1O30A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o30A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o30A02
1C1PA 3ZYDA 1OPHB 1K21H 3GCTF 1JXPA 3D23A 1YCPK 1IHSH 1CT4E 2XBXA 1VITF 1HIAA 3TK5A 2BXTH 4MNWA 1GJ5H 1KDQA 4DVAU 1HAXB 1EZQA 4K1EA 4Y76A 1CHOG 1SGPE 1EOJA 3MO6A 1SSXA 3GCOA 3A88A 2HNTF 1GMDF 1ZRBA 2FDAA 3ZV9A 2FOBA 1HJ8A 1E35B 5JBTA 1CVWH 3D65E 1WYKA 1NFXA 1VCWA 1BHXB 4X1NU 1V2UT 1EPTB 1BMAA 5T6GA 4TPYA 2XWBI 1RS0A 1OWJA 4BOHA 2C8WB 6GCHF 2ZFTA 2A7JA 3LH1A 3AVZA 3VB3A 3GY7A 2Y5GA 5LPRA 2FZZA 3A7WA 3B23B 3MH4A 2C93B 4X8VH 3T2NA 2ZPRA 4D7FA 3ZVDA 1ELTA 2SGEE 5JYIA 1O3MA 4DJZB 4FXGH 1YPKH 1ZGIA 1L0ZA 2C8ZB 2GD4B 1GL0E 3EAJA 1GBJA 2ANMH 4H42U 1C5QA 2BDGA 4YLUA 3BIVH 3PLBA 3MWIU 4Y6DA 3SW2B 1MTVA 4JZIA 1W2KH 1YBWA 1SQAA 1A3BH 1TAWA 1DM4B 3GYMA 1O3NA 4DIIH 4HTCH 1BRAA 2RA0A 2XBWA 2W3IA 1D4PB 1TQ0B 1V2RT 3KNXA 5ESBA 4NIYA 3UNQA 3BEIB 5FPTA 5GXPA 1CHOF 1MD8A 2XNIA 1AB9B 4WH6A 1HAGE 3SUDA 1GVLA 2BVRH 3QN7A 1FPCH 3TVJB 1EB2A 2BD3A 2QAAA 2H9EH 2YNAA 1L1NA 1IQEA 3GDSA 1BQYA 1C5PA 1O0DH 4KGAA 1BUIA 2RCEA 3GICB 4I8HA 3PLKA 2ZFQH 1C1OA 1E34B 2Z7FE 5CHAB 1FY1A 1UTOA 1Z8RA 3A85A 1O39A 1V2LT 4FUBA 1QGFA 1W13U 3GOVB 3ZZ7A 2TPIZ 3QUMP 4IGDA 2IN2A 3F9HA 3KCGH 1F5LA 3BN9A 3ATKA 4CBNA 1B0EA 3RXOA 2Z3EA 4MPVA 2XC4A 2OD3B 1QRZA 2J34A 1MUEB 1GI1A 5DKMA 1UHBB 1XKAC 4NFEA 1GBLA 2BOHB 1GWAA 2GCHG 3DT0H 4KTUA 3EA7A 4OS6A 3ATMA 1C2FA 4FUEA 2W7UA 3ODDA 5TCCA 1H8IH 1YPMH 1OXGA 2FEQH 1LMWB 2VGCB 1BRCE 1Z8IB 1LHCH 3A87A 1IQIA 2UUKB 1OOKB 2R0KA 3T28A 1V3XA 2ZCKP 2YNBA 5A2MH 1EAWA 3SU6A 1T31A 4DGJA 1SPJA 4CR9A 1NS3A 3PWBA 4KELA 2JETB 1GI5A 1YLCA 3SN8A 3MNCA 3ELAH 3NXPA 1C2KA 1HPGA 1SFIA 4J1YA 5GJ4B 1T4UH 4KP0A 2NU0E 3ZZ5A 1TGTA 3RU4E 1LPZB 1O33A 1C5LH 1GBMA 5DP9A 3UQVA 2ZIQH 3A7TA 3GY4A 1ESTA 1O5CB 4JMYA 4DURA 1O37A 1CT2E 3TNTA 1AO5A 1HCGA 1CGJE 3RXHA 1Z8GA 1EPTC 4JZ1A 3SUEA 1J14A 3HGPA 3PMJA 1EQ9A 4GHTA 2JH5D 1K1JA 3VB6A 1C2LA 4DY7B 2BDCA 4Q2KA 2BD4A 2VIVA 1TOCB 3OYPA 3ZZCA 3Q76A 1ZHRA 3TNSA 3E91A 3QDZB 3LJOA 3RC5A 4RN6A 1JOUB 2ZDLA 2Y5FA 5T6FA 2ZQ1A 4NA8A 3Q3KA 7GCHF 1PFXC 2BX3A 1TNKA 2GZ9A 2PSXA 3LIWA 4D9QA 1K1PA 2YOLA 4GCHF 2Q6DA 4B76A 1QB9A 1WAYB 1SLXB 3M3VA 1O30A 5EW2H 1O3AA 3RXAA 2XYAA 3T27A 3UR9A 3OY6U 1OYTH 1P06A 3JZ1B 1AQ7A 1K1LA 2OC7A 1C1QA 2WV5A 2ZC9H 1YPEH 1HYLA 3LOXA 3MO9A 3RDZA 1GHXH 1WOFA 3ZZDA 3GY5A 4FU8A 5JPMH 4GSOA 3HATH 1BITA 1TPSA 2F91A 1GBFA 1A61H 2ILNA 2V6NA 1GHAG 2FI4E 3GY2A 1GJ9B 1O35A 3RXGA 1HBTH 1QCPA 2BXUH 5A0BA 1IQJA 1UTQA 5G4BA 5JDUB 1WCZA 4HZHA 4RKJB 2Z94A 4JYTA 3TITA 3U8OH 1G3EA 1UTLM 3QZQA 2ZTZA 1YCPM 1YGCH 1LVOA 3RXUA 2FESH 5DP5A 4JYUH 5CHAC 3H7OA 1MTNB 1V2TT 3F9GA 2GZ7A 1TNIA 4MNVA 1MTWA 2BD5A 3GISB 4INHA 4Y0ZE 4ZUHA 3SUFA 4UFDH 1Z1IA 2FOGA 3OY5U 1C2GA 4WH8A 4UFFH 1VGCB 5GIBA 1MTSA 4DW2U 2FOEA 3E8LA 1S85A 5IYTA 3UY9A 4AGKA 1SHHB 1O36A 2VIWA 2ZCLP 4VGCC 2A2XH 3PV4A 4IMQA 3SZNA 4CH8B 4UDWH 4CRCA 1DS2E 1L1GA 1NO9H 2XC0A 1P2QA 3RMMH 4D9RA 4WMDA 4X0WU 1BHXF 4X6PA 4K8BA 4Y79A 3M5MA 1BTZA 1C4U2 2VGCC 2AYWA 1O3KA 5EW1H 3K6YA 3TGJE 4JYVH 3NWUA 2FODA 2Z9JA 4WMEA 5C2ZA 2WUCA 1FDPA 2JETC 3QO6A 3P17H 3EA9A 3BTDE 3SV8A 4GAWA 1DLKB 1SGNE 4B2AA 1MH0A 1F7ZA 3MNSA 4WJG2 1WTGH 4XFQA 1DX5M 1YM0A 1P03A 2DE8A 2UUYA 2QV1A 3P8OA 3V3MA 2ZGHA 3I78A 3QK1A 2WYJA 5C20A 3R0FA 1TMTH 1NRNH 3DFJA 1B0FA 1ZSLA 2D1JA 4KTSA 1KXFA 4U30A 4ABAA 1ID5H 3TPIZ 1QHRB 2CF9H 3V12A 3ATIA 1SLUB 3BG8A 4BAQB 1EZUC 1MCTA 3A83A 2AGGX 1YPHC 4MTBA 2O8UA 1G2LA 4I7YH 2G00A 4JK6A 2ZGXH 1UK3A 1OP0A 1BOQA 2Y7XA 1ELDE 1HAIH 1TMBH 2F9PA 3BSQA 3M36A 3TJOA 2HOBA 1OP2A 5E2OA 2A5IA 1GBAA 4OS4A 4B71A 4CH2B 3QGNB 1LHEH 2CHAB 2BZAA 3RXLA 3A81A 1PPGE 2A31A 4XDEA 5E0HA 1DWDH 3SI4H 3SU0A 4E06H 1GBEA 3BTME 3MH6A 3RU4T 3OX7U 4UFEH 3MOCA 1DE7H 1XUIA 4Z6AH 2HPPH 1PQAA 2JH0D 1MKXH 3DUXH 3QZRA 3SJKA 1P3EA 1PPEE 2Z6BD 7LPRA 2BQ7B 2H9TH 8GCHG 3FANA 2ZF0H 4NZQA 3HPTB 3SORA 1ETRH 5DP7A 3LC3A 1YPHE 2V3HH 1BBRK 3RXDA 2QXIA 2XBVA 1QL7A 5FPYA 1D3TB 3BTFE 1P04A 3ZZBA 2GVFA 1FAKH 5PTPA 1NRSH 4NSVA 1C1UH 1BDAA 2H2ZA 5FPSA 4H6TA 1AGJA 3LT3A 3R3GB 2PSYA 2A32A 1NRRH 1O5GH 2ZTYA 5C1UA 3S0NA 4AYYB 1GI2A 5EXMA 3ESTA 3C1KA 4K69A 1SVPA 1TLDA 3ZVFA 1MBQA 4ABHA 1ESAA 1GPZA 1J15A 1J9CH 1MTNC 1S81A 3SU4A 1GJ6A 2ZEBA 1VCQA 2WINI 3SHCH 2ZFPH 1FUJA 1ELGA 3LU9B 2GTBA 2CJIA 3A7VA 3RU4D 4AYVB 2BLVA 3N7OA 1G3CA 2BB4A 2OC1A 1ZPCA 1VGCC 4ABGA 1VCPA 4Z0KA 1WUNH 1O2WA 1C5OH 3UWJH 3DA9B 4K60A 3I77A 1AHTH 3OSYA 1D3QB 3RM2H 1XUKA 2HLCA 2PTNA 3MU1A 4Y8ZA 2ANYA 4B75A 3ITIA 2O9QA 1DDJA 5GDSH 2F9OA 3KHVA 3GCTG 4FVBA 5DP4A 3NK8A 4DT7B 1QL9A 4NIXA 1VITG 1RJXB 1NRPH 1TA6A 1LO6A 2R2WU 3F9FA 1SLVB 1UCYK 1GHYH 1QJ6B 4BTIB 3RLYH 2OC8A 2FWWA 3VPKA 1KTSB 1TYNA 1Y5AT 1P57B 3MH7A 2BD7A 1GMDG 3P95A 2SNWA 3A8CA 3RP2A 2Y81A 3UFAA 1FY3A 1CGIE 1GGDC 3ZVCA 1HIAB 1YC0A 2WPHS 3AW0A 2J9NA 1KDQB 1C1NA 4R0IA 2B0FA 2JKHA 1THRH 4M7GA 6GCHG 1PQ8A 1C5YB 1PPFE 1TGBA 4B2CA 4YOGA 1MCVA 1O2JA 2NWNA 5F8XA 4WXVA 3RXPA 5FAHA 5JBCS 3TGIE 3EA8A 1B7XB 1EAUA 1G2MA 4IN1A 2ZU2A 1GBHA 1P0SH 4ABDA 4CRAA 3W94A 1K1NA 1N1LA 1ZMLA 3RXKA 1KSNA 3HKIB 4ZHLU 1KXDA 2ZKSA 2PGQB 4YTAA 3S9AA 2Q1JA 1QNJA 1MMJN 4K1TA 3VB4A 1O3HA 2R0LA 6ESTA 3H5CB 2CHAC 1EZXC 2OXSA 1BBRH 3GYLB 3TJVA 5HXFA 1C2HA 1T4VH 1HFDA 3SO3A 1AU8A 5DPAA 1YLDA 3MU0A 1DOJA 2FOMB 1W3CA 3A7ZA 4OS5A 1Y3VA 1GHZA 1HLTH 1H4WA 2BD8A 2VWMA 4K1SA 4QT8C 1BTHH 2VVUA 3EDXB 4X2WA 1S6FA 3FZDA 1O2XA 1UTKA 2WPJS 3BV9B 6CHAB 1P11E 1FY8E 3NUMA 1ZHMA 4AORA 1RTKA 1V2QT 2CMYA 4Y10E 1ELAA 1BRBE 1MKWK 2P8OB 3Q77A 2IPHA 4AZ2B 2FO9A 2AS9A 2J2UA 1TGSZ 5L2ZH 1LVMA 1Z71A 1HAZB 1CQQA 1IHTH 3NKKA 4B74A 2ZDNA 1O2LA 3GY6A 1TBRH 1EZSC 1CE5A 3VXEH 1IQHA 1KLTA 2AMDA 5LPFA 1XXFA 1SGDE 4YT6H 2BY5X 3D49H 2XRCA 3AASA 1GHBG 1JBUH 1XKBC 2UUJB 3TJUA 1CBWC 2AERH 4Q7YA 4AGJA 1ANCA 1O2YA 1AE5A 1PJPA 4HI3A 3QTOH 2R3UA 1GDQA 1S6HA 4BTTB 1FI8A 2SGAA 4X2VA 5A8XA 1UVTH 3CP7A 1AVGH 4GUXA 2BY8X 2PR3A 4O03A 4X2YA 1THSH 3GCHB 3S9BA 1A46H 1QFKH 1F5KU 1CO7E 4OGXA 2QGRA 1MQ5A 3I29A 1P9UA 1SGEE 1ARCA 1LQDB 4NCYA 2C8XB 2D26C 1H8DH 1CHGA 4ISIH 4OS1A 4Q7ZA 2ODQA 3Q3XA 1OP8A 1T7CA 1SHYA 2HALA 1EATA 3A80A 4O3TA 2GDEH 1F92A 2PGBB 1FN8A 5T3HA 1D6RA 1BTWA 2ZECA 2EEKA 2RA3A 3TLOA 5C5OA 3A7YA 3A8AA 3LKWA 1EAXA 1HAOH 2EC9H 2VU8E 1YF4A 2Z3CA 3EYDA 2WPLS 4CRBA 1HJAB 2ZG0H 3T62A 1GI0A 1GHBF 1N8OB 4Y0YE 1O2MA 4AFUA 1BBRE 1D3PB 1O3GA 1P2MA 4NGAH 4YESB 4MQAA 2GMTC 1GMHG 2QF3A 1GCTB 3KGPA 2UWLA 3O8CA 2ZDKA 2OLGA 1QA0A 5EG4A 1FNIA 2O8WA 1AN1E 4YZUA 4RSPA 1K22H 2V3OH 3SNCA 2BLQA 1YCPH 7GCHG 5EQSA 1UVOA 1IQFA 1SG8B 4VGCB 3ZZAA 2ZA5A 4DCDA 2PLXA 4GCHG 1TGCA 3T26A 4UEHH 1DUEA 4YO9A 3T5FH 1Q3XA 1E0FD 3PMHB 1SGRE 2TGDA 1TRNA 5HM9A 2WV4A 3O8RA 1HAPH 2BD9A 1GJ7B 2O8LA 2ZO3H 1T8LA 1BTXA 2ODPA 3P8GA 1C1RA 1YYY1 1ELEE 1KLJH 1GI9B 5FBEA 1BMMH 2CXVA 1GHWH 5J4QA 1RTFB 2XTTB 1TALA 3SNEA 1J16A 5F8TA 2OQUA 1XUHA 5GWZA 4WMFA 2GT8A 3RLWH 1KYNA 1QRXA 2G8TA 3K65B 2G52A 4A92A 6CHAC 5FX6A 3SNBA 1O5FH 2TRMA 3E16B 1EB1H 1GJ8B 3PM3A 3M35A 4ABJA 1A7SA 2D2DA 1BMLA 2P8OC 3OTJE 1HV7A 1LPGB 2QC2A 4I33A 2D8WA 1EX3A 1NESE 2A0QB 3QLPH 2Q6GA 3PB1E 3IITA 1XVOA 3L3TA 2FLRH 4ASHA 1SGFG 4MG3A 3LGIA 5AFZH 2GDDA 1GMHF 1JIRA 3UOUA 1O3BA 3C27B 1GJBB 1GI4A 1W11U 1GDNA 1TX8A 1O31A 1RFNA 3TH4H 4ABIA 2KAIA 1SGYE 2V0BA 1HAVA 5C1XA 1Y3WA 3KQBA 9LPRA 1Y3YA 3LDXH 4WXIA 3TK6A 4ESTE 2BTCE 2PKSB 1JIMA 2A4RA 2VIDA 2AEIH 2VNTA 5FCRA 4AG1A 1O2IA 1TBQH 4OS2A 2XC5A 1W0ZU 4X8TH 2A5AA 2OTVA 3ZZ3A 2R9PA 5LH8A 2FOCA 4K2YA 4XOJA 3RMNH 1SQTA 4MDSA 1LVBA 4CRDA 1T8OA 1SR5C 1CU1A 3A8DA 5A8YA 3GCHC 1AI8H 3BTKE 1QB6A 4FUJA 2BQWB 2SGQE 1LDTT 1ZTKA 2Y6TA 1YKTA 1Y3XA 1DWBH 3E0NB 5F8ZA 4D7GA 3U98H 4U32A 3KIDU 2XCNA 2F9UA 3TIUA 4AFZA 1P2KA 1DWCH 1VJ9U 1PYTD 4U2WA 3STIA 3UNRA 1S84A 3TU7H 1V2VT 2C90B 4K5ZA 4IW4E 1L2EA 2FOFA 1FV9A 1MD7A 4ZXXH 2ALPA 2OBQA 3SJOA 1SGIB 1TE0A 3BTWE 4BNRA 4FUIA 1HJAC 2A4QA 5EXLA 2QYIA 3UIRA 1N8OC 4XE4A 1K1IA 3CENA 6LPRA 1UMAH 3BF6H 4I8GA 3S7HB 2XXLA 1K1OA 2V35A 1GCTC 1QJ7B 5K0HA 3S69A 2O8TA 3FP8E 4IS5A 1E36B 1ACBE 1RRKA 2Y82A 5FHTA 7ESTE 3U8RH 1ARBA 2XWAA 1C5MD 2W26A 4LZ4B 4A1XA 1NY22 2FMJA 3L6PA 1S0RA 5EPYA 4MNXA 1O2VA 5BPEA 2ALVA 1H9HE 1G3BA 3AW1A 5C5NA 3UOPA 3HK3B 4Q80A 1K2I1 1KY9A 2FTLE 2EA3A 4AFQA 1V2PT 3EE0B 1P10A 5DP3A 3E90B 2W3KA 1LQEA 4ISLA 2BOKA 5E0GA 3S9CA 1GCDA 1GGDB 3RM0H 2A5KA 4DG4A 8LPRA 4BAMB 3SV6A 1X7AC 3AAVA 2BQ6B 1AE8H 3ZVEA 1C1SA 3IG6B 2B8OH 3M7UA 1G32B 1ABIH 3FAOA 2ZTXA 3ZZ9A 1XMNB 4ZKNU 2PUXB 4Y8XA 4K3JA 3CS0A 4Y11E 1SBWA 1EUFA 2GT7A 1VITH 1FLEE 1JRSA 3T29A 2A45B 3EQ0H 3PO1B 4I32A 2ZHDA 1OSSA 1IQMA 4HGCA 3LGVA 4KKDA 3TJNA 2F9VA 3UUZA 1J8AA 5GCHG 2TIOA 2WPMS 2PKSC 4DIHH 4Y71A 3M37A 1C5XB 2NU2E 5L6NH 1ZJDA 1OYQA 5EQQA 1O32A 1FQ3A 2M5TA 1N6XA 3SU2A 1E38B 4ZHMU 2XCFA 2VIQA 4FUHA 4I8JA 4MPXA 1K9OE 3K9XB 4LOYH 4NSYA 1O3EA 2CGAA 3UREA 1C1VH 4AOQA 4D8NA 3U69H 1O2SA 1O2PA 1RIWB 4AFSA 1G3DA 1GJAB 4KTCA 1FIZA 3SV2H 4O97A 1DXWA 1AKSA 1C9PA 1O2NA 4FU9A 2GCTB 4JZFH 1Y5BT 3STJA 2AGEX 3F9EA 1C5ZB 4AX9H 2SGDE 2ZHEH 4IMZA 2ZPQA 4CREA 3ODFA 2BYAX 1W7GH 1QY6A 2OP9A 3A8BA 2QXHA 2NU3E 1DUAA 4SGAE 2XW9A 3RXQA 3SU3A 1GBBA 3KF2A 4INKA 1V2JT 1ORFA 1UTNA 2PKAA 1YP9A 2FP7B 5I25A 2A4GA 1TPPA 3LC5A 4CRFA 1SQOA 1ZLRA 1LTOA 2STBE 1NFYA 1ZTJA 1UTJA 1WSSH 1CBWB 5GCHF 2QCYA 2BDAA 4BXWA 1Y3UA 4AB8A 3A89A 1A0HB 1A0JA 3URCA 3ENSB 2F83A 4X1RU 1S82A 1TGNA 1TBZH 3MHWU 1T32A 1B5GH 1NROH 2HNTC 5TCAA 4CR5A 1BT7A 4K8YA 1BZXE 1GL1A 1C2IA 3SJ8A 1Z7KA 2STAE 4B73A 2ZHFH 2XBYA 3P70B 4MPUA 1BTUA 2OC0A 2H1UA 2ZZUH 1G30B 2ZU3A 1DVAH 4X6MA 2BY7X 3RXTA 1TOMH 1GBCA 4GLYA 2P95A 1LKAA 5FBIA 3B8JA 1UK4A 3FP6E 4ZHAA 4X8UH 1O3PB 2H5CA 2AIQA 1PPBH 1TPOA 1CT0E 1GI6A 1A5GH 3LGWA 1O3DA 2GX4A 2CN0H 1HRTH 4UFGH 1D6WA 1LPKB 3VEQB 1O2RA 4ZMAH 5DG6A 2HNTE 2Q6FA 3PYHA 3RUOA 1W8BH 2ZWLH 1GHVH 1PYTC 1Y8TA 3BG4B 1XX9A 1KXCA 3SGBE 2G5VA 3KL6A 1WQSA 8ESTE 1RD3B 3SJIA 3P8FA 1WU1A 1XUGA 4NFFA 2ZU4A 3U1JB 4GPGA 4OS7A 2VH0A 1D9IA 5A0CA 1G36A 2GMTB 5TJXA 1O5AB 5LPEA 1UTPA 2FTMA 2TGPZ 2P3TB 1FPHH 3OU0A 4E7RG 1A4WH 1TWXB 2CF8H 1EXFA 5EQRA 3NCLA 3PO1C 2EI7A 1CSOE 3IWMA 2GV7A 5C1YA 1BA8B 1OWIA 4F4OC 3PMAB 4ZAEA 4XBBA 1OWDA 2ZHWH 2G4UA 1LCYA 4FUDA 2FLBH 4RKOB 2P3FH 4XBDA 4OGYA 1AVWA 2VB0A 1FZZA 1QA7A 1CA0B 2HRVA 3RXBA 1O2UA 4R8TB 2BLOA 1NZQH 1TABE 1HAYB 1P8VC 2I6QA 3KQDA 3M7QA 4ZXYH 4X1QU 3BTQE 3RXCA 1RIWC 4NIVA 3O8BA 3BEFB 2FM2A 4J2YB 2B5TB 1PQ7A 1DICA 3CS7A 2TGAA 3TGKE 3VFEA 1A5IA 4ISHH 2GCTC 1GI7B 4WVPE 1HB0B 1TA2A 1KXAA 1NU7B 2ZFRH 4ZKSU 3RC4A 1SC8U 4X8SH 2Y5HA 1GVZA 3ATLA 4SGBE 2O8MA 1AWHB 4JZDH 2ANKH 4H4FA 1L4ZA 5DO4H 1IQGA 2Y80A 5EOKA 3TH3H 3ZVAA 3VB7A 5L2YH 1AWFH 1ELBA 3SV9A 1C5WB 1THPB 2ANWA 3LPRA 1ANDA 2SGFE 3MNBA 1P2NA 3M3TA 2B7DH 1W7XH 1LHFH 3PROA 3BTGE 1A1RA 2QIQA 5CE1A 1QRWA 1QBVH 2W5EA 3MI4A 3M61U 1SGFA 3UQOA 2ZDAH 3UNSA 1MTUA 1Q2WA 3UPEA 1SOZA 5ABWA 2PWXA 1AMHA 1AVXA 1GJCB 2P59A 1SFQB 3E1XB 1QTFA 1VZQH 2PFEA 4YM9A 1WV7H 2AGIX 3SQEE 1ZSKA 1SMFE 1GDUA 5J4SA 3LH3A 2DUCA 3SGQE 1TNJA 1AZZA 3GDUA 1P9SA 4ABEA 2PV9B 1D3DB 1EAIA 2J94A 4WWYA 2Z3DA 2ZNKH 4X1PU 1BTYA 1HJ9A 1BRUP 3L33A 5JB8S 1UCYH 5AF9H 2OBOA 3MU8A 2VIPA 4I31A 1SL3A 3DHKH 1GBDA 4GVUA 1P05A 2LPRA 1HXEH 1DSUA 1GBKA 3ZV8A 5A09A 2B9LA 1O3FA 5CMXH 3V13A 2ZFSA 1GI8B 3GCNA 1PPHE 1EASA 4O3UA 3D62A 4MVNA 2P93A 1IQNA 1QL8A 2WPIS 2EI6A 3M5LA 3PWCA 1TX7A 5EODA 1V2WT 1V2MT 2BDYA 3KN2A 4WY3A 1EPTA 4TWWA 1ZRKA 2WYGA 4YOIA 4A1TA 4MNYA 4E05H 1V2ST 5IDKA 1NTPA 1JWTA 3NZIA 3MO3A 3MMGA 1GBTA 2VWNA 2H6MA 3BG4C 1Y5UT 1MU6B 2FX6A 2FYQA 1EKBB 5ETXA 1ELCA 1J17T 2G81E 2BZ6H 4IC6A 2A1DB 1NT1A 1NFWA 2BLWA 2BVXH 5HMAA 3RMOH 2UWOA 3UR6A 2ZI2H 1YPLH 1DLEA 1DY9A 2DE9A 3SNAA 1P2JA 2J4IA 1P2OA 1Z6JH 1AUTC 3E3TA 3EGKH 4WF8A 5AFYH 4LZ1H 5JBBS 2W7SA 1GG6B 3BIUH 3RXMA 4CHAB 1K1MA 4TYDA 1ZPZA 1UK2A 1SGQE 3VXFH 1SLWB 2F3CE 4D76A 1ETSH 2ZGBH 1ZSJA 2AMQA 5EXNA 2A7HA 2BX4A 3BTTE 1O3IA 1UVUH 4U01A 1OWKA 4BTUB 1C9TA 2KAIB 1HAVB 1FAXA 1QB1A 1UJ1A 1ABJH 5DK1A 3GY8A 2AMPA 1HUTH 1CA0C 2GZ8A 1F0UA 1LKBA 3HK6B 1CA8B 1OWEA 2QA9E 1AIXH 1MKWH 3PTNA 3QWCH 5DP6A 3UTUH 2R3YA 2ZU1A 4ZKOU 1QURH 1C1MA 4LK4A 3UWIA 4ZROA 2WPKS 4F49A 1F0TA 2ULLA 3A86A 2SGPE 3GDVA 1XUFA 1KXEA 4FVDA 2BHGA 1TB6H 4CBOA 3H7TA 4Y8YA 3KQCA 1O2HA 3MFJA 4NZLA 1IOEA 3RXEA 3O8DA 1HXFH 2BM2A 1H1BA 3RMLH 5HM2A 1FXYA 3JZ2B 1G9IE 4Y7BA 1C5NH 4MPWA 1A0LA 1AFEH 1QR3E 1E37B 2ODYB 5FCKA 3E6PH 1P2IA 3SNDA 1UVSH 2GP9B 3U9AH 1SGCA 3MYWA 2IJOB 1VR1H 2VINA 1UCYE 3BTHE 4BANB 1O34A 1TRYA 2ZDMA 3ZVBA 1UHBA 2P16A 1EOLA 1FONA 2VWLA 3ATWA 1HAHH 1BCUH 5AHGH 1ZGVA 1L1JA 1O2KA 1Q31A 2OCVB 1AZ8A 1NC6A 3FZZA 3P8NA 3SI3H 2F9BH 4AB9A 4THNH 1W12U 2A7CA 3SUGA 8KME2 1SOTA 2GCHF 4DOQA 1O2ZA 1O3JA 2J38A 1F2SE 2SFAA 2H5DA 2WUBA 4FUGA 1TNGA 2A2QH 1ELVA 4JCNA 4X2XA 3FFGA 4X6OA 1NU9A 4FUCA 1RGQA 2FI3E 5B6OA 5A0AE 5BRRE 1O2GH 2Z9KA 3ZZ6A 1PPZA 1UO6A 2BY6X 2AIPA 1ETTH 5E8EH 1GVKB 1MAYA 4JZEH 5E0JA 4Q7XA 2RDLA 1P01A 1TPAE 3M7TA 1ELFA 7KMEH 3MU5A 4ISNA 4IBLH 2ESTE 2P94A 1WBGB 1IQLA 2VWOA 1FY4A 1GBIA 4FUFA 1C1WH 1NFUA 3RXRA 1AB9C 1MKXK 2OINA 4TY7A 2R2MB 2FXRA 1ANBA 1W10U 4HFPB 1MAXA 1C5VA 3MTYA 2BVSH 1KIGH 1TNHA 1GMCG 3MNXA 4BAKB 2ZDVH 1XM1A 1ZZZA 3KEEA 3U1IB 1KTTB 4NWLA 4A6LA 3F1SB 4JK5A 1BJUA 1O2TA 1AUJA 1L4DA 2ZCHP 1O5DH 2ZPSA 4IC5A 4NIWA 2OQ5A 1C2MA 5E2PA 1Z1JA 2JH6D 2PTCE 1GI3A 4ABBA 1XXDA 1GG6C 3RXIA 2A4OA 4CHAC 2G5NA 3FVFB 4H6SB 2VH6A 3B9FH 1T8MA 9ESTA 3A82A 1LVYA 1SB1H 3SQHE 2ZHQH 3WY8A 3DD2H 2HVXA 1VJAU 1OKXA 2VIOA 3Q00A 5F6MA 1EP5A 5DP8A 5LGOA 2C8YB 3VGCB 1FN6A 4A5TS 1ZMNA 1BIOA 3SU5A 1W14U 2P3UB 4O9VA 3M5OA 3PTBA 4YOJA 1BTPA 3LJJA 1EP6A 3G01A 3W95A 3SU1A 1EJAA 3LGYA 2VVCA 1OS8A 1KLIH 1T8NA 1DXPA 4MLFB 3QTVH 2BDIA 4XSKU 1YPJH 1C5SA 3NPSA 1GHAF 1QQ4A 3P6ZB 1GJ4H 2J92A 2ZQ2A 1C1TA 3VB5A 1QQUA 3LGUA 2VVVA 4AN7A 3RXSA 3HKJB 2QXJA 2TGTA 1NM6A 4CRGA 2I6SA 1AD8H 3FP7E 1UTMA 1GMCF 1LHGH 1AKSB 1DITH 4BAHB 1S83A 1XVMA 2UWPA 4INLA 1M9UA 2GGVB 1DSTA 4X6NA 3PLPA 2FOHA 3S7KB 3BEUA 1UVPA 2G51A 2H9HA 1DY8A 3QGJA 2CV3A 1ZOMA 2NU4E 1H9LB 3T25A 4AG2A 5DJ7A 2J95A 1AFQB 2FPZA 1F5RA 1JRTA 1TONA 2PKAB 2ZGJA 5ESTE 1P09A 4LXBH 1V2NT 1TX6A 2AH4X 1C5TA 1BB0B 4YT7H 1V2KT 1TMUH 5C3NA 2TBSA 1EJMA 1C4V2 4NA7A 4BAOB 1OX1A 1MQ6A 3RXJA 1KXBA 1F0SA 4UE7H 1WQVH 2BY9X 1NN6A 1PPCE 2Z9LA 2VJ1A 1F0RA 1V6DA 3F68H 2NU1E 4B2BA 1ESBA 3ZZ8A 1C2JA 3ZYEA 1O5EH 1MZDA 5EPNA 1BJVA 4NWKA 1C2EA 5JB9S 3RC6A 3ZVGA 2GV6A 1DWEH 3PMBB 1MZAA 5SGAE 5FX5A 1HDTH 1O3OA 5JBAS 2FYRA 1PQ5A 1O3LA 1C4Y2 2G4TA 5DGJA 2AFQB 2QF0A 1QBNA 2HGTH 3GY3A 2F9NA 2HWLB 1A5HA 1EJNA 3K2UA 1DFPA 2IOTA 1P12E 2C4FH 5FXLA 4I8LA 4YLQH 1TRMA 1C5RA 3V7TA 1IAUA 2GKVE 2ZP0H 1Z8JB 1O38A 2FX4A 2QY0B 3P92A 4UONA 1A3EH 1GJDB 1ZYOA 1K28D 1WTHD 1ZMJA 1S0QA 2SNVA 1G37A 3SBKA 1CGHA 4E7NA 1Y59T 3Q3YA 5I46H 5L30H 3RXVA 1XUJA 5EU8A 3SJ9A 3LGTA 5HGGA 2FIRH 3U8TH 2LNCA 1AY6H 1DANH 3QX5H 1SI5H 3A84A 3SOSA 1SGTA 1FMGA 3VGCC 4NG9H 2HPQH 1ZR0A 4ZH8A 1H9IE 3SHAH 3M3SA 4ZKRU 2QN5T 1TQ7B 4A7IB 2ZFFH 1S5SA 1INCA 3M5NA 2Z9GA 8GCHF 2FS9A 1JMOH 3A7XA 2FS8A 4BXSA 1TNLA 3HGNA 1OWHA 1MU8B 2UUFB 1BMNH 1W0YH 2C3SA 1O5BB 2FI5E 5K7RA 2PUQH 4GHQA 5F03A 3E0PB 4IN2A 3URDA 3F6UH 2EI8A 2THFB 3TK9A 2ZU5A 4TY6A 4NA9H 4A1VA 2ASUB 2G55A 3MU4A 3RXFA 1IQKA 5A8ZA 5C67A 2RG3A 1ZTLA 3AAUA 3K6ZA 1NRQH 2BDBA 4PROA 1TIOA 3BTEE 2BD2A 1DPOA 1MBMA 1P02A 1HGTH 2Z9IA 3SV7A 1C5UA 4B1TA 1FIWA 4Y7AA 1ZJKA 5HYOA 3V0XA 5EGMA 2FOAA 1HNEE 2PHBA 4I8KA 4UD9H 3ZZ4A 1AFQC 1ZPBA 1O3CA 1ZHPA 1QBOA 2Y7ZA 3TH2H 1RXPA 1QIXB 2BDHA 3MH5A 5H4IB 2ZGCA 1DT2A 2QXGA 1Z6EA 2BMGB 3LONA 1N6YA 1O2OA 1V2OT 1YPGH 1ANEA 3KQEA 4XBCA 1LHDH 1U6QA 1FY5A 2PW8H 4ISOA 5GPIB 1NPMA 4TWYA 1P3CA 5AVDA 1QJ1B 2K1QA 1RTLA 4FU7A 4X1SU 1TFXA 1FJSA 3DFLA 1O2QA 1A2CH 5T6DA 4TPIZ 1C2DA 4ABFA 2OUAA 3SGAE
chains in the Genus database with same CATH superfamily
1C1PA 3ZYDA 1OPHB 1K21H 3GCTF 1JXPA 3D23A 1YCPK 1IHSH 1CT4E 2XBXA 1VITF 3F0OA 1HIAA 3TK5A 2BXTH 4MNWA 1GJ5H 1KDQA 4DVAU 1HAXB 1EZQA 4K1EA 4Y76A 1CHOG 1SGPE 1EOJA 3MO6A 1SSXA 3GCOA 3A88A 2HNTF 1GMDF 1ZRBA 2FDAA 3ZV9A 2FOBA 1HJ8A 1E35B 5JBTA 1CVWH 3D65E 1WYKA 1NFXA 1VCWA 1BHXB 4X1NU 1V2UT 2F4LA 1EPTB 4HG6A 1BMAA 5T6GA 4TPYA 2XWBI 1RS0A 1OWJA 4BOHA 2C8WB 3F2GA 2ZFTA 6GCHF 2A7JA 3LH1A 3AVZA 3VB3A 3GY7A 2Y5GA 5LPRA 2FZZA 3A7WA 3B23B 3MH4A 2C93B 4X8VH 3T2NA 2ZPRA 4D7FA 3ZVDA 1ELTA 2SGEE 4Z1MD 1O3MA 5JYIA 4DJZB 4FXGH 3VG8A 5HIZA 1YPKH 1ZGIA 1L0ZA 2C8ZB 2GD4B 1GL0E 3EAJA 1GBJA 2ANMH 4H42U 5C17A 1C5QA 2BDGA 4YLUA 3BIVH 3PLBA 3MWIU 4Y6DA 3SW2B 1MTVA 2KCAA 4JZIA 1W2KH 1YBWA 1SQAA 1A3BH 1TAWA 1DM4B 3GYMA 1O3NA 4DIIH 4HTCH 1BRAA 2RA0A 2XBWA 2W3IA 1D4PB 1TQ0B 1V2RT 3KNXA 5ESBA 4NIYA 3UNQA 3BEIB 5FPTA 5GXPA 1CHOF 1MD8A 2XNIA 1AB9B 4WH6A 1NBMD 1HAGE 3SUDA 1GVLA 2BVRH 3QN7A 1FPCH 3TVJB 1EB2A 2BD3A 2QAAA 2H9EH 2YNAA 1L1NA 1IQEA 3GDSA 1BQYA 1C5PA 1O0DH 4KGAA 1BUIA 2RCEA 3GICB 4I8HA 3PLKA 2ZFQH 1C1OA 1E34B 2Z7FE 5CHAB 1FY1A 1UTOA 1Z8RA 3A85A 1O39A 1V2LT 4FUBA 1QGFA 1W13U 3GOVB 4OM9A 3ZZ7A 2TPIZ 3OEHD 3QUMP 4IGDA 2IN2A 3F9HA 3KCGH 1F5LA 3BN9A 3UB0A 3ATKA 4CBNA 1B0EA 3N7EA 3RXOA 2Z3EA 4MPVA 2XC4A 3PV2A 2IJD1 2OD3B 1QRZA 2J34A 5KEDA 1MUEB 1GI1A 5DKMA 1UHBB 1XKAC 4NFEA 1GBLA 2BOHB 1GWAA 2GCHG 3DT0H 4KTUA 3EA7A 4OS6A 3ATMA 1C2FA 4FUEA 2W7UA 3ODDA 5IK2D 5TCCA 1H8IH 1YPMH 1H8ED 1OXGA 2FEQH 1LMWB 2VGCB 1BRCE 1Z8IB 1LHCH 3A87A 1IQIA 2UUKB 1OOKB 2R0KA 3T28A 1V3XA 2ZCKP 2YNBA 3F2HA 1EAWA 5A2MH 3SU6A 1T31A 4DGJA 1SPJA 4CR9A 1NS3A 3PWBA 4KELA 2JETB 1GI5A 1YLCA 3SN8A 3MNCA 3ELAH 3NXPA 1C2KA 1HPGA 1SFIA 4J1YA 5GJ4B 1T4UH 4KP0A 2NU0E 3ZZ5A 1TGTA 3RU4E 1LPZB 1O33A 1C5LH 1GBMA 5DP9A 3UQVA 2ZIQH 3A7TA 3GY4A 1ESTA 1O5CB 4JMYA 4DURA 1O37A 1CT2E 3TNTA 1AO5A 1HCGA 1CGJE 2RDEA 3RXHA 1Z8GA 1EPTC 4JZ1A 3SUEA 5C94A 1J14A 3HGPA 3PMJA 1EQ9A 4GHTA 2JH5D 1K1JA 3VB6A 1C2LA 4DY7B 2BDCA 4Q2KA 2BD4A 2VIVA 3NRLA 1TOCB 3OYPA 3ZZCA 3Q76A 1ZHRA 3TNSA 3E91A 3QDZB 3LJOA 3RC5A 4RN6A 1JOUB 2ZDLA 2Y5FA 5T6FA 2V3MA 2ZQ1A 4NA8A 3Q3KA 7GCHF 1PFXC 2BX3A 1TNKA 2GZ9A 2PSXA 3LIWA 4D9QA 1K1PA 2YOLA 4GCHF 2Q6DA 4Q63A 4B76A 1QB9A 1WAYB 1SLXB 3EE7A 3M3VA 1O30A 5EW2H 1O3AA 3RXAA 2XYAA 3T27A 3UR9A 3OY6U 1OYTH 1P06A 3JZ1B 1AQ7A 1K1LA 2OC7A 1C1QA 2WV5A 2ZC9H 1YPEH 1HYLA 3LOXA 3MO9A 3RDZA 1GHXH 1WOFA 3ZZDA 3GY5A 4FU8A 5JPMH 4GSOA 3HATH 1BITA 1TPSA 2F91A 1GBFA 1A61H 2ILNA 2V6NA 1GHAG 4Q4LA 2FI4E 3GY2A 1GJ9B 1O35A 3RXGA 1HBTH 1QCPA 2BXUH 5A0BA 1IQJA 1UTQA 5G4BA 5JDUB 1WCZA 4HZHA 4RKJB 2Z94A 4JYTA 4AC9A 3TITA 3U8OH 1G3EA 1UTLM 3PV5A 3QZQA 1MABB 2ZTZA 1YCPM 1YGCH 1LVOA 3RXUA 2FESH 5DP5A 1W0KD 4JYUH 5CHAC 3H7OA 1MTNB 1V2TT 3F9GA 2GZ7A 1TNIA 4MNVA 1MTWA 2BD5A 3GISB 4INHA 4Y0ZE 4ZUHA 3SUFA 4UFDH 1Z1IA 2FOGA 3OY5U 1C2GA 4WH8A 4UFFH 1VGCB 5GIBA 1MTSA 4DW2U 2KR7A 2FOEA 3E8LA 1S85A 5IYTA 3UY9A 4AGKA 2L74A 1SHHB 1O36A 2VIWA 2ZCLP 4VGCC 2A2XH 3PV4A 4IMQA 3SZNA 4CH8B 4UDWH 4CRCA 5KECA 1DS2E 1L1GA 1NO9H 2XC0A 1P2QA 3RMMH 4D9RA 4WMDA 4X0WU 1BHXF 4X6PA 4K8BA 4Y79A 3M5MA 1BTZA 1C4U2 2VGCC 2AYWA 1O3KA 5EW1H 3K6YA 3TGJE 4JYVH 3NWUA 4ZCNA 2FODA 2Z9JA 4WMEA 5C2ZA 2WUCA 1FDPA 2JETC 3QO6A 3P17H 1FX0B 3EA9A 3BTDE 3SV8A 4GAWA 1DLKB 1SGNE 4B2AA 1MH0A 1F7ZA 3MQKC 3MNSA 4WJG2 1WTGH 4XFQA 4TT3D 1DX5M 1YM0A 1P03A 2DE8A 2UUYA 2QV1A 3P8OA 3V3MA 2ZGHA 3I78A 3QK1A 2WYJA 5C20A 3R0FA 1TMTH 1NRNH 3DFJA 1B0FA 1ZSLA 2D1JA 4KTSA 1KXFA 4U30A 4ABAA 1ID5H 3TPIZ 1QHRB 2CF9H 3V12A 3ATIA 1SLUB 3BG8A 2V7QD 4BAQB 1EZUC 1MCTA 3A83A 2AGGX 1YPHC 4MTBA 2O8UA 1G2LA 4I7YH 2G00A 4JK6A 2ZGXH 5CDFE 1UK3A 4XD7D 1OP0A 1BOQA 2Y7XA 1ELDE 1HAIH 1TMBH 2F9PA 3BSQA 3M36A 3TJOA 2HOBA 1OP2A 5E2OA 2A5IA 1GBAA 4OS4A 4B71A 4CH2B 5HIYA 3QGNB 1LHEH 2CHAB 2BZAA 5DSFA 3RXLA 3A81A 1PPGE 2A31A 4XDEA 2F43B 5E0HA 1DWDH 3SI4H 3SU0A 4E06H 3F3BA 1GBEA 3BTME 3MH6A 3RU4T 3OX7U 4UFEH 3MOCA 1DE7H 1XUIA 4Z6AH 2HPPH 1PQAA 2JH0D 2LP6A 1MKXH 3DUXH 3QZRA 3SJKA 1P3EA 1PPEE 2Z6BD 7LPRA 2BQ7B 2H9TH 8GCHG 3FANA 2ZF0H 4NZQA 3HPTB 3SORA 1ETRH 5DP7A 5FL7D 3LC3A 1YPHE 2V3HH 1BBRK 2JJ2D 3RXDA 2QXIA 2XBVA 1QL7A 5FPYA 1D3TB 3BTFE 1P04A 3ZZBA 2GVFA 1FAKH 5PTPA 1NRSH 4NSVA 1C1UH 1BDAA 2H2ZA 5FPSA 4H6TA 1AGJA 1YLNA 3WW7A 3LT3A 3R3GB 2PSYA 2A32A 1NRRH 1O5GH 2ZTYA 5C1UA 3S0NA 4AYYB 1GI2A 5EXMA 3ESTA 3C1KA 4K69A 1SVPA 1TLDA 3ZVFA 1MBQA 1E1QD 4ABHA 1ESAA 1GPZA 1J15A 1J9CH 1MTNC 1S81A 2AHME 3SU4A 1GJ6A 2ZEBA 1VCQA 2WINI 3SHCH 2ZFPH 1FUJA 1ELGA 3LU9B 2GTBA 2CJIA 3A7VA 3RU4D 4AYVB 2BLVA 3N7OA 1G3CA 2BB4A 2OC1A 1ZPCA 1VGCC 4ABGA 1VCPA 4Z0KA 1WUNH 1O2WA 1C5OH 3UWJH 2KX4A 3DA9B 4K60A 3I77A 1AHTH 3OSYA 1D3QB 3RM2H 1XUKA 2HLCA 2PTNA 3MU1A 4Y8ZA 2ANYA 4B75A 3ITIA 2O9QA 1DDJA 5CHBA 5GDSH 2QF4A 2F9OA 3KHVA 3GCTG 4FVBA 5DP4A 3NK8A 4DT7B 1QL9A 4NIXA 1VITG 1RJXB 1NRPH 1TA6A 1LO6A 2R2WU 3F9FA 1SLVB 1UCYK 1GHYH 1QJ6B 4BTIB 3RLYH 2OC8A 2FWWA 3VPKA 1KTSB 1TYNA 1Y5AT 1P57B 3MH7A 2BD7A 1GMDG 3P95A 2SNWA 3A8CA 3RP2A 2Y81A 3UFAA 1FY3A 1CGIE 1GGDC 3ZVCA 1HIAB 3KQ5A 1YC0A 2WPHS 3AW0A 2J9NA 1KDQB 1C1NA 4R0IA 2B0FA 2JKHA 1THRH 4M7GA 6GCHG 1PQ8A 1C5YB 1PPFE 2JDID 1TGBA 4B2CA 4YOGA 1MCVA 1O2JA 2NWNA 5F8XA 4WXVA 3RXPA 5FAHA 5JBCS 3TGIE 3EA8A 1B7XB 1EAUA 1G2MA 4IN1A 2ZU2A 1GBHA 1P0SH 4ABDA 4CRAA 3W94A 1K1NA 1N1LA 1ZMLA 3RXKA 1KSNA 3HKIB 4ZHLU 1KXDA 2ZKSA 2PGQB 4YTAA 3S9AA 2Q1JA 1QNJA 1MMJN 4K1TA 3VB4A 1O3HA 2R0LA 6ESTA 3H5CB 2CHAC 1EFRD 1EZXC 2OXSA 1BBRH 3GYLB 3TJVA 5HXFA 1C2HA 1T4VH 1HFDA 3DSOA 3SO3A 1AU8A 5DPAA 1YLDA 3MU0A 4RI0A 1DOJA 2FOMB 1W3CA 3A7ZA 4OS5A 1Y3VA 2QE7D 5F53A 1GHZA 1HLTH 1H4WA 2BD8A 2VWMA 4K1SA 4QT8C 1BTHH 2VVUA 3EDXB 4X2WA 1S6FA 3FZDA 1O2XA 1UTKA 2WPJS 3BV9B 6CHAB 1P11E 1FY8E 3NUMA 1ZHMA 4AORA 1RTKA 1V2QT 2CMYA 4Y10E 1ELAA 1BRBE 1UW7A 1MKWK 2P8OB 3Q77A 2IPHA 4AZ2B 2FO9A 2AS9A 2J2UA 3DSGA 1TGSZ 5L2ZH 1LVMA 1Z71A 2YMSD 1HAZB 1CQQA 1IHTH 3NKKA 4B74A 2ZDNA 1O2LA 3GY6A 1TBRH 1EZSC 1CE5A 3VXEH 1IQHA 1KLTA 2AMDA 4RT0A 5LPFA 1XXFA 4YXWD 1SGDE 4YT6H 2BY5X 3D49H 2XRCA 3AASA 1GHBG 1JBUH 1XKBC 2UUJB 3TJUA 1CBWC 2AERH 4Q7YA 4AGJA 1ANCA 1O2YA 1AE5A 1PJPA 4HI3A 3QTOH 3U28C 2R3UA 4FETA 1GDQA 1S6HA 4BTTB 1FI8A 2SGAA 4X2VA 5A8XA 1UVTH 3CP7A 1AVGH 4GUXA 2BY8X 1W0JD 2PR3A 4O03A 4X2YA 1THSH 3GCHB 3S9BA 1A46H 4DT4A 1QFKH 3H09A 1F5KU 1CO7E 4OGXA 2QGRA 1MQ5A 3I29A 1P9UA 1SGEE 1ARCA 1LQDB 4NCYA 2C8XB 2D26C 1H8DH 1CHGA 2WPDD 4ISIH 4OS1A 4Q7ZA 3OEED 2ODQA 3Q3XA 1OP8A 1T7CA 5HKKD 1SHYA 2W6JD 5B6LA 2HALA 1EATA 3A80A 4O3TA 2GDEH 1F92A 2PGBB 1E1RD 1FN8A 5T3HA 1D6RA 1BTWA 2ZECA 2YMSB 2EEKA 2RA3A 3TLOA 2EY4C 5C5OA 3A7YA 3A8AA 3LKWA 1EAXA 1HAOH 2EC9H 2VU8E 1YF4A 2Z3CA 3EYDA 2WPLS 4CRBA 1HJAB 2ZG0H 3T62A 1GI0A 1GHBF 1N8OB 4Y0YE 1O2MA 4AFUA 1BBRE 1D3PB 1O3GA 1P2MA 4NGAH 4YESB 4MQAA 2GMTC 1GMHG 2QF3A 1GCTB 1YY3A 3KGPA 2UWLA 3O8CA 2ZDKA 2OLGA 1QA0A 5EG4A 1FNIA 2O8WA 1AN1E 4YZUA 4RSPA 1K22H 2V3OH 3SNCA 2BLQA 1YCPH 7GCHG 5EQSA 1UVOA 1IQFA 1SG8B 4VGCB 3ZZAA 2ZA5A 4DCDA 2PLXA 3WWFA 2GJGA 4GCHG 5C0TA 1TGCA 3T26A 4UEHH 1DUEA 4YO9A 3T5FH 1Q3XA 1E0FD 3PMHB 1SGRE 2TGDA 1TRNA 5HM9A 2WV4A 3O8RA 1HAPH 2BD9A 1GJ7B 2O8LA 2ZO3H 1T8LA 1BTXA 2ODPA 3P8GA 1C1RA 1YYY1 3F2FA 1ELEE 1KLJH 1GI9B 5FBEA 1BMMH 3UAIC 2CXVA 1GHWH 5J4QA 1RTFB 2XTTB 1TALA 3SNEA 1J16A 5F8TA 2J97A 2OQUA 1XUHA 5GWZA 4WMFA 2GT8A 3RLWH 1KYNA 1QRXA 2G8TA 3K65B 2G52A 4A92A 6CHAC 5FX6A 3SNBA 1O5FH 2TRMA 3E16B 3N7DA 1EB1H 1GJ8B 3PM3A 3M35A 4ABJA 1A7SA 2D2DA 1BMLA 2P8OC 3OTJE 1HV7A 2W6ID 1LPGB 2QC2A 4I33A 2D8WA 1EX3A 1NESE 2A0QB 3QLPH 2Q6GA 3PB1E 3IITA 1XVOA 3L3TA 2FLRH 4ASHA 1SGFG 4MG3A 3LGIA 5AFZH 2GDDA 1GMHF 1JIRA 3UOUA 1O3BA 4F48B 3C27B 1GJBB 1GI4A 1W11U 1GDNA 1TX8A 1O31A 1RFNA 3TH4H 4ABIA 2KAIA 1SGYE 2V0BA 1HAVA 5C1XA 1Y3WA 3KQBA 4B6FA 9LPRA 1Y3YA 3LDXH 4WXIA 3TK6A 4ESTE 2BTCE 2PKSB 1JIMA 2A4RA 2VIDA 2AEIH 2VNTA 2OK5A 2WV9A 5FCRA 4AG1A 1O2IA 1TBQH 4OS2A 2XC5A 1W0ZU 4X8TH 2A5AA 1QZ8A 2OTVA 3ZZ3A 2R9PA 5LH8A 2FOCA 4K2YA 4XOJA 3RMNH 1SQTA 4MDSA 1SKYE 1LVBA 4CRDA 1T8OA 1SR5C 1CU1A 3A8DA 5A8YA 3GCHC 1AI8H 3BTKE 1QB6A 4FUJA 2BQWB 2SGQE 1LDTT 1ZTKA 2Y6TA 1YKTA 2KZ4A 1Y3XA 1DWBH 4TSFD 3E0NB 5F8ZA 4D7GA 3U98H 4U32A 3KIDU 2XCNA 2F9UA 3TIUA 4ASUD 4AFZA 1P2KA 1DWCH 1VJ9U 1PYTD 2YMSC 4U2WA 3STIA 3UNRA 1S84A 3TU7H 1V2VT 2C90B 4K5ZA 4IW4E 1L2EA 2FOFA 1FV9A 1MD7A 4ZXXH 2ALPA 2OBQA 3SJOA 1SGIB 1TE0A 3BTWE 4BNRA 4FUIA 1HJAC 2A4QA 5EXLA 2QYIA 3UIRA 1N8OC 4XE4A 1K1IA 3CENA 6LPRA 1UMAH 3FN8A 3BF6H 4I8GA 3S7HB 2XXLA 1K1OA 3KYFA 2V35A 2XNDD 1GCTC 1QJ7B 5K0HA 3S69A 2O8TA 3FP8E 4IS5A 1E36B 1ACBE 1RRKA 2Y82A 5FHTA 7ESTE 3U8RH 1ARBA 2XWAA 1C5MD 2W26A 4LZ4B 4A1XA 1NY22 2FMJA 3L6PA 1S0RA 5EPYA 4MNXA 1O2VA 5BPEA 2KCYA 2ALVA 1H9HE 5DN6D 2XOKD 1G3BA 3AW1A 5C5NA 3UOPA 3HK3B 4Q80A 1K2I1 1KY9A 2FTLE 2EA3A 4AFQA 1V2PT 3EE0B 1P10A 5DP3A 3E90B 2W3KA 1LQEA 4ISLA 2BOKA 5E0GA 3S9CA 1GCDA 1GGDB 3RM0H 2A5KA 4DG4A 8LPRA 4BAMB 3SV6A 1X7AC 3AAVA 2BQ6B 1AE8H 3ZVEA 1C1SA 3IG6B 2B8OH 3M7UA 1G32B 1ABIH 3FAOA 2ZTXA 3ZZ9A 1XMNB 4P02A 2PUXB 4ZKNU 4Y8XA 4K3JA 3CS0A 1SQRA 4Y11E 1SBWA 1EUFA 2GT7A 1VITH 1FLEE 1JRSA 2IPQX 3T29A 2A45B 3EQ0H 3PO1B 4I32A 2ZHDA 1OSSA 1IQMA 4HGCA 3LGVA 4KKDA 3TJNA 3FKSD 2F9VA 3UUZA 1J8AA 5GCHG 2TIOA 2WPMS 2PKSC 4DIHH 4Y71A 3M37A 1WXRA 1C5XB 2KFWA 2NU2E 5L6NH 1ZJDA 1OYQA 5EQQA 1O32A 2K0QA 1FQ3A 2M5TA 1N6XA 3SU2A 1E38B 4ZHMU 2XCFA 2VIQA 4FUHA 4I8JA 3OTPA 4MPXA 1K9OE 3K9XB 4LOYH 4NSYA 1O3EA 2CGAA 3UREA 1C1VH 4AOQA 4D8NA 3U69H 1O2SA 1O2PA 1RIWB 4AFSA 1G3DA 1GJAB 4KTCA 1FIZA 3SV2H 4O97A 1DXWA 1AKSA 1C9PA 1O2NA 4FU9A 2GCTB 4JZFH 1Y5BT 3STJA 2AGEX 4I86A 3F9EA 1C5ZB 4AX9H 2SGDE 2ZHEH 4IMZA 2ZPQA 4CREA 3ODFA 2BYAX 1W7GH 1QY6A 2OP9A 3A8BA 2QXHA 2NU3E 3OE7D 1DUAA 4SGAE 2XW9A 3RXQA 3SU3A 4ACAA 1GBBA 3KF2A 4INKA 1V2JT 3SYJA 1ORFA 1UTNA 2PKAA 1YP9A 2FP7B 5I25A 2HLDD 2A4GA 1TPPA 3LC5A 4CRFA 2WHXA 1SQOA 1ZLRA 3WWBA 1LTOA 2STBE 1NFYA 1ZTJA 1UTJA 1WSSH 1CBWB 5GCHF 2QCYA 2BDAA 2JIZD 4BXWA 1Y3UA 4AB8A 3A89A 1A0HB 1A0JA 3URCA 3ENSB 2F83A 2WZQA 4X1RU 1S82A 1TGNA 1TBZH 3MHWU 1T32A 1B5GH 1NROH 2HNTC 5TCAA 4CR5A 1BT7A 4K8YA 3W1EA 1BZXE 1GL1A 1C2IA 3SJ8A 1Z7KA 2STAE 4B73A 2ZHFH 2XBYA 3P70B 3SZEA 4MPUA 1BTUA 2OC0A 2H1UA 2ZZUH 1G30B 2ZU3A 1DVAH 4X6MA 2BY7X 3RXTA 1TOMH 1GBCA 4GLYA 2P95A 1LKAA 5FBIA 3B8JA 1UK4A 3FP6E 4ZHAA 4X8UH 1WDIA 1O3PB 2H5CA 2AIQA 1PPBH 1TPOA 1CT0E 1GI6A 1A5GH 3LGWA 1O3DA 2GX4A 2CN0H 1HRTH 2J5UA 4UFGH 1D6WA 2VBCA 1LPKB 3VEQB 1O2RA 4ZMAH 5DG6A 2HNTE 2Q6FA 3OFND 3PYHA 1W8BH 2ZWLH 1GHVH 1PYTC 3RUOA 1Y8TA 2J98A 3BG4B 1XX9A 1KXCA 2KCOA 3SGBE 2G5VA 3KL6A 1WQSA 8ESTE 1RD3B 3SJIA 3P8FA 1WU1A 1XUGA 4NFFA 2ZU4A 3U1JB 4GPGA 4OS7A 2VH0A 1D9IA 5A0CA 1G36A 2GMTB 5TJXA 1O5AB 5LPEA 1OHHD 1UTPA 3FO8D 3PRBA 1VKYA 2FTMA 2TGPZ 5EJLA 2P3TB 2HVYB 1FPHH 3OU0A 4E7RG 1A4WH 1TWXB 2CF8H 1EXFA 5EQRA 3NCLA 3PO1C 4RT1A 2EI7A 1CSOE 3IWMA 2GV7A 5C1YA 2JJ1D 1BA8B 1OWIA 4F4OC 3PMAB 4ZAEA 4XBBA 1OWDA 2ZHWH 2G4UA 1LCYA 4FUDA 2FLBH 4RKOB 2P3FH 4XBDA 4OGYA 1AVWA 2VB0A 1FZZA 1QA7A 1CA0B 2HRVA 3RXBA 1O2UA 4R8TB 2BLOA 1NZQH 1TABE 1HAYB 1P8VC 2I6QA 3KQDA 3M7QA 4ZXYH 4X1QU 5KGOA 3BTQE 3RXCA 1RIWC 4NIVA 3O8BA 3BEFB 2FM2A 4J2YB 2B5TB 1PQ7A 1DICA 3CS7A 2TGAA 3TGKE 3VFEA 1A5IA 4ISHH 2GCTC 1GI7B 4WVPE 1HB0B 1TA2A 1KXAA 1NU7B 2ZFRH 4ZKSU 3RC4A 1SC8U 4X8SH 5T1VA 2Y5HA 1GVZA 3ATLA 4SGBE 2O8MA 1AWHB 4JZDH 2ANKH 4H4FA 1L4ZA 5DO4H 1IQGA 2Y80A 5EOKA 3TH3H 3ZVAA 3VB7A 5L2YH 1AWFH 1ELBA 3SV9A 1C5WB 1THPB 2ANWA 3LPRA 1ANDA 2SGFE 3MNBA 1P2NA 3M3TA 2B7DH 1W7XH 1LHFH 3PROA 3BTGE 1A1RA 2QIQA 5CE1A 1QRWA 1QBVH 2W5EA 3MI4A 3M61U 1SGFA 3UQOA 2ZDAH 3UNSA 1MTUA 1Q2WA 3UPEA 1SOZA 5ABWA 2PWXA 1AMHA 1AVXA 1GJCB 2P59A 1SFQB 3E1XB 1QTFA 1VZQH 2PFEA 4YM9A 1WV7H 2AGIX 3SQEE 1ZSKA 1SMFE 1GDUA 5J4SA 3LH3A 2DUCA 3SGQE 1TNJA 1AZZA 3GDUA 1P9SA 4ABEA 2PV9B 1D3DB 1EAIA 2J94A 4WWYA 2Z3DA 2ZNKH 4X1PU 1BTYA 1HJ9A 1BRUP 3L33A 5JB8S 1UCYH 5AF9H 2OBOA 3MU8A 2VIPA 4I31A 1SL3A 3DHKH 1GBDA 4GVUA 1P05A 2LPRA 1HXEH 1DSUA 1KMHB 1GBKA 2QF5A 3ZV8A 1COWD 5A09A 2B9LA 1O3FA 1BMFD 5CMXH 3V13A 2ZFSA 1GI8B 3AK5A 3GCNA 1PPHE 1EASA 4O3UA 3D62A 4MVNA 2EQNA 1IQNA 2P93A 1QL8A 2WPIS 2EI6A 3M5LA 3PWCA 1TX7A 5EODA 3DCLA 1V2WT 1V2MT 2BDYA 3KN2A 4WY3A 1EPTA 4TWWA 3KYGA 1ZRKA 2WYGA 4YOIA 4A1TA 4MNYA 4E05H 1V2ST 5IDKA 1NTPA 2CK3D 1JWTA 3NZIA 3OAAD 3MO3A 3MMGA 1GBTA 2VWNA 2H6MA 3BG4C 1Y5UT 1MU6B 2FX6A 2FYQA 1EKBB 5ETXA 1ELCA 1J17T 2G81E 2BZ6H 4IC6A 2A1DB 4XRNA 1NT1A 1NFWA 2BLWA 2BVXH 5HMAA 3RMOH 2UWOA 3UR6A 2ZI2H 1YPLH 1DLEA 1DY9A 2DE9A 3SNAA 1P2JA 2J4IA 1P2OA 1Z6JH 1AUTC 3E3TA 3EGKH 4WF8A 5AFYH 4LZ1H 5JBBS 2W7SA 1GG6B 3BIUH 3RXMA 4CHAB 1K1MA 4TYDA 1ZPZA 1UK2A 1SGQE 3VXFH 1SLWB 2F3CE 4D76A 1ETSH 2ZGBH 1ZSJA 2AMQA 5EXNA 2A7HA 2BX4A 3BTTE 1O3IA 1UVUH 4U01A 1OWKA 4BTUB 1C9TA 2KAIB 1HAVB 1FAXA 1QB1A 1UJ1A 1ABJH 5DK1A 3GY8A 2AMPA 1HUTH 1CA0C 2GZ8A 1F0UA 1LKBA 3HK6B 1CA8B 1OWEA 2QA9E 1AIXH 1MKWH 2KM0A 3PTNA 3QWCH 5DP6A 3UTUH 2R3YA 2ZU1A 4ZKOU 1QURH 1C1MA 4LK4A 3UWIA 4ZROA 4F55A 2WPKS 4F49A 1F0TA 2ULLA 3A86A 2SGPE 3GDVA 1XUFA 1KXEA 4FVDA 2BHGA 1TB6H 4CBOA 3H7TA 4Y8YA 3KQCA 1O2HA 3MFJA 4NZLA 1IOEA 3RXEA 3O8DA 1HXFH 2BM2A 1H1BA 3RMLH 5HM2A 1FXYA 3JZ2B 1G9IE 4Y7BA 1C5NH 4MPWA 5C0UA 1A0LA 1AFEH 1QR3E 1E37B 2ODYB 5FCKA 3E6PH 1P2IA 3SNDA 1UVSH 2GP9B 3U9AH 1SGCA 3MYWA 2IJOB 1VR1H 2VINA 1UCYE 3BTHE 4BANB 1O34A 1TRYA 2ZDMA 3ZVBA 1UHBA 2P16A 1EOLA 1FONA 2VWLA 3ATWA 1HAHH 1BCUH 5AHGH 1ZGVA 1L1JA 1O2KA 1Q31A 2OCVB 1AZ8A 1NC6A 3FZZA 3P8NA 3SI3H 2F9BH 4AB9A 4THNH 1W12U 2A7CA 3SUGA 8KME2 3CNRA 1E79D 1SOTA 2GCHF 4DOQA 1O2ZA 1O3JA 2J38A 1F2SE 2L6OA 2SFAA 2H5DA 2WUBA 4FUGA 1TNGA 2A2QH 1ELVA 4JCNA 4X2XA 3FFGA 4X6OA 1NU9A 4FUCA 1RGQA 2FI3E 5B6OA 5A0AE 5BRRE 1O2GH 2Z9KA 3ZZ6A 1PPZA 1UO6A 2BY6X 2AIPA 1ETTH 5E8EH 1GVKB 1MAYA 4JZEH 1H8HD 5E0JA 4Q7XA 2RDLA 1P01A 1TPAE 3M7TA 1ELFA 7KMEH 3MU5A 4ISNA 4IBLH 2ESTE 2P94A 1WBGB 1IQLA 2VWOA 1FY4A 1GBIA 4FUFA 1C1WH 1NFUA 3RXRA 1AB9C 1MKXK 2OINA 4TY7A 2R2MB 2FXRA 1ANBA 1W10U 4HFPB 1MAXA 1C5VA 3MTYA 2BVSH 1KIGH 1TNHA 1GMCG 3MNXA 4BAKB 2ZDVH 1XM1A 1ZZZA 3KEEA 3U1IB 1KTTB 4NWLA 4A6LA 3F1SB 4JK5A 1BJUA 1O2TA 1AUJA 1L4DA 2ZCHP 1O5DH 2ZPSA 4IC5A 4NIWA 2OQ5A 3F0PA 1C2MA 5E2PA 1Z1JA 2JH6D 2PTCE 1GI3A 4ABBA 1XXDA 1GG6C 3RXIA 2A4OA 4CHAC 2G5NA 3FVFB 4H6SB 2VH6A 4M9FA 3B9FH 1T8MA 9ESTA 3A82A 1LVYA 1SB1H 3SQHE 2ZHQH 3WY8A 3DD2H 2HVXA 1VJAU 1OKXA 2VIOA 3N99A 3Q00A 5F6MA 1EP5A 5DP8A 5LGOA 2C8YB 3VGCB 1FN6A 2LELA 4A5TS 1ZMNA 1BIOA 3SU5A 1W14U 2P3UB 4O9VA 3M5OA 3PTBA 4YOJA 1BTPA 3LJJA 1EP6A 3G01A 3W95A 1S6LA 3SU1A 1EJAA 3LGYA 2VVCA 1OS8A 1KLIH 1T8NA 1DXPA 4MLFB 3QTVH 2BDIA 4XSKU 1YPJH 1C5SA 3NPSA 1GHAF 1QQ4A 3P6ZB 1GJ4H 2J92A 2ZQ2A 1C1TA 3VB5A 1QQUA 3LGUA 2VVVA 4AN7A 3RXSA 3HKJB 2QXJA 2TGTA 1NM6A 4CRGA 2I6SA 1AD8H 3FP7E 1UTMA 1GMCF 1LHGH 1AKSB 1DITH 4BAHB 1S83A 1XVMA 1K0HA 2UWPA 4INLA 1M9UA 2GGVB 1DSTA 4X6NA 3PLPA 2FOHA 3S7KB 3BEUA 1UVPA 2G51A 2H9HA 1DY8A 5EJ1A 3QGJA 2CV3A 1ZOMA 2NU4E 1H9LB 3T25A 4AG2A 5DJ7A 2J95A 1AFQB 2FPZA 1F5RA 2WSSD 1JRTA 1TONA 2PKAB 2ZGJA 5ESTE 1P09A 2KCPA 4LXBH 1V2NT 1TX6A 2K8IA 2AH4X 1C5TA 1BB0B 4YT7H 4B6EA 1V2KT 1TMUH 5C3NA 1NBME 2TBSA 3DSPA 1EJMA 3PRDA 1C4V2 4NA7A 4BAOB 1OX1A 4P00A 1MQ6A 3RXJA 1KXBA 1F0SA 4UE7H 1WQVH 2BY9X 1NN6A 1PPCE 2Z9LA 2VJ1A 5GNDA 1F0RA 1V6DA 3F68H 2NU1E 4B2BA 1ESBA 3ZZ8A 1C2JA 3ZYEA 1O5EH 1MZDA 5EPNA 3GS9A 1BJVA 4NWKA 5EIYA 1C2EA 5JB9S 3RC6A 3ZVGA 2GV6A 4FOUC 1DWEH 3PMBB 1MZAA 5SGAE 5FX5A 1HDTH 5EJZA 1O3OA 5JBAS 2FYRA 1PQ5A 1O3LA 1C4Y2 2G4TA 5DGJA 2AFQB 2QF0A 1QBNA 2HGTH 3GY3A 2F9NA 2HWLB 1A5HA 1EJNA 3K2UA 1DFPA 2IOTA 1P12E 2C4FH 5FXLA 4I8LA 4YLQH 1TRMA 1C5RA 3V7TA 1IAUA 2GKVE 2M2AA 2ZP0H 1Z8JB 1O38A 2FX4A 2QY0B 3P92A 4UONA 2J98B 1A3EH 1GJDB 1ZYOA 1K28D 1WTHD 1ZMJA 1S0QA 2SNVA 1G37A 3SBKA 1CGHA 4E7NA 1Y59T 3Q3YA 5I46H 5L30H 3RXVA 1XUJA 5EU8A 3SJ9A 3LGTA 5HGGA 2FIRH 3U8TH 2LNCA 1AY6H 1DANH 3QX5H 1SI5H 3A84A 3SOSA 1SGTA 1FMGA 3VGCC 4NG9H 2HPQH 1ZR0A 4ZH8A 1H9IE 3SHAH 3M3SA 4ZKRU 2QN5T 1TQ7B 4A7IB 2ZFFH 1S5SA 1INCA 3M5NA 2Z9GA 8GCHF 2FS9A 1JMOH 3ZIAD 3A7XA 2FS8A 4BXSA 1TNLA 1YWUA 3HGNA 1OWHA 1MU8B 2UUFB 1BMNH 1W0YH 2C3SA 1O5BB 2FI5E 5K7RA 2PUQH 4GHQA 5F03A 3E0PB 2PP6A 4IN2A 3URDA 3F6UH 2EI8A 2THFB 3TK9A 2ZU5A 4TY6A 4NA9H 4A1VA 2ASUB 2G55A 3MU4A 3RXFA 1IQKA 5A8ZA 5C67A 2RG3A 1ZTLA 3AAUA 3K6ZA 1NRQH 2BDBA 4PROA 1TIOA 3BTEE 2BD2A 1DPOA 3FOAA 1MBMA 1P02A 1HGTH 2Z9IA 3SV7A 1C5UA 4B1TA 1FIWA 4Y7AA 1ZJKA 5HYOA 3V0XA 5EGMA 2FOAA 1HNEE 2PHBA 4I8KA 4UD9H 3ZZ4A 1AFQC 1ZPBA 1O3CA 1ZHPA 1QBOA 2Y7ZA 3TH2H 1RXPA 1QIXB 2BDHA 3MH5A 5H4IB 2ZGCA 1DT2A 4ACBA 2QXGA 1Z6EA 2BMGB 3LONA 1N6YA 1O2OA 1V2OT 1YPGH 1ANEA 3KQEA 4XBCA 1LHDH 1U6QA 1FY5A 2PW8H 4ISOA 5GPIB 1NPMA 4TWYA 1P3CA 5AVDA 1QJ1B 2K1QA 1RTLA 4FU7A 4X1SU 1TFXA 1FJSA 3DFLA 1O2QA 1A2CH 2RFKC 5T6DA 4TPIZ 1C2DA 4ABFA 2OUAA 3SGAE
chains in the Genus database with same CATH topology
1C1PA 3ZYDA 1OPHB 1K21H 3GCTF 1JXPA 3D23A 1YCPK 1IHSH 1CT4E 2XBXA 1VITF 1HIAA 3TK5A 2BXTH 4MNWA 1GJ5H 1KDQA 4DVAU 1HAXB 1EZQA 4K1EA 4Y76A 1CHOG 1SGPE 1EOJA 3MO6A 1SSXA 3GCOA 3A88A 2HNTF 1GMDF 1ZRBA 2FDAA 3ZV9A 2FOBA 1HJ8A 1E35B 5JBTA 1CVWH 3D65E 1WYKA 1NFXA 1VCWA 1BHXB 4X1NU 1V2UT 1EPTB 1BMAA 5T6GA 4TPYA 2XWBI 1RS0A 1OWJA 4BOHA 2C8WB 6GCHF 2ZFTA 2A7JA 3LH1A 3AVZA 3VB3A 3GY7A 2Y5GA 5LPRA 2FZZA 3A7WA 3B23B 3MH4A 2C93B 4X8VH 3T2NA 2ZPRA 4D7FA 3ZVDA 1ELTA 2SGEE 5JYIA 1O3MA 4DJZB 4FXGH 1YPKH 1ZGIA 1L0ZA 2C8ZB 2GD4B 1GL0E 3EAJA 1GBJA 2ANMH 4H42U 1C5QA 2BDGA 4YLUA 3BIVH 3PLBA 3MWIU 4Y6DA 3SW2B 1MTVA 4JZIA 1W2KH 1YBWA 1SQAA 1A3BH 1TAWA 1DM4B 3GYMA 1O3NA 4DIIH 4HTCH 1BRAA 2RA0A 2XBWA 2W3IA 1D4PB 1TQ0B 1V2RT 3KNXA 5ESBA 4NIYA 3UNQA 3BEIB 5FPTA 5GXPA 1CHOF 1MD8A 2XNIA 1AB9B 4WH6A 1HAGE 3SUDA 1GVLA 2BVRH 3QN7A 1FPCH 3TVJB 1EB2A 2BD3A 2QAAA 2H9EH 2YNAA 1L1NA 1IQEA 3GDSA 1BQYA 1C5PA 1O0DH 4KGAA 1BUIA 2RCEA 3GICB 4I8HA 3PLKA 2ZFQH 1C1OA 1E34B 2Z7FE 5CHAB 1FY1A 1UTOA 1Z8RA 3A85A 1O39A 1V2LT 4FUBA 1QGFA 1W13U 3GOVB 3ZZ7A 2TPIZ 3QUMP 4IGDA 2IN2A 3F9HA 3KCGH 1F5LA 3BN9A 3ATKA 4CBNA 1B0EA 3RXOA 2Z3EA 4MPVA 2XC4A 2OD3B 1QRZA 2J34A 1MUEB 1GI1A 5DKMA 1UHBB 1XKAC 4NFEA 1GBLA 2BOHB 1GWAA 2GCHG 3DT0H 4KTUA 3EA7A 4OS6A 3ATMA 1C2FA 4FUEA 2W7UA 3ODDA 5TCCA 1H8IH 1YPMH 1OXGA 2FEQH 1LMWB 2VGCB 1BRCE 1Z8IB 1LHCH 3A87A 1IQIA 2UUKB 1OOKB 2R0KA 3T28A 1V3XA 2ZCKP 2YNBA 5A2MH 1EAWA 3SU6A 1T31A 4DGJA 1SPJA 4CR9A 1NS3A 3PWBA 4KELA 2JETB 1GI5A 1YLCA 3SN8A 3MNCA 3ELAH 3NXPA 1C2KA 1HPGA 1SFIA 4J1YA 5GJ4B 1T4UH 4KP0A 2NU0E 3ZZ5A 1TGTA 3RU4E 1LPZB 1O33A 1C5LH 1GBMA 5DP9A 3UQVA 2ZIQH 3A7TA 3GY4A 1ESTA 1O5CB 4JMYA 4DURA 1O37A 1CT2E 3TNTA 1AO5A 1HCGA 1CGJE 3RXHA 1Z8GA 1EPTC 4JZ1A 3SUEA 1J14A 3HGPA 3PMJA 1EQ9A 4GHTA 2JH5D 1K1JA 3VB6A 1C2LA 4DY7B 2BDCA 4Q2KA 2BD4A 2VIVA 1TOCB 3OYPA 3ZZCA 3Q76A 1ZHRA 3TNSA 3E91A 3QDZB 3LJOA 3RC5A 4RN6A 1JOUB 2ZDLA 2Y5FA 5T6FA 2ZQ1A 4NA8A 3Q3KA 7GCHF 1PFXC 2BX3A 1TNKA 2GZ9A 2PSXA 3LIWA 4D9QA 1K1PA 2YOLA 4GCHF 2Q6DA 4B76A 1QB9A 1WAYB 1SLXB 3M3VA 1O30A 5EW2H 1O3AA 3RXAA 2XYAA 3T27A 3UR9A 3OY6U 1OYTH 1P06A 3JZ1B 1AQ7A 1K1LA 2OC7A 1C1QA 2WV5A 2ZC9H 1YPEH 1HYLA 3LOXA 3MO9A 3RDZA 1GHXH 1WOFA 3ZZDA 3GY5A 4FU8A 5JPMH 4GSOA 3HATH 1BITA 1TPSA 2F91A 1GBFA 1A61H 2ILNA 2V6NA 1GHAG 2FI4E 3GY2A 1GJ9B 1O35A 3RXGA 1HBTH 1QCPA 2BXUH 5A0BA 1IQJA 1UTQA 5G4BA 5JDUB 1WCZA 4HZHA 4RKJB 2Z94A 4JYTA 3TITA 3U8OH 1G3EA 1UTLM 3QZQA 2ZTZA 1YCPM 1YGCH 1LVOA 3RXUA 2FESH 5DP5A 4JYUH 5CHAC 3H7OA 1MTNB 1V2TT 3F9GA 2GZ7A 1TNIA 4MNVA 1MTWA 2BD5A 3GISB 4INHA 4Y0ZE 4ZUHA 3SUFA 4UFDH 1Z1IA 2FOGA 3OY5U 1C2GA 4WH8A 4UFFH 1VGCB 5GIBA 1MTSA 4DW2U 2FOEA 3E8LA 1S85A 5IYTA 3UY9A 4AGKA 1SHHB 1O36A 2VIWA 2ZCLP 4VGCC 2A2XH 3PV4A 4IMQA 3SZNA 4CH8B 4UDWH 4CRCA 1DS2E 1L1GA 1NO9H 2XC0A 1P2QA 3RMMH 4D9RA 4WMDA 4X0WU 1BHXF 4X6PA 4K8BA 4Y79A 3M5MA 1BTZA 1C4U2 2VGCC 2AYWA 1O3KA 5EW1H 3K6YA 3TGJE 4JYVH 3NWUA 2FODA 2Z9JA 4WMEA 5C2ZA 2WUCA 1FDPA 2JETC 3QO6A 3P17H 3EA9A 3BTDE 3SV8A 4GAWA 1DLKB 1SGNE 4B2AA 1MH0A 1F7ZA 3MNSA 4WJG2 1WTGH 4XFQA 1DX5M 1YM0A 1P03A 2DE8A 2UUYA 2QV1A 3P8OA 3V3MA 2ZGHA 3I78A 3QK1A 2WYJA 5C20A 3R0FA 1TMTH 1NRNH 3DFJA 1B0FA 1ZSLA 2D1JA 4KTSA 1KXFA 4U30A 4ABAA 1ID5H 3TPIZ 1QHRB 2CF9H 3V12A 3ATIA 1SLUB 3BG8A 4BAQB 1EZUC 1MCTA 3A83A 2AGGX 1YPHC 4MTBA 2O8UA 1G2LA 4I7YH 2G00A 4JK6A 2ZGXH 1UK3A 1OP0A 1BOQA 2Y7XA 1ELDE 1HAIH 1TMBH 2F9PA 3BSQA 3M36A 3TJOA 2HOBA 1OP2A 5E2OA 2A5IA 1GBAA 4OS4A 4B71A 4CH2B 3QGNB 1LHEH 2CHAB 2BZAA 3RXLA 3A81A 1PPGE 2A31A 4XDEA 5E0HA 1DWDH 3SI4H 3SU0A 4E06H 1GBEA 3BTME 3MH6A 3RU4T 3OX7U 4UFEH 3MOCA 1DE7H 1XUIA 4Z6AH 2HPPH 1PQAA 2JH0D 1MKXH 3DUXH 3QZRA 3SJKA 1P3EA 1PPEE 2Z6BD 7LPRA 2BQ7B 2H9TH 8GCHG 3FANA 2ZF0H 4NZQA 3HPTB 3SORA 1ETRH 5DP7A 3LC3A 1YPHE 2V3HH 1BBRK 3RXDA 2QXIA 2XBVA 1QL7A 5FPYA 1D3TB 3BTFE 1P04A 3ZZBA 2GVFA 1FAKH 5PTPA 1NRSH 4NSVA 1C1UH 1BDAA 2H2ZA 5FPSA 4H6TA 1AGJA 3LT3A 3R3GB 2PSYA 2A32A 1NRRH 1O5GH 2ZTYA 5C1UA 3S0NA 4AYYB 1GI2A 5EXMA 3ESTA 3C1KA 4K69A 1SVPA 1TLDA 3ZVFA 1MBQA 4ABHA 1ESAA 1GPZA 1J15A 1J9CH 1MTNC 1S81A 3SU4A 1GJ6A 2ZEBA 1VCQA 2WINI 3SHCH 2ZFPH 1FUJA 1ELGA 3LU9B 2GTBA 2CJIA 3A7VA 3RU4D 4AYVB 2BLVA 3N7OA 1G3CA 2BB4A 2OC1A 1ZPCA 1VGCC 4ABGA 1VCPA 4Z0KA 1WUNH 1O2WA 1C5OH 3UWJH 3DA9B 4K60A 3I77A 1AHTH 3OSYA 1D3QB 3RM2H 1XUKA 2HLCA 2PTNA 3MU1A 4Y8ZA 2ANYA 4B75A 3ITIA 2O9QA 1DDJA 5GDSH 2F9OA 3KHVA 3GCTG 4FVBA 5DP4A 3NK8A 4DT7B 1QL9A 4NIXA 1VITG 1RJXB 1NRPH 1TA6A 1LO6A 2R2WU 3F9FA 1SLVB 1UCYK 1GHYH 1QJ6B 4BTIB 3RLYH 2OC8A 2FWWA 3VPKA 1KTSB 1TYNA 1Y5AT 1P57B 3MH7A 2BD7A 1GMDG 3P95A 2SNWA 3A8CA 3RP2A 2Y81A 3UFAA 1FY3A 1CGIE 1GGDC 3ZVCA 1HIAB 1YC0A 2WPHS 3AW0A 2J9NA 1KDQB 1C1NA 4R0IA 2B0FA 2JKHA 1THRH 4M7GA 6GCHG 1PQ8A 1C5YB 1PPFE 1TGBA 4B2CA 4YOGA 1MCVA 1O2JA 2NWNA 5F8XA 4WXVA 3RXPA 5FAHA 5JBCS 3TGIE 3EA8A 1B7XB 1EAUA 1G2MA 4IN1A 2ZU2A 1GBHA 1P0SH 4ABDA 4CRAA 3W94A 1K1NA 1N1LA 1ZMLA 3RXKA 1KSNA 3HKIB 4ZHLU 1KXDA 2ZKSA 2PGQB 4YTAA 3S9AA 2Q1JA 1QNJA 1MMJN 4K1TA 3VB4A 1O3HA 2R0LA 6ESTA 3H5CB 2CHAC 1EZXC 2OXSA 1BBRH 3GYLB 3TJVA 5HXFA 1C2HA 1T4VH 1HFDA 3SO3A 1AU8A 5DPAA 1YLDA 3MU0A 1DOJA 2FOMB 1W3CA 3A7ZA 4OS5A 1Y3VA 1GHZA 1HLTH 1H4WA 2BD8A 2VWMA 4K1SA 4QT8C 1BTHH 2VVUA 3EDXB 4X2WA 1S6FA 3FZDA 1O2XA 1UTKA 2WPJS 3BV9B 6CHAB 1P11E 1FY8E 3NUMA 1ZHMA 4AORA 1RTKA 1V2QT 2CMYA 4Y10E 1ELAA 1BRBE 1MKWK 2P8OB 3Q77A 2IPHA 4AZ2B 2FO9A 2AS9A 2J2UA 1TGSZ 5L2ZH 1LVMA 1Z71A 1HAZB 1CQQA 1IHTH 3NKKA 4B74A 2ZDNA 1O2LA 3GY6A 1TBRH 1EZSC 1CE5A 3VXEH 1IQHA 1KLTA 2AMDA 5LPFA 1XXFA 1SGDE 4YT6H 2BY5X 3D49H 2XRCA 3AASA 1GHBG 1JBUH 1XKBC 2UUJB 3TJUA 1CBWC 2AERH 4Q7YA 4AGJA 1ANCA 1O2YA 1AE5A 1PJPA 4HI3A 3QTOH 2R3UA 1GDQA 1S6HA 4BTTB 1FI8A 2SGAA 4X2VA 5A8XA 1UVTH 3CP7A 1AVGH 4GUXA 2BY8X 2PR3A 4O03A 4X2YA 1THSH 3GCHB 3S9BA 1A46H 1QFKH 1F5KU 1CO7E 4OGXA 2QGRA 1MQ5A 3I29A 1P9UA 1SGEE 1ARCA 1LQDB 4NCYA 2C8XB 2D26C 1H8DH 1CHGA 4ISIH 4OS1A 4Q7ZA 2ODQA 3Q3XA 1OP8A 1T7CA 1SHYA 2HALA 1EATA 3A80A 4O3TA 2GDEH 1F92A 2PGBB 1FN8A 5T3HA 1D6RA 1BTWA 2ZECA 2EEKA 2RA3A 3TLOA 5C5OA 3A7YA 3A8AA 3LKWA 1EAXA 1HAOH 2EC9H 2VU8E 1YF4A 2Z3CA 3EYDA 2WPLS 4CRBA 1HJAB 2ZG0H 3T62A 1GI0A 1GHBF 1N8OB 4Y0YE 1O2MA 4AFUA 1BBRE 1D3PB 1O3GA 1P2MA 4NGAH 4YESB 4MQAA 2GMTC 1GMHG 2QF3A 1GCTB 3KGPA 2UWLA 3O8CA 2ZDKA 2OLGA 1QA0A 5EG4A 1FNIA 2O8WA 1AN1E 4YZUA 4RSPA 1K22H 2V3OH 3SNCA 2BLQA 1YCPH 7GCHG 5EQSA 1UVOA 1IQFA 1SG8B 4VGCB 3ZZAA 2ZA5A 4DCDA 2PLXA 4GCHG 1TGCA 3T26A 4UEHH 1DUEA 4YO9A 3T5FH 1Q3XA 1E0FD 3PMHB 1SGRE 2TGDA 1TRNA 5HM9A 2WV4A 3O8RA 1HAPH 2BD9A 1GJ7B 2O8LA 2ZO3H 1T8LA 1BTXA 2ODPA 3P8GA 1C1RA 1YYY1 1ELEE 1KLJH 1GI9B 5FBEA 1BMMH 2CXVA 1GHWH 5J4QA 1RTFB 2XTTB 1TALA 3SNEA 1J16A 5F8TA 2OQUA 1XUHA 5GWZA 4WMFA 2GT8A 3RLWH 1KYNA 1QRXA 2G8TA 3K65B 2G52A 4A92A 6CHAC 5FX6A 3SNBA 1O5FH 2TRMA 3E16B 1EB1H 1GJ8B 3PM3A 3M35A 4ABJA 1A7SA 2D2DA 1BMLA 2P8OC 3OTJE 1HV7A 1LPGB 2QC2A 4I33A 2D8WA 1EX3A 1NESE 2A0QB 3QLPH 2Q6GA 3PB1E 3IITA 1XVOA 3L3TA 2FLRH 4ASHA 1SGFG 4MG3A 3LGIA 5AFZH 2GDDA 1GMHF 1JIRA 3UOUA 1O3BA 3C27B 1GJBB 1GI4A 1W11U 1GDNA 1TX8A 1O31A 1RFNA 3TH4H 4ABIA 2KAIA 1SGYE 2V0BA 1HAVA 5C1XA 1Y3WA 3KQBA 9LPRA 1Y3YA 3LDXH 4WXIA 3TK6A 4ESTE 2BTCE 2PKSB 1JIMA 2A4RA 2VIDA 2AEIH 2VNTA 5FCRA 4AG1A 1O2IA 1TBQH 4OS2A 2XC5A 1W0ZU 4X8TH 2A5AA 2OTVA 3ZZ3A 2R9PA 5LH8A 2FOCA 4K2YA 4XOJA 3RMNH 1SQTA 4MDSA 1LVBA 4CRDA 1T8OA 1SR5C 1CU1A 3A8DA 5A8YA 3GCHC 1AI8H 3BTKE 1QB6A 4FUJA 2BQWB 2SGQE 1LDTT 1ZTKA 2Y6TA 1YKTA 1Y3XA 1DWBH 3E0NB 5F8ZA 4D7GA 3U98H 4U32A 3KIDU 2XCNA 2F9UA 3TIUA 4AFZA 1P2KA 1DWCH 1VJ9U 1PYTD 4U2WA 3STIA 3UNRA 1S84A 3TU7H 1V2VT 2C90B 4K5ZA 4IW4E 1L2EA 2FOFA 1FV9A 1MD7A 4ZXXH 2ALPA 2OBQA 3SJOA 1SGIB 1TE0A 3BTWE 4BNRA 4FUIA 1HJAC 2A4QA 5EXLA 2QYIA 3UIRA 1N8OC 4XE4A 1K1IA 3CENA 6LPRA 1UMAH 3BF6H 4I8GA 3S7HB 2XXLA 1K1OA 2V35A 1GCTC 1QJ7B 5K0HA 3S69A 2O8TA 3FP8E 4IS5A 1E36B 1ACBE 1RRKA 2Y82A 5FHTA 7ESTE 3U8RH 1ARBA 2XWAA 1C5MD 2W26A 4LZ4B 4A1XA 1NY22 2FMJA