2Z3DA

A mechanistic view of enzyme inhibition and peptide hydrolysis in the active site of the sars-cov 3c-like peptidase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Replicase polyprotein 1ab (pp1ab)
publication title A mechanistic view of enzyme inhibition and peptide hydrolysis in the active site of the SARS-CoV 3C-like peptidase
pubmed doi rcsb
source organism Sars coronavirus
total genus 88
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z3dA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z3dA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z3dA02
2BHGA 2OBOA 3SU1A 1OP8A 1F7ZA 1K1NA 1K2I1 1CT4E 1G9IE 1CU1A 1OP0A 4Y0ZE 2CHAB 3P6ZB 1GJ7B 1SGTA 4X6MA 1YPKH 3A84A 4HFPB 2XCNA 5FCKA 3KNXA 1O37A 1UHBA 4UD9H 5DGJA 4B1TA 4O03A 1EASA 1L1GA 4GCHG 1IQFA 1O5FH 1OS8A 8GCHF 1ELGA 1C5SA 1DWBH 3T5FH 1GCDA 1SHHB 4ZROA 2W3IA 1YM0A 3UWIA 1MU6B 3R3GB 1NFWA 1TPAE 2BOHB 2CV3A 2GV7A 2P94A 1O3FA 5IDKA 4BANB 2PR3A 3OSYA 1P2QA 4XBCA 2Y5GA 3SQEE 2W7SA 2BXTH 2BB4A 3F68H 4ESTE 1AWHB 3MNSA 4A1XA 4YO9A 4D9RA 2KAIB 3NUMA 1GBLA 1EAXA 3F1SB 3SJ9A 1TGCA 2FXRA 1TNLA 3MYWA 1ELTA 1P57B 2ZQ2A 1G30B 4QT8C 4ABJA 1EJNA 1S84A 1TBRH 3GCHB 1T8MA 3M3TA 3BN9A 3RM0H 3H5CB 2FYRA 6ESTA 4YT6H 4NSVA 3VXEH 4CH8B 1FQ3A 4VGCB 2FESH 1KTSB 2P3UB 2P8OB 4Y71A 4CR9A 2FM2A 2GP9B 1UTMA 1THSH 2VH0A 4WMEA 1NY22 1KDQA 1QJ1B 5ABWA 4YZUA 3PV4A 4CREA 1FIWA 4B71A 3AAUA 3VGCB 1EJAA 4RKOB 2J4IA 4RKJB 4ZKRU 1BOQA 2QGRA 1AUJA 3URDA 1DWDH 2FP7B 1BDAA 1Z8IB 2QAAA 3EE0B 1IQKA 3MHWU 3TK9A 5A0CA 3RP2A 3ZZ3A 4AORA 2ZCLP 2TGDA 3HPTB 4OS7A 1G2MA 5AF9H 1TA6A 6CHAC 1XM1A 3SV8A 2ZP0H 1S0QA 1XVOA 2ZHQH 1NM6A 1NTPA 3PM3A 4LXBH 4X2VA 2FOMB 3NKKA 4K1EA 4I8KA 1GJ5H 5I25A 2A4RA 1F5LA 4WH6A 5ETXA 4UEHH 3RU4E 5TCCA 2A31A 1DLKB 2XC0A 1TYNA 1JMOH 3SJ8A 1LHGH 3PROA 2LNCA 4J1YA 1LVYA 1O3LA 1MTVA 1AWFH 2PTNA 3STJA 1DXWA 3LPRA 3RXFA 3SV7A 1P9UA 1YPEH 3P8FA 2P3TB 3RXVA 3PMHB 1O5EH 1GGDC 3CS7A 2C8WB 3KGPA 1C5VA 2ASUB 1AVWA 1GBMA 1WOFA 1KXFA 1ZHPA 2BLOA 4DGJA 3M7UA 3ZVGA 2V35A 4D7FA 4K1SA 1P05A 1P12E 3C27B 3RMLH 1GDQA 2GT8A 1MUEB 3GDSA 1IQMA 4AOQA 1MTUA 2NU0E 3CENA 5A8XA 2BD5A 2Z3EA 4GHTA 1CA0B 2I6QA 1KXCA 2G51A 3EA7A 1UVUH 2BX4A 2Y81A 2RA0A 1C4U2 1CVWH 1S6HA 1V2UT 5LH8A 2V6NA 4JYVH 1HXEH 2SGAA 3SHAH 1VCWA 1CA8B 1G36A 3UNSA 1QBNA 1GPZA 3UREA 1NRNH 2LPRA 4K69A 4BXSA 1ARBA 2ZFPH 4WVPE 2VIVA 2C8XB 2HPQH 1VJ9U 1B5GH 2ZCHP 1F0UA 2YNBA 2SFAA 4FVDA 5FBEA 2O8UA 1TA2A 2JH0D 4ZHMU 1P0SH 3FP7E 1C1WH 1QNJA 1D3TB 3GY5A 1A3EH 1ZRKA 1W10U 3A88A 2ODQA 3MH7A 1BTYA 2XBVA 2V0BA 1AKSB 1EQ9A 2OTVA 1QRZA 2VIDA 1GI4A 3GCHC 2PFEA 4NFEA 1ZMLA 3DT0H 1V2NT 1WAYB 2ZHFH 2A1DB 4YOGA 5LPFA 1TONA 3BF6H 1W0YH 4VGCC 4TWYA 1H1BA 5BRRE 1IAUA 1O5GH 2P95A 1EPTA 1ZMNA 7LPRA 4GVUA 1EX3A 3AW1A 9LPRA 4WJG2 4TY7A 4D9QA 4YOJA 3SNEA 1C1MA 1FY3A 4X2XA 3G01A 1C2IA 1ZSKA 2A4GA 3TK5A 1KLTA 2BDHA 4LZ1H 3FVFB 3KQDA 1TRYA 1O2RA 1HJ9A 2HOBA 1O3BA 4YLUA 1A2CH 8KME2 4SGBE 1HBTH 1Q31A 1SGIB 2C8ZB 2NWNA 1L4DA 1YLCA 4XFQA 3BTQE 1NESE 4KTSA 3B9FH 2H5CA 5LPEA 1RFNA 6LPRA 1GI0A 1LVMA 3VB5A 3VB4A 3SU3A 2GTBA 3U8OH 1W3CA 4AFQA 3F9GA 1K1PA 1Y5UT 4KKDA 1C5OH 1N6XA 2XW9A 4ZMAH 4UFDH 1QB9A 1A7SA 3KL6A 1QA0A 1MKXH 1DUEA 2NU3E 2WYJA 3PB1E 3SU2A 4X8UH 2G8TA 4X1PU 1UK3A 1C2KA 1TALA 4B2BA 2CF9H 1IQGA 2A0QB 2FWWA 3UR9A 1P11E 2B0FA 1HJ8A 1GBHA 1P2JA 6GCHF 1ORFA 2R0KA 3UUZA 2G4UA 5GXPA 1GBIA 3GCTG 1MKXK 1BQYA 1HAVA 4JYTA 1TIOA 5A8YA 5L30H 1BJVA 5LGOA 4IBLH 2FDAA 4KP0A 1TX8A 2SNWA 3A82A 1THPB 3MFJA 1V2OT 1C2EA 2B7DH 4XDEA 2PGBB 5EPYA 1QL8A 1IQLA 1ETSH 1P8VC 3RXUA 1ELFA 1GHAF 2YOLA 3UTUH 5C20A 1UTPA 3TU7H 3S9BA 4ISIH 3SNCA 2OBQA 1GBBA 1FNIA 1GBCA 1GVKB 1C4Y2 1NRSH 4O3UA 1BRUP 1FONA 1O2UA 1ACBE 5J4SA 1TBZH 1DY8A 9ESTA 4DY7B 3LIWA 5AVDA 2UUYA 1AI8H 1J16A 1ZMJA 1EB2A 5DJ7A 3M7QA 1TFXA 1OWEA 2QV1A 3KEEA 2HNTE 1MKWH 1TMBH 3QTVH 1NC6A 1BRCE 2EEKA 5FHTA 2BD9A 2GKVE 4Q7YA 5GDSH 1C2JA 5DP6A 1DICA 4NSYA 1SGRE 3BTTE 3ZZCA 4XBDA 1VR1H 2ZHEH 1FLEE 2VIPA 3SU6A 1MTSA 2Z9KA 1PPGE 1MKWK 4RSPA 4CRFA 3VFEA 3A8BA 2Y82A 4NFFA 1MD8A 1Y5AT 4ISLA 5GPIB 2XWBI 2EI8A 3TLOA 3H7TA 2YNAA 2UUFB 1DSTA 2PKAA 2UUKB 2STBE 2RA3A 2XC4A 2RDLA 1OOKB 1EATA 4I8GA 1ANBA 1P01A 4IC5A 1V2KT 3A8DA 1PJPA 1NO9H 2F9BH 2EI7A 3HKIB 3UY9A 2A2QH 3M35A 4TPYA 2XBWA 5GCHF 2GCHF 4YOIA 1AVGH 1FN8A 1SGCA 1A3BH 2AYWA 1V2RT 3VB3A 3PO1B 1YPJH 1PPFE 2G52A 2FS9A 4I33A 2A7CA 1QJ6B 2W3KA 2A5AA 2G4TA 5TJXA 1UK4A 3HATH 3D62A 1EUFA 3FP6E 2ZU4A 1UCYE 4BTIB 2ZDNA 5HXFA 2H5DA 1O2PA 5FX5A 3HGNA 5L2ZH 2K7XA 1ID5H 3ZV8A 1EJMA 1Z7KA 4ZKNU 4TWWA 4WY3A 3DFLA 1ZGVA 1GHBG 4FUIA 1O5CB 1LHFH 3GY3A 2BTCE 1BMMH 1GHZA 1O3AA 1V2MT 1O3NA 1JRSA 1YPLH 4O97A 4KGAA 1XKAC 1GI1A 1XUFA 2Q6FA 1O2MA 2HWLB 3RXQA 5CMXH 3HKJB 3JZ1B 5FX6A 1AMHA 3ZZ9A 1E35B 1D3PB 5E8EH 2J34A 3NZIA 3SN8A 1O3JA 1UTNA 1OWDA 1CHGA 3PMJA 4HGCA 3ATWA 1DOJA 2XYAA 5ESTE 1PQAA 3BTHE 3RXDA 4Y8ZA 1UHBB 1A4WH 1QRWA 4FUGA 4X1NU 1GBTA 1C4V2 1GWAA 2VVCA 4Y79A 1VITG 4X2YA 4IGDA 3EGKH 2ZDAH 1DE7H 3Q3XA 1GI3A 4B73A 5DG6A 4H4FA 3RXMA 3CP7A 2BY9X 2QXGA 5FPYA 2TIOA 2WPLS 4GCHF 2XTTB 3Q76A 1INCA 3UPEA 1UTJA 3QZRA 1OP2A 4K2YA 3A7WA 2AMPA 1ESTA 3GISB 1FXYA 2FOEA 3SOSA 3FFGA 3TGIE 2R2WU 2Z94A 1SGFA 4WWYA 4XBBA 1QB1A 3RXBA 3UNQA 3TPIZ 3MU1A 1E34B 2HALA 1TAWA 2ZC9H 3ENSB 1L1JA 3HK6B 3SHCH 1O31A 3RXEA 2QF3A 3RXKA 5C1UA 1A61H 1MQ6A 2ZDVH 1O3PB 3BTDE 5HM2A 1CHOG 1KSNA 4B76A 4D76A 2IJOB 1TWXB 3BTWE 2R3YA 3M61U 2BD8A 2GMTB 1KDQB 3UFAA 1QQUA 1UO6A 1W11U 2H9TH 3RU4D 3TJOA 4FUEA 3GCNA 1TNJA 1ABJH 4AX9H 1LHDH 3ZYEA 1O2YA 3TVJB 1RD3B 2BQ6B 2IN2A 3NPSA 1C5PA 1EXFA 3TNTA 2BZAA 4H42U 3PO1C 5AFYH 1C5LH 1GBJA 3RMMH 3SGAE 3RXAA 3DHKH 1HAIH 1TNHA 1BUIA 1QCPA 1MCTA 2Z9JA 3RDZA 1GDNA 1GL1A 3RXOA 4CRAA 4MQAA 1WUNH 4MNVA 2A5IA 1RTFB 1N8OC 2G55A 1GI6A 2ALVA 1K1MA 3V3MA 2H6MA 1RIWB 1TMTH 2EC9H 4FUBA 3SV2H 5E0JA 3ZZ5A 3S0NA 3LGIA 4MPUA 3SUEA 5LPRA 3RC4A 1AY6H 4RN6A 1OWJA 4JZ1A 1N6YA 1IQIA 3D65E 5DO4H 2QIQA 2UUJB 4O9VA 1O3IA 5F8ZA 2D26C 2ZTZA 1AD8H 1T8LA 1ZZZA 1XX9A 2CJIA 4X8SH 1O2NA 2FI5E 2VWLA 5GJ4B 1EZSC 5GIBA 1ANDA 1L2EA 1FY1A 1HB0B 1FZZA 4K3JA 3EA9A 1SFIA 3VEQB 1DSUA 5C1YA 2WINI 1AZ8A 4YT7H 5EPNA 1SQOA 2R3UA 4GUXA 1VGCB 1QR3E 4R8TB 2Q6GA 4ASHA 3MH4A 1WYKA 4E7NA 2AERH 3TJUA 2B9LA 2WUBA 3QWCH 3RXHA 5JB8S 1PYTC 2OC8A 1VZQH 4NA8A 2NU4E 3RXGA 3A87A 1UMAH 2CGAA 1O3MA 1TE0A 1FI8A 1DY9A 2QF0A 2SGQE 2FOGA 1HJAB 2WUCA 2XCFA 1YPGH 1GG6B 3LGVA 3ZVFA 1SR5C 1SHYA 5DPAA 1V6DA 3MU8A 4NZQA 3ZZAA 2G5NA 3M36A 3FAOA 4DURA 1ETTH 1E38B 1CT0E 1GMHG 4CH2B 3EA8A 2JH6D 3O8CA 2O8LA 1Z8RA 4CRCA 2FEQH 7KMEH 3SU0A 1QB6A 1QFKH 3RMNH 2AGGX 2F9VA 1UVSH 3U1IB 4NG9H 1NU9A 1IOEA 1O2ZA 2GD4B 5K0HA 1ZR0A 2Y6TA 5DP4A 3ZZDA 5FAHA 4YM9A 1A1RA 3GDUA 4X1SU 1A0HB 5HYOA 1O3HA 4XE4A 1O2VA 4K8BA 3U8RH 1O34A 1EOJA 1GJ4H 2UWLA 3T2NA 1LVBA 1XUGA 1P3CA 2F83A 2PUXB 2CF8H 5BPEA 1JWTA 2HPPH 2GMTC 3QX5H 4D8NA 3A8AA 1V3XA 4ABIA 4FUCA 1MAYA 2FLBH 2ANYA 1GBEA 3MH6A 3K65B 1NT1A 1ARCA 4MG3A 4CRBA 1GVLA 3LJJA 4MNWA 2BDAA 4IS5A 4A1VA 4A7IB 1LCYA 1FJSA 1V2VT 3P95A 1F0TA 2EI6A 2OCVB 2UWOA 1FAXA 2BDYA 5JBTA 3TNSA 1UVOA 1KLIH 4JZIA 4BAHB 1HCGA 1K21H 2ZFRH 2JKHA 2CHAC 4BAKB 1C2MA 2VIWA 2WPIS 1TBQH 4BXWA 1OXGA 1C2LA 3EYDA 1Y5BT 1VJAU 3MO6A 1RIWC 1W12U 2GX4A 3MNBA 3P17H 1ABIH 2ANMH 7GCHG 2ZF0H 3U69H 1JIMA 3DFJA 1GJAB 2V3HH 2CMYA 3D23A 2GGVB 3LT3A 1V2TT 2SGFE 1YCPM 1NPMA 2BQ7B 1T8OA 2AGEX 8LPRA 4JK6A 2VWMA 3A7XA 2XRCA 1ZJKA 3QTOH 1O2TA 5EQSA 4DG4A 1C1NA 4FUFA 2GZ9A 3ZVAA 1C1RA 3SUFA 2DE9A 5AFZH 2FOHA 2BQWB 1D3QB 1XUJA 1O39A 2J2UA 1S6FA 2WV5A 3Q3YA 2ULLA 4FUHA 4ABBA 3ZVEA 4CR5A 1HAVB 2W7UA 4ISOA 2BLQA 1O33A 5FXLA 2XBXA 1HAGE 3ZZ6A 1IQJA 3K6YA 1C1SA 1LMWB 5C1XA 1K22H 4AGKA 2A32A 1RTKA 1HUTH 1VGCC 1WCZA 2I6SA 4Y76A 1AUTC 1ZYOA 1FN6A 1XUHA 3W94A 4THNH 1FV9A 1V2JT 2FOAA 1QURH 2FX6A 3Q3KA 2V3OH 3GCTF 2ZU5A 2P8OC 4U30A 1QRXA 2D2DA 1EAUA 1F2SE 1MMJN 2Z3CA 1GCTB 4K1TA 1HAPH 1LPZB 5JPMH 4X1RU 1QQ4A 4CRGA 3PTNA 1UVPA 3AW0A 1F0RA 1O2SA 3RXIA 5CE1A 3PWCA 3VGCC 2QXIA 3N7OA 2BD7A 3SGQE 4MTBA 1BTPA 3SO3A 3MO3A 3NK8A 1F5RA 1GMCF 2OUAA 1E37B 1E36B 2ZPQA 3BEIB 3ATKA 2F9NA 3M5MA 1H8IH 3M5NA 3ZVBA 1KYNA 4X1QU 1SG8B 1FY5A 1C2FA 5DP8A 4ZXYH 1Z6JH 3ATIA 3L3TA 4FXGH 3P8OA 1BHXF 3BTGE 2PWXA 1EP5A 1GVZA 4FUDA 4KELA 4Y11E 5DK1A 1SOZA 5J4QA 1W7GH 4X6PA 1RRKA 3IITA 3IG6B 1GMDG 2Q6DA 2A2XH 4MVNA 1UK2A 3GYMA 3RC5A 3UQOA 1RXPA 3DD2H 1TQ0B 2H9HA 1THRH 1WQVH 4NWLA 1ELAA 3T29A 1F5KU 4ZKOU 1Y3XA 5B6OA 3ODFA 3T28A 1HAXB 1MZAA 3UWJH 4GAWA 1JIRA 1TNGA 4F4OC 4AB8A 2WV4A 5FCRA 4ABHA 1KTTB 2PSXA 3GY8A 3RXTA 3LDXH 2J95A 4B2AA 1PPEE 1H9IE 5JBBS 4MDSA 1AO5A 4UDWH 1C5NH 3V13A 1FUJA 4JYUH 4FU7A 4TY6A 2FOFA 5EQRA 2OC0A 2VIOA 5A0BA 1D6WA 1J17T 1HAHH 1CGJE 1ELCA 4ABFA 1CA0C 2TGTA 1HPGA 1AFEH 3P92A 1O38A 5FPSA 3BTFE 2SGPE 1BMLA 4UFGH 4CHAB 3LC5A 1AKSA 1Y3VA 3UNRA 1EZXC 2VVUA 4X6NA 1AIXH 5E2PA 1W8BH 3A85A 1SLWB 2R9PA 4HTCH 1BBRH 3SNDA 1P9SA 1C2HA 1HYLA 3P8GA 4B2CA 3SV6A 2F9PA 4AYYB 1P2MA 4I7YH 3M3SA 1D4PB 1NFXA 1GHYH 1AFQB 1FY8E 2FOBA 3SW2B 1OSSA 1A0LA 1QBVH 1BBRK 1IQHA 3F9FA 2ZZUH 1DXPA 3SNAA 4OS1A 3D49H 2AEIH 3NXPA 4CRDA 1CO7E 4WXIA 2P93A 4NA7A 3LU9B 5EG4A 1YBWA 3IWMA 1LDTT 1L0ZA 1J8AA 1GHBF 2QYIA 1LHCH 3RXJA 4ABDA 1OKXA 3F9EA 5JBAS 1BIOA 3RC6A 2ZGJA 3RXPA 5GWZA 3E1XB 1KY9A 1EOLA 4IN2A 4KTUA 2ZKSA 1PQ5A 1C5ZB 3V0XA 3V12A 1YF4A 1BTWA 2G81E 2DE8A 1SGYE 4AG2A 4M7GA 3S9AA 2C8YB 2GDDA 1O36A 2ZO3H 1GCTC 1P04A 5F8TA 1BCUH 4BAOB 3LGWA 3RU4T 1T4UH 3EBNA 2BY5X 3AAVA 3LONA 2BM2A 2GVFA 1GHVH 1O3EA 4LK4A 2QXHA 4ZHAA 3E6PH 2M5TA 3QLPH 1SOTA 3I77A 1L1NA 2O8MA 1CSOE 4UFEH 3RXRA 1BRAA 1VITF 1Y3YA 1AE5A 2FPZA 2Z7FE 3LOXA 3KHVA 1SGQE 3SORA 4TYDA 4Y8XA 3SUDA 4IN1A 2AH4X 2Z9LA 1PYTD 2ZGHA 4Q2KA 1MTWA 1N1LA 2WPHS 4YESB 4CBNA 3KF2A 1ZTLA 1XKBC 1SGNE 3FANA 2HNTC 2PW8H 3A83A 4NCYA 2G5VA 4DIHH 3SU4A 1TABE 2BY8X 1G3BA 1A46H 5EXMA 1CBWB 1ZTJA 1XVMA 2OD3B 3O8DA 1NU7B 3LJOA 3OYPA 2SNVA 1MTNB 1OWHA 1O35A 1C5TA 1TNIA 1MCVA 1YPHE 3E16B 4AFZA 3E90B 3SQHE 1MBMA 3PWBA 3RM2H 4BTUB 2A7JA 1W7XH 4NIWA 1ZPCA 3GCOA 2BDCA 3T26A 1QJ7B 1JXPA 3P8NA 5AHGH 2J9NA 1SFQB 1CHOF 1C2DA 2ZDLA 2ZG0H 3S7KB 1C5YB 1BZXE 4ABGA 1NZQH 1V2QT 3ATLA 2J94A 2VWOA 2QC2A 5F03A 1WQSA 4INLA 2D1JA 2ZTYA 2TGPZ 3A80A 1B7XB 1FPHH 3SU5A 2C90B 2ZIQH 1BTXA 2D8WA 2Z9IA 3S9CA 3SGBE 1DWEH 4ZH8A 2PKSB 4CHAC 7ESTE 1C2GA 5C67A 2ZPRA 1TPPA 2B5TB 5HGGA 3SNBA 1ZGIA 2VJ1A 2ZU3A 1Z1JA 1HIAA 3T62A 1IQEA 2SGEE 3RXCA 2VIQA 2JH5D 4JMYA 1JOUB 1MU8B 1ZOMA 2VGCB 4X2WA 1YCPH 1GHXH 1PQ7A 1DWCH 1TOMH 1UVTH 3TH3H 1AFQC 2XXLA 4WH8A 1GI2A 2PV9B 1RS0A 3HK3B 2ZNKH 1DLEA 2OQ5A 2XBYA 4DOQA 1AE8H 1G3EA 3Q00A 2OC1A 2Y5FA 3PLKA 3DUXH 1YCPK 2ZGBH 1BTZA 1AVXA 3TGJE 1QL9A 3PLBA 3VXFH 4E06H 1CGHA 3RXSA 1LO6A 4GSOA 5FBIA 1DUAA 2VWNA 3SI4H 2ESTE 1YPHC 1AGJA 1W2KH 1A0JA 3AVZA 1LQEA 1IHTH 3BTME 2NU2E 5JYIA 2C93B 1Z8JB 3TH4H 3OX7U 1ESAA 3BTEE 4I8HA 4DIIH 1ZJDA 2R0LA 2BVRH 1SGPE 1M9UA 3QO6A 2A45B 3Q77A 1YKTA 2BY6X 1P10A 5EOKA 1SQAA 1HAZB 5CHAB 3TK6A 1B0EA 2H9EH 1PPBH 1PFXC 3GOVB 1ZPBA 1S5SA 1PPZA 2IOTA 1Y59T 4IMQA 1TX7A 1SGEE 2W5EA 3E0PB 4NA9H 4GPGA 1MD7A 2TPIZ 1OWIA 2BX3A 1SB1H 3I29A 3STIA 3MO9A 3PTBA 4X8TH 5E0HA 1BA8B 1NS3A 2AGIX 4I31A 4UONA 1SPJA 2A4OA 5FPTA 1A5GH 3QDZB 3BSQA 1WU1A 3TJVA 4MNXA 3A8CA 1GMHF 1TOCB 3TJNA 4IW4E 1SSXA 1VITH 3UOPA 3S7HB 5H4IB 4X0WU 3QGNB 2PSYA 1CBWC 4JZDH 3H7OA 1QIXB 1O5BB 1A5HA 1G2LA 1GI5A 5E2OA 2J92A 2F3CE 4FU8A 4JZFH 1MTNC 1HAYB 1P02A 1GBKA 3SI3H 5F8XA 1XMNB 5L2YH 2VINA 1GJ9B 3R0FA 2OQUA 5EODA 5JDUB 1NN6A 2FLRH 2BZ6H 2K1QA 2P3FH 4WMFA 5F6MA 1P09A 1CGIE 1SC8U 1SGDE 3VB7A 3EQ0H 3T25A 1TB6H 1PPCE 3MTYA 1X7AC 2HGTH 2AS9A 2H1UA 3EDXB 3MNXA 1GBFA 3A7ZA 3GYLB 5DP7A 4A6LA 1U6QA 1ZHRA 2FTMA 1O2WA 2OP9A 1VCPA 4X8VH 1V2WT 1SBWA 3PMAB 1W13U 3U1JB 1HNEE 1CE5A 2OLGA 5HM9A 2PKSC 4GHQA 3FZDA 2QY0B 2XWAA 2EA3A 1LHEH 5TCAA 5E0GA 4UFFH 4H6TA 4OGXA 5EXNA 3MMGA 2BDIA 4F49A 1OX1A 3O8BA 1GJDB 2ZGXH 5DP3A 2GT7A 1C5WB 2ZI2H 2VGCC 1O2GH 1P2NA 2SGDE 5L6NH 1QGFA 7GCHF 4XSKU 4ZXXH 1BJUA 1WBGB 2PHBA 4HZHA 2WPMS 1O5AB 1O3OA 2Y7ZA 1YGCH 1KIGH 8GCHG 2TGAA 3TGKE 3C1KA 3ITIA 3RLYH 3W95A 3P70B 4Y6DA 3PYHA 1O3GA 1P03A 1K9OE 2OINA 2ZWLH 3BEUA 5HMAA 1D9IA 4JZEH 1ELDE 1ZRBA 2O8WA 1H9HE 3PMBB 1EPTB 4OS4A 1C9TA 2A5KA 1BRBE 2Z3DA 3SJKA 1DFPA 1WSSH 2ZGCA 1O2OA 5SGAE 1LKAA 4Q7XA 2ANWA 4Y8YA 2ODYB 1QA7A 1XXFA 2BLWA 1TQ7B 2A4QA 2GV6A 1F92A 5G4BA 2Y5HA 5CHAC 3RXLA 1TGTA 4BAQB 2Q1JA 2ZHWH 1G37A 2NU1E 2J38A 4MLFB 2KAIA 3T27A 1ANCA 1Y3UA 1MBQA 3L6PA 1CQQA 1YYY1 1SLXB 2ZA5A 5DKMA 3BG4B 2R2MB 1EAWA 2XNIA 4WMDA 4KTCA 3M7TA 2PTCE 2WPKS 3A86A 4ISHH 3MI4A 3S69A 3SUGA 5T6FA 1FIZA 2VVVA 4TPIZ 4E7RG 5EU8A 4INHA 4LOYH 3FZZA 4ZUHA 4JK5A 3QGJA 2BOKA 5K7RA 3MWIU 1P06A 3VB6A 1ZSJA 1F0SA 4DJZB 1BITA 1ZTKA 4AN7A 1MAXA 2AIPA 4YLQH 2PLXA 2ZFQH 5A2MH 1ESBA 1T4VH 1FDPA 1O3CA 1GMDF 5A8ZA 2FMJA 1MQ5A 1KXBA 3B23B 1BTHH 1B0FA 5JBCS 4LZ4B 1PPHE 1Z71A 1GBDA 2ZHDA 1LPGB 2F9UA 1MH0A 2GZ7A 1AZZA 2ZU1A 4AGJA 1O5DH 1QHRB 1S0RA 1W0ZU 1HGTH 1AU8A 1IQNA 3QZQA 3ELAH 1BBRE 1Z6EA 1C1TA 2QCYA 2C3SA 2BVSH 2ZCKP 1O3DA 1Q2WA 3GY7A 3K6ZA 3GDVA 4U32A 5C3NA 1GI7B 3QK1A 1YC0A 1FY4A 1C1OA 4O3TA 3CS0A 1TRMA 1HJAC 3E8LA 3ZZ4A 3K9XB 1GG6C 2OXSA 1C1VH 5JB9S 1TX6A 1T7CA 2TBSA 3LKWA 3MU4A 1RTLA 1QBOA 4ZHLU 1BB0B 4U2WA 2QXJA 2BYAX 4AG1A 3E3TA 1WV7H 4NWKA 2OC7A 3MH5A 2FIRH 3ZV9A 1AN1E 1P3EA 1BHXB 2ALPA 2FO9A 2ZQ1A 4Y7BA 5EXLA 3EAJA 4DCDA 2Z6BD 3M5LA 4INKA 2O9QA 3E91A 1O2JA 1O0DH 1GJCB 1RGQA 4K60A 1TNKA 4D7GA 1HLTH 2PUQH 1DPOA 1J9CH 1QTFA 1LPKB 1E0FD 1XUIA 2ZFFH 2FODA 2VNTA 4IMZA 2PKAB 1OYTH 4Q80A 5IYTA 1EPTC 3RMOH 1HRTH 1UTQA 2ZEBA 1NFUA 1BMAA 2AFQB 1D3DB 2BD3A 2HNTF 2ZECA 1DITH 1C5XB 1GI8B 1SL3A 1TGBA 1YP9A 1SQTA 2LIZA 3MOCA 1HAOH 2VU8E 1IHSH 4R0IA 1DDJA 2ZTXA 3LGYA 1ELBA 1P2OA 2HLCA 1JRTA 1K1IA 1C5RA 5A0AE 2BY7X 2WYGA 2STAE 4AB9A 2GDEH 1TGSZ 2BDBA 1OYQA 2ZFSA 2TRMA 1S85A 1AQ7A 4OS5A 2BD2A 4OGYA 1EB1H 1K1JA 3UIRA 1UTLM 3BG4C 1TMUH 3GY4A 1OPHB 3OU0A 3MU5A 1FAKH 5DP5A 3RLWH 1O32A 3RUOA 4Y10E 3VPKA 4UE7H 2FI4E 1ETRH 1YPMH 1GMCG 1SVPA 4OS2A 1CT2E 2Y7XA 1WTGH 4BNRA 2IPHA 5I46H 1D6RA 8ESTE 3MU0A 1FPCH 3SJIA 1EAIA 3DA9B 3ZVCA 1AB9B 1NRPH 1AHTH 1V2LT 1PQ8A 3KQEA 1S82A 2RCEA 2GCTB 2THFB 1EKBB 2W26A 4H6SB 3TH2H 3U8TH 2P16A 4K5ZA 4BAMB 1C5QA 2PGQB 1LKBA 3ZZ8A 3LGTA 4Z0KA 2ZDKA 1SI5H 4MNYA 4NIYA 1BT7A 1UTKA 3BTKE 4FUJA 1Z1IA 1O2IA 3M3VA 4I8JA 1ZHMA 3A89A 4XOJA 6GCHG 4Z6AH 1LVOA 2H2ZA 5C5OA 2Z9GA 2AIQA 2QN5T 4K8YA 1GI9B 5T6GA 1NRQH 1XXDA 4MPXA 2BXUH 3LGUA 2F91A 3O8RA 3V7TA 1HIAB 5EW1H 1ELVA 1LQDB 1HFDA 1NRRH 1JBUH 2FZZA 4DVAU 2JETB 3OY5U 5DP9A 1O30A 4CBOA 1SLVB 3HGPA 1S81A 1K28D 3ATMA 1Q3XA 1DVAH 1P2KA 1GHAG 4A5TS 2FOCA 3BEFB 3KCGH 3M37A 1Y8TA 1HV7A 3ZYDA 4GLYA 4AFSA 4Q7ZA 1EZQA 4SGAE 4FU9A 4B74A 2DUCA 1A5IA 4PROA 5EQQA 5T3HA 3I78A 2UWPA 3LC3A 3LH3A 1J14A 5C5NA 3ZZBA 4ABAA 1KXDA 4NZLA 1DX5M 3KQCA 1BTUA 2FX4A 2WPJS 2QA9E 2Y80A 1C1PA 4IC6A 2CN0H 3BV9B 1XUKA 4YTAA 1NFYA 1RJXB 1N8OB 1T31A 2HRVA 1K1LA 1DM4B 3SZNA 4U01A 2A7HA 1C1UH 3ZZ7A 2G00A 4MPWA 3UR6A 3E0NB 3NCLA 4NIVA 2AMQA 1ANEA 3L33A 3F9HA 2P59A 3KIDU 4NGAH 1VCQA 4MPVA 3QN7A 5ESBA 1YLDA 1MZDA 1FMGA 3NWUA 3LH1A 1LTOA 3AASA 3ESTA 1C9PA 2B8OH 1T8NA 3MNCA 4FVBA 2ZPSA 2ILNA 4B75A 4DT7B 3A81A 3TITA 1TLDA 1SLUB 2FS8A 4AYVB 2ZU2A 1T32A 1ELEE 4HI3A 4JCNA 1GL0E 3SJOA 2C4FH 2ZFTA 2BVXH 1KXEA 3A7TA 3UOUA 1HDTH 1G3DA 3GY2A 1K1OA 2XC5A 4ZAEA 2BD4A 2BMGB 1ZPZA 1GJBB 1TRNA 1WTHD 3KN2A 1ZLRA 5GCHG 5PTPA 4I32A 2CXVA 2GCHG 3WY8A 3BIUH 2FYQA 3ODDA 2FTLE 4I8LA 4Y0YE 4AZ2B 3GY6A 3URCA 1TPSA 1BMNH 1G32B 2BLVA 1GJ6A 1P2IA 1C5UA 1G3CA 1GJ8B 2RG3A 4J2YB 1KXAA 2FI3E 5A09A 3A7YA 1QY6A 1Y3WA 1H9LB 5EGMA 3SBKA 1DS2E 2ODPA 3U98H 1EP6A 1AB9C 1GHWH 2BDGA 2HVXA 4NIXA 4X6OA 3GICB 3TIUA 3BG8A 3OTJE 2GCTC 1SGFG 1UJ1A 4BOHA 2VB0A 5EW2H 3M5OA 1TGNA 6CHAB 1HXFH 3UQVA 3PLPA 4DW2U 1SMFE 1V2ST 4WF8A 4BTTB 1O3KA 1J15A 4WXVA 4Y7AA 1H4WA 3A7VA 4ABEA 3ZVDA 1QL7A 1ZSLA 4A92A 3BIVH 1C5MD 4AFUA 1DT2A 2AMDA 1GBAA 1O2HA 1O2KA 4A1TA 1KLJH 4E05H 2ZDMA 1NROH 1UCYH 3F6UH 2VH6A 4OS6A 1TPOA 1UTOA 3K2UA 1S83A 1OWKA 2GZ8A 1Z8GA 2O8TA 1GGDB 1C1QA 1GDUA 3B8JA 1O2LA 1V2PT 1H8DH 2JETC 4ZKSU 3FP8E 3QUMP 3U9AH 1O2XA 5C2ZA 2ANKH 1O2QA 1UCYK 3SV9A 1W14U 3OY6U 1L4ZA 4ISNA 5T6DA 1EZUC 1DANH 2F9OA 3JZ2B 3KQBA
chains in the Genus database with same CATH superfamily
2BHGA 2CK3D 2OBOA 3SU1A 1OP8A 3WW7A 1F7ZA 1K1NA 2KCAA 1K2I1 1CT4E 1G9IE 1CU1A 1OP0A 4Y0ZE 2CHAB 3P6ZB 1GJ7B 1SGTA 4X6MA 1YPKH 3A84A 4HFPB 2XCNA 5FCKA 3KNXA 1O37A 1UHBA 4UD9H 5DGJA 4B1TA 4O03A 1EASA 1L1GA 4GCHG 1IQFA 1O5FH 1OS8A 8GCHF 1ELGA 1C5SA 1DWBH 3T5FH 1GCDA 1SHHB 4ZROA 2W3IA 1YM0A 3UWIA 1MU6B 3R3GB 1NFWA 1TPAE 2BOHB 2CV3A 2GV7A 2P94A 1E1QD 3KQ5A 1O3FA 5IDKA 4BANB 2PR3A 3OSYA 1P2QA 4XBCA 2Y5GA 3SQEE 2W7SA 2BXTH 2BB4A 3F68H 4ESTE 1AWHB 3MNSA 4A1XA 4YO9A 4D9RA 2KAIB 3NUMA 1GBLA 1EAXA 3F1SB 3SJ9A 4RI0A 1TGCA 2FXRA 1TNLA 3MYWA 1ELTA 1P57B 2ZQ2A 3W1EA 1G30B 4QT8C 4ABJA 1EJNA 1S84A 1TBRH 3GCHB 1T8MA 3M3TA 3BN9A 3RM0H 3H5CB 2FYRA 6ESTA 4YT6H 3FN8A 4NSVA 3VXEH 4CH8B 1FQ3A 4VGCB 2FESH 1KTSB 2P3UB 2P8OB 4Y71A 4CR9A 2FM2A 2GP9B 1UTMA 1THSH 2VH0A 4WMEA 1NY22 1KDQA 1QJ1B 5ABWA 4YZUA 3PV4A 4CREA 1FIWA 4B71A 2WV9A 3AAUA 3VGCB 1EJAA 4RKOB 2J4IA 4RKJB 4ZKRU 1BOQA 2QGRA 1AUJA 3URDA 1DWDH 2FP7B 1BDAA 1Z8IB 2QAAA 3EE0B 1IQKA 3MHWU 3F2HA 3TK9A 5A0CA 3RP2A 3ZZ3A 4AORA 2ZCLP 2TGDA 3HPTB 4OS7A 1G2MA 5AF9H 1TA6A 6CHAC 1XM1A 2VBCA 3SV8A 2ZP0H 1S0QA 1XVOA 2ZHQH 1NM6A 2KCOA 1NTPA 3PM3A 4LXBH 4X2VA 2FOMB 3NKKA 5KGOA 4K1EA 4I8KA 1GJ5H 5I25A 2A4RA 1F5LA 4WH6A 5ETXA 4UEHH 3RU4E 5TCCA 2A31A 1DLKB 2XC0A 1TYNA 5B6LA 1JMOH 3SJ8A 1LHGH 3PROA 2LNCA 4J1YA 1LVYA 1O3LA 4F55A 1MTVA 1AWFH 2PTNA 3STJA 1DXWA 3LPRA 3RXFA 3SV7A 1P9UA 1YPEH 3P8FA 2P3TB 3RXVA 1YY3A 4ACAA 3PMHB 1O5EH 1GGDC 3CS7A 2C8WB 3KGPA 1C5VA 2ASUB 1AVWA 1GBMA 1WOFA 1KXFA 1ZHPA 2BLOA 4DGJA 3M7UA 3ZVGA 2V35A 4D7FA 4K1SA 1P05A 1P12E 3C27B 3RMLH 1GDQA 2GT8A 1MUEB 3GDSA 1IQMA 4AOQA 1MTUA 2NU0E 3CENA 3UAIC 5A8XA 2BD5A 2Z3EA 4GHTA 1CA0B 2I6QA 1KXCA 2G51A 3EA7A 1UVUH 2BX4A 2Y81A 2RA0A 1C4U2 1CVWH 1S6HA 1V2UT 5LH8A 2V6NA 3OEED 4JYVH 1HXEH 2SGAA 3SHAH 1VCWA 1CA8B 1G36A 3UNSA 1QBNA 1GPZA 3UREA 1NRNH 2LPRA 4K69A 4BXSA 1ARBA 2ZFPH 4WVPE 2VIVA 2V7QD 2C8XB 1W0JD 2HPQH 1VJ9U 1B5GH 2ZCHP 1F0UA 2YNBA 2XNDD 2SFAA 4FVDA 5FBEA 2O8UA 1TA2A 2JH0D 4ZHMU 1P0SH 3FP7E 1C1WH 1QNJA 1D3TB 3GY5A 1A3EH 2J97A 1ZRKA 3WWFA 1W10U 3A88A 2J98B 2ODQA 3MH7A 1BTYA 2XBVA 2V0BA 1AKSB 1EQ9A 2OTVA 1QRZA 2VIDA 1GI4A 3GCHC 2PFEA 4NFEA 1ZMLA 3DT0H 1V2NT 1WAYB 2ZHFH 2A1DB 4YOGA 5LPFA 1TONA 3BF6H 1W0YH 4VGCC 4TWYA 1H1BA 5BRRE 1IAUA 1O5GH 2P95A 1EPTA 1ZMNA 7LPRA 4GVUA 1EX3A 3AW1A 9LPRA 4WJG2 4TY7A 4D9QA 4YOJA 3SNEA 1C1MA 1FY3A 4X2XA 3G01A 1C2IA 1ZSKA 2A4GA 3TK5A 1KLTA 2BDHA 4LZ1H 3FVFB 3KQDA 1TRYA 1O2RA 1HJ9A 2HOBA 1O3BA 4YLUA 3OTPA 1A2CH 8KME2 4SGBE 2QE7D 1HBTH 1Q31A 1SGIB 2C8ZB 2NWNA 1L4DA 1YLCA 4XFQA 3BTQE 2K0QA 1NESE 4KTSA 3B9FH 2H5CA 5LPEA 1RFNA 6LPRA 1GI0A 1LVMA 3VB5A 3VB4A 3SU3A 2GTBA 3U8OH 1W3CA 4AFQA 1YLNA 3F9GA 1K1PA 1Y5UT 2J5UA 4KKDA 1C5OH 1N6XA 2XW9A 4ZMAH 4UFDH 1QB9A 1A7SA 3KL6A 1QA0A 1MKXH 1DUEA 2NU3E 2WYJA 3PB1E 3SU2A 4X8UH 2G8TA 4X1PU 1UK3A 1C2KA 1TALA 4B2BA 2CF9H 1IQGA 2A0QB 2FWWA 3UR9A 1P11E 2B0FA 1HJ8A 1GBHA 1P2JA 2RDEA 6GCHF 1ORFA 2R0KA 2YMSD 2G4UA 3UUZA 5GXPA 1GBIA 3GCTG 1MKXK 1BQYA 1HAVA 4JYTA 1TIOA 5A8YA 5L30H 1BJVA 5LGOA 4IBLH 2FDAA 4KP0A 1TX8A 2SNWA 3A82A 1THPB 3MFJA 1V2OT 1C2EA 2B7DH 4XDEA 2PGBB 5EPYA 1QL8A 1IQLA 1ETSH 1P8VC 3RXUA 1ELFA 1GHAF 2YOLA 3UTUH 5C20A 1UTPA 3TU7H 3S9BA 1E79D 4ISIH 3EE7A 3SNCA 2OBQA 1GBBA 1FNIA 1GBCA 1GVKB 1C4Y2 2JJ1D 1NRSH 4O3UA 1BRUP 1FONA 1O2UA 1ACBE 5J4SA 1TBZH 1DY8A 2HVYB 9ESTA 4DY7B 3LIWA 5AVDA 2UUYA 1AI8H 1J16A 1ZMJA 1EB2A 5DJ7A 3M7QA 1TFXA 1OWEA 2QV1A 3KEEA 2HNTE 1MKWH 1TMBH 3QTVH 1NC6A 1BRCE 2EEKA 5FHTA 2BD9A 2GKVE 4Q7YA 5GDSH 1C2JA 3WWBA 5DP6A 1DICA 4NSYA 1SGRE 3BTTE 3ZZCA 4XBDA 2V3MA 3AK5A 1VR1H 2ZHEH 1FLEE 2VIPA 3SU6A 1MTSA 2Z9KA 1PPGE 1MKWK 4HG6A 4RSPA 4CRFA 3VFEA 3A8BA 2Y82A 1WXRA 4NFFA 1MD8A 1Y5AT 4ISLA 5GPIB 2XWBI 4TT3D 2EI8A 3TLOA 3H7TA 5DN6D 2YNAA 2UUFB 1DSTA 2PKAA 2UUKB 2EQNA 2STBE 2RA3A 2XC4A 2RDLA 1OOKB 1EATA 4I8GA 1ANBA 1P01A 4IC5A 1V2KT 3A8DA 1PJPA 1NO9H 2F9BH 2EI7A 3HKIB 3UY9A 2A2QH 3M35A 4TPYA 2XBWA 5GCHF 4YOIA 1AVGH 2GCHF 1FN8A 1SGCA 1A3BH 2AYWA 1V2RT 3VB3A 3PO1B 1YPJH 1PPFE 2G52A 2FS9A 4I33A 2A7CA 1QJ6B 2W3KA 2A5AA 2G4TA 5TJXA 1UK4A 3HATH 3D62A 1EUFA 3FP6E 2ZU4A 1UCYE 4BTIB 2ZDNA 5HXFA 2H5DA 1O2PA 5FX5A 3HGNA 5L2ZH 2K7XA 1ID5H 3ZV8A 1EJMA 1Z7KA 4ZKNU 4TWWA 3F2FA 4WY3A 3DFLA 1ZGVA 1GHBG 4FUIA 1O5CB 1LHFH 3GY3A 2BTCE 2WPDD 1BMMH 1GHZA 1NBMD 1O3AA 1V2MT 1O3NA 1JRSA 1YPLH 4O97A 4KGAA 1XKAC 1GI1A 1XUFA 2Q6FA 1O2MA 2HWLB 3RXQA 5CMXH 3HKJB 3JZ1B 5FX6A 1AMHA 3ZZ9A 1E35B 1D3PB 5E8EH 2J34A 3NZIA 3SN8A 1O3JA 1UTNA 1OWDA 1CHGA 2XOKD 3PMJA 4HGCA 3ATWA 1DOJA 2XYAA 5ESTE 1PQAA 3BTHE 2KX4A 3RXDA 4Y8ZA 1UHBB 5CHBA 1A4WH 1H8ED 1QRWA 4FUGA 4X1NU 1GBTA 1C4V2 1GWAA 2VVCA 4Y79A 5C17A 1VITG 5F53A 5C0UA 4X2YA 4IGDA 3EGKH 2ZDAH 1DE7H 3Q3XA 1GI3A 4B73A 5DG6A 2LELA 4H4FA 3RXMA 3CP7A 2BY9X 2QXGA 5FPYA 2TIOA 2WPLS 4GCHF 2XTTB 3Q76A 1INCA 3UPEA 1UTJA 3QZRA 1OP2A 4K2YA 3A7WA 2AHME 2AMPA 1COWD 1ESTA 3GISB 1FXYA 2FOEA 3SOSA 3U28C 3FFGA 3TGIE 2R2WU 2Z94A 1SGFA 4WWYA 4XBBA 1QB1A 3RXBA 3KYGA 3UNQA 3TPIZ 3MU1A 1E34B 2HALA 1TAWA 2ZC9H 3ENSB 1L1JA 3HK6B 3SHCH 1O31A 3RXEA 2QF3A 3RXKA 5C1UA 1A61H 1MQ6A 2ZDVH 1O3PB 3BTDE 5HM2A 1CHOG 1KSNA 4B76A 4RT0A 4FOUC 4D76A 2IJOB 1TWXB 3BTWE 2R3YA 3M61U 2BD8A 2GMTB 1KDQB 3UFAA 1QQUA 1UO6A 1W11U 2H9TH 3RU4D 3TJOA 4FUEA 3GCNA 1TNJA 1ABJH 4AX9H 1LHDH 3ZYEA 1O2YA 3TVJB 1RD3B 2BQ6B 2IN2A 3NPSA 1C5PA 1EXFA 3TNTA 2BZAA 4H42U 3PO1C 5AFYH 1C5LH 1GBJA 3RMMH 3SGAE 3RXAA 3DHKH 1HAIH 1TNHA 1BUIA 1QCPA 1MCTA 2K8IA 2Z9JA 3RDZA 1GDNA 1GL1A 3RXOA 4CRAA 4MQAA 1WUNH 4MNVA 2A5IA 1RTFB 1N8OC 2G55A 1GI6A 2ALVA 1K1MA 3V3MA 2H6MA 1RIWB 1TMTH 3ZIAD 2EC9H 4FUBA 3SV2H 5E0JA 3ZZ5A 3OE7D 3S0NA 3LGIA 4MPUA 3SUEA 5LPRA 3RC4A 1AY6H 4RN6A 1OWJA 4JZ1A 1N6YA 1IQIA 3D65E 5DO4H 2QIQA 2UUJB 4O9VA 1O3IA 5F8ZA 2D26C 3SYJA 2ZTZA 1AD8H 1T8LA 1ZZZA 1XX9A 2CJIA 4X8SH 1O2NA 2FI5E 2VWLA 5GJ4B 1EZSC 5GIBA 1ANDA 1L2EA 1FY1A 3VG8A 1HB0B 1FZZA 4K3JA 3EA9A 1SFIA 3VEQB 1DSUA 1FX0B 4FETA 5C1YA 2WINI 4I86A 4ASUD 1AZ8A 4YT7H 5EPNA 1SQOA 2R3UA 4GUXA 1VGCB 1QR3E 4R8TB 2Q6GA 4ASHA 5CDFE 3MH4A 1WYKA 4E7NA 2AERH 3TJUA 2B9LA 2WUBA 3QWCH 3RXHA 5JB8S 2KM0A 1PYTC 2OC8A 1VZQH 4NA8A 2NU4E 3RXGA 3A87A 1UMAH 2CGAA 1O3MA 1TE0A 1FI8A 1DY9A 2QF0A 2SGQE 2FOGA 1HJAB 2WUCA 2XCFA 4AC9A 1YPGH 1GG6B 3LGVA 3ZVFA 1SR5C 1SHYA 5DPAA 1V6DA 3MU8A 4NZQA 3ZZAA 2G5NA 3M36A 3FAOA 4DURA 1ETTH 1E38B 1CT0E 1GMHG 2W6ID 4CH2B 3EA8A 2JH6D 3O8CA 2O8LA 1Z8RA 4CRCA 2FEQH 7KMEH 3SU0A 1QB6A 1QFKH 3RMNH 5DSFA 2AGGX 2F9VA 1UVSH 3U1IB 4NG9H 1NU9A 1IOEA 1O2ZA 2GD4B 5K0HA 1ZR0A 2Y6TA 5DP4A 3ZZDA 5FAHA 4YM9A 1A1RA 3GDUA 4X1SU 1A0HB 5HYOA 1O3HA 4RT1A 4XE4A 1O2VA 4K8BA 3U8RH 1O34A 1EOJA 1GJ4H 2UWLA 3T2NA 1LVBA 1XUGA 1P3CA 2F83A 2PUXB 2CF8H 5BPEA 1JWTA 2HPPH 2GMTC 3QX5H 4D8NA 3A8AA 1V3XA 4ABIA 4FUCA 1MAYA 2FLBH 2ANYA 1GBEA 3PRDA 5C0TA 3MH6A 3K65B 1NT1A 1ARCA 4MG3A 4CRBA 1GVLA 3F2GA 3LJJA 2BDAA 4IS5A 4MNWA 4A1VA 4A7IB 1LCYA 1FJSA 1V2VT 3P95A 1F0TA 2EI6A 2OCVB 2UWOA 1FAXA 2BDYA 5JBTA 3TNSA 1UVOA 1KLIH 4JZIA 4BAHB 1HCGA 1K21H 2ZFRH 2JKHA 2CHAC 4BAKB 1C2MA 2VIWA 2WPIS 1TBQH 3FOAA 4BXWA 1OXGA 1C2LA 3EYDA 1Y5BT 1VJAU 3UB0A 3MO6A 1RIWC 1W12U 2GX4A 3MNBA 3P17H 1ABIH 2ANMH 7GCHG 2ZF0H 3U69H 1JIMA 3DFJA 1GJAB 2V3HH 2CMYA 3D23A 2GGVB 3LT3A 1V2TT 2SGFE 1YCPM 1NPMA 2BQ7B 1T8OA 2AGEX 8LPRA 4JK6A 2VWMA 3A7XA 2XRCA 1ZJKA 3QTOH 1O2TA 5EQSA 3H09A 4DG4A 2KFWA 1C1NA 4FUFA 2GZ9A 3PV2A 3ZVAA 1C1RA 3SUFA 2DE9A 5AFZH 2FOHA 2BQWB 1D3QB 1XUJA 1O39A 2J2UA 1S6FA 2WV5A 3Q3YA 2ULLA 4FUHA 4ABBA 3ZVEA 4CR5A 1HAVB 2W7UA 4ISOA 2BLQA 1O33A 5FXLA 2XBXA 1HAGE 3ZZ6A 1IQJA 3K6YA 1C1SA 1LMWB 5C1XA 1K22H 4AGKA 2A32A 1RTKA 1HUTH 1VGCC 1WCZA 2I6SA 4Y76A 1AUTC 1ZYOA 1FN6A 1XUHA 3W94A 4THNH 1FV9A 1W0KD 1V2JT 2FOAA 1QURH 2FX6A 3Q3KA 2IPQX 2V3OH 3GCTF 2ZU5A 2P8OC 4U30A 1QRXA 2D2DA 1EAUA 1F2SE 1MMJN 3DSPA 2Z3CA 1GCTB 4K1TA 1HAPH 1LPZB 5JPMH 4X1RU 1QQ4A 4CRGA 3PTNA 1UVPA 3AW0A 1F0RA 1O2SA 3RXIA 5CE1A 3PWCA 3VGCC 2QXIA 3N7OA 2BD7A 4OM9A 3SGQE 4MTBA 1BTPA 3SO3A 3MO3A 3NK8A 1F5RA 1GMCF 2OUAA 1E37B 1E36B 2ZPQA 3BEIB 3ATKA 2F9NA 5C94A 3M5MA 1H8IH 3M5NA 3ZVBA 4ACBA 1KYNA 4X1QU 4XD7D 1SG8B 1FY5A 1C2FA 5DP8A 4ZXYH 1Z6JH 3ATIA 3L3TA 4FXGH 3P8OA 1BHXF 3BTGE 2PWXA 1EP5A 1GVZA 4FUDA 4KELA 4Y11E 5DK1A 1SOZA 5J4QA 1W7GH 4X6PA 1RRKA 3IITA 3IG6B 1QZ8A 1GMDG 2Q6DA 2A2XH 4MVNA 1UK2A 3GYMA 3RC5A 3UQOA 1RXPA 3DD2H 1TQ0B 2H9HA 1THRH 1WQVH 4NWLA 1ELAA 3T29A 1F5KU 4ZKOU 1Y3XA 5B6OA 3ODFA 3T28A 1HAXB 1MZAA 3UWJH 4GAWA 1JIRA 1TNGA 4F4OC 4AB8A 2WV4A 5FCRA 4ABHA 1KTTB 2PSXA 3GY8A 3RXTA 3LDXH 2J95A 4B2AA 1PPEE 1H9IE 5JBBS 4MDSA 1AO5A 4UDWH 1C5NH 3V13A 1FUJA 4JYUH 4FU7A 4TY6A 2FOFA 3DCLA 5EQRA 2OC0A 2VIOA 5A0BA 1D6WA 1J17T 1HAHH 1KMHB 1CGJE 1ELCA 4ABFA 1CA0C 2TGTA 1HPGA 1AFEH 3P92A 1O38A 5FPSA 3BTFE 2SGPE 1BMLA 4UFGH 4CHAB 3LC5A 1AKSA 1Y3VA 3UNRA 1EZXC 2VVUA 1H8HD 4X6NA 1AIXH 5E2PA 1W8BH 3A85A 1SLWB 2R9PA 4HTCH 4B6FA 1BBRH 3SNDA 1P9SA 1C2HA 1HYLA 3P8GA 4B2CA 3SV6A 2F9PA 4AYYB 1P2MA 4I7YH 3M3SA 1D4PB 1NFXA 1GHYH 1AFQB 1FY8E 2WSSD 2FOBA 3SW2B 1OSSA 1A0LA 1QBVH 1BBRK 1IQHA 3F9FA 2ZZUH 1DXPA 3SNAA 4OS1A 3D49H 2AEIH 3NXPA 4CRDA 1CO7E 4WXIA 2P93A 4NA7A 3LU9B 5EG4A 4ZCNA 1YBWA 3IWMA 1LDTT 1L0ZA 1J8AA 1GHBF 2JDID 2QYIA 1LHCH 3RXJA 4ABDA 1OKXA 3FKSD 3F9EA 5JBAS 1BIOA 3RC6A 2ZGJA 3RXPA 5GWZA 2M2AA 5HKKD 3E1XB 1KY9A 1EOLA 4IN2A 4KTUA 2ZKSA 1PQ5A 1C5ZB 3V0XA 3V12A 1YF4A 1BTWA 2G81E 2DE8A 1SGYE 4AG2A 4M7GA 3S9AA 2C8YB 2GDDA 1O36A 2ZO3H 1GCTC 1P04A 5F8TA 1BCUH 4BAOB 3LGWA 1YWUA 3RU4T 1T4UH 3EBNA 2BY5X 3AAVA 3LONA 2BM2A 2GVFA 1GHVH 1OHHD 1O3EA 4LK4A 2W6JD 2QXHA 4ZHAA 3E6PH 2M5TA 3QLPH 1SOTA 3I77A 1L1NA 2O8MA 1CSOE 4UFEH 3RXRA 1BRAA 1VITF 1Y3YA 1AE5A 2FPZA 2Z7FE 3LOXA 3KHVA 1SGQE 3SORA 4TYDA 4Y8XA 3SUDA 4IN1A 2AH4X 2Z9LA 1PYTD 2ZGHA 4Q2KA 1MTWA 1N1LA 5HIZA 2WPHS 4YESB 4CBNA 3KF2A 1ZTLA 1XKBC 1SGNE 3FANA 2HNTC 2PW8H 3A83A 4NCYA 2G5VA 4DIHH 3SU4A 1TABE 1K0HA 2BY8X 1G3BA 1A46H 5EXMA 1CBWB 1ZTJA 1XVMA 2OD3B 3O8DA 1NU7B 3LJOA 3OYPA 2SNVA 1MTNB 1OWHA 1O35A 4B6EA 1C5TA 1TNIA 1MCVA 1YPHE 3E16B 4AFZA 3E90B 3SQHE 1MBMA 3PWBA 3RM2H 4BTUB 2A7JA 1W7XH 4NIWA 1ZPCA 3GCOA 2BDCA 3T26A 5EIYA 1QJ7B 1JXPA 3P8NA 5AHGH 2J9NA 1SFQB 1CHOF 1C2DA 2ZDLA 2ZG0H 3S7KB 1C5YB 1BZXE 4ABGA 1NZQH 1V2QT 3ATLA 2J94A 2VWOA 2QC2A 5F03A 1WQSA 4INLA 2D1JA 3F0PA 2IJD1 2ZTYA 2TGPZ 3A80A 1B7XB 1FPHH 3SU5A 2C90B 2ZIQH 1BTXA 2D8WA 2Z9IA 3S9CA 3SGBE 1DWEH 4ZH8A 2PKSB 4CHAC 7ESTE 1C2GA 5C67A 2ZPRA 1TPPA 2B5TB 1BMFD 5HGGA 3SNBA 1ZGIA 2VJ1A 2ZU3A 1Z1JA 2L6OA 1HIAA 3T62A 1IQEA 2SGEE 3RXCA 2VIQA 2JH5D 4JMYA 1JOUB 1MU8B 1ZOMA 2VGCB 4X2WA 1YCPH 1GHXH 1PQ7A 1DWCH 1TOMH 1UVTH 3TH3H 1AFQC 2XXLA 4WH8A 1GI2A 2WHXA 2PV9B 5IK2D 1RS0A 3HK3B 2ZNKH 1DLEA 2OQ5A 2XBYA 4DOQA 1AE8H 1G3EA 3Q00A 2OC1A 2Y5FA 3PLKA 3DUXH 1YCPK 2ZGBH 1BTZA 1AVXA 3TGJE 1QL9A 3PLBA 5GNDA 3VXFH 4E06H 1CGHA 2PP6A 3RXSA 1LO6A 4GSOA 5FBIA 1DUAA 2WZQA 2VWNA 3SI4H 2ESTE 1YPHC 1AGJA 1W2KH 1A0JA 3AVZA 1LQEA 4YXWD 1IHTH 3BTME 2NU2E 5JYIA 2C93B 1Z8JB 3TH4H 3OX7U 1ESAA 3BTEE 4I8HA 4TSFD 4DIIH 1ZJDA 2R0LA 2BVRH 1SGPE 1M9UA 3QO6A 2A45B 3Q77A 1YKTA 2BY6X 1P10A 5EOKA 1SQAA 1HAZB 5CHAB 3TK6A 1B0EA 2H9EH 1PPBH 3F0OA 1PFXC 3GOVB 1ZPBA 1S5SA 1PPZA 2IOTA 1Y59T 4IMQA 1VKYA 1TX7A 1SGEE 2W5EA 3E0PB 4NA9H 4GPGA 1MD7A 2TPIZ 1OWIA 2BX3A 1SB1H 3I29A 3STIA 3MO9A 3PTBA 4X8TH 5E0HA 1BA8B 1NS3A 4F48B 2AGIX 4I31A 4UONA 1SPJA 2A4OA 5FPTA 1A5GH 3QDZB 3BSQA 1WU1A 3TJVA 2F4LA 4MNXA 3A8CA 1GMHF 1TOCB 3TJNA 4IW4E 1SSXA 1VITH 3UOPA 3S7HB 5H4IB 4X0WU 3QGNB 1NBME 2PSYA 1CBWC 4JZDH 3H7OA 1QIXB 1O5BB 1A5HA 1G2LA 1GI5A 5E2OA 2J92A 4P02A 2F3CE 4FU8A 4JZFH 1MTNC 3F3BA 1HAYB 1P02A 1GBKA 3SI3H 5F8XA 1XMNB 5L2YH 2VINA 1GJ9B 1S6LA 3R0FA 2OQUA 5EODA 5JDUB 1NN6A 2FLRH 2BZ6H 2K1QA 2P3FH 4WMFA 5F6MA 1P09A 1CGIE 1SC8U 1SGDE 3VB7A 3EQ0H 3T25A 1TB6H 1PPCE 3MTYA 1X7AC 2HGTH 2AS9A 2H1UA 3EDXB 3MNXA 1GBFA 1SQRA 3A7ZA 3GYLB 5DP7A 4A6LA 1U6QA 1ZHRA 2FTMA 1O2WA 2OP9A 1VCPA 4X8VH 1V2WT 1SBWA 3PMAB 1W13U 3U1JB 1HNEE 1CE5A 2OLGA 2L74A 5HM9A 2PKSC 4GHQA 3FZDA 2QY0B 2XWAA 2EA3A 1LHEH 5TCAA 5E0GA 3KYFA 4UFFH 4H6TA 4OGXA 5EXNA 3MMGA 4XRNA 2BDIA 4F49A 1OX1A 3O8BA 1GJDB 2ZGXH 1WDIA 5DP3A 2GT7A 1C5WB 2ZI2H 2VGCC 1O2GH 1P2NA 2SGDE 5L6NH 1QGFA 7GCHF 4XSKU 4ZXXH 1BJUA 1WBGB 2PHBA 4HZHA 2WPMS 1O5AB 1O3OA 2Y7ZA 1YGCH 1KIGH 8GCHG 1E1RD 2TGAA 3TGKE 5EJLA 3C1KA 3ITIA 3RLYH 3W95A 3P70B 4Y6DA 3PYHA 2RFKC 1O3GA 1P03A 2GJGA 1K9OE 2OINA 2ZWLH 3BEUA 5HMAA 1D9IA 4JZEH 1ELDE 1ZRBA 2O8WA 1H9HE 3N99A 3PMBB 1EPTB 4OS4A 1C9TA 2A5KA 1BRBE 2Z3DA 3SJKA 1DFPA 1WSSH 2ZGCA 1O2OA 5SGAE 1LKAA 4Q7XA 2ANWA 4Y8YA 2ODYB 1QA7A 1XXFA 2BLWA 1TQ7B 2A4QA 2GV6A 5KEDA 1F92A 5G4BA 2Y5HA 5CHAC 3RXLA 1MABB 1TGTA 4BAQB 2Q1JA 2ZHWH 1SKYE 1G37A 2NU1E 2J38A 4MLFB 2KAIA 3T27A 3CNRA 1ANCA 1Y3UA 1MBQA 3L6PA 1CQQA 1YYY1 1SLXB 2ZA5A 5DKMA 3BG4B 2R2MB 1EAWA 1EFRD 4WMDA 2XNIA 4KTCA 3M7TA 2PTCE 2WPKS 3A86A 4ISHH 3MI4A 3S69A 3SUGA 5T6FA 1FIZA 2VVVA 4TPIZ 4E7RG 5EU8A 4INHA 4LOYH 3FZZA 4ZUHA 4JK5A 3QGJA 2BOKA 5K7RA 3MWIU 1P06A 3PV5A 2F43B 3VB6A 1ZSJA 3N7EA 1F0SA 4DJZB 1BITA 1ZTKA 4AN7A 1MAXA 4Q4LA 2AIPA 4YLQH 2PLXA 2ZFQH 5A2MH 1ESBA 4M9FA 1T4VH 1FDPA 1O3CA 1GMDF 5A8ZA 2FMJA 1MQ5A 1KXBA 3B23B 1BTHH 1B0FA 5JBCS 4LZ4B 1PPHE 1Z71A 1GBDA 2ZHDA 1LPGB 2F9UA 1MH0A 2GZ7A 1AZZA 2ZU1A 5KECA 4AGJA 1O5DH 1QHRB 1S0RA 1W0ZU 1HGTH 1AU8A 1IQNA 3QZQA 2QF5A 1BBRE 1Z6EA 3ELAH 1C1TA 2QCYA 2C3SA 2BVSH 2ZCKP 1O3DA 1Q2WA 3GY7A 3K6ZA 3GDVA 4U32A 5C3NA 1GI7B 3QK1A 1YC0A 4P00A 1FY4A 2JIZD 1C1OA 4O3TA 3CS0A 4Q63A 1TRMA 1HJAC 3E8LA 3ZZ4A 3K9XB 1GG6C 2OXSA 1C1VH 5JB9S 2KR7A 1TX6A 1T7CA 2TBSA 3LKWA 3MU4A 1RTLA 1QBOA 4ZHLU 1BB0B 4U2WA 2QXJA 2BYAX 5EJZA 4AG1A 3E3TA 1WV7H 4NWKA 2OC7A 3MH5A 2FIRH 3ZV9A 1AN1E 1P3EA 1BHXB 2ALPA 2FO9A 2ZQ1A 4Y7BA 5FL7D 5EXLA 3EAJA 4DCDA 2Z6BD 3M5LA 3NRLA 3OAAD 4INKA 2O9QA 3E91A 1O2JA 1O0DH 1GJCB 1RGQA 3N7DA 1TNKA 4K60A 4D7GA 1HLTH 2PUQH 1DPOA 1J9CH 1QTFA 1LPKB 1E0FD 1XUIA 2ZFFH 2FODA 2VNTA 4IMZA 2PKAB 1OYTH 4Q80A 5IYTA 1EPTC 3RMOH 1HRTH 1UTQA 2ZEBA 1NFUA 1BMAA 2AFQB 1D3DB 2BD3A 2HNTF 2ZECA 1DITH 1C5XB 1GI8B 1SL3A 1TGBA 1YP9A 1SQTA 2LIZA 3MOCA 1HAOH 2VU8E 1IHSH 4R0IA 1DDJA 2ZTXA 3LGYA 1ELBA 1P2OA 2HLCA 1JRTA 1K1IA 1C5RA 5A0AE 2BY7X 2WYGA 2STAE 4AB9A 2GDEH 1TGSZ 2BDBA 2J98A 1OYQA 2ZFSA 2TRMA 1S85A 1AQ7A 4OS5A 2BD2A 4OGYA 1EB1H 1K1JA 3UIRA 1UTLM 3BG4C 1TMUH 3GY4A 5HIYA 1OPHB 3OU0A 3MU5A 1FAKH 5DP5A 3RLWH 1O32A 5EJ1A 3RUOA 3DSGA 4Y10E 3VPKA 4UE7H 2FI4E 1ETRH 1YPMH 1GMCG 1SVPA 4OS2A 1CT2E 2Y7XA 1WTGH 4BNRA 2IPHA 5I46H 1D6RA 8ESTE 3MU0A 1FPCH 3SJIA 2KCYA 1EAIA 3DA9B 3ZVCA 1AB9B 1NRPH 1AHTH 1V2LT 1PQ8A 3KQEA 1S82A 2RCEA 2GCTB 2KZ4A 2THFB 2KCPA 1EKBB 2W26A 4H6SB 3TH2H 3U8TH 2P16A 4K5ZA 4BAMB 1C5QA 2YMSB 2PGQB 1LKBA 3ZZ8A 3LGTA 4Z0KA 2ZDKA 1SI5H 4MNYA 5T1VA 4NIYA 1BT7A 1UTKA 3BTKE 4FUJA 1Z1IA 1O2IA 3M3VA 4I8JA 1ZHMA 3A89A 4XOJA 6GCHG 4Z6AH 1LVOA 2H2ZA 5C5OA 2Z9GA 2AIQA 2QN5T 4K8YA 1GI9B 5T6GA 1NRQH 1XXDA 2EY4C 2BXUH 4MPXA 3LGUA 1UW7A 3PRBA 2F91A 3O8RA 3V7TA 1HIAB 5EW1H 1ELVA 1LQDB 1HFDA 1NRRH 1JBUH 2FZZA 4DVAU 2JETB 3OY5U 5DP9A 1O30A 4CBOA 1SLVB 3HGPA 1S81A 1K28D 3ATMA 1Q3XA 1DVAH 1P2KA 1GHAG 3DSOA 4A5TS 2FOCA 3BEFB 3KCGH 3M37A 1Y8TA 1HV7A 3ZYDA 4GLYA 4AFSA 4Q7ZA 1EZQA 4SGAE 4FU9A 4B74A 2DUCA 1A5IA 4PROA 5EQQA 5T3HA 3I78A 2UWPA 3LC3A 3GS9A 1J14A 5C5NA 3LH3A 3ZZBA 1KXDA 4ABAA 4NZLA 1DX5M 3KQCA 1BTUA 2FX4A 2WPJS 2QA9E 2Y80A 1C1PA 4IC6A 4Z1MD 2CN0H 3BV9B 1XUKA 4YTAA 1NFYA 1RJXB 1N8OB 1T31A 3SZEA 2HRVA 1K1LA 1DM4B 2OK5A 3SZNA 4U01A 2A7HA 1C1UH 3ZZ7A 2G00A 4MPWA 3UR6A 3E0NB 3FO8D 3NCLA 4NIVA 2AMQA 1ANEA 3MQKC 3L33A 3F9HA 2P59A 3KIDU 4NGAH 1VCQA 4MPVA 3QN7A 5ESBA 1YLDA 1MZDA 1FMGA 3NWUA 3LH1A 1LTOA 3AASA 3ESTA 1C9PA 2B8OH 1T8NA 3MNCA 4FVBA 2ZPSA 2ILNA 4B75A 4DT7B 3A81A 3TITA 3OFND 3OEHD 1TLDA 1SLUB 2FS8A 4AYVB 2ZU2A 1T32A 1ELEE 4HI3A 4JCNA 1GL0E 3SJOA 2C4FH 2ZFTA 2BVXH 1KXEA 3A7TA 3UOUA 1HDTH 1G3DA 2JJ2D 3GY2A 1K1OA 2XC5A 4ZAEA 2BD4A 2BMGB 1ZPZA 1GJBB 1TRNA 1WTHD 3KN2A 1ZLRA 5GCHG 5PTPA 4I32A 2CXVA 2GCHG 3WY8A 3BIUH 2FYQA 3ODDA 2FTLE 4I8LA 4Y0YE 4AZ2B 3GY6A 3URCA 1TPSA 1BMNH 1G32B 2BLVA 1GJ6A 1P2IA 1C5UA 1G3CA 1GJ8B 2RG3A 4J2YB 1KXAA 2FI3E 5A09A 3A7YA 1QY6A 1Y3WA 1H9LB 5EGMA 3SBKA 1DS2E 2ODPA 3U98H 1EP6A 1AB9C 1GHWH 2BDGA 2HVXA 4NIXA 4X6OA 3GICB 3TIUA 3BG8A 3OTJE 2GCTC 1SGFG 1UJ1A 4BOHA 2VB0A 5EW2H 3M5OA 2HLDD 2LP6A 1TGNA 6CHAB 1HXFH 3UQVA 3PLPA 4DW2U 1SMFE 1V2ST 2YMSC 4WF8A 4BTTB 1O3KA 1J15A 4WXVA 4Y7AA 1H4WA 3A7VA 4ABEA 3ZVDA 1QL7A 1ZSLA 4A92A 3BIVH 1C5MD 4AFUA 1DT2A 4DT4A 2AMDA 1GBAA 1O2HA 1O2KA 4A1TA 1KLJH 4E05H 2ZDMA 1NROH 1UCYH 3F6UH 2VH6A 4OS6A 1TPOA 1UTOA 3K2UA 1S83A 1OWKA 2GZ8A 1Z8GA 2O8TA 1GGDB 1C1QA 1GDUA 3B8JA 1O2LA 1V2PT 1H8DH 2JETC 4ZKSU 2QF4A 3FP8E 3QUMP 3U9AH 1O2XA 5C2ZA 2ANKH 1O2QA 1UCYK 3SV9A 1W14U 3OY6U 1L4ZA 4ISNA 5T6DA 1EZUC 1DANH 2F9OA 3JZ2B 3KQBA
chains in the Genus database with same CATH topology
2BHGA 2OBOA 3SU1A 1OP8A 1F7ZA 1K1NA 1K2I1 1CT4E 1G9IE 1CU1A 1OP0A 4Y0ZE 2CHAB 3P6ZB 1GJ7B 1SGTA 4X6MA 1YPKH 3A84A 4HFPB 2XCNA 5FCKA 3KNXA 1O37A 1UHBA 4UD9H 5DGJA 4B1TA 4O03A 1EASA 1L1GA 4GCHG 1IQFA 1O5FH 1OS8A 8GCHF 1ELGA 1C5SA 1DWBH 3T5FH 1GCDA 1SHHB 4ZROA 2W3IA 1YM0A 3UWIA 1MU6B 3R3GB 1NFWA 1TPAE 2BOHB 2CV3A 2GV7A 2P94A 1O3FA 5IDKA 4BANB 2PR3A 3OSYA 1P2QA 4XBCA 2Y5GA 3SQEE 2W7SA 2BXTH 2BB4A 3F68H 4ESTE 1AWHB 3MNSA 4A1XA 4YO9A 4D9RA 2KAIB 3NUMA 1GBLA 1EAXA 3F1SB 3SJ9A 1TGCA 2FXRA 1TNLA 3MYWA 1ELTA 1P57B 2ZQ2A 1G30B 4QT8C 4ABJA 1EJNA 1S84A 1TBRH 3GCHB 1T8MA 3M3TA 3BN9A 3RM0H 3H5CB 2FYRA 6ESTA 4YT6H 4NSVA 3VXEH 4CH8B 1FQ3A 4VGCB 2FESH 1KTSB 2P3UB 2P8OB 4Y71A 4CR9A 2FM2A 2GP9B 1UTMA 1THSH 2VH0A 4WMEA 1NY22 1KDQA 1QJ1B 5ABWA 4YZUA 3PV4A 4CREA 1FIWA 4B71A 3AAUA 3VGCB 1EJAA 4RKOB 2J4IA 4RKJB 4ZKRU 1BOQA 2QGRA 1AUJA 3URDA 1DWDH 2FP7B 1BDAA 1Z8IB 2QAAA 3EE0B 1IQKA 3MHWU 3TK9A 5A0CA 3RP2A 3ZZ3A 4AORA 2ZCLP 2TGDA 3HPTB 4OS7A 1G2MA 5AF9H 1TA6A 6CHAC 1XM1A 3SV8A 2ZP0H 1S0QA 1XVOA 2ZHQH 1NM6A 1NTPA 3PM3A 4LXBH 4X2VA 2FOMB 3NKKA 4K1EA 4I8KA 1GJ5H 5I25A 2A4RA 1F5LA 4WH6A 5ETXA 4UEHH 3RU4E 5TCCA 2A31A 1DLKB 2XC0A 1TYNA 1JMOH 3SJ8A 1LHGH 3PROA 2LNCA 4J1YA 1LVYA 1O3LA 1MTVA 1AWFH 2PTNA 3STJA 1DXWA 3LPRA 3RXFA 3SV7A 1P9UA 1YPEH 3P8FA 2P3TB 3RXVA 3PMHB 1O5EH 1GGDC 3CS7A 2C8WB 3KGPA 1C5VA 2ASUB 1AVWA 1GBMA 1WOFA 1KXFA 1ZHPA 2BLOA 4DGJA 3M7UA 3ZVGA 2V35A 4D7FA 4K1SA 1P05A 1P12E 3C27B 3RMLH 1GDQA 2GT8A 1MUEB 3GDSA 1IQMA 4AOQA 1MTUA 2NU0E 3CENA 5A8XA 2BD5A 2Z3EA 4GHTA 1CA0B 2I6QA 1KXCA 2G51A 3EA7A 1UVUH 2BX4A 2Y81A 2RA0A 1C4U2 1CVWH 1S6HA 1V2UT 5LH8A 2V6NA 4JYVH 1HXEH 2SGAA 3SHAH 1VCWA 1CA8B 1G36A 3UNSA 1QBNA 1GPZA 3UREA 1NRNH 2LPRA 4K69A 4BXSA 1ARBA 2ZFPH 4WVPE 2VIVA 2C8XB 2HPQH 1VJ9U 1B5GH 2ZCHP 1F0UA 2YNBA 2SFAA 4FVDA 5FBEA 2O8UA 1TA2A 2JH0D 4ZHMU 1P0SH 3FP7E 1C1WH 1QNJA 1D3TB 3GY5A 1A3EH 1ZRKA 1W10U 3A88A 2ODQA 3MH7A 1BTYA 2XBVA 2V0BA 1AKSB 1EQ9A 2OTVA 1QRZA 2VIDA 1GI4A 3GCHC 2PFEA 4NFEA 1ZMLA 3DT0H 1V2NT 1WAYB 2ZHFH 2A1DB 4YOGA 5LPFA 1TONA 3BF6H 1W0YH 4VGCC 4TWYA 1H1BA 5BRRE 1IAUA 1O5GH 2P95A 1EPTA 1ZMNA 7LPRA 4GVUA 1EX3A 3AW1A 9LPRA 4WJG2 4TY7A 4D9QA 4YOJA 3SNEA 1C1MA 1FY3A 4X2XA 3G01A 1C2IA 1ZSKA 2A4GA 3TK5A 1KLTA 2BDHA 4LZ1H 3FVFB 3KQDA 1TRYA 1O2RA 1HJ9A 2HOBA 1O3BA 4YLUA 1A2CH 8KME2 4SGBE 1HBTH 1Q31A 1SGIB 2C8ZB 2NWNA 1L4DA 1YLCA 4XFQA 3BTQE 1NESE 4KTSA 3B9FH 2H5CA 5LPEA 1RFNA 6LPRA 1GI0A 1LVMA 3VB5A 3VB4A 3SU3A 2GTBA 3U8OH 1W3CA 4AFQA 3F9GA 1K1PA 1Y5UT 4KKDA 1C5OH 1N6XA 2XW9A 4ZMAH 4UFDH 1QB9A 1A7SA 3KL6A 1QA0A 1MKXH 1DUEA 2NU3E 2WYJA 3PB1E 3SU2A 4X8UH 2G8TA 4X1PU 1UK3A 1C2KA 1TALA 4B2BA 2CF9H 1IQGA 2A0QB 2FWWA 3UR9A 1P11E 2B0FA 1HJ8A 1GBHA 1P2JA 6GCHF 1ORFA 2R0KA 3UUZA 2G4UA 5GXPA 1GBIA 3GCTG 1MKXK 1BQYA 1HAVA 4JYTA 1TIOA 5A8YA 5L30H 1BJVA 5LGOA 4IBLH 2FDAA 4KP0A 1TX8A 2SNWA 3A82A 1THPB 3MFJA 1V2OT 1C2EA 2B7DH 4XDEA 2PGBB 5EPYA 1QL8A 1IQLA 1ETSH 1P8VC 3RXUA 1ELFA 1GHAF 2YOLA 3UTUH 5C20A 1UTPA 3TU7H 3S9BA 4ISIH 3SNCA 2OBQA 1GBBA 1FNIA 1GBCA 1GVKB 1C4Y2 1NRSH 4O3UA 1BRUP 1FONA 1O2UA 1ACBE 5J4SA 1TBZH 1DY8A 9ESTA 4DY7B 3LIWA 5AVDA 2UUYA 1AI8H 1J16A 1ZMJA 1EB2A 5DJ7A 3M7QA 1TFXA 1OWEA 2QV1A 3KEEA 2HNTE 1MKWH 1TMBH 3QTVH 1NC6A 1BRCE 2EEKA 5FHTA 2BD9A 2GKVE 4Q7YA 5GDSH 1C2JA 5DP6A 1DICA 4NSYA 1SGRE 3BTTE 3ZZCA 4XBDA 1VR1H 2ZHEH 1FLEE 2VIPA 3SU6A 1MTSA 2Z9KA 1PPGE 1MKWK 4RSPA 4CRFA 3VFEA 3A8BA 2Y82A 4NFFA 1MD8A 1Y5AT 4ISLA 5GPIB 2XWBI 2EI8A 3TLOA 3H7TA 2YNAA 2UUFB 1DSTA 2PKAA 2UUKB 2STBE 2RA3A 2XC4A 2RDLA 1OOKB 1EATA 4I8GA 1ANBA 1P01A 4IC5A 1V2KT 3A8DA 1PJPA 1NO9H 2F9BH 2EI7A 3HKIB 3UY9A 2A2QH 3M35A 4TPYA 2XBWA 5GCHF 2GCHF 4YOIA 1AVGH 1FN8A 1SGCA 1A3BH 2AYWA 1V2RT 3VB3A 3PO1B 1YPJH 1PPFE 2G52A 2FS9A 4I33A 2A7CA 1QJ6B 2W3KA 2A5AA 2G4TA 5TJXA 1UK4A 3HATH 3D62A 1EUFA 3FP6E 2ZU4A 1UCYE 4BTIB 2ZDNA 5HXFA 2H5DA 1O2PA 5FX5A 3HGNA 5L2ZH 2K7XA 1ID5H 3ZV8A 1EJMA 1Z7KA 4ZKNU 4TWWA 4WY3A 3DFLA 1ZGVA 1GHBG 4FUIA 1O5CB 1LHFH 3GY3A 2BTCE 1BMMH 1GHZA 1O3AA 1V2MT 1O3NA 1JRSA 1YPLH 4O97A 4KGAA 1XKAC 1GI1A 1XUFA 2Q6FA 1O2MA 2HWLB 3RXQA 5CMXH 3HKJB 3JZ1B 5FX6A 1AMHA 3ZZ9A 1E35B 1D3PB 5E8EH 2J34A 3NZIA 3SN8A 1O3JA 1UTNA 1OWDA 1CHGA 3PMJA 4HGCA 3ATWA 1DOJA 2XYAA 5ESTE 1PQAA 3BTHE 3RXDA 4Y8ZA 1UHBB 1A4WH 1QRWA 4FUGA 4X1NU 1GBTA 1C4V2 1GWAA 2VVCA 4Y79A 1VITG 4X2YA 4IGDA 3EGKH 2ZDAH 1DE7H 3Q3XA 1GI3A 4B73A 5DG6A 4H4FA 3RXMA 3CP7A 2BY9X 2QXGA 5FPYA 2TIOA 2WPLS 4GCHF 2XTTB 3Q76A 1INCA 3UPEA 1UTJA 3QZRA 1OP2A 4K2YA 3A7WA 2AMPA 1ESTA 3GISB 1FXYA 2FOEA 3SOSA 3FFGA 3TGIE 2R2WU 2Z94A 1SGFA 4WWYA 4XBBA 1QB1A 3RXBA 3UNQA 3TPIZ 3MU1A 1E34B 2HALA 1TAWA 2ZC9H 3ENSB 1L1JA 3HK6B 3SHCH 1O31A 3RXEA 2QF3A 3RXKA 5C1UA 1A61H 1MQ6A 2ZDVH 1O3PB 3BTDE 5HM2A 1CHOG 1KSNA 4B76A 4D76A 2IJOB 1TWXB 3BTWE 2R3YA 3M61U 2BD8A 2GMTB 1KDQB 3UFAA 1QQUA 1UO6A 1W11U 2H9TH 3RU4D 3TJOA 4FUEA 3GCNA 1TNJA 1ABJH 4AX9H 1LHDH 3ZYEA 1O2YA 3TVJB 1RD3B 2BQ6B 2IN2A 3NPSA 1C5PA 1EXFA 3TNTA 2BZAA 4H42U 3PO1C 5AFYH 1C5LH 1GBJA 3RMMH 3SGAE 3RXAA 3DHKH 1HAIH 1TNHA 1BUIA 1QCPA 1MCTA 2Z9JA 3RDZA 1GDNA 1GL1A 3RXOA 4CRAA 4MQAA 1WUNH 4MNVA 2A5IA 1RTFB 1N8OC 2G55A 1GI6A 2ALVA 1K1MA 3V3MA 2H6MA 1RIWB 1TMTH 2EC9H 4FUBA 3SV2H 5E0JA 3ZZ5A 3S0NA 3LGIA 4MPUA 3SUEA 5LPRA 3RC4A 1AY6H 4RN6A 1OWJA 4JZ1A 1N6YA 1IQIA 3D65E 5DO4H 2QIQA 2UUJB 4O9VA 1O3IA 5F8ZA 2D26C 2ZTZA 1AD8H 1T8LA 1ZZZA 1XX9A 2CJIA 4X8SH 1O2NA 2FI5E 2VWLA 5GJ4B 1EZSC 5GIBA 1ANDA 1L2EA 1FY1A 1HB0B 1FZZA 4K3JA 3EA9A 1SFIA 3VEQB 1DSUA 5C1YA 2WINI 1AZ8A 4YT7H 5EPNA 1SQOA 2R3UA 4GUXA 1VGCB 1QR3E 4R8TB 2Q6GA 4ASHA 3MH4A 1WYKA 4E7NA 2AERH 3TJUA 2B9LA 2WUBA 3QWCH 3RXHA 5JB8S 1PYTC 2OC8A 1VZQH 4NA8A 2NU4E 3RXGA 3A87A 1UMAH 2CGAA 1O3MA 1TE0A 1FI8A 1DY9A 2QF0A 2SGQE 2FOGA 1HJAB 2WUCA 2XCFA 1YPGH 1GG6B 3LGVA 3ZVFA 1SR5C 1SHYA 5DPAA 1V6DA 3MU8A 4NZQA 3ZZAA 2G5NA 3M36A 3FAOA 4DURA 1ETTH 1E38B 1CT0E 1GMHG 4CH2B 3EA8A 2JH6D 3O8CA 2O8LA 1Z8RA 4CRCA 2FEQH 7KMEH 3SU0A 1QB6A 1QFKH 3RMNH 2AGGX 2F9VA 1UVSH 3U1IB 4NG9H 1NU9A 1IOEA 1O2ZA 2GD4B 5K0HA 1ZR0A 2Y6TA 5DP4A 3ZZDA 5FAHA 4YM9A 1A1RA 3GDUA 4X1SU 1A0HB 5HYOA 1O3HA 4XE4A 1O2VA 4K8BA 3U8RH 1O34A 1EOJA 1GJ4H 2UWLA 3T2NA 1LVBA 1XUGA 1P3CA 2F83A 2PUXB 2CF8H 5BPEA 1JWTA 2HPPH 2GMTC 3QX5H 4D8NA 3A8AA 1V3XA 4ABIA 4FUCA 1MAYA 2FLBH 2ANYA 1GBEA 3MH6A 3K65B 1NT1A 1ARCA 4MG3A 4CRBA 1GVLA 3LJJA 4MNWA 2BDAA 4IS5A 4A1VA 4A7IB 1LCYA 1FJSA 1V2VT 3P95A 1F0TA 2EI6A 2OCVB 2UWOA 1FAXA 2BDYA 5JBTA 3TNSA 1UVOA 1KLIH 4JZIA 4BAHB 1HCGA 1K21H 2ZFRH 2JKHA 2CHAC 4BAKB 1C2MA 2VIWA 2WPIS 1TBQH 4BXWA 1OXGA 1C2LA 3EYDA 1Y5BT 1VJAU 3MO6A 1RIWC 1W12U 2GX4A 3MNBA 3P17H 1ABIH 2ANMH 7GCHG 2ZF0H 3U69H 1JIMA 3DFJA 1GJAB 2V3HH 2CMYA 3D23A 2GGVB 3LT3A 1V2TT 2SGFE 1YCPM 1NPMA 2BQ7B 1T8OA 2AGEX 8LPRA 4JK6A 2VWMA 3A7XA 2XRCA 1ZJKA 3QTOH 1O2TA 5EQSA 4DG4A 1C1NA 4FUFA 2GZ9A 3ZVAA 1C1RA 3SUFA 2DE9A 5AFZH 2FOHA 2BQWB 1D3QB 1XUJA 1O39A 2J2UA 1S6FA 2WV5A 3Q3YA 2ULLA 4FUHA 4ABBA 3ZVEA 4CR5A 1HAVB 2W7UA 4ISOA 2BLQA 1O33A 5FXLA 2XBXA 1HAGE 3ZZ6A 1IQJA 3K6YA 1C1SA 1LMWB 5C1XA 1K22H 4AGKA 2A32A 1RTKA 1HUTH 1VGCC 1WCZA 2I6SA 4Y76A 1AUTC 1ZYOA 1FN6A 1XUHA 3W94A 4THNH 1FV9A 1V2JT 2FOAA 1QURH 2FX6A 3Q3KA 2V3OH 3GCTF 2ZU5A 2P8OC 4U30A 1QRXA 2D2DA 1EAUA 1F2SE 1MMJN 2Z3CA 1GCTB 4K1TA 1HAPH 1LPZB 5JPMH 4X1RU 1QQ4A 4CRGA 3PTNA 1UVPA 3AW0A 1F0RA 1O2SA 3RXIA 5CE1A 3PWCA 3VGCC 2QXIA 3N7OA 2BD7A 3SGQE 4MTBA 1BTPA 3SO3A 3MO3A 3NK8A 1F5RA 1GMCF 2OUAA 1E37B 1E36B 2ZPQA 3BEIB 3ATKA 2F9NA 3M5MA 1H8IH 3M5NA 3ZVBA 1KYNA 4X1QU 1SG8B 1FY5A 1C2FA 5DP8A 4ZXYH 1Z6JH 3ATIA 3L3TA 4FXGH 3P8OA 1BHXF 3BTGE 2PWXA 1EP5A 1GVZA 4FUDA 4KELA 4Y11E 5DK1A 1SOZA 5J4QA 1W7GH 4X6PA 1RRKA 3IITA 3IG6B 1GMDG 2Q6DA 2A2XH 4MVNA 1UK2A 3GYMA 3RC5A 3UQOA 1RXPA 3DD2H 1TQ0B 2H9HA 1THRH 1WQVH 4NWLA 1ELAA 3T29A 1F5KU 4ZKOU 1Y3XA 5B6OA 3ODFA 3T28A 1HAXB 1MZAA 3UWJH 4GAWA 1JIRA 1TNGA 4F4OC 4AB8A 2WV4A 5FCRA 4ABHA 1KTTB 2PSXA 3GY8A