1O30A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o30A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o30A02
3VEQB 2DE9A 4CRBA 1TIOA 3LT3A 1SR5C 1S85A 4MPXA 1EKBB 2BDAA 3RXKA 2BVXH 5DP7A 3LH1A 4I8KA 1TBQH 1Z6JH 1UVOA 2NU4E 2PLXA 1UTKA 3SGAE 2IPHA 1GI9B 1GHBF 5EODA 1SPJA 1BTXA 1GJAB 2J34A 1GG6B 2BTCE 4K1TA 4AGKA 3MHWU 1SGIB 1LVYA 1CVWH 1HAZB 1HYLA 4ABEA 4ZXXH 4UDWH 2VIPA 2GT7A 2QC2A 1O2GH 4FUDA 2GVFA 1VZQH 1GMHF 2FWWA 4Y0YE 3GDVA 2WPHS 3SQHE 3BV9B 3FFGA 2ZDVH 7ESTE 1DFPA 3LGIA 2GP9B 1K21H 2WYJA 5CMXH 1SB1H 4KGAA 3TJNA 3SGBE 1OWIA 5EW1H 3EA7A 3A7VA 2A2QH 3FANA 1MCVA 3SU0A 4TWYA 1TGTA 1TMTH 1FIWA 1GI0A 1DWEH 3SU6A 5C5OA 1HBTH 1QFKH 2NU2E 1ZSJA 3AVZA 1D3DB 1GJBB 2OC7A 1NZQH 4FVBA 1B0EA 1D3TB 1K1PA 1GHWH 2GT8A 5AFYH 2V3HH 3FP6E 1OYTH 1G2MA 1KXBA 3D62A 3RC4A 4ZHAA 1WTGH 1AFEH 1O3LA 1L0ZA 4GCHF 1RIWC 1AUTC 2ZGXH 1KXAA 1NRPH 3AASA 4Y71A 2C4FH 1ACBE 4Y8YA 2XWBI 1UHBA 1NFWA 4D76A 1S6FA 1FXYA 1SG8B 1ELDE 3BG4B 1GJ5H 1VJAU 3U8TH 3T26A 3PO1C 2V0BA 1TALA 2Z7FE 4BXWA 4NFFA 1BDAA 1T8OA 2J2UA 3SBKA 2D8WA 2G00A 3N7OA 2SGQE 3MH5A 3UPEA 6ESTA 1YPGH 1EZXC 1SVPA 3IG6B 3C27B 4TPYA 3T29A 3T5FH 1TGBA 2SFAA 2SGEE 2FOFA 4R8TB 1EAUA 2EI8A 1D9IA 2AS9A 4IN2A 1EPTA 4H4FA 1BMMH 3ZYDA 2QGRA 1GDNA 2ZEBA 2FZZA 2ZC9H 1O3PB 1VCPA 4K2YA 2XBXA 3RXMA 6CHAB 4JYVH 5JB9S 4IN1A 1N8OB 3LOXA 1QA7A 3FP7E 2GV7A 3GISB 2FLRH 3O8CA 4NWLA 3SUFA 1THRH 2GMTB 3MU1A 1KTSB 2ZHQH 4WH6A 3I77A 3BTGE 1QQ4A 1OWKA 1FAXA 2ZTYA 4E05H 3U69H 3OY5U 3BTDE 4U2WA 4D9QA 3MWIU 4K5ZA 1UTQA 7GCHF 3H7OA 4FUJA 1GJDB 4O9VA 3RXAA 3UOUA 1UK4A 4KTCA 5DP8A 2ZO3H 3Q00A 1GJCB 2BY6X 4Y7AA 4HI3A 1O2NA 1O3BA 2PKSC 5LH8A 1DOJA 2ZU3A 2OUAA 4PROA 1V2MT 5E0HA 1G36A 3JZ1B 2OTVA 2FIRH 3ODFA 4O3TA 1AVGH 3F68H 5H4IB 2ODQA 5L2YH 2JKHA 3AW1A 1GJ8B 1BMNH 2GGVB 1QB6A 2GX4A 2BZAA 2WPJS 5GJ4B 3H5CB 1IHTH 2AMDA 3SZNA 2PFEA 1GI3A 1PPHE 1UVUH 2FOEA 4DW2U 1QA0A 2XBVA 4GUXA 2J9NA 3SJ8A 2HNTE 1QRXA 2D26C 2TBSA 1HPGA 1OPHB 1QNJA 1GI6A 2ZGJA 3Q3XA 5C1YA 5JBCS 4CHAB 2CJIA 2G5VA 1SLVB 3LGYA 1BTHH 1GBMA 1NFUA 4UFFH 3CS7A 2WPMS 4QT8C 1AVWA 1ELVA 2ZDNA 1V6DA 3Q77A 1C1VH 1C2MA 1Y5UT 3ZVGA 1J16A 1QHRB 3ATMA 4AYVB 2CF8H 1O2MA 5FBEA 3RP2A 2BMGB 1HAVB 3TIUA 2G4TA 1VCWA 4D8NA 1SL3A 1Y5AT 1OWJA 3B23B 1SLXB 1BITA 5SGAE 4MPVA 4J1YA 5AF9H 2H9TH 1XVMA 2I6SA 5CE1A 1O5FH 1T8NA 1UTJA 1QBOA 1QR3E 1ESAA 2M5TA 1QIXB 1OWEA 1EP5A 2XXLA 1LVOA 3MNCA 1HFDA 1EJMA 1E36B 4BTUB 5LGOA 1ANCA 4VGCB 4X6OA 2STAE 2HLCA 3P8FA 3MU5A 3LGVA 1XX9A 2UUFB 1ZMJA 1PYTD 3LGUA 3SQEE 3ATIA 1GI8B 1XUFA 1YPHE 4XSKU 1RRKA 1U6QA 1WAYB 5FXLA 1S0RA 4BAOB 1ELBA 1YPJH 3BF6H 1YCPM 3RDZA 2ALVA 2BDIA 3RMNH 2O8MA 2OLGA 1G2LA 2F9BH 1YKTA 4BTTB 9LPRA 4I31A 1LHEH 1P57B 3SJKA 1NM6A 4O97A 1UCYE 1SBWA 2AMPA 1SGRE 3HKJB 4ABJA 1GJ6A 1SC8U 4HFPB 1HAPH 2G51A 2ZWLH 1JRSA 1OP0A 2ANMH 1SI5H 4CREA 2THFB 1PQAA 3GCTG 1W0YH 2J38A 1KY9A 1PPFE 2O9QA 3M7QA 3AW0A 3SNBA 2GTBA 3S69A 1V2OT 4IMZA 1EUFA 2VWOA 3W94A 1RTFB 1CGHA 1GBBA 3A88A 1TOCB 1FUJA 1TX8A 1ZHRA 2G55A 4DT7B 2GD4B 2TGDA 1P0SH 1TX6A 1Z1JA 2SGPE 2H5DA 3RXHA 2ASUB 1AHTH 4AFZA 2H1UA 1GG6C 1O3KA 2UUYA 3VB7A 2R0KA 1YPLH 3FZDA 1FIZA 1AVXA 4ABGA 3SI3H 2SGFE 3P6ZB 5I25A 1JIMA 3LONA 8GCHG 1C5PA 2A5KA 1DLEA 3LGWA 3HK3B 1AKSB 1Y3UA 3RXDA 4DIIH 2DE8A 1C5OH 4BTIB 3RXJA 1FI8A 1G3BA 3MO9A 1O2QA 1P12E 1O5DH 1ETTH 1L1GA 3TVJB 1LHFH 1IOEA 1MTSA 4Q80A 1C1UH 2J4IA 3LIWA 1V2VT 1MQ6A 4U32A 4ZKSU 1JRTA 5ETXA 3ZYEA 4B71A 3F9FA 5K7RA 2WPIS 1BA8B 2QYIA 3QZRA 1YBWA 2Q6GA 2XYAA 1JOUB 1LQEA 3Q76A 3QO6A 4DURA 3BEFB 3SN8A 1O2XA 3RXPA 5FPYA 1XXDA 3A7WA 3SHAH 1H9LB 1AB9B 1Z7KA 4FVDA 2CV3A 1DX5M 1MKXH 1C2JA 2J94A 4FUCA 1DY9A 1T31A 3SV7A 1C4Y2 1AZ8A 5EG4A 1GBEA 1MMJN 2G4UA 1GHAF 2ZGHA 3BG4C 4OS1A 1O3GA 3TJUA 4WMEA 1A5HA 4WY3A 1ELAA 1DLKB 1SGNE 1MAXA 1S0QA 4O03A 2O8UA 2VIWA 2C90B 1F2SE 1V2TT 1UTOA 1ZRKA 2FOHA 4GLYA 2G81E 2H9EH 2ZFQH 1JIRA 1LMWB 1XUGA 2V3OH 1ELEE 4CBOA 4BNRA 1PQ8A 3SO3A 3BTHE 1TPPA 1HNEE 2ZCHP 4WH8A 3UWJH 1EAWA 2A4OA 1WQVH 1O35A 1XKBC 1HIAA 4Y8XA 2WUCA 1YLDA 1CU1A 6CHAC 4ZKOU 1H8IH 4F49A 1N8OC 3PWCA 4ZAEA 5K0HA 1A3EH 3UQOA 3RXBA 4ASHA 3TH4H 3E90B 5ESBA 2GMTC 1TOMH 2BOHB 2BX3A 4MNYA 2HALA 4ZH8A 4X8UH 1SGFA 5F6MA 1L1JA 4DIHH 1XVOA 1KLTA 1LPKB 3EQ0H 1C2DA 2UUKB 3TNSA 1N6YA 4WWYA 1UTLM 4F4OC 5AFZH 3SUGA 2V6NA 2BXUH 4ISNA 1C2LA 3GY6A 1HJAB 1S81A 2WINI 2ZDKA 2PGBB 1V2LT 1C2FA 3MH6A 2Y5GA 4IMQA 1C4U2 1ZTJA 3BIVH 4YESB 1NPMA 1VJ9U 3VB4A 2BQ6B 3C1KA 1Y5BT 3PROA 3W95A 1M9UA 2WYGA 4JYUH 4JZIA 4K1EA 5C67A 2BZ6H 1A0JA 1TA6A 2FTLE 2ZFFH 4LOYH 3KQBA 1FY3A 1CT2E 5F8ZA 1EB1H 1ABIH 1GHBG 1BBRH 3VPKA 3RXVA 4NSVA 1SFQB 3TGIE 2OQUA 2ZFPH 4U30A 2V35A 2UUJB 2OINA 4ZHLU 3TGKE 1TNJA 1O5EH 4CHAC 1UK3A 3E0NB 1Y3YA 2BYAX 1N6XA 1KXCA 1GGDB 3HATH 3GCNA 3L33A 3SHCH 1P04A 1GMHG 2BVSH 1GDQA 3BEIB 1GBIA 4YOGA 3QZQA 1DVAH 3CENA 4UFEH 5DP5A 3TK5A 1RTLA 4IBLH 4JZ1A 4X0WU 3TGJE 1O2WA 1O3IA 3BTWE 1P9UA 2PR3A 5C5NA 1OS8A 1DXPA 1Z8IB 1YPKH 4X6PA 2AIPA 1HAOH 4INKA 5EGMA 2PWXA 1XUIA 4BOHA 1HJ8A 3M36A 2CGAA 1LKAA 2Y5HA 1AU8A 2AERH 1ETSH 2GCHG 1ZLRA 2BXTH 8ESTE 5EQQA 1ORFA 2ZNKH 5FBIA 1NRNH 1BRAA 4GCHG 1FPCH 4VGCC 1XXFA 1ZMNA 1DXWA 1ZYOA 4X1RU 4ISHH 2JETB 1N1LA 3V3MA 2XRCA 1EATA 1LHCH 2PV9B 2WUBA 3EDXB 1P2NA 1NTPA 2XTTB 1TMUH 3GDUA 3PMBB 5PTPA 4CRFA 1AI8H 1ZHMA 5CHAB 2F83A 4NIVA 4NSYA 2BY9X 1VITH 1K1IA 2BB4A 2ZDAH 4I8LA 1O3OA 3UNRA 3A89A 4D7GA 5TJXA 5A8XA 4YLQH 3RXGA 2BDYA 1W8BH 3DFLA 4ZKRU 1SGFG 2IOTA 1AE8H 4DOQA 1F0TA 3T28A 9ESTA 3R3GB 3MNBA 3PTNA 4FUFA 1C1RA 1Q3XA 1T4VH 4GAWA 4JZEH 1ID5H 1KDQA 3S9AA 1RGQA 2AGGX 2FLBH 1O37A 2GV6A 1C1OA 1C4V2 2ZDMA 3L6PA 1ELCA 1F5KU 3P8OA 2F3CE 3PM3A 1GBKA 1O5BB 1SQTA 1GJ4H 4NG9H 3Q3YA 3ODDA 1O3FA 2Z9IA 1XUKA 5DP9A 1TFXA 5A2MH 2O8WA 1YCPK 1SGEE 2QF0A 8KME2 2PUXB 5TCCA 4NA9H 5GDSH 5JPMH 1J9CH 3PYHA 4DY7B 3RMOH 3MH4A 5A0BA 1S83A 1L4DA 3VB5A 4OGXA 2QXIA 4K69A 1KSNA 2GDEH 3RC6A 2XW9A 1C5SA 1AIXH 1QURH 2ESTE 1DWCH 1BTPA 3TJOA 1T4UH 2BOKA 3NCLA 1EX3A 4JCNA 3F6UH 3ATLA 1SQOA 3B9FH 1DUAA 1KXEA 1TNIA 2TIOA 3RMMH 3RM0H 1O39A 1G3DA 2FOMB 1C5WB 4K60A 4AFUA 2BD3A 2FPZA 3KGPA 3QN7A 4Y6DA 1TYNA 1AB9C 1TGCA 1YM0A 2P95A 4ZHMU 1V2RT 1KLIH 1Z8RA 4NGAH 1B7XB 4ABBA 1OWDA 1UJ1A 5I46H 1ZR0A 1CHOF 3RXEA 4YOJA 3ZVFA 2BDGA 3PB1E 1NT1A 1GBTA 2B7DH 2CF9H 1P11E 1O2LA 2VH0A 1DSUA 1MKWH 2WPKS 1C2HA 2ZU1A 2C93B 3OTJE 5A09A 1P01A 3M5MA 3UIRA 2BY7X 1LDTT 4H42U 3T2NA 1O3AA 5DJ7A 5BRRE 4D7FA 1FDPA 5JB8S 2HPQH 3ZZAA 1GJ7B 1V2UT 5EXLA 4CRAA 4XOJA 3U8RH 2AYWA 2ZFSA 3DA9B 1Z1IA 1NFYA 1MZDA 3M3TA 4NIXA 5C2ZA 3IWMA 2RCEA 2Y7ZA 2VWNA 2W7SA 4UONA 3UWIA 2XCNA 2HVXA 4BAMB 3D23A 1EOLA 2EEKA 3RC5A 4I32A 2HGTH 3BTTE 2QXJA 3OSYA 4JMYA 2F9NA 4I33A 1UCYK 4X2VA 3ATKA 2QA9E 1A2CH 2R0LA 2P8OB 1YPMH 1NS3A 4GHQA 1CT4E 2ZU2A 3NUMA 2BY5X 3TNTA 5C1UA 3EA9A 4DG4A 1SGYE 1MKXK 2BLVA 3A83A 3A7YA 1O5GH 1SGPE 1THSH 3RXOA 1AQ7A 1HJAC 3BG8A 3TH2H 3T62A 1Y3WA 4HTCH 5DPAA 1SGCA 2OCVB 3SJIA 4J2YB 1O2SA 2GZ9A 1FAKH 3S7KB 1P06A 2ULLA 2A5IA 2AH4X 4MG3A 1P05A 2BQWB 2C8XB 2ANYA 1V2NT 1KIGH 2FI3E 2QF3A 2ZU4A 2P3FH 3SJ9A 2JH0D 2ZKSA 3BIUH 2FO9A 1K1MA 1ZPZA 4UFDH 3ZZ4A 1FNIA 1DANH 2ZTXA 1SGDE 2CHAB 5E0GA 1O3NA 1ABJH 2AMQA 3QK1A 4IW4E 3E3TA 4ESTE 3T25A 2PSYA 2ZHWH 4TY7A 4IC5A 2P94A 4YT6H 1GGDC 1VR1H 4YZUA 5EQSA 4AOQA 3GCOA 2JH6D 3S9CA 3P70B 1QGFA 3B8JA 2BHGA 1MU6B 2AGIX 5A8YA 5T3HA 1P09A 1ZJKA 1EOJA 3NKKA 5E0JA 4B73A 5EPYA 1JWTA 2OP9A 1HUTH 2FXRA 1K1OA 2FX4A 2W7UA 2BM2A 1DUEA 2G5NA 2LNCA 5GCHF 1EB2A 1IQJA 1P2QA 1FLEE 3T27A 1YPEH 5HMAA 3A85A 1BIOA 2FOBA 1EXFA 2ZP0H 4Y79A 2FODA 4ABHA 2ZPRA 1C5RA 4RSPA 4ZXYH 1J17T 3QX5H 1P02A 1GVLA 1TWXB 5LPFA 1MH0A 3SI4H 5JBTA 2JETC 1GHAG 1EAXA 5C1XA 3KEEA 3QUMP 3BSQA 1HAVA 2FOCA 2DUCA 4HGCA 5LPEA 1MQ5A 3OYPA 7LPRA 3EGKH 2VIVA 1WU1A 1BHXB 4AB9A 3KIDU 4X1QU 1F5LA 5CHAC 3RXQA 1C5YB 3ELAH 1C9TA 5HM9A 3V13A 1MD8A 1G30B 4JZFH 4I7YH 2CN0H 1MZAA 2R2WU 4CH8B 1CA8B 1NO9H 2NWNA 3SV8A 2QY0B 4FUEA 2EC9H 1BRBE 1P2JA 5EPNA 4FUIA 1IQHA 3SUEA 4IS5A 3VXEH 1CBWB 2J95A 2ZZUH 1YF4A 1G9IE 2BLQA 4K8YA 2PKAB 1SOTA 6GCHF 1WSSH 3BN9A 2A7CA 1BRUP 2PSXA 3O8RA 3QTVH 4H6SB 1OOKB 1BJUA 4FUHA 3ZZCA 2W3KA 3PMAB 1F0RA 4GSOA 5FX5A 4A1XA 4CBNA 2A4QA 4OGYA 3ENSB 3EYDA 4XE4A 2Y5FA 3E16B 4K8BA 2IJOB 2OD3B 1Z8JB 4NFEA 4TYDA 3ZZDA 1FZZA 1AO5A 1PYTC 3SNDA 2KAIB 1VITG 4X2YA 3RXRA 1W7XH 3F9EA 3LU9B 4HZHA 4IGDA 1DICA 2W3IA 2YNBA 1MTVA 2H6MA 3STIA 1BZXE 2D2DA 4MNWA 4E7RG 5JBAS 1PFXC 1D3PB 2WV5A 3MH7A 4NCYA 4ABFA 1GMCF 2OC0A 4ISIH 1T32A 4AN7A 2UWOA 1ZJDA 1OXGA 5FAHA 5JBBS 3URDA 1FN8A 1DM4B 3BTFE 3UNQA 1P10A 2VIQA 4KELA 3S0NA 4X6NA 1DS2E 1MTWA 1PPZA 1C1QA 4NWKA 1O2RA 4AX9H 2RDLA 1L4ZA 2SNVA 1BOQA 2W5EA 2OBOA 1SFIA 1F7ZA 1IQNA 3TPIZ 1A61H 2ZU5A 2H5CA 4CR5A 1GVKB 4BXSA 4ABIA 4Y10E 5BPEA 4Q7YA 2C3SA 3QGJA 1GMDG 4B2BA 1HLTH 1RS0A 1GBDA 3F1SB 4JK5A 1OP8A 2PUQH 1ANBA 3QTOH 5AVDA 5F8XA 3O8BA 3LC5A 1TNHA 1XKAC 1LHDH 1UVTH 1Z6EA 1AFQB 2VVCA 3UTUH 2FI5E 4WXIA 3E8LA 3UR9A 4BANB 3SORA 1O2ZA 1BBRE 2ZIQH 2H9HA 1W0ZU 2GKVE 3ZZ5A 1F0SA 5F8TA 1LTOA 1DDJA 1NY22 5T6FA 4I8HA 4Y11E 4X8SH 3SU4A 1DWBH 1TPOA 3KL6A 2BY8X 1ZZZA 2TRMA 1S84A 1ZOMA 3A7ZA 2P8OC 2A1DB 3HGPA 1O31A 3V7TA 3UQVA 1DWDH 2STBE 1LPGB 1MBMA 5EXMA 2ZPSA 1DITH 1O2YA 3M5OA 1FMGA 2OXSA 3GCTF 4KKDA 2FYRA 1PPCE 4NIYA 2GCTB 1WQSA 1THPB 1EJAA 2FOAA 2QXHA 1CT0E 1QQUA 1GBLA 3A8BA 1ESTA 1KXFA 2PHBA 1NN6A 1Y8TA 1ZGVA 1BRCE 3E0PB 1QBNA 3M3SA 1YYY1 3NZIA 1O36A 1PQ7A 1MCTA 4GPGA 3PWBA 3BEUA 3D49H 1QJ7B 4B2AA 4Z6AH 5T6DA 2F9PA 2A7HA 4UD9H 2PGQB 1C2IA 4I8GA 2CHAC 2Q1JA 2YNAA 4TY6A 1C5MD 5LPRA 4D9RA 3PLBA 1OSSA 2A4GA 1H4WA 3MOCA 1O32A 3FP8E 2BD4A 2EI6A 2PTCE 1W14U 1IQKA 1ZSLA 2Z9LA 3ZZ6A 2SNWA 1AD8H 1S6HA 2C8ZB 3A86A 4X6MA 3GICB 1LO6A 1SGQE 3A81A 3BTME 1GHXH 3ATWA 4R0IA 1O3DA 1G32B 2BDBA 1OP2A 3GY3A 3RMLH 1NRQH 1W3CA 1VCQA 1X7AC 2XC5A 5HXFA 1HJ9A 1ZTLA 1FY4A 5B6OA 1LVBA 2ZFTA 1CSOE 1Y3XA 2TGPZ 5HYOA 1YC0A 1GCTB 5J4SA 1BT7A 1H9IE 3VB6A 1ELFA 3A82A 1Q31A 1TBZH 1SLUB 1OWHA 1PPBH 1TPAE 1XUHA 2B5TB 3ITIA 1GHVH 1MUEB 1O5AB 1TX7A 1B0FA 4DVAU 3NPSA 1INCA 4E06H 1E34B 1OYQA 1EZUC 1GVZA 1TONA 1J8AA 1NC6A 1P2OA 5GXPA 1ZPCA 5T6GA 4KTUA 3HK6B 1RD3B 2VGCB 2Z9JA 2XC0A 3UREA 3RM2H 1DY8A 3M61U 4WJG2 3K9XB 2HOBA 1NRRH 3EE0B 3ZVBA 1WOFA 4WF8A 3E91A 5JDUB 1BHXF 1FN6A 2F9OA 4MDSA 5DK1A 4XBDA 1GI1A 1KXDA 3TK9A 1GL1A 1CBWC 3RLYH 1G3EA 4INLA 4Y0ZE 2ZQ2A 5EOKA 4WMDA 3SUDA 5A0AE 5FHTA 2RA3A 1ZGIA 2FEQH 1AN1E 3PLPA 1W2KH 3U98H 1CGJE 3RXSA 5FCRA 2P3TB 3AAUA 1KYNA 4FUGA 1ZTKA 2R3YA 4GHTA 1S5SA 2P16A 4YTAA 2BD5A 1Y3VA 4UEHH 1CA0B 1QRWA 1J14A 3E6PH 1TABE 3A8DA 1O38A 4MLFB 1H8DH 2H2ZA 4B74A 7GCHG 3ZVDA 2A32A 4ABDA 4Z0KA 1C2KA 4K1SA 2A2XH 4CR9A 2BVRH 3RU4E 1HXFH 5L2ZH 1WV7H 3TU7H 4NIWA 1HAGE 5E2OA 4YT7H 1O3CA 2GZ8A 3M37A 4WVPE 5A8ZA 4SGBE 4BAQB 4A7IB 1TE0A 3VGCB 1EASA 4UFGH 3Q3KA 3UOPA 4AG2A 4B76A 5GIBA 2W26A 3HGNA 3M7UA 1O3EA 3P95A 1EZSC 1MU8B 4AZ2B 2AEIH 3UY9A 3TJVA 4AGJA 4CH2B 5IDKA 1RFNA 2ZF0H 1O34A 2EA3A 4JZDH 2PW8H 1A7SA 1P2MA 2TGTA 1UHBB 1ZSKA 2F9UA 1K1LA 2BLOA 1MTNB 2OC1A 1L1NA 1EJNA 4U01A 3SNAA 3EA8A 5HM2A 2GDDA 2BLWA 3A80A 3TLOA 4X8TH 1AZZA 2BQ7B 5HGGA 4INHA 1FY8E 3LGTA 2ILNA 4BAHB 1GI5A 1P3CA 3U9AH 4OS6A 1TNKA 3P17H 1PPGE 3K6ZA 1O5CB 1BTUA 1CGIE 1AFQC 2GCHF 2ANWA 1QJ1B 2FYQA 1VGCB 2FS8A 3TH3H 1RJXB 3LDXH 5GCHG 1T8LA 1EPTB 3LJOA 1NFXA 4UE7H 4MVNA 2O8LA 3U1IB 2OC8A 2ZHDA 3M5LA 2TPIZ 1O3HA 1EP6A 4OS5A 2WV4A 1LPZB 1UVPA 4LK4A 1QB1A 3LC3A 2ZA5A 2FMJA 3URCA 4RN6A 4CRDA 1CQQA 4A1TA 2VWMA 1JXPA 1F0UA 5F03A 1GDUA 1C1PA 1FQ3A 1TRNA 1D4PB 2A31A 1WCZA 4FUBA 1Z8GA 2PTNA 2GCTC 1TRYA 2HNTC 4DJZB 1G3CA 2P93A 2VIOA 3QGNB 3GDSA 1D6WA 3R0FA 1L2EA 1FJSA 3ZZ9A 1SLWB 2J92A 2ODPA 2UWPA 2FS9A 2HNTF 4MTBA 1UK2A 3SU5A 3GYLB 3TK6A 6GCHG 5G4BA 1QL8A 5C20A 1UO6A 5JYIA 1XM1A 2Z9KA 2C8YB 1V3XA 1SGTA 4GVUA 2ZQ1A 1DSTA 1IHSH 4X2XA 2AGEX 1FY1A 2C8WB 1IAUA 1NROH 3RLWH 3A8CA 3MI4A 3UR6A 3PTBA 2ANKH 1C5NH 1HRTH 2K1QA 4XFQA 2VNTA 5EQRA 2VB0A 1WYKA 2BDHA 5ESTE 4B2CA 1G37A 2BX4A 1C5LH 4TPIZ 1O2JA 3GYMA 1GMCG 3RUOA 1BUIA 2XCFA 2ZTZA 3SNCA 1GBCA 1K28D 1SQAA 2RG3A 3DD2H 4CRGA 2BD9A 1A0HB 1RXPA 1NESE 4FXGH 3VB3A 3A7XA 2ZHEH 5C3NA 4NA7A 1HDTH 1HCGA 1O2IA 4LZ1H 1YPHC 3KNXA 1RTKA 1HAXB 1O30A 1D6RA 1V2JT 4OS4A 1Q2WA 3SU3A 1HAIH 1BB0B 2VJ1A 1GCTC 2XNIA 4X1PU 4AFSA 1T7CA 3DUXH 1GBAA 1C1MA 1LKBA 1EZQA 2FDAA 5FPTA 1C5TA 2Z3CA 3K65B 3OU0A 5TCAA 3NXPA 3WY8A 1SMFE 2NU1E 1F92A 3MMGA 4DCDA 3VFEA 4LXBH 4BAKB 3DFJA 5E2PA 3SW2B 1CO7E 4LZ4B 1GI2A 1K1NA 1V2ST 2TGAA 1BBRK 2Z94A 2VGCC 3A7TA 1C9PA 3ZV9A 1BCUH 3SJOA 2FM2A 3MO6A 4AB8A 3MNXA 3RXUA 3SV9A 5A0CA 1DPOA 2QN5T 4Y8ZA 1P9SA 2Q6FA 3ZVEA 1CE5A 4B75A 1KLJH 5DP4A 1FONA 2JH5D 2QIQA 1QB9A 3UNSA 3P8NA 4XDEA 1YCPH 1GWAA 3PLKA 2Y6TA 4I8JA 1C5XB 3ESTA 2ZDLA 2VU8E 3EAJA 4X8VH 4SGAE 3S9BA 2QV1A 5GPIB 1MAYA 1ETRH 1O2PA 2VIDA 1TBRH 1V2WT 3A8AA 5FCKA 1MTUA 1NRSH 2FESH 1BTWA 1O2TA 4OS2A 1C5ZB 1W7GH 1TAWA 3GCHB 3KQDA 4KTSA 4A6LA 1GJ9B 3IITA 4NZQA 3PV4A 2YOLA 4MPUA 1CA0C 1V2PT 1ELGA 1KTTB 1LVMA 5ABWA 2ZHFH 1P2IA 3MO3A 1K2I1 1JMOH 1HAHH 4THNH 7KMEH 1DT2A 1GI7B 2CXVA 3SGQE 1ANEA 2GZ7A 1GBJA 1QBVH 2A45B 1GHYH 4MPWA 1GI4A 4CRCA 1ZRBA 1O33A 1UTMA 1FY5A 1T8MA 1K1JA 1O2UA 3E1XB 3TITA 3SV6A 3LKWA 1O0DH 2F91A 4RKJB 3BTKE 1ELTA 2PKAA 2Y81A 1K22H 1AE5A 2Z3DA 5EW2H 4Q2KA 3F9HA 2FOGA 1QL7A 3G01A 2P59A 2NU0E 1SOZA 3KN2A 4Q7XA 3F9GA 2Z3EA 1ANDA 3QDZB 2ZGCA 3VGCC 3M5NA 1FPHH 5L30H 4ZROA 2FP7B 1W12U 1ARBA 2D1JA 3LPRA 3S7HB 2R2MB 4OS7A 3RU4T 4ISLA 1QL9A 5DO4H 2KAIA 1TRMA 3A87A 5E8EH 3ZVAA 1XMNB 2LPRA 3SOSA 1A5IA 1O3JA 4H6TA 1SHHB 3BTEE 1S82A 3OY6U 1A5GH 2BD2A 3PMHB 5AHGH 1IQFA 1JBUH 4Y76A 1LQDB 1AKSA 3FZZA 1UMAH 3RXFA 1MTNC 3JZ2B 1BTZA 3LJJA 1W13U 2IN2A 1TGNA 1ZHPA 2A5AA 1E37B 1EAIA 1TQ7B 1UCYH 1WTHD 1HXEH 2ZI2H 2AIQA 1V2QT 2BDCA 4YLUA 1VGCC 2UWLA 4KP0A 4O3UA 2B9LA 1F5RA 1EPTC 3DT0H 4Y7BA 4ZKNU 1A1RA 1QCPA 3ZVCA 1ARCA 1J15A 1TB6H 1WBGB 3KCGH 4ABAA 4TWWA 2WPLS 1A4WH 5DKMA 3FAOA 1IQIA 2BD8A 1QTFA 2O8TA 2ZGBH 1E38B 1HIAB 1NU7B 3SU2A 5FX6A 1K9OE 1TLDA 1GBHA 4YO9A 1RIWB 2SGDE 4NZLA 3M7TA 3KF2A 1AY6H 3D65E 3HPTB 2ZCLP 4JK6A 5EXNA 5L6NH 3PO1B 1SHYA 3RXIA 3CP7A 3LH3A 2RA0A 4NA8A 3ZZ3A 1YLCA 3MYWA 4A1VA 1PPEE 3ZZ8A 2QAAA 1XUJA 3MNSA 4XBCA 3AAVA 2G8TA 1TMBH 5GWZA 3V12A 1D3QB 5DG6A 1O2HA 1Y59T 5EU8A 6LPRA 1TNLA 4IC6A 4YM9A 1O3MA 2VWLA 4A92A 2VVVA 4AG1A 4B1TA 1ZMLA 1MKWK 2XWAA 1BMLA 3RXTA 1GL0E 1P3EA 2ZPQA 1UTNA 3FVFB 3MTYA 3K6YA 1BMAA 2B0FA 2Z6BD 1BTYA 3I29A 1AGJA 3MU0A 3QLPH 2Q6DA 3I78A 1C1SA 1BQYA 3ZV8A 1VITF 3P92A 3ZZ7A 1QRZA 1C5QA 4MNVA 1E0FD 3MU8A 3OX7U 2NU3E 2P3UB 1WUNH 4MNXA 4X1SU 8GCHF 3RXCA 1H1BA 2QXGA 3SU1A 1HGTH 2ZECA 4RKOB 1TQ0B 3STJA 1H9HE 1P03A 2PKSB 3VXFH 3QWCH 3K2UA 2VH6A 4Q7ZA 3SV2H 1IQLA 4M7GA 1CHGA 3SNEA 4A5TS 1QJ6B 4JYTA 1IQMA 1AUJA 5DP3A 8LPRA 2VVUA 1YGCH 2ZG0H 3PMJA 4FU7A 3ZZBA 1NU9A 2HWLB 1V2KT 1GBFA 1MBQA 2AFQB 5IYTA 4AYYB 5J4QA 1QY6A 2B8OH 1C2GA 3GY8A 1Z71A 3H7TA 1C1TA 2R9PA 2BD7A 4K3JA 3M35A 3GY4A 1PQ5A 1UTPA 1OKXA 3RU4D 3GY7A 2Z9GA 3KQEA 4FU8A 1O2KA 1GMDF 1OX1A 1W11U 2G52A 2ODYB 1A46H 4ZMAH 2FX6A 1IQGA 4WXVA 2HRVA 2Y82A 1UVSH 4XBBA 4FU9A 2XBWA 2R3UA 3HKIB 3V0XA 1SSXA 1TPSA 1YP9A 5DP6A 1HAYB 1MD7A 1CHOG 2CMYA 1GCDA 1C1NA 4E7NA 4AORA 2SGAA 4DGJA 1TGSZ 3U1JB 4YOIA 1C5UA 3GOVB 1HB0B 2A7JA 1E35B 2XC4A 1C5VA 2Y7XA 3NWUA 3U8OH 3NK8A 3KQCA 1LCYA 3GY5A 4AFQA 2VINA 1ESBA 1EQ9A 3MFJA 1GHZA 1GPZA 3A84A 2FTMA 3DHKH 1B5GH 4X1NU 2HPPH 1AMHA 2EI7A 1IQEA 1DE7H 3P8GA 1P2KA 2ALPA 3KHVA 1AWHB 2I6QA 1A3BH 4MQAA 1A0LA 3GY2A 4ZUHA 1TNGA 2QCYA 2OQ5A 1AWFH 1C2EA 1FV9A 1LHGH 3MU4A 2XBYA 2F9VA 3RXLA 1KDQB 5DGJA 3M3VA 3GCHC 2A4RA 2FI4E 1P8VC 2Y80A 1ZPBA 1BJVA 2OBQA 1TA2A 3CS0A 4ISOA 1HV7A 1C1WH 1O2VA 3UUZA 3BTQE 3L3TA 3O8DA 4X2WA 5FPSA 2ZCKP 1PJPA 2A0QB 1O2OA 1W10U 4WMFA 2ZFRH 3UFAA
chains in the Genus database with same CATH superfamily
3VEQB 2DE9A 4CRBA 1TIOA 3LT3A 1SR5C 1S85A 4MPXA 1EKBB 2BDAA 3RXKA 2BVXH 5DP7A 3LH1A 4I8KA 1TBQH 1Z6JH 1UVOA 2NU4E 2PLXA 1UTKA 3SGAE 1WXRA 2IPHA 1GI9B 1GHBF 5EODA 1SPJA 1BTXA 1GJAB 2J34A 3KYFA 1GG6B 2BTCE 4K1TA 4AGKA 3MHWU 1SGIB 1LVYA 1CVWH 1HAZB 1HYLA 4ABEA 4ZXXH 4ACBA 4B6EA 2F4LA 4UDWH 2VIPA 2GT7A 2QC2A 1O2GH 4FUDA 2GVFA 1VZQH 1GMHF 2FWWA 4Y0YE 3GDVA 2WPHS 3SQHE 3BV9B 3FFGA 2ZDVH 7ESTE 1DFPA 3LGIA 2GP9B 1K21H 2WYJA 5CMXH 1SB1H 4KGAA 3TJNA 3SGBE 1OWIA 5EW1H 3EA7A 3A7VA 2A2QH 3FANA 1MCVA 3SU0A 4TWYA 1TGTA 1TMTH 1FIWA 1GI0A 1DWEH 3SU6A 5C5OA 1HBTH 1QFKH 2NU2E 1ZSJA 3AVZA 1D3DB 1GJBB 2OC7A 1NZQH 4FVBA 1B0EA 1D3TB 1K1PA 1GHWH 2GT8A 5AFYH 2V3HH 3FP6E 1OYTH 1G2MA 1KXBA 3D62A 3RC4A 4ZHAA 1WTGH 1AFEH 1O3LA 1L0ZA 4GCHF 1RIWC 1AUTC 2ZGXH 1KXAA 1NRPH 3AASA 4Y71A 2C4FH 1ACBE 4Y8YA 2XWBI 1UHBA 1NFWA 4D76A 1S6FA 1FXYA 1SG8B 1ELDE 3BG4B 1GJ5H 1VJAU 3U8TH 3T26A 3PO1C 2V0BA 1TALA 2Z7FE 4BXWA 4NFFA 1BDAA 1T8OA 2J2UA 3SBKA 2D8WA 2G00A 3N7OA 2SGQE 3MH5A 3UPEA 6ESTA 1YPGH 1EZXC 1SVPA 3IG6B 3C27B 4TPYA 3T29A 3T5FH 1TGBA 2SFAA 2SGEE 2FOFA 4R8TB 1EAUA 2EI8A 1D9IA 2AS9A 4IN2A 1EPTA 4H4FA 1BMMH 3ZYDA 2QGRA 1GDNA 2ZEBA 2FZZA 2ZC9H 1O3PB 1VCPA 4K2YA 2XBXA 3RXMA 3KQ5A 6CHAB 4JYVH 5JB9S 2YMSC 4IN1A 1N8OB 3LOXA 1QA7A 3FP7E 2GV7A 3GISB 2WPDD 2FLRH 3O8CA 4NWLA 3SUFA 1THRH 2GMTB 3MU1A 1KTSB 2WV9A 2ZHQH 4WH6A 3I77A 2KCYA 1QQ4A 3BTGE 1OWKA 1FAXA 2ZTYA 4E05H 3U69H 3OY5U 3BTDE 4U2WA 4D9QA 3MWIU 4K5ZA 1UTQA 7GCHF 3H7OA 4FUJA 1GJDB 4O9VA 3RXAA 3UOUA 1UK4A 4KTCA 5DP8A 2ZO3H 3Q00A 1GJCB 2BY6X 4Y7AA 4HI3A 1O2NA 1O3BA 2PKSC 5LH8A 1DOJA 2ZU3A 2OUAA 4PROA 1V2MT 5E0HA 5FL7D 1G36A 3JZ1B 2OTVA 2FIRH 3ODFA 4O3TA 1AVGH 3F68H 5H4IB 2ODQA 2JIZD 2JKHA 3AW1A 5L2YH 1GJ8B 1BMNH 2GGVB 1QB6A 2GX4A 2BZAA 4B6FA 2WPJS 5GJ4B 3H5CB 1IHTH 2AMDA 3PV5A 3SZNA 2PFEA 3OEHD 1GI3A 1PPHE 1UVUH 2FOEA 2IJD1 4DW2U 1QA0A 2XBVA 4GUXA 2J9NA 3SJ8A 2HNTE 1QRXA 2D26C 5C94A 2TBSA 1HPGA 1OPHB 1UW7A 1QNJA 1GI6A 2ZGJA 3Q3XA 5C1YA 5JBCS 4CHAB 2CJIA 2G5VA 1SLVB 3LGYA 1BTHH 1GBMA 1NFUA 4UFFH 3CS7A 2WPMS 4QT8C 1AVWA 1ELVA 2ZDNA 1V6DA 3Q77A 1C1VH 1C2MA 1Y5UT 3ZVGA 1J16A 1QHRB 3ATMA 4AYVB 1H8ED 2CF8H 1O2MA 5FBEA 3RP2A 2BMGB 1HAVB 3TIUA 4XD7D 2G4TA 1VCWA 4D8NA 1SL3A 1Y5AT 1OWJA 3B23B 1SLXB 3WWFA 1BITA 5SGAE 4MPVA 4J1YA 5AF9H 2H9TH 1H8HD 1XVMA 2I6SA 5CE1A 1O5FH 1T8NA 1UTJA 1QBOA 1QR3E 1ESAA 2M5TA 1QIXB 1OWEA 1EP5A 2XXLA 3W1EA 1LVOA 3MNCA 1HFDA 1EJMA 1E36B 4BTUB 5LGOA 1ANCA 4VGCB 4X6OA 2STAE 2HLCA 3P8FA 3MU5A 3LGVA 1XX9A 2UUFB 1ZMJA 1PYTD 3LGUA 3SQEE 3ATIA 1GI8B 3N99A 1XUFA 1YPHE 4XSKU 1RRKA 1U6QA 2KR7A 1COWD 1WAYB 3F0OA 1S0RA 5FXLA 4BAOB 1ELBA 1YPJH 3BF6H 1YCPM 3RDZA 2ALVA 2BDIA 3RMNH 2O8MA 2OLGA 1G2LA 2F9BH 1YKTA 4BTTB 9LPRA 4I31A 1LHEH 1P57B 3SJKA 1NM6A 4O97A 1UCYE 1SBWA 2AMPA 1SGRE 3HKJB 4ABJA 3F2FA 1GJ6A 1SC8U 3PV2A 4HFPB 1HAPH 2G51A 2ZWLH 1JRSA 1OP0A 2ANMH 1SI5H 4CREA 2THFB 1PQAA 3GCTG 1W0YH 2J38A 1KY9A 1PPFE 2O9QA 3M7QA 3AW0A 3SNBA 2GTBA 3S69A 1V2OT 4IMZA 1EUFA 2VWOA 3W94A 1RTFB 1CGHA 1GBBA 3A88A 1TOCB 1FUJA 1TX8A 1ZHRA 2G55A 3F2GA 4DT7B 2GD4B 2TGDA 1P0SH 1TX6A 1Z1JA 2SGPE 2H5DA 3RXHA 2ASUB 1AHTH 4AFZA 2H1UA 3FN8A 1GG6C 2AHME 1O3KA 2UUYA 3VB7A 2R0KA 1YPLH 3FZDA 5DN6D 1FIZA 1AVXA 4ABGA 3SI3H 2SGFE 3P6ZB 5I25A 1JIMA 3LONA 8GCHG 1C5PA 2A5KA 1DLEA 3LGWA 5DSFA 3SZEA 3HK3B 1AKSB 5CDFE 1Y3UA 3RXDA 4DIIH 2DE8A 1C5OH 4BTIB 3RXJA 1FI8A 1G3BA 3MO9A 1O2QA 1P12E 1O5DH 1ETTH 1L1GA 3TVJB 1LHFH 1IOEA 1MTSA 4Q80A 1C1UH 2J4IA 3LIWA 1V2VT 2WSSD 1MQ6A 4U32A 4ZKSU 1JRTA 5ETXA 3ZYEA 4B71A 3F9FA 5K7RA 2WPIS 1BA8B 2QYIA 3QZRA 1YBWA 2Q6GA 2XYAA 1JOUB 1LQEA 3Q76A 3QO6A 4DURA 3BEFB 3SN8A 1O2XA 3RXPA 5FPYA 1XXDA 3A7WA 3SHAH 1H9LB 1AB9B 1Z7KA 4FVDA 2CV3A 1DX5M 1MKXH 1C2JA 2J94A 4FUCA 1DY9A 1BMFD 1T31A 3SV7A 1C4Y2 1AZ8A 5EG4A 1GBEA 1MMJN 2G4UA 1GHAF 2ZGHA 3BG4C 4OS1A 1O3GA 3TJUA 4WMEA 1A5HA 4WY3A 1ELAA 1DLKB 1SGNE 1MAXA 1S0QA 4O03A 2O8UA 2VIWA 2C90B 1F2SE 1V2TT 1UTOA 1ZRKA 2FOHA 4GLYA 2G81E 2H9EH 2ZFQH 1JIRA 1LMWB 1XUGA 2V3OH 1ELEE 4CBOA 4BNRA 1PQ8A 3GS9A 3SO3A 3BTHE 1TPPA 1HNEE 2ZCHP 4WH8A 3UWJH 1EAWA 4F55A 2A4OA 1WQVH 1O35A 1XKBC 1HIAA 4Y8XA 2WUCA 1YLDA 1CU1A 6CHAC 4ZKOU 1H8IH 4F49A 1N8OC 3PWCA 4ZAEA 5K0HA 1A3EH 3UQOA 3RXBA 4ASHA 3TH4H 3E90B 5ESBA 2GMTC 1TOMH 2BOHB 2BX3A 4AC9A 2CK3D 4MNYA 2HALA 1W0KD 4ZH8A 4M9FA 4X8UH 1SGFA 5F6MA 1L1JA 4DIHH 1XVOA 1KLTA 1LPKB 3EQ0H 1C2DA 2UUKB 3TNSA 1N6YA 4WWYA 1UTLM 4F4OC 5AFZH 3SUGA 2V6NA 2BXUH 4ISNA 1C2LA 3GY6A 1HJAB 1S81A 2WINI 2ZDKA 2PGBB 3VG8A 1V2LT 1C2FA 3MH6A 2Y5GA 3OFND 4IMQA 1C4U2 2WZQA 1ZTJA 3BIVH 4YESB 1NPMA 1VJ9U 3VB4A 2W6ID 2BQ6B 3C1KA 1Y5BT 3PROA 3W95A 1M9UA 2WYGA 4JYUH 4JZIA 4K1EA 5C67A 2BZ6H 1A0JA 1TA6A 2FTLE 2ZFFH 4LOYH 3KQBA 1FY3A 1CT2E 5F8ZA 1EB1H 1ABIH 1GHBG 1BBRH 3VPKA 3RXVA 4NSVA 1SFQB 3TGIE 2OQUA 2ZFPH 2KCAA 4F48B 4U30A 2JJ2D 2V35A 2UUJB 2OINA 4ZHLU 3TGKE 1TNJA 1O5EH 5HIZA 1UK3A 3E0NB 4CHAC 1Y3YA 3KYGA 2BYAX 1N6XA 1KXCA 1GGDB 3HATH 1EFRD 3GCNA 3L33A 3SHCH 1P04A 1GMHG 2BVSH 1GDQA 3BEIB 1GBIA 4YOGA 3QZQA 1DVAH 1E79D 3CENA 4UFEH 5DP5A 3TK5A 1RTLA 4IBLH 4JZ1A 4X0WU 3TGJE 1O2WA 1O3IA 3BTWE 1P9UA 2PR3A 5C5NA 1OS8A 1DXPA 1Z8IB 1YPKH 4X6PA 2AIPA 1HAOH 4INKA 5EGMA 2PWXA 1XUIA 4BOHA 1HJ8A 3M36A 2CGAA 3H09A 1LKAA 2Y5HA 1AU8A 2AERH 1ETSH 2GCHG 2RFKC 1ZLRA 2BXTH 8ESTE 5EQQA 1ORFA 2ZNKH 5FBIA 1NRNH 1SKYE 1BRAA 2LP6A 2KCOA 4GCHG 1FPCH 4VGCC 1XXFA 2QE7D 1ZMNA 1DXWA 1ZYOA 4X1RU 4ISHH 2JETB 1N1LA 3V3MA 2XRCA 1EATA 1LHCH 2PV9B 2K8IA 1WDIA 2WUBA 3EDXB 1P2NA 1NTPA 2XTTB 1TMUH 3GDUA 3PMBB 5PTPA 4CRFA 1AI8H 1ZHMA 5CHAB 2F83A 4NIVA 4NSYA 2BY9X 1VITH 1K1IA 2BB4A 2L6OA 2ZDAH 4I8LA 1O3OA 3UNRA 3A89A 4D7GA 5TJXA 5A8XA 4YLQH 3RXGA 2BDYA 1W8BH 3DFLA 4ZKRU 1SGFG 2IOTA 1AE8H 4DOQA 1F0TA 3T28A 9ESTA 3R3GB 3MNBA 3PTNA 4FUFA 1C1RA 1Q3XA 1NBME 1T4VH 4GAWA 4JZEH 1ID5H 1KDQA 3S9AA 1RGQA 2AGGX 2FLBH 1O37A 2GV6A 1C1OA 2PP6A 1C4V2 2ZDMA 3L6PA 1ELCA 1F5KU 3P8OA 2F3CE 3PM3A 1GBKA 1O5BB 1SQTA 1GJ4H 4NG9H 3Q3YA 3ODDA 4YXWD 1O3FA 2Z9IA 1XUKA 5DP9A 1TFXA 5A2MH 2O8WA 1YCPK 1SGEE 2QF0A 8KME2 2PUXB 5TCCA 3ZIAD 4NA9H 5GDSH 5JPMH 1J9CH 3PYHA 4DY7B 3RMOH 3MH4A 5A0BA 1S83A 1L4DA 3VB5A 4OGXA 2QXIA 4K69A 1KSNA 2GDEH 3RC6A 2XW9A 1C5SA 1AIXH 1QURH 2ESTE 4RI0A 1DWCH 1BTPA 3TJOA 1T4UH 2BOKA 3NCLA 1EX3A 4JCNA 5GNDA 3F6UH 3ATLA 1SQOA 3B9FH 1DUAA 1KXEA 1TNIA 2TIOA 3RMMH 3RM0H 1O39A 1G3DA 2FOMB 1C5WB 4K60A 4AFUA 2BD3A 2FPZA 3KGPA 3QN7A 4Y6DA 1TYNA 1AB9C 1TGCA 1YM0A 2P95A 5EJZA 4ZHMU 1V2RT 1KLIH 1Z8RA 4NGAH 1B7XB 4ABBA 2V7QD 1OWDA 1UJ1A 5I46H 1ZR0A 1CHOF 3RXEA 4YOJA 3ZVFA 2BDGA 3PB1E 1NT1A 1GBTA 2B7DH 2CF9H 1P11E 1O2LA 2VH0A 1DSUA 1MKWH 2WPKS 1C2HA 2ZU1A 2C93B 3F3BA 3OTJE 5A09A 1P01A 3M5MA 3UIRA 2BY7X 1LDTT 4H42U 4TT3D 3T2NA 1O3AA 5DJ7A 5BRRE 4D7FA 1FDPA 2KX4A 5JB8S 2HPQH 3ZZAA 1GJ7B 2W6JD 1V2UT 5EXLA 4CRAA 4XOJA 3U8RH 2AYWA 2ZFSA 3DA9B 3F2HA 1Z1IA 1NFYA 1MZDA 3M3TA 1K0HA 4NIXA 5C2ZA 3IWMA 2RCEA 2Y7ZA 2VWNA 2W7SA 4UONA 3UWIA 2XCNA 2HVXA 4BAMB 1SQRA 3D23A 1EOLA 2EEKA 3OEED 3RC5A 4I32A 2HGTH 3N7DA 3BTTE 2QXJA 3OSYA 4JMYA 2F9NA 4I33A 2IPQX 1UCYK 4X2VA 3ATKA 2QA9E 1A2CH 2R0LA 2P8OB 1S6LA 1YPMH 1NS3A 4GHQA 1CT4E 2ZU2A 1FX0B 3NUMA 2BY5X 3TNTA 5C1UA 3EA9A 4DG4A 1SGYE 1MKXK 2BLVA 3SYJA 3A83A 3A7YA 1O5GH 1SGPE 1THSH 3RXOA 1AQ7A 1HJAC 3BG8A 3TH2H 3T62A 1Y3WA 4HTCH 5DPAA 2KM0A 1SGCA 2OCVB 3SJIA 4J2YB 1O2SA 2GZ9A 1FAKH 5F53A 3S7KB 1P06A 3FO8D 2ULLA 2A5IA 2AH4X 4MG3A 1P05A 2BQWB 2C8XB 2ANYA 1V2NT 1KIGH 2FI3E 2QF3A 2ZU4A 2P3FH 3SJ9A 2JH0D 2ZKSA 3BIUH 2FO9A 1K1MA 1ZPZA 4UFDH 3ZZ4A 1FNIA 1DANH 2ZTXA 1SGDE 2CHAB 2JJ1D 5E0GA 1O3NA 1ABJH 2AMQA 3QK1A 4IW4E 3E3TA 4ESTE 3T25A 2PSYA 2ZHWH 5B6LA 4TY7A 4IC5A 2P94A 4YT6H 1GGDC 1VR1H 4YZUA 5EQSA 4AOQA 3GCOA 2JH6D 3S9CA 3P70B 1QGFA 2EY4C 3B8JA 2BHGA 4ASUD 1MU6B 2AGIX 5A8YA 4XRNA 5T3HA 3OAAD 1P09A 1ZJKA 1EOJA 3NKKA 5E0JA 4B73A 5EPYA 1JWTA 2OP9A 1HUTH 2FXRA 1K1OA 2FX4A 2W7UA 2BM2A 5C0UA 1DUEA 2G5NA 2LNCA 5GCHF 1EB2A 1E1QD 1IQJA 1P2QA 1FLEE 1YLNA 3T27A 1YPEH 5HMAA 3A85A 1BIOA 2FOBA 1EXFA 2ZP0H 4Y79A 2FODA 4ABHA 2ZPRA 1C5RA 4RSPA 4ZXYH 1J17T 3QX5H 3DSOA 1P02A 1GVLA 1TWXB 5LPFA 1MH0A 2M2AA 3SI4H 5JBTA 2JETC 1GHAG 1EAXA 5C1XA 3KEEA 3QUMP 3BSQA 1HAVA 2FOCA 2DUCA 4HGCA 5LPEA 1MQ5A 3OYPA 7LPRA 3EGKH 2VIVA 1WU1A 1BHXB 4AB9A 3KIDU 4X1QU 1F5LA 5CHAC 3RXQA 1C5YB 3ELAH 3OE7D 1C9TA 5HM9A 3V13A 1MD8A 1G30B 4JZFH 4I7YH 2CN0H 1MZAA 2R2WU 5HKKD 4CH8B 1CA8B 1NO9H 2NWNA 3SV8A 2QY0B 4FUEA 2EC9H 1BRBE 1P2JA 5EPNA 4FUIA 1IQHA 3SUEA 4IS5A 3VXEH 1CBWB 2J95A 2ZZUH 1YF4A 1G9IE 2BLQA 4K8YA 2PKAB 1SOTA 6GCHF 1WSSH 2J5UA 2A7CA 1BRUP 2PSXA 2XOKD 3BN9A 3QTVH 3O8RA 3MQKC 4H6SB 1OOKB 1BJUA 4FUHA 3ZZCA 2W3KA 3PMAB 1F0RA 4GSOA 5FX5A 4A1XA 4CBNA 1KMHB 2A4QA 4OGYA 3ENSB 3EYDA 4XE4A 2Y5FA 3E16B 4K8BA 2IJOB 2OD3B 1Z8JB 4NFEA 4TYDA 3ZZDA 1FZZA 1AO5A 1PYTC 3SNDA 2KAIB 1VITG 4X2YA 3RXRA 1W7XH 3F9EA 3LU9B 4HZHA 4IGDA 1DICA 2W3IA 2YNBA 3DSGA 1MTVA 2H6MA 3STIA 1BZXE 2D2DA 4MNWA 4E7RG 5JBAS 2KCPA 1PFXC 1D3PB 2WV5A 3MH7A 4NCYA 4ABFA 1GMCF 2OC0A 4ISIH 1T32A 4AN7A 2J98B 2UWOA 1ZJDA 1OXGA 5FAHA 5JBBS 3URDA 1FN8A 1DM4B 3BTFE 3UNQA 1P10A 2VIQA 4KELA 3S0NA 4X6NA 2L74A 1DS2E 1MTWA 1PPZA 2V3MA 1C1QA 4NWKA 1O2RA 4AX9H 2RDLA 1L4ZA 2SNVA 1BOQA 2W5EA 2OBOA 1SFIA 1F7ZA 1IQNA 3TPIZ 1A61H 2ZU5A 3DSPA 2H5CA 4CR5A 1GVKB 4BXSA 4ABIA 4Y10E 5BPEA 4Q7YA 2C3SA 3QGJA 1QZ8A 1GMDG 4B2BA 1HLTH 1RS0A 1GBDA 3F1SB 4JK5A 1OP8A 2PUQH 1ANBA 3QTOH 5AVDA 5F8XA 3O8BA 3LC5A 1TNHA 1XKAC 2KFWA 1LHDH 1UVTH 1Z6EA 4P00A 1AFQB 2VVCA 3UTUH 2FI5E 4WXIA 3E8LA 3UR9A 4BANB 3SORA 1O2ZA 1BBRE 2ZIQH 2H9HA 1W0ZU 2GKVE 3ZZ5A 1F0SA 5EJ1A 5F8TA 1LTOA 1DDJA 1NY22 5T6FA 4I8HA 4Y11E 4X8SH 3SU4A 1DWBH 1TPOA 3KL6A 2BY8X 1ZZZA 2TRMA 1S84A 1ZOMA 3A7ZA 2P8OC 2A1DB 3HGPA 1O31A 3V7TA 3UQVA 1DWDH 2STBE 1LPGB 1MBMA 5EXMA 2ZPSA 1DITH 1O2YA 3M5OA 1FMGA 2OXSA 3GCTF 4KKDA 2FYRA 1PPCE 4NIYA 2GCTB 1WQSA 4RT0A 1THPB 1EJAA 2FOAA 2QXHA 1CT0E 1QQUA 1GBLA 3A8BA 1ESTA 1KXFA 2PHBA 1NN6A 1Y8TA 1ZGVA 1BRCE 1OHHD 3E0PB 1QBNA 3M3SA 1YYY1 3NZIA 1O36A 1PQ7A 1MCTA 2EQNA 4GPGA 3PWBA 3BEUA 3D49H 1QJ7B 4B2AA 4Z6AH 5T6DA 2F9PA 2A7HA 4UD9H 2PGQB 1C2IA 4I8GA 2CHAC 2Q1JA 2YNAA 4TY6A 1C5MD 5LPRA 4D9RA 3PLBA 1OSSA 2A4GA 1H4WA 3MOCA 1O32A 3FP8E 2BD4A 2EI6A 2PTCE 1NBMD 1W14U 1IQKA 1ZSLA 3EE7A 2Z9LA 3ZZ6A 2SNWA 1AD8H 1S6HA 2C8ZB 3A86A 4X6MA 3GICB 1LO6A 2QF5A 1SGQE 3A81A 3BTME 1GHXH 3ATWA 4R0IA 1O3DA 1G32B 2BDBA 1OP2A 3GY3A 3RMLH 1NRQH 1W3CA 1VCQA 4DT4A 1X7AC 2XC5A 5HXFA 4HG6A 1HJ9A 1ZTLA 1FY4A 5B6OA 5IK2D 1LVBA 2ZFTA 1CSOE 1Y3XA 2TGPZ 5HYOA 3U28C 1YC0A 1GCTB 5J4SA 1BT7A 1H9IE 3VB6A 1ELFA 3A82A 1Q31A 1TBZH 1SLUB 1OWHA 1PPBH 1TPAE 1XUHA 2B5TB 3ITIA 1GHVH 1MUEB 1O5AB 1TX7A 1B0FA 4DVAU 3NPSA 1INCA 2QF4A 4E06H 1E34B 1OYQA 1EZUC 1GVZA 1TONA 1J8AA 1NC6A 1P2OA 5GXPA 1MABB 1ZPCA 5T6GA 2K0QA 4KTUA 3HK6B 1RD3B 2VGCB 2Z9JA 2XC0A 3UREA 3RM2H 1DY8A 5C17A 3M61U 4WJG2 3K9XB 5KECA 2HOBA 1NRRH 3EE0B 3ZVBA 1E1RD 1WOFA 4WF8A 3E91A 5JDUB 1BHXF 1FN6A 2F9OA 4MDSA 5DK1A 4XBDA 1GI1A 1KXDA 3TK9A 1GL1A 1CBWC 3RLYH 1G3EA 4INLA 4Y0ZE 2ZQ2A 5EOKA 4WMDA 3SUDA 1VKYA 5A0AE 5FHTA 2RA3A 1ZGIA 2FEQH 1AN1E 3PLPA 5HIYA 1W2KH 3U98H 1CGJE 3RXSA 5FCRA 2P3TB 3AAUA 1KYNA 4FUGA 1ZTKA 2R3YA 4GHTA 1S5SA 2P16A 4YTAA 2BD5A 1Y3VA 4UEHH 1CA0B 1QRWA 1J14A 3E6PH 1TABE 3A8DA 5KGOA 1O38A 1W0JD 4MLFB 1H8DH 2H2ZA 4B74A 7GCHG 3ZVDA 2A32A 4ABDA 4Z0KA 1C2KA 4K1SA 2A2XH 4CR9A 2BVRH 3RU4E 1HXFH 5L2ZH 1WV7H 3TU7H 4NIWA 1HAGE 5E2OA 4YT7H 2GJGA 1O3CA 2GZ8A 3M37A 4WVPE 5A8ZA 4SGBE 4BAQB 4A7IB 1TE0A 3VGCB 3AK5A 1EASA 4UFGH 3Q3KA 3UOPA 4AG2A 4B76A 2OK5A 5GIBA 2W26A 3HGNA 3M7UA 1O3EA 3P95A 1EZSC 1MU8B 4AZ2B 2AEIH 3UY9A 3TJVA 4AGJA 4CH2B 4I86A 5IDKA 1RFNA 2ZF0H 1O34A 3WWBA 2EA3A 4JZDH 2PW8H 1A7SA 1P2MA 2TGTA 1UHBB 1ZSKA 2F9UA 1K1LA 2BLOA 1MTNB 2OC1A 1L1NA 1EJNA 4U01A 3SNAA 3EA8A 5HM2A 2GDDA 2BLWA 3A80A 3TLOA 4X8TH 1AZZA 2BQ7B 5HGGA 4INHA 1FY8E 3LGTA 2ILNA 4BAHB 1GI5A 1P3CA 3U9AH 4OS6A 5CHBA 1TNKA 3P17H 1PPGE 3K6ZA 1O5CB 1BTUA 2WHXA 1CGIE 1AFQC 2GCHF 2ANWA 1QJ1B 2YMSD 2FYQA 1VGCB 2FS8A 4Z1MD 3TH3H 1RJXB 3LDXH 5GCHG 1T8LA 4Q63A 1EPTB 3LJOA 1NFXA 4UE7H 4MVNA 2O8LA 3U1IB 2OC8A 2ZHDA 3M5LA 4ZCNA 2TPIZ 1O3HA 1EP6A 4OS5A 2WV4A 1LPZB 1UVPA 4LK4A 1QB1A 3LC3A 2ZA5A 2FMJA 3URCA 4RN6A 4CRDA 1CQQA 4A1TA 2VWMA 1JXPA 1F0UA 5F03A 1GDUA 1C1PA 4TSFD 1FQ3A 1TRNA 1D4PB 2A31A 1WCZA 4FUBA 1Z8GA 2PTNA 2GCTC 1TRYA 2HNTC 4DJZB 1G3CA 3PRBA 2P93A 2VIOA 3QGNB 3GDSA 1D6WA 3R0FA 1L2EA 1FJSA 3ZZ9A 1SLWB 3FOAA 2J92A 2ODPA 2UWPA 2FS9A 2HNTF 4MTBA 1UK2A 3SU5A 3GYLB 3TK6A 6GCHG 5G4BA 1QL8A 5C20A 1UO6A 5JYIA 1XM1A 2Z9KA 2C8YB 1V3XA 1SGTA 4GVUA 2ZQ1A 1DSTA 1IHSH 4X2XA 2AGEX 1FY1A 2C8WB 1IAUA 1NROH 3RLWH 3A8CA 3MI4A 3UR6A 3PTBA 2ANKH 1C5NH 1HRTH 2K1QA 4XFQA 2VNTA 5EQRA 2VB0A 1WYKA 2BDHA 5ESTE 4B2CA 1G37A 2BX4A 1C5LH 4TPIZ 5EIYA 1O2JA 3GYMA 1GMCG 3RUOA 1BUIA 2XCFA 2ZTZA 2F43B 3SNCA 1GBCA 1K28D 1SQAA 2RG3A 3DD2H 4CRGA 2BD9A 1A0HB 1RXPA 1NESE 4FXGH 3VB3A 3A7XA 2ZHEH 5C3NA 3WW7A 4NA7A 1HDTH 1HCGA 1O2IA 4LZ1H 1YPHC 3KNXA 1RTKA 1HAXB 1O30A 1D6RA 1V2JT 4OS4A 1Q2WA 3SU3A 1HAIH 1BB0B 2VJ1A 1GCTC 2XNIA 4X1PU 4AFSA 1T7CA 3DUXH 1GBAA 1C1MA 1LKBA 1EZQA 2FDAA 5FPTA 1C5TA 2Z3CA 3K65B 3OU0A 5TCAA 3NXPA 3WY8A 1SMFE 2NU1E 1F92A 3MMGA 4DCDA 3VFEA 4LXBH 4BAKB 3NRLA 3DFJA 5E2PA 3SW2B 1CO7E 4LZ4B 1GI2A 1K1NA 1V2ST 2TGAA 1BBRK 2Z94A 2VGCC 3A7TA 1C9PA 3ZV9A 1BCUH 3SJOA 2FM2A 3MO6A 4AB8A 3MNXA 3RXUA 3SV9A 5A0CA 1DPOA 2QN5T 4Y8ZA 1P9SA 2Q6FA 3ZVEA 1CE5A 4B75A 1KLJH 5DP4A 1FONA 2JH5D 2QIQA 1QB9A 4FOUC 3P8NA 4XDEA 3UNSA 5EJLA 1YCPH 1GWAA 3PLKA 2Y6TA 4I8JA 1C5XB 3ESTA 2ZDLA 2VU8E 3EAJA 2XNDD 4X8VH 4SGAE 3CNRA 3S9BA 2QV1A 5GPIB 1MAYA 1ETRH 1O2PA 2VIDA 1TBRH 1V2WT 3A8AA 5FCKA 1MTUA 1NRSH 2FESH 1BTWA 1O2TA 4OS2A 1C5ZB 1W7GH 1TAWA 3GCHB 3KQDA 4KTSA 4A6LA 1GJ9B 3IITA 4NZQA 3PV4A 2YOLA 4MPUA 1CA0C 1V2PT 1ELGA 1KTTB 1LVMA 5ABWA 2ZHFH 1P2IA 3MO3A 1K2I1 1JMOH 1HAHH 4THNH 7KMEH 1DT2A 1GI7B 2CXVA 3SGQE 1ANEA 3F0PA 2GZ7A 1GBJA 1QBVH 2A45B 1GHYH 4MPWA 1GI4A 4CRCA 1ZRBA 1O33A 4Q4LA 1UTMA 1FY5A 1T8MA 1K1JA 1O2UA 2J97A 3E1XB 3TITA 3SV6A 3LKWA 1O0DH 2F91A 4RKJB 3BTKE 1ELTA 2PKAA 2Y81A 1K22H 1AE5A 2Z3DA 5EW2H 4Q2KA 3F9HA 2FOGA 1QL7A 3G01A 2P59A 2NU0E 1SOZA 3KN2A 4Q7XA 3F9GA 2Z3EA 2RDEA 1ANDA 3QDZB 2ZGCA 3VGCC 3M5NA 1FPHH 5L30H 4ZROA 4ACAA 2FP7B 1W12U 1ARBA 2D1JA 3LPRA 3PRDA 3S7HB 2R2MB 4OS7A 3RU4T 4ISLA 1QL9A 5DO4H 2KAIA 1TRMA 3A87A 5E8EH 3ZVAA 1XMNB 2LPRA 3SOSA 1A5IA 1O3JA 4H6TA 1SHHB 3BTEE 1S82A 3OY6U 1A5GH 2BD2A 3PMHB 5AHGH 1IQFA 2HVYB 1JBUH 4Y76A 1LQDB 4FETA 1AKSA 3FZZA 1UMAH 2J98A 3RXFA 1MTNC 3JZ2B 1BTZA 3LJJA 1W13U 2IN2A 1TGNA 1ZHPA 2A5AA 1E37B 1YY3A 1EAIA 1TQ7B 1UCYH 4RT1A 1WTHD 1HXEH 2ZI2H 2AIQA 1V2QT 2BDCA 4YLUA 1VGCC 3DCLA 2UWLA 4KP0A 4O3UA 2B9LA 1F5RA 1EPTC 3DT0H 4Y7BA 4ZKNU 1A1RA 5C0TA 1YWUA 1QCPA 3ZVCA 1ARCA 1J15A 1TB6H 1WBGB 3KCGH 4ABAA 4TWWA 2WPLS 1A4WH 5DKMA 3FAOA 2VBCA 1IQIA 2BD8A 1QTFA 2O8TA 2ZGBH 1E38B 1HIAB 1NU7B 3SU2A 5FX6A 1K9OE 1TLDA 1GBHA 4YO9A 1RIWB 2SGDE 4NZLA 2JDID 3M7TA 3KF2A 1AY6H 3D65E 3HPTB 2ZCLP 4JK6A 5EXNA 5L6NH 4OM9A 3PO1B 1SHYA 3RXIA 3CP7A 3LH3A 2RA0A 4NA8A 3ZZ3A 1YLCA 3MYWA 4A1VA 1PPEE 3ZZ8A 2QAAA 1XUJA 3MNSA 4XBCA 3AAVA 2G8TA 1TMBH 5GWZA 3V12A 4P02A 1D3QB 5DG6A 1O2HA 1Y59T 5EU8A 6LPRA 1TNLA 4IC6A 4YM9A 1O3MA 2VWLA 4A92A 2VVVA 3UAIC 4AG1A 4B1TA 1ZMLA 1MKWK 2XWAA 2YMSB 1BMLA 3RXTA 1GL0E 1P3EA 2ZPQA 1UTNA 3FVFB 3MTYA 2LELA 3K6YA 1BMAA 2B0FA 2Z6BD 1BTYA 3I29A 1AGJA 3MU0A 3QLPH 2Q6DA 3I78A 1C1SA 1BQYA 3ZV8A 1VITF 3P92A 5T1VA 3ZZ7A 1QRZA 1C5QA 4MNVA 1E0FD 3MU8A 3OX7U 2NU3E 2P3UB 1WUNH 4MNXA 4X1SU 8GCHF 3RXCA 1H1BA 2QXGA 3SU1A 1HGTH 2ZECA 4RKOB 1TQ0B 3STJA 1H9HE 1P03A 2PKSB 3VXFH 3QWCH 3K2UA 2VH6A 4Q7ZA 3SV2H 1IQLA 4M7GA 1CHGA 3SNEA 4A5TS 1QJ6B 4JYTA 1IQMA 1AUJA 5DP3A 8LPRA 2VVUA 1YGCH 2ZG0H 3PMJA 4FU7A 3ZZBA 5KEDA 1NU9A 2HWLB 1V2KT 1GBFA 1MBQA 2AFQB 5IYTA 2KZ4A 4AYYB 5J4QA 1QY6A 2B8OH 1C2GA 3GY8A 1Z71A 3H7TA 1C1TA 2R9PA 2BD7A 4K3JA 3M35A 3GY4A 1PQ5A 1UTPA 1OKXA 3RU4D 3GY7A 2Z9GA 3KQEA 4FU8A 1O2KA 1GMDF 1OX1A 1W11U 2G52A 2ODYB 1A46H 4ZMAH 2FX6A 1IQGA 4WXVA 2HRVA 2Y82A 1UVSH 4XBBA 4FU9A 2XBWA 2R3UA 3N7EA 3HKIB 3V0XA 1SSXA 3UB0A 1TPSA 1YP9A 5DP6A 1HAYB 1MD7A 1CHOG 2CMYA 1GCDA 1C1NA 4E7NA 4AORA 2SGAA 4DGJA 1TGSZ 3U1JB 4YOIA 1C5UA 3GOVB 1HB0B 2A7JA 1E35B 2XC4A 1C5VA 2Y7XA 3NWUA 3U8OH 3NK8A 3KQCA 2HLDD 1LCYA 3GY5A 4AFQA 2VINA 1ESBA 1EQ9A 3MFJA 1GHZA 1GPZA 3A84A 2FTMA 3DHKH 1B5GH 4X1NU 2HPPH 1AMHA 2EI7A 1IQEA 1DE7H 3P8GA 1P2KA 2ALPA 3KHVA 1AWHB 2I6QA 1A3BH 4MQAA 1A0LA 3GY2A 4ZUHA 1TNGA 2QCYA 2OQ5A 1AWFH 1C2EA 1FV9A 1LHGH 3MU4A 2XBYA 2F9VA 3RXLA 1KDQB 5DGJA 3M3VA 3GCHC 2A4RA 2FI4E 1P8VC 2Y80A 1ZPBA 1BJVA 2OBQA 1TA2A 3CS0A 3OTPA 4ISOA 1HV7A 1C1WH 1O2VA 3UUZA 3BTQE 3FKSD 3L3TA 3O8DA 4X2WA 5FPSA 2ZCKP 1PJPA 2A0QB 1O2OA 1W10U 4WMFA 2ZFRH 3UFAA
chains in the Genus database with same CATH topology
3VEQB 2DE9A 4CRBA 1TIOA 3LT3A 1SR5C 1S85A 4MPXA 1EKBB 2BDAA 3RXKA 2BVXH 5DP7A 3LH1A 4I8KA 1TBQH 1Z6JH 1UVOA 2NU4E 2PLXA 1UTKA 3SGAE 2IPHA 1GI9B 1GHBF 5EODA 1SPJA 1BTXA 1GJAB 2J34A 1GG6B 2BTCE 4K1TA 4AGKA 3MHWU 1SGIB 1LVYA 1CVWH 1HAZB 1HYLA 4ABEA 4ZXXH 4UDWH 2VIPA 2GT7A 2QC2A 1O2GH 4FUDA 2GVFA 1VZQH 1GMHF 2FWWA 4Y0YE 3GDVA 2WPHS 3SQHE 3BV9B 3FFGA 2ZDVH 7ESTE 1DFPA 3LGIA 2GP9B 1K21H 2WYJA 5CMXH 1SB1H 4KGAA 3TJNA 3SGBE 1OWIA 5EW1H 3EA7A 3A7VA 2A2QH 3FANA 1MCVA 3SU0A 4TWYA 1TGTA 1TMTH 1FIWA 1GI0A 1DWEH 3SU6A 5C5OA 1HBTH 1QFKH 2NU2E 1ZSJA 3AVZA 1D3DB 1GJBB 2OC7A 1NZQH 4FVBA 1B0EA 1D3TB 1K1PA 1GHWH 2GT8A 5AFYH 2V3HH 3FP6E 1OYTH 1G2MA 1KXBA 3D62A 3RC4A 4ZHAA 1WTGH 1AFEH 1O3LA 1L0ZA 4GCHF 1RIWC 1AUTC 2ZGXH 1KXAA 1NRPH 3AASA 4Y71A 2C4FH 1ACBE 4Y8YA 2XWBI 1UHBA 1NFWA 4D76A 1S6FA 1FXYA 1SG8B 1ELDE 3BG4B 1GJ5H 1VJAU 3U8TH 3T26A 3PO1C 2V0BA 1TALA 2Z7FE 4BXWA 4NFFA 1BDAA 1T8OA 2J2UA 3SBKA 2D8WA 2G00A 3N7OA 2SGQE 3MH5A 3UPEA 6ESTA 1YPGH 1EZXC 1SVPA 3IG6B 3C27B 4TPYA 3T29A 3T5FH 1TGBA 2SFAA 2SGEE 2FOFA 4R8TB 1EAUA 2EI8A 1D9IA 2AS9A 4IN2A 1EPTA 4H4FA 1BMMH 3ZYDA 2QGRA 1GDNA 2ZEBA 2FZZA 2ZC9H 1O3PB 1VCPA 4K2YA 2XBXA 3RXMA 6CHAB 4JYVH 5JB9S 4IN1A 1N8OB 3LOXA 1QA7A 3FP7E 2GV7A 3GISB 2FLRH 3O8CA 4NWLA 3SUFA 1THRH 2GMTB 3MU1A 1KTSB 2ZHQH 4WH6A 3I77A 3BTGE 1QQ4A 1OWKA 1FAXA 2ZTYA 4E05H 3U69H 3OY5U 3BTDE 4U2WA 4D9QA 3MWIU 4K5ZA 1UTQA 7GCHF 3H7OA 4FUJA 1GJDB 4O9VA 3RXAA 3UOUA 1UK4A 4KTCA 5DP8A 2ZO3H 3Q00A 1GJCB 2BY6X 4Y7AA 4HI3A 1O2NA 1O3BA 2PKSC 5LH8A 1DOJA 2ZU3A 2OUAA 4PROA 1V2MT 5E0HA 1G36A 3JZ1B 2OTVA 2FIRH 3ODFA 4O3TA 1AVGH 3F68H 5H4IB 2ODQA 5L2YH 2JKHA 3AW1A 1GJ8B 1BMNH 2GGVB 1QB6A 2GX4A 2BZAA 2WPJS 5GJ4B 3H5CB 1IHTH 2AMDA 3SZNA 2PFEA 1GI3A 1PPHE 1UVUH 2FOEA 4DW2U 1QA0A 2XBVA 4GUXA 2J9NA 3SJ8A 2HNTE 1QRXA 2D26C 2TBSA 1HPGA 1OPHB 1QNJA 1GI6A 2ZGJA 3Q3XA 5C1YA 5JBCS 4CHAB 2CJIA 2G5VA 1SLVB 3LGYA 1BTHH 1GBMA 1NFUA 4UFFH 3CS7A 2WPMS 4QT8C 1AVWA 1ELVA 2ZDNA 1V6DA 3Q77A 1C1VH 1C2MA 1Y5UT 3ZVGA 1J16A 1QHRB 3ATMA 4AYVB 2CF8H 1O2MA 5FBEA 3RP2A 2BMGB 1HAVB 3TIUA 2G4TA 1VCWA 4D8NA 1SL3A 1Y5AT 1OWJA 3B23B 1SLXB 1BITA 5SGAE 4MPVA 4J1YA 5AF9H 2H9TH 1XVMA 2I6SA 5CE1A 1O5FH 1T8NA 1UTJA 1QBOA 1QR3E 1ESAA 2M5TA 1QIXB 1OWEA 1EP5A 2XXLA 1LVOA 3MNCA 1HFDA 1EJMA 1E36B 4BTUB 5LGOA 1ANCA 4VGCB 4X6OA 2STAE 2HLCA 3P8FA 3MU5A 3LGVA 1XX9A 2UUFB 1ZMJA 1PYTD 3LGUA 3SQEE 3ATIA 1GI8B 1XUFA 1YPHE 4XSKU 1RRKA 1U6QA 1WAYB 5FXLA 1S0RA 4BAOB 1ELBA 1YPJH 3BF6H 1YCPM 3RDZA 2ALVA 2BDIA 3RMNH 2O8MA 2OLGA 1G2LA 2F9BH 1YKTA 4BTTB 9LPRA 4I31A 1LHEH 1P57B 3SJKA 1NM6A 4O97A 1UCYE 1SBWA 2AMPA 1SGRE 3HKJB 4ABJA 1GJ6A 1SC8U 4HFPB 1HAPH 2G51A 2ZWLH 1JRSA 1OP0A 2ANMH 1SI5H 4CREA 2THFB 1PQAA 3GCTG 1W0YH 2J38A 1KY9A 1PPFE 2O9QA 3M7QA 3AW0A 3SNBA 2GTBA 3S69A 1V2OT 4IMZA 1EUFA 2VWOA 3W94A 1RTFB 1CGHA 1GBBA 3A88A 1TOCB 1FUJA 1TX8A 1ZHRA 2G55A 4DT7B 2GD4B 2TGDA 1P0SH 1TX6A 1Z1JA 2SGPE 2H5DA 3RXHA 2ASUB 1AHTH 4AFZA 2H1UA 1GG6C 1O3KA 2UUYA 3VB7A 2R0KA 1YPLH 3FZDA 1FIZA 1AVXA 4ABGA 3SI3H 2SGFE 3P6ZB 5I25A 1JIMA 3LONA 8GCHG 1C5PA 2A5KA 1DLEA 3LGWA 3HK3B 1AKSB 1Y3UA 3RXDA 4DIIH 2DE8A 1C5OH 4BTIB 3RXJA 1FI8A 1G3BA 3MO9A 1O2QA 1P12E 1O5DH 1ETTH 1L1GA 3TVJB 1LHFH 1IOEA 1MTSA 4Q80A 1C1UH 2J4IA 3LIWA 1V2VT 1MQ6A 4U32A 4ZKSU 1JRTA 5ETXA 3ZYEA 4B71A 3F9FA 5K7RA 2WPIS 1BA8B 2QYIA 3QZRA 1YBWA 2Q6GA 2XYAA 1JOUB 1LQEA 3Q76A 3QO6A 4DURA 3BEFB 3SN8A 1O2XA 3RXPA 5FPYA 1XXDA 3A7WA 3SHAH 1H9LB 1AB9B 1Z7KA 4FVDA 2CV3A 1DX5M 1MKXH 1C2JA 2J94A 4FUCA 1DY9A 1T31A 3SV7A 1C4Y2 1AZ8A 5EG4A 1GBEA 1MMJN 2G4UA 1GHAF 2ZGHA 3BG4C 4OS1A 1O3GA 3TJUA 4WMEA 1A5HA 4WY3A 1ELAA 1DLKB 1SGNE 1MAXA 1S0QA 4O03A 2O8UA 2VIWA 2C90B 1F2SE 1V2TT 1UTOA 1ZRKA 2FOHA 4GLYA 2G81E 2H9EH 2ZFQH 1JIRA 1LMWB 1XUGA 2V3OH 1ELEE 4CBOA 4BNRA 1PQ8A 3SO3A 3BTHE 1TPPA 1HNEE 2ZCHP 4WH8A 3UWJH 1EAWA 2A4OA 1WQVH 1O35A 1XKBC 1HIAA 4Y8XA 2WUCA 1YLDA 1CU1A 6CHAC 4ZKOU 1H8IH 4F49A 1N8OC 3PWCA 4ZAEA 5K0HA 1A3EH 3UQOA 3RXBA 4ASHA 3TH4H 3E90B 5ESBA 2GMTC 1TOMH 2BOHB 2BX3A 4MNYA 2HALA 4ZH8A 4X8UH 1SGFA 5F6MA 1L1JA 4DIHH 1XVOA 1KLTA 1LPKB 3EQ0H 1C2DA 2UUKB 3TNSA 1N6YA 4WWYA 1UTLM 4F4OC 5AFZH 3SUGA 2V6NA 2BXUH 4ISNA 1C2LA 3GY6A 1HJAB 1S81A 2WINI 2ZDKA 2PGBB 1V2LT 1C2FA 3MH6A 2Y5GA 4IMQA 1C4U2 1ZTJA 3BIVH 4YESB 1NPMA 1VJ9U 3VB4A 2BQ6B 3C1KA 1Y5BT 3PROA 3W95A 1M9UA 2WYGA 4JYUH 4JZIA 4K1EA 5C67A 2BZ6H 1A0JA 1TA6A 2FTLE 2ZFFH 4LOYH 3KQBA 1FY3A 1CT2E 5F8ZA 1EB1H 1ABIH 1GHBG 1BBRH 3VPKA 3RXVA 4NSVA 1SFQB 3TGIE 2OQUA 2ZFPH 4U30A 2V35A 2UUJB 2OINA 4ZHLU 3TGKE 1TNJA 1O5EH 4CHAC 1UK3A 3E0NB 1Y3YA 2BYAX 1N6XA 1KXCA 1GGDB 3HATH 3GCNA 3L33A 3SHCH 1P04A 1GMHG 2BVSH 1GDQA 3BEIB 1GBIA 4YOGA 3QZQA 1DVAH 3CENA 4UFEH 5DP5A 3TK5A 1RTLA 4IBLH 4JZ1A 4X0WU 3TGJE 1O2WA 1O3IA 3BTWE 1P9UA 2PR3A 5C5NA 1OS8A 1DXPA 1Z8IB 1YPKH 4X6PA 2AIPA 1HAOH 4INKA 5EGMA 2PWXA 1XUIA 4BOHA 1HJ8A 3M36A 2CGAA 1LKAA 2Y5HA 1AU8A 2AERH 1ETSH 2GCHG 1ZLRA 2BXTH 8ESTE 5EQQA 1ORFA 2ZNKH 5FBIA 1NRNH 1BRAA 4GCHG 1FPCH 4VGCC 1XXFA 1ZMNA 1DXWA 1ZYOA 4X1RU 4ISHH 2JETB 1N1LA 3V3MA 2XRCA 1EATA 1LHCH 2PV9B 2WUBA 3EDXB 1P2NA 1NTPA 2XTTB 1TMUH 3GDUA 3PMBB 5PTPA 4CRFA 1AI8H 1ZHMA 5CHAB 2F83A 4NIVA 4NSYA 2BY9X 1VITH 1K1IA 2BB4A 2ZDAH 4I8LA 1O3OA 3UNRA 3A89A 4D7GA 5TJXA 5A8XA 4YLQH 3RXGA 2BDYA 1W8BH 3DFLA 4ZKRU 1SGFG 2IOTA 1AE8H 4DOQA 1F0TA 3T28A 9ESTA 3R3GB 3MNBA 3PTNA 4FUFA 1C1RA 1Q3XA 1T4VH 4GAWA 4JZEH 1ID5H 1KDQA 3S9AA 1RGQA 2AGGX 2FLBH 1O37A 2GV6A 1C1OA 1C4V2 2ZDMA 3L6PA 1ELCA 1F5KU 3P8OA 2F3CE 3PM3A 1GBKA 1O5BB 1SQTA 1GJ4H 4NG9H 3Q3YA 3ODDA 1O3FA 2Z9IA 1XUKA 5DP9A 1TFXA 5A2MH 2O8WA 1YCPK 1SGEE 2QF0A 8KME2 2PUXB 5TCCA 4NA9H 5GDSH 5JPMH 1J9CH 3PYHA 4DY7B 3RMOH 3MH4A 5A0BA 1S83A 1L4DA 3VB5A 4OGXA 2QXIA 4K69A 1KSNA 2GDEH 3RC6A 2XW9A 1C5SA 1AIXH 1QURH 2ESTE 1DWCH 1BTPA 3TJOA 1T4UH 2BOKA 3NCLA 1EX3A 4JCNA 3F6UH 3ATLA 1SQOA 3B9FH 1DUAA 1KXEA 1TNIA 2TIOA 3RMMH 3RM0H 1O39A 1G3DA 2FOMB 1C5WB 4K60A 4AFUA 2BD3A 2FPZA 3KGPA 3QN7A 4Y6DA 1TYNA 1AB9C 1TGCA 1YM0A 2P95A 4ZHMU 1V2RT 1KLIH 1Z8RA 4NGAH 1B7XB 4ABBA 1OWDA 1UJ1A 5I46H 1ZR0A 1CHOF 3RXEA 4YOJA 3ZVFA 2BDGA 3PB1E 1NT1A 1GBTA 2B7DH 2CF9H 1P11E 1O2LA 2VH0A 1DSUA 1MKWH 2WPKS 1C2HA 2ZU1A 2C93B 3OTJE 5A09A 1P01A 3M5MA 3UIRA 2BY7X 1LDTT 4H42U 3T2NA 1O3AA 5DJ7A 5BRRE 4D7FA 1FDPA 5JB8S 2HPQH 3ZZAA 1GJ7B 1V2UT 5EXLA 4CRAA 4XOJA 3U8RH 2AYWA 2ZFSA 3DA9B 1Z1IA 1NFYA 1MZDA 3M3TA 4NIXA 5C2ZA 3IWMA 2RCEA 2Y7ZA 2VWNA 2W7SA 4UONA 3UWIA 2XCNA 2HVXA 4BAMB 3D23A 1EOLA 2EEKA 3RC5A 4I32A 2HGTH 3BTTE 2QXJA 3OSYA 4JMYA 2F9NA 4I33A 1UCYK 4X2VA 3ATKA 2QA9E 1A2CH 2R0LA 2P8OB 1YPMH 1NS3A 4GHQA 1CT4E 2ZU2A 3NUMA 2BY5X 3TNTA 5C1UA 3EA9A 4DG4A 1SGYE 1MKXK 2BLVA 3A83A 3A7YA 1O5GH 1SGPE 1THSH 3RXOA 1AQ7A 1HJAC 3BG8A 3TH2H 3T62A 1Y3WA 4HTCH 5DPAA 1SGCA 2OCVB 3SJIA 4J2YB 1O2SA 2GZ9A 1FAKH 3S7KB 1P06A 2ULLA 2A5IA 2AH4X 4MG3A 1P05A 2BQWB 2C8XB 2ANYA 1V2NT 1KIGH 2FI3E 2QF3A 2ZU4A 2P3FH 3SJ9A 2JH0D 2ZKSA 3BIUH 2FO9A 1K1MA 1ZPZA 4UFDH 3ZZ4A 1FNIA 1DANH 2ZTXA 1SGDE 2CHAB 5E0GA 1O3NA 1ABJH 2AMQA 3QK1A 4IW4E 3E3TA 4ESTE 3T25A 2PSYA 2ZHWH 4TY7A 4IC5A 2P94A 4YT6H 1GGDC 1VR1H 4YZUA 5EQSA 4AOQA 3GCOA 2JH6D 3S9CA 3P70B 1QGFA 3B8JA 2BHGA 1MU6B 2AGIX 5A8YA 5T3HA 1P09A 1ZJKA 1EOJA 3NKKA 5E0JA 4B73A 5EPYA 1JWTA 2OP9A 1HUTH 2FXRA 1K1OA 2FX4A 2W7UA 2BM2A 1DUEA 2G5NA 2LNCA 5GCHF 1EB2A 1IQJA 1P2QA 1FLEE 3T27A 1YPEH 5HMAA 3A85A 1BIOA 2FOBA 1EXFA 2ZP0H 4Y79A 2FODA 4ABHA 2ZPRA 1C5RA 4RSPA 4ZXYH 1J17T 3QX5H 1P02A 1GVLA 1TWXB 5LPFA 1MH0A 3SI4H 5JBTA 2JETC 1GHAG 1EAXA 5C1XA 3KEEA 3QUMP 3BSQA 1HAVA 2FOCA 2DUCA 4HGCA 5LPEA 1MQ5A 3OYPA 7LPRA 3EGKH 2VIVA 1WU1A 1BHXB 4AB9A 3KIDU 4X1QU 1F5LA 5CHAC 3RXQA 1C5YB 3ELAH 1C9TA 5HM9A 3V13A 1MD8A 1G30B 4JZFH 4I7YH 2CN0H 1MZAA 2R2WU 4CH8B 1CA8B 1NO9H 2NWNA 3SV8A 2QY0B 4FUEA 2EC9H 1BRBE 1P2JA 5EPNA 4FUIA 1IQHA 3SUEA 4IS5A 3VXEH 1CBWB 2J95A 2ZZUH 1YF4A 1G9IE 2BLQA 4K8YA 2PKAB 1SOTA 6GCHF 1WSSH 3BN9A 2A7CA 1BRUP 2PSXA 3O8RA 3QTVH 4H6SB 1OOKB 1BJUA 4FUHA 3ZZCA 2W3KA