2Z3DA

A mechanistic view of enzyme inhibition and peptide hydrolysis in the active site of the sars-cov 3c-like peptidase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab (pp1ab)
publication title A mechanistic view of enzyme inhibition and peptide hydrolysis in the active site of the SARS-CoV 3C-like peptidase
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 88
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z3dA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z3dA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z3dA02
2W5EA 3RXEA 1CQQA 4A6LA 1TQ0B 3ZVFA 3V3MA 1SGFA 1HAIH 1EP6A 1K1LA 4YTAA 3VB7A 5H4IB 1TB6H 1N8OC 1PPZA 1OWKA 4LZ1H 1BB0B 4JK6A 5A8XA 1O2PA 4ABGA 4IN2A 4OGYA 1BTXA 3C27B 1OYTH 2BZ6H 1V2LT 1CA0C 2EI8A 3FVFB 2PGQB 1SQTA 5DP4A 4I8KA 3ATIA 1T8NA 1O31A 1O3MA 2ZHDA 3BN9A 1TGNA 1VITH 4DVAU 3RU4D 1DOJA 4FUBA 3GCTF 1AUTC 1RIWC 3BEFB 5F8XA 2AMPA 1ETSH 1GHWH 2ZNKH 3RDZA 2VH0A 2VIVA 1NU7B 3MO3A 3M5MA 2Z6BD 9ESTA 1HIAA 3M3SA 1C4Y2 3I29A 1O2QA 2BYAX 1ANCA 2AYWA 1LMWB 5DP8A 1C5LH 1EAXA 4NIYA 3SNBA 5E0GA 1UK3A 4JZDH 1BRCE 1B7XB 4TWWA 1AI8H 3T2NA 4BTIB 3ATLA 1B5GH 4U30A 5DG6A 2XYAA 3RXRA 2Z9GA 1O2TA 2FS9A 1SOZA 1FY5A 3TK6A 3UUZA 3ZZ7A 1GI6A 3NUMA 1O2NA 2FX4A 2UUKB 3SI3H 1IQIA 1KLJH 1ELEE 2WUBA 3ENSB 1YF4A 2BLQA 1QBOA 1WOFA 1AKSA 3LIWA 1HAVA 1T8OA 1TGTA 5L2ZH 1F5RA 1YGCH 4I8HA 4H4FA 5J4QA 5B6OA 3RXFA 1PPCE 4O3TA 1QJ7B 1P2MA 1C5VA 3BEUA 1O0DH 2OQUA 4F4OC 1PPEE 1E36B 2O8WA 5FPSA 4B2BA 3VXFH 1ZGVA 1DLKB 1KXDA 1C1PA 1KIGH 1TBQH 1LQDB 4MPWA 1Z71A 1AGJA 1UK4A 3MU8A 2ZIQH 4FUCA 3SU4A 2NU4E 2JETC 4XBDA 2GDDA 1HLTH 1HB0B 2C8WB 2ZU1A 1KXAA 2C3SA 3M5LA 1P0SH 1TALA 1YPEH 4K8YA 2ZCLP 1DE7H 1QB9A 1C1SA 1GJ5H 5EOKA 3RXVA 1K1OA 1KDQA 4UFGH 3TJUA 4BTTB 4DW2U 4GCHG 1OWJA 3R0FA 4FU7A 1NC6A 3LGWA 3VB3A 3UTUH 4YESB 1ZPZA 4Y7AA 4DGJA 2Q6FA 4CRAA 3HK6B 1HCGA 3A7WA 1P8VC 4JZIA 1T8MA 1P2JA 1D3DB 3DT0H 1G36A 3A7ZA 1V2ST 3LT3A 3GY4A 1IHSH 1YM0A 2BDBA 1DSTA 2EC9H 3QTVH 4DIHH 3PYHA 4AB8A 3N7OA 2A5AA 1HAZB 4ISOA 1LHGH 2GDEH 3L6PA 4ZKRU 2FOHA 1H9IE 3NZIA 1NU9A 1IQGA 1Z8GA 2BMGB 3MMGA 1K28D 3FFGA 3KQEA 3P17H 3T27A 1VGCB 1FAXA 1FQ3A 2F9NA 2ZPRA 4H6SB 1ESBA 1KTSB 1MTWA 4Y10E 3U9AH 2XBWA 1L1JA 4YOGA 1NRPH 2RA0A 3OSYA 1SBWA 1DUEA 1BMAA 2Z9KA 1YLCA 2AGIX 5GCHF 3SU1A 1Q2WA 2IJOB 1XUHA 4WWYA 4X1SU 1F0TA 1XKAC 4BNRA 3F6UH 4WH6A 3KHVA 1O2HA 1KTTB 2Y81A 1FPHH 1TQ7B 3A87A 1C2EA 3DFLA 2ANYA 1MAXA 4JYVH 1DLEA 2PW8H 4YOJA 3GDUA 3TGKE 2A31A 1DWBH 3UFAA 3BTKE 1PJPA 1ZRKA 2FOFA 2GD4B 2XC5A 1TMUH 1SOTA 3HGNA 3S7KB 1TNLA 3MNCA 2LNCA 3SV6A 4JCNA 1HGTH 2A1DB 3A8AA 5C3NA 1ZHPA 4DY7B 4XSKU 2ULLA 1JIMA 1XX9A 2CJIA 2FOMB 4XFQA 1HJAC 1VR1H 3GY5A 4I8GA 2JKHA 3CP7A 1QRWA 2ZGXH 4ZUHA 1HAOH 2QIQA 3ZYEA 1O2RA 1TOCB 1THSH 1S6FA 1LPZB 3F9FA 2FYRA 5AVDA 1GHBF 2XXLA 1O3FA 3SJ9A 3OX7U 2P8OB 2FOGA 2XRCA 3P8GA 2CHAB 3IITA 5DP3A 1O3PB 1MTNC 1IOEA 1TPOA 2BDAA 4RKOB 3SZNA 1DM4B 1SGTA 1BMLA 4Y0ZE 1TA2A 2BD8A 3OY6U 3M36A 1O5CB 1JRTA 1C2JA 1QTFA 4MVNA 1EASA 3M7QA 2BXUH 4INLA 2ZC9H 3QLPH 2VIPA 4KTSA 1DY9A 3SU2A 1QL8A 2VIWA 4B76A 1V2RT 4JK5A 1GL1A 1ZMNA 1GPZA 4UFFH 2XNIA 2ZDAH 1YCPK 4YO9A 1ZTKA 3ZV9A 5EQSA 1S6HA 1AVXA 1GDQA 2BDCA 4ABEA 3ZVCA 3M3TA 1O37A 3WY8A 1A3EH 3RXTA 3MFJA 3LGIA 2HGTH 3MH4A 2UWOA 1TX8A 1GMCG 2FMJA 4CRGA 5IDKA 1BTPA 1T31A 5TJXA 4ZXXH 1CGIE 1HJAB 1EAIA 3SV9A 4AG1A 1OWHA 1V2UT 3M37A 1S81A 1YPMH 1TOMH 2BQ6B 3RLYH 3QZRA 1EZXC 1KYNA 1KY9A 1SR5C 1HDTH 4UDWH 3BTDE 1TPSA 3M7UA 4KGAA 2BD5A 3ZZCA 2ZFSA 3RU4E 2ZTYA 4JZEH 1O3KA 3A7TA 1GI5A 1PPHE 2JH0D 7GCHG 1AIXH 1SGFG 1HRTH 1Z8RA 4AB9A 5DP6A 2PR3A 2R0LA 3TGIE 1O5BB 1XXFA 1C5PA 3SJIA 1LVYA 1C5SA 4YOIA 1ID5H 1MD7A 2W26A 5F8TA 3TJVA 1BMNH 2TGDA 4RKJB 1SI5H 3DD2H 4KTCA 6LPRA 1INCA 1KLIH 1ANEA 1YLDA 2ZPSA 1V2MT 4GPGA 5GXPA 2GMTB 1ETRH 1FONA 1LPKB 1QL9A 3B9FH 1J15A 1C5YB 2JH5D 1YYY1 5FCRA 2O8LA 3BF6H 3MTYA 1VCPA 4NG9H 5JBBS 1O2XA 1BRAA 1AMHA 1P3CA 1P12E 1GI1A 1T4VH 5A8YA 1XXDA 1ELCA 3O8DA 1YCPM 1UO6A 1AVWA 5FXLA 1YPHE 3BV9B 2J9NA 1P9SA 3U98H 1V2KT 2XTTB 5JB9S 1H8DH 4LXBH 1UTOA 4ABBA 1ELVA 3NK8A 1EPTB 1SSXA 1C9TA 4AGKA 1GMHG 1AE8H 3HATH 4K1SA 3T28A 1GCTC 1O2KA 2V3HH 2BXTH 3A81A 1O5AB 1P05A 3S69A 5CMXH 2PSXA 1A2CH 1O34A 1SG8B 4VGCB 1BHXB 2BOHB 1FIWA 3LH3A 2A4QA 2P94A 3LGYA 4CREA 2NU0E 1BBRH 1L2EA 1BTYA 2VINA 4ZKOU 1FXYA 3RUOA 4MDSA 1LCYA 1P2KA 5SGAE 3QGJA 1O3EA 1TPPA 1L1GA 4O03A 1MZAA 2ZGBH 4AZ2B 4MPXA 3LGVA 1P04A 3TNTA 4GHQA 1CHOG 1C4V2 4IGDA 3D65E 2CF8H 1S84A 1C2GA 3ODFA 2P3UB 3STJA 1AHTH 1FPCH 2GKVE 3BG4C 1XVMA 1ZOMA 2BTCE 1G3BA 1PQ8A 4U32A 1F0UA 3E8LA 3RM2H 1C5MD 1P01A 5F8ZA 1NO9H 1L4ZA 2GZ7A 1RJXB 1SGQE 3T29A 2XC4A 4GHTA 1GJDB 3QWCH 2FPZA 1LQEA 2Z9IA 1G9IE 4IMZA 5I25A 4FVBA 5BRRE 3E0NB 1P9UA 2Y5HA 3LH1A 2WPKS 1LVOA 3F1SB 1GJ7B 1RTLA 1QURH 1O2JA 4NFFA 1ZMJA 3D49H 1C1MA 1GVKB 5T3HA 1DWCH 4AFZA 3ZZBA 5A0CA 1AB9B 1H8IH 2HNTF 4FUIA 4D7FA 3ZZAA 5LPRA 1SLUB 2AERH 1FUJA 2W3IA 4AYYB 2XBVA 1B0FA 1C1RA 1O3HA 3MNSA 3FZDA 3U69H 4BXWA 3UNSA 1G2MA 5ETXA 2SGEE 1ZR0A 2B5TB 4RN6A 5DPAA 3A8DA 3ZV8A 2VWNA 2BQWB 3QUMP 3ZVDA 1TBRH 2VB0A 1IHTH 5EXNA 2ZU3A 3NWUA 1JIRA 2QF0A 2Z7FE 3SU5A 1O5FH 3UNQA 2C8XB 4JYUH 3PTBA 1A5IA 1WAYB 1GDUA 1QRXA 2THFB 3B8JA 3T5FH 1OP0A 3RXKA 1ELTA 2Y7ZA 4AYVB 2H9EH 4NA9H 3BTTE 3V0XA 1UTJA 1W13U 2XW9A 1O3OA 3MO6A 5CHAC 1F92A 2H5DA 3ATMA 3SJOA 4Y11E 2FOEA 3F68H 3AAUA 1K1PA 1JXPA 1QY6A 1MU8B 1TA6A 3SUFA 5AFZH 4CRBA 3LPRA 3NKKA 5CE1A 3UPEA 1VJAU 3JZ2B 1KXBA 2GVFA 1QL7A 3LONA 2UUJB 2RG3A 1FY4A 2OP9A 3T25A 3TH2H 3A89A 7ESTE 4K60A 3K6ZA 3G01A 1RFNA 1P09A 4K2YA 1O2UA 1W0YH 2FYQA 1ZYOA 5K7RA 5EPYA 2DUCA 2TGTA 1T8LA 2GV7A 2NU2E 1QJ1B 1GJCB 2GCTB 1ACBE 1ZTLA 3P70B 1NPMA 2O8UA 3BG8A 3Q00A 1Z1IA 3SGAE 8KME2 5LH8A 1C5OH 1EZQA 2ZTZA 3A83A 3BTME 3GY2A 4H6TA 2G4TA 3ZZ9A 1O3JA 2QCYA 4O3UA 3P8FA 2ZWLH 2GT7A 1F5LA 1BIOA 2WPLS 2BDGA 4I8LA 1QCPA 1Q3XA 2OQ5A 4GUXA 1C1NA 1AQ7A 1GBLA 3MU1A 4X8UH 5HMAA 1BTZA 1C4U2 5EXLA 1YPJH 2BHGA 4FVDA 2FLBH 3V7TA 4J1YA 4CHAC 3GDVA 1O3CA 4JYTA 1OPHB 1GBIA 1AWFH 2P3FH 1C9PA 4XBBA 1GG6C 4X0WU 1YPHC 4B1TA 2HLCA 1EQ9A 1O2YA 1P2QA 2ZFPH 4WVPE 1IQKA 1SGEE 4BAOB 1IQJA 2PWXA 4R0IA 4WXVA 4Z0KA 1HV7A 1A46H 2VGCB 1QNJA 2ZKSA 1HBTH 2XWBI 1GGDC 2EI7A 3KL6A 2SGQE 4IC5A 2ZP0H 1LHDH 1J8AA 2QAAA 4Y7BA 1NM6A 2ALPA 4IBLH 3BTFE 4FUHA 1GBMA 2CXVA 3BTWE 3TLOA 2I6SA 2AMQA 1BBRE 1PQ5A 3K6YA 3GCOA 3HK3B 1RS0A 5C2ZA 3MWIU 4NIWA 1T7CA 1FDPA 4MNWA 1RGQA 4Y8YA 2ZGHA 5EQQA 1MAYA 3R3GB 1C2FA 1N8OB 2ZPQA 3A7VA 1LHFH 3HPTB 2Z3DA 2D1JA 2BDHA 1AE5A 1TRYA 2ILNA 4INKA 2YNAA 4HZHA 2D2DA 3NCLA 1K2I1 5DP9A 3SGBE 1CA0B 4HGCA 3SNCA 1WCZA 2WPHS 4AGJA 5GJ4B 3E3TA 3A85A 3S9CA 3UQVA 2QXHA 4DG4A 1L0ZA 3SQEE 4WMFA 1RIWB 4WJG2 3P95A 5E0HA 3KF2A 3GYLB 2Q6DA 4X8SH 1VITG 3ZZ8A 1D6WA 1ARCA 5T6FA 1W2KH 4DT7B 1PPBH 2RA3A 5F6MA 1EX3A 3SU3A 3LJJA 3MH6A 3Q3KA 1AFQC 3FP7E 1YPGH 3LU9B 3L33A 1CE5A 2FI5E 1NFWA 2P93A 5FHTA 4B71A 1BTUA 3PMBB 1C2MA 1ZMLA 3E1XB 4DIIH 1CT2E 3PWBA 1MBMA 1SQAA 3SUEA 1SLWB 2OXSA 5EW1H 1GHAG 1NROH 4Q7YA 3NPSA 2NU3E 3SI4H 1MH0A 3PMJA 5FBIA 2AMDA 1GJBB 3A8CA 4UFDH 1PPGE 2STBE 4BOHA 4CRCA 3W95A 3FP6E 1NT1A 5JBTA 1V6DA 2PUQH 1XKBC 4B73A 1AVGH 1YP9A 1J17T 1CU1A 1LHCH 3MOCA 2BB4A 1CHGA 2OC8A 2SGFE 1EXFA 2Y7XA 3BEIB 3V13A 3K2UA 1SLVB 2GP9B 2VIOA 1K1MA 2G52A 1IQNA 1D3PB 2PFEA 1MKWH 2AFQB 3RXHA 4FUFA 1Z1JA 2EA3A 4X2XA 1Z7KA 1MUEB 5FX6A 4I7YH 3DHKH 4BAHB 1AWHB 3A88A 2GV6A 4FUJA 4B2CA 2JETB 3BSQA 1AFEH 1IQFA 1EJAA 2PHBA 1SLXB 1TABE 4KTUA 3QN7A 1O2OA 1K1NA 1SQOA 1BA8B 1NFYA 3GY6A 4K69A 2J38A 3PMAB 3MHWU 4THNH 3EA9A 4NZQA 1LKAA 1QA7A 2BZAA 1WU1A 1EP5A 1WQSA 4I8JA 1BBRK 1A7SA 2PUXB 4ZMAH 4E06H 1HAGE 2ZFRH 1O3IA 2QA9E 1WV7H 3EA8A 1J14A 3UNRA 2P3TB 2W7SA 1W10U 3GY3A 1JWTA 3LDXH 2NWNA 1GWAA 4FU9A 3SNDA 4BAKB 1UTQA 3A84A 6GCHG 2BY6X 5EG4A 1THPB 2A2XH 3RLWH 1A0LA 4Z6AH 2BDIA 5EU8A 2F9OA 2F91A 5FCKA 4I32A 4UEHH 1GMDG 4XDEA 1S83A 1P10A 2WINI 1O3GA 1ELGA 4ABDA 4AFUA 1HIAB 3A7XA 2WPIS 1TNKA 1GBKA 3PLKA 1ZPBA 1H1BA 3GOVB 1W0ZU 5A0AE 3FZZA 1GI2A 1ELBA 2M5TA 4SGAE 1UHBA 2Y82A 1UTPA 2YNBA 1NN6A 3SU0A 1P02A 1MKXH 1FY3A 1Z6JH 4YT7H 1O5DH 5PTPA 3RMOH 3AASA 1GI9B 4NWLA 4IN1A 1HJ9A 2R0KA 1GBHA 3ATKA 3KIDU 1GHXH 4O97A 1P03A 2A4RA 1BQYA 5EXMA 5E2OA 1BTHH 1Y3UA 2Z9LA 4FU8A 4NSVA 1ANBA 3SN8A 3C1KA 1OS8A 2BD9A 3SNAA 4X1QU 1BT7A 2OUAA 1N1LA 1P2NA 1XMNB 2Y80A 1HXFH 1DX5M 1EOJA 3AAVA 9LPRA 3F9GA 1FNIA 1QB6A 4DOQA 2AGEX 4GVUA 5ESTE 1C1OA 3P92A 1VZQH 4YT6H 1GMHF 3S7HB 3PTNA 4AORA 1DITH 3EDXB 1GHVH 1ZHMA 3ZYDA 2EEKA 2KAIB 1Y3VA 2H2ZA 3O8CA 3KQBA 2ZCHP 1WTHD 1O2IA 1MTNB 1F5KU 4FUEA 3GY8A 1UTMA 1O38A 3RMMH 1BDAA 2ZDKA 2W7UA 2ZF0H 4CBOA 1P06A 3QX5H 4XE4A 4PROA 2BY5X 1GHBG 1O2WA 2ZDVH 3VPKA 1P2OA 3H7OA 1BCUH 4B75A 2NU1E 5FPTA 3VGCC 4I31A 1FAKH 3UR9A 1BITA 2A2QH 3LKWA 1OP2A 2D8WA 1SHYA 3SGQE 3PO1C 3SV7A 3FANA 8ESTE 1UVPA 1FI8A 2O8MA 1DANH 1NFUA 2H6MA 2GTBA 3TIUA 1QJ6B 2ALVA 4X6NA 2XBYA 2FTMA 3EQ0H 5IYTA 2QXJA 4ISLA 1RD3B 1W11U 1Z6EA 1SGNE 5A2MH 4UFEH 1EAUA 2QYIA 1IQHA 2A4OA 1MTUA 2ASUB 2HRVA 3JZ1B 1HFDA 1QQ4A 2VVCA 2ZDLA 3E6PH 1CO7E 3GCHB 3TVJB 1IQMA 1MMJN 2JH6D 5LPFA 1ZRBA 2FS8A 4CR9A 1W3CA 4NGAH 4LOYH 1FN8A 1QFKH 4OS2A 4AFQA 1NY22 1VCQA 4XBCA 8GCHG 1D3QB 1V2NT 1CA8B 3FP8E 3O8BA 1GBBA 1TWXB 2Y5GA 3A8BA 3QZQA 1AD8H 1D4PB 4TPYA 1CT0E 2HWLB 4ABJA 1G3EA 1BZXE 4LK4A 3ZZ4A 5DJ7A 4X2WA 1J16A 1GI0A 3VB6A 4NWKA 3M5OA 1UCYH 2PKAB 1LKBA 2GZ9A 2YOLA 2ZHQH 2F9UA 4ABFA 5EW2H 1TBZH 1QB1A 3TK9A 5DK1A 1P2IA 2TBSA 4OS1A 1EB2A 3VGCB 2ZO3H 4INHA 1GJ6A 2XBXA 3SBKA 2PTNA 3LJOA 4AFSA 1O2GH 3LGTA 1HAXB 2BY7X 1A1RA 4ZH8A 3TH3H 1FLEE 2FWWA 1AY6H 3GICB 4WF8A 1FY1A 1TPAE 1BUIA 1QHRB 2HOBA 2BM2A 3ODDA 1KXEA 5G4BA 2Y5FA 1V2WT 1TNGA 1UVUH 2ZHWH 2SNWA 5JPMH 2FDAA 4E7NA 2FI4E 4WMEA 3RC6A 1BHXF 2OBOA 3ZZ3A 1C5RA 4Y8ZA 5I46H 1HPGA 1CBWC 1GJ9B 3RP2A 1GJ4H 2STAE 2CF9H 1W7GH 4E7RG 2AGGX 2R9PA 2QV1A 1GCTB 2C8ZB 2ZFQH 3RXJA 1ZGIA 1M9UA 1FIZA 2QC2A 3RXIA 1LVBA 3TITA 2ANKH 5K0HA 2R3YA 4BXSA 2BVRH 1H4WA 4B2AA 1EUFA 4M7GA 4X6PA 2FIRH 4KKDA 3UREA 3PLPA 5JBCS 3MU4A 1AN1E 2B9LA 1T32A 5C5NA 1GI4A 2BD4A 1TONA 2GCHG 3ESTA 1ZTJA 2C90B 1SHHB 1Y3XA 3GCHC 5HXFA 1YCPH 1P11E 4IMQA 2J34A 1XUJA 1C5WB 1OWIA 1XVOA 2ZFTA 3SO3A 3URCA 2ZCKP 3PROA 3U8OH 1NTPA 3GY7A 5HGGA 1C2LA 3GYMA 2VWLA 4Y79A 4WH8A 3BG4B 3QK1A 1UTLM 2PSYA 1DSUA 4O9VA 2ZG0H 1S0RA 2J92A 1SL3A 1NS3A 1H9LB 2F83A 5ABWA 4FUDA 3U8RH 7LPRA 2ZECA 2IN2A 1F2SE 1OXGA 3VEQB 2AEIH 1SB1H 3MU5A 5E0JA 2QN5T 1MKWK 6CHAC 3TK5A 2QF3A 4NA8A 4TY6A 5GWZA 3VB5A 1IQLA 2ZGJA 2Y6TA 4D9RA 3U1IB 2F9VA 6ESTA 1O2ZA 3AW0A 3UWJH 2OC0A 3ATWA 4DURA 1DT2A 1LPGB 1GBJA 2G81E 2IPHA 3HGPA 2PKSC 3V12A 2TGAA 2AS9A 2AIPA 1J9CH 4A1TA 3PWCA 1D3TB 1OX1A 4ABHA 2PLXA 3D23A 1THRH 2ESTE 2J2UA 4D9QA 4Y0YE 1QBVH 4Q7XA 2CMYA 3VFEA 3KNXA 1QQUA 2G5NA 3I78A 1GHZA 3Q3YA 4MNYA 1O3LA 2BX3A 5DO4H 1PQAA 1ZZZA 1YPLH 2TPIZ 1TX6A 1DS2E 3FAOA 3S0NA 4D7GA 1GBFA 4IW4E 1V3XA 3RC5A 4ESTE 1DICA 3RU4T 2BY9X 1G37A 2ODYB 2XC0A 1MTVA 1BTWA 2UUYA 3MYWA 3E91A 2P59A 3SUDA 2VIDA 4IS5A 2FTLE 1TGSZ 3SU6A 3ZVAA 3BIUH 4ZXYH 1VITF 1N6XA 5CHAB 4CH2B 2Z3EA 3EE0B 1NRSH 1OP8A 2FOCA 3RMLH 5C1UA 2B8OH 4ISNA 4HFPB 2XCFA 3TGJE 3OY5U 5L30H 1RXPA 2ZQ2A 2TIOA 2H5CA 2WPMS 1O33A 1NFXA 1SMFE 1MCVA 3VB4A 4GCHF 4BAQB 3L3TA 6CHAB 1A5GH 3SOSA 5DGJA 3BTHE 3K9XB 2FESH 1L4DA 5HM9A 3LC3A 2SFAA 3H5CB 3KGPA 1GHAF 2F9BH 4YLQH 1DVAH 1MKXK 2TGPZ 3T26A 1U6QA 2PKSB 4J2YB 1FV9A 4NA7A 5E8EH 3KEEA 5AFYH 1N6YA 2VH6A 1ELDE 1MCTA 2BOKA 4WMDA 4Q2KA 4ZKNU 3TU7H 1UCYE 2ZA5A 1UVSH 4GAWA 2P95A 5TCAA 4K8BA 1TNJA 2ZI2H 3PLBA 1GJAB 2CV3A 3U1JB 2VU8E 1KXFA 1DUAA 1SGRE 2C93B 3M61U 4NCYA 1GI8B 3CS7A 2BQ7B 4ISIH 1C2KA 2Z9JA 1HAYB 3RXSA 3U8TH 2FX6A 5FX5A 4CHAB 1E0FD 1C1TA 2ZU4A 2PGBB 3MNXA 1FMGA 4A1XA 4TYDA 1W14U 1O3BA 1JMOH 1GG6B 1X7AC 1Y5BT 3TH4H 3KQCA 4YZUA 1Z8IB 5FBEA 1VGCC 3GDSA 2SNVA 4H42U 1SGIB 2EI6A 1UTKA 1UTNA 3TJOA 4BTUB 3DFJA 5GPIB 1ANDA 3MH5A 4ZHAA 2VVUA 5TCCA 5C5OA 4YLUA 2BVSH 2ZDMA 4GLYA 1DXPA 3GCTG 1K9OE 2QGRA 3SJKA 4QT8C 5JB8S 3PV4A 2A45B 2LIZA 1VCWA 3ZVEA 1GGDB 1LHEH 1ABJH 4OS7A 2ZZUH 2Q6GA 1GBEA 3SNEA 1G32B 2KAIA 2ZGCA 2BX4A 1C1UH 5AHGH 4HTCH 8LPRA 2ZTXA 1C1WH 2OLGA 3SHAH 4LZ4B 4X1NU 1GVZA 2A32A 1CGHA 4ZHMU 1ZSJA 6GCHF 1LDTT 1GI3A 2FZZA 3QGNB 1SVPA 2HNTE 4ZROA 2QXGA 2IOTA 1E34B 1GMDF 2VJ1A 5GIBA 1W7XH 3F9EA 1WBGB 3EBNA 1SPJA 1OSSA 2G51A 4E05H 4OS4A 2FO9A 5DP5A 3BTQE 3PM3A 3LGUA 2Z3CA 4U01A 3ELAH 3SORA 1VJ9U 2CN0H 1NRQH 1DDJA 1OWEA 4ZKSU 4K5ZA 1EJNA 2J4IA 4NFEA 1K1IA 2K1QA 2BLWA 2SGAA 2DE9A 4AN7A 1S85A 1H9HE 5EQRA 2BD2A 2QY0B 3LC5A 1TNHA 2OBQA 1C1QA 4OGXA 3URDA 4D8NA 4JZ1A 1DFPA 1CT4E 2P8OC 3RXCA 1AFQB 1PYTC 1MQ5A 2CHAC 1QBNA 3A7YA 1XUIA 1QA0A 4X2VA 4NSYA 2G5VA 1SC8U 1Q31A 5EGMA 1QGFA 2ZQ1A 4A92A 2VWOA 1K21H 1EPTA 3RXOA 1V2TT 1WTGH 2G55A 1IQEA 2DE8A 5C20A 1B0EA 1PQ7A 2PV9B 1ESAA 5EODA 1ZSKA 3RXPA 3RXLA 1XM1A 2ZHEH 1F0RA 1QRZA 3RXBA 1UCYK 4U2WA 1SFQB 2HVXA 3RXMA 1FN6A 1GMCF 4MNVA 1O30A 1SGDE 1TNIA 3S9AA 1O2MA 2I6QA 1NRRH 2A7CA 1ZJKA 1QR3E 2Q1JA 4Y8XA 4NZLA 3SV8A 4KELA 1TYNA 1BMMH 1EZSC 2AH4X 3RC4A 4I33A 4XOJA 1PYTD 4MPUA 2PKAA 1RRKA 2OC1A 2FLRH 1Y5UT 3IWMA 1EATA 2A4GA 3PB1E 3SQHE 1A4WH 4TPIZ 5A8ZA 1O2VA 1TMTH 3RXAA 3GCNA 4ISHH 2BY8X 1YBWA 2V0BA 5LPEA 2LPRA 7GCHF 3EA7A 1DPOA 1BJUA 2H9HA 1WUNH 1CSOE 3BTGE 1K1JA 4K1EA 4TWYA 3TNSA 1G2LA 3LOXA 1YC0A 2WV4A 1A5HA 1C5UA 1TGCA 1F0SA 1UVTH 1G3DA 1FJSA 5E2PA 4UONA 4K1TA 1W8BH 3AVZA 2VNTA 1P3EA 4B74A 1TE0A 1UVOA 2FI3E 3TPIZ 1D6RA 1FZZA 1GBCA 1C5ZB 1WSSH 1O2LA 1UK2A 1AKSB 3S9BA 1HAVB 5GCHG 4CH8B 1MZDA 1XUFA 1V2OT 1GHYH 4X1PU 5JBAS 1GBAA 1AU8A 1E37B 1O3AA 2GMTC 4MPVA 1OWDA 2A0QB 3H7TA 2BD7A 3E0PB 2CGAA 2UUFB 3Q3XA 4X2YA 4Y71A 1F7ZA 3W94A 4TY7A 1S5SA 4Y6DA 1SGCA 1LTOA 3HKIB 1GJ8B 2FXRA 1MU6B 3IG6B 3AW1A 3K65B 1V2QT 3RXUA 4ZAEA 2ZU2A 3ZZDA 5JDUB 3ZZ6A 1AO5A 3ZVGA 2AIQA 1HYLA 1V2VT 8GCHF 2K7XA 2ZDNA 1TLDA 4ZHLU 1MBQA 1K22H 1KLTA 3RMNH 1KDQB 1TRMA 3P8NA 1MQ6A 1EPTC 3MH7A 3VXEH 2WPJS 2ZFFH 5JYIA 4WXIA 4CBNA 3CENA 4BANB 4MTBA 1XUKA 1TIOA 2H1UA 4VGCC 2V35A 3BIVH 3T62A 4HI3A 2BD3A 1D9IA 4FUGA 4CRDA 5C1XA 5C67A 1RTFB 1ZJDA 4AX9H 5C1YA 1W12U 2FOBA 3SUGA 2OINA 1CHOF 3OU0A 3HKJB 1LO6A 2O8TA 5AF9H 2G4UA 1BJVA 1EKBB 1TFXA 3M5NA 1PFXC 2WYJA 1HUTH 4MG3A 2GGVB 3Q76A 1GL0E 1WYKA 2D26C 2RDLA 3A82A 4F49A 4ABIA 5L6NH 3ITIA 2FP7B 3SHCH 2OTVA 1GBDA 1O5GH 2G8TA 4X6MA 4GSOA 2V6NA 1OYQA 1CGJE 2HNTC 1C5NH 1A61H 5ESBA 3A80A 4BAMB 1G30B 3UIRA 2A5IA 3UR6A 1TAWA 2ANWA 2BDYA 3MI4A 4R8TB 2F3CE 3M7TA 1C5QA 3UY9A 2SGPE 2GZ8A 3QO6A 2HALA 5HYOA 3OYPA 2XCNA 2ODPA 2XWAA 4X6OA 1WQVH 2WYGA 5A0BA 1LVMA 4X8VH 3UOUA 2SGDE 3F9HA 1EB1H 1ELFA 5J4SA 1KXCA 3RXQA 1Z8JB 4WY3A 1L1NA 1PPFE 5EPNA 2A7JA 3E16B 4DCDA 4A7IB 2C4FH 1BOQA 1ZSLA 5F03A 1C2DA 3QDZB 1V2JT 3Q77A 3KQDA 1C2IA 3EYDA 1DWEH 4ABAA 1EJMA 2P16A 1ABIH 2GCHF 2PTCE 4K3JA 1HNEE 1Y59T 4CR5A 4X8TH 4SGBE 2VIQA 4MQAA 5A09A 1AB9C 1SFIA 1FY8E 4Q7ZA 3PO1B 3DA9B 4MLFB 1RTKA 4D76A 5L2YH 1NRNH 1E35B 4A5TS 1AUJA 5DKMA 2J95A 2WV5A 1OKXA 4NIVA 3NXPA 1NZQH 2J94A 2GT8A 3MO9A 1O39A 1Y3YA 4OS5A 1T4UH 1DY8A 2A7HA 1ETTH 1QIXB 2OC7A 2C8YB 2R2MB 1UHBB 1AZZA 1ELAA 4RSPA 1C5XB 1C2HA 1ZLRA 1JRSA 3P8OA 5FPYA 2WUCA 3STIA 1DWDH 1TX7A 2O9QA 2GX4A 3CS0A 5GDSH 1G3CA 2UWLA 3PMHB 5HM2A 1V2PT 3I77A 1ARBA 1GBTA 2B7DH 3B23B 1JBUH 1NESE 2FOAA 1HAPH 2ANMH 2ODQA 5T6GA 3QTOH 4FXGH 4AG2A 1SGPE 2W3KA 1Y3WA 7KMEH 1A0HB 2VVVA 3KCGH 1HAHH 3RM0H 1EOLA 1O3DA 1TGBA 1ORFA 1ESTA 1TMBH 1ZHRA 2VWMA 1O36A 2R2WU 1GVLA 4UE7H 3ZVBA 3GISB 1UMAH 1C5TA 5FAHA 3M35A 1XUGA 1YKTA 1TRNA 3DUXH 3UOPA 3UWIA 4MNXA 2FODA 1SGYE 2F9PA 3RXGA 2GCTC 2V3OH 4A1VA 1YPKH 2R3UA 2ZEBA 1BRUP 2HPPH 4IC6A 3KN2A 2QXIA 1E38B 3SV2H 3O8RA 1EAWA 4CRFA 3OTJE 1AZ8A 2OD3B 1IAUA 1BRBE 4AOQA 4DJZB 1CVWH 2OCVB 2UWPA 3MNBA 3M3VA 3ZZ5A 1A3BH 1UJ1A 1HJ8A 3RXDA 3EAJA 2FM2A 5DP7A 1GDNA 4OS6A 1O5EH 2BVXH 1CBWB 2G00A 1Y5AT 3TJNA 1S82A 2H9TH 4Y76A 1C1VH 2Z94A 1O3NA 2HPQH 3EGKH 2A5KA 1ZPCA 2BLVA 4JZFH 1GCDA 4Q80A 1O32A 3SW2B 1MD8A 3A86A 2TRMA 1OOKB 1EZUC 1S0QA 3D62A 1MTSA 3P6ZB 2VGCC 1A0JA 4JMYA 1JOUB 4KP0A 5T6DA 2ZHFH 2RCEA 1KSNA 1DXWA 4YM9A 2FEQH 2BLOA 3UQOA 3SJ8A 4NIXA 4X1RU 1O2SA 3MU0A 1Y8TA 5BPEA 4ASHA 1P57B 3E90B 5LGOA 3BTEE 4UD9H 1O35A 1GI7B 2ZU5A 1HXEH 2B0FA
chains in the Genus database with same CATH superfamily
2W5EA 3RXEA 5EJLA 1CQQA 4A6LA 1TQ0B 3ZVFA 3V3MA 1SGFA 1HAIH 5GNDA 1EP6A 1K1LA 4YTAA 3VB7A 5H4IB 1TB6H 1N8OC 1PPZA 1OWKA 4LZ1H 1BB0B 4JK6A 5A8XA 1O2PA 4ABGA 4IN2A 4OGYA 1BTXA 3C27B 1OYTH 2BZ6H 2L6OA 1V2LT 1CA0C 2EI8A 3FVFB 2PGQB 1SQTA 5DP4A 4I8KA 3ATIA 1T8NA 1O31A 1O3MA 2ZHDA 3BN9A 1TGNA 1VITH 4DVAU 3RU4D 1DOJA 4FUBA 3GCTF 1AUTC 1RIWC 3BEFB 5F8XA 2AMPA 1ETSH 1GHWH 2ZNKH 3RDZA 2VH0A 2VIVA 1NU7B 3MO3A 3M5MA 2Z6BD 9ESTA 1HIAA 3M3SA 1C4Y2 3I29A 1O2QA 2BYAX 1ANCA 2VBCA 2AYWA 1LMWB 5DP8A 1C5LH 1EAXA 4NIYA 3SNBA 5E0GA 1UK3A 4JZDH 1BRCE 1B7XB 4TWWA 1AI8H 3T2NA 4BTIB 3ATLA 1B5GH 4U30A 5DG6A 2XYAA 3RXRA 2Z9GA 1O2TA 2FS9A 1SOZA 1FY5A 3TK6A 3UUZA 3ZZ7A 1GI6A 2KCYA 3KYGA 3NUMA 1O2NA 2FX4A 1W0KD 2UUKB 3SI3H 1IQIA 1KLJH 1ELEE 2WUBA 3ENSB 1YF4A 2BLQA 1QBOA 1WOFA 2JIZD 1AKSA 3LIWA 1HAVA 1T8OA 1TGTA 5L2ZH 1F5RA 1YGCH 4I8HA 4H4FA 5J4QA 5B6OA 3RXFA 1PPCE 4O3TA 1QJ7B 1P2MA 1C5VA 3BEUA 1O0DH 5EJ1A 2OQUA 4F4OC 1PPEE 1E36B 2O8WA 5FPSA 4B2BA 3VXFH 1ZGVA 1DLKB 1KXDA 1C1PA 1KIGH 1TBQH 1LQDB 4MPWA 1Z71A 1AGJA 1UK4A 3MU8A 2ZIQH 4FUCA 3SU4A 2NU4E 2JETC 2WZQA 4XBDA 2GDDA 1HLTH 1HB0B 2C8WB 2ZU1A 1KXAA 4B6FA 3VG8A 2C3SA 3M5LA 1P0SH 1TALA 1YPEH 4K8YA 2ZCLP 1DE7H 1QB9A 1C1SA 1GJ5H 5EOKA 3RXVA 1K1OA 1KDQA 4UFGH 3TJUA 4BTTB 4DW2U 4GCHG 1OWJA 3R0FA 4FU7A 1NC6A 3LGWA 3VB3A 3UTUH 4YESB 1H8HD 1ZPZA 4Y7AA 4ACAA 4DGJA 2Q6FA 4CRAA 3HK6B 1HCGA 3A7WA 1P8VC 4JZIA 1T8MA 1P2JA 1D3DB 3DT0H 1G36A 3A7ZA 1V2ST 3LT3A 3GY4A 1IHSH 1YM0A 2BDBA 1DSTA 2EC9H 3QTVH 4DIHH 3DCLA 3PYHA 4AB8A 3N7OA 2A5AA 1HAZB 4ISOA 1LHGH 2GDEH 3L6PA 4ZKRU 2FOHA 1H9IE 3NZIA 2XNDD 1NU9A 1IQGA 1Z8GA 2BMGB 1E1QD 3MMGA 1K28D 3FFGA 3KQEA 3P17H 3T27A 1VGCB 1FAXA 1FQ3A 2F9NA 2ZPRA 4H6SB 1ESBA 1KTSB 1MTWA 4Y10E 3U9AH 2XBWA 1L1JA 4YOGA 1NRPH 2RA0A 3OSYA 1SBWA 3H09A 1DUEA 1BMAA 2Z9KA 1YLCA 2AGIX 5GCHF 3SU1A 1Q2WA 2IJOB 1XUHA 4WWYA 4X1SU 1F0TA 1XKAC 4BNRA 3F6UH 4WH6A 3KHVA 1O2HA 4TT3D 1KTTB 2Y81A 1FPHH 1TQ7B 3A87A 1C2EA 3DFLA 2ANYA 1MAXA 4JYVH 1DLEA 3AK5A 2PW8H 4YOJA 3GDUA 3TGKE 2A31A 1MABB 1DWBH 3UFAA 3BTKE 1PJPA 1ZRKA 2FOFA 2GD4B 2XC5A 1TMUH 1SOTA 3HGNA 3S7KB 1TNLA 3MNCA 2LNCA 3SV6A 4JCNA 1HGTH 2A1DB 3A8AA 5C3NA 1ZHPA 4XRNA 4XSKU 2ULLA 4DY7B 1JIMA 1XX9A 2CJIA 2FOMB 4XFQA 5EJZA 1HJAC 1VR1H 3GY5A 4I8GA 2JKHA 3CP7A 1QRWA 2ZGXH 4ZUHA 1HAOH 2QIQA 3ZYEA 1O2RA 1TOCB 1THSH 1S6FA 1LPZB 3F9FA 2FYRA 5AVDA 1GHBF 4OM9A 2XXLA 1O3FA 3SJ9A 3OX7U 2P8OB 2FOGA 2XRCA 3P8GA 2CHAB 3IITA 5DP3A 1O3PB 1MTNC 1IOEA 1TPOA 2AHME 2BDAA 4RKOB 3ZIAD 3SZNA 1DM4B 1SGTA 1BMLA 4Y0ZE 1TA2A 2BD8A 3OY6U 3M36A 1O5CB 1JRTA 1C2JA 1QTFA 4MVNA 1EASA 3F3BA 3M7QA 2BXUH 4INLA 2LELA 2ZC9H 3QLPH 2VIPA 4KTSA 1DY9A 3SU2A 1QL8A 2VIWA 4B76A 5HKKD 1V2RT 4JK5A 1GL1A 3WWBA 1ZMNA 1GPZA 1VKYA 4UFFH 2XNIA 2ZDAH 1YCPK 4YO9A 1ZTKA 2JDID 2KR7A 3ZV9A 5EQSA 1S6HA 1AVXA 2PP6A 1GDQA 2BDCA 4ABEA 3ZVCA 3CNRA 3M3TA 1O37A 3WY8A 1A3EH 3RXTA 3MFJA 3LGIA 2HGTH 3MH4A 2KZ4A 2UWOA 1TX8A 1GMCG 2FMJA 1E1RD 4CRGA 5IDKA 1BTPA 1T31A 5TJXA 4ZXXH 1CGIE 1HJAB 1EAIA 3SV9A 4AG1A 1OWHA 1V2UT 3M37A 1S81A 1YPMH 1TOMH 2BQ6B 3RLYH 3QZRA 1EZXC 1KYNA 1KY9A 1SR5C 1HDTH 4UDWH 3BTDE 1TPSA 3M7UA 4KGAA 2BD5A 3ZZCA 2XOKD 2ZFSA 3RU4E 2ZTYA 4JZEH 1O3KA 3A7TA 1GI5A 1PPHE 2JH0D 7GCHG 1AIXH 1SGFG 1HRTH 1Z8RA 4AB9A 5DP6A 1FX0B 2PR3A 2R0LA 3TGIE 1O5BB 1XXFA 1C5PA 3SJIA 1LVYA 1C5SA 4YOIA 1ID5H 1MD7A 2W26A 5F8TA 3TJVA 1BMNH 2TGDA 4RKJB 1SI5H 3DD2H 2QF4A 4KTCA 6LPRA 1INCA 1KLIH 1ANEA 1YLDA 2ZPSA 1V2MT 4GPGA 5GXPA 2GMTB 1ETRH 1FONA 1LPKB 1QL9A 3B9FH 1J15A 1C5YB 2JH5D 1YYY1 5FCRA 2O8LA 3BF6H 3MTYA 1VCPA 4NG9H 5JBBS 1O2XA 1BRAA 1AMHA 1P3CA 1P12E 1GI1A 1T4VH 5A8YA 5DSFA 1XXDA 1ELCA 3O8DA 1YCPM 1UO6A 1AVWA 5FXLA 1YPHE 3BV9B 2J98A 1K0HA 4ZCNA 2J9NA 1P9SA 3U98H 1V2KT 2XTTB 5JB9S 1H8DH 4LXBH 1UTOA 2K0QA 4ABBA 1ELVA 3NK8A 1EPTB 1SQRA 1SSXA 1C9TA 4AGKA 1GMHG 1AE8H 3HATH 4K1SA 3T28A 1GCTC 1O2KA 2V3HH 2BXTH 3A81A 1O5AB 1P05A 3S69A 5CMXH 2PSXA 1A2CH 1O34A 1SG8B 4VGCB 1BHXB 2BOHB 1FIWA 3LH3A 2A4QA 2WPDD 2P94A 3LGYA 4CREA 2NU0E 1BBRH 1L2EA 1BTYA 2VINA 4ZKOU 1FXYA 3RUOA 2WSSD 4MDSA 3OTPA 1LCYA 1P2KA 5SGAE 3QGJA 1O3EA 1TPPA 1L1GA 4O03A 1MZAA 2ZGBH 4AZ2B 4MPXA 3LGVA 1P04A 3TNTA 4GHQA 1CHOG 1C4V2 4IGDA 3D65E 2CF8H 1S84A 1C2GA 3ODFA 4FOUC 2P3UB 3STJA 1AHTH 1FPCH 2GKVE 3BG4C 1XVMA 1ZOMA 2BTCE 1G3BA 1PQ8A 4U32A 1F0UA 3E8LA 3RM2H 2EQNA 5KECA 1C5MD 1P01A 5F8ZA 3OAAD 1NO9H 1L4ZA 2GZ7A 1RJXB 1SGQE 3T29A 2XC4A 4GHTA 1GJDB 3QWCH 2FPZA 1LQEA 2Z9IA 1G9IE 4IMZA 5I25A 4FVBA 5BRRE 3E0NB 1P9UA 2KCOA 2Y5HA 3LH1A 3DSPA 2WPKS 1LVOA 3F1SB 1GJ7B 1RTLA 1QURH 1O2JA 4NFFA 1ZMJA 3D49H 2LP6A 1C1MA 1GVKB 2IPQX 5T3HA 1DWCH 4AFZA 3ZZBA 5A0CA 1AB9B 1H8IH 2HNTF 4FUIA 4D7FA 3ZZAA 5LPRA 1SLUB 2AERH 1FUJA 2W3IA 4AYYB 2XBVA 1B0FA 1C1RA 1O3HA 2M2AA 3MNSA 3FZDA 3U69H 4BXWA 3UNSA 1G2MA 5ETXA 4DT4A 2SGEE 1ZR0A 2B5TB 4RN6A 5DPAA 3A8DA 3UB0A 2VWNA 2BQWB 3QUMP 3ZV8A 3ZVDA 1TBRH 2VB0A 1IHTH 5EXNA 2ZU3A 3NWUA 1JIRA 2QF0A 2Z7FE 3SU5A 1O5FH 3UNQA 2C8XB 4JYUH 3PTBA 1A5IA 1WAYB 1GDUA 1QRXA 2THFB 3B8JA 3T5FH 1OP0A 3RXKA 1ELTA 2Y7ZA 4AYVB 2H9EH 4NA9H 3BTTE 3V0XA 1UTJA 1W13U 2XW9A 1O3OA 3MO6A 5CHAC 1F92A 2H5DA 3ATMA 3SJOA 4Y11E 2FOEA 3F68H 3AAUA 1K1PA 1JXPA 1QY6A 1MU8B 1TA6A 3SUFA 5AFZH 5B6LA 4CRBA 3LPRA 3NKKA 1S6LA 5CE1A 3UPEA 1VJAU 3JZ2B 1KXBA 2GVFA 1QL7A 2L74A 3LONA 2UUJB 2RG3A 1FY4A 2OP9A 3T25A 3TH2H 3A89A 7ESTE 4K60A 3K6ZA 4M9FA 3G01A 1RFNA 1P09A 4K2YA 1O2UA 1W0YH 2FYQA 1EFRD 1ZYOA 5K7RA 3NRLA 5EPYA 2DUCA 2TGTA 1T8LA 2GV7A 2NU2E 1QJ1B 1GJCB 2GCTB 1ACBE 1ZTLA 3P70B 1NPMA 2O8UA 3BG8A 3Q00A 1Z1IA 3SGAE 8KME2 5LH8A 1C5OH 1EZQA 2ZTZA 3A83A 3BTME 2W6JD 3GY2A 4AC9A 4H6TA 2G4TA 3ZZ9A 1O3JA 2QCYA 4O3UA 3P8FA 2ZWLH 2GT7A 1F5LA 1BIOA 2KX4A 2WPLS 2BDGA 4I8LA 1QCPA 1Q3XA 2OQ5A 4GUXA 1C1NA 1AQ7A 1GBLA 3MU1A 4X8UH 5CHBA 5HMAA 1BTZA 1C4U2 5EXLA 1YPJH 2BHGA 4FVDA 3GS9A 2FLBH 3V7TA 4J1YA 4CHAC 3GDVA 1O3CA 4JYTA 1OPHB 1GBIA 1AWFH 3U28C 2P3FH 1C9PA 4XBBA 1GG6C 4X0WU 1YPHC 4B1TA 2HLCA 2K8IA 1EQ9A 3W1EA 1O2YA 1P2QA 2ZFPH 4WVPE 1IQKA 1SGEE 4BAOB 1IQJA 2PWXA 4R0IA 4WXVA 4Z0KA 1HV7A 1A46H 2VGCB 1QNJA 2ZKSA 1HBTH 2XWBI 1GGDC 2EI7A 3KL6A 2SGQE 5C0TA 4IC5A 2ZP0H 1LHDH 1J8AA 2QAAA 4Y7BA 1NM6A 2ALPA 4IBLH 3BTFE 4FUHA 1GBMA 2CXVA 3BTWE 3TLOA 1WDIA 2I6SA 2AMQA 1BBRE 5F53A 1PQ5A 3K6YA 3GCOA 3HK3B 1RS0A 5C2ZA 3MWIU 4NIWA 1T7CA 1FDPA 4MNWA 1RGQA 4Y8YA 2ZGHA 5EQQA 1MAYA 3FO8D 3R3GB 1C2FA 1N8OB 2ZPQA 3A7VA 1LHFH 3HPTB 2Z3DA 2D1JA 2BDHA 1AE5A 1TRYA 2ILNA 4INKA 2YNAA 4HZHA 2D2DA 3NCLA 1K2I1 5DP9A 3SGBE 1CA0B 4HGCA 3SNCA 1WCZA 2WPHS 4AGJA 5GJ4B 3E3TA 3A85A 3S9CA 3UAIC 3UQVA 2QXHA 4DG4A 1L0ZA 3SQEE 4WMFA 1RIWB 4WJG2 3P95A 5E0HA 3PV5A 5C0UA 3KF2A 3GYLB 2Q6DA 4X8SH 1VITG 3ZZ8A 1D6WA 1ARCA 5T6FA 1W2KH 4DT7B 1PPBH 2RA3A 5F6MA 1EX3A 3SU3A 3LJJA 3MH6A 3Q3KA 1AFQC 3FP7E 1YPGH 3LU9B 3L33A 1CE5A 2FI5E 3OFND 1NFWA 2P93A 5FHTA 4B71A 1BTUA 3PMBB 1C2MA 1ZMLA 3E1XB 4DIIH 1CT2E 3PWBA 1MBMA 1SQAA 3SUEA 1SLWB 2OXSA 5EW1H 1GHAG 1NROH 4Q7YA 3NPSA 1H8ED 2NU3E 3SI4H 1MH0A 3PMJA 5FBIA 3F2FA 2AMDA 1GJBB 3A8CA 4UFDH 1PPGE 2STBE 4BOHA 4CRCA 3W95A 3FP6E 1NT1A 5JBTA 1V6DA 2PUQH 1XKBC 3KQ5A 4B73A 1AVGH 1YP9A 1J17T 1CU1A 1LHCH 3MOCA 2BB4A 1CHGA 2OC8A 2SGFE 1EXFA 2Y7XA 3BEIB 3FKSD 3V13A 3K2UA 1SLVB 2GP9B 2VIOA 2WV9A 1K1MA 1IQNA 1D3PB 2G52A 2PFEA 1MKWH 2AFQB 3RXHA 4FUFA 1Z1JA 2EA3A 4X2XA 1Z7KA 1MUEB 5FX6A 4I7YH 3DHKH 4BAHB 1AWHB 4XD7D 3A88A 2GV6A 4FUJA 4B2CA 2JETB 2QF5A 3BSQA 1AFEH 1IQFA 1EJAA 2PHBA 1SLXB 3F2GA 1TABE 4KTUA 3QN7A 1O2OA 1K1NA 1SQOA 1BA8B 3FOAA 1NFYA 3GY6A 4K69A 2J38A 3PMAB 3MHWU 4THNH 3EA9A 4NZQA 1LKAA 1QA7A 2BZAA 1WU1A 1EP5A 1WQSA 4I8JA 1BBRK 1A7SA 2PUXB 4ZMAH 4E06H 1HAGE 2ZFRH 1O3IA 2QA9E 1WV7H 3EA8A 1J14A 3UNRA 2P3TB 2W7SA 1W10U 3GY3A 1JWTA 3LDXH 2NWNA 1GWAA 4FU9A 3SNDA 4BAKB 1UTQA 3A84A 6GCHG 2BY6X 5EG4A 1THPB 2A2XH 3RLWH 1A0LA 1W0JD 2BDIA 5EU8A 2F9OA 2F91A 4Z6AH 5FCKA 4I32A 4UEHH 1GMDG 4XDEA 1S83A 1P10A 2WINI 1O3GA 1ELGA 4ABDA 4AFUA 1HIAB 3A7XA 2WPIS 1TNKA 1GBKA 3PLKA 1ZPBA 1H1BA 2F43B 3GOVB 1W0ZU 5A0AE 3FZZA 1GI2A 1ELBA 2M5TA 1QZ8A 2HVYB 4SGAE 1UHBA 2Y82A 4TSFD 1UTPA 2YNBA 1NN6A 3SU0A 1P02A 1MKXH 1FY3A 1Z6JH 4YT7H 1O5DH 5PTPA 3RMOH 3AASA 1GI9B 4NWLA 4IN1A 1HJ9A 2R0KA 1GBHA 3ATKA 4FETA 3KIDU 1GHXH 4O97A 1P03A 2A4RA 1BQYA 5EXMA 5E2OA 1BTHH 1Y3UA 2Z9LA 3PRBA 4FU8A 4NSVA 1ANBA 3SN8A 3C1KA 1OS8A 2BD9A 3SNAA 4X1QU 1BT7A 2OUAA 1N1LA 5HIYA 1P2NA 1XMNB 2Y80A 1HXFH 1DX5M 1EOJA 3AAVA 9LPRA 3F9GA 1FNIA 1QB6A 4DOQA 2QE7D 2AGEX 2KFWA 4I86A 4GVUA 5ESTE 3SYJA 1C1OA 3P92A 1VZQH 4YT6H 1GMHF 3S7HB 3PTNA 4Q4LA 4AORA 1DITH 3EDXB 1GHVH 1ZHMA 2RDEA 3ZYDA 2EEKA 2KAIB 1Y3VA 2H2ZA 3O8CA 3KQBA 2ZCHP 1WTHD 4B6EA 2CK3D 1O2IA 1MTNB 3PV2A 1F5KU 4FUEA 3GY8A 1UTMA 1O38A 1KMHB 3RMMH 1BDAA 2ZDKA 2W7UA 2ZF0H 4CBOA 1P06A 3QX5H 4XE4A 4PROA 2BY5X 1GHBG 1O2WA 2ZDVH 3VPKA 1P2OA 3H7OA 1BCUH 4B75A 2NU1E 5FPTA 3VGCC 4I31A 1FAKH 3UR9A 1BITA 2A2QH 3LKWA 1OP2A 2D8WA 1SHYA 3SGQE 3PO1C 3SV7A 3FANA 8ESTE 1UVPA 1FI8A 2O8MA 1DANH 1NFUA 2H6MA 2GTBA 3TIUA 1QJ6B 2ALVA 4X6NA 2XBYA 2FTMA 3EQ0H 5IYTA 2QXJA 4ISLA 1RD3B 1W11U 1Z6EA 1SGNE 5A2MH 4UFEH 1EAUA 1YLNA 2QYIA 1IQHA 2A4OA 1MTUA 2ASUB 2HRVA 3JZ1B 1HFDA 1QQ4A 2VVCA 2ZDLA 3E6PH 1CO7E 3GCHB 3TVJB 1IQMA 1MMJN 2JH6D 5LPFA 1ZRBA 2FS8A 4CR9A 1W3CA 4NGAH 4LOYH 1FN8A 1QFKH 4OS2A 4AFQA 1NY22 1VCQA 4XBCA 8GCHG 1D3QB 1V2NT 1CA8B 3FP8E 3O8BA 1GBBA 1TWXB 2Y5GA 3A8BA 3QZQA 1AD8H 1D4PB 4TPYA 1CT0E 2HWLB 4ABJA 1G3EA 1BZXE 4LK4A 3ZZ4A 2V7QD 5DJ7A 2YMSC 4X2WA 1J16A 2WHXA 1GI0A 3VB6A 4NWKA 3M5OA 1UCYH 2PKAB 1LKBA 2GZ9A 2YOLA 2ZHQH 2F9UA 4ABFA 5EW2H 1TBZH 1QB1A 3TK9A 5DK1A 1P2IA 2TBSA 4OS1A 1EB2A 3VGCB 2ZO3H 4INHA 1GJ6A 2XBXA 3SBKA 2PTNA 3LJOA 4AFSA 1O2GH 3LGTA 1HAXB 2BY7X 1A1RA 4ZH8A 3TH3H 1FLEE 2FWWA 1AY6H 3GICB 4WF8A 1FY1A 1TPAE 1BUIA 1QHRB 2HOBA 2BM2A 3ODDA 1KXEA 5G4BA 2Y5FA 1V2WT 1TNGA 1E79D 1UVUH 2SNWA 2ZHWH 2FDAA 4E7NA 2FI4E 4WMEA 3RC6A 1BHXF 5JPMH 2OBOA 3ZZ3A 1C5RA 4Y8ZA 2YMSD 3N7EA 5I46H 1HPGA 1CBWC 1GJ9B 3RP2A 1GJ4H 2STAE 2CF9H 1W7GH 4E7RG 2AGGX 2R9PA 2QV1A 1GCTB 3EE7A 3OEHD 2C8ZB 2ZFQH 3RXJA 1ZGIA 1M9UA 1FIZA 2QC2A 3RXIA 1LVBA 3TITA 2ANKH 5K0HA 3OEED 2R3YA 4BXSA 2BVRH 1H4WA 4B2AA 1EUFA 5IK2D 4M7GA 4X6PA 1YWUA 4RT1A 2FIRH 4KKDA 3UREA 3PLPA 5JBCS 1YY3A 3MU4A 1AN1E 2B9LA 1T32A 2RFKC 3WW7A 5C5NA 1GI4A 2BD4A 1TONA 2GCHG 3ESTA 1ZTJA 2C90B 1SHHB 1Y3XA 3GCHC 5HXFA 1YCPH 1P11E 4IMQA 2J34A 1XUJA 1C5WB 1OWIA 1XVOA 2ZFTA 3SO3A 3URCA 2ZCKP 3PROA 3U8OH 1NTPA 3GY7A 5HGGA 1C2LA 3GYMA 4F55A 2VWLA 4Y79A 4WH8A 3BG4B 3QK1A 1UTLM 2PSYA 1DSUA 4O9VA 2ZG0H 1S0RA 2J92A 1SL3A 1NS3A 1H9LB 2F83A 5ABWA 4FUDA 3U8RH 7LPRA 2ZECA 2IN2A 1F2SE 1OXGA 3VEQB 2AEIH 1SB1H 3MU5A 5E0JA 2QN5T 1MKWK 6CHAC 1COWD 3TK5A 2QF3A 4NA8A 4TY6A 5GWZA 3VB5A 1IQLA 2ZGJA 2Y6TA 4D9RA 3U1IB 2F9VA 6ESTA 1O2ZA 3AW0A 3UWJH 2OC0A 3ATWA 4DURA 1DT2A 1LPGB 1GBJA 2G81E 2IPHA 3HGPA 2PKSC 3V12A 2TGAA 2AS9A 2AIPA 1J9CH 4A1TA 3PWCA 1D3TB 1OX1A 4ABHA 2PLXA 3D23A 1THRH 2ESTE 2J2UA 4D9QA 4Y0YE 5CDFE 1QBVH 4Q7XA 2CMYA 3VFEA 3KNXA 1QQUA 2G5NA 3I78A 1GHZA 3Q3YA 4MNYA 1O3LA 2BX3A 5DO4H 1PQAA 1ZZZA 1YPLH 2TPIZ 1TX6A 1DS2E 3FAOA 3S0NA 4D7GA 1GBFA 4IW4E 1V3XA 3RC5A 4ESTE 1DICA 3RU4T 2BY9X 1G37A 2ODYB 2XC0A 1MTVA 1BTWA 2UUYA 3MYWA 3E91A 2P59A 3SUDA 2VIDA 4IS5A 2FTLE 1TGSZ 3SU6A 3ZVAA 3BIUH 4ZXYH 1BMFD 1VITF 1N6XA 5CHAB 4CH2B 2Z3EA 3EE0B 1NRSH 1OP8A 2FOCA 3RMLH 5C1UA 2B8OH 4ISNA 4HFPB 2XCFA 3TGJE 3DSOA 3OY5U 5L30H 1RXPA 2ZQ2A 2TIOA 2H5CA 2WPMS 1O33A 1NFXA 1SMFE 1MCVA 3VB4A 4GCHF 4BAQB 3L3TA 6CHAB 1A5GH 3SOSA 5DGJA 3BTHE 3K9XB 2FESH 1L4DA 5HM9A 3LC3A 2SFAA 3H5CB 3KGPA 1GHAF 2F9BH 4YLQH 1DVAH 1MKXK 2TGPZ 3T26A 1U6QA 2PKSB 4J2YB 1FV9A 4NA7A 3FN8A 4Q63A 5E8EH 3KEEA 5AFYH 1N6YA 2VH6A 1SKYE 1ELDE 1MCTA 2BOKA 4WMDA 4Q2KA 4ZKNU 3TU7H 1UCYE 2ZA5A 1UVSH 4GAWA 2P95A 5TCAA 4K8BA 1TNJA 2ZI2H 3PLBA 1GJAB 2J5UA 2CV3A 3U1JB 2VU8E 1KXFA 1DUAA 1SGRE 2C93B 3M61U 4NCYA 1GI8B 3CS7A 2BQ7B 4ISIH 1C2KA 2Z9JA 1HAYB 3RXSA 3U8TH 2FX6A 5FX5A 4CHAB 1E0FD 1C1TA 2ZU4A 2PGBB 3MNXA 1FMGA 4A1XA 4TYDA 1W14U 1O3BA 1JMOH 1GG6B 1X7AC 1Y5BT 3TH4H 3KQCA 4YZUA 1Z8IB 5FBEA 1VGCC 3GDSA 2SNVA 4H42U 1SGIB 2EI6A 1UTKA 1UTNA 3TJOA 4BTUB 3DFJA 5GPIB 1ANDA 3MH5A 4ZHAA 2VVUA 5TCCA 5C5OA 4YLUA 2BVSH 2ZDMA 4GLYA 1DXPA 3GCTG 1K9OE 2QGRA 3SJKA 4QT8C 5JB8S 3PV4A 2A45B 2LIZA 1VCWA 3ZVEA 1GGDB 1LHEH 1ABJH 4OS7A 2ZZUH 2Q6GA 1GBEA 3SNEA 1G32B 2KAIA 2ZGCA 2BX4A 1C1UH 5AHGH 4HTCH 8LPRA 2ZTXA 1C1WH 2OLGA 3SHAH 4LZ4B 4X1NU 1GVZA 2A32A 1CGHA 4ZHMU 1ZSJA 6GCHF 1LDTT 1GI3A 2FZZA 3QGNB 5EIYA 1SVPA 2HNTE 4ZROA 2QXGA 2IOTA 1E34B 1GMDF 2VJ1A 5GIBA 1W7XH 3N99A 3F9EA 1WBGB 5C17A 3EBNA 1SPJA 1OSSA 3F0OA 2G51A 4E05H 4OS4A 2FO9A 5DP5A 3BTQE 3PM3A 3LGUA 2Z3CA 4U01A 3ELAH 3SORA 5KEDA 1VJ9U 2OK5A 2CN0H 1NRQH 1DDJA 1OWEA 4ZKSU 4K5ZA 1EJNA 2J4IA 4NFEA 1K1IA 2K1QA 2BLWA 2SGAA 2DE9A 4AN7A 1S85A 1H9HE 3OE7D 5EQRA 2BD2A 2QY0B 3LC5A 1TNHA 2OBQA 1C1QA 2JJ2D 4OGXA 3URDA 4D8NA 4JZ1A 1DFPA 1CT4E 2P8OC 3RXCA 1AFQB 1PYTC 1MQ5A 2CHAC 3SZEA 1QBNA 3A7YA 1XUIA 5DN6D 1QA0A 4X2VA 4NSYA 2G5VA 2JJ1D 1SC8U 1Q31A 5EGMA 1QGFA 2ZQ1A 4A92A 2VWOA 4F48B 1K21H 1EPTA 3RXOA 1V2TT 1WTGH 2G55A 1IQEA 2DE8A 5C20A 1B0EA 1PQ7A 2PV9B 1ESAA 5EODA 1ZSKA 3RXPA 3RXLA 1XM1A 2ZHEH 1F0RA 1QRZA 3RXBA 1UCYK 4U2WA 1SFQB 2HVXA 3RXMA 1FN6A 1GMCF 4MNVA 1NBMD 1O30A 1SGDE 1TNIA 3S9AA 1O2MA 2I6QA 2W6ID 1NRRH 2A7CA 1ZJKA 1QR3E 2Q1JA 4Y8XA 4NZLA 3SV8A 4KELA 4P02A 1TYNA 1BMMH 1EZSC 2AH4X 3RC4A 4I33A 4XOJA 1PYTD 4MPUA 2PKAA 1RRKA 2OC1A 2FLRH 1Y5UT 3IWMA 1EATA 2A4GA 2KCAA 3PB1E 1A4WH 3SQHE 4TPIZ 5A8ZA 1O2VA 1TMTH 3RXAA 3GCNA 4ISHH 2BY8X 1YBWA 2V0BA 5LPEA 2LPRA 7GCHF 3EA7A 1DPOA 1BJUA 2H9HA 1WUNH 1CSOE 3BTGE 1K1JA 4K1EA 4TWYA 3TNSA 1G2LA 3LOXA 1YC0A 2WV4A 1A5HA 1C5UA 1TGCA 1F0SA 1UVTH 1G3DA 1FJSA 5E2PA 4UONA 4K1TA 1W8BH 5KGOA 3AVZA 2VNTA 1P3EA 4B74A 1TE0A 1UVOA 2FI3E 3TPIZ 1D6RA 1FZZA 1GBCA 3PRDA 1C5ZB 1WSSH 1O2LA 1UK2A 1AKSB 3S9BA 1HAVB 5GCHG 4CH8B 1MZDA 1XUFA 1V2OT 1GHYH 4X1PU 5JBAS 5FL7D 1GBAA 1AU8A 1E37B 1O3AA 2GMTC 4MPVA 1OWDA 2A0QB 3H7TA 2BD7A 3E0PB 2CGAA 2UUFB 3WWFA 3Q3XA 4X2YA 4Y71A 1F7ZA 3W94A 4TY7A 1S5SA 4Y6DA 1SGCA 1LTOA 3HKIB 1GJ8B 2FXRA 2HLDD 1MU6B 3IG6B 3AW1A 1OHHD 3K65B 1V2QT 3RXUA 4ZAEA 2ZU2A 3ZZDA 5JDUB 3ZZ6A 1AO5A 3ZVGA 2AIQA 1HYLA 1V2VT 8GCHF 2K7XA 2ZDNA 1TLDA 4ZHLU 1MBQA 1K22H 1KLTA 3RMNH 1KDQB 1TRMA 3P8NA 1MQ6A 1EPTC 3MH7A 3VXEH 2WPJS 2GJGA 2ZFFH 5JYIA 4WXIA 4CBNA 3CENA 2KCPA 4BANB 4MTBA 1XUKA 1TIOA 2H1UA 4VGCC 4RI0A 2V35A 3BIVH 3T62A 4HI3A 2BD3A 1D9IA 4FUGA 4CRDA 5C1XA 5C67A 5C94A 1RTFB 2V3MA 1WXRA 1ZJDA 4AX9H 3F2HA 5C1YA 1W12U 2FOBA 3SUGA 2OINA 1CHOF 3OU0A 3HKJB 1LO6A 2O8TA 5AF9H 2G4UA 1BJVA 1EKBB 1TFXA 3M5NA 1PFXC 2WYJA 1HUTH 4MG3A 2GGVB 3Q76A 1GL0E 1WYKA 2D26C 2RDLA 3A82A 4F49A 4YXWD 4ABIA 5L6NH 3ITIA 2FP7B 3SHCH 2OTVA 1GBDA 3N7DA 1O5GH 2G8TA 4X6MA 4GSOA 2V6NA 1OYQA 1CGJE 2HNTC 3F0PA 1C5NH 1A61H 5ESBA 3DSGA 3A80A 4BAMB 1G30B 2EY4C 2A5IA 3UIRA 1TAWA 3UR6A 2ANWA 2BDYA 3MI4A 4R8TB 2F3CE 3M7TA 1C5QA 3UY9A 2SGPE 2GZ8A 3QO6A 2HALA 5HYOA 3OYPA 2XCNA 2ODPA 2XWAA 4X6OA 1WQVH 2WYGA 5A0BA 1LVMA 4X8VH 3UOUA 2SGDE 3F9HA 1EB1H 1ELFA 5J4SA 1KXCA 3RXQA 1Z8JB 1UW7A 4WY3A 1L1NA 1PPFE 5EPNA 2A7JA 3E16B 4DCDA 4A7IB 2C4FH 1BOQA 1ZSLA 5F03A 1C2DA 3QDZB 1V2JT 3Q77A 3KQDA 1C2IA 3EYDA 4HG6A 1DWEH 4ABAA 1EJMA 2P16A 1ABIH 2GCHF 2PTCE 4K3JA 1HNEE 3MQKC 1Y59T 4CR5A 4X8TH 4SGBE 2VIQA 4MQAA 5A09A 1AB9C 1SFIA 1FY8E 4Q7ZA 3PO1B 3DA9B 4MLFB 1RTKA 4D76A 5L2YH 1NRNH 1E35B 4A5TS 1AUJA 5DKMA 2J95A 2WV5A 1OKXA 4NIVA 3NXPA 1NZQH 2J94A 2GT8A 3MO9A 1O39A 1Y3YA 4OS5A 1T4UH 1DY8A 2A7HA 4Z1MD 1ETTH 1QIXB 2OC7A 2C8YB 2R2MB 2KM0A 1UHBB 1AZZA 1ELAA 4RSPA 1C5XB 1C2HA 1ZLRA 1JRSA 4P00A 3P8OA 5FPYA 2WUCA 3STIA 1DWDH 1TX7A 5HIZA 2O9QA 2GX4A 3CS0A 5GDSH 1G3CA 2UWLA 3PMHB 5HM2A 1V2PT 3I77A 1ARBA 1GBTA 2B7DH 3B23B 1JBUH 4ASUD 1NESE 2FOAA 1HAPH 2ANMH 2ODQA 5T6GA 3QTOH 4FXGH 4AG2A 1SGPE 2W3KA 1Y3WA 7KMEH 2YMSB 1A0HB 2VVVA 3KCGH 1HAHH 3RM0H 1EOLA 1O3DA 1TGBA 1ORFA 1ESTA 1TMBH 1ZHRA 2VWMA 4ACBA 1O36A 2R2WU 1GVLA 4UE7H 3ZVBA 3GISB 1UMAH 1C5TA 5FAHA 3M35A 1XUGA 1YKTA 1TRNA 3DUXH 3UOPA 3UWIA 4MNXA 2FODA 1SGYE 2F9PA 3RXGA 2GCTC 2V3OH 4A1VA 1YPKH 2R3UA 2ZEBA 1BRUP 2HPPH 4RT0A 4IC6A 3KN2A 2QXIA 1E38B 3SV2H 3O8RA 1EAWA 4CRFA 3OTJE 1AZ8A 2OD3B 1IAUA 1BRBE 4AOQA 2IJD1 4DJZB 1NBME 3KYFA 1CVWH 2OCVB 2UWPA 3MNBA 3M3VA 3ZZ5A 1A3BH 1UJ1A 1HJ8A 3RXDA 3EAJA 2FM2A 5DP7A 1GDNA 4OS6A 1O5EH 2BVXH 1CBWB 2G00A 1Y5AT 3TJNA 1S82A 2H9TH 4Y76A 1C1VH 2Z94A 1O3NA 2HPQH 3EGKH 2A5KA 2F4LA 1ZPCA 2BLVA 4JZFH 1GCDA 4Q80A 1O32A 5T1VA 3SW2B 1MD8A 3A86A 2TRMA 1OOKB 1EZUC 1S0QA 3D62A 1MTSA 3P6ZB 2VGCC 1A0JA 4JMYA 1JOUB 4KP0A 5T6DA 2ZHFH 2RCEA 1KSNA 1DXWA 4YM9A 2FEQH 2BLOA 3UQOA 3SJ8A 2J97A 4NIXA 4X1RU 1O2SA 3MU0A 1Y8TA 5BPEA 4ASHA 1P57B 3E90B 5LGOA 3BTEE 2J98B 4UD9H 1O35A 1GI7B 2ZU5A 1HXEH 2B0FA
chains in the Genus database with same CATH topology
2W5EA 3RXEA 1CQQA 4A6LA 1TQ0B 3ZVFA 3V3MA 1SGFA 1HAIH 1EP6A 1K1LA 4YTAA 3VB7A 5H4IB 1TB6H 1N8OC 1PPZA 1OWKA 4LZ1H 1BB0B 4JK6A 5A8XA 1O2PA 4ABGA 4IN2A 4OGYA 1BTXA 3C27B 1OYTH 2BZ6H 1V2LT 1CA0C 2EI8A 3FVFB 2PGQB 1SQTA 5DP4A 4I8KA 3ATIA 1T8NA 1O31A 1O3MA 2ZHDA 3BN9A 1TGNA 1VITH 4DVAU 3RU4D 1DOJA 4FUBA 3GCTF 1AUTC 1RIWC 3BEFB 5F8XA 2AMPA 1ETSH 1GHWH 2ZNKH 3RDZA 2VH0A 2VIVA 1NU7B 3MO3A 3M5MA 2Z6BD 9ESTA 1HIAA 3M3SA 1C4Y2 3I29A 1O2QA 2BYAX 1ANCA 2AYWA 1LMWB 5DP8A 1C5LH 1EAXA 4NIYA 3SNBA 5E0GA 1UK3A 4JZDH 1BRCE 1B7XB 4TWWA 1AI8H 3T2NA 4BTIB 3ATLA 1B5GH 4U30A 5DG6A 2XYAA 3RXRA 2Z9GA 1O2TA 2FS9A 1SOZA 1FY5A 3TK6A 3UUZA 3ZZ7A 1GI6A 3NUMA 1O2NA 2FX4A 2UUKB 3SI3H 1IQIA 1KLJH 1ELEE 2WUBA 3ENSB 1YF4A 2BLQA 1QBOA 1WOFA 1AKSA 3LIWA 1HAVA 1T8OA 1TGTA 5L2ZH 1F5RA 1YGCH 4I8HA 4H4FA 5J4QA 5B6OA 3RXFA 1PPCE 4O3TA 1QJ7B 1P2MA 1C5VA 3BEUA 1O0DH 2OQUA 4F4OC 1PPEE 1E36B 2O8WA 5FPSA 4B2BA 3VXFH 1ZGVA 1DLKB 1KXDA 1C1PA 1KIGH 1TBQH 1LQDB 4MPWA 1Z71A 1AGJA 1UK4A 3MU8A 2ZIQH 4FUCA 3SU4A 2NU4E 2JETC 4XBDA 2GDDA 1HLTH 1HB0B 2C8WB 2ZU1A 1KXAA 2C3SA 3M5LA 1P0SH 1TALA 1YPEH 4K8YA 2ZCLP 1DE7H 1QB9A 1C1SA 1GJ5H 5EOKA 3RXVA 1K1OA 1KDQA 4UFGH 3TJUA 4BTTB 4DW2U 4GCHG 1OWJA 3R0FA 4FU7A 1NC6A 3LGWA 3VB3A 3UTUH 4YESB 1ZPZA 4Y7AA 4DGJA 2Q6FA 4CRAA 3HK6B 1HCGA 3A7WA 1P8VC 4JZIA 1T8MA 1P2JA 1D3DB 3DT0H 1G36A 3A7ZA 1V2ST 3LT3A 3GY4A 1IHSH 1YM0A 2BDBA 1DSTA 2EC9H 3QTVH 4DIHH 3PYHA 4AB8A 3N7OA 2A5AA 1HAZB 4ISOA 1LHGH 2GDEH 3L6PA 4ZKRU 2FOHA 1H9IE 3NZIA 1NU9A 1IQGA 1Z8GA 2BMGB 3MMGA 1K28D 3FFGA 3KQEA 3P17H 3T27A 1VGCB 1FAXA 1FQ3A 2F9NA 2ZPRA 4H6SB 1ESBA 1KTSB 1MTWA 4Y10E 3U9AH 2XBWA 1L1JA 4YOGA 1NRPH 2RA0A 3OSYA 1SBWA 1DUEA 1BMAA 2Z9KA 1YLCA 2AGIX 5GCHF 3SU1A 1Q2WA 2IJOB 1XUHA 4WWYA 4X1SU 1F0TA 1XKAC 4BNRA 3F6UH 4WH6A 3KHVA 1O2HA 1KTTB 2Y81A 1FPHH 1TQ7B 3A87A 1C2EA 3DFLA 2ANYA 1MAXA 4JYVH 1DLEA 2PW8H 4YOJA 3GDUA 3TGKE 2A31A 1DWBH 3UFAA 3BTKE 1PJPA 1ZRKA 2FOFA 2GD4B 2XC5A 1TMUH 1SOTA 3HGNA 3S7KB 1TNLA 3MNCA 2LNCA 3SV6A 4JCNA 1HGTH 2A1DB 3A8AA 5C3NA 1ZHPA 4DY7B 4XSKU 2ULLA 1JIMA 1XX9A 2CJIA 2FOMB 4XFQA 1HJAC 1VR1H 3GY5A 4I8GA 2JKHA 3CP7A 1QRWA 2ZGXH 4ZUHA 1HAOH 2QIQA 3ZYEA 1O2RA 1TOCB 1THSH 1S6FA 1LPZB 3F9FA 2FYRA 5AVDA 1GHBF 2XXLA 1O3FA 3SJ9A 3OX7U 2P8OB 2FOGA 2XRCA 3P8GA 2CHAB 3IITA 5DP3A 1O3PB 1MTNC 1IOEA 1TPOA 2BDAA 4RKOB 3SZNA 1DM4B 1SGTA 1BMLA 4Y0ZE 1TA2A 2BD8A 3OY6U 3M36A 1O5CB 1JRTA 1C2JA 1QTFA 4MVNA 1EASA 3M7QA 2BXUH 4INLA 2ZC9H 3QLPH 2VIPA 4KTSA 1DY9A 3SU2A 1QL8A 2VIWA 4B76A 1V2RT 4JK5A 1GL1A 1ZMNA 1GPZA 4UFFH 2XNIA 2ZDAH 1YCPK 4YO9A 1ZTKA 3ZV9A 5EQSA 1S6HA 1AVXA 1GDQA 2BDCA 4ABEA 3ZVCA 3M3TA 1O37A 3WY8A 1A3EH 3RXTA 3MFJA 3LGIA 2HGTH 3MH4A 2UWOA 1TX8A 1GMCG 2FMJA 4CRGA 5IDKA 1BTPA 1T31A 5TJXA 4ZXXH 1CGIE 1HJAB 1EAIA 3SV9A 4AG1A 1OWHA 1V2UT 3M37A 1S81A 1YPMH 1TOMH 2BQ6B 3RLYH 3QZRA 1EZXC 1KYNA 1KY9A 1SR5C 1HDTH 4UDWH 3BTDE 1TPSA 3M7UA 4KGAA 2BD5A 3ZZCA 2ZFSA 3RU4E 2ZTYA 4JZEH 1O3KA 3A7TA 1GI5A 1PPHE 2JH0D 7GCHG 1AIXH 1SGFG 1HRTH 1Z8RA 4AB9A 5DP6A 2PR3A 2R0LA 3TGIE 1O5BB 1XXFA 1C5PA 3SJIA 1LVYA 1C5SA 4YOIA 1ID5H 1MD7A 2W26A 5F8TA 3TJVA 1BMNH 2TGDA 4RKJB 1SI5H 3DD2H 4KTCA 6LPRA 1INCA 1KLIH 1ANEA 1YLDA 2ZPSA 1V2MT 4GPGA 5GXPA 2GMTB 1ETRH 1FONA 1LPKB 1QL9A 3B9FH 1J15A 1C5YB 2JH5D 1YYY1 5FCRA 2O8LA 3BF6H 3MTYA 1VCPA 4NG9H 5JBBS 1O2XA 1BRAA 1AMHA 1P3CA 1P12E 1GI1A 1T4VH 5A8YA 1XXDA 1ELCA 3O8DA 1YCPM 1UO6A 1AVWA 5FXLA 1YPHE 3BV9B 2J9NA 1P9SA 3U98H 1V2KT 2XTTB 5JB9S 1H8DH 4LXBH 1UTOA 4ABBA 1ELVA 3NK8A 1EPTB 1SSXA 1C9TA 4AGKA 1GMHG 1AE8H 3HATH 4K1SA 3T28A 1GCTC 1O2KA 2V3HH 2BXTH 3A81A 1O5AB 1P05A 3S69A 5CMXH 2PSXA 1A2CH 1O34A 1SG8B 4VGCB 1BHXB 2BOHB 1FIWA 3LH3A 2A4QA 2P94A 3LGYA 4CREA 2NU0E 1BBRH 1L2EA 1BTYA 2VINA 4ZKOU 1FXYA 3RUOA 4MDSA 1LCYA 1P2KA 5SGAE 3QGJA 1O3EA 1TPPA 1L1GA 4O03A 1MZAA 2ZGBH 4AZ2B 4MPXA 3LGVA 1P04A 3TNTA 4GHQA 1CHOG 1C4V2 4IGDA 3D65E 2CF8H 1S84A 1C2GA 3ODFA 2P3UB 3STJA 1AHTH 1FPCH 2GKVE 3BG4C 1XVMA 1ZOMA 2BTCE 1G3BA 1PQ8A 4U32A 1F0UA 3E8LA 3RM2H 1C5MD 1P01A 5F8ZA 1NO9H 1L4ZA 2GZ7A 1RJXB 1SGQE 3T29A 2XC4A 4GHTA 1GJDB 3QWCH 2FPZA 1LQEA 2Z9IA 1G9IE 4IMZA 5I25A 4FVBA 5BRRE 3E0NB 1P9UA 2Y5HA 3LH1A 2WPKS 1LVOA 3F1SB 1GJ7B 1RTLA 1QURH 1O2JA 4NFFA 1ZMJA 3D49H 1C1MA 1GVKB 5T3HA 1DWCH 4AFZA 3ZZBA 5A0CA 1AB9B 1H8IH 2HNTF 4FUIA 4D7FA 3ZZAA 5LPRA 1SLUB 2AERH 1FUJA 2W3IA 4AYYB 2XBVA 1B0FA 1C1RA 1O3HA 3MNSA 3FZDA 3U69H 4BXWA 3UNSA 1G2MA 5ETXA 2SGEE 1ZR0A 2B5TB 4RN6A 5DPAA 3A8DA 3ZV8A 2VWNA 2BQWB 3QUMP 3ZVDA 1TBRH 2VB0A 1IHTH 5EXNA 2ZU3A 3NWUA 1JIRA 2QF0A 2Z7FE 3SU5A 1O5FH 3UNQA 2C8XB 4JYUH 3PTBA 1A5IA 1WAYB 1GDUA 1QRXA 2THFB 3B8JA 3T5FH 1OP0A 3RXKA 1ELTA 2Y7ZA 4AYVB 2H9EH 4NA9H 3BTTE 3V0XA 1UTJA 1W13U 2XW9A 1O3OA 3MO6A 5CHAC 1F92A 2H5DA 3ATMA 3SJOA 4Y11E 2FOEA 3F68H 3AAUA 1K1PA 1JXPA 1QY6A 1MU8B 1TA6A 3SUFA 5AFZH 4CRBA 3LPRA 3NKKA 5CE1A 3UPEA 1VJAU 3JZ2B 1KXBA 2GVFA 1QL7A 3LONA 2UUJB 2RG3A 1FY4A 2OP9A 3T25A 3TH2H 3A89A 7ESTE 4K60A 3K6ZA 3G01A 1RFNA 1P09A 4K2YA 1O2UA 1W0YH 2FYQA 1ZYOA 5K7RA 5EPYA 2DUCA 2TGTA 1T8LA 2GV7A 2NU2E 1QJ1B 1GJCB 2GCTB 1ACBE 1ZTLA 3P70B 1NPMA 2O8UA 3BG8A 3Q00A 1Z1IA 3SGAE 8KME2 5LH8A 1C5OH 1EZQA 2ZTZA 3A83A 3BTME 3GY2A 4H6TA 2G4TA 3ZZ9A 1O3JA 2QCYA 4O3UA 3P8FA 2ZWLH 2GT7A 1F5LA 1BIOA 2WPLS 2BDGA 4I8LA 1QCPA 1Q3XA 2OQ5A 4GUXA 1C1NA 1AQ7A 1GBLA 3MU1A 4X8UH 5HMAA 1BTZA 1C4U2 5EXLA 1YPJH 2BHGA 4FVDA 2FLBH 3V7TA 4J1YA 4CHAC 3GDVA 1O3CA 4JYTA 1OPHB 1GBIA 1AWFH 2P3FH 1C9PA 4XBBA 1GG6C 4X0WU 1YPHC 4B1TA 2HLCA 1EQ9A 1O2YA 1P2QA 2ZFPH 4WVPE 1IQKA 1SGEE 4BAOB 1IQJA 2PWXA 4R0IA 4WXVA 4Z0KA 1HV7A 1A46H 2VGCB 1QNJA 2ZKSA 1HBTH 2XWBI 1GGDC 2EI7A 3KL6A 2SGQE 4IC5A 2ZP0H 1LHDH 1J8AA 2QAAA 4Y7BA 1NM6A 2ALPA 4IBLH 3BTFE 4FUHA 1GBMA 2CXVA 3BTWE 3TLOA 2I6SA 2AMQA 1BBRE 1PQ5A 3K6YA 3GCOA 3HK3B 1RS0A 5C2ZA 3MWIU 4NIWA 1T7CA 1FDPA 4MNWA 1RGQA 4Y8YA 2ZGHA 5EQQA 1MAYA 3R3GB 1C2FA 1N8OB 2ZPQA 3A7VA 1LHFH 3HPTB 2Z3DA 2D1JA 2BDHA 1AE5A 1TRYA 2ILNA 4INKA 2YNAA 4HZHA 2D2DA 3NCLA 1K2I1 5DP9A 3SGBE 1CA0B 4HGCA 3SNCA 1WCZA 2WPHS 4AGJA 5GJ4B 3E3TA 3A85A 3S9CA 3UQVA 2QXHA 4DG4A 1L0ZA 3SQEE 4WMFA 1RIWB 4WJG2 3P95A 5E0HA 3KF2A 3GYLB 2Q6DA 4X8SH 1VITG 3ZZ8A 1D6WA 1ARCA 5T6FA 1W2KH 4DT7B 1PPBH 2RA3A 5F6MA 1EX3A 3SU3A 3LJJA 3MH6A 3Q3KA 1AFQC 3FP7E 1YPGH 3LU9B 3L33A 1CE5A 2FI5E 1NFWA 2P93A 5FHTA 4B71A 1BTUA 3PMBB 1C2MA 1ZMLA 3E1XB 4DIIH 1CT2E 3PWBA 1MBMA 1SQAA 3SUEA 1SLWB 2OXSA 5EW1H 1GHAG 1NROH 4Q7YA 3NPSA 2NU3E 3SI4H 1MH0A 3PMJA 5FBIA 2AMDA 1GJBB 3A8CA 4UFDH 1PPGE 2STBE 4BOHA 4CRCA 3W95A 3FP6E 1NT1A 5JBTA 1V6DA 2PUQH 1XKBC 4B73A 1AVGH 1YP9A 1J17T 1CU1A 1LHCH 3MOCA 2BB4A 1CHGA 2OC8A 2SGFE 1EXFA 2Y7XA 3BEIB 3V13A 3K2UA 1SLVB 2GP9B 2VIOA 1K1MA 2G52A 1IQNA 1D3PB 2PFEA 1MKWH 2AFQB 3RXHA 4FUFA 1Z1JA 2EA3A 4X2XA 1Z7KA 1MUEB 5FX6A 4I7YH 3DHKH 4BAHB 1AWHB 3A88A 2GV6A 4FUJA 4B2CA 2JETB 3BSQA 1AFEH 1IQFA 1EJAA 2PHBA 1SLXB 1TABE 4KTUA 3QN7A 1O2OA 1K1NA 1SQOA 1BA8B 1NFYA 3GY6A 4K69A 2J38A 3PMAB 3MHWU 4THNH 3EA9A 4NZQA 1LKAA 1QA7A 2BZAA 1WU1A 1EP5A 1WQSA 4I8JA 1BBRK 1A7SA 2PUXB 4ZMAH 4E06H 1HAGE 2ZFRH 1O3IA 2QA9E 1WV7H 3EA8A 1J14A 3UNRA 2P3TB 2W7SA 1W10U 3GY3A 1JWTA 3LDXH 2NWNA 1GWAA 4FU9A 3SNDA 4BAKB 1UTQA 3A84A 6GCHG 2BY6X 5EG4A 1THPB 2A2XH 3RLWH 1A0LA 4Z6AH 2BDIA 5EU8A 2F9OA 2F91A 5FCKA 4I32A 4UEHH 1GMDG 4XDEA 1S83A 1P10A 2WINI 1O3GA 1ELGA 4ABDA 4AFUA 1HIAB 3A7XA 2WPIS 1TNKA 1GBKA 3PLKA 1ZPBA 1H1BA 3GOVB 1W0ZU 5A0AE 3FZZA 1GI2A 1ELBA 2M5TA 4SGAE 1UHBA 2Y82A 1UTPA 2YNBA 1NN6A 3SU0A 1P02A 1MKXH 1FY3A 1Z6JH 4YT7H 1O5DH 5PTPA 3RMOH 3AASA 1GI9B 4NWLA 4IN1A 1HJ9A 2R0KA 1GBHA 3ATKA 3KIDU 1GHXH 4O97A 1P03A 2A4RA 1BQYA 5EXMA 5E2OA 1BTHH 1Y3UA 2Z9LA 4FU8A 4NSVA 1ANBA 3SN8A 3C1KA 1OS8A 2BD9A 3SNAA 4X1QU 1BT7A 2OUAA 1N1LA 1P2NA 1XMNB 2Y80A 1HXFH 1DX5M 1EOJA 3AAVA 9LPRA 3F9GA 1FNIA 1QB6A 4DOQA 2AGEX 4GVUA 5ESTE 1C1OA 3P92A 1VZQH 4YT6H 1GMHF 3S7HB 3PTNA 4AORA 1DITH 3EDXB 1GHVH 1ZHMA 3ZYDA 2EEKA