16 in complex with faglrqavtq peptide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
179
structure length
179
Chain Sequence
LDFALSLLRRNIRQVQTDQGHFTMLGVRDRLAILPRHSQPGKTIWVEHKLINVLDAVELVDEQGVNLELTLVTLDTNEKFRDVTKFIPETITGASDATLIINTEHMPSMFVPVGDVVQYGFLNLSGKPTHRTMMYNFPTKAGQAGGVVTSVGKIIGIHIGGNGRQGFCAGLKRGYFASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C protease
publication title Enterovirus 71 and Coxsackievirus A16 3C Proteases: Binding to Rupintrivir and Their Substrates and Anti-Hand, Foot, and Mouth Disease Virus Drug Design.
pubmed doi rcsb
source organism Human coxsackievirus a16
molecule tags Hydrolase
total genus 35
structure length 179
sequence length 179
ec nomenclature ec 3.4.22.28: Picornain 3C.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sj9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sj9A02
3T29A 4E06H 1G3BA 3TGJE 1S0RA 1LTOA 3LOXA 1BTYA 3ATKA 1VJ9U 3GCNA 4BOHA 4B75A 2QIQA 1HRTH 2BQWB 5GPIB 1KXAA 2BVSH 4IW4E 1GI5A 2F91A 2EEKA 3UFAA 4LZ4B 1ELVA 2BZ6H 4FUGA 1GHVH 2FODA 1TONA 2R9PA 3SNAA 4WH8A 1YPHC 1Y5AT 2HPQH 2QN5T 1O3GA 1YPKH 1L1GA 1HAIH 1O5FH 2ZTYA 1ZPBA 1KSNA 2BD9A 2P3UB 1QL9A 3ZVFA 5C2ZA 2AGIX 1ZMLA 4BNRA 2ILNA 2XBXA 4XOJA 1O5GH 1JMOH 1TNJA 1UVSH 2XBWA 5EG4A 1MCVA 3PMHB 3RU4D 2JH5D 1FQ3A 3SV2H 2ZF0H 5EQRA 1SB1H 1CA0C 2GZ9A 1C5ZB 1UJ1A 4TPYA 2R3YA 2IOTA 4NIVA 1GI0A 2UWOA 6LPRA 1MU8B 1HXFH 1EAIA 3DUXH 1QNJA 4WMFA 4BAQB 2A31A 1TFXA 1W3CA 1DICA 2C4FH 1V2WT 1MZDA 1O2NA 1SHHB 3BTEE 4AB9A 2PKAA 2VIVA 3RP2A 3LC5A 2A5KA 3RXGA 2SGPE 2D1JA 1EPTB 3K65B 1BBRK 3VGCC 4X8VH 1Z1JA 3RC5A 1GDUA 1VCPA 1ZSJA 1YBWA 1P10A 4A6LA 1TX6A 3SJ9A 1XVOA 1ANEA 1O2HA 3MOCA 2H9EH 3EE0B 3TNTA 1MU6B 1YPJH 2FESH 3RC4A 1O2VA 1V2ST 2C3SA 1AE5A 4Q7YA 2FI5E 4JK5A 4K60A 3BG8A 2G5NA 2VWOA 3W95A 1QB1A 1GGDC 1O35A 1O5DH 2XC5A 3N7OA 3RXCA 2WV4A 4R0IA 1MKWH 1QJ1B 3U8TH 5FCKA 1L0ZA 3LJJA 3BTME 4AFQA 1VZQH 1OPHB 1OP8A 3BEIB 3QO6A 3S7HB 3E8LA 2DUCA 3ZZCA 5JBAS 2A5IA 3WY8A 1Z1IA 3A83A 1JBUH 2ZHEH 4CRDA 1TLDA 2ZPSA 3BTKE 2BD3A 2H9TH 1GBTA 1TPPA 1UVOA 1UTKA 2Y6TA 1Z8RA 4ZMAH 3I29A 2C93B 4Y11E 5H4IB 2AEIH 1BZXE 1XMNB 2W5EA 1DSTA 5DG6A 2Z3CA 4MG3A 2FP7B 1HNEE 4ABHA 1ESBA 1NFUA 1CT0E 4X2YA 1DFPA 1O5EH 2A32A 3ZVDA 1CBWC 2SGEE 1CHOF 2FYRA 1DXPA 1TA2A 2W3IA 1TNLA 3STIA 4I8JA 1QL8A 5F03A 4Y71A 3SUDA 4X6NA 4IGDA 4CBOA 1K22H 1L4ZA 2TRMA 3A84A 1BRCE 4CHAB 1EX3A 2Z9IA 1SHYA 3GY5A 1IHSH 1ESAA 1ZRKA 4ASHA 3VFEA 4B2CA 1C5YB 1Z8JB 3F1SB 2ZPQA 2BLOA 1D9IA 1RXPA 2Z3EA 2EI7A 1TBRH 4KP0A 3SZNA 1GBKA 1G3DA 2CN0H 2ZP0H 3AAUA 1J8AA 1BUIA 3RXTA 2VVCA 3AAVA 1DWDH 1ELDE 5AHGH 4I31A 1K9OE 5GXPA 3TITA 1K1OA 2ODYB 5C1YA 6CHAC 1AGJA 4D7FA 1KTTB 4X8SH 1PPHE 1BA8B 4AGKA 1W7GH 3RM2H 1BB0B 5ABWA 1UK4A 2FXRA 1UTNA 3HATH 3UUZA 1XUGA 4ABGA 1QTFA 1IQEA 5DP3A 1ELAA 1O3MA 1P9SA 3K2UA 1EJNA 2FOHA 2HWLB 1GMCF 3RXMA 1EB1H 1Y8TA 1V2JT 2BD5A 1KIGH 1FAKH 4XE4A 2GVFA 2Y82A 1K1MA 3TVJB 2HRVA 1JXPA 4NWLA 5C1UA 2OBQA 2PW8H 2R2WU 4K5ZA 1MZAA 4YLUA 3SU6A 1OWKA 1W0YH 2OXSA 3ESTA 4KTSA 1O5AB 4NG9H 3H7TA 6GCHG 4FUEA 4ABJA 3IG6B 1GHAF 4NIYA 4ZH8A 2PLXA 2BM2A 5A8YA 2QYIA 2A7HA 3ZZAA 3A85A 4NFEA 3M37A 4Y8YA 2XTTB 2HNTF 2KAIB 1BITA 4VGCB 5LPRA 3EQ0H 2H1UA 3ODDA 4OS1A 5E0HA 1DWEH 2OQ5A 1GJ4H 3BEUA 2VWLA 3PTNA 1IQHA 1HFDA 1DLKB 1A5HA 1YP9A 1PYTC 3E16B 4SGBE 5GJ4B 2FMJA 3TK9A 1QQUA 3GCHC 3VPKA 3P6ZB 1SGYE 1Y5BT 3QK1A 1OWDA 1ZPZA 1ETTH 1DUEA 1T4VH 1T8MA 4AB8A 1QIXB 1EB2A 1LKBA 2A4RA 2F9BH 4AZ2B 4E7RG 4O3UA 2W7SA 1FMGA 2FZZA 1LCYA 2UWPA 1AFQC 1X7AC 1DUAA 1MUEB 5FBEA 5I46H 4J1YA 3TK5A 4YESB 1XVMA 1BTUA 4O9VA 2ZZUH 3ZV9A 1VITF 2H5CA 2CXVA 3MMGA 2P94A 4TWYA 3A7YA 1GBLA 2UWLA 1DSUA 3GICB 2ZQ2A 1GJCB 3P8GA 1C1WH 5LPEA 2ZPRA 1C1OA 1S82A 3BSQA 1SGFA 1OP2A 1Y59T 1GI9B 2I6SA 2GD4B 1KXDA 4WJG2 4FUFA 2FYQA 1C5LH 3S69A 1GHWH 1O36A 3L6PA 4H6SB 3BTTE 1DM4B 2BQ7B 1ZTLA 5EW1H 1T7CA 2B8OH 1BRBE 1W7XH 1GCTC 1OX1A 1A4WH 4YT6H 5E2PA 2ZFRH 4XDEA 1AD8H 1GBCA 1YC0A 1IQGA 4NCYA 5JDUB 1KYNA 3V3MA 3MU1A 1C5UA 1Z7KA 1SLVB 4ISOA 3TNSA 2P95A 2BDCA 3ZVAA 3ENSB 1H9LB 3SU3A 1C4Y2 1JRSA 2V3HH 2P93A 1BRUP 1SSXA 1MAXA 5F8TA 1QRZA 1P8VC 5ESBA 1O3EA 3EA9A 3KIDU 1NTPA 4NIWA 1CHOG 5LPFA 2J2UA 2GDDA 3FVFB 2OP9A 1C5WB 3RXRA 1UHBB 4ZAEA 1KXBA 4AN7A 3AVZA 3UWJH 3T27A 1TX8A 1MTNC 3UNSA 1XUIA 2Y7ZA 1Q3XA 4CBNA 2QXIA 4AFSA 1MKXK 1QJ6B 1WUNH 2FOAA 3EGKH 3MU0A 3QN7A 1QB9A 1UVPA 1YPLH 2WPIS 2V6NA 5E0GA 5HM9A 3NWUA 1V2RT 3RUOA 4GHTA 2UUJB 1XXFA 5HXFA 1P03A 5PTPA 1CA0B 3UPEA 2GZ8A 2WPHS 3A8BA 9LPRA 2ZWLH 1C5QA 2VU8E 3IWMA 1UO6A 4UFEH 2ALPA 1SLXB 1S83A 2H5DA 3GY6A 2LPRA 4WMEA 1DWCH 3UOPA 1D6RA 1HAYB 1QJ7B 2HVXA 3BTFE 3Q76A 1GMCG 2BDAA 4CR9A 4Y0YE 1QRWA 1BIOA 4ZHAA 1D3QB 5EODA 3VGCB 1KY9A 3QWCH 2O8LA 2WUBA 1WSSH 3B9FH 2OINA 1QB6A 3BG4C 3LDXH 1LO6A 1NRSH 3MFJA 7LPRA 2IPHA 1GHAG 1HBTH 2D2DA 1A46H 3KQEA 4GUXA 1K1JA 2FIRH 1MD8A 4A5TS 1TGTA 3DA9B 3MWIU 4WWYA 1W11U 1RIWC 3E90B 4NFFA 5FX6A 4DURA 4FUHA 2QXHA 1P2JA 1ZTJA 1GGDB 1O2LA 2ZGXH 1XUKA 1JOUB 1DS2E 2XBVA 2ANWA 1UCYH 1IQNA 3VB6A 1EASA 4GSOA 1C2LA 1GDQA 1GVZA 4IMQA 1PYTD 3L3TA 3BTQE 3ZV8A 3E91A 1C1NA 4AYYB 5AVDA 3TGIE 3IITA 1GL0E 4VGCC 1LVBA 2ZU5A 2ESTE 1UVTH 4DIIH 4BXWA 1AUTC 5FAHA 3B23B 2PGQB 2BD7A 1EKBB 4ABFA 2V3OH 2VWNA 1RTLA 1A0LA 3LGUA 2Q6GA 1O3LA 2GV6A 1RFNA 2GTBA 4XBCA 1BMLA 1GHXH 4DW2U 1LHFH 1SL3A 3NXPA 1HAVA 3D65E 2THFB 4IS5A 3OY5U 1P2OA 1CBWB 1Y3XA 2FOBA 1O38A 3RLWH 3A8DA 1KXEA 3Q3KA 5DPAA 2J95A 1ZLRA 1O3IA 1G2MA 3DFLA 3SW2B 1Y3WA 4FVBA 4U2WA 1ELEE 4NWKA 1O37A 3NKKA 4AFUA 5DK1A 1W12U 5HYOA 1TE0A 3GY2A 1SPJA 5DP9A 1UVUH 1BCUH 1O3OA 1DITH 1C5OH 2PSXA 2BQ6B 2Y5GA 1HIAB 1WBGB 3PLBA 2QC2A 2O9QA 1FI8A 1C2HA 3F9FA 3T25A 2A4OA 1FXYA 4B73A 4MNWA 2ZFTA 5LGOA 1TRMA 1O3NA 3A7ZA 4ZROA 1BBRE 4FUIA 3SV8A 4I33A 5FXLA 1MTWA 4Q80A 4BTIB 1NO9H 3KGPA 3U8OH 1CVWH 3LGTA 2D26C 6CHAB 4LOYH 4K69A 2XBYA 5C5NA 4HI3A 3DHKH 1ZZZA 4UE7H 1E36B 3ZYEA 1LQDB 1DDJA 5EXLA 4YT7H 1BMAA 1SI5H 3TH3H 2XCFA 2G55A 4WXIA 2BYAX 1O5BB 3RDZA 2ZDKA 1QY6A 4YM9A 1C2KA 4IMZA 2BD8A 3LGIA 1ZJDA 2A2XH 2UUKB 3Q3YA 5EXMA 1TMUH 1H8DH 2GMTC 2R0LA 5F8ZA 4OS2A 3RMNH 1IAUA 4Y7BA 3E0PB 1GI2A 1CO7E 1HYLA 2C8WB 2QGRA 1GMDF 4B2AA 1HJ9A 3H7OA 2YNAA 2ZEBA 3P8OA 1XUJA 3E0NB 3NUMA 3RLYH 3RXAA 1MQ5A 3FP7E 2OBOA 1J9CH 2BY5X 1VITH 3DD2H 1CGIE 3SN8A 2PSYA 3RU4T 1Z8IB 2TIOA 1O2IA 1EUFA 1WQSA 4RSPA 1AE8H 1V2UT 3P8NA 3SO3A 3Q77A 3ZZ3A 1K2I1 1GJ9B 1VGCC 4Q7ZA 1L1JA 2A4QA 1AKSA 3GCHB 3VB5A 1MKWK 1G2LA 3ZYDA 1H1BA 4MPWA 1C2EA 3T62A 4GCHF 1FY4A 2ZTZA 1MBMA 2PKAB 2A7JA 4B71A 4IN1A 2FOMB 2ZU4A 2Z9KA 1AFQB 1EZUC 2FDAA 3M7QA 4DJZB 1MH0A 1CQQA 2STBE 1D3DB 2PUQH 3UNRA 2ZGJA 2FO9A 1CGJE 2FTMA 4Y8ZA 1THSH 2Z3DA 1PQ5A 2EA3A 4Q2KA 2VIOA 1F7ZA 4INKA 4ABAA 4Q7XA 2RA3A 2A5AA 1WQVH 3KF2A 1U6QA 2SGAA 1QHRB 1FY8E 1GCDA 4HZHA 3QLPH 1TNIA 1IQIA 1ARCA 1TB6H 1EJMA 3SBKA 2PFEA 1C2GA 4Z0KA 1PFXC 1IHTH 1P02A 1ELTA 2XC0A 3ZZBA 4BAMB 2QV1A 1GCTB 2R2MB 1P09A 3PLKA 3UQOA 3SHCH 5A2MH 1ZGVA 1NROH 5C20A 1DY8A 4YOIA 3NZIA 1PQ8A 1TQ7B 3S9CA 4WY3A 1P11E 1QGFA 3CENA 1E34B 4LXBH 4OS5A 1UTPA 1SGPE 3ATIA 1O2KA 3ZVCA 2PTNA 4BAHB 4E7NA 1VJAU 1G32B 2AS9A 3NCLA 1OWEA 5B6OA 4IC6A 3SQHE 1QURH 1XUFA 2BDYA 4SGAE 2QXGA 5K0HA 2BX3A 4XBDA 3M36A 1P2QA 3D49H 5T6DA 2BDGA 5JBTA 4I7YH 1A2CH 2RCEA 3GY4A 3M5NA 3M5OA 1NS3A 1TGSZ 1LHCH 2YOLA 4RKJB 5J4QA 1FY1A 1FV9A 1G9IE 1MTNB 1ZSKA 3I77A 4OGYA 8LPRA 1S5SA 2C90B 3G01A 2SNWA 4YTAA 1YKTA 1SGDE 2Y5HA 4X0WU 4U30A 2TGDA 1SR5C 4IN2A 2EI8A 3K6YA 2F9VA 4Y8XA 1HPGA 4Y0ZE 3DFJA 4CRGA 3A86A 3A7XA 3SGAE 4ZKNU 4OS6A 4PROA 1THRH 1WTGH 1YGCH 2ZCKP 1V2KT 3AW0A 4ISNA 4CR5A 3MI4A 2RDLA 1EJAA 1F0UA 1FLEE 3VEQB 3S9BA 1NFWA 2HGTH 5L2ZH 3UY9A 1WAYB 2AIPA 3RM0H 4OS7A 3EDXB 4CRBA 1G37A 5EQQA 2XXLA 1GMHF 2PKSC 1ZSLA 2BOKA 4NA8A 5JB9S 2A7CA 3SU2A 4HTCH 3ZZ6A 2Y5FA 1O3AA 3SI3H 1SQAA 9ESTA 3BIVH 1D3TB 3SJIA 2CF9H 1BTZA 3SJKA 5LH8A 1NU7B 3BG4B 1N6YA 1DLEA 1P3CA 4ABDA 1TRNA 1JWTA 2P8OC 4ESTE 1T32A 4IBLH 5TJXA 3LH1A 1K1LA 1F5LA 1O2ZA 2PUXB 2ZGBH 3RU4E 2ZDVH 5JPMH 3OY6U 3E6PH 1IQMA 1LQEA 1RIWB 2WUCA 3BTHE 5EU8A 2TBSA 2ZFQH 5CHAC 2FLBH 1O3HA 3F9EA 1AWHB 3R0FA 1KDQB 1MQ6A 5CE1A 2ZI2H 4JZ1A 4F49A 1ANCA 2GT8A 4DCDA 2ULLA 3KHVA 1GJ7B 3CS7A 4ZHLU 3A82A 2Y7XA 1T4UH 2VIQA 4GHQA 3TJVA 4YOGA 2HOBA 1ORFA 4JZIA 4YO9A 3OSYA 4GCHG 1WV7H 1AWFH 1RJXB 3LKWA 4ABEA 1O2RA 2O8MA 4TY7A 4FU7A 1ZTKA 1TA6A 1GDNA 3U1IB 3OYPA 1EAWA 3SV9A 2CJIA 2F83A 2VINA 5F8XA 5GCHF 1O2PA 4CREA 1AN1E 3HKJB 4YZUA 1DE7H 2XNIA 3O8RA 1MTSA 2RG3A 5L30H 4X1NU 4YLQH 1ZJKA 1DOJA 1Z6JH 2Z94A 2P16A 3QGJA 1UTOA 2KAIA 2FEQH 3BN9A 5GDSH 4I8GA 3JZ1B 3PO1C 1E0FD 2J4IA 2F9PA 1BMMH 1NU9A 3UWIA 2H6MA 3SU1A 1AHTH 3U98H 4TYDA 3U8RH 1AZZA 2ASUB 2GV7A 2G4TA 1P2IA 5ETXA 1SGRE 3S9AA 2J92A 2ZDMA 5IDKA 2G52A 5A0BA 1N6XA 1PPFE 2VH6A 1QA7A 3SNDA 1GBBA 1YM0A 3A80A 3SU5A 2F9NA 1H9IE 3LT3A 5HM2A 1YF4A 4I32A 5DP5A 4DIHH 1ETRH 4FU9A 2ZFSA 1EAUA 2VVVA 1GI8B 5ESTE 3TH2H 4CH8B 2ZGCA 1P3EA 2WPKS 1ELFA 1AU8A 1S85A 1GBIA 1XXDA 1Y3VA 3LONA 1LVMA 3SOSA 1THPB 1T8OA 1EZSC 3OTJE 5C5OA 3RXEA 1DANH 1C5NH 2A2QH 4IC5A 2SFAA 5GWZA 3RMLH 3BEFB 1NC6A 2LNCA 1WYKA 2JH6D 1ZGIA 4X1QU 2QCYA 3O8BA 2BX4A 2GMTB 5EQSA 2J34A 3PLPA 1YPGH 3KQBA 3LIWA 3QDZB 1TMBH 4OS4A 5DP8A 4K1SA 1C5SA 1EP6A 1BTWA 2TGPZ 4GVUA 4THNH 2VGCC 1BDAA 2NU2E 1TOMH 2GP9B 4D7GA 1FPCH 1F5KU 1QL7A 2XRCA 4JZEH 2NU3E 2P3TB 2HNTE 2R3UA 5DP6A 1FPHH 1G36A 3PWCA 3T28A 2FS9A 1C5TA 4YOJA 1PJPA 1NN6A 3GISB 2I6QA 3SUGA 2WPLS 4Y79A 5FPYA 4D76A 1VGCB 3M7UA 1XX9A 1DY9A 1H9HE 2ODPA 4MQAA 2ZU1A 4JK6A 1OXGA 1UCYK 2Y80A 2NWNA 3LC3A 1GMHG 1K28D 1O2QA 2FPZA 1ID5H 1C5RA 1ZHMA 3SJ8A 4UFDH 8ESTE 1C1QA 2ZKSA 1TABE 1UHBA 3RXUA 3VXFH 1NPMA 4D9RA 2BTCE 1O2XA 4KTUA 1GHBF 3ZVEA 1LHGH 4B1TA 1OSSA 2ZA5A 4ISHH 1AY6H 4X1PU 3TPIZ 3RXKA 4HFPB 1O39A 2JKHA 2BHGA 3TK6A 5AFZH 2NU4E 1OP0A 5L2YH 1V2VT 5F6MA 3UR9A 1ZMNA 2F9UA 1P06A 2BVRH 4BTUB 1TRYA 1UTLM 1A5IA 1G30B 3PMAB 1N8OC 1SGEE 1DPOA 4BAKB 4DVAU 1O2OA 1PPCE 2PTCE 1K21H 3SNCA 1HB0B 1GVLA 1Y3YA 3RXPA 3MO9A 1BTHH 1P2KA 3GCTF 1P9UA 2C8YB 1T8LA 3SNEA 3TJNA 1HUTH 1P01A 4WXVA 4RKOB 3BTDE 3SUFA 3LJOA 3Q00A 1O2MA 1PQ7A 3RXFA 3ZZ9A 1V2PT 1FY3A 1RGQA 3CP7A 3HGNA 1FJSA 1FAXA 2BVXH 2ZCHP 1C2FA 1V2OT 4XSKU 3S0NA 2FI4E 1QBVH 4MDSA 1F2SE 2XYAA 2DE8A 3SU0A 2Q1JA 1RTFB 1CGHA 2CMYA 4BTTB 2XC4A 5FPTA 1GBJA 3A87A 3OX7U 1YCPH 5GCHG 3SI4H 1ZOMA 1OOKB 3RXLA 4FUJA 5DGJA 4A1VA 6ESTA 1DX5M 3T5FH 3U9AH 2SGFE 1C4V2 4AG1A 1HJAC 1O3CA 3PMJA 1FIZA 2XWBI 3D62A 2H9HA 3TIUA 2WPJS 2OC7A 4X2VA 5EGMA 5EPYA 1OWIA 4RN6A 1FONA 2TGAA 1SLUB 1LKAA 1B7XB 3PTBA 2AYWA 3KL6A 4NA7A 3GOVB 3RMMH 1VITG 1AIXH 5EPNA 1KXFA 3P70B 1K1NA 1UTQA 5FBIA 4AYVB 3MO6A 1TNKA 2A0QB 1CHGA 3MH6A 1J16A 7GCHF 3DT0H 1CE5A 3NK8A 5EW2H 5EOKA 2QAAA 3W94A 4MNYA 2W26A 3MU8A 5DO4H 4O3TA 4A92A 1WTHD 3PM3A 2XWAA 4X2WA 4NSVA 3MH7A 1C2IA 2A4GA 2P3FH 1YCPM 2PV9B 2C8ZB 1T8NA 3PB1E 1AFEH 2NU1E 3QZRA 4K1EA 1O5CB 3L33A 2HLCA 3EA8A 4GPGA 1F0TA 3M3SA 3TLOA 3TGKE 4X6OA 1HAGE 1IQKA 3SGQE 1FZZA 1IOEA 3ELAH 1K1IA 3MYWA 1AZ8A 1BJVA 1W0ZU 1NZQH 2JETC 2JH0D 3V7TA 4CRAA 4DY7B 1SGQE 1GI1A 3SU4A 1Q2WA 2DE9A 2FOCA 1A0HB 2PKSB 1GWAA 1XKBC 1XKAC 2ZDNA 1ESTA 2UUYA 5G4BA 3UQVA 1Y5UT 4K8YA 5DJ7A 1OYTH 2FLRH 1F92A 2QF0A 2P8OB 3F9GA 3H5CB 2C8XB 2B5TB 1HAOH 2TGTA 1DWBH 1SGIB 2O8WA 3BF6H 2GDEH 3NPSA 4WF8A 4F4OC 3A8CA 3LGWA 4JCNA 5JYIA 1PPBH 2ZU2A 1O3FA 4QT8C 5CHAB 3SORA 4Z6AH 1H4WA 4O97A 3AW1A 1C5MD 1A3EH 2ZQ1A 3SV7A 3F6UH 2V35A 4KELA 4GAWA 2OLGA 3ZZ5A 1C1TA 4OGXA 2Q6FA 4KKDA 5TCAA 4A1XA 2BD2A 2GCHF 5A0AE 4ISLA 1TPAE 3LGYA 5FX5A 1O32A 1O2JA 2HALA 1HDTH 3P17H 1HAHH 1GJ6A 2HNTC 4CH2B 1AKSB 2F3CE 2B0FA 1GHBG 4UD9H 1V2NT 1TPSA 4Y10E 1SGTA 1ELCA 1FN8A 3MHWU 3T26A 4NZQA 3URCA 1YLDA 1CU1A 1L4DA 1C5XB 1BTXA 4MNVA 2XCNA 3M3TA 4XFQA 4ZKOU 4K3JA 3A88A 1C9TA 3LU9B 2ZU3A 4AOQA 4DG4A 1C1SA 2BDHA 6GCHF 1AQ7A 3U1JB 1HAZB 1OS8A 3PO1B 4NZLA 3TJUA 5CMXH 2VIWA 1G3CA 1RD3B 3O8DA 1AB9C 1FN6A 1V2MT 2ZHWH 3M7TA 2H2ZA 2G51A 1W14U 2BY6X 1D3PB 5DP7A 1DT2A 2BLVA 5FCRA 4WVPE 3GCTG 4ZXYH 4B74A 1BOQA 1QFKH 1E37B 4I8KA 1GBFA 2FX6A 1PPZA 4UEHH 4Y76A 2ZTXA 3PV4A 2O8UA 4R8TB 5JBBS 1O2UA 2GKVE 2SGDE 5E2OA 2QA9E 3ZVGA 1Y3UA 1O3PB 3PROA 4A1TA 1FDPA 3LPRA 2BD4A 1EOJA 1B0FA 4ZUHA 3ATLA 2G8TA 2CHAC 3M5LA 3VB7A 1SC8U 3A7WA 7ESTE 3GDVA 1O3KA 1GI7B 2OTVA 3M61U 1GJBB 5J4SA 3BTGE 3EA7A 1DVAH 4MPUA 1V2QT 1W13U 2G5VA 3B8JA 1ZHPA 1EPTA 1EZQA 4AFZA 1KTSB 7KMEH 1NRNH 1BT7A 1K1PA 1UTJA 1TWXB 1O2GH 3KN2A 2PWXA 3ZVBA 3PWBA 1QBNA 7GCHG 3TJOA 4XBBA 1JRTA 3SNBA 1O2YA 4BANB 1Z8GA 1ANBA 1PQAA 2EI6A 1GL1A 1WCZA 3FZDA 3A7TA 2BB4A 2VGCB 3A7VA 3HK6B 2K1QA 1INCA 2IN2A 1MMJN 1TBQH 1BHXF 2ZFFH 2ANMH 1S0QA 1HJ8A 3ATWA 1EAXA 4TY6A 1S81A 1PPEE 1O3BA 2AIQA 2CV3A 1GG6C 4O03A 3V12A 3HGPA 1KLIH 2FS8A 3MTYA 2FWWA 1VR1H 3RXSA 1BBRH 3SJOA 1D6WA 2O8TA 4FXGH 3C27B 3MNCA 4A7IB 1KLTA 2CF8H 2J38A 1BTPA 1SFIA 1FY5A 1TX7A 2OUAA 3KEEA 1EZXC 3OU0A 1AVWA 1SFQB 2M5TA 2UUFB 3RXIA 2GCTC 4LK4A 1J17T 2VB0A 2AMQA 1V2TT 4X6MA 1CT4E 2A1DB 1BJUA 2WINI 1SG8B 1GJ5H 3KNXA 1P57B 4ZKRU 1EXFA 4UDWH 2G81E 2OCVB 4WMDA 1A5GH 2FOEA 3A81A 1ETSH 1C1UH 4K2YA 1GI3A 1MTVA 2Y81A 3EAJA 3MO3A 4X1RU 1HAPH 3LH3A 3HPTB 3UOUA 1SGCA 1N8OB 3D23A 3KQDA 5I25A 2ZDLA 1T31A 3F9HA 1B5GH 1GMDG 1SOZA 1V6DA 3S7KB 2VJ1A 1NT1A 1TQ0B 1LPKB 4K8BA 3VB3A 4AX9H 3QTVH 3V13A 5DKMA 4H42U 2GCHG 1ZHRA 2Z7FE 1E35B 5C1XA 3MNXA 1AVXA 1ELBA 3MU4A 3O8CA 4JZDH 1C1RA 1MD7A 3P92A 2IJOB 5FPSA 1RTKA 3SUEA 1BRAA 1UTMA 1BQYA 1P05A 3A89A 4TWWA 3LGVA 8KME2 1TNHA 4NSYA 5E0JA 1LPGB 2GT7A 1ABIH 1LVYA 1MCTA 1HGTH 1HJAB 2ODQA 1BHXB 4MLFB 5FHTA 2AERH 1C5VA 2NU0E 1NRRH 2OD3B 5JB8S 1GHZA 1ELGA 3QTOH 1OWHA 1C9PA 2GX4A 3RXHA 3HKIB 4E05H 1TOCB 3E3TA 1GBAA 4FU8A 1TAWA 1AMHA 1J15A 2Z9JA 3UTUH 1KDQA 2CGAA 2ZHDA 3A8AA 3MU5A 2AH4X 1QRXA 5AFYH 2FX4A 1LDTT 3RC6A 5EXNA 1C4U2 1CA8B 1TPOA 2OQUA 3ZZDA 3VB4A 1A61H 3BTWE 5A0CA 2PGBB 1UCYE 2OC0A 3FANA 1B0EA 2GZ7A 4I8HA 1J14A 4JYUH 4MNXA 3K6ZA 3ZZ7A 1FNIA 1ACBE 1LHDH 3M5MA 3BIUH 3GCOA 3GY3A 5DP4A 2HPPH 1GI6A 4M7GA 1GHYH 2V0BA 2A45B 3QX5H 3FAOA 2ZECA 1LPZB 1O2WA 1GJ8B 1TBZH 2AMPA 1MBQA 1C2MA 2JETB 1EQ9A 3QZQA 3C1KA 1QR3E 3EYDA 5SGAE 3CS0A 1WOFA 2STAE 4U01A 1DXWA 4CRFA 2J9NA 4DOQA 5AF9H 2BMGB 4DT7B 3I78A 2BY7X 1VCWA 4H6TA 2R0KA 3P95A 1HAXB 4ZKSU 1H8IH 3ZZ4A 3M3VA 1A1RA 1O0DH 1ABJH 1EPTC 3RXOA 2XW9A 1SOTA 2BXUH 2YNBA 1LHEH 1O33A 4X6PA 1QBOA 1GVKB 1P2MA 4X8TH 2AFQB 2WV5A 1QQ4A 1A3BH 4KTCA 1ZMJA 2ANKH 1GBEA 1Q31A 1F5RA 2FOFA 1Z71A 4ZHMU 1NRQH 1XM1A 2PR3A 1FUJA 2BDIA 2VIDA 5L6NH 1IQFA 2ZHFH 3GY7A 1TGNA 3FZZA 4INHA 4MPVA 1PPGE 2VIPA 2ZGHA 2ZHQH 1A7SA 2ZCLP 5C67A 1UK3A 2RA0A 1OYQA 1MAYA 1EP5A 5A8XA 1ZRBA 4ZXXH 3MNSA 3MH4A 4X8UH 2VWMA 4D8NA 5BPEA 3P8FA 1V3XA 2W7UA 8GCHF 1KLJH 4ABBA 2VNTA 1SMFE 4D9QA 1NRPH 3RMOH 1YPHE 1SGFG 1HXEH 3K9XB 4INLA 1YPMH 1O2SA 1P04A 4JZFH 5TCCA 2VVUA 1TGCA 1N1LA 1W2KH 3UREA 2AGEX 1D4PB 1KXCA 2ZC9H 5JBCS 3Q3XA 1GI4A 3M35A 3ATMA 1LMWB 2EC9H 1YCPK 1FIWA 3GYLB 3SHAH 1AO5A 1RS0A 1TMTH 2Z6BD 1O31A 1VCQA 2VH0A 2BY8X 4CHAC 1AB9B 2BY9X 1AUJA 3QUMP 3F68H 3U69H 1CSOE 3UNQA 2Z9GA 4Y6DA 3MNBA 1YLCA 1C1MA 1MTUA 1RRKA 4BXSA 5T3HA 1UK2A 1HLTH 2FOGA 2ZIQH 4FUCA 1IQLA 4FUDA 1C1VH 4MTBA 2QXJA 4LZ1H 2AMDA 2ZO3H 1W8BH 1HV7A 1P0SH 1ZR0A 2OC1A 1TALA 1C2JA 1GPZA 2ZFPH 3RXDA 4K1TA 1C1PA 2ZDAH 3URDA 1O30A 1SVPA 2CHAB 1E38B 2Q6DA 1SGNE 3GDUA 4J2YB 1S6FA 3MH5A 2GGVB 4NA9H 4CRCA 5A8ZA 4X2XA 3GDSA 5T6FA 1IQJA 5HGGA 3GY8A 5BRRE 2W3KA 1L1NA 4UONA 1EOLA 1SBWA 3PMBB 3STJA 2P59A 1YPEH 4NIXA 2J94A 1O3JA 1MKXH 2SNVA 1XUHA 1SQTA 3SGBE 2BDBA 3RXQA 3SV6A 3KCGH 2F9OA 1P2NA 1HAVB 1QCPA 3RXJA 3GYMA 4DGJA 1BMNH 1ANDA 1TIOA 4I8LA 5C3NA 2B9LA 4U32A 2FTLE 1CT2E 3VXEH 3ODFA 3QGNB 2WPMS 1M9UA 1S84A 2BLQA 4FUBA 1EATA 1GJAB 2BZAA 1OWJA 2TPIZ 3RXVA 4Y7AA 1TNGA 2G4UA 1SLWB 1NY22 4BAOB 4H4FA 2ZNKH 1GBDA 2QY0B 3HK3B 3PYHA 3R3GB 4MPXA 1O2TA 1C5PA 2WYJA 3FP6E 1GG6B 5E8EH 1OKXA 2ALVA 5IYTA 1C2DA 4MVNA 3ITIA 4KGAA 2B7DH 3RXBA 4JYVH 1O3DA 1LVOA 1S6HA 3V0XA 3JZ2B 4AG2A 2BXTH 4FVDA 2AGGX 2WYGA 1G3EA 2FM2A 1V2LT 2GCTB 3ZZ8A 1Z6EA 4ABIA 4JYTA 1F0RA 4X1SU 1L2EA 4JMYA 3FP8E 1NFYA 1JIRA 1P12E 1HCGA 1NESE 1TYNA 4HGCA 4UFFH 3UIRA 4B76A 3KQCA 1UMAH 1QA0A 5GIBA 3SQEE 2SGQE 1GJDB 3TU7H 5HMAA 3E1XB 4NGAH 3AASA 3UR6A 1W10U 4TPIZ 2FI3E 1YYY1 3T2NA 2D8WA 1A0JA 2G00A 5K7RA 4UFGH 2OC8A 1AI8H 3FFGA 2BOHB 5T6GA 2ZG0H 4ISIH 1WU1A 1AVGH 1HIAA 1ZYOA 1GBMA 3BV9B 2QF3A 1JIMA 1GBHA 1F0SA 1ARBA 8GCHG 2BLWA 3TH4H 4B2BA 4WH6A 2PHBA 5A09A 2Z9LA 2ANYA 1TGBA 1NFXA 1ZPCA 4AGJA 1O34A 1SQOA 4GLYA 4AORA 1NM6A
chains in the Genus database with same CATH superfamily
3T29A 4E06H 1G3BA 3TGJE 1S0RA 1LTOA 4F48B 3LOXA 1BTYA 3ATKA 1VJ9U 3GCNA 4BOHA 4B75A 2QIQA 1HRTH 2BQWB 5GPIB 1KXAA 2BVSH 4IW4E 5GNDA 1GI5A 2F91A 2EEKA 3UFAA 4LZ4B 1ELVA 2BZ6H 1EFRD 4FUGA 1GHVH 5C94A 2FODA 1TONA 2R9PA 3SNAA 4WH8A 1YPHC 2W6JD 1Y5AT 2HPQH 2QN5T 1O3GA 1YPKH 1L1GA 1HAIH 1O5FH 2ZTYA 1ZPBA 1KSNA 2BD9A 2P3UB 1QL9A 3ZVFA 5KGOA 2AGIX 5C2ZA 1ZMLA 4BNRA 3UAIC 2ILNA 2XBXA 4XOJA 1O5GH 1JMOH 1TNJA 1UVSH 2XBWA 5EG4A 1MCVA 3PMHB 3RU4D 2JH5D 1FQ3A 2KX4A 3SV2H 2ZF0H 5EQRA 1SB1H 1CA0C 2GZ9A 1C5ZB 1UJ1A 4TPYA 2R3YA 2IOTA 4NIVA 1GI0A 2UWOA 6LPRA 1MU8B 1HXFH 1EAIA 3DUXH 3OEHD 1QNJA 4WMFA 4BAQB 2A31A 1TFXA 1W3CA 4TSFD 1DICA 2C4FH 1V2WT 1MZDA 1O2NA 1SHHB 3BTEE 4AB9A 2PKAA 2VIVA 3RP2A 3LC5A 2A5KA 3RXGA 2SGPE 2D1JA 1EPTB 3K65B 1BBRK 3VGCC 4X8VH 1Z1JA 3RC5A 4XRNA 1GDUA 1VCPA 1ZSJA 1YBWA 1P10A 4A6LA 1TX6A 3SJ9A 1XVOA 1ANEA 1O2HA 3MOCA 2H9EH 3EE0B 3TNTA 1MU6B 1YPJH 2FESH 3RC4A 1O2VA 1V2ST 2C3SA 1AE5A 4Q7YA 2FI5E 4JK5A 4K60A 3BG8A 2G5NA 2VWOA 3W95A 1QB1A 1GGDC 1O35A 1O5DH 2XC5A 3N7OA 5IK2D 3RXCA 2WV4A 4R0IA 1MKWH 1QJ1B 3U8TH 5FCKA 1L0ZA 3F2FA 3LJJA 3BTME 4AFQA 1VZQH 2W6ID 1OPHB 1OP8A 3BEIB 3QO6A 3S7HB 3E8LA 2DUCA 3ZZCA 5JBAS 2A5IA 3WY8A 1Z1IA 3A83A 1JBUH 2ZHEH 4CRDA 1TLDA 2ZPSA 3BTKE 2BD3A 2H9TH 1GBTA 1TPPA 1UVOA 1UTKA 2Y6TA 1Z8RA 4ZMAH 3I29A 2C93B 4Y11E 5H4IB 2AEIH 1BZXE 1XMNB 2W5EA 1DSTA 5DG6A 2Z3CA 4MG3A 2FP7B 1HNEE 4ABHA 1ESBA 1NFUA 3NRLA 1CT0E 4X2YA 1DFPA 1O5EH 2A32A 3ZVDA 1CBWC 2SGEE 1CHOF 2FYRA 1DXPA 1TA2A 2W3IA 1TNLA 3STIA 4I8JA 1QL8A 5F03A 4Y71A 3SUDA 4X6NA 4IGDA 4CBOA 1K22H 1L4ZA 2TRMA 3A84A 1BRCE 4CHAB 5EJ1A 1EX3A 2Z9IA 2KCPA 1SHYA 3GY5A 1IHSH 1ESAA 1YY3A 3F2HA 1ZRKA 4ASHA 3VFEA 4B2CA 1C5YB 1Z8JB 3F1SB 2ZPQA 2BLOA 3OFND 1D9IA 1RXPA 2Z3EA 2EI7A 1TBRH 4KP0A 3SZNA 1GBKA 1G3DA 2CN0H 2ZP0H 3AAUA 1J8AA 1BUIA 3RXTA 2VVCA 3AAVA 1DWDH 1ELDE 5AHGH 4I31A 1K9OE 5GXPA 3TITA 1K1OA 2ODYB 5C1YA 6CHAC 1AGJA 2QE7D 1KTTB 4D7FA 4X8SH 1PPHE 1BA8B 4AGKA 1W7GH 3RM2H 1QZ8A 1BB0B 5ABWA 1UK4A 2FXRA 1UTNA 3HATH 3UUZA 1XUGA 4ABGA 1QTFA 1IQEA 5DP3A 1ELAA 1O3MA 1P9SA 3K2UA 1EJNA 2FOHA 2HWLB 1GMCF 3RXMA 1EB1H 1Y8TA 1V2JT 2BD5A 1KIGH 1FAKH 4XE4A 2GVFA 2Y82A 1K1MA 3TVJB 2HRVA 1JXPA 4NWLA 5C1UA 2OBQA 2PW8H 2R2WU 4K5ZA 1MZAA 4YLUA 3SU6A 1OWKA 1W0YH 2OXSA 3ESTA 4KTSA 1O5AB 4NG9H 3H7TA 6GCHG 4FUEA 4ABJA 3IG6B 1GHAF 4NIYA 4ZH8A 2PLXA 2BM2A 5A8YA 2QYIA 2A7HA 3ZZAA 3A85A 4NFEA 3M37A 4Y8YA 2YMSC 2XTTB 2HNTF 2KAIB 1BITA 4VGCB 5LPRA 3EQ0H 2H1UA 3ODDA 4OS1A 5E0HA 1S6LA 1DWEH 2OQ5A 1GJ4H 3UB0A 3BEUA 2VWLA 3PTNA 1IQHA 1HFDA 1DLKB 1A5HA 1YP9A 1PYTC 3E16B 4SGBE 5GJ4B 2FMJA 3TK9A 1QQUA 3GCHC 3VPKA 3P6ZB 1SGYE 1Y5BT 3QK1A 1OWDA 1ZPZA 1ETTH 1DUEA 1T4VH 1T8MA 4AB8A 1QIXB 1EB2A 1LKBA 2A4RA 2F9BH 4AZ2B 4E7RG 4O3UA 2W7SA 1FMGA 2FZZA 1LCYA 2UWPA 1AFQC 1X7AC 1DUAA 1MUEB 5FBEA 5I46H 4J1YA 3TK5A 4YESB 1XVMA 3WWFA 1BTUA 4B6FA 4O9VA 2ZZUH 3ZV9A 1VITF 2H5CA 2CXVA 3MMGA 2P94A 1KMHB 4TWYA 3A7YA 1GBLA 2UWLA 1DSUA 3GICB 2ZQ2A 1GJCB 3P8GA 1C1WH 5LPEA 2ZPRA 1C1OA 1S82A 3BSQA 1SGFA 1OP2A 1Y59T 1GI9B 2I6SA 2GD4B 1KXDA 4WJG2 4FUFA 2FYQA 1C5LH 3S69A 1GHWH 1O36A 3L6PA 4H6SB 3BTTE 1DM4B 2BQ7B 1ZTLA 5EW1H 1T7CA 2B8OH 1BRBE 1W7XH 1GCTC 1OX1A 1A4WH 4YT6H 5E2PA 2ZFRH 4XDEA 1AD8H 2K0QA 1GBCA 1YC0A 2WZQA 1IQGA 4NCYA 5JDUB 1KYNA 3V3MA 3MU1A 1C5UA 1Z7KA 1SLVB 4ISOA 3TNSA 2P95A 2BDCA 3ZVAA 3ENSB 1H9LB 3SU3A 1C4Y2 1JRSA 2V3HH 2P93A 1BRUP 1SSXA 1MAXA 5F8TA 1QRZA 1P8VC 5ESBA 1O3EA 3EA9A 3KIDU 1NTPA 4NIWA 1CHOG 5LPFA 2J2UA 2GDDA 3KQ5A 3FVFB 2OP9A 1C5WB 3RXRA 1UHBB 4ZAEA 1KXBA 4AN7A 3AVZA 3UWJH 3T27A 1TX8A 2JJ2D 1MTNC 2XOKD 3UNSA 1XUIA 2Y7ZA 1Q3XA 4CBNA 2QXIA 4AFSA 1MKXK 1QJ6B 2CK3D 1WUNH 2FOAA 3EGKH 3MU0A 3QN7A 1QB9A 1UVPA 1YPLH 2WPIS 2V6NA 5E0GA 1K0HA 5HM9A 3NWUA 1V2RT 3RUOA 4GHTA 2UUJB 1XXFA 5HXFA 1P03A 5PTPA 1CA0B 3UPEA 2GZ8A 2WPHS 3A8BA 9LPRA 3DSGA 2ZWLH 4XD7D 1C5QA 5FL7D 2VU8E 3IWMA 1UO6A 4UFEH 2ALPA 1SLXB 1S83A 4M9FA 2H5DA 3GY6A 2LPRA 4WMEA 1DWCH 3UOPA 1D6RA 1HAYB 1QJ7B 2HVXA 3BTFE 3Q76A 1GMCG 2BDAA 4CR9A 4Y0YE 1QRWA 1BIOA 4ZHAA 1D3QB 5EODA 3VGCB 1KY9A 3QWCH 2O8LA 2WUBA 1WSSH 3B9FH 2OINA 1QB6A 3BG4C 3LDXH 1LO6A 1NRSH 3MFJA 7LPRA 2IPHA 1GHAG 1HBTH 2D2DA 1A46H 3KQEA 4GUXA 1W0KD 1K1JA 2FIRH 1MD8A 4A5TS 1TGTA 3DA9B 3MWIU 4WWYA 1W11U 1RIWC 3E90B 4NFFA 5FX6A 2OK5A 4DURA 4FUHA 2QXHA 1P2JA 1ZTJA 1GGDB 1O2LA 2ZGXH 1XUKA 1JOUB 1DS2E 2XBVA 2ANWA 1UCYH 1IQNA 3VB6A 1EASA 4GSOA 1C2LA 1GDQA 1GVZA 4IMQA 1PYTD 3L3TA 3BTQE 3ZV8A 3E91A 1C1NA 4AYYB 5AVDA 3TGIE 3IITA 1GL0E 4VGCC 1LVBA 2ZU5A 2ESTE 1UVTH 4DIIH 4BXWA 1AUTC 5FAHA 3B23B 2KCOA 2BD7A 1EKBB 2PGQB 2V3OH 4ABFA 2VWNA 1RTLA 2WSSD 1A0LA 3LGUA 2Q6GA 1O3LA 2GV6A 1RFNA 2GTBA 4XBCA 1BMLA 1GHXH 4DW2U 1LHFH 1SL3A 3NXPA 1HAVA 3D65E 2THFB 4IS5A 3OY5U 1P2OA 1CBWB 1Y3XA 2FOBA 1O38A 3RLWH 5T1VA 3A8DA 1KXEA 3Q3KA 5DPAA 2J95A 1ZLRA 1O3IA 1VKYA 1G2MA 3DFLA 3SW2B 1Y3WA 4FVBA 4U2WA 1ELEE 4NWKA 1O37A 3NKKA 4AFUA 5DK1A 1W12U 5HYOA 1TE0A 3GY2A 1SPJA 5DP9A 1UVUH 1BCUH 1O3OA 1DITH 1C5OH 2PSXA 2BQ6B 2Y5GA 1HIAB 1WBGB 3PLBA 2QC2A 2O9QA 1FI8A 1C2HA 3F9FA 3T25A 2A4OA 1FXYA 4B73A 4MNWA 2ZFTA 5LGOA 1TRMA 1O3NA 3A7ZA 4ZROA 1BBRE 4FUIA 3SV8A 4I33A 5FXLA 1MTWA 4Q80A 4BTIB 1NO9H 3KGPA 3U8OH 1CVWH 3LGTA 2D26C 6CHAB 4LOYH 4K69A 2XBYA 5C5NA 4HI3A 3DHKH 1ZZZA 4UE7H 1E36B 3ZYEA 1LQDB 1DDJA 5EXLA 4YT7H 1BMAA 1SI5H 3TH3H 2XCFA 2G55A 4WXIA 2BYAX 1O5BB 3RDZA 2ZDKA 3N7EA 1QY6A 4YM9A 1C2KA 4IMZA 2BD8A 3LGIA 1ZJDA 2A2XH 2UUKB 3PRDA 3Q3YA 5EXMA 1TMUH 1H8DH 2GMTC 2R0LA 5F8ZA 4RT1A 4OS2A 3RMNH 3OAAD 1IAUA 4Y7BA 3E0PB 1GI2A 1CO7E 1HYLA 2C8WB 2QGRA 1GMDF 4B2AA 1HJ9A 3H7OA 2YNAA 2ZEBA 3P8OA 1XUJA 3E0NB 3NUMA 3RLYH 2YMSB 3RXAA 1MQ5A 3FP7E 2OBOA 2HLDD 1J9CH 2BY5X 3AK5A 1VITH 3DD2H 1CGIE 3SN8A 2PSYA 3RU4T 1Z8IB 2TIOA 1O2IA 1EUFA 1WQSA 4RSPA 1AE8H 1V2UT 3P8NA 3SO3A 3Q77A 3ZZ3A 1K2I1 1GJ9B 1VGCC 4Q7ZA 1L1JA 2A4QA 1AKSA 3GCHB 3VB5A 1MKWK 1G2LA 3ZYDA 3U28C 1H1BA 4MPWA 1C2EA 3T62A 4GCHF 1FY4A 2ZTZA 1MBMA 2PKAB 2IPQX 3PRBA 2A7JA 4B71A 4IN1A 2FOMB 2ZU4A 2Z9KA 1NBME 1AFQB 1EZUC 5C17A 2FDAA 3M7QA 4DJZB 1MH0A 1CQQA 2STBE 1D3DB 2PUQH 3UNRA 2ZGJA 2FO9A 1CGJE 2FTMA 4Y8ZA 1THSH 2Z3DA 1PQ5A 2EA3A 4Q2KA 2VIOA 1F7ZA 4INKA 4ABAA 4Q7XA 2RA3A 2A5AA 1WQVH 3KF2A 1U6QA 2SGAA 1QHRB 4P00A 3DSPA 1FY8E 1GCDA 4HZHA 4RI0A 3QLPH 1TNIA 2IJD1 1IQIA 1ARCA 1TB6H 1EJMA 3SBKA 2PFEA 1C2GA 4Z0KA 1PFXC 1IHTH 1P02A 1ELTA 2XC0A 3ZZBA 4BAMB 2QV1A 1GCTB 2R2MB 1P09A 3PLKA 3UQOA 3SHCH 5A2MH 1ZGVA 1NROH 5C20A 1DY8A 4YOIA 3NZIA 1PQ8A 1TQ7B 3S9CA 4WY3A 1P11E 1QGFA 3CENA 1E34B 4LXBH 4OS5A 1UTPA 1SGPE 3ATIA 1O2KA 3ZVCA 2PTNA 4BAHB 4E7NA 1VJAU 1G32B 2AS9A 3NCLA 1OWEA 5B6OA 4IC6A 3SQHE 1QURH 1XUFA 2BDYA 4SGAE 2QXGA 5K0HA 2BX3A 4XBDA 3M36A 2V7QD 1P2QA 3D49H 5T6DA 2BDGA 5JBTA 4I7YH 1A2CH 2RCEA 3GY4A 3M5NA 3M5OA 1NS3A 3CNRA 1TGSZ 1LHCH 2YOLA 4RKJB 5J4QA 1FY1A 1FV9A 4YXWD 1G9IE 1MTNB 1ZSKA 3I77A 4OGYA 8LPRA 1S5SA 2C90B 3G01A 2SNWA 4YTAA 1YKTA 1SGDE 2Y5HA 4X0WU 4U30A 2TGDA 1SR5C 4IN2A 2EI8A 3K6YA 2F9VA 4Y8XA 1HPGA 4Y0ZE 3DFJA 5HIZA 4CRGA 3A86A 3A7XA 3SGAE 4ZKNU 1H8HD 4OS6A 4PROA 1THRH 1WTGH 1YGCH 2ZCKP 1V2KT 3AW0A 4ISNA 4CR5A 3MI4A 2RDLA 1EJAA 1F0UA 1COWD 1FLEE 3VEQB 3S9BA 1NFWA 2HGTH 5L2ZH 3UY9A 1WAYB 2AIPA 3RM0H 4OS7A 3EDXB 4CRBA 4F55A 1G37A 5EQQA 2XXLA 1GMHF 1ZSLA 2BOKA 2PKSC 4NA8A 5JB9S 3MQKC 2A7CA 3SU2A 4HTCH 3ZZ6A 2Y5FA 1O3AA 3SI3H 1SQAA 9ESTA 3BIVH 4FETA 1D3TB 3SJIA 2CF9H 1BTZA 3SJKA 5LH8A 1NU7B 3BG4B 1N6YA 1DLEA 1P3CA 4ABDA 1TRNA 1JWTA 2P8OC 4ESTE 1T32A 4IBLH 5TJXA 2JJ1D 3LH1A 4AC9A 1K1LA 1F5LA 1O2ZA 2PUXB 2ZGBH 3RU4E 2ZDVH 5JPMH 3OY6U 3E6PH 1IQMA 4DT4A 1LQEA 1RIWB 2KR7A 2WUCA 3BTHE 5EU8A 2TBSA 2WPDD 2ZFQH 4HG6A 5CHAC 5F53A 2FLBH 2GJGA 1O3HA 3F9EA 1AWHB 3R0FA 4OM9A 1KDQB 1MQ6A 4I86A 5CE1A 2ZI2H 4JZ1A 4F49A 1ANCA 2GT8A 4DCDA 2ULLA 3KHVA 1GJ7B 3CS7A 4ZHLU 3A82A 2L74A 2Y7XA 1T4UH 2VIQA 4GHQA 3TJVA 4YOGA 2HOBA 1ORFA 4JZIA 4YO9A 3OSYA 4GCHG 1WV7H 1AWFH 1RJXB 3LKWA 4ABEA 1O2RA 3N7DA 5C0UA 2K8IA 2O8MA 4TY7A 4FU7A 1ZTKA 1TA6A 1GDNA 3U1IB 3OYPA 1EAWA 3SV9A 2CJIA 2F83A 2VINA 5F8XA 1WXRA 5GCHF 1O2PA 4CREA 1AN1E 3HKJB 4YZUA 1DE7H 2XNIA 5HIYA 3O8RA 1MTSA 2RG3A 5L30H 4X1NU 3FO8D 4YLQH 1UW7A 1ZJKA 1DOJA 1Z6JH 2Z94A 2P16A 3QGJA 1UTOA 2KAIA 2FEQH 3BN9A 3F3BA 5GDSH 4I8GA 3JZ1B 3PO1C 1E0FD 2J4IA 2F9PA 1BMMH 1NU9A 3UWIA 2H6MA 3SU1A 1AHTH 3U98H 3DSOA 4TYDA 3U8RH 1AZZA 2ASUB 2GV7A 2G4TA 1P2IA 5ETXA 1SGRE 3S9AA 1MABB 2J92A 2ZDMA 4Q4LA 5IDKA 2G52A 5A0BA 1N6XA 1PPFE 2VH6A 1QA7A 4RT0A 3SNDA 1GBBA 1YM0A 3A80A 3SU5A 2F9NA 1H9IE 3LT3A 5HM2A 1YF4A 4I32A 5DP5A 4DIHH 1ETRH 3H09A 4FU9A 4FOUC 2ZFSA 1EAUA 2VVVA 1GI8B 5ESTE 2KZ4A 3TH2H 4CH8B 2ZGCA 1P3EA 2VBCA 2WPKS 1ELFA 1AU8A 1S85A 1GBIA 1XXDA 1Y3VA 3LONA 1LVMA 3SOSA 1THPB 1T8OA 1EZSC 3OTJE 5C5OA 3RXEA 1DANH 1C5NH 2A2QH 4IC5A 2SFAA 5GWZA 3RMLH 3BEFB 1NC6A 2LNCA 1WYKA 2JH6D 1ZGIA 4X1QU 2QCYA 3O8BA 2BX4A 2GMTB 5EQSA 2J34A 3PLPA 1YPGH 3KQBA 3LIWA 3QDZB 1TMBH 4OS4A 5DP8A 4K1SA 5HKKD 1C5SA 1EP6A 1BTWA 2TGPZ 4GVUA 4THNH 2VGCC 1BDAA 3F0OA 2NU2E 1TOMH 2GP9B 4D7GA 1FPCH 1F5KU 1QL7A 2XRCA 4JZEH 2NU3E 2P3TB 2HNTE 2R3UA 5DP6A 1FPHH 1G36A 3PWCA 3T28A 2FS9A 1C5TA 4YOJA 1PJPA 1NN6A 3GISB 2I6QA 3SUGA 2WPLS 4Y79A 5FPYA 4D76A 1VGCB 3M7UA 1XX9A 1DY9A 1H9HE 2ODPA 4MQAA 2ZU1A 4JK6A 1OXGA 1UCYK 2KM0A 2Y80A 2NWNA 3LC3A 1GMHG 1K28D 1O2QA 2FPZA 1ID5H 1C5RA 1ZHMA 3SJ8A 4UFDH 8ESTE 1C1QA 2ZKSA 1TABE 1UHBA 5KECA 3RXUA 3VXFH 1NPMA 4D9RA 2BTCE 1O2XA 4KTUA 1GHBF 3ZVEA 2HVYB 1LHGH 1E79D 5DSFA 4B1TA 1OSSA 2ZA5A 4ISHH 2J5UA 1AY6H 4X1PU 3TPIZ 3RXKA 4HFPB 1O39A 2JKHA 1FX0B 2BHGA 3TK6A 5AFZH 2NU4E 1OP0A 5L2YH 1V2VT 5F6MA 2RDEA 3UR9A 1ZMNA 2F9UA 1P06A 2BVRH 4BTUB 1BMFD 1TRYA 1UTLM 1A5IA 1G30B 3PMAB 1N8OC 1SGEE 1DPOA 4BAKB 4DVAU 3OTPA 1O2OA 1PPCE 2PTCE 1K21H 3SNCA 1HB0B 1GVLA 1Y3YA 3RXPA 2YMSD 3MO9A 1BTHH 1P2KA 2J97A 1P9UA 2C8YB 1T8LA 3GCTF 3SNEA 3TJNA 1HUTH 1P01A 2V3MA 4WXVA 4RKOB 3BTDE 3SUFA 3LJOA 3Q00A 1O2MA 1PQ7A 3RXFA 3ZZ9A 1SKYE 1V2PT 1E1RD 1FY3A 1RGQA 3CP7A 3HGNA 1FJSA 1FAXA 2BVXH 2ZCHP 1C2FA 1V2OT 4XSKU 3S0NA 2FI4E 1QBVH 4MDSA 1F2SE 2XYAA 2DE8A 3SU0A 1OHHD 3WW7A 2Q1JA 1RTFB 1CGHA 2CMYA 4BTTB 2XC4A 5FPTA 1GBJA 3A87A 3OX7U 1YCPH 5GCHG 3SI4H 1ZOMA 1OOKB 3RXLA 4FUJA 5DGJA 4A1VA 6ESTA 1DX5M 3T5FH 3U9AH 2SGFE 1C4V2 2M2AA 4AG1A 1HJAC 1O3CA 3PMJA 1FIZA 2XWBI 3D62A 2H9HA 3EE7A 3TIUA 2WPJS 2OC7A 4X2VA 5EGMA 5EPYA 1OWIA 4RN6A 1FONA 2JDID 2TGAA 1SLUB 1LKAA 1B7XB 3PTBA 2AYWA 3KL6A 4NA7A 1WDIA 3GOVB 3RMMH 1VITG 1AIXH 5EPNA 1KXFA 3P70B 1K1NA 1UTQA 5FBIA 4AYVB 3MO6A 1TNKA 2A0QB 1CHGA 3MH6A 1J16A 7GCHF 3DT0H 1CE5A 3NK8A 5EW2H 5EOKA 2QAAA 3W94A 4MNYA 2W26A 3MU8A 5DO4H 4O3TA 4A92A 3WWBA 1WTHD 3PM3A 2XWAA 4X2WA 4NSVA 3MH7A 1C2IA 2A4GA 2P3FH 1YCPM 2PV9B 2C8ZB 1T8NA 3PB1E 1AFEH 2NU1E 3QZRA 4K1EA 1O5CB 3L33A 3SYJA 2HLCA 3EA8A 4GPGA 1F0TA 3M3SA 3TLOA 3TGKE 4X6OA 1HAGE 1IQKA 3SGQE 1FZZA 1IOEA 3ELAH 1K1IA 3MYWA 1AZ8A 1BJVA 1W0ZU 1NZQH 2JETC 2JH0D 3V7TA 4CRAA 4DY7B 1SGQE 1GI1A 3SU4A 1Q2WA 2DE9A 2FOCA 1A0HB 2PKSB 1GWAA 1XKBC 1XKAC 2ZDNA 2QF5A 1ESTA 2EY4C 2UUYA 5G4BA 3UQVA 1Y5UT 4K8YA 5DJ7A 1OYTH 2FLRH 1F92A 2QF0A 2P8OB 3F9GA 3H5CB 2J98A 2C8XB 2B5TB 1HAOH 2TGTA 1DWBH 1SGIB 2O8WA 3BF6H 2GDEH 3NPSA 4WF8A 4F4OC 3A8CA 3LGWA 4JCNA 5JYIA 1PPBH 2ZU2A 1O3FA 4QT8C 5CHAB 3SORA 4Z6AH 1H4WA 4O97A 3AW1A 1C5MD 5DN6D 1A3EH 2QF4A 2ZQ1A 3SV7A 3F6UH 2V35A 4KELA 2L6OA 4GAWA 2OLGA 3ZZ5A 1C1TA 4OGXA 2Q6FA 4KKDA 5TCAA 4A1XA 2BD2A 2GCHF 5A0AE 4ISLA 1TPAE 3LGYA 5FX5A 1O32A 1O2JA 2HALA 1HDTH 3P17H 1HAHH 1GJ6A 2HNTC 4CH2B 1AKSB 2F3CE 2B0FA 1GHBG 4UD9H 1V2NT 1TPSA 4Y10E 1SGTA 1ELCA 1FN8A 3MHWU 3T26A 3F2GA 4NZQA 3URCA 1YLDA 1CU1A 1L4DA 1C5XB 1BTXA 4MNVA 2XCNA 3M3TA 4XFQA 4ZKOU 4K3JA 3A88A 1C9TA 3LU9B 2ZU3A 4AOQA 4DG4A 1C1SA 2BDHA 2WHXA 6GCHF 1AQ7A 3U1JB 1HAZB 1OS8A 3PO1B 4NZLA 3TJUA 5CMXH 2VIWA 1G3CA 1RD3B 3O8DA 1AB9C 1FN6A 1V2MT 2ZHWH 3M7TA 2H2ZA 2G51A 1W14U 2BY6X 4B6EA 1D3PB 5DP7A 1DT2A 2BLVA 5FCRA 4WVPE 3GCTG 4ZXYH 4B74A 1BOQA 1QFKH 1E37B 4I8KA 1GBFA 2FX6A 1PPZA 4UEHH 4Y76A 2ZTXA 3PV4A 2O8UA 4R8TB 5JBBS 1O2UA 2GKVE 2SGDE 5E2OA 2QA9E 3ZVGA 1Y3UA 2KCAA 1O3PB 3PROA 4A1TA 1FDPA 3LPRA 2BD4A 1EOJA 1B0FA 4ZUHA 3ATLA 2G8TA 2CHAC 3M5LA 3VB7A 1SC8U 3A7WA 7ESTE 3GDVA 1O3KA 1GI7B 2OTVA 3M61U 1GJBB 5J4SA 3DCLA 3BTGE 3EA7A 1DVAH 4MPUA 1V2QT 1W13U 2G5VA 3B8JA 1ZHPA 1EPTA 1EZQA 4AFZA 1KTSB 7KMEH 1NRNH 1BT7A 1K1PA 1UTJA 1TWXB 1O2GH 3KN2A 2LELA 2PWXA 2KFWA 3ZVBA 3PWBA 1QBNA 7GCHG 3TJOA 4XBBA 1JRTA 3SNBA 1O2YA 4BANB 1Z8GA 1ANBA 1PQAA 2EI6A 1GL1A 1WCZA 3FKSD 3FZDA 3A7TA 2BB4A 2VGCB 3A7VA 3HK6B 2K1QA 1INCA 2IN2A 1MMJN 1TBQH 1BHXF 2ZFFH 5KEDA 3N99A 2ANMH 1S0QA 1HJ8A 3ATWA 1EAXA 4TY6A 1S81A 1PPEE 3VG8A 1O3BA 2AIQA 2CV3A 1GG6C 4O03A 3V12A 3HGPA 1KLIH 2FS8A 3MTYA 2FWWA 1VR1H 3RXSA 1BBRH 3SJOA 1D6WA 2O8TA 4FXGH 2EQNA 3C27B 3MNCA 4A7IB 3KYGA 1KLTA 2CF8H 2J38A 1BTPA 1SFIA 1FY5A 1TX7A 2OUAA 3KEEA 1EZXC 3OU0A 1AVWA 1SFQB 3SZEA 2M5TA 2UUFB 3RXIA 2GCTC 4LK4A 1J17T 2VB0A 2AMQA 1V2TT 4X6MA 1CT4E 2A1DB 1BJUA 2WINI 1SG8B 1GJ5H 3KNXA 1P57B 4ZKRU 1EXFA 4UDWH 2G81E 2OCVB 4WMDA 1A5GH 2FOEA 3A81A 1ETSH 1C1UH 4K2YA 1GI3A 1MTVA 2Y81A 3EAJA 3MO3A 4X1RU 1HAPH 3LH3A 3HPTB 3UOUA 1SGCA 1N8OB 3D23A 3KQDA 5I25A 2LP6A 2ZDLA 1T31A 3F9HA 1B5GH 1GMDG 1SOZA 1V6DA 3S7KB 2VJ1A 1NT1A 1TQ0B 1LPKB 4K8BA 3VB3A 4AX9H 3QTVH 3V13A 5DKMA 4H42U 2GCHG 1ZHRA 2Z7FE 3FN8A 1E35B 5C1XA 3MNXA 1AVXA 1ELBA 3MU4A 1W0JD 3O8CA 4JZDH 3OE7D 1C1RA 1MD7A 3P92A 2IJOB 5FPSA 1RTKA 3SUEA 1BRAA 1UTMA 1BQYA 1P05A 1SQRA 3A89A 4TWWA 3LGVA 8KME2 1TNHA 4NSYA 5E0JA 1LPGB 2GT7A 1ABIH 1LVYA 1MCTA 1HGTH 1HJAB 2ODQA 1BHXB 4MLFB 5FHTA 2AERH 1C5VA 2NU0E 4ASUD 1NRRH 2OD3B 5JB8S 1GHZA 4ZCNA 1ELGA 3QTOH 1OWHA 1C9PA 2GX4A 3RXHA 3HKIB 4E05H 1TOCB 3E3TA 1GBAA 4FU8A 1TAWA 1AMHA 1J15A 2Z9JA 3UTUH 1KDQA 2CGAA 2ZHDA 3A8AA 3MU5A 3KYFA 2AH4X 1QRXA 5AFYH 2FX4A 1LDTT 3RC6A 5EXNA 1C4U2 1CA8B 1TPOA 2OQUA 3ZZDA 3VB4A 1A61H 3BTWE 5A0CA 2PGBB 1UCYE 2OC0A 3FANA 1B0EA 2GZ7A 4I8HA 1J14A 4JYUH 4MNXA 3K6ZA 3ZZ7A 1FNIA 1ACBE 1LHDH 3M5MA 2F43B 3BIUH 3GCOA 3GY3A 5DP4A 2HPPH 1GI6A 4M7GA 1GHYH 2V0BA 2A45B 3QX5H 3FAOA 2ZECA 1LPZB 1O2WA 1GJ8B 1TBZH 4P02A 2AMPA 1MBQA 1C2MA 2JETB 1EQ9A 3QZQA 3C1KA 1QR3E 3EYDA 5SGAE 3CS0A 1WOFA 5CDFE 2STAE 4U01A 1DXWA 4CRFA 2J9NA 4DOQA 5AF9H 2BMGB 4DT7B 3I78A 2BY7X 1VCWA 4H6TA 2R0KA 3P95A 1HAXB 4ZKSU 1H8IH 3ZZ4A 3M3VA 1A1RA 1O0DH 1ABJH 1EPTC 3RXOA 2XW9A 1SOTA 2BXUH 2YNBA 1LHEH 1O33A 4X6PA 1QBOA 1GVKB 1P2MA 4X8TH 2AFQB 2WV5A 1QQ4A 1A3BH 4KTCA 1ZMJA 2RFKC 2ANKH 2PP6A 1GBEA 1Q31A 1F5RA 4ACAA 2FOFA 1Z71A 4ZHMU 1NRQH 1XM1A 2PR3A 1FUJA 2WV9A 5EJLA 2BDIA 2VIDA 5L6NH 1IQFA 2ZHFH 3GY7A 1TGNA 3FZZA 4INHA 4MPVA 1PPGE 2VIPA 2ZGHA 2ZHQH 1A7SA 2ZCLP 5C67A 1UK3A 2RA0A 1OYQA 1MAYA 1EP5A 5A8XA 1ZRBA 4ZXXH 1H8ED 4Q63A 3MNSA 3MH4A 4X8UH 5CHBA 2VWMA 4D8NA 3ZIAD 5BPEA 3P8FA 1V3XA 2W7UA 8GCHF 1KLJH 4ABBA 4ACBA 2VNTA 1SMFE 4D9QA 1NRPH 3PV5A 3RMOH 1YPHE 1SGFG 1HXEH 3K9XB 4INLA 1YPMH 2JIZD 1O2SA 1P04A 4JZFH 5TCCA 2KCYA 2VVUA 1TGCA 1N1LA 1W2KH 3UREA 2AGEX 1D4PB 1KXCA 2ZC9H 5JBCS 3Q3XA 1GI4A 3M35A 3ATMA 1LMWB 2EC9H 1YCPK 1FIWA 3GYLB 3SHAH 1AO5A 1RS0A 1TMTH 2Z6BD 1O31A 1VCQA 2VH0A 2BY8X 4CHAC 1AB9B 2BY9X 1AUJA 3QUMP 3F68H 3U69H 1CSOE 3UNQA 2Z9GA 3W1EA 4Y6DA 3MNBA 1YLCA 1C1MA 1MTUA 1RRKA 4BXSA 5T3HA 1UK2A 1HLTH 2FOGA 2ZIQH 4FUCA 1YLNA 2F4LA 1IQLA 4FUDA 1C1VH 4MTBA 2QXJA 4LZ1H 2AMDA 2ZO3H 1W8BH 1HV7A 1P0SH 1ZR0A 2OC1A 1TALA 1C2JA 1GPZA 2ZFPH 3RXDA 4K1TA 1C1PA 2ZDAH 3URDA 1O30A 1SVPA 3OEED 2CHAB 1E38B 3PV2A 2Q6DA 1SGNE 3GDUA 3GS9A 4J2YB 1S6FA 3MH5A 2GGVB 3F0PA 4NA9H 4CRCA 5A8ZA 4X2XA 3GDSA 5T6FA 1IQJA 5HGGA 3GY8A 5BRRE 2W3KA 1L1NA 4UONA 1EOLA 1SBWA 3PMBB 3STJA 2P59A 1YPEH 4NIXA 2J94A 1O3JA 1MKXH 2SNVA 1XUHA 1SQTA 3SGBE 2BDBA 5EJZA 3RXQA 3SV6A 3KCGH 2F9OA 1P2NA 1HAVB 1QCPA 3RXJA 3GYMA 4DGJA 1BMNH 1ANDA 1TIOA 4I8LA 1NBMD 2B9LA 5B6LA 4U32A 5C3NA 2FTLE 5EIYA 1CT2E 3VXEH 3ODFA 3QGNB 2WPMS 1M9UA 1S84A 2BLQA 4FUBA 1EATA 1GJAB 2BZAA 1OWJA 2TPIZ 3RXVA 4Y7AA 1TNGA 2G4UA 1SLWB 1NY22 4BAOB 4H4FA 2AHME 2ZNKH 1GBDA 2QY0B 3HK3B 3PYHA 3R3GB 4MPXA 1O2TA 1C5PA 1YWUA 2WYJA 3FP6E 1GG6B 5E8EH 1OKXA 2ALVA 5IYTA 1C2DA 4MVNA 3ITIA 4KGAA 2B7DH 3RXBA 4JYVH 1O3DA 1LVOA 1S6HA 3V0XA 3JZ2B 4AG2A 4Z1MD 2BXTH 4FVDA 2AGGX 2WYGA 1G3EA 2FM2A 1V2LT 2GCTB 3ZZ8A 1Z6EA 4ABIA 4JYTA 1F0RA 4X1SU 1L2EA 4JMYA 3FP8E 1NFYA 1E1QD 1JIRA 2J98B 1P12E 1HCGA 1NESE 1TYNA 2XNDD 4HGCA 3FOAA 4UFFH 3UIRA 4B76A 3KQCA 1UMAH 1QA0A 5GIBA 3SQEE 2SGQE 1GJDB 3TU7H 5HMAA 3E1XB 4NGAH 3AASA 3UR6A 1W10U 4TPIZ 2FI3E 1YYY1 3T2NA 5C0TA 2D8WA 1A0JA 2G00A 5K7RA 4UFGH 2OC8A 1AI8H 3FFGA 2BOHB 5T6GA 2ZG0H 4ISIH 1WU1A 1AVGH 1HIAA 1ZYOA 1GBMA 3BV9B 2QF3A 1JIMA 1GBHA 1F0SA 1ARBA 8GCHG 2BLWA 3TH4H 4TT3D 4B2BA 4WH6A 2PHBA 5A09A 2Z9LA 2ANYA 1TGBA 1NFXA 1ZPCA 4AGJA 1O34A 1SQOA 4GLYA 4AORA 1NM6A
chains in the Genus database with same CATH topology
3T29A 4E06H 1G3BA 3TGJE 1S0RA 1LTOA 3LOXA 1BTYA 3ATKA 1VJ9U 3GCNA 4BOHA 4B75A 2QIQA 1HRTH 2BQWB 5GPIB 1KXAA 2BVSH 4IW4E 1GI5A 2F91A 2EEKA 3UFAA 4LZ4B 1ELVA 2BZ6H 4FUGA 1GHVH 2FODA 1TONA 2R9PA 3SNAA 4WH8A 1YPHC 1Y5AT 2HPQH 2QN5T 1O3GA 1YPKH 1L1GA 1HAIH 1O5FH 2ZTYA 1ZPBA 1KSNA 2BD9A 2P3UB 1QL9A 3ZVFA 5C2ZA 2AGIX 1ZMLA 4BNRA 2ILNA 2XBXA 4XOJA 1O5GH 1JMOH 1TNJA 1UVSH 2XBWA 5EG4A 1MCVA 3PMHB 3RU4D 2JH5D 1FQ3A 3SV2H 2ZF0H 5EQRA 1SB1H 1CA0C 2GZ9A 1C5ZB 1UJ1A 4TPYA 2R3YA 2IOTA 4NIVA 1GI0A 2UWOA 6LPRA 1MU8B 1HXFH 1EAIA 3DUXH 1QNJA 4WMFA 4BAQB 2A31A 1TFXA 1W3CA 1DICA 2C4FH 1V2WT 1MZDA 1O2NA 1SHHB 3BTEE 4AB9A 2PKAA 2VIVA 3RP2A 3LC5A 2A5KA 3RXGA 2SGPE 2D1JA 1EPTB 3K65B 1BBRK 3VGCC 4X8VH 1Z1JA 3RC5A 1GDUA 1VCPA 1ZSJA 1YBWA 1P10A 4A6LA 1TX6A 3SJ9A 1XVOA 1ANEA 1O2HA 3MOCA 2H9EH 3EE0B 3TNTA 1MU6B 1YPJH 2FESH 3RC4A 1O2VA 1V2ST 2C3SA 1AE5A 4Q7YA 2FI5E 4JK5A 4K60A 3BG8A 2G5NA 2VWOA 3W95A 1QB1A 1GGDC 1O35A 1O5DH 2XC5A 3N7OA 3RXCA 2WV4A 4R0IA 1MKWH 1QJ1B 3U8TH 5FCKA 1L0ZA 3LJJA 3BTME 4AFQA 1VZQH 1OPHB 1OP8A 3BEIB 3QO6A 3S7HB 3E8LA 2DUCA 3ZZCA 5JBAS 2A5IA 3WY8A 1Z1IA 3A83A 1JBUH 2ZHEH 4CRDA 1TLDA 2ZPSA 3BTKE 2BD3A 2H9TH 1GBTA 1TPPA 1UVOA 1UTKA 2Y6TA 1Z8RA 4ZMAH 3I29A 2C93B 4Y11E 5H4IB 2AEIH 1BZXE 1XMNB 2W5EA 1DSTA 5DG6A 2Z3CA 4MG3A 2FP7B 1HNEE 4ABHA 1ESBA 1NFUA 1CT0E 4X2YA 1DFPA 1O5EH 2A32A 3ZVDA 1CBWC 2SGEE 1CHOF 2FYRA 1DXPA 1TA2A 2W3IA 1TNLA 3STIA 4I8JA 1QL8A 5F03A 4Y71A 3SUDA 4X6NA 4IGDA 4CBOA 1K22H 1L4ZA 2TRMA 3A84A 1BRCE 4CHAB 1EX3A 2Z9IA 1SHYA 3GY5A 1IHSH 1ESAA 1ZRKA 4ASHA 3VFEA 4B2CA 1C5YB 1Z8JB 3F1SB 2ZPQA 2BLOA 1D9IA 1RXPA 2Z3EA 2EI7A 1TBRH 4KP0A 3SZNA 1GBKA 1G3DA 2CN0H 2ZP0H 3AAUA 1J8AA 1BUIA 3RXTA 2VVCA 3AAVA 1DWDH 1ELDE 5AHGH 4I31A 1K9OE 5GXPA 3TITA 1K1OA 2ODYB 5C1YA 6CHAC 1AGJA 4D7FA 1KTTB 4X8SH 1PPHE 1BA8B 4AGKA 1W7GH 3RM2H 1BB0B 5ABWA 1UK4A 2FXRA 1UTNA 3HATH 3UUZA 1XUGA 4ABGA 1QTFA 1IQEA 5DP3A 1ELAA 1O3MA 1P9SA 3K2UA 1EJNA 2FOHA 2HWLB 1GMCF 3RXMA 1EB1H 1Y8TA 1V2JT 2BD5A 1KIGH 1FAKH 4XE4A 2GVFA 2Y82A 1K1MA 3TVJB 2HRVA 1JXPA 4NWLA 5C1UA 2OBQA 2PW8H 2R2WU 4K5ZA 1MZAA 4YLUA 3SU6A 1OWKA 1W0YH 2OXSA 3ESTA 4KTSA 1O5AB 4NG9H 3H7TA 6GCHG 4FUEA 4ABJA 3IG6B 1GHAF 4NIYA 4ZH8A 2PLXA 2BM2A 5A8YA 2QYIA 2A7HA 3ZZAA 3A85A 4NFEA 3M37A 4Y8YA 2XTTB 2HNTF 2KAIB 1BITA 4VGCB 5LPRA 3EQ0H 2H1UA 3ODDA 4OS1A 5E0HA 1DWEH 2OQ5A 1GJ4H 3BEUA 2VWLA 3PTNA 1IQHA 1HFDA 1DLKB 1A5HA 1YP9A 1PYTC 3E16B 4SGBE 5GJ4B 2FMJA 3TK9A 1QQUA 3GCHC 3VPKA 3P6ZB 1SGYE 1Y5BT 3QK1A 1OWDA 1ZPZA 1ETTH 1DUEA 1T4VH 1T8MA 4AB8A 1QIXB 1EB2A 1LKBA 2A4RA 2F9BH 4AZ2B 4E7RG 4O3UA 2W7SA 1FMGA 2FZZA 1LCYA 2UWPA 1AFQC 1X7AC 1DUAA 1MUEB 5FBEA 5I46H 4J1YA 3TK5A 4YESB 1XVMA 1BTUA 4O9VA 2ZZUH 3ZV9A 1VITF 2H5CA 2CXVA 3MMGA 2P94A 4TWYA 3A7YA 1GBLA 2UWLA 1DSUA 3GICB 2ZQ2A 1GJCB 3P8GA 1C1WH 5LPEA 2ZPRA 1C1OA 1S82A 3BSQA 1SGFA 1OP2A 1Y59T 1GI9B 2I6SA 2GD4B 1KXDA 4WJG2 4FUFA 2FYQA 1C5LH 3S69A 1GHWH 1O36A 3L6PA 4H6SB 3BTTE 1DM4B 2BQ7B 1ZTLA 5EW1H 1T7CA 2B8OH 1BRBE 1W7XH 1GCTC 1OX1A 1A4WH 4YT6H 5E2PA 2ZFRH 4XDEA 1AD8H 1GBCA 1YC0A 1IQGA 4NCYA 5JDUB 1KYNA 3V3MA 3MU1A 1C5UA 1Z7KA 1SLVB 4ISOA 3TNSA 2P95A 2BDCA 3ZVAA 3ENSB 1H9LB 3SU3A 1C4Y2 1JRSA 2V3HH 2P93A 1BRUP 1SSXA 1MAXA 5F8TA 1QRZA 1P8VC 5ESBA 1O3EA 3EA9A 3KIDU 1NTPA 4NIWA 1CHOG 5LPFA 2J2UA 2GDDA 3FVFB 2OP9A 1C5WB 3RXRA 1UHBB 4ZAEA 1KXBA 4AN7A 3AVZA 3UWJH 3T27A 1TX8A 1MTNC 3UNSA 1XUIA 2Y7ZA 1Q3XA 4CBNA 2QXIA 4AFSA 1MKXK 1QJ6B 1WUNH 2FOAA 3EGKH 3MU0A 3QN7A 1QB9A 1UVPA 1YPLH 2WPIS 2V6NA 5E0GA 5HM9A 3NWUA 1V2RT 3RUOA 4GHTA 2UUJB 1XXFA 5HXFA 1P03A 5PTPA 1CA0B 3UPEA 2GZ8A 2WPHS 3A8BA 9LPRA 2ZWLH 1C5QA 2VU8E 3IWMA 1UO6A 4UFEH 2ALPA 1SLXB 1S83A 2H5DA 3GY6A 2LPRA 4WMEA 1DWCH 3UOPA 1D6RA 1HAYB 1QJ7B 2HVXA 3BTFE 3Q76A 1GMCG 2BDAA 4CR9A 4Y0YE 1QRWA 1BIOA 4ZHAA 1D3QB 5EODA 3VGCB 1KY9A 3QWCH 2O8LA 2WUBA 1WSSH 3B9FH 2OINA 1QB6A 3BG4C 3LDXH 1LO6A 1NRSH 3MFJA 7LPRA 2IPHA 1GHAG 1HBTH 2D2DA 1A46H 3KQEA 4GUXA 1K1JA 2FIRH 1MD8A 4A5TS 1TGTA 3DA9B 3MWIU 4WWYA 1W11U 1RIWC 3E90B 4NFFA 5FX6A 4DURA 4FUHA 2QXHA 1P2JA 1ZTJA 1GGDB 1O2LA 2ZGXH 1XUKA 1JOUB 1DS2E 2XBVA 2ANWA 1UCYH 1IQNA 3VB6A 1EASA 4GSOA 1C2LA 1GDQA 1GVZA 4IMQA 1PYTD 3L3TA 3BTQE 3ZV8A 3E91A 1C1NA 4AYYB 5AVDA 3TGIE 3IITA 1GL0E 4VGCC 1LVBA 2ZU5A 2ESTE 1UVTH 4DIIH 4BXWA 1AUTC 5FAHA 3B23B 2PGQB 2BD7A 1EKBB 4ABFA 2V3OH 2VWNA 1RTLA 1A0LA 3LGUA 2Q6GA 1O3LA 2GV6A 1RFNA 2GTBA 4XBCA 1BMLA 1GHXH 4DW2U 1LHFH 1SL3A 3NXPA 1HAVA 3D65E 2THFB 4IS5A 3OY5U 1P2OA 1CBWB 1Y3XA 2FOBA 1O38A 3RLWH 3A8DA 1KXEA 3Q3KA 5DPAA 2J95A 1ZLRA 1O3IA 1G2MA 3DFLA 3SW2B 1Y3WA 4FVBA 4U2WA 1ELEE 4NWKA 1O37A 3NKKA 4AFUA 5DK1A 1W12U 5HYOA 1TE0A 3GY2A 1SPJA 5DP9A 1UVUH 1BCUH 1O3OA 1DITH 1C5OH 2PSXA 2BQ6B 2Y5GA 1HIAB 1WBGB 3PLBA 2QC2A 2O9QA 1FI8A 1C2HA 3F9FA 3T25A 2A4OA 1FXYA 4B73A 4MNWA 2ZFTA 5LGOA 1TRMA 1O3NA 3A7ZA 4ZROA 1BBRE 4FUIA 3SV8A 4I33A 5FXLA 1MTWA 4Q80A 4BTIB 1NO9H 3KGPA 3U8OH 1CVWH 3LGTA 2D26C 6CHAB 4LOYH 4K69A 2XBYA 5C5NA 4HI3A 3DHKH 1ZZZA 4UE7H 1E36B 3ZYEA 1LQDB 1DDJA 5EXLA 4YT7H 1BMAA 1SI5H 3TH3H 2XCFA 2G55A 4WXIA 2BYAX 1O5BB 3RDZA 2ZDKA 1QY6A 4YM9A 1C2KA 4IMZA 2BD8A 3LGIA 1ZJDA 2A2XH 2UUKB 3Q3YA 5EXMA 1TMUH 1H8DH 2GMTC 2R0LA 5F8ZA 4OS2A 3RMNH 1IAUA 4Y7BA 3E0PB 1GI2A 1CO7E 1HYLA 2C8WB 2QGRA 1GMDF 4B2AA 1HJ9A 3H7OA 2YNAA 2ZEBA 3P8OA 1XUJA 3E0NB 3NUMA 3RLYH 3RXAA 1MQ5A 3FP7E 2OBOA 1J9CH 2BY5X 1VITH 3DD2H 1CGIE 3SN8A 2PSYA 3RU4T 1Z8IB 2TIOA 1O2IA 1EUFA 1WQSA 4RSPA 1AE8H 1V2UT 3P8NA 3SO3A 3Q77A 3ZZ3A 1K2I1 1GJ9B 1VGCC 4Q7ZA 1L1JA 2A4QA 1AKSA 3GCHB 3VB5A 1MKWK 1G2LA 3ZYDA 1H1BA 4MPWA 1C2EA 3T62A 4GCHF 1FY4A 2ZTZA 1MBMA 2PKAB 2A7JA 4B71A 4IN1A 2FOMB 2ZU4A 2Z9KA 1AFQB 1EZUC 2FDAA 3M7QA 4DJZB 1MH0A 1CQQA 2STBE 1D3DB 2PUQH 3UNRA 2ZGJA 2FO9A 1CGJE 2FTMA 4Y8ZA 1THSH 2Z3DA 1PQ5A 2EA3A 4Q2KA 2VIOA 1F7ZA 4INKA 4ABAA 4Q7XA 2RA3A 2A5AA 1WQVH 3KF2A 1U6QA 2SGAA 1QHRB 1FY8E 1GCDA 4HZHA 3QLPH 1TNIA 1IQIA 1ARCA 1TB6H 1EJMA 3SBKA 2PFEA 1C2GA 4Z0KA 1PFXC 1IHTH 1P02A 1ELTA 2XC0A 3ZZBA 4BAMB 2QV1A 1GCTB 2R2MB 1P09A 3PLKA 3UQOA 3SHCH 5A2MH 1ZGVA 1NROH 5C20A 1DY8A 4YOIA 3NZIA 1PQ8A 1TQ7B 3S9CA 4WY3A 1P11E 1QGFA 3CENA 1E34B 4LXBH 4OS5A 1UTPA 1SGPE 3ATIA 1O2KA 3ZVCA 2PTNA 4BAHB 4E7NA 1VJAU 1G32B 2AS9A 3NCLA 1OWEA 5B6OA 4IC6A 3SQHE 1QURH 1XUFA 2BDYA 4SGAE 2QXGA 5K0HA 2BX3A 4XBDA 3M36A 1P2QA 3D49H 5T6DA 2BDGA 5JBTA 4I7YH 1A2CH 2RCEA 3GY4A 3M5NA 3M5OA 1NS3A 1TGSZ 1LHCH 2YOLA 4RKJB 5J4QA 1FY1A 1FV9A 1G9IE 1MTNB 1ZSKA 3I77A 4OGYA 8LPRA 1S5SA 2C90B 3G01A 2SNWA 4YTAA 1YKTA 1SGDE 2Y5HA 4X0WU 4U30A 2TGDA 1SR5C 4IN2A 2EI8A 3K6YA 2F9VA 4Y8XA 1HPGA 4Y0ZE 3DFJA 4CRGA 3A86A 3A7XA 3SGAE 4ZKNU 4OS6A 4PROA 1THRH 1WTGH 1YGCH 2ZCKP 1V2KT 3AW0A 4ISNA 4CR5A 3MI4A 2RDLA 1EJAA 1F0UA 1FLEE 3VEQB 3S9BA 1NFWA 2HGTH 5L2ZH 3UY9A 1WAYB 2AIPA 3RM0H 4OS7A 3EDXB 4CRBA 1G37A 5EQQA 2XXLA 1GMHF 2PKSC 1ZSLA 2BOKA 4NA8A 5JB9S 2A7CA 3SU2A 4HTCH 3ZZ6A 2Y5FA 1O3AA 3SI3H 1SQAA 9ESTA 3BIVH 1D3TB 3SJIA 2CF9H 1BTZA 3SJKA 5LH8A 1NU7B 3BG4B 1N6YA 1DLEA 1P3CA 4ABDA 1TRNA 1JWTA 2P8OC 4ESTE 1T32A 4IBLH 5TJXA 3LH1A 1K1LA 1F5LA 1O2ZA 2PUXB 2ZGBH 3RU4E 2ZDVH 5JPMH 3OY6U 3E6PH 1IQMA 1LQEA 1RIWB 2WUCA 3BTHE 5EU8A 2TBSA 2ZFQH 5CHAC 2FLBH 1O3HA 3F9EA 1AWHB 3R0FA 1KDQB 1MQ6A 5CE1A 2ZI2H 4JZ1A 4F49A 1ANCA 2GT8A 4DCDA 2ULLA 3KHVA 1GJ7B 3CS7A 4ZHLU 3A82A 2Y7XA 1T4UH 2VIQA 4GHQA 3TJVA 4YOGA 2HOBA 1ORFA 4JZIA 4YO9A 3OSYA 4GCHG 1WV7H 1AWFH 1RJXB 3LKWA 4ABEA 1O2RA 2O8MA 4TY7A 4FU7A 1ZTKA 1TA6A 1GDNA 3U1IB 3OYPA 1EAWA 3SV9A 2CJIA 2F83A 2VINA 5F8XA 5GCHF 1O2PA 4CREA 1AN1E 3HKJB 4YZUA 1DE7H 2XNIA 3O8RA 1MTSA 2RG3A 5L30H 4X1NU 4YLQH 1ZJKA 1DOJA 1Z6JH 2Z94A 2P16A 3QGJA 1UTOA 2KAIA 2FEQH 3BN9A 5GDSH 4I8GA 3JZ1B 3PO1C 1E0FD 2J4IA 2F9PA 1BMMH 1NU9A 3UWIA 2H6MA 3SU1A 1AHTH 3U98H 4TYDA 3U8RH 1AZZA 2ASUB 2GV7A 2G4TA 1P2IA 5ETXA 1SGRE 3S9AA 2J92A 2ZDMA 5IDKA 2G52A 5A0BA 1N6XA 1PPFE 2VH6A 1QA7A 3SNDA 1GBBA 1YM0A 3A80A 3SU5A 2F9NA 1H9IE 3LT3A 5HM2A 1YF4A 4I32A 5DP5A 4DIHH 1ETRH