2VIOA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vioA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vioA01
4OS7A 1FZZA 2ESTE 2ZFRH 4INKA 3PMJA 3ENSB 1UVSH 1C5NH 3A86A 1UTLM 4X6NA 1F5KU 2I6SA 1HAHH 5E0JA 1PPBH 4IMZA 1GBKA 4TWWA 1TBQH 4TY6A 1THPB 3P70B 1SGPE 1DS2E 3FP6E 3RXRA 1LQEA 4Z0KA 4LZ4B 2XBXA 5C1YA 3AASA 3D65E 1C9PA 1CT0E 1GBTA 3VPKA 1TRYA 3OX7U 1GHAF 1O3DA 1XKAC 4XOJA 2HNTF 4CH2B 1BMLA 2FLRH 3KQCA 1RFNA 3UUZA 1TOMH 1YPHC 1AUJA 1G3DA 1MTVA 1TPPA 2F3CE 5TCCA 3ZV9A 2G4UA 4IW4E 1GHZA 2O8UA 3KEEA 3U69H 4UEHH 3SUEA 2BDHA 2OC1A 1Z1JA 4ISHH 1O3CA 1EZUC 4QT8C 1TRMA 8LPRA 3IG6B 1ETTH 5J4SA 3V12A 1Z71A 2ANWA 1NN6A 1AB9C 2ZHFH 1WTGH 4J2YB 1DDJA 1PPHE 4NA8A 2A4GA 7GCHF 4CBNA 1AHTH 3PYHA 2QIQA 1QGFA 3BG8A 3ZZAA 5DP5A 4FUHA 1O2KA 1AD8H 1QJ6B 2SGFE 1J8AA 3MI4A 4FUJA 3U8RH 4ISIH 5F03A 5BPEA 4GAWA 4X1QU 4AFZA 3FZZA 1HRTH 4AFUA 1C2MA 1HPGA 1QNJA 1HJ8A 1GI4A 3KNXA 1Y59T 4A6LA 2QGRA 1BIOA 1ZMJA 1TA2A 2P95A 1C5RA 2KAIB 1L1GA 3VGCB 1E37B 2AMQA 1ARCA 2HGTH 3A80A 4NCYA 5EODA 1SQAA 3V7TA 4NZLA 2GT8A 1FY8E 1Q2WA 3TJVA 3QWCH 1VGCC 4OS6A 1LVYA 1BBRE 4UE7H 1QA7A 2GZ9A 1O36A 1IQFA 4NA7A 3RXDA 3LPRA 1C5TA 1V2NT 2VWLA 2RA3A 3AW1A 5PTPA 1O3JA 4YLUA 3TH4H 3A8DA 2M5TA 3B23B 3AVZA 5AF9H 1CGIE 1N1LA 3O8RA 3GY8A 3HGNA 4B76A 1IHSH 3BTME 1O3IA 4K69A 4INHA 2CMYA 2ZO3H 1GBBA 4BTUB 1O2PA 1P01A 2V3HH 1CHGA 4MNXA 3A87A 3URCA 1GGDC 4GCHG 1F7ZA 1P2KA 1GI6A 2ZP0H 3LONA 2EI8A 1Z8IB 1YP9A 1P05A 2A4QA 3ZZBA 2AGIX 1A7SA 2Y5HA 1P2MA 1NTPA 4ZHLU 3BEFB 1NROH 4WMEA 2FLBH 1FV9A 2W3IA 1F0TA 1EB1H 1MU6B 1H1BA 1D3DB 2VU8E 2WPKS 3SHCH 1C1WH 4Y0ZE 1ETRH 1AFQB 1DXWA 1P12E 1AKSB 1H9IE 2ZGXH 1SQOA 1DLKB 4SGAE 3VB7A 1ANEA 1YPEH 2BDBA 5F8TA 1P06A 4TY7A 1OP2A 4KTCA 4Y79A 3SU3A 3W94A 1SQTA 1AVXA 1BRBE 1UCYH 3RU4D 1O3EA 4AX9H 5B6OA 1DITH 1ZPCA 4CHAC 3E16B 1HJAC 1QB9A 3S7KB 2G4TA 1S82A 1Y8TA 3VB6A 1MMJN 3BN9A 2OP9A 2B9LA 1L1NA 1GI3A 2GV6A 2A7JA 3ATLA 3SNAA 3Q3KA 3RXSA 1D3TB 1HFDA 2BX4A 4DY7B 3A7VA 1AIXH 1QBVH 3FP7E 1SFIA 1AN1E 5JYIA 3RM2H 5G4BA 1PFXC 2GMTC 1KIGH 1UMAH 2JH5D 3LGYA 5E0GA 3KHVA 3LDXH 1ELAA 1LCYA 1GVZA 5ESTE 1ESTA 3SI3H 1V3XA 5HYOA 1WOFA 3M61U 3GY4A 1A5GH 1DY9A 1HAZB 1EUFA 2J38A 1O2NA 6GCHG 4Y0YE 1SBWA 3SQHE 2YOLA 4MTBA 1VZQH 2JETC 2PKAA 3SGQE 3RXEA 3ZVDA 2Z94A 5FHTA 2ALVA 2G81E 4U2WA 1UTQA 2CHAC 3ZZ9A 1OOKB 1Y5UT 8GCHF 1PPGE 2R0LA 1C2HA 2GP9B 2FOBA 2BLVA 3GCNA 2R0KA 3MNCA 5FX6A 2QA9E 2YNAA 1P2OA 1C2FA 2P93A 4YTAA 1F2SE 1Y5BT 2O9QA 1BCUH 2PLXA 1ZOMA 1C5UA 4AOQA 2PKSC 1GBLA 4I33A 2GDDA 1FN6A 3ESTA 2TIOA 3M37A 3HATH 5A0CA 2AH4X 2OXSA 4XFQA 1Z6JH 2H1UA 2P3UB 1XMNB 1TYNA 1EZXC 3AAUA 1GJAB 1WV7H 2HVXA 4KTUA 3SV7A 2WYJA 2Q6GA 1QRXA 5EQSA 4NZQA 2Y7XA 2VWNA 2FP7B 2WPMS 2VINA 1M9UA 6CHAC 3LGUA 1GI9B 3E3TA 4JZIA 5A0AE 1AE8H 3D23A 4HTCH 1TBZH 3GCOA 1C1OA 1SGRE 1C5QA 1RRKA 3TGKE 3SNEA 4XE4A 2H9TH 4E7NA 3RC4A 1C2LA 1G3CA 3KN2A 1LMWB 1ESAA 2P3TB 3SGAE 1O2LA 1S6HA 2SNVA 4TPIZ 1GL0E 1UVUH 1QJ1B 1B0EA 2PR3A 3U1JB 1XKBC 2CXVA 2WPJS 4Y6DA 1DXPA 3KQEA 5T6GA 3H5CB 1ELEE 1YPMH 1O34A 3BTDE 2J4IA 4O3TA 5L2YH 3A89A 1AZZA 2C8YB 1GDNA 1PPFE 2WPLS 2Z3CA 3A85A 2BXUH 3F9FA 5EXLA 2J34A 2BDAA 3F6UH 1GBCA 1UCYK 3TK6A 3EYDA 4BAKB 4MNVA 2ANMH 2BD2A 3M3VA 2A45B 1ELGA 1Q3XA 3P8NA 4U30A 5GCHF 1HDTH 3FZDA 1J15A 4I8GA 1KXEA 3ZZ6A 1GI2A 4LXBH 1YPLH 3MH7A 1KTTB 1C5OH 5A09A 1MQ5A 2BZAA 1OWJA 4NIVA 1BRAA 3PMAB 1TRNA 3HK6B 1GBEA 1O5CB 1BMNH 5GCHG 2QC2A 2WINI 2EI7A 4NA9H 2JH0D 1FPHH 4RKOB 2BVXH 1N6XA 1CBWB 1NPMA 1W8BH 5HM2A 1W2KH 2ZPSA 1PQ7A 1C5SA 1TX6A 2VIWA 1O35A 1W7XH 3TPIZ 1TGBA 3BTFE 1Z6EA 1CHOF 3VGCC 1W3CA 1XXDA 2FOFA 3BTTE 2BQ7B 2GCHF 2V0BA 1LVBA 1O2RA 3FAOA 2ASUB 1GJCB 1BITA 3LGTA 3GCTF 2ZTZA 4B73A 3UOPA 1UTMA 5CHAB 1C5YB 3LJJA 1WBGB 3T28A 1UHBA 1C1NA 4TWYA 3RC6A 3LKWA 4YZUA 2CGAA 4U32A 1W11U 3M7TA 4AYVB 4AGKA 1NRRH 2ZTXA 5C1XA 3S9AA 3A7ZA 1RIWB 1HAXB 1O3GA 4AB8A 1G30B 2OCVB 5FPSA 3M5NA 5FAHA 1GJ8B 3U8OH 4OS1A 1MUEB 1QR3E 4NIXA 3GY3A 2C93B 4I7YH 2OLGA 1W12U 3HKJB 5AHGH 2ZGCA 1O2GH 2WUCA 3W95A 2ZU1A 3ZVBA 1S83A 2HWLB 1ZSJA 4JCNA 5FXLA 4ZAEA 3RXMA 4GSOA 2A31A 2ZFTA 2ZIQH 1HAVA 1KY9A 3M7QA 4KKDA 2J94A 5A2MH 4ABAA 1EX3A 5JB8S 3QGJA 1KTSB 5FBEA 1OYQA 3UOUA 1KDQA 3RXQA 2UWOA 2VB0A 5T6FA 1TGCA 4DT7B 1ABIH 2QXJA 3PROA 1LPGB 1AFQC 2STBE 3A8AA 1LPKB 1QA0A 5HGGA 1EJNA 3SOSA 2O8LA 5EPYA 4U01A 4JMYA 2BDGA 3RLYH 1C4U2 2FI4E 1TMTH 4IC6A 2GZ8A 1PQ8A 2SGPE 3CS7A 2XC0A 2PSYA 1CA0B 2O8TA 1YLCA 1DSUA 1YM0A 4X1PU 2FX4A 1SLWB 1GCDA 1E36B 3RXKA 2SNWA 5E2OA 1GMDF 1NFXA 4FUEA 3C27B 4GHQA 2B5TB 4ISNA 1BRUP 7KMEH 1ZTJA 1QRWA 4D9QA 4KTSA 5IYTA 1P10A 4MNYA 3RMNH 1SC8U 4GPGA 1LHFH 4Y7AA 4B75A 2F91A 2Z3DA 5E8EH 3RP2A 2F9OA 4ABBA 5F8ZA 4GLYA 4TYDA 1THSH 3BSQA 4E06H 1O2UA 5JBCS 1J14A 2BY7X 3TITA 5FPYA 1S5SA 2FPZA 4ZMAH 1TA6A 1UVPA 2UWLA 3UQVA 1AFEH 1BBRH 4X8TH 3ZZ7A 1HJ9A 1V2RT 3T2NA 1HXFH 3D49H 2BY8X 3V0XA 3TNTA 2ZU2A 2A7CA 1GHXH 2AMDA 4ABGA 3M5MA 1H4WA 4K8YA 2PWXA 5E2PA 1Y5AT 1QJ7B 1T8LA 1RXPA 1TAWA 3F9HA 3HGPA 3KQDA 3OTJE 1DX5M 4GHTA 2FXRA 3GY2A 4ZKOU 1C1PA 3TIUA 2DUCA 2WUBA 1XUJA 1O3OA 2OD3B 1GMHG 1ZSLA 1VCQA 3VB4A 1FQ3A 3SGBE 1LHEH 3L33A 3M3SA 4BAOB 1EXFA 4JK5A 4NSYA 2Q1JA 3K2UA 1D4PB 2J92A 3VXEH 5EW2H 5FX5A 4CR5A 4F49A 1A4WH 3VB5A 1IQIA 1OYTH 3UY9A 3OYPA 3V13A 9LPRA 1C1TA 4ABDA 2ANKH 1NY22 1CGHA 1T8NA 2B7DH 2WYGA 1P9SA 1E35B 4JYVH 4ESTE 5DP4A 1O0DH 1Y3XA 3IITA 2ZFQH 4I8JA 3UTUH 1VJAU 1NO9H 1C2EA 1A5IA 1K21H 1K9OE 4UFDH 2TBSA 1O3FA 4AORA 5EW1H 2ZU4A 8ESTE 1ZJDA 3ZZ3A 3K9XB 4B74A 2PGQB 1UK4A 2RG3A 9ESTA 4DCDA 1WAYB 3T26A 2OUAA 1TLDA 4D9RA 3RMMH 1FY4A 3PLPA 4FUIA 1HAGE 2Z9KA 2BLQA 2R2WU 1OP8A 2ZC9H 1UJ1A 2ZDVH 4AB9A 2FOCA 3VFEA 1EP5A 1V2KT 1S6FA 1L2EA 2A5KA 1JMOH 1IQLA 1KXFA 1SHYA 1MTNC 3A7TA 1SGYE 2GTBA 1C1UH 3RM0H 2VNTA 1RD3B 2A5IA 1C5LH 1C5WB 1D3QB 2FM2A 2H6MA 1FIZA 1TIOA 2PUXB 5SGAE 1EZQA 3GDVA 2QAAA 1MTWA 5EXNA 2ZGJA 1RJXB 3STIA 2FYRA 3BTWE 1HAYB 1ZPZA 1XUFA 1YCPH 1QBOA 1BHXF 1IQNA 3ZYDA 1FY1A 3ZZ5A 3A7YA 1BBRK 1YPKH 2PTNA 4J1YA 1CBWC 2TGTA 2KAIA 1SLUB 2BYAX 3GCHB 1AUTC 5EPNA 2G00A 5FCKA 1TNIA 2C4FH 2Y6TA 1ABJH 2GCTB 3UWIA 1G32B 3LH3A 1D6WA 3QGNB 1NRPH 1GJBB 1O3HA 2W5EA 1O5EH 3SJOA 1VJ9U 4DOQA 4K1EA 1W13U 2ILNA 1LVMA 1AWHB 1SGIB 2ZZUH 3S7HB 2BDCA 1K1IA 3ZZ8A 2VIVA 1YPGH 1Y3WA 4WY3A 1OWKA 3E0PB 1LTOA 1A0HB 1P2NA 1TBRH 2VGCB 3RXPA 1EKBB 1GBHA 6ESTA 1B5GH 1MBQA 1BDAA 1OSSA 1DWEH 1C1SA 3Q00A 1Z8GA 5C1UA 1RIWC 1MAXA 1VCPA 4K8BA 2F9BH 2PTCE 1QL8A 3ATWA 3NUMA 1SOTA 3SU6A 4BANB 4UD9H 3P17H 2O8MA 1MQ6A 1G2MA 2BD9A 1F0RA 4GCHF 1BTXA 2XBWA 3PTNA 1THRH 1QY6A 1K1PA 1H8IH 3TNSA 1O33A 3RMOH 4MPVA 4A1XA 5HXFA 5JBAS 1LPZB 1SGEE 5AFZH 1E0FD 1AKSA 2Z6BD 1TNLA 1AI8H 2BD7A 2BHGA 3RC5A 3T27A 1GI5A 1D3PB 1GDQA 2AGGX 4GVUA 4NFFA 4DJZB 1O2SA 4X8VH 1ZYOA 2IOTA 3SU1A 2XBVA 1PPZA 5T6DA 1IQKA 5LPFA 1CA0C 3V3MA 1GHBG 1DPOA 1O2TA 1NZQH 5HMAA 1QQ4A 1VCWA 1KXCA 2FIRH 1ZHMA 4JZEH 4CRDA 1GBJA 2EA3A 1ZGVA 3ATKA 1F0UA 3RXFA 5CE1A 2F9VA 3GDUA 4A5TS 2Z9JA 4AGJA 4JZ1A 5EQRA 2D8WA 3IWMA 3DA9B 1WU1A 4WMDA 1TABE 1YF4A 1TPAE 2Y7ZA 1QHRB 3T29A 3NK8A 3UR9A 2BY5X 5L2ZH 1A61H 4K5ZA 2H9HA 3EE0B 3ZVFA 4CRFA 1ELDE 1F92A 1JIRA 5C20A 2ZGBH 4NWLA 1BHXB 2B8OH 1MCTA 2GGVB 5JB9S 1WQSA 4ABEA 1MU8B 3JZ1B 5AVDA 4R0IA 4YM9A 1XXFA 1FAXA 1NM6A 4RKJB 1Y3YA 6GCHF 3F68H 1DANH 1FY3A 3U1IB 5TCAA 4UFFH 3NKKA 5DPAA 4O03A 3PLBA 5EOKA 3RLWH 1G3EA 5DK1A 1O30A 4ISOA 4Q80A 1ZJKA 2AGEX 1JWTA 1YPJH 4Y11E 3SU2A 2VIPA 1ZTKA 3K65B 5T3HA 1O5BB 3PWBA 1P3EA 1IQMA 4FU8A 1W14U 4K1TA 3S0NA 2PV9B 1MZAA 2JH6D 1UTPA 2ZECA 2XNIA 1MTUA 2VH0A 1QQUA 4A92A 3BTGE 3RXVA 2XCNA 4WVPE 4ZXXH 2BLOA 4B1TA 1O2VA 3GICB 4Y10E 4CREA 1AZ8A 1CGJE 1YGCH 3RXBA 1N8OB 1EPTB 1LHCH 2ODPA 4ABFA 2R3YA 3KL6A 1T8MA 2FOHA 1RGQA 2VJ1A 1TFXA 2A5AA 2J2UA 2V35A 2TGDA 4OS4A 1C5PA 1ZSKA 3SJ9A 5A8ZA 2Y81A 2OBQA 2R9PA 1A1RA 4ZH8A 1QIXB 1V2MT 2ZFFH 4IMQA 3RDZA 3OSYA 2R3UA 1NT1A 2A0QB 3M7UA 1L0ZA 3E6PH 3FFGA 3P8OA 4ZXYH 2VH6A 1DWBH 1O2HA 1PYTC 3ZZ4A 3I78A 1DUAA 1DWDH 2Y5GA 4MPXA 2C8XB 1C5ZB 3CENA 3UREA 3U8TH 4UFGH 4DURA 2XWBI 1OWDA 4JZFH 2H2ZA 1TQ7B 4WJG2 2A4RA 2XBYA 1ELCA 1MAYA 1KYNA 3RXUA 3FP8E 1V6DA 1HYLA 1S0QA 4YESB 3SU0A 1SHHB 1P11E 2ZCHP 1MCVA 4FVBA 4RN6A 1GPZA 1MKXH 3KF2A 4D76A 3QZRA 2P16A 4Q7YA 3KGPA 4XSKU 4YT7H 3QO6A 4FVDA 1GCTB 5EXMA 2FX6A 5GJ4B 3GCHC 4INLA 1BTPA 1TGNA 3Q76A 1F5LA 1OP0A 4AG1A 5L6NH 1TB6H 1A0JA 2CF9H 3E0NB 1C9TA 4X8SH 3PTBA 4NFEA 2EEKA 4GUXA 2O8WA 1C2GA 2W7UA 1GBDA 3BTQE 2NU1E 4FUDA 1O3KA 1FAKH 1JBUH 4X2XA 4DIIH 1RTLA 2QXIA 2WV5A 3MO9A 1E34B 3E90B 2BVSH 2XCFA 2VGCC 2W3KA 1DE7H 3RXIA 4BAHB 2AS9A 3GYLB 4DG4A 1D6RA 1FN8A 3OY5U 4MPWA 2ALPA 1QFKH 2FMJA 5DG6A 2ULLA 5LPEA 2NU0E 3K6ZA 4WWYA 2W26A 2XC5A 3EA7A 3ZZCA 1Y3UA 5DP9A 2C8WB 5E0HA 3ZVCA 1DFPA 3QN7A 1B0FA 1NU7B 2OC8A 1VITG 1CSOE 3MFJA 2SGQE 1W0YH 1O2JA 4LZ1H 4WXVA 2BDYA 1CU1A 2IPHA 1AY6H 1C1VH 1O5AB 3MMGA 3F9GA 1GJ6A 1EZSC 1KXDA 4Y76A 2TPIZ 3BV9B 1O2MA 4IBLH 2BZ6H 1SI5H 1TNHA 2SGAA 1IQEA 3RXJA 3TJNA 3Q3YA 1G36A 2FOMB 3P95A 1PQ5A 4H6SB 3TU7H 3C1KA 1H8DH 3LC5A 2ZF0H 3LC3A 4DIHH 1ARBA 1GBIA 2AYWA 4DW2U 3RU4E 3TGIE 1A46H 1V2PT 1BOQA 2PGBB 1Z8JB 3SV2H 3T5FH 2G8TA 2NU3E 1BTYA 2G5NA 4D7GA 1BUIA 1VGCB 4ASHA 3M36A 1W0ZU 2BB4A 2V3OH 1VR1H 3MHWU 1NU9A 4Y71A 2ZHDA 1YCPM 1SMFE 3F1SB 5FPTA 2HNTC 4I8HA 1FLEE 3M5OA 2GKVE 1UK3A 1V2TT 5A0BA 1UHBB 4CH8B 3OU0A 2ANYA 2F9NA 3TJUA 5ETXA 3ELAH 2ZDMA 1RTFB 4Q7ZA 3BIUH 1SG8B 1BJUA 2ZHEH 4LOYH 1EB2A 1MKXK 3PB1E 1IQHA 3SNBA 1K1JA 1NRNH 2CN0H 4OS5A 4X6MA 1OPHB 3HPTB 3A7WA 3SU4A 1J9CH 3PV4A 1XUHA 4A1VA 1GGDB 1A0LA 1GJ5H 3SUDA 2QF0A 3DUXH 1TWXB 4VGCB 3ZVAA 5BRRE 2FTMA 1ID5H 3MU8A 3PO1B 2QN5T 2UUYA 4MLFB 2HPPH 1SVPA 2Z7FE 2A2XH 2FS8A 2G51A 2BY9X 4KP0A 2ZWLH 5TJXA 1XX9A 3H7OA 4X6PA 3BEUA 1TNKA 2ODYB 3UIRA 2RCEA 3L3TA 3E1XB 4MVNA 3SJIA 1DVAH 4YLQH 3MO3A 1ZR0A 4Z6AH 4UONA 4IGDA 4ZHMU 3BTEE 1F5RA 1G3BA 2ZA5A 1GMHF 1TE0A 3RXAA 4ZUHA 4X2VA 1P0SH 4BNRA 5LH8A 3P92A 3ZYEA 1NRSH 1HIAB 4CHAB 3A82A 5A8XA 1FNIA 3TVJB 1FPCH 4X2YA 1O2IA 3S69A 3A81A 2G55A 5LGOA 2Q6FA 3N7OA 2FYQA 5C5NA 3EQ0H 2GT7A 1ZRBA 1DICA 1EQ9A 1YPHE 4O3UA 3LU9B 2H5DA 3MOCA 3SU5A 1IOEA 1FDPA 1OX1A 2GMTB 1T4VH 4ZROA 4BOHA 2ZDAH 1O31A 1O3NA 1EPTC 4WF8A 3TK5A 6LPRA 3GYMA 1P8VC 1QRZA 3B9FH 1BRCE 2FOAA 3SN8A 3O8CA 5FBIA 3BIVH 1LO6A 3UNRA 3P8GA 3NCLA 5EG4A 1OWIA 1SGNE 1GMCG 1PYTD 2CHAB 2EI6A 4YOGA 4JYTA 4NG9H 4MG3A 1ZRKA 1S84A 5DO4H 4IS5A 1GL1A 2VIOA 1SOZA 4FUBA 2J9NA 2Q6DA 5GIBA 1P2JA 4A7IB 2K1QA 1P04A 1G9IE 3STJA 4RSPA 1J16A 3VB3A 5JDUB 2XRCA 3MYWA 4FU9A 4FXGH 2BVRH 2UWPA 1YLDA 1GBFA 1UK2A 2GDEH 3A83A 5K0HA 2BTCE 2HALA 2ZDLA 1C2IA 1GHWH 3B8JA 1BMAA 1FI8A 2QCYA 1HUTH 1W7GH 1L4DA 1SPJA 2BXTH 3RUOA 1GVKB 3URDA 6CHAB 3I29A 2XTTB 2XWAA 3ODDA 3U9AH 4FUFA 1GI7B 3RXCA 3A7XA 2FOGA 2VVVA 3SZNA 2CV3A 2A1DB 3EA8A 4ZKSU 1OWHA 4JYUH 4JK6A 1DY8A 3VEQB 1H9LB 4FUCA 2G5VA 2NU4E 1GCTC 4OS2A 2J95A 4YOJA 1BA8B 1TQ0B 3GY5A 4HGCA 3Q3XA 3R0FA 1AGJA 3S9BA 1AWFH 1GJ4H 2SFAA 1HLTH 5DP8A 3NWUA 1V2LT 2ODQA 2AIPA 2ZKSA 1EOJA 1MZDA 4CR9A 1MD7A 1UTJA 2IN2A 1NFWA 3QUMP 1YYY1 3SNDA 1GHAG 4WH6A 3KCGH 1F0SA 1SGFA 2QV1A 2ZNKH 4WMFA 4BAQB 5GWZA 1SSXA 2TGAA 1LDTT 3HKIB 3O8BA 4K2YA 1IHTH 3NXPA 2GZ7A 3UWJH 3TLOA 4MDSA 1U6QA 5ESBA 2AEIH 2BDIA 3QTOH 5ABWA 1C1QA 3WY8A 1V2JT 1NESE 2HRVA 4NIYA 1GI8B 2HOBA 2XYAA 1ZTLA 4BTTB 5CHAC 1NC6A 1RTKA 1A3BH 3VXFH 3QDZB 1D9IA 1HB0B 3SV6A 3BG4B 4MNWA 1BT7A 1B7XB 4BTIB 3QZQA 5C5OA 2ZGHA 2PHBA 4O9VA 3MO6A 7GCHG 1LKBA 2B0FA 3D62A 1SLVB 2BQWB 4OGXA 5DGJA 5J4QA 3MH4A 4M7GA 3EDXB 3TH3H 3MH6A 4ZHAA 3CS0A 2SGDE 1O32A 1JRTA 2HLCA 3SHAH 3DHKH 3GISB 1BTUA 1DLEA 3SV8A 1GG6B 1O5DH 1XVMA 1HV7A 7LPRA 1EOLA 3PWCA 2A2QH 4D8NA 2D1JA 2Y82A 4UFEH 1GHBF 4ABHA 1ZMLA 5JBTA 2VWOA 1JIMA 2ZDKA 1O3MA 2LPRA 1P2QA 5FCRA 1KLJH 3MU5A 1C4V2 1G2LA 2YNBA 2P94A 5DJ7A 1V2VT 1L1JA 1W10U 2PW8H 1SFQB 2BLWA 2ZEBA 3PLKA 3LJOA 3PMHB 1SGTA 5HM9A 1K1LA 1Z7KA 2XC4A 4OGYA 2Z9IA 3QX5H 1UVTH 1TOCB 3GOVB 3LOXA 4VGCC 5C67A 1CT2E 1CO7E 3PO1C 1HAPH 3SUFA 4CBOA 1BZXE 1ZHPA 1ETSH 2AIQA 4X1NU 4I8LA 5CMXH 1INCA 4IC5A 3NZIA 2QXHA 2ZU5A 1YCPK 1P09A 2AFQB 1T4UH 2TGPZ 2IJOB 1GJDB 1TX8A 1ELFA 3LT3A 1MTSA 1QL9A 1G37A 1K28D 1A5HA 1PPCE 1ESBA 1O3BA 1KXBA 3ODFA 3FANA 3UR6A 1TONA 1NFUA 1GI0A 1K22H 1XM1A 2BD5A 1ZHRA 1BJVA 2FZZA 4LK4A 4B2BA 2ZCKP 3ZVEA 1K1OA 3SO3A 5EU8A 1EP6A 3PMBB 1AVGH 1O2QA 4CRAA 3KQBA 2AMPA 1DT2A 1O39A 2BOHB 3ZV8A 2VWMA 1WSSH 2DE8A 1K1NA 3ITIA 2HPQH 1ANBA 1YBWA 4K3JA 4WH8A 1WCZA 2ZHWH 1A2CH 1S85A 2H9EH 4ZKRU 1EASA 2BM2A 2OQ5A 5JPMH 4Y7BA 1ELTA 1YC0A 1EPTA 2BMGB 4AZ2B 5LPRA 1K2I1 4NGAH 3BF6H 3RXOA 2Y80A 2Z3EA 3O8DA 1C2DA 1P3CA 4WXIA 1DOJA 4AYYB 3RXGA 1AQ7A 1IQGA 2FODA 1T8OA 1C2JA 3EA9A 1FUJA 2AERH 1T31A 1O38A 1C4Y2 1T7CA 4FUGA 3MNXA 3K6YA 4ZKNU 2FI5E 2W7SA 3ZVGA 2LNCA 1JXPA 1P57B 2C90B 5DKMA 1TGSZ 2RA0A 3RU4T 3P8FA 2STAE 3A88A 1RS0A 2NWNA 1O2YA 2ZQ2A 1AVWA 3RMLH 1GJ7B 1OXGA 3M35A 2OINA 3QLPH 1P9UA 1FXYA 1O2OA 2F9UA 2FI3E 2NU2E 3MNBA 1EAIA 4R8TB 3SNCA 5GXPA 3A8CA 8GCHG 2DE9A 4Y8YA 1IQJA 1V2WT 4Q7XA 4X1SU 3DT0H 2FOEA 2PKAB 1FY5A 3RXTA 3SORA 1S81A 2ZTYA 1WYKA 3G01A 1CA8B 1TGTA 2PUQH 4MPUA 1SL3A 4BXWA 1GI1A 1E38B 2D26C 3GY7A 3E8LA 3S9CA 1AE5A 1DSTA 3CP7A 1ANCA 1TPSA 2EC9H 1YKTA 5JBBS 4IN1A 4XDEA 1PJPA 2BD3A 3A84A 2C8ZB 2P8OB 1NRQH 1LVOA 4XBBA 3LH1A 1TNGA 4Q2KA 1O2ZA 1UTNA 3TJOA 4AG2A 1A3EH 5IDKA 1XVOA 4B71A 1Z1IA 2ZPQA 3M3TA 4ABIA 3Q77A 1SB1H 1GHVH 1V2UT 1LKAA 3NPSA 1CVWH 1KLIH 1NFYA 3BTHE 3LIWA 2G52A 2JKHA 2I6QA 1QTFA 1HGTH 5I46H 2D2DA 1O3PB 3EAJA 3A8BA 5I25A 1GDUA 4AFSA 1DUEA 2SGEE 4DGJA 2WPIS 3FVFB 4X0WU 2F9PA 4HI3A 1HAOH 1KXAA 2GCTC 1TMBH 1MTNB 2Z9LA 4Y8XA 1WUNH 4CRCA 1T32A 3T62A 1AU8A 3AAVA 4B2AA 1QB1A 1QL7A 1O2WA 1SGDE 3I77A 3M5LA 3UNQA 1WQVH 4H42U 5H4IB 1EAUA 3MU0A 2FEQH 1Z8RA 3T25A 2QF3A 2ZCLP 3ATMA 2ZG0H 1TALA 2HNTE 1GBMA 1VITF 5DP3A 3AW0A 5K7RA 1DM4B 1BTHH 2GX4A 2XW9A 3BTKE 1HBTH 7ESTE 4NSVA 1XUKA 2GD4B 2OQUA 1X7AC 3BG4C 3ZZDA 4D7FA 3LGVA 2QY0B 1SGQE 1TMUH 1GVLA 2QXGA 3H7TA 4HFPB 1AB9B 3UQOA 1JOUB 4BAMB 2XXLA 4UDWH 1JRSA 2F83A 3TGJE 1EAWA 1K1MA 1EJMA 2ZPRA 2FS9A 3MNSA 1UCYE 2OTVA 4F4OC 4I32A 3R3GB 1AMHA 1LQDB 2A4OA 1GWAA 1EJAA 4AFQA 3DD2H 1UTOA 1LHDH 4YT6H 1V2QT 4JZDH 4CRBA 5C2ZA 2BX3A 1TX7A 2ZHQH 1GG6C 2OC7A 3QTVH 4E7RG 4K60A 1ZMNA 1AO5A 1C1RA 4MQAA 1UTKA 1MKWH 2RDLA 1NS3A 1WTHD 1CHOG 1BB0B 3U98H 2CJIA 3SV9A 3HK3B 4KGAA 4X6OA 1ELBA 2GCHG 1KLTA 2FTLE 5A8YA 3GDSA 2FDAA 3SW2B 1TNJA 3MH5A 4K1SA 3SI4H 4BXSA 3GCTG 4I31A 1XUIA 4FU7A 1P03A 1SLXB 3LGWA 2R2MB 4X8UH 2TRMA 2P3FH 1BTZA 1BTWA 1KSNA 2ZFPH 1P2IA 1QB6A 3QK1A 1C5MD 1GJ9B 2GV7A 4A1TA 1LHGH 1C5XB 1J17T 4DVAU 3L6PA 2BY6X 3OY6U 2ZU3A 1FMGA 2OC0A 4YOIA 3SBKA 1Y3VA 5EGMA 2BQ6B 5EQQA 1ZPBA 4ISLA 1O3AA 1S0RA 4H4FA 1C2KA 1CT4E 2VVCA 1DWCH 3MU4A 1O5FH 2BOKA 1HNEE 5DP7A 1GBAA 2A7HA 4O97A 2Y5FA 8KME2 1L4ZA 2ZQ1A 1QURH 2PSXA 5AFYH 1ORFA 2CF8H 1SGCA 3SUGA 2THFB 3JZ2B 4Y8ZA 2BD4A 2UUJB 1HIAA 4IN2A 4B2CA 1HAVB 2P59A 3MTYA 1ELVA 2FO9A 1FJSA 1KDQB 1N6YA 4TPYA 1V2ST 2V6NA 5C3NA 1GHYH 2VIDA 1EATA 2H5CA 1ZZZA 2BD8A 4AN7A 1ANDA 3GY6A 4E05H 2VVUA 3UNSA 1QBNA 2FWWA 4H6TA 1ZLRA 1UVOA 1CQQA 2ZDNA 1VITH 4PROA 5F8XA 1GMDG 1TPOA 5DP6A 3LGIA 4HZHA 1V2OT 4NWKA 3MWIU 1ACBE 3E91A 1HJAB 4YO9A 2ZFSA 4X2WA 2UUFB 3MU1A 5GDSH 1OKXA 1FONA 4I8KA 2Z9GA 1IAUA 5GPIB 3UPEA 5L30H 3P6ZB 3F9EA 3TH2H 4XBCA 3ATIA 1OS8A 1H9HE 2A32A 2QYIA 2VIQA 3DFJA 4X1RU 3RXHA 1GMCF 4SGBE 3SQEE 1FIWA 1CE5A 1MKWK 4THNH 1N8OC 3SJKA 1QCPA 4XBDA 1SR5C 2FESH 2WV4A 1O3LA 1O37A 2UUKB 3EGKH 3DFLA 1UO6A 5F6MA 1O5GH 4NIWA 1MBMA 2JETB 1P02A 1C1MA 4KELA 1HXEH 1EAXA 3UFAA 3BEIB 1BMMH 2PFEA 1C5VA 2GVFA 1MH0A 3SJ8A 3PM3A 1O2XA 3KIDU 2OBOA 1ZGIA 2C3SA 1XUGA 1HAIH 1Q31A 1BQYA 2WPHS 1OWEA 4CRGA 4ABJA 2PKSB 1HCGA 1SGFG 1MD8A 2ZI2H 3TK9A 1PPEE 2P8OC 1PQAA 3RXLA
chains in the Genus database with same CATH superfamily
4OS7A 1FZZA 2ESTE 2ZFRH 4INKA 3PMJA 3ENSB 1UVSH 1C5NH 3A86A 1UTLM 4X6NA 1F5KU 2I6SA 1HAHH 5E0JA 1PPBH 4IMZA 1GBKA 4TWWA 3DSOA 1TBQH 4TY6A 1THPB 2YMSB 3P70B 1SGPE 1DS2E 3FP6E 3RXRA 1LQEA 4Z0KA 4LZ4B 2XBXA 5HIYA 5C1YA 3AASA 3D65E 1C9PA 1CT0E 1GBTA 3VPKA 1TRYA 5CDFE 3OX7U 1GHAF 1O3DA 1XKAC 4XOJA 2HNTF 4CH2B 3OEED 1BMLA 2FLRH 3KQCA 4I86A 1RFNA 4P00A 3UUZA 1TOMH 1YPHC 1AUJA 1G3DA 1MTVA 1TPPA 2F3CE 5TCCA 3ZV9A 2G4UA 4IW4E 1GHZA 2O8UA 3KEEA 3U69H 2QF5A 5EJ1A 4UEHH 3SUEA 2BDHA 2OC1A 1Z1JA 4ISHH 1O3CA 1EZUC 4QT8C 1TRMA 4ASUD 8LPRA 3DSGA 3IG6B 1ETTH 5J4SA 3V12A 1Z71A 2ANWA 1NN6A 1AB9C 2ZHFH 1WTGH 4J2YB 1DDJA 1PPHE 4NA8A 2A4GA 7GCHF 4CBNA 1AHTH 3PYHA 2QIQA 1QGFA 3BG8A 3ZZAA 5DP5A 4FUHA 1O2KA 1AD8H 1QJ6B 2SGFE 1J8AA 3MI4A 4FUJA 3U8RH 4ISIH 5F03A 5BPEA 4GAWA 4X1QU 4AFZA 3FZZA 1HRTH 4AFUA 1C2MA 1HPGA 1QNJA 1HJ8A 1GI4A 3KNXA 1Y59T 4A6LA 2QGRA 1BIOA 1ZMJA 3W1EA 1E79D 1TA2A 2P95A 1C5RA 2KAIB 1L1GA 3CNRA 3VGCB 1E37B 1WDIA 2AMQA 2J97A 1ARCA 2HGTH 3A80A 4NCYA 5EODA 1SQAA 3V7TA 4NZLA 2GT8A 1FY8E 1Q2WA 3TJVA 3QWCH 1VGCC 4OS6A 1LVYA 1BBRE 4UE7H 1QA7A 2GZ9A 5T1VA 1O36A 1IQFA 4NA7A 3RXDA 3LPRA 1C5TA 1V2NT 2VWLA 2RA3A 3AW1A 5PTPA 1O3JA 4YLUA 3TH4H 3A8DA 2M5TA 3B23B 3AVZA 5AF9H 1CGIE 1N1LA 3O8RA 3GY8A 3HGNA 4B76A 1YWUA 1IHSH 3BTME 1O3IA 4K69A 4INHA 2CMYA 2ZO3H 1GBBA 4BTUB 3DSPA 1O2PA 1P01A 2V3HH 1CHGA 4MNXA 3A87A 3URCA 1GGDC 4GCHG 1F7ZA 2IJD1 1P2KA 1GI6A 2ZP0H 3LONA 2EI8A 3SYJA 1Z8IB 1YP9A 1P05A 2A4QA 3ZZBA 2AGIX 1A7SA 2Y5HA 1P2MA 1NTPA 4ZHLU 3BEFB 1NROH 4WMEA 2FLBH 5HIZA 1FV9A 2W3IA 1F0TA 1EB1H 1MU6B 1H1BA 1D3DB 2VU8E 2WPKS 3SHCH 1C1WH 4Y0ZE 1ETRH 1H8ED 4TT3D 1AFQB 1DXWA 1P12E 1AKSB 1H9IE 2ZGXH 1SQOA 1DLKB 4SGAE 3VB7A 1ANEA 1YPEH 2BDBA 5F8TA 1P06A 4TY7A 1OP2A 4KTCA 4Y79A 3SU3A 3W94A 1SQTA 1AVXA 1BRBE 2KZ4A 1UCYH 3RU4D 1O3EA 4AX9H 5B6OA 1DITH 1ZPCA 4CHAC 3E16B 1HJAC 1QB9A 3S7KB 2G4TA 1S82A 1Y8TA 3VB6A 1MMJN 3BN9A 2OP9A 2B9LA 1L1NA 1GI3A 2GV6A 2A7JA 3ATLA 4RT1A 3SNAA 3Q3KA 3RXSA 1D3TB 1HFDA 2BX4A 4DY7B 3A7VA 1AIXH 1QBVH 3FP7E 1SFIA 1AN1E 5JYIA 3RM2H 5G4BA 1PFXC 2GMTC 1KIGH 1UMAH 1EFRD 2JH5D 3LGYA 5E0GA 3KHVA 3LDXH 1ELAA 1LCYA 1GVZA 5ESTE 1ESTA 3SI3H 1V3XA 5HYOA 1WOFA 3M61U 3PRDA 3GY4A 1A5GH 1DY9A 1HAZB 1EUFA 2J38A 1O2NA 6GCHG 4Y0YE 1SBWA 3SQHE 2YOLA 4MTBA 1VZQH 2JETC 2PKAA 3F2FA 3SGQE 3RXEA 3ZVDA 2Z94A 5FHTA 2ALVA 2G81E 4U2WA 1UTQA 2CHAC 3ZZ9A 1OOKB 1Y5UT 8GCHF 1PPGE 2R0LA 1C2HA 2GP9B 2FOBA 3F2HA 2BLVA 3GCNA 2R0KA 3MNCA 5FX6A 2QA9E 2YNAA 1P2OA 1C2FA 2P93A 4YTAA 1F2SE 1Y5BT 2O9QA 1BCUH 2PLXA 1ZOMA 1C5UA 4AOQA 2PKSC 1GBLA 4I33A 2GDDA 1FN6A 3ESTA 2TIOA 3M37A 3HATH 5A0CA 2AH4X 2OXSA 4M9FA 4XFQA 1Z6JH 2H1UA 2P3UB 1XMNB 1TYNA 1EZXC 3AAUA 1GJAB 1WV7H 2HVXA 4KTUA 3SV7A 2WYJA 2Q6GA 1QRXA 5EQSA 4NZQA 2Y7XA 2VWNA 2FP7B 2WPMS 2VINA 1M9UA 6CHAC 1W0JD 3LGUA 1GI9B 3E3TA 4JZIA 5A0AE 1AE8H 3D23A 4HTCH 1TBZH 3GCOA 1C1OA 1SGRE 2YMSC 1C5QA 1RRKA 3TGKE 3SNEA 4XE4A 2H9TH 4E7NA 3RC4A 1C2LA 1G3CA 3EE7A 3KN2A 1LMWB 1ESAA 2P3TB 3SGAE 3WW7A 2JJ1D 1O2LA 1S6HA 2SNVA 4TPIZ 1GL0E 1UVUH 1QJ1B 1B0EA 2PR3A 3U1JB 1XKBC 2CXVA 2WPJS 4Y6DA 1DXPA 3KQEA 5T6GA 3H5CB 1ELEE 1YPMH 1O34A 3BTDE 2J4IA 4O3TA 5L2YH 3A89A 1AZZA 2K0QA 2C8YB 1GDNA 1E1RD 1PPFE 2WPLS 2Z3CA 3A85A 2BXUH 2L74A 3F9FA 5EXLA 2J34A 2BDAA 3F6UH 1GBCA 1UCYK 3TK6A 3EYDA 4BAKB 4MNVA 2ANMH 2BD2A 3M3VA 2A45B 1ELGA 1Q3XA 3P8NA 4U30A 5GCHF 1HDTH 3FZDA 1J15A 4I8GA 1KXEA 3ZZ6A 1GI2A 4LXBH 1YPLH 3MH7A 1KTTB 1C5OH 5A09A 1MQ5A 2BZAA 1OWJA 4NIVA 1BRAA 3PMAB 1TRNA 3HK6B 1GBEA 1O5CB 2KX4A 1BMNH 5GCHG 2QC2A 1YY3A 2WINI 2EI7A 4DT4A 4NA9H 2JH0D 1FPHH 4RKOB 2BVXH 1N6XA 1CBWB 1NPMA 1W8BH 5HM2A 1W2KH 2ZPSA 1PQ7A 1C5SA 1TX6A 2VIWA 1O35A 1W7XH 3TPIZ 1TGBA 3BTFE 1Z6EA 1CHOF 3VGCC 1W3CA 1XXDA 2FOFA 3BTTE 2BQ7B 2GCHF 2V0BA 1LVBA 1O2RA 3FAOA 2ASUB 2XNDD 1GJCB 1BITA 3LGTA 3GCTF 2ZTZA 4B73A 3UOPA 1UTMA 5CHAB 1C5YB 3LJJA 1WBGB 3T28A 1UHBA 1C1NA 4TWYA 3RC6A 3LKWA 4YZUA 2CGAA 4U32A 1W11U 3M7TA 4AYVB 4AGKA 1NRRH 2ZTXA 5C1XA 3S9AA 3A7ZA 1RIWB 1HAXB 1O3GA 4AB8A 1G30B 1BMFD 2OCVB 5FPSA 3M5NA 5FAHA 1GJ8B 3U8OH 4OS1A 2WSSD 1MUEB 1QR3E 4NIXA 3GY3A 2C93B 4I7YH 2OLGA 1W12U 3HKJB 5AHGH 2ZGCA 1O2GH 2WUCA 3W95A 2ZU1A 3ZVBA 1S83A 2HWLB 1ZSJA 4JCNA 5FXLA 4ZAEA 3RXMA 4GSOA 2A31A 2ZFTA 2ZIQH 1HAVA 1KY9A 3M7QA 4KKDA 2J94A 5A2MH 4ABAA 1EX3A 5JB8S 3QGJA 1KTSB 2GJGA 5FBEA 1OYQA 3UOUA 1KDQA 3RXQA 2UWOA 2VB0A 5T6FA 2OK5A 1TGCA 4DT7B 1ABIH 2QXJA 3PROA 1LPGB 1AFQC 2STBE 3A8AA 1LPKB 1QA0A 5HGGA 1EJNA 3SOSA 2O8LA 5EPYA 4U01A 4JMYA 2BDGA 3RLYH 1C4U2 2FI4E 1TMTH 4IC6A 2GZ8A 2KR7A 1PQ8A 2SGPE 3CS7A 2XC0A 2PSYA 1CA0B 2J98B 2O8TA 1YLCA 1DSUA 1YM0A 4X1PU 2FX4A 1SLWB 1GCDA 1E36B 3RXKA 2SNWA 5E2OA 1GMDF 1NFXA 4FUEA 3C27B 4GHQA 2B5TB 4ISNA 1BRUP 3N7DA 7KMEH 1ZTJA 1QRWA 4D9QA 4KTSA 5IYTA 1P10A 4MNYA 3RMNH 1SC8U 4GPGA 1LHFH 4Y7AA 4B75A 2F91A 2Z3DA 5E8EH 3RP2A 2F9OA 4ABBA 5F8ZA 4GLYA 4TYDA 1THSH 3BSQA 4E06H 1O2UA 5JBCS 1J14A 4TSFD 2BY7X 3TITA 5FPYA 1S5SA 5C94A 2FPZA 4ZMAH 3F2GA 1TA6A 1UVPA 4Z1MD 2UWLA 1VKYA 3UQVA 1AFEH 1BBRH 4X8TH 3ZZ7A 1HJ9A 1V2RT 3T2NA 1HXFH 3D49H 2BY8X 3V0XA 3TNTA 2ZU2A 2A7CA 1GHXH 2AMDA 4ABGA 3M5MA 1H4WA 4K8YA 2PWXA 5E2PA 1Y5AT 1QJ7B 1T8LA 1RXPA 1TAWA 3F9HA 3HGPA 3KQDA 3OTJE 1DX5M 4GHTA 2FXRA 3GY2A 4ZKOU 1W0KD 1UW7A 1C1PA 3TIUA 2DUCA 2WUBA 1XUJA 1O3OA 2OD3B 1GMHG 1ZSLA 1VCQA 3VB4A 1FQ3A 3SGBE 1LHEH 5F53A 3L33A 3M3SA 4BAOB 1EXFA 4JK5A 1S6LA 4NSYA 2Q1JA 3K2UA 4B6FA 1D4PB 2J92A 3VXEH 5EW2H 5FX5A 4CR5A 4F49A 1A4WH 3VB5A 1IQIA 1OYTH 3UY9A 3OYPA 3V13A 9LPRA 1C1TA 4ABDA 2ANKH 1NY22 2YMSD 1CGHA 1H8HD 1T8NA 2B7DH 2WYGA 1P9SA 1E35B 3OTPA 4JYVH 4ESTE 5DP4A 1O0DH 1Y3XA 3IITA 2ZFQH 4I8JA 3UTUH 1VJAU 1NO9H 1C2EA 1A5IA 1K21H 1K9OE 4UFDH 2TBSA 1O3FA 4AORA 5EW1H 2ZU4A 8ESTE 1ZJDA 3ZZ3A 3K9XB 4B74A 2PGQB 1UK4A 2RG3A 9ESTA 4DCDA 4HG6A 1WAYB 3T26A 2OUAA 1TLDA 4D9RA 3RMMH 1FY4A 3PLPA 4FUIA 1HAGE 2Z9KA 2BLQA 2R2WU 1OP8A 2VBCA 1UJ1A 2ZC9H 2ZDVH 4AB9A 2FOCA 3VFEA 1EP5A 1V2KT 1S6FA 5CHBA 1L2EA 2A5KA 1JMOH 1IQLA 1KXFA 1SHYA 1MTNC 3A7TA 1SGYE 2GTBA 1C1UH 3RM0H 2VNTA 1RD3B 2A5IA 2V7QD 1C5LH 1C5WB 1D3QB 2FM2A 2H6MA 1FIZA 1TIOA 2PUXB 5SGAE 1EZQA 3GDVA 2QAAA 1MTWA 3MQKC 5EXNA 2ZGJA 1RJXB 3STIA 2FYRA 2JJ2D 3BTWE 1HAYB 1ZPZA 1XUFA 1YCPH 2KCYA 1QBOA 1BHXF 1IQNA 3ZYDA 1FY1A 3ZZ5A 3A7YA 1BBRK 1YPKH 2PTNA 4J1YA 1CBWC 2JIZD 2TGTA 2KAIA 1SLUB 2BYAX 3GCHB 1AUTC 5EPNA 2G00A 3PV2A 5C0TA 5FCKA 1TNIA 2C4FH 2Y6TA 1ABJH 2GCTB 3UWIA 1G32B 3LH3A 1D6WA 3QGNB 1NRPH 1GJBB 1O3HA 2W5EA 1O5EH 3SJOA 1VJ9U 4DOQA 4K1EA 1W13U 2ILNA 1LVMA 1AWHB 1SGIB 2ZZUH 3S7HB 2BDCA 1K1IA 3ZZ8A 2VIVA 1YPGH 1Y3WA 4WY3A 1OWKA 3E0PB 1LTOA 1A0HB 1P2NA 1TBRH 2VGCB 3RXPA 1EKBB 1GBHA 6ESTA 1B5GH 4Q4LA 1MBQA 4FOUC 1BDAA 1OSSA 1DWEH 1C1SA 3Q00A 1Z8GA 5C1UA 1RIWC 1MAXA 1VCPA 4K8BA 2F9BH 2PTCE 1QL8A 3ATWA 3NUMA 1SOTA 3SU6A 4BANB 4UD9H 3P17H 2RFKC 2O8MA 1MQ6A 1G2MA 2BD9A 2HLDD 1F0RA 4GCHF 1BTXA 2XBWA 3PTNA 1THRH 1QY6A 1K1PA 1H8IH 3TNSA 1O33A 3RMOH 4MPVA 4A1XA 5HXFA 5JBAS 2JDID 1LPZB 1SGEE 5AFZH 1E0FD 1AKSA 2Z6BD 1TNLA 1AI8H 2BD7A 2BHGA 3RC5A 3T27A 1GI5A 1D3PB 1GDQA 2AGGX 4GVUA 4NFFA 4DJZB 1O2SA 4X8VH 1ZYOA 2IOTA 3SU1A 2XBVA 1PPZA 5DSFA 5T6DA 1IQKA 5LPFA 1CA0C 3V3MA 3F0PA 1GHBG 1DPOA 1O2TA 1NZQH 5HMAA 1QQ4A 1VCWA 1KXCA 2FIRH 1ZHMA 4JZEH 2KCAA 4CRDA 1GBJA 2EA3A 1ZGVA 3ATKA 1F0UA 3RXFA 5CE1A 2F9VA 3GDUA 4A5TS 2Z9JA 4AGJA 4JZ1A 5EQRA 4ZCNA 2D8WA 3IWMA 3DA9B 1WU1A 4WMDA 2EQNA 1TABE 1YF4A 1TPAE 2Y7ZA 1QHRB 3T29A 3NK8A 3UR9A 2BY5X 5L2ZH 1A61H 4K5ZA 2H9HA 3EE0B 3ZVFA 4CRFA 1ELDE 1F92A 1JIRA 1YLNA 5C20A 2ZGBH 4NWLA 1BHXB 2B8OH 1MCTA 2GGVB 5JB9S 1WQSA 4ABEA 1MU8B 3JZ1B 5AVDA 4R0IA 4YM9A 1XXFA 1FAXA 1NM6A 4RKJB 1Y3YA 6GCHF 3F68H 1DANH 1FY3A 3U1IB 5TCAA 4UFFH 3NKKA 5DPAA 3OAAD 4O03A 3PLBA 5EOKA 3RLWH 1G3EA 5DK1A 1O30A 4ISOA 4Q80A 1ZJKA 2AGEX 1JWTA 1YPJH 4Y11E 3SU2A 2VIPA 1ZTKA 3K65B 5T3HA 1O5BB 3PWBA 1P3EA 1IQMA 4FU8A 1W14U 4K1TA 3S0NA 2PV9B 2LP6A 1MZAA 2JH6D 1UTPA 2ZECA 2XNIA 1MTUA 2VH0A 1QQUA 4A92A 3BTGE 3RXVA 2XCNA 4WVPE 4ZXXH 2BLOA 4B1TA 1O2VA 3GICB 4Y10E 4CREA 1AZ8A 1CGJE 1YGCH 3RXBA 1N8OB 1EPTB 2CK3D 1LHCH 2ODPA 4ABFA 2R3YA 3KL6A 1T8MA 2FOHA 1RGQA 2VJ1A 1TFXA 2A5AA 2J2UA 2V35A 2TGDA 4OS4A 1C5PA 1ZSKA 3SJ9A 5A8ZA 2Y81A 2OBQA 2R9PA 5EIYA 1A1RA 4ZH8A 1QIXB 1V2MT 2ZFFH 4IMQA 3RDZA 3OSYA 2R3UA 1NT1A 2EY4C 2A0QB 3KYGA 3AK5A 3M7UA 1L0ZA 3E6PH 3FFGA 3P8OA 4ZXYH 2VH6A 1DWBH 1O2HA 1PYTC 3ZZ4A 3I78A 1DUAA 1DWDH 2Y5GA 4AC9A 4MPXA 2C8XB 1C5ZB 3CENA 3UREA 3U8TH 4UFGH 4DURA 2XWBI 1OWDA 4JZFH 2H2ZA 1TQ7B 4WJG2 2A4RA 2XBYA 1ELCA 1MAYA 1KYNA 3RXUA 3FP8E 1V6DA 1HYLA 1S0QA 4YESB 3SU0A 1SHHB 1P11E 2ZCHP 1MCVA 4FVBA 4RN6A 1GPZA 3FO8D 1MKXH 3KF2A 4D76A 3QZRA 2P16A 4Q7YA 3KGPA 5B6LA 4XSKU 4YT7H 3QO6A 4FVDA 1GCTB 5EXMA 2FX6A 5GJ4B 3GCHC 4INLA 1BTPA 1TGNA 3Q76A 1F5LA 1OP0A 4AG1A 5L6NH 3FOAA 1TB6H 1A0JA 2CF9H 3E0NB 1C9TA 4X8SH 3PTBA 3DCLA 4NFEA 2EEKA 4GUXA 2O8WA 1C2GA 2W7UA 1GBDA 3BTQE 2NU1E 4FUDA 1O3KA 1FAKH 1JBUH 4X2XA 4DIIH 1RTLA 2QXIA 2WV5A 3MO9A 1E34B 3E90B 2BVSH 2XCFA 2VGCC 1KMHB 2W3KA 1DE7H 3RXIA 4BAHB 2AS9A 3GYLB 4DG4A 1D6RA 1FN8A 3OY5U 4MPWA 2ALPA 1QFKH 2FMJA 5DG6A 2ULLA 5LPEA 5KGOA 2NU0E 3K6ZA 4WWYA 2W26A 2XC5A 3EA7A 3ZZCA 2J5UA 1Y3UA 5DP9A 2C8WB 5E0HA 3ZVCA 1DFPA 3QN7A 1B0FA 1NU7B 2OC8A 1VITG 1CSOE 3MFJA 2SGQE 1W0YH 3F3BA 1O2JA 4LZ1H 4WXVA 2BDYA 1CU1A 2IPHA 1AY6H 1C1VH 1O5AB 3MMGA 3UB0A 3F9GA 1GJ6A 1EZSC 1KXDA 4Y76A 2TPIZ 3BV9B 1O2MA 4IBLH 2BZ6H 1SI5H 1TNHA 2F4LA 2SGAA 1IQEA 3RXJA 3TJNA 3Q3YA 1G36A 2FOMB 3P95A 1PQ5A 4H6SB 3TU7H 4OM9A 3C1KA 1H8DH 3LC5A 2ZF0H 3LC3A 4DIHH 1ARBA 1GBIA 2AYWA 3U28C 3RU4E 4DW2U 3TGIE 2J98A 1A46H 1V2PT 1BOQA 2PGBB 1Z8JB 3SV2H 3T5FH 2G8TA 2NU3E 3OE7D 1BTYA 2G5NA 4D7GA 1BUIA 1VGCB 3H09A 4ASHA 3M36A 4RT0A 1W0ZU 2BB4A 2V3OH 1VR1H 3UAIC 3MHWU 1NU9A 4Y71A 2ZHDA 1YCPM 1SMFE 3F1SB 5FPTA 1OHHD 2HNTC 4I8HA 1FLEE 3M5OA 2GKVE 1UK3A 1V2TT 5A0BA 1UHBB 4CH8B 3OU0A 2ANYA 2F9NA 3TJUA 5ETXA 3ELAH 2ZDMA 1RTFB 4Q7ZA 3BIUH 1SG8B 1BJUA 2ZHEH 4LOYH 1EB2A 1MKXK 3PB1E 1IQHA 3SNBA 1K1JA 4P02A 1NRNH 2CN0H 4OS5A 4X6MA 4RI0A 1OPHB 3HPTB 4YXWD 3A7WA 3SU4A 1J9CH 3PV4A 1XUHA 4A1VA 1GGDB 1A0LA 1GJ5H 3SUDA 2QF0A 3DUXH 1TWXB 4VGCB 3ZVAA 5BRRE 1SQRA 2FTMA 1ID5H 3MU8A 5EJZA 3PO1B 4ACBA 2QN5T 2UUYA 4MLFB 2HPPH 1SVPA 2Z7FE 2A2XH 2FS8A 2G51A 2BY9X 4KP0A 2ZWLH 5TJXA 1XX9A 3H7OA 4X6PA 3BEUA 1TNKA 2ODYB 3UIRA 2RCEA 3L3TA 3E1XB 4MVNA 3SJIA 1DVAH 4YLQH 3WWFA 3MO3A 1ZR0A 4Z6AH 4UONA 4IGDA 4ZHMU 3BTEE 1F5RA 1G3BA 2ZA5A 1GMHF 1TE0A 2RDEA 3WWBA 3RXAA 4ZUHA 4X2VA 2QE7D 1P0SH 4BNRA 5LH8A 3P92A 3ZYEA 1NRSH 1HIAB 4CHAB 3A82A 5A8XA 1FNIA 3TVJB 1FPCH 4X2YA 1O2IA 3S69A 3A81A 2G55A 5LGOA 2Q6FA 3N7OA 5HKKD 2FYQA 2K8IA 5C5NA 1SKYE 3EQ0H 2GT7A 1ZRBA 1DICA 1EQ9A 1YPHE 4O3UA 3LU9B 2H5DA 2QF4A 3MOCA 3SU5A 1IOEA 1FDPA 1OX1A 2GMTB 1T4VH 4ZROA 4BOHA 2AHME 1FX0B 2ZDAH 1O31A 1O3NA 1EPTC 4WF8A 3TK5A 6LPRA 3GYMA 1P8VC 1QRZA 3B9FH 1BRCE 4ACAA 2FOAA 3SN8A 3O8CA 5FBIA 3BIVH 1LO6A 3UNRA 3P8GA 3NCLA 5EG4A 1OWIA 1SGNE 1QZ8A 1GMCG 1PYTD 2CHAB 2EI6A 4YOGA 4JYTA 4NG9H 4MG3A 1ZRKA 1S84A 5DO4H 4IS5A 1GL1A 2VIOA 1SOZA 4FUBA 3PRBA 2J9NA 2Q6DA 2WHXA 5GIBA 1P2JA 4A7IB 2K1QA 1P04A 1G9IE 3STJA 4RSPA 1J16A 3VB3A 5JDUB 2XRCA 3MYWA 4FU9A 4FXGH 3F0OA 2KCOA 2BVRH 2UWPA 1YLDA 1GBFA 1UK2A 2GDEH 3A83A 5K0HA 2BTCE 2HALA 2ZDLA 1C2IA 1GHWH 3B8JA 1BMAA 1FI8A 2QCYA 1HUTH 1W7GH 1L4DA 1SPJA 2BXTH 3RUOA 1GVKB 3URDA 6CHAB 3I29A 2XTTB 2XWAA 3ODDA 3U9AH 4FUFA 1GI7B 3RXCA 3A7XA 2FOGA 2VVVA 3SZNA 2CV3A 2A1DB 3EA8A 4ZKSU 1OWHA 1MABB 4JYUH 1COWD 1DY8A 4JK6A 3VEQB 1H9LB 4FUCA 2G5VA 2NU4E 1GCTC 4OS2A 2J95A 4YOJA 1BA8B 1TQ0B 3GY5A 4HGCA 3Q3XA 3R0FA 2M2AA 1AGJA 3S9BA 1AWFH 1GJ4H 2SFAA 1HLTH 5DP8A 3NWUA 1V2LT 2ODQA 2AIPA 2XOKD 2ZKSA 1EOJA 1MZDA 5EJLA 4CR9A 1MD7A 1UTJA 2IN2A 1NFWA 3QUMP 1YYY1 3SNDA 1GHAG 4WH6A 3KCGH 1F0SA 1SGFA 2QV1A 2ZNKH 4WMFA 4BAQB 5GWZA 1SSXA 2TGAA 1LDTT 3HKIB 3O8BA 4K2YA 1IHTH 3NXPA 2GZ7A 3UWJH 3TLOA 4MDSA 1U6QA 3PV5A 2AEIH 2BDIA 3QTOH 5ESBA 5ABWA 1C1QA 3WY8A 1V2JT 1NESE 2HRVA 4NIYA 1GI8B 2HOBA 3FN8A 2XYAA 1ZTLA 4BTTB 5CHAC 1NC6A 1RTKA 1A3BH 3VXFH 3QDZB 1D9IA 1HB0B 3SV6A 3BG4B 4MNWA 1BT7A 1B7XB 2KCPA 3QZQA 5C5OA 4BTIB 2ZGHA 2PHBA 4FETA 4O9VA 3MO6A 3OFND 7GCHG 1LKBA 2B0FA 3D62A 1SLVB 2BQWB 4OGXA 5DGJA 5J4QA 3MH4A 4M7GA 3EDXB 3TH3H 3MH6A 4ZHAA 3CS0A 2SGDE 1O32A 1JRTA 2HLCA 3SHAH 1NBME 3DHKH 3GISB 1BTUA 5DN6D 1DLEA 3SV8A 1GG6B 1O5DH 1XVMA 1HV7A 7LPRA 1EOLA 3GS9A 3PWCA 2A2QH 4D8NA 2D1JA 2Y82A 4UFEH 3FKSD 1GHBF 4ABHA 1ZMLA 5JBTA 2VWOA 1JIMA 2ZDKA 1O3MA 2IPQX 2LPRA 1P2QA 5FCRA 1KLJH 3MU5A 1C4V2 1G2LA 2YNBA 2P94A 5DJ7A 1V2VT 2KM0A 1L1JA 1W10U 2PW8H 1SFQB 2BLWA 2ZEBA 3PLKA 3VG8A 3LJOA 3PMHB 1SGTA 5HM9A 1K1LA 1Z7KA 2XC4A 3ZIAD 4OGYA 2Z9IA 3QX5H 1UVTH 1TOCB 3GOVB 3LOXA 4VGCC 5C67A 1CT2E 1CO7E 3PO1C 1HAPH 3SUFA 4CBOA 1BZXE 1ZHPA 1ETSH 2AIQA 4X1NU 4I8LA 5CMXH 1INCA 4IC5A 3NZIA 2QXHA 2ZU5A 1YCPK 1P09A 2AFQB 1T4UH 2TGPZ 2IJOB 1GJDB 2LELA 1TX8A 1ELFA 3LT3A 1MTSA 1QL9A 1G37A 1K28D 1A5HA 1PPCE 1ESBA 1O3BA 1KXBA 3ODFA 3FANA 3UR6A 1TONA 1NFUA 1GI0A 1K22H 1XM1A 2BD5A 1ZHRA 1BJVA 2FZZA 4LK4A 4B2BA 2ZCKP 3ZVEA 1K1OA 3SO3A 5EU8A 1EP6A 3PMBB 1AVGH 1O2QA 4CRAA 3KQBA 2AMPA 1DT2A 1O39A 2BOHB 3ZV8A 2VWMA 1WSSH 2DE8A 1K1NA 3ITIA 2HPQH 1ANBA 1YBWA 4K3JA 4WH8A 1WCZA 2ZHWH 1A2CH 1S85A 2H9EH 4ZKRU 1EASA 2BM2A 2OQ5A 3OEHD 2KFWA 5JPMH 2V3MA 4Y7BA 1ELTA 1YC0A 1EPTA 2BMGB 4AZ2B 5LPRA 1K2I1 4NGAH 3BF6H 3RXOA 2Y80A 2Z3EA 3O8DA 4XRNA 1C2DA 1P3CA 4WXIA 1DOJA 4AYYB 3RXGA 1AQ7A 1IQGA 2FODA 1T8OA 1C2JA 3EA9A 1FUJA 2AERH 1T31A 1O38A 1C4Y2 1T7CA 4FUGA 3MNXA 3K6YA 4ZKNU 2FI5E 2W7SA 3ZVGA 2LNCA 1JXPA 1P57B 2C90B 5DKMA 1TGSZ 2RA0A 3RU4T 3P8FA 2STAE 3A88A 1RS0A 2NWNA 1O2YA 2ZQ2A 1AVWA 3RMLH 1GJ7B 1OXGA 3M35A 2OINA 3QLPH 2WV9A 1P9UA 1FXYA 1O2OA 2F9UA 2FI3E 2NU2E 3MNBA 1EAIA 4R8TB 3SNCA 2HVYB 5GXPA 3A8CA 8GCHG 2DE9A 4Y8YA 1IQJA 1V2WT 4Q7XA 4X1SU 3DT0H 2FOEA 2PKAB 1FY5A 3RXTA 3SORA 1S81A 2ZTYA 1WYKA 3G01A 1CA8B 1TGTA 2PUQH 4MPUA 1SL3A 4BXWA 1GI1A 1E38B 2D26C 3GY7A 3E8LA 3S9CA 1AE5A 1DSTA 3CP7A 1ANCA 1TPSA 2EC9H 1YKTA 5JBBS 4IN1A 4XDEA 1PJPA 2BD3A 3A84A 2C8ZB 2P8OB 1NRQH 1LVOA 4XBBA 3LH1A 1TNGA 4Q2KA 1O2ZA 1UTNA 3TJOA 4AG2A 1A3EH 5IDKA 5IK2D 1XVOA 4B71A 1Z1IA 2ZPQA 3M3TA 4ABIA 3Q77A 1SB1H 1GHVH 1V2UT 2PP6A 1LKAA 3NPSA 1CVWH 1KLIH 1NFYA 3BTHE 3LIWA 2G52A 2JKHA 2I6QA 1QTFA 1HGTH 5I46H 2D2DA 1O3PB 3EAJA 3A8BA 5I25A 3N99A 1GDUA 4AFSA 1DUEA 2SGEE 4DGJA 2WPIS 3FVFB 4X0WU 2F9PA 4HI3A 1HAOH 1KXAA 2GCTC 1TMBH 1MTNB 2Z9LA 4Y8XA 1WUNH 4CRCA 1T32A 3T62A 1AU8A 3AAVA 4B2AA 1QB1A 1QL7A 1O2WA 1SGDE 3I77A 3M5LA 5FL7D 2F43B 3UNQA 1WQVH 4H42U 5H4IB 1EAUA 3MU0A 5C17A 2FEQH 1Z8RA 3T25A 2QF3A 2ZCLP 3ATMA 2ZG0H 1TALA 2HNTE 1GBMA 1VITF 5DP3A 3AW0A 5K7RA 1DM4B 1BTHH 2GX4A 2XW9A 3BTKE 1HBTH 7ESTE 4NSVA 1XUKA 2GD4B 2OQUA 1X7AC 3BG4C 3ZZDA 4D7FA 3LGVA 2QY0B 1SGQE 1TMUH 1GVLA 2QXGA 3H7TA 4HFPB 1AB9B 3UQOA 1JOUB 4BAMB 2XXLA 4UDWH 1JRSA 2F83A 3TGJE 1EAWA 1K1MA 1EJMA 2ZPRA 2FS9A 3MNSA 1UCYE 2OTVA 4F4OC 4I32A 3R3GB 1AMHA 1LQDB 2A4OA 1GWAA 1EJAA 4AFQA 3DD2H 1UTOA 1LHDH 4YT6H 1V2QT 4JZDH 4CRBA 5C2ZA 2BX3A 1TX7A 2ZHQH 1GG6C 2OC7A 3QTVH 4E7RG 4K60A 1ZMNA 1AO5A 1C1RA 4MQAA 1UTKA 1MKWH 2RDLA 1NS3A 1WTHD 1CHOG 1BB0B 3U98H 2WPDD 2CJIA 3SV9A 3HK3B 4KGAA 4X6OA 1ELBA 2GCHG 1KLTA 5KECA 3N7EA 2FTLE 5A8YA 3GDSA 2FDAA 3SW2B 1TNJA 3MH5A 4K1SA 4Q63A 3SI4H 4BXSA 3GCTG 4I31A 1XUIA 3KQ5A 4FU7A 4B6EA 1P03A 1SLXB 3LGWA 2R2MB 4X8UH 4F55A 2TRMA 2P3FH 1BTZA 1BTWA 1KSNA 2ZFPH 1P2IA 1QB6A 3QK1A 1C5MD 1GJ9B 2GV7A 4A1TA 1LHGH 1C5XB 1J17T 4DVAU 3L6PA 2BY6X 3OY6U 2ZU3A 1FMGA 2OC0A 4YOIA 3SBKA 1Y3VA 5EGMA 2BQ6B 5EQQA 1ZPBA 4ISLA 1O3AA 2W6ID 2WZQA 1S0RA 4H4FA 1C2KA 1CT4E 4F48B 2VVCA 1DWCH 3MU4A 1O5FH 2BOKA 1HNEE 5DP7A 1GBAA 2A7HA 3KYFA 4O97A 2Y5FA 3SZEA 8KME2 1L4ZA 2ZQ1A 1QURH 2PSXA 5AFYH 1ORFA 2CF8H 1SGCA 3SUGA 2THFB 3JZ2B 4Y8ZA 2BD4A 2UUJB 1HIAA 4IN2A 4B2CA 1HAVB 2P59A 3MTYA 1ELVA 2FO9A 1FJSA 1KDQB 1NBMD 1N6YA 4TPYA 5GNDA 1V2ST 2V6NA 5C3NA 1GHYH 2VIDA 2L6OA 1EATA 2H5CA 1ZZZA 2BD8A 4AN7A 1ANDA 3GY6A 4E05H 2VVUA 3UNSA 1QBNA 2FWWA 4H6TA 1ZLRA 1UVOA 1CQQA 2ZDNA 1VITH 5KEDA 4PROA 5F8XA 1GMDG 1TPOA 5DP6A 3LGIA 4HZHA 1V2OT 4NWKA 1E1QD 3MWIU 1ACBE 3E91A 1HJAB 4YO9A 2ZFSA 4X2WA 2UUFB 3MU1A 5GDSH 1OKXA 1FONA 4I8KA 2Z9GA 1IAUA 5GPIB 3UPEA 5L30H 3P6ZB 3F9EA 3TH2H 4XBCA 3ATIA 1OS8A 1H9HE 2A32A 2QYIA 2VIQA 2W6JD 3DFJA 4X1RU 3RXHA 1GMCF 4SGBE 3SQEE 1FIWA 1CE5A 1MKWK 4THNH 1N8OC 3SJKA 1QCPA 4XBDA 1SR5C 2FESH 2WV4A 1O3LA 1O37A 2UUKB 3EGKH 3NRLA 3DFLA 1UO6A 5F6MA 1O5GH 4NIWA 1MBMA 2JETB 1P02A 1C1MA 4KELA 1HXEH 1EAXA 3UFAA 3BEIB 1BMMH 2PFEA 1C5VA 2GVFA 1MH0A 3SJ8A 3PM3A 1O2XA 3KIDU 2OBOA 2C3SA 1ZGIA 1XUGA 1HAIH 1Q31A 1BQYA 2WPHS 1OWEA 4CRGA 4ABJA 2PKSB 1HCGA 1SGFG 1MD8A 1WXRA 5C0UA 2ZI2H 3TK9A 1K0HA 1PPEE 4XD7D 2P8OC 1PQAA 3RXLA
chains in the Genus database with same CATH topology
4OS7A 1FZZA 2ESTE 2ZFRH 4INKA 3PMJA 3ENSB 1UVSH 1C5NH 3A86A 1UTLM 4X6NA 1F5KU 2I6SA 1HAHH 5E0JA 1PPBH 4IMZA 1GBKA 4TWWA 1TBQH 4TY6A 1THPB 3P70B 1SGPE 1DS2E 3FP6E 3RXRA 1LQEA 4Z0KA 4LZ4B 2XBXA 5C1YA 3AASA 3D65E 1C9PA 1CT0E 1GBTA 3VPKA 1TRYA 3OX7U 1GHAF 1O3DA 1XKAC 4XOJA 2HNTF 4CH2B 1BMLA 2FLRH 3KQCA 1RFNA 3UUZA 1TOMH 1YPHC 1AUJA 1G3DA 1MTVA 1TPPA 2F3CE 5TCCA 3ZV9A 2G4UA 4IW4E 1GHZA 2O8UA 3KEEA 3U69H 4UEHH 3SUEA 2BDHA 2OC1A 1Z1JA 4ISHH 1O3CA 1EZUC 4QT8C 1TRMA 8LPRA 3IG6B 1ETTH 5J4SA 3V12A 1Z71A 2ANWA 1NN6A 1AB9C 2ZHFH 1WTGH 4J2YB 1DDJA 1PPHE 4NA8A 2A4GA 7GCHF 4CBNA 1AHTH 3PYHA 2QIQA 1QGFA 3BG8A 3ZZAA 5DP5A 4FUHA 1O2KA 1AD8H 1QJ6B 2SGFE 1J8AA 3MI4A 4FUJA 3U8RH 4ISIH 5F03A 5BPEA 4GAWA 4X1QU 4AFZA 3FZZA 1HRTH 4AFUA 1C2MA 1HPGA 1QNJA 1HJ8A 1GI4A 3KNXA 1Y59T 4A6LA 2QGRA 1BIOA 1ZMJA 1TA2A 2P95A 1C5RA 2KAIB 1L1GA 3VGCB 1E37B 2AMQA 1ARCA 2HGTH 3A80A 4NCYA 5EODA 1SQAA 3V7TA 4NZLA 2GT8A 1FY8E 1Q2WA 3TJVA 3QWCH 1VGCC 4OS6A 1LVYA 1BBRE 4UE7H 1QA7A 2GZ9A 1O36A 1IQFA 4NA7A 3RXDA 3LPRA 1C5TA 1V2NT 2VWLA 2RA3A 3AW1A 5PTPA 1O3JA 4YLUA 3TH4H 3A8DA 2M5TA 3B23B 3AVZA 5AF9H 1CGIE 1N1LA 3O8RA 3GY8A 3HGNA 4B76A 1IHSH 3BTME 1O3IA 4K69A 4INHA 2CMYA 2ZO3H 1GBBA 4BTUB 1O2PA 1P01A 2V3HH 1CHGA 4MNXA 3A87A 3URCA 1GGDC 4GCHG 1F7ZA 1P2KA 1GI6A 2ZP0H 3LONA 2EI8A 1Z8IB 1YP9A 1P05A 2A4QA 3ZZBA 2AGIX 1A7SA 2Y5HA 1P2MA 1NTPA 4ZHLU 3BEFB 1NROH 4WMEA 2FLBH 1FV9A 2W3IA 1F0TA 1EB1H 1MU6B 1H1BA 1D3DB 2VU8E 2WPKS 3SHCH 1C1WH 4Y0ZE 1ETRH 1AFQB 1DXWA 1P12E 1AKSB 1H9IE 2ZGXH 1SQOA 1DLKB 4SGAE 3VB7A 1ANEA 1YPEH 2BDBA 5F8TA 1P06A 4TY7A 1OP2A 4KTCA 4Y79A 3SU3A 3W94A 1SQTA 1AVXA 1BRBE 1UCYH 3RU4D 1O3EA 4AX9H 5B6OA 1DITH 1ZPCA 4CHAC 3E16B 1HJAC 1QB9A 3S7KB 2G4TA 1S82A 1Y8TA 3VB6A 1MMJN 3BN9A 2OP9A 2B9LA 1L1NA 1GI3A 2GV6A 2A7JA 3ATLA 3SNAA 3Q3KA 3RXSA 1D3TB 1HFDA 2BX4A 4DY7B 3A7VA 1AIXH 1QBVH 3FP7E 1SFIA 1AN1E 5JYIA 3RM2H 5G4BA 1PFXC 2GMTC 1KIGH 1UMAH 2JH5D 3LGYA 5E0GA 3KHVA 3LDXH 1ELAA 1LCYA 1GVZA 5ESTE 1ESTA 3SI3H 1V3XA 5HYOA 1WOFA 3M61U 3GY4A 1A5GH 1DY9A 1HAZB 1EUFA 2J38A 1O2NA 6GCHG 4Y0YE 1SBWA 3SQHE 2YOLA 4MTBA 1VZQH 2JETC 2PKAA 3SGQE 3RXEA 3ZVDA 2Z94A 5FHTA 2ALVA 2G81E 4U2WA 1UTQA 2CHAC 3ZZ9A 1OOKB 1Y5UT 8GCHF 1PPGE 2R0LA 1C2HA 2GP9B 2FOBA 2BLVA 3GCNA 2R0KA 3MNCA 5FX6A 2QA9E 2YNAA 1P2OA 1C2FA 2P93A 4YTAA 1F2SE 1Y5BT 2O9QA 1BCUH 2PLXA 1ZOMA 1C5UA 4AOQA 2PKSC 1GBLA 4I33A 2GDDA 1FN6A 3ESTA 2TIOA 3M37A 3HATH 5A0CA 2AH4X 2OXSA 4XFQA 1Z6JH 2H1UA 2P3UB 1XMNB 1TYNA 1EZXC 3AAUA 1GJAB 1WV7H 2HVXA 4KTUA 3SV7A 2WYJA 2Q6GA 1QRXA 5EQSA 4NZQA 2Y7XA 2VWNA 2FP7B 2WPMS 2VINA 1M9UA 6CHAC 3LGUA 1GI9B 3E3TA 4JZIA 5A0AE 1AE8H 3D23A 4HTCH 1TBZH 3GCOA 1C1OA 1SGRE 1C5QA 1RRKA 3TGKE 3SNEA 4XE4A 2H9TH 4E7NA 3RC4A 1C2LA 1G3CA 3KN2A 1LMWB 1ESAA 2P3TB 3SGAE 1O2LA 1S6HA 2SNVA 4TPIZ 1GL0E 1UVUH 1QJ1B 1B0EA 2PR3A 3U1JB 1XKBC 2CXVA 2WPJS 4Y6DA 1DXPA 3KQEA 5T6GA 3H5CB 1ELEE 1YPMH 1O34A 3BTDE 2J4IA 4O3TA 5L2YH 3A89A 1AZZA 2C8YB 1GDNA 1PPFE 2WPLS 2Z3CA 3A85A 2BXUH 3F9FA 5EXLA 2J34A 2BDAA 3F6UH 1GBCA 1UCYK 3TK6A 3EYDA 4BAKB 4MNVA 2ANMH 2BD2A 3M3VA 2A45B 1ELGA 1Q3XA 3P8NA 4U30A 5GCHF 1HDTH 3FZDA 1J15A 4I8GA 1KXEA 3ZZ6A 1GI2A 4LXBH 1YPLH 3MH7A 1KTTB 1C5OH 5A09A 1MQ5A 2BZAA 1OWJA 4NIVA 1BRAA 3PMAB 1TRNA 3HK6B 1GBEA 1O5CB 1BMNH 5GCHG 2QC2A 2WINI 2EI7A 4NA9H 2JH0D 1FPHH 4RKOB 2BVXH 1N6XA 1CBWB 1NPMA 1W8BH 5HM2A 1W2KH 2ZPSA 1PQ7A 1C5SA 1TX6A 2VIWA 1O35A 1W7XH 3TPIZ 1TGBA 3BTFE 1Z6EA 1CHOF 3VGCC 1W3CA 1XXDA 2FOFA 3BTTE 2BQ7B 2GCHF 2V0BA 1LVBA 1O2RA 3FAOA 2ASUB 1GJCB 1BITA 3LGTA 3GCTF 2ZTZA 4B73A 3UOPA 1UTMA 5CHAB 1C5YB 3LJJA 1WBGB 3T28A 1UHBA 1C1NA 4TWYA 3RC6A 3LKWA 4YZUA 2CGAA 4U32A 1W11U 3M7TA 4AYVB 4AGKA 1NRRH 2ZTXA 5C1XA 3S9AA 3A7ZA 1RIWB 1HAXB 1O3GA 4AB8A 1G30B 2OCVB 5FPSA 3M5NA 5FAHA 1GJ8B 3U8OH 4OS1A 1MUEB 1QR3E 4NIXA 3GY3A 2C93B 4I7YH 2OLGA 1W12U 3HKJB 5AHGH 2ZGCA 1O2GH 2WUCA 3W95A 2ZU1A 3ZVBA 1S83A 2HWLB 1ZSJA 4JCNA 5FXLA 4ZAEA 3RXMA 4GSOA 2A31A 2ZFTA 2ZIQH 1HAVA 1KY9A 3M7QA 4KKDA 2J94A 5A2MH 4ABAA 1EX3A 5JB8S 3QGJA 1KTSB 5FBEA 1OYQA 3UOUA 1KDQA 3RXQA 2UWOA 2VB0A 5T6FA 1TGCA 4DT7B 1ABIH 2QXJA 3PROA 1LPGB 1AFQC 2STBE 3A8AA 1LPKB 1QA0A 5HGGA 1EJNA 3SOSA 2O8LA 5EPYA 4U01A 4JMYA 2BDGA 3RLYH 1C4U2 2FI4E 1TMTH 4IC6A 2GZ8A 1PQ8A 2SGPE 3CS7A 2XC0A 2PSYA 1CA0B 2O8TA 1YLCA 1DSUA 1YM0A 4X1PU 2FX4A 1SLWB 1GCDA 1E36B 3RXKA 2SNWA 5E2OA 1GMDF 1NFXA 4FUEA 3C27B 4GHQA 2B5TB 4ISNA 1BRUP 7KMEH 1ZTJA 1QRWA 4D9QA 4KTSA 5IYTA 1P10A 4MNYA 3RMNH 1SC8U 4GPGA 1LHFH 4Y7AA 4B75A 2F91A 2Z3DA 5E8EH 3RP2A 2F9OA 4ABBA 5F8ZA 4GLYA 4TYDA 1THSH 3BSQA 4E06H 1O2UA 5JBCS 1J14A 2BY7X 3TITA 5FPYA 1S5SA 2FPZA 4ZMAH 1TA6A 1UVPA 2UWLA 3UQVA 1AFEH 1BBRH 4X8TH 3ZZ7A 1HJ9A 1V2RT 3T2NA 1HXFH 3D49H 2BY8X 3V0XA 3TNTA 2ZU2A 2A7CA 1GHXH 2AMDA 4ABGA 3M5MA 1H4WA 4K8YA 2PWXA 5E2PA 1Y5AT 1QJ7B 1T8LA 1RXPA 1TAWA 3F9HA 3HGPA 3KQDA 3OTJE 1DX5M 4GHTA 2FXRA 3GY2A 4ZKOU 1C1PA 3TIUA 2DUCA 2WUBA 1XUJA 1O3OA 2OD3B 1GMHG 1ZSLA 1VCQA 3VB4A 1FQ3A 3SGBE 1LHEH 3L33A 3M3SA 4BAOB 1EXFA 4JK5A 4NSYA 2Q1JA 3K2UA 1D4PB 2J92A 3VXEH 5EW2H 5FX5A 4CR5A 4F49A 1A4WH 3VB5A 1IQIA 1OYTH 3UY9A 3OYPA 3V13A 9LPRA 1C1TA 4ABDA 2ANKH 1NY22 1CGHA 1T8NA 2B7DH 2WYGA 1P9SA 1E35B 4JYVH 4ESTE 5DP4A 1O0DH 1Y3XA 3IITA 2ZFQH 4I8JA 3UTUH 1VJAU 1NO9H 1C2EA 1A5IA 1K21H 1K9OE 4UFDH 2TBSA 1O3FA 4AORA 5EW1H 2ZU4A 8ESTE 1ZJDA 3ZZ3A 3K9XB 4B74A 2PGQB 1UK4A 2RG3A 9ESTA 4DCDA 1WAYB 3T26A 2OUAA 1TLDA 4D9RA 3RMMH 1FY4A 3PLPA 4FUIA 1HAGE 2Z9KA 2BLQA 2R2WU 1OP8A 2ZC9H 1UJ1A 2ZDVH 4AB9A 2FOCA 3VFEA 1EP5A 1V2KT 1S6FA 1L2EA 2A5KA 1JMOH 1IQLA 1KXFA 1SHYA 1MTNC 3A7TA 1SGYE 2GTBA 1C1UH 3RM0H 2VNTA 1RD3B 2A5IA 1C5LH 1C5WB 1D3QB 2FM2A 2H6MA 1FIZA 1TIOA 2PUXB 5SGAE 1EZQA 3GDVA 2QAAA 1MTWA 5EXNA 2ZGJA 1RJXB 3STIA 2FYRA 3BTWE 1HAYB 1ZPZA 1XUFA 1YCPH 1QBOA 1BHXF 1IQNA 3ZYDA 1FY1A 3ZZ5A 3A7YA 1BBRK 1YPKH 2PTNA 4J1YA 1CBWC 2TGTA 2KAIA 1SLUB 2BYAX 3GCHB 1AUTC 5EPNA 2G00A 5FCKA 1TNIA 2C4FH 2Y6TA 1ABJH 2GCTB 3UWIA 1G32B 3LH3A 1D6WA 3QGNB 1NRPH 1GJBB 1O3HA 2W5EA 1O5EH 3SJOA 1VJ9U 4DOQA 4K1EA 1W13U 2ILNA 1LVMA 1AWHB 1SGIB 2ZZUH 3S7HB 2BDCA 1K1IA 3ZZ8A 2VIVA 1YPGH 1Y3WA 4WY3A 1OWKA 3E0PB 1LTOA 1A0HB 1P2NA 1TBRH 2VGCB 3RXPA 1EKBB 1GBHA 6ESTA 1B5GH 1MBQA 1BDAA 1OSSA 1DWEH 1C1SA 3Q00A 1Z8GA 5C1UA 1RIWC 1MAXA 1VCPA 4K8BA 2F9BH 2PTCE 1QL8A 3ATWA 3NUMA 1SOTA 3SU6A 4BANB 4UD9H 3P17H 2O8MA 1MQ6A 1G2MA 2BD9A 1F0RA 4GCHF 1BTXA 2XBWA 3PTNA 1THRH 1QY6A 1K1PA 1H8IH 3TNSA 1O33A 3RMOH 4MPVA 4A1XA 5HXFA 5JBAS 1LPZB 1SGEE 5AFZH 1E0FD 1AKSA 2Z6BD 1TNLA 1AI8H 2BD7A 2BHGA 3RC5A 3T27A 1GI5A 1D3PB 1GDQA 2AGGX 4GVUA 4NFFA 4DJZB 1O2SA 4X8VH 1ZYOA 2IOTA 3SU1A 2XBVA 1PPZA 5T6DA 1IQKA 5LPFA 1CA0C 3V3MA 1GHBG 1DPOA 1O2TA 1NZQH 5HMAA 1QQ4A 1VCWA 1KXCA 2FIRH 1ZHMA 4JZEH 4CRDA 1GBJA 2EA3A 1ZGVA 3ATKA 1F0UA 3RXFA 5CE1A 2F9VA 3GDUA 4A5TS 2Z9JA 4AGJA 4JZ1A 5EQRA 2D8WA 3IWMA 3DA9B 1WU1A 4WMDA 1TABE 1YF4A 1TPAE 2Y7ZA 1QHRB 3T29A 3NK8A 3UR9A 2BY5X 5L2ZH 1A61H 4K5ZA 2H9HA 3EE0B 3ZVFA 4CRFA 1ELDE 1F92A 1JIRA 5C20A 2ZGBH 4NWLA 1BHXB 2B8OH 1MCTA 2GGVB 5JB9S 1WQSA 4ABEA 1MU8B 3JZ1B 5AVDA 4R0IA 4YM9A 1XXFA 1FAXA 1NM6A 4RKJB 1Y3YA 6GCHF 3F68H 1DANH 1FY3A 3U1IB 5TCAA 4UFFH 3NKKA 5DPAA 4O03A 3PLBA 5EOKA 3RLWH 1G3EA 5DK1A 1O30A 4ISOA 4Q80A 1ZJKA 2AGEX 1JWTA 1YPJH 4Y11E 3SU2A 2VIPA 1ZTKA 3K65B 5T3HA 1O5BB 3PWBA 1P3EA 1IQMA 4FU8A 1W14U 4K1TA 3S0NA 2PV9B 1MZAA 2JH6D 1UTPA 2ZECA 2XNIA 1MTUA 2VH0A 1QQUA 4A92A 3BTGE 3RXVA 2XCNA 4WVPE 4ZXXH 2BLOA 4B1TA 1O2VA 3GICB 4Y10E 4CREA 1AZ8A 1CGJE 1YGCH 3RXBA 1N8OB 1EPTB 1LHCH 2ODPA 4ABFA 2R3YA 3KL6A 1T8MA 2FOHA 1RGQA 2VJ1A 1TFXA 2A5AA 2J2UA 2V35A 2TGDA 4OS4A 1C5PA 1ZSKA 3SJ9A 5A8ZA 2Y81A 2OBQA 2R9PA 1A1RA 4ZH8A 1QIXB 1V2MT 2ZFFH 4IMQA 3RDZA 3OSYA 2R3UA 1NT1A 2A0QB 3M7UA 1L0ZA 3E6PH 3FFGA 3P8OA 4ZXYH 2VH6A 1DWBH 1O2HA 1PYTC 3ZZ4A 3I78A 1DUAA 1DWDH 2Y5GA 4MPXA 2C8XB 1C5ZB 3CENA 3UREA 3U8TH 4UFGH 4DURA 2XWBI 1OWDA 4JZFH 2H2ZA 1TQ7B 4WJG2 2A4RA 2XBYA 1ELCA 1MAYA 1KYNA 3RXUA</