3SGQE

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgqE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgqE01
3LGIA 2BOKA 2HOBA 2Y6TA 1HJ9A 3ATLA 4FUDA 1GMCG 1LHFH 2A7JA 4RKJB 1NU9A 1V2LT 2V0BA 3PM3A 4ZHAA 2Z9KA 3U98H 4AG1A 4CHAB 4H42U 1K1JA 1EPTC 3F1SB 1GJ5H 1DLEA 4X6MA 2ZU4A 1IQKA 4D76A 5EW1H 3SJOA 3NKKA 3A8BA 4FUCA 2R3UA 1F0UA 5DPAA 1O5EH 4FUGA 1LKAA 4E7NA 3MU5A 5FPYA 1BQYA 2C3SA 4TY7A 1SPJA 1GJ6A 1SGQE 1DOJA 2ZECA 1BTWA 1T4VH 5GJ4B 2BX3A 3PLKA 1T32A 2OQ5A 4ZXYH 5DP7A 1Y5AT 2Q6DA 1FZZA 1O3KA 3RXHA 1SGDE 4I32A 3OSYA 1DWDH 1C5VA 3A89A 5AFZH 3RU4D 1V6DA 1NT1A 1TE0A 3ENSB 1RGQA 2BD7A 2BDGA 3P95A 3PO1C 1SQOA 1C9TA 4ZXXH 1A3EH 3PMJA 1E0FD 1RIWB 4GVUA 3QUMP 4NIXA 4AYYB 2ZU3A 1TGBA 3UQOA 2D26C 1AHTH 2GV7A 3A88A 1TPAE 1MAYA 2ZFPH 3U8OH 4O3UA 4X2WA 3MYWA 1DE7H 1V2WT 1O3BA 5FCKA 2ZHQH 3TH2H 4ZHMU 5TCCA 4DT7B 2P3TB 4DCDA 5GCHG 1AWFH 3T28A 9LPRA 1WQSA 3AW1A 3LIWA 3W95A 4MG3A 3BTFE 3GY6A 1W3CA 1EXFA 5FPSA 4RSPA 4ABJA 4TY6A 1QL7A 2FO9A 3A7YA 4ZKNU 3TK5A 1RTLA 2P16A 5EW2H 4GHTA 1KLTA 1GHZA 3NPSA 4NWLA 5A0CA 2FOEA 3M3SA 3SU2A 1PPCE 3SZNA 4ISLA 1FONA 2CGAA 1IQHA 1GBDA 1GBHA 1NS3A 4ZKSU 2BDAA 4GCHF 1AVWA 1J9CH 3GDSA 4ABHA 2BX4A 5DJ7A 1JXPA 1P8VC 4MPVA 2IOTA 2UUKB 2ZHFH 1TGNA 1MQ6A 5L6NH 1C2DA 1RS0A 3LH1A 3JZ1B 1SGIB 1TA2A 4UFDH 2VNTA 3ZVAA 1F5RA 5T6GA 4BAOB 6CHAB 2ZDKA 4XE4A 1NROH 1CT0E 3STJA 3KQCA 3V0XA 2HNTE 4MNXA 1C5TA 3HPTB 1C1PA 4CHAC 3PTBA 1HAVA 2VH0A 1DUAA 5JB9S 1QIXB 1DITH 8KME2 3V7TA 1K2I1 3FP7E 1QBVH 2VGCB 4D9QA 1GI4A 1H9HE 5F8XA 2AGIX 1SR5C 1ESAA 2BZAA 4DY7B 4K2YA 1D6WA 1MKXK 3ZV8A 4BAHB 1AB9B 2OC8A 4KTSA 3FP6E 4X6NA 2BY9X 3P8FA 1KSNA 1XUGA 1O3DA 2ZU1A 2H1UA 1AWHB 3A84A 1YPHE 3M3TA 2FX6A 2PV9B 1GJCB 1TOCB 5CMXH 3M7TA 1O2KA 4K3JA 1KDQB 5JPMH 4ABFA 1WBGB 3U9AH 1O3HA 2RA0A 3L6PA 2WPJS 4Z0KA 3SO3A 4X1SU 3SUFA 3SJ8A 1W7GH 1GMDF 1O2IA 2UUYA 1UTQA 2PUQH 4SGBE 1EKBB 1ZRBA 1CSOE 4NFFA 4B76A 5JBBS 2XBXA 5DP6A 2ZQ2A 2W3IA 2ANWA 2A4GA 2HGTH 3RXAA 3E6PH 2ZCHP 2PUXB 1TQ0B 5BRRE 2STAE 2THFB 3F9HA 3R0FA 1TX6A 2CV3A 2FP7B 1RIWC 3MH5A 5HGGA 3RXPA 4BANB 2CHAB 3SN8A 2XWBI 4NA8A 1EPTA 2CF9H 1GBFA 2FI3E 3A81A 4I8HA 1VITH 2AGEX 2XNIA 1SQTA 3RXSA 4DIIH 1C1RA 2A4OA 5DP3A 3E0NB 3UY9A 1NRRH 3GYLB 2H9TH 3SV6A 1XVMA 4K8YA 1TA6A 1ZGIA 4Y11E 1MTUA 4OS5A 1Y3UA 3TJUA 1A7SA 5TJXA 1S0QA 1S84A 1TBRH 4I8JA 1ELGA 1UK4A 5F8TA 1C1MA 1ABIH 1AQ7A 5DGJA 2F9PA 1TMBH 1D6RA 2OCVB 1DXPA 4THNH 3MU8A 3P6ZB 2SFAA 1D3TB 1HV7A 3D49H 2ANMH 5GXPA 3MNBA 3RMNH 4JK6A 1EQ9A 3H5CB 1K1PA 1HXEH 2WV4A 4YM9A 3LONA 1SFQB 4NZLA 1E36B 1TMTH 2OBOA 3SU4A 3TGIE 1FV9A 1F5LA 8ESTE 1GG6B 2XC0A 4Y10E 2C4FH 1W0ZU 1SGYE 1RTKA 1Y3VA 3S7KB 2GZ9A 3HATH 1MKWK 1EAUA 2Z7FE 3CP7A 3VB3A 4A1XA 2Z9IA 6CHAC 2AFQB 2FEQH 2GCHF 3T62A 5IDKA 1JBUH 1NFYA 1AE8H 3IG6B 1FXYA 5HXFA 1ZSKA 2ZO3H 3RP2A 4X8SH 1YYY1 1QB6A 1QGFA 1V2JT 4D9RA 3KNXA 4K1TA 1FI8A 1ELCA 1CHOF 1VITG 3GY8A 4CBNA 3CENA 4ABIA 2VIWA 3EA8A 3S0NA 5C3NA 4Y8YA 2FI4E 2VGCC 5G4BA 1KLJH 1YPHC 2VVUA 3MFJA 1C5WB 1TX8A 1AGJA 1HJ8A 1K1MA 1GI9B 1FY1A 1PPFE 2FLRH 3RXTA 1O2OA 3RXQA 1AB9C 1KXAA 3TH3H 1G3EA 1EAIA 4XFQA 2NU4E 4UEHH 3TGJE 4WMFA 1CT2E 1BTHH 1GJ9B 2PKAA 2QXJA 1FAKH 1XKAC 2H9EH 3P17H 4WY3A 3MI4A 3A87A 3QDZB 1KXCA 1Z7KA 3T27A 2ZDMA 1PQ8A 4INKA 1C4U2 1O2GH 4FU9A 4I8LA 1OX1A 2STBE 4ISNA 1ZZZA 4B71A 1M9UA 3Q3KA 1SSXA 5EOKA 4BTIB 2XYAA 2TGDA 1XXDA 1JIMA 1CGJE 2BLOA 1O2XA 2G52A 1FUJA 3KQBA 1MU8B 3RC5A 5JYIA 1AE5A 2IN2A 4Z6AH 5A0AE 3AVZA 4O03A 4HGCA 2BD4A 2D2DA 1HJAB 3KIDU 2HPQH 2BLQA 4NZQA 1GMHF 4I33A 1FJSA 1ELDE 3KHVA 1MD7A 1GI8B 3KN2A 1AZ8A 2CHAC 3MU1A 5E2OA 3RXRA 2UWOA 2Y7XA 3LU9B 1LDTT 2J2UA 1DUEA 1KTSB 2PTCE 3BTHE 5JBCS 1DY9A 1MTWA 1WCZA 2XW9A 4I31A 4U2WA 3U1JB 2ZU5A 3SUDA 4Q7XA 1MQ5A 1O3CA 1WQVH 2GCTB 1FY8E 1EB2A 1OS8A 3KCGH 1TPOA 1DS2E 4FUBA 4I7YH 4MDSA 2FWWA 1UVTH 3ZVFA 1GHYH 1T31A 1ZSJA 1K21H 1IAUA 2BOHB 5E0JA 4TPYA 1WOFA 1PPBH 4CRAA 2H6MA 2NU0E 3PYHA 2AIPA 6GCHF 2HLCA 1Y3YA 1UTMA 1GBMA 1THRH 2Z3EA 2A32A 2R2WU 1THSH 1OP2A 1K1IA 2G8TA 1P12E 4LK4A 1V3XA 1V2VT 1QQ4A 3Q3XA 3SU1A 2UWPA 4HTCH 4JK5A 1HXFH 4Y7AA 2ALVA 1S0RA 1P10A 1XMNB 4MLFB 3SV9A 1A1RA 2EI6A 1AU8A 1GBCA 3BTQE 1SBWA 3GDUA 1GG6C 5T3HA 2ZPRA 4X8VH 1OOKB 4X8UH 2R0KA 1TRYA 5DP8A 3UNSA 5C1UA 2GKVE 1YGCH 1HRTH 4FVBA 5L2ZH 2W26A 2A5KA 2G81E 1G9IE 2B9LA 2FS8A 4IMQA 1SGPE 5C1YA 3PTNA 2PLXA 3LGUA 3U8RH 1O2UA 1FDPA 1ELEE 1C5QA 4DG4A 1C1VH 4TYDA 1K9OE 2F9UA 4TPIZ 2ULLA 2QAAA 1XXFA 2FOAA 3ATKA 1H8IH 4D8NA 5FPTA 3UUZA 1SC8U 2Q6GA 4ZH8A 2ZFTA 1AVXA 1C1UH 5SGAE 4YESB 4O3TA 1UK3A 1XUKA 1IOEA 2ZGHA 2CMYA 1LPGB 1QBNA 2AYWA 1IQEA 3ATIA 1RD3B 1LMWB 2CN0H 1LPZB 3UTUH 1EOLA 1P2OA 2XRCA 3LC5A 3SHCH 1NRPH 1TNJA 3A7XA 1GHAF 1OWKA 1G2LA 3BTME 1TB6H 1H4WA 5I46H 2J4IA 3QGNB 3SW2B 3M37A 4MPWA 2ZTXA 1HDTH 3TNTA 3ZZDA 1C2IA 1IQIA 4NCYA 2TGAA 4CH2B 1L1GA 1GHBF 1E37B 1SGFG 3E8LA 3RXKA 3A7TA 1FIZA 4XSKU 4Q80A 1HAHH 1PPHE 5AVDA 1GVLA 1C2LA 1IQNA 1FQ3A 3LC3A 1HJAC 2H5DA 1DT2A 4PROA 2O8TA 1EJMA 3LOXA 1ABJH 2R2MB 1GJ7B 2GT7A 4XBDA 1C5OH 3VXFH 2FLBH 3EE0B 4ZROA 4MNYA 1FY4A 1NC6A 4MTBA 1GL1A 3GCOA 1CQQA 1JWTA 5EG4A 2GCTC 4A1TA 3GDVA 1Q31A 4AORA 3A80A 3MNXA 1Z71A 3CS7A 3URDA 4DJZB 2IJOB 3RXIA 4BAMB 2QF0A 3T29A 1OPHB 1MCTA 3RXOA 1QURH 1O2VA 4DIHH 1YPGH 1G3DA 2NU3E 4DOQA 1YPJH 1GBIA 1SLVB 2ESTE 2ZHEH 3HK3B 4WXVA 4ISOA 5F6MA 3BTWE 5IYTA 2GP9B 1WU1A 8GCHF 3IWMA 5FX5A 1QR3E 3UWJH 3A82A 4X0WU 3HK6B 1KXEA 3Q3YA 3ELAH 4BXSA 5DP5A 2A0QB 1OWDA 2P8OB 2OXSA 1EOJA 1QNJA 1ZMLA 1O5GH 5CE1A 1O2TA 5HM2A 2QIQA 3MH6A 3RXLA 4SGAE 1Y5BT 2AMPA 4JCNA 4JYTA 1O3JA 1FY3A 1ORFA 2ALPA 2QV1A 5JDUB 3MOCA 3ITIA 5A0BA 3SQHE 3UR9A 3UOPA 1WV7H 1BJVA 2R3YA 9ESTA 4GPGA 4X6PA 2WPKS 1DWBH 2OQUA 3RC4A 1AO5A 5DG6A 2Z9GA 1MBQA 4FUHA 2BY7X 1DVAH 1VGCB 2ZZUH 2OBQA 1IHSH 5A8XA 3B23B 2ZPQA 3T2NA 2NWNA 3RXVA 1H9LB 3ZVBA 1BB0B 1SI5H 1C5XB 2PR3A 2F83A 1A2CH 1GCTB 1ZHPA 1CHGA 1VCWA 3A86A 1C1SA 3FAOA 1S83A 1LVOA 2TRMA 4WJG2 1ZRKA 3SQEE 2ANYA 1SG8B 2ZFFH 1HFDA 1YLDA 4ABBA 5AF9H 1YBWA 2EC9H 1T7CA 2P3UB 2P94A 3TLOA 2F9NA 3RXEA 3LJJA 3RXGA 3A8AA 1GBJA 1C2HA 3OY6U 4ESTE 1AUJA 2PSXA 4AZ2B 1C1TA 1ZHMA 4D7GA 3K65B 3S9AA 1LQDB 1AY6H 5GPIB 2UUFB 1LO6A 1O3PB 1ZJDA 3GCTF 1V2RT 1BIOA 1C2KA 2A2XH 3O8RA 1A0LA 1QJ1B 2ASUB 1XUFA 3PLPA 3S69A 1W7XH 2C8ZB 2PSYA 2VIPA 1EJAA 1S6HA 3R3GB 2A1DB 3RM0H 4MNWA 3NUMA 2KAIB 3SBKA 5I25A 2HVXA 3BG4B 3SUEA 4RN6A 1Y8TA 1LCYA 2JH0D 5B6OA 2Y5HA 3ZZ9A 4IS5A 2GMTB 1O36A 1ARBA 2ZGBH 1C5UA 1O2JA 3MU0A 2BD9A 1NO9H 1JOUB 3A7WA 1C2GA 2Z94A 1DANH 1EUFA 5DK1A 3E3TA 3NK8A 4KGAA 3ZYEA 1MUEB 4UFEH 5EPNA 2O8UA 1N1LA 2O8WA 3ESTA 1YKTA 1TBQH 1TOMH 1MBMA 3RUOA 7ESTE 1LHDH 1MH0A 1MTSA 3T25A 4WH6A 4DVAU 4I8KA 1XUIA 2Z9JA 3RXCA 2Y7ZA 3P92A 5EPYA 2P93A 2FODA 2B8OH 2XC4A 3M36A 1EX3A 4IN2A 1XUJA 1O2WA 4XDEA 1P9SA 2P8OC 3ATWA 2ZI2H 2SGFE 4OS1A 1G36A 1ZGVA 2V6NA 7GCHG 1PQ7A 3M7UA 2BD2A 4H4FA 1PFXC 1TGSZ 4X2XA 4J1YA 4MVNA 1HAPH 5C67A 4IGDA 3SU6A 3NXPA 1YF4A 4NIVA 5TCAA 1IQGA 2VH6A 7LPRA 1UK2A 2FMJA 3TK6A 4RKOB 1QA0A 2J38A 3DT0H 3QZQA 1AD8H 2ZGXH 2RDLA 3MTYA 1A4WH 1O2QA 3B9FH 3SUGA 1G32B 2W7UA 3UFAA 1QQUA 4R8TB 1BMAA 3ZVDA 4X1QU 2FOHA 1ANBA 1J16A 1O2MA 2FOMB 4Y0ZE 1C1NA 1HIAA 2BVXH 3BF6H 1O3GA 4CRDA 1DDJA 1QRXA 1VGCC 4GSOA 1ESTA 4UDWH 2PFEA 3ZZBA 2JKHA 3VB5A 3LGWA 3AAVA 5K7RA 1G37A 5C5OA 3TIUA 1DX5M 1GCTC 1NPMA 3F68H 3AASA 1MD8A 1NESE 4X1PU 1GI7B 3U69H 1K1NA 1QBOA 2VWMA 1SGEE 4KKDA 2QYIA 1Z6EA 1UVUH 3K2UA 2Z3DA 1UTPA 4Y0YE 5GWZA 4Q7YA 1HLTH 4KTCA 1U6QA 1O33A 5EQQA 2ZG0H 1AN1E 1GHWH 3PV4A 1SFIA 4IW4E 2BYAX 4KP0A 4LXBH 1SB1H 1UVOA 5AHGH 1AI8H 4AYVB 2GD4B 1GJ4H 3M7QA 1MKXH 3URCA 4JZ1A 1SGFA 1BHXF 3RDZA 1UVPA 4BAQB 1Y59T 1UTJA 5EGMA 1L0ZA 3UNRA 1P04A 1O32A 1KY9A 2FXRA 3ZZ7A 1UTKA 3VPKA 3E0PB 1YP9A 2BQ6B 3BEFB 2QY0B 2CJIA 1OWEA 3HGNA 1A61H 1SLUB 1OXGA 4B2AA 1NZQH 3BTEE 1GGDB 4JZEH 3VB6A 1LVYA 3RMOH 1Q3XA 1NRQH 1UTLM 1F2SE 2BMGB 3UREA 3BG4C 2J94A 3RXBA 1YCPK 5K0HA 3OTJE 1VCPA 2GMTC 1V2QT 2Z3CA 4OS4A 1SLWB 3LGYA 2AERH 2F91A 2D8WA 3SI3H 1KXDA 2ANKH 4GUXA 1GI6A 1MZAA 3OX7U 2Q6FA 1JMOH 3QZRA 3MHWU 1P01A 3SGAE 1T8OA 3GY4A 7KMEH 4AB9A 3QTOH 3STIA 1GBTA 1MCVA 1N6XA 1K28D 1QJ7B 2C90B 4Q2KA 1SOZA 3KEEA 1D3QB 2FDAA 1V2TT 1TWXB 3ATMA 1J15A 4F49A 4A6LA 2NU2E 5DP4A 2BM2A 2SGDE 1PPZA 1QY6A 2SNVA 1AIXH 6ESTA 1WTGH 1O5CB 4IBLH 1ETSH 1PQAA 4A7IB 1O2HA 2BDBA 1UVSH 1BUIA 1OYQA 3SJIA 1BOQA 1MAXA 4UFGH 5AFYH 4LZ4B 6LPRA 3VB4A 1W8BH 1DWCH 3BTTE 4MPUA 1BTUA 1ELFA 1EATA 1D3DB 1EZSC 5J4QA 3E16B 4OS2A 2BDIA 1SVPA 1GJAB 1O38A 2JH5D 1VR1H 2BDCA 3DD2H 3B8JA 1VJ9U 1ZTJA 2VIOA 1G2MA 2RA3A 2W5EA 2ZDLA 2NU1E 2QC2A 5A2MH 4K5ZA 5GCHF 4I8GA 2VIDA 2SGPE 2VWOA 1OSSA 4WF8A 3SU3A 3TNSA 1ANDA 1OWHA 1MKWH 1TLDA 2BQWB 5ESTE 4AN7A 2BD5A 3A85A 1F0SA 3SHAH 1QL9A 2K1QA 1NU7B 1O2PA 1V2PT 4Q7ZA 3TPIZ 4YOJA 1P2QA 4GLYA 1NN6A 2M5TA 1ZSLA 1C5PA 3FZDA 1QCPA 3D62A 5FBIA 3RMMH 1BTXA 1CU1A 2J9NA 3BTGE 3P70B 2QA9E 3MU4A 2VIVA 4AFZA 1TAWA 2F9BH 2FESH 1CGIE 1NRNH 1O0DH 2XBVA 1WAYB 3HGPA 5LPRA 1ARCA 4ZKRU 1ZPZA 1L1JA 1EZUC 2BY8X 1VZQH 1CGHA 1FPCH 4A1VA 1Z8RA 1C4V2 1LKBA 3TVJB 1O3NA 2A7CA 2ZF0H 1TRNA 1GBAA 1ETTH 1RXPA 1HCGA 2EEKA 3C1KA 1A5GH 1P2MA 3I78A 2O9QA 1F0RA 1C5RA 1P2NA 4AFUA 2JETB 1YPMH 4CR9A 5LPFA 1GGDC 1A46H 3RC6A 3GY5A 1S82A 1C2JA 1ZJKA 3BEIB 1ZOMA 3GOVB 3LH3A 2BQ7B 2XWAA 4GCHG 2XBWA 1P57B 2FIRH 1DSUA 2A7HA 2YOLA 5DO4H 1OWIA 3M3VA 3MNSA 3QGJA 1GHXH 1UHBB 1HNEE 2TBSA 3O8BA 1PYTC 4NWKA 4WMEA 3SORA 2PKSB 1PPEE 1GJBB 2WPMS 1TX7A 1W13U 2A45B 3GYMA 3M5NA 4VGCB 2W3KA 3MMGA 2BD8A 2I6SA 4UE7H 4X1RU 3VEQB 3MO3A 1T8NA 4YOIA 4AGKA 1KXBA 2FTMA 1E38B 1NFWA 3M61U 5CHAC 1O2LA 2QGRA 3UR6A 3D23A 3F9GA 2VINA 5FX6A 4ASHA 1ANEA 1O35A 1Y3XA 1NRSH 3RXJA 1W0YH 3ZZAA 4FUJA 1L4DA 1SL3A 4B2CA 4OGXA 1TGTA 4OS7A 1YLCA 2OTVA 2YNAA 1O2NA 1B5GH 2AMQA 2ZCLP 5FBEA 1CVWH 1FIWA 2HWLB 1Q2WA 1S6FA 1TRMA 3VGCB 1J14A 1TFXA 2A2QH 4JMYA 1FLEE 1ELTA 1SGRE 4JZDH 1ZTKA 3PWCA 3ODDA 1P2IA 3ZZCA 5E2PA 3DHKH 1G3CA 4CRGA 2SGQE 3ZZ8A 1D3PB 3SNAA 4YT6H 1BHXB 1SHHB 2AGGX 1N8OB 4TWYA 3RXDA 1S5SA 1MTVA 2Y80A 3OYPA 1QRWA 3BSQA 3ZV9A 1IQJA 1ZPCA 1G30B 1LQEA 2Z9LA 3GISB 1C1OA 4GAWA 1E35B 2GDDA 1GMDG 2QXGA 5C20A 3KQDA 4KTUA 5H4IB 1UTOA 3SNCA 2H9HA 3NWUA 1TMUH 5FAHA 1ZR0A 2CXVA 1P9UA 1PYTD 2GVFA 2BY6X 3IITA 2P3FH 1DSTA 2QCYA 4FUFA 3PWBA 1ZHRA 1Z1JA 2G4TA 1CE5A 1W2KH 1FNIA 2HALA 1C5SA 3AW0A 3PLBA 3PROA 2G5NA 2I6QA 3UIRA 1Z8JB 1MTNB 2VIQA 4B74A 1N6YA 4IN1A 1BMLA 2PWXA 1EAWA 4JZFH 1AMHA 5C5NA 3GY7A 1UO6A 1WUNH 4ZHLU 1LHEH 1W12U 4X1NU 1ZTLA 1FN6A 1KYNA 1HAOH 3VB7A 5EU8A 4FXGH 1O2ZA 1V2NT 4DGJA 3M35A 3QWCH 1KDQA 1TYNA 1T8MA 2JETC 1VITF 2BDYA 1AZZA 4BXWA 1FAXA 4AFSA 3QK1A 3SGBE 1O3MA 1P09A 1UMAH 3F9EA 3MH4A 3L33A 3VXEH 1HGTH 1ZYOA 2RCEA 3M5OA 2OD3B 3MH7A 1Y5UT 2ZPSA 3HKJB 1C4Y2 1Z8GA 4NIWA 4WXIA 3K6YA 3DFLA 1O5FH 3EDXB 4JYVH 2PKSC 2VVVA 1TNIA 1O39A 1BMNH 1CO7E 1BTZA 1P2JA 5BPEA 1GHVH 2WPLS 3PMHB 3KL6A 1TIOA 1QFKH 1GDUA 3P8GA 4VGCC 3S9BA 1NY22 2B5TB 3M5MA 1O37A 2G4UA 3DA9B 3T5FH 2GCHG 8LPRA 2XC5A 1YPEH 1AFEH 4TWWA 3PMAB 5E0HA 5ABWA 1OYTH 5GDSH 2FM2A 3RLWH 1O3LA 3TITA 3SV2H 4WWYA 4X2YA 2BXUH 1HUTH 1ZPBA 2A5AA 1GJDB 1E34B 4FUIA 1BTYA 1CHOG 1FMGA 3UNQA 3TH4H 3LJOA 3BIUH 1GDNA 1QL8A 2A4RA 1PPGE 1RFNA 1INCA 3VGCC 1HAIH 4WVPE 3EQ0H 4O97A 3RU4T 2V3HH 2AS9A 1QJ6B 4FVDA 3O8CA 2G51A 1O31A 4NA7A 1N8OC 1TALA 5EQRA 3RXMA 2F3CE 1HYLA 2SGAA 2UWLA 3VFEA 3ZZ3A 2ZTYA 3I29A 1GBKA 1GVZA 2BLVA 2GX4A 1AKSB 5EODA 1TPPA 1BZXE 4KELA 3TJVA 2XBYA 1KXFA 4CBOA 4INHA 4CREA 4ABAA 1OP8A 1MU6B 1HAXB 1XVOA 3KQEA 1MZDA 4M7GA 4H6TA 2QF3A 4CRBA 1J8AA 1ESBA 1ELVA 4U30A 4Y8ZA 1NM6A 2P95A 3L3TA 3V3MA 4B75A 3E1XB 1WTHD 2XCFA 1A5IA 1D9IA 4O9VA 4X2VA 1BTPA 1EZQA 3SJKA 2RG3A 2BY5X 4NSVA 3D65E 5A8ZA 2XCNA 3FANA 1GMHG 2WPIS 1XX9A 5ESBA 4ZKOU 1MTNC 1TQ7B 2FS9A 2FOCA 1HAGE 1CA0B 2H5CA 5F03A 4XBBA 3PB1E 2TPIZ 2LPRA 3UWIA 1F7ZA 3Q00A 1V2MT 3CS0A 2XTTB 3EAJA 1SGTA 3M5LA 3V12A 1EB1H 1SOTA 3MWIU 1B0FA 1P3CA 1AFQB 3DUXH 4E7RG 3OU0A 3RXUA 2BB4A 5EQSA 1ZMJA 1GDQA 2ZDVH 2GGVB 1T4UH 1FY5A 1KIGH 4R0IA 5GIBA 4D7FA 2UUJB 1EP5A 1VJAU 6GCHG 1TNKA 1THPB 4FU8A 1P05A 4HZHA 5A8YA 1CA8B 4E05H 2A4QA 3BTKE 4K1SA 3QO6A 1O5AB 4IC5A 4YO9A 1TONA 3SV8A 2OLGA 2FZZA 2VWLA 1RRKA 4YLUA 1F0TA 2ZGCA 1T8LA 1FN8A 3SNBA 1JRSA 2EI7A 5ETXA 2VVCA 4NGAH 4AX9H 4Y6DA 2ZFSA 4K8BA 3A7ZA 2ZTZA 1Z1IA 3OY5U 4YT7H 3MNCA 4ISIH 2ZNKH 4BNRA 2FX4A 1YC0A 3EGKH 4AGJA 1BMMH 1O3EA 2ODQA 3TJOA 1J17T 4Y79A 1V2OT 2OINA 3SNEA 1BRBE 3GCNA 1CT4E 4AB8A 4K60A 3G01A 2QXHA 3AAUA 1AUTC 1AVGH 2ZHWH 4YOGA 2WYGA 4HI3A 4UD9H 1H1BA 2HPPH 1NFUA 4NG9H 3DFJA 2ODPA 3O8DA 1DPOA 1C5NH 3K6ZA 1DWEH 4E06H 1HAZB 1LHGH 5FXLA 2A5IA 2D1JA 5E8EH 3BV9B 5JBAS 2C8YB 3A83A 4IMZA 4DURA 1SMFE 1ANCA 3TU7H 4K69A 3SU0A 2Q1JA 2VU8E 3LT3A 1GHAG 4JZIA 4U32A 4UONA 1LPKB 2IPHA 1GVKB 1IQMA 2O8LA 1BBRK 2C8XB 1C2EA 4XBCA 1GMCF 3SOSA 2ILNA 1P02A 1F92A 5T6FA 3SGQE 1UHBA 3LPRA 3W94A 1EJNA 2Z6BD 2R9PA 2G5VA 2ZGJA 1GHBG 3GY3A 4B73A 3F6UH 1DM4B 4BAKB 1SLXB 2AEIH 1P06A 3RXFA 3KF2A 4CR5A 2ZA5A 1C5MD 3QN7A 3ZZ4A 1RTFB 3U8TH 4YZUA 3S9CA 3MO9A 1HB0B 3ZVCA 2LNCA 1IHTH 1DY8A 1QRZA 1CA0C 1IQFA 2AMDA 4BTTB 1V2ST 2J92A 3BG8A 4CRFA 5PTPA 3A7VA 4WH8A 2Y82A 1K1OA 3I77A 3QX5H 2BVSH 5LGOA 2VWNA 4QT8C 5HM9A 1DXWA 1AFQC 1GPZA 2HNTC 4INLA 1G3BA 1JRTA 3NZIA 1SGCA 2ZHDA 1OKXA 2ZP0H 2C93B 2SNWA 1QA7A 2V3OH 2OC1A 1C5YB 5T6DA 1S81A 5CHAB 3UPEA 1H8DH 1L2EA 4X6OA 1RJXB 3GICB 3UOUA 2C8WB 2G55A 1TPSA 4MQAA 1GBLA 2ZIQH 4Y8XA 8GCHG 2VB0A 5A09A 1W14U 1Z6JH 2HRVA 1UCYK 1XUHA 2SGEE 3ODFA 2ZC9H 4NSYA 1BRCE 3RLYH 1A5HA 3TK9A 1O2RA 1O2YA 4J2YB 4H6SB 1BBRH 1SGNE 1WYKA 2FOGA 3FP8E 1A0JA 3GCHB 2A31A 1FPHH 2FOBA 1ACBE 5J4SA 2QXIA 2TIOA 1ZMNA 1W11U 1CBWB 3UQVA 3JZ2B 3RMLH 3EA9A 3WY8A 1X7AC 2PTNA 4A92A 4CRCA 1EAXA 2ZWLH 3BEUA 4JYUH 4A5TS 1XM1A 1HAVB 5F8ZA 1W10U 1O34A 1YCPH 1BBRE 4CH8B 2EA3A 3QTVH 4YTAA 5EXMA 1KLIH 1UTNA 1BCUH 2BD3A 3BTDE 1SHYA 2WPHS 5E0GA 1HAYB 2FOFA 4Y7BA 4Y76A 1HBTH 1TNHA 2BLWA 2TGPZ 2BZ6H 1PJPA 2OC0A 4B2BA 4XOJA 3E91A 2V35A 1IQLA 1O3FA 2WUBA 1P3EA 3LKWA 5L2YH 3QLPH 2J95A 3ZYDA 1NFXA 2GT8A 4FU7A 1C2MA 1LTOA 2F9VA 3K9XB 5L30H 2PHBA 1GL0E 4FUEA 5LPEA 2FI5E 2GDEH 1C1WH 3H7TA 2XXLA 1O30A 3FZZA 2TGTA 3MO6A 1GBBA 1GI1A 2GV6A 1UCYH 3NCLA 3Q77A 3F9FA 1LHCH 1EP6A 1EASA 1HIAB 1O3IA 2DE8A 4YLQH 2J34A 1A0HB 1EZXC 1GJ8B 1GBEA 2ZFQH 3GCTG 1GCDA 4ABGA 2AIQA 1F5KU 4ABDA 5FHTA 1QB9A 2VJ1A 2ZQ1A 1JIRA 4OGYA 2ZKSA 1XKBC 3RU4E 1EPTB 1UCYE 2WUCA 2ZCKP 4ZAEA 2F9OA 2BVRH 1V2KT 2OUAA 1MMJN 7GCHF 1BJUA 1B0EA 5EXNA 1TGCA 5C1XA 2EI8A 1ZLRA 4NA9H 1ETRH 2FYQA 1O2SA 2FYRA 2FPZA 4ISHH 1YCPM 2P59A 1P0SH 2DE9A 1A3BH 1TBZH 3SV7A 1K22H 4LOYH 3BN9A 2ODYB 2ZDNA 1O3OA 3U1IB 4ABEA 4ZMAH 5HMAA 1Y3WA 3Q76A 3A8CA 1D4PB 2HNTF 1BITA 1GWAA 4OS6A 2AH4X 4DW2U 1H9IE 1P11E 2OP9A 3T26A 2ZDAH 3H7OA 4U01A 2W7SA 5JB8S 4GHQA 1AKSA 1TNLA 4UFFH 1DICA 1B7XB 1BA8B 1L1NA 4BOHA 1SQAA 3GY2A 3EYDA 3EA7A 3E90B 1YPKH 5DP9A 1BRUP 2JH6D 1ID5H 2H2ZA 1QTFA 1O3AA 1GI0A 1VCQA 2BHGA 3GCHC 3N7OA 2OC7A 4AG2A 3ZZ5A 2Y5GA 3P8OA 1BT7A 1YM0A 1KTTB 1C5LH 1O5BB 5JBTA 3PO1B 2GZ7A 5HYOA 1BDAA 2G00A 2KAIA 1CBWC 1P2KA 3C27B 4B1TA 3SU5A 1OP0A 3RM2H 2DUCA 3BIVH 3FFGA 1WSSH 4MPXA 1C5ZB 5EXLA 1LVBA 2GZ8A 2FTLE 4WMDA 2ZU2A 3SI4H 1C9PA 3SJ9A 3PMBB 3LDXH 1ELBA 1V2UT 4ZUHA 1LVMA 4X8TH 4AOQA 3ZZ6A 2WV5A 2QN5T 1HPGA 4HFPB 1K1LA 1NTPA 2BXTH 1L4ZA 1ELAA 1UJ1A 4BTUB 2BTCE 2B0FA 3P8NA 1P03A 3FVFB 4AFQA 2O8MA 1DFPA 1DLKB 1GI2A 2PGQB 1BRAA 2B7DH 3TGKE 2ZFRH 3TJNA 1GI5A 2PKAB 3ZVGA 4Y71A 3LGTA 5DKMA 2ZEBA 2WINI 5FCRA 2BDHA 2PW8H 2R0LA 5C2ZA 4F4OC 4NFEA 1C2FA 3KGPA 1TNGA 3A8DA 3S7HB 1YPLH 1TABE 2Y5FA 1PQ5A 4IC6A 1QHRB 3LGVA 1Z8IB 2PGBB 3V13A 3HKIB 2CF8H 2WYJA 1C1QA 1OWJA 3SNDA 5LH8A 4NIYA 1O5DH 2YNBA 4K1EA 2GTBA 4MNVA 1S85A 2Y81A 3ZVEA 1GI3A 4LZ1H 1QB1A
chains in the Genus database with same CATH superfamily
3LGIA 2BOKA 2HOBA 2Y6TA 1HJ9A 3ATLA 4FUDA 1GMCG 1LHFH 2A7JA 4RKJB 1NU9A 1V2LT 5EJZA 4ZCNA 2V0BA 3PM3A 4ZHAA 2Z9KA 3U98H 4AG1A 4CHAB 4H42U 1K1JA 1EPTC 3F1SB 1GJ5H 1DLEA 4X6MA 2ZU4A 5FL7D 1H8ED 1IQKA 4D76A 5EW1H 3SJOA 3NKKA 3A8BA 4FUCA 2QF5A 2R3UA 1F0UA 5DPAA 1O5EH 4FUGA 1LKAA 4E7NA 3MU5A 5FPYA 1BQYA 2C3SA 4TY7A 1SPJA 1GJ6A 1SGQE 1DOJA 2ZECA 1BTWA 1MABB 1T4VH 5GJ4B 2BX3A 3PLKA 1T32A 2OQ5A 2GJGA 4ZXYH 5DP7A 1Y5AT 2Q6DA 1FZZA 1O3KA 3RXHA 1SGDE 4I32A 3OSYA 1DWDH 1C5VA 3A89A 3OFND 5AFZH 3RU4D 1V6DA 1NT1A 1TE0A 3ENSB 1RGQA 2BD7A 2BDGA 3P95A 3PO1C 1SQOA 1C9TA 4ZXXH 1A3EH 3PMJA 1E0FD 1RIWB 4GVUA 3QUMP 4NIXA 4AYYB 2ZU3A 1TGBA 3UQOA 2D26C 1AHTH 2GV7A 3A88A 1TPAE 1MAYA 2ZFPH 3U8OH 4O3UA 4X2WA 3MYWA 1DE7H 1V2WT 2L74A 1O3BA 5FCKA 2ZHQH 1QZ8A 3TH2H 4ZHMU 5TCCA 4DT7B 2P3TB 4DCDA 5GCHG 1AWFH 3T28A 9LPRA 1WQSA 3AW1A 3LIWA 3N7DA 3W95A 4MG3A 3BTFE 3GY6A 1W3CA 1EXFA 5FPSA 4RSPA 4ABJA 4TY6A 1QL7A 2FO9A 3A7YA 4ZKNU 3TK5A 1RTLA 2P16A 5EW2H 4GHTA 1KLTA 1GHZA 3NPSA 4NWLA 5A0CA 2FOEA 3M3SA 3SU2A 1PPCE 3SZNA 4ISLA 1FONA 2CGAA 2IJD1 1IQHA 1GBDA 1GBHA 1NS3A 2YMSD 4ZKSU 2BDAA 4GCHF 1AVWA 1J9CH 3GDSA 4ABHA 5KGOA 2BX4A 5DJ7A 1JXPA 1P8VC 4MPVA 2IOTA 2UUKB 2ZHFH 1TGNA 1MQ6A 5L6NH 1C2DA 1RS0A 3LH1A 3JZ1B 1SGIB 1TA2A 4UFDH 2VNTA 3ZVAA 1F5RA 5T6GA 4BAOB 6CHAB 3GS9A 2ZDKA 4XE4A 1NROH 1CT0E 3F3BA 3STJA 3KQCA 3V0XA 2HNTE 4MNXA 3SZEA 1C5TA 3HPTB 1C1PA 4CHAC 5C0UA 3PTBA 5EJ1A 5KECA 1HAVA 3EE7A 2VH0A 1DUAA 5JB9S 1QIXB 1DITH 8KME2 3V7TA 1K2I1 3FP7E 1QBVH 2VGCB 4D9QA 1GI4A 1H9HE 5F8XA 2AGIX 1SR5C 1ESAA 2BZAA 4DY7B 4K2YA 1D6WA 1MKXK 3ZV8A 4BAHB 1AB9B 2OC8A 4KTSA 3FP6E 4X6NA 2BY9X 3P8FA 1KSNA 1XUGA 1O3DA 2ZU1A 2H1UA 1AWHB 3A84A 1YPHE 3M3TA 2FX6A 2PV9B 1GJCB 1TOCB 5CMXH 3M7TA 1O2KA 4K3JA 1KDQB 5JPMH 4ABFA 1WBGB 3U9AH 1O3HA 2RA0A 3L6PA 2WPJS 4Z0KA 3SO3A 4X1SU 3SUFA 3SJ8A 1W7GH 4XD7D 1GMDF 1O2IA 2UUYA 1UTQA 2PUQH 4SGBE 1EKBB 1ZRBA 1CSOE 4NFFA 4ACBA 4B76A 5JBBS 2XBXA 5DP6A 2ZQ2A 2W3IA 2ANWA 2A4GA 2HGTH 3RXAA 3E6PH 2ZCHP 2PUXB 1TQ0B 5BRRE 2STAE 2THFB 3F9HA 3R0FA 1TX6A 2CV3A 2FP7B 2JJ2D 1RIWC 5HIYA 3MH5A 5HGGA 3RXPA 4BANB 2CHAB 3SN8A 3WWBA 2XWBI 3PRBA 4NA8A 1EPTA 2CF9H 1GBFA 2FI3E 3A81A 4I8HA 1VITH 2AGEX 2XNIA 1SQTA 3RXSA 4DIIH 1C1RA 2A4OA 5DP3A 3E0NB 3UY9A 1NRRH 3GYLB 2H9TH 3SV6A 1XVMA 4K8YA 1TA6A 1ZGIA 4Y11E 1MTUA 4OS5A 1Y3UA 3TJUA 1A7SA 5TJXA 1S0QA 1S84A 1TBRH 4I8JA 1ELGA 1UK4A 5F8TA 1C1MA 1ABIH 1AQ7A 5DGJA 2F9PA 1TMBH 1D6RA 2OCVB 1DXPA 4THNH 3MU8A 3P6ZB 1W0JD 1D3TB 2SFAA 4HG6A 1HV7A 3D49H 2ANMH 5GXPA 3MNBA 3RMNH 4JK6A 1EQ9A 3H5CB 2XOKD 1K1PA 1HXEH 2WV4A 4YM9A 3LONA 1SFQB 4NZLA 1E36B 1TMTH 2OBOA 3SU4A 3TGIE 1FV9A 3FN8A 1F5LA 8ESTE 1GG6B 2XC0A 4Y10E 2C4FH 1W0ZU 1SGYE 1RTKA 1Y3VA 3KQ5A 3S7KB 2GZ9A 3HATH 1MKWK 1EAUA 2Z7FE 3CP7A 3VB3A 4A1XA 2Z9IA 6CHAC 2AFQB 2FEQH 2GCHF 3T62A 5IDKA 1JBUH 1NFYA 5EIYA 1AE8H 3IG6B 1FXYA 5HXFA 1ZSKA 2ZO3H 3RP2A 3FKSD 4X8SH 1YYY1 1QB6A 1QGFA 1V2JT 4D9RA 3KNXA 4K1TA 3WWFA 1FI8A 1ELCA 1CHOF 1VITG 3GY8A 4CBNA 3CENA 4ABIA 3F0PA 2VIWA 3EA8A 3S0NA 5C3NA 4Y8YA 2FI4E 2VGCC 5G4BA 1KLJH 1YPHC 2VVUA 3MFJA 1C5WB 1TX8A 1AGJA 1HJ8A 1K1MA 1GI9B 1FY1A 1PPFE 2FLRH 3RXTA 1O2OA 3RXQA 2WZQA 1AB9C 1KXAA 3TH3H 1G3EA 1EAIA 4XFQA 2NU4E 4UEHH 3TGJE 4WMFA 1CT2E 1BTHH 1GJ9B 2PKAA 2QXJA 1FAKH 1XKAC 2H9EH 3P17H 4WY3A 3MI4A 3A87A 3QDZB 1KXCA 1Z7KA 3T27A 2ZDMA 1PQ8A 4INKA 1C4U2 1O2GH 4FU9A 4I8LA 1OX1A 2STBE 4ISNA 1ZZZA 4B71A 1M9UA 3Q3KA 1SSXA 5EOKA 4BTIB 2XYAA 2TGDA 2J98A 1XXDA 1JIMA 1CGJE 2BLOA 1O2XA 2G52A 1FUJA 3KQBA 1MU8B 3RC5A 3ZIAD 1AE5A 5JYIA 2IN2A 4Z6AH 5A0AE 3AVZA 4O03A 5KEDA 4HGCA 2BD4A 2D2DA 1HJAB 3KIDU 2HPQH 2BLQA 4NZQA 1GMHF 4I33A 1FJSA 1ELDE 3KHVA 1MD7A 1GI8B 3KN2A 1AZ8A 2CHAC 3MU1A 5E2OA 3RXRA 2KM0A 2UWOA 2Y7XA 3LU9B 1LDTT 2J2UA 1DUEA 1KTSB 2PTCE 3BTHE 5JBCS 1DY9A 1MTWA 1WCZA 2XW9A 4I31A 4U2WA 3U1JB 2KR7A 2ZU5A 3SUDA 4Q7XA 1MQ5A 1O3CA 1WQVH 2GCTB 1FY8E 1EB2A 1OS8A 3KCGH 1TPOA 1DS2E 4FUBA 3DSOA 4I7YH 4MDSA 2FWWA 1UVTH 3ZVFA 1GHYH 1T31A 1ZSJA 1K21H 1IAUA 2BOHB 5E0JA 3FOAA 4TPYA 1WOFA 1PPBH 4CRAA 2H6MA 2NU0E 3PYHA 2AIPA 6GCHF 2HLCA 1Y3YA 2QF4A 1UTMA 1GBMA 1THRH 2Z3EA 2A32A 2R2WU 1THSH 1OP2A 1K1IA 2G8TA 1P12E 4LK4A 1V3XA 1V2VT 1QQ4A 3Q3XA 3SU1A 2UWPA 4HTCH 4JK5A 1HXFH 4Y7AA 2ALVA 1S0RA 1P10A 1XMNB 4MLFB 3SV9A 1A1RA 2EI6A 1AU8A 1GBCA 3BTQE 1SBWA 3GDUA 1GG6C 5T3HA 2ZPRA 3F2GA 4X8VH 2F43B 1OOKB 4X8UH 2R0KA 1TRYA 5DP8A 3UNSA 5C1UA 2GKVE 1YGCH 1HRTH 1YY3A 4FVBA 3F2HA 2W26A 5L2ZH 2A5KA 2G81E 1G9IE 2B9LA 2FS8A 4IMQA 1SGPE 4FOUC 5C1YA 3PTNA 2V7QD 2PLXA 3LGUA 3U8RH 1O2UA 1FDPA 1ELEE 1C5QA 4DG4A 1C1VH 4TYDA 1K9OE 2F9UA 4TPIZ 2ULLA 2QAAA 1XXFA 2FOAA 3ATKA 1H8IH 2PP6A 5FPTA 4D8NA 3UUZA 1SC8U 4XRNA 4ZH8A 2Q6GA 5CDFE 2ZFTA 1AVXA 1C1UH 5SGAE 4YESB 4O3TA 1UK3A 1XUKA 1IOEA 2ZGHA 2CMYA 1LPGB 1QBNA 2AYWA 2WV9A 2RFKC 1IQEA 3ATIA 1RD3B 1LMWB 2CN0H 1LPZB 3UTUH 1EOLA 1P2OA 2XRCA 3LC5A 3SHCH 1NRPH 1TNJA 3A7XA 1GHAF 1OWKA 1G2LA 3BTME 1TB6H 1H4WA 5I46H 2J4IA 3QGNB 3SW2B 3M37A 4MPWA 4RT0A 2ZTXA 1HDTH 2K8IA 3TNTA 3ZZDA 1C2IA 1IQIA 4NCYA 2V3MA 2TGAA 4CH2B 1L1GA 1GHBF 3OAAD 1E37B 1SGFG 3E8LA 3RXKA 3A7TA 1FIZA 4XSKU 4Q80A 1HAHH 1PPHE 5AVDA 1GVLA 1C2LA 2JDID 1IQNA 1FQ3A 3LC3A 1HJAC 2H5DA 1DT2A 4PROA 2O8TA 1EJMA 3LOXA 5C0TA 1ABJH 2R2MB 1GJ7B 4P00A 2GT7A 4XBDA 1C5OH 3VXFH 2FLBH 3EE0B 4ZROA 4MNYA 1FY4A 1NC6A 4MTBA 1GL1A 3GCOA 1CQQA 1JWTA 5EG4A 3UB0A 2GCTC 4A1TA 3GDVA 1Q31A 4AORA 3A80A 3MNXA 1Z71A 1WDIA 3CS7A 3URDA 4DJZB 4DT4A 2IJOB 3RXIA 3AK5A 4BAMB 2QF0A 3T29A 1OPHB 1MCTA 3F0OA 3RXOA 1QURH 1O2VA 4DIHH 1YPGH 1G3DA 2NU3E 4DOQA 1YPJH 1GBIA 1SLVB 2ESTE 2ZHEH 3HK3B 4F55A 4WXVA 4ISOA 5F6MA 3BTWE 5IYTA 2GP9B 1WU1A 8GCHF 3IWMA 5FX5A 1QR3E 3UWJH 3A82A 4X0WU 1VKYA 3HK6B 1KXEA 3Q3YA 3ELAH 4BXSA 5DP5A 2A0QB 1OWDA 2P8OB 2OXSA 3PV2A 1EOJA 1QNJA 1ZMLA 1O5GH 5CE1A 1O2TA 5HM2A 2QIQA 3MH6A 3RXLA 4SGAE 1Y5BT 2AMPA 4JCNA 4JYTA 1O3JA 1FY3A 1ORFA 2ALPA 2QV1A 5JDUB 3MOCA 3ITIA 5A0BA 3SQHE 3UR9A 3UOPA 1WV7H 1BJVA 2R3YA 9ESTA 4GPGA 4X6PA 2AHME 2WPKS 1DWBH 2OQUA 3RC4A 1AO5A 5DG6A 2Z9GA 1MBQA 4FUHA 2BY7X 1DVAH 1VGCB 2ZZUH 2OBQA 1IHSH 5A8XA 3B23B 2ZPQA 3T2NA 2NWNA 3RXVA 1H9LB 3ZVBA 1BB0B 1SI5H 1C5XB 2PR3A 2F83A 1A2CH 1GCTB 1ZHPA 4TT3D 4ACAA 1CHGA 1VCWA 3A86A 1C1SA 2J5UA 3FAOA 1S83A 1LVOA 2TRMA 4WJG2 1ZRKA 3SQEE 2ANYA 1SG8B 2ZFFH 1HFDA 1YLDA 4ABBA 5AF9H 1YBWA 2EC9H 1T7CA 2P3UB 2P94A 3TLOA 2F9NA 3RXEA 3LJJA 3RXGA 3A8AA 2CK3D 1GBJA 1C2HA 3OY6U 4ESTE 1AUJA 2PSXA 4AZ2B 1C1TA 1ZHMA 4D7GA 3K65B 3S9AA 1LQDB 1AY6H 5GPIB 2UUFB 1LO6A 1O3PB 1ZJDA 3GCTF 1V2RT 1BIOA 1C2KA 2A2XH 3O8RA 1A0LA 1UW7A 1QJ1B 2ASUB 1XUFA 3PLPA 3S69A 1W7XH 3KYFA 2C8ZB 2PSYA 2VIPA 1EJAA 1S6HA 3R3GB 2A1DB 3RM0H 4MNWA 3NUMA 2KAIB 3SBKA 5I25A 2HVXA 3BG4B 3SUEA 4RN6A 1Y8TA 1LCYA 3PRDA 2JH0D 3OEED 5B6OA 2Y5HA 3H09A 3ZZ9A 4IS5A 2GMTB 1O36A 1ARBA 2ZGBH 1C5UA 1O2JA 3MU0A 3SYJA 2BD9A 1NO9H 1JOUB 3A7WA 1C2GA 2Z94A 1DANH 1EUFA 5DK1A 3E3TA 3NK8A 4KGAA 3ZYEA 1MUEB 4UFEH 5EPNA 2O8UA 1N1LA 2O8WA 3ESTA 1YKTA 1TBQH 1TOMH 2XNDD 1MBMA 3RUOA 7ESTE 1LHDH 3KYGA 1MH0A 1MTSA 3T25A 4WH6A 4DVAU 4I8KA 1XUIA 2Z9JA 3RXCA 2Y7ZA 3P92A 5EPYA 2P93A 2FODA 3NRLA 5IK2D 2B8OH 2JIZD 2XC4A 3M36A 1EX3A 4IN2A 1XUJA 5C17A 1O2WA 4XDEA 1P9SA 2P8OC 3ATWA 1COWD 2ZI2H 2SGFE 4OS1A 1G36A 1ZGVA 1K0HA 2HVYB 2V6NA 7GCHG 1PQ7A 3M7UA 2BD2A 4H4FA 1PFXC 1TGSZ 4X2XA 4J1YA 4MVNA 1HAPH 5C67A 4IGDA 3SU6A 3NXPA 1YF4A 4NIVA 5TCAA 1IQGA 2VH6A 7LPRA 1UK2A 2FMJA 3TK6A 4RKOB 1QA0A 2J38A 3DT0H 3QZQA 1AD8H 2ZGXH 2RDLA 3MTYA 1A4WH 1O2QA 3B9FH 3SUGA 1G32B 2W7UA 3UFAA 1QQUA 4R8TB 1BMAA 3ZVDA 2LP6A 4X1QU 2FOHA 1ANBA 1J16A 1O2MA 2FOMB 4Y0ZE 1C1NA 1HIAA 2BVXH 3BF6H 1O3GA 4YXWD 4CRDA 1DDJA 1QRXA 1VGCC 4GSOA 1ESTA 4UDWH 2PFEA 3ZZBA 2JKHA 3VB5A 3LGWA 3AAVA 5K7RA 1G37A 5C5OA 3TIUA 1DX5M 1GCTC 1NPMA 2LELA 3F68H 3AASA 1MD8A 2L6OA 1NESE 3VG8A 4X1PU 1GI7B 3U69H 1K1NA 1QBOA 2VWMA 1SGEE 4KKDA 2QYIA 1Z6EA 1UVUH 3K2UA 2Z3DA 1UTPA 4Y0YE 5GWZA 4Q7YA 1HLTH 4KTCA 1U6QA 1O33A 5EQQA 2ZG0H 1AN1E 1GHWH 2W6JD 3PV4A 1SFIA 4IW4E 2BYAX 4KP0A 4LXBH 1SB1H 3DSGA 1UVOA 5AHGH 1AI8H 4AYVB 2GD4B 1GJ4H 3M7QA 1MKXH 3URCA 4JZ1A 1SGFA 1BHXF 3RDZA 1UVPA 4BAQB 1Y59T 1UTJA 5EGMA 1L0ZA 3UNRA 1P04A 1O32A 1KY9A 2FXRA 3ZZ7A 1UTKA 3VPKA 3E0PB 1YP9A 2BQ6B 3BEFB 4ASUD 2QY0B 2CJIA 1OWEA 3HGNA 1A61H 1SLUB 1OXGA 4B2AA 1NZQH 3BTEE 1GGDB 2EY4C 4JZEH 1LVYA 3RMOH 3VB6A 1Q3XA 1NRQH 1UTLM 1F2SE 2BMGB 3UREA 3BG4C 2J94A 3RXBA 1YCPK 5K0HA 3OTJE 1VCPA 2GMTC 1V2QT 2Z3CA 4OS4A 1SLWB 3LGYA 2AERH 2F91A 2D8WA 3F2FA 3SI3H 1KXDA 2ANKH 4GUXA 1GI6A 1MZAA 3OX7U 2Q6FA 1JMOH 3QZRA 3MHWU 1P01A 3SGAE 1T8OA 3GY4A 7KMEH 4AB9A 3QTOH 3STIA 1GBTA 1MCVA 1N6XA 1K28D 1QJ7B 2C90B 4Q2KA 1SOZA 4OM9A 3KEEA 1D3QB 2FDAA 1V2TT 1TWXB 3ATMA 1J15A 4F49A 2EQNA 4A6LA 2NU2E 5DP4A 2BM2A 2SGDE 1PPZA 1QY6A 2SNVA 1AIXH 6ESTA 1WTGH 1O5CB 4IBLH 1ETSH 1PQAA 4A7IB 1O2HA 2BDBA 1UVSH 1BUIA 1OYQA 3SJIA 1BOQA 1MAXA 4UFGH 5AFYH 4LZ4B 6LPRA 3VB4A 1W8BH 1DWCH 3BTTE 4MPUA 1BTUA 1ELFA 1EATA 1D3DB 1EZSC 5J4QA 3E16B 4OS2A 2BDIA 1SVPA 1GJAB 1O38A 2JH5D 1VR1H 2BDCA 5C94A 3DD2H 3B8JA 1VJ9U 1ZTJA 2VIOA 1G2MA 2RA3A 2W5EA 2ZDLA 2NU1E 2QC2A 5A2MH 4K5ZA 5GCHF 4I8GA 2VIDA 2SGPE 2VWOA 1OSSA 4WF8A 3SU3A 3TNSA 1ANDA 1OWHA 1MKWH 1TLDA 2BQWB 5ESTE 4AN7A 2BD5A 3A85A 1F0SA 3SHAH 1QL9A 2K1QA 1NU7B 1O2PA 1V2PT 4Q7ZA 3TPIZ 4YOJA 1P2QA 4GLYA 1NN6A 1W0KD 1ZSLA 1C5PA 2M5TA 3FZDA 1QCPA 3D62A 5FBIA 1YWUA 3RMMH 1BTXA 1CU1A 2J9NA 3BTGE 3P70B 2QA9E 2W6ID 2WHXA 3MU4A 2VIVA 4AFZA 1TAWA 2F9BH 1SKYE 2FESH 1CGIE 5F53A 1NRNH 1O0DH 2XBVA 1WAYB 3HGPA 5LPRA 2RDEA 1ARCA 4ZKRU 1ZPZA 1L1JA 1EZUC 2BY8X 1VZQH 1CGHA 1FPCH 4A1VA 1Z8RA 1C4V2 1LKBA 3TVJB 1O3NA 2A7CA 2ZF0H 1TRNA 3DCLA 1GBAA 1ETTH 1RXPA 1HCGA 2EEKA 3C1KA 1A5GH 1P2MA 3I78A 1F0RA 2O9QA 1C5RA 1P2NA 4AFUA 2JETB 1YPMH 4CR9A 5LPFA 1GGDC 1A46H 3RC6A 3GY5A 1S82A 4RI0A 1C2JA 1ZJKA 3BEIB 1ZOMA 3GOVB 3LH3A 2BQ7B 2XWAA 1NBME 2XBWA 4GCHG 1P57B 2FIRH 1DSUA 2A7HA 2YOLA 5DO4H 1WXRA 1OWIA 3M3VA 3MNSA 3QGJA 3MQKC 1GHXH 1UHBB 1HNEE 2TBSA 3O8BA 1PYTC 4NWKA 4WMEA 3SORA 2PKSB 1PPEE 1GJBB 2WPMS 1TX7A 1W13U 2A45B 3GYMA 3M5NA 4VGCB 2OK5A 2W3KA 3MMGA 2BD8A 2I6SA 4UE7H 3DSPA 4X1RU 3VEQB 3MO3A 1T8NA 4YOIA 4AGKA 4P02A 1KXBA 2FTMA 1E38B 1NFWA 3M61U 5CHAC 1O2LA 2QGRA 3UR6A 2YMSB 3D23A 3F9GA 2VINA 5FX6A 4ASHA 1ANEA 1O35A 1Y3XA 1NRSH 3RXJA 1W0YH 3ZZAA 4FUJA 1L4DA 1SL3A 4B2CA 4OGXA 1TGTA 4OS7A 1YLCA 2OTVA 2YNAA 1O2NA 1B5GH 2AMQA 2KCOA 2ZCLP 5FBEA 1CVWH 1FIWA 2HWLB 1Q2WA 1S6FA 1TRMA 3VGCB 1J14A 1TFXA 2A2QH 4FETA 1FX0B 4JMYA 1FLEE 4I86A 1ELTA 1SGRE 4JZDH 1ZTKA 3PWCA 3ODDA 1P2IA 3ZZCA 5E2PA 3DHKH 1G3CA 4CRGA 2SGQE 3ZZ8A 1D3PB 3SNAA 2KFWA 4YT6H 1BHXB 1SHHB 4AC9A 2KCAA 2AGGX 1N8OB 4TWYA 3RXDA 3FO8D 1S5SA 1MTVA 2Y80A 3OYPA 1QRWA 3BSQA 3ZV9A 1IQJA 1ZPCA 1G30B 1LQEA 2Z9LA 3GISB 1C1OA 4GAWA 1E35B 2GDDA 1GMDG 2QXGA 5C20A 3KQDA 4KTUA 5H4IB 1UTOA 3SNCA 2H9HA 3NWUA 1TMUH 5FAHA 1ZR0A 2CXVA 1P9UA 1PYTD 2GVFA 2BY6X 3IITA 2P3FH 1DSTA 2QCYA 4FUFA 3PWBA 1ZHRA 1Z1JA 2G4TA 1CE5A 1W2KH 1FNIA 2HALA 1C5SA 3AW0A 3PLBA 3PROA 2G5NA 2I6QA 3CNRA 3UIRA 1Z8JB 1MTNB 2VIQA 4B74A 4B6EA 1N6YA 4IN1A 1BMLA 2PWXA 1EAWA 4JZFH 1AMHA 2VBCA 5C5NA 3GY7A 1UO6A 1WUNH 4ZHLU 1LHEH 1W12U 4X1NU 1ZTLA 1FN6A 2KCYA 2J98B 1KYNA 1HAOH 3VB7A 5EU8A 4FXGH 1O2ZA 1V2NT 4DGJA 3M35A 3QWCH 1KDQA 3OTPA 1TYNA 1T8MA 2JETC 1VITF 2BDYA 1AZZA 4BXWA 1FAXA 4AFSA 3QK1A 3SGBE 1O3MA 1P09A 1UMAH 3F9EA 3MH4A 3L33A 3VXEH 1HGTH 1ZYOA 2RCEA 3M5OA 2OD3B 3MH7A 1Y5UT 2ZPSA 3HKJB 1C4Y2 1Z8GA 4NIWA 1E1RD 3K6YA 4WXIA 3DFLA 1O5FH 3EDXB 4JYVH 2HLDD 2PKSC 2J97A 1TNIA 2VVVA 1O39A 1BMNH 1CO7E 1BTZA 1P2JA 5BPEA 1GHVH 2WPLS 3PMHB 3KL6A 1TIOA 1QFKH 1GDUA 3P8GA 4VGCC 3S9BA 1NY22 2B5TB 3M5MA 1O37A 2G4UA 3DA9B 3T5FH 2GCHG 8LPRA 2XC5A 1YPEH 1AFEH 4TWWA 3PMAB 5E0HA 5ABWA 1OYTH 5GDSH 2FM2A 3RLWH 1O3LA 3TITA 3SV2H 2YMSC 4WWYA 2BXUH 4X2YA 1HUTH 1ZPBA 2A5AA 1GJDB 1E34B 4FUIA 1BTYA 1CHOG 1FMGA 3UNQA 3TH4H 3LJOA 3BIUH 1GDNA 1QL8A 2A4RA 1PPGE 1RFNA 1INCA 3VGCC 1HAIH 4WVPE 3EQ0H 4O97A 3RU4T 3UAIC 2V3HH 2AS9A 1QJ6B 1NBMD 4FVDA 3O8CA 2G51A 1O31A 4NA7A 3N99A 1N8OC 1TALA 5EQRA 3RXMA 2F3CE 1HYLA 2SGAA 2UWLA 3VFEA 3ZZ3A 2ZTYA 3I29A 1GBKA 1GVZA 2BLVA 2GX4A 1AKSB 5EODA 1TPPA 1BZXE 4KELA 3TJVA 2XBYA 1KXFA 4CBOA 4INHA 4CREA 4ABAA 1OP8A 1MU6B 1HAXB 1XVOA 3KQEA 4F48B 1MZDA 4M7GA 4H6TA 2QF3A 4CRBA 1J8AA 1ESBA 1ELVA 4U30A 4Y8ZA 1NM6A 2P95A 3L3TA 3V3MA 4B75A 3E1XB 1WTHD 2XCFA 1A5IA 1D9IA 4O9VA 4X2VA 1BTPA 1EZQA 5T1VA 3SJKA 2RG3A 2BY5X 4NSVA 3D65E 5A8ZA 2XCNA 3FANA 1GMHG 2WPIS 3OE7D 1XX9A 5ESBA 4ZKOU 1MTNC 1TQ7B 2FS9A 2FOCA 1HAGE 1CA0B 2H5CA 5F03A 4XBBA 3PB1E 2TPIZ 2LPRA 3UWIA 1F7ZA 3Q00A 1V2MT 3CS0A 2XTTB 3EAJA 1SGTA 3M5LA 3V12A 1EB1H 1SOTA 3MWIU 1B0FA 1P3CA 1AFQB 3DUXH 4E7RG 3OU0A 3RXUA 2BB4A 5EQSA 1ZMJA 1GDQA 2ZDVH 2GGVB 1T4UH 1FY5A 5DSFA 1KIGH 4R0IA 5GIBA 4D7FA 3W1EA 2UUJB 1EP5A 1VJAU 5B6LA 6GCHG 1TNKA 1THPB 4FU8A 1P05A 4HZHA 5A8YA 1CA8B 5CHBA 4E05H 2A4QA 3BTKE 4K1SA 5EJLA 3QO6A 1O5AB 4IC5A 4YO9A 1TONA 3SV8A 2OLGA 2IPQX 2FZZA 2VWLA 1RRKA 4YLUA 1F0TA 2ZGCA 1T8LA 1FN8A 3SNBA 1JRSA 2EI7A 5ETXA 2VVCA 4NGAH 4AX9H 4Y6DA 2ZFSA 4K8BA 3A7ZA 2ZTZA 1Z1IA 3OY5U 4YT7H 3MNCA 4ISIH 2ZNKH 4BNRA 2FX4A 1YC0A 3EGKH 4AGJA 1BMMH 1O3EA 2ODQA 2KZ4A 3TJOA 1J17T 4Y79A 1V2OT 2OINA 3SNEA 1BRBE 3GCNA 1CT4E 4AB8A 4K60A 3G01A 2QXHA 3AAUA 1AUTC 1AVGH 2ZHWH 4YOGA 2WYGA 4HI3A 4UD9H 1H1BA 2HPPH 1NFUA 4NG9H 3DFJA 2ODPA 3O8DA 1DPOA 1C5NH 3K6ZA 1DWEH 4E06H 1HAZB 1LHGH 5FXLA 2A5IA 2D1JA 5E8EH 3BV9B 5JBAS 2C8YB 3A83A 4Q4LA 3U28C 4IMZA 4DURA 1SMFE 1ANCA 3TU7H 4K69A 3SU0A 2Q1JA 2VU8E 3LT3A 1GHAG 4JZIA 4U32A 4UONA 1LPKB 2IPHA 1E1QD 1GVKB 1IQMA 2O8LA 1BBRK 2C8XB 1C2EA 4XBCA 1GMCF 3SOSA 2ILNA 1P02A 1F92A 5T6FA 3SGQE 1UHBA 3LPRA 3W94A 1EJNA 2Z6BD 2R9PA 2G5VA 2ZGJA 1GHBG 3GY3A 4B73A 3F6UH 1DM4B 4BAKB 1SLXB 2WPDD 2AEIH 1P06A 3RXFA 3KF2A 4CR5A 2ZA5A 1C5MD 3QN7A 3ZZ4A 1RTFB 3U8TH 4YZUA 3S9CA 3MO9A 1HB0B 3ZVCA 2LNCA 1IHTH 1DY8A 1QRZA 1CA0C 1IQFA 2AMDA 4BTTB 1EFRD 1V2ST 2J92A 3BG8A 4CRFA 5PTPA 3A7VA 4WH8A 2Y82A 1K1OA 3I77A 3QX5H 2BVSH 5LGOA 2VWNA 4QT8C 5HM9A 1DXWA 1AFQC 1GPZA 2HNTC 4INLA 1G3BA 1JRTA 3NZIA 1SGCA 2ZHDA 1OKXA 2ZP0H 2C93B 2SNWA 1QA7A 2V3OH 2OC1A 1C5YB 5T6DA 1S81A 5CHAB 3UPEA 1H8DH 1L2EA 2KX4A 4X6OA 1RJXB 3GICB 3UOUA 2C8WB 2G55A 1TPSA 4MQAA 1GBLA 2ZIQH 4Y8XA 8GCHG 2VB0A 5A09A 1W14U 1Z6JH 2HRVA 1UCYK 1XUHA 2SGEE 3ODFA 2ZC9H 3OEHD 1BRCE 4NSYA 3RLYH 3WW7A 1A5HA 3TK9A 1O2RA 1O2YA 4J2YB 4H6SB 1BBRH 1SGNE 1WYKA 2FOGA 3FP8E 1A0JA 3GCHB 2A31A 1FPHH 2FOBA 1ACBE 5J4SA 2QXIA 2WSSD 2TIOA 3PV5A 1ZMNA 1W11U 1CBWB 3UQVA 3JZ2B 3RMLH 3EA9A 3WY8A 1X7AC 2PTNA 4A92A 4CRCA 1KMHB 1EAXA 2ZWLH 3BEUA 4JYUH 4A5TS 1XM1A 1HAVB 5F8ZA 1W10U 2K0QA 1O34A 1YCPH 1BBRE 4CH8B 2EA3A 3QTVH 1BMFD 4YTAA 5EXMA 1KLIH 1UTNA 1BCUH 2BD3A 3BTDE 1SHYA 2WPHS 5E0GA 1HAYB 2FOFA 4Y7BA 4Y76A 1HBTH 1TNHA 2BLWA 5GNDA 2TGPZ 2BZ6H 1PJPA 2OC0A 4B2BA 5DN6D 5HIZA 4TSFD 4XOJA 3E91A 2V35A 1IQLA 1O3FA 2WUBA 1P3EA 3LKWA 5L2YH 3QLPH 4B6FA 2J95A 3ZYDA 1NFXA 2GT8A 4FU7A 1C2MA 2JJ1D 1LTOA 2F9VA 3K9XB 5L30H 2PHBA 1GL0E 4FUEA 5LPEA 2FI5E 2GDEH 1C1WH 3H7TA 2XXLA 1O30A 3FZZA 2TGTA 3MO6A 1GBBA 1GI1A 2GV6A 1UCYH 3NCLA 3Q77A 4RT1A 3F9FA 1LHCH 1EP6A 1EASA 1HIAB 1O3IA 1SQRA 2DE8A 2F4LA 4YLQH 2J34A 1A0HB 1EZXC 1GJ8B 1GBEA 2ZFQH 2QE7D 3GCTG 1GCDA 4ABGA 2AIQA 1F5KU 4ABDA 5FHTA 1QB9A 2VJ1A 2ZQ1A 1JIRA 4OGYA 2ZKSA 1XKBC 3RU4E 1EPTB 1UCYE 2WUCA 2ZCKP 4ZAEA 2F9OA 2BVRH 1V2KT 2OUAA 2KCPA 1MMJN 7GCHF 1BJUA 1B0EA 5EXNA 1TGCA 5C1XA 2EI8A 1ZLRA 4NA9H 1ETRH 2FYQA 1O2SA 2FYRA 2FPZA 4ISHH 1YCPM 2P59A 1P0SH 2DE9A 1A3BH 1TBZH 3SV7A 1K22H 4LOYH 3BN9A 2ODYB 2ZDNA 1O3OA 4Z1MD 3U1IB 4ABEA 4ZMAH 5HMAA 1Y3WA 3Q76A 3A8CA 1D4PB 2HNTF 1BITA 1GWAA 4OS6A 2AH4X 4DW2U 1H9IE 1P11E 2OP9A 3T26A 2ZDAH 3H7OA 4U01A 2W7SA 5JB8S 4GHQA 1AKSA 1TNLA 4UFFH 1DICA 1B7XB 1BA8B 1L1NA 4BOHA 2M2AA 1SQAA 3GY2A 3EYDA 3EA7A 3E90B 1YPKH 5DP9A 1BRUP 2JH6D 1ID5H 2H2ZA 1QTFA 1O3AA 1GI0A 1VCQA 2BHGA 4Q63A 3GCHC 3N7OA 2OC7A 4AG2A 3ZZ5A 2Y5GA 3P8OA 1BT7A 1YM0A 1KTTB 1C5LH 1O5BB 5JBTA 3PO1B 2GZ7A 5HYOA 1BDAA 2G00A 2KAIA 1CBWC 1P2KA 3C27B 4B1TA 3SU5A 5HKKD 1OP0A 3RM2H 2DUCA 1YLNA 3BIVH 3FFGA 1WSSH 4MPXA 1C5ZB 5EXLA 1LVBA 2GZ8A 2FTLE 4WMDA 2ZU2A 3SI4H 1C9PA 3SJ9A 3PMBB 3LDXH 1ELBA 1V2UT 4ZUHA 1LVMA 4X8TH 4AOQA 3ZZ6A 2WV5A 2QN5T 1HPGA 4HFPB 1K1LA 1NTPA 2BXTH 1L4ZA 1ELAA 1UJ1A 3N7EA 4BTUB 2BTCE 2B0FA 3P8NA 1P03A 3FVFB 1E79D 4AFQA 2O8MA 1DFPA 1DLKB 1GI2A 2PGQB 1BRAA 2B7DH 3TGKE 2ZFRH 3TJNA 1GI5A 2PKAB 3ZVGA 4Y71A 3LGTA 1S6LA 5DKMA 2ZEBA 2WINI 5FCRA 2BDHA 2PW8H 4M9FA 2R0LA 5C2ZA 4F4OC 4NFEA 1C2FA 3KGPA 1TNGA 3A8DA 3S7HB 1YPLH 1TABE 2Y5FA 1H8HD 1PQ5A 4IC6A 1QHRB 3LGVA 1Z8IB 2PGBB 3V13A 3HKIB 2CF8H 2WYJA 1C1QA 1OWJA 3SNDA 5LH8A 4NIYA 1O5DH 2YNBA 4K1EA 2GTBA 4MNVA 1S85A 2Y81A 1OHHD 3ZVEA 1GI3A 4LZ1H 1QB1A
chains in the Genus database with same CATH topology
3LGIA 2BOKA 2HOBA 2Y6TA 1HJ9A 3ATLA 4FUDA 1GMCG 1LHFH 2A7JA 4RKJB 1NU9A 1V2LT 2V0BA 3PM3A 4ZHAA 2Z9KA 3U98H 4AG1A 4CHAB 4H42U 1K1JA 1EPTC 3F1SB 1GJ5H 1DLEA 4X6MA 2ZU4A 1IQKA 4D76A 5EW1H 3SJOA 3NKKA 3A8BA 4FUCA 2R3UA 1F0UA 5DPAA 1O5EH 4FUGA 1LKAA 4E7NA 3MU5A 5FPYA 1BQYA 2C3SA 4TY7A 1SPJA 1GJ6A 1SGQE 1DOJA 2ZECA 1BTWA 1T4VH 5GJ4B 2BX3A 3PLKA 1T32A 2OQ5A 4ZXYH 5DP7A 1Y5AT 2Q6DA 1FZZA 1O3KA 3RXHA 1SGDE 4I32A 3OSYA 1DWDH 1C5VA 3A89A 5AFZH 3RU4D 1V6DA 1NT1A 1TE0A 3ENSB 1RGQA 2BD7A 2BDGA 3P95A 3PO1C 1SQOA 1C9TA 4ZXXH 1A3EH 3PMJA 1E0FD 1RIWB 4GVUA 3QUMP 4NIXA 4AYYB 2ZU3A 1TGBA 3UQOA 2D26C 1AHTH 2GV7A 3A88A 1TPAE 1MAYA 2ZFPH 3U8OH 4O3UA 4X2WA 3MYWA 1DE7H 1V2WT 1O3BA 5FCKA 2ZHQH 3TH2H 4ZHMU 5TCCA 4DT7B 2P3TB 4DCDA 5GCHG 1AWFH 3T28A 9LPRA 1WQSA 3AW1A 3LIWA 3W95A 4MG3A 3BTFE 3GY6A 1W3CA 1EXFA 5FPSA 4RSPA 4ABJA 4TY6A 1QL7A 2FO9A 3A7YA 4ZKNU 3TK5A 1RTLA 2P16A 5EW2H 4GHTA 1KLTA 1GHZA 3NPSA 4NWLA 5A0CA 2FOEA 3M3SA 3SU2A 1PPCE 3SZNA 4ISLA 1FONA 2CGAA 1IQHA 1GBDA 1GBHA 1NS3A 4ZKSU 2BDAA 4GCHF 1AVWA 1J9CH 3GDSA 4ABHA 2BX4A 5DJ7A 1JXPA 1P8VC 4MPVA 2IOTA 2UUKB 2ZHFH 1TGNA 1MQ6A 5L6NH 1C2DA 1RS0A 3LH1A 3JZ1B 1SGIB 1TA2A 4UFDH 2VNTA 3ZVAA 1F5RA 5T6GA 4BAOB 6CHAB 2ZDKA 4XE4A 1NROH 1CT0E 3STJA 3KQCA 3V0XA 2HNTE 4MNXA 1C5TA 3HPTB 1C1PA 4CHAC 3PTBA 1HAVA 2VH0A 1DUAA 5JB9S 1QIXB 1DITH 8KME2 3V7TA 1K2I1 3FP7E 1QBVH 2VGCB 4D9QA 1GI4A 1H9HE 5F8XA 2AGIX 1SR5C 1ESAA 2BZAA 4DY7B 4K2YA 1D6WA 1MKXK 3ZV8A 4BAHB 1AB9B 2OC8A 4KTSA 3FP6E 4X6NA 2BY9X 3P8FA 1KSNA 1XUGA 1O3DA 2ZU1A 2H1UA 1AWHB 3A84A 1YPHE 3M3TA 2FX6A 2PV9B 1GJCB 1TOCB 5CMXH 3M7TA 1O2KA 4K3JA 1KDQB 5JPMH 4ABFA 1WBGB 3U9AH 1O3HA 2RA0A 3L6PA 2WPJS 4Z0KA 3SO3A 4X1SU 3SUFA 3SJ8A 1W7GH 1GMDF 1O2IA 2UUYA 1UTQA 2PUQH 4SGBE 1EKBB 1ZRBA 1CSOE 4NFFA 4B76A 5JBBS 2XBXA 5DP6A 2ZQ2A 2W3IA 2ANWA 2A4GA 2HGTH 3RXAA 3E6PH 2ZCHP 2PUXB 1TQ0B 5BRRE 2STAE 2THFB 3F9HA 3R0FA 1TX6A 2CV3A 2FP7B 1RIWC 3MH5A 5HGGA 3RXPA 4BANB 2CHAB 3SN8A 2XWBI 4NA8A 1EPTA 2CF9H 1GBFA 2FI3E 3A81A 4I8HA 1VITH 2AGEX 2XNIA 1SQTA 3RXSA 4DIIH 1C1RA 2A4OA 5DP3A 3E0NB 3UY9A 1NRRH 3GYLB 2H9TH 3SV6A 1XVMA 4K8YA 1TA6A 1ZGIA 4Y11E 1MTUA 4OS5A 1Y3UA 3TJUA 1A7SA 5TJXA 1S0QA 1S84A 1TBRH 4I8JA 1ELGA 1UK4A 5F8TA 1C1MA 1ABIH 1AQ7A 5DGJA 2F9PA 1TMBH 1D6RA 2OCVB 1DXPA 4THNH 3MU8A 3P6ZB 2SFAA 1D3TB 1HV7A 3D49H 2ANMH 5GXPA 3MNBA 3RMNH 4JK6A 1EQ9A 3H5CB 1K1PA 1HXEH 2WV4A 4YM9A 3LONA 1SFQB 4NZLA 1E36B 1TMTH 2OBOA 3SU4A 3TGIE 1FV9A 1F5LA 8ESTE 1GG6B 2XC0A 4Y10E 2C4FH 1W0ZU 1SGYE 1RTKA 1Y3VA 3S7KB 2GZ9A 3HATH 1MKWK 1EAUA 2Z7FE 3CP7A 3VB3A 4A1XA 2Z9IA 6CHAC 2AFQB 2FEQH 2GCHF 3T62A 5IDKA 1JBUH 1NFYA 1AE8H 3IG6B 1FXYA 5HXFA 1ZSKA 2ZO3H 3RP2A 4X8SH 1YYY1 1QB6A 1QGFA 1V2JT 4D9RA 3KNXA 4K1TA 1FI8A 1ELCA 1CHOF 1VITG 3GY8A 4CBNA 3CENA 4ABIA 2VIWA 3EA8A 3S0NA 5C3NA 4Y8YA 2FI4E 2VGCC 5G4BA 1KLJH 1YPHC 2VVUA 3MFJA 1C5WB 1TX8A 1AGJA 1HJ8A 1K1MA 1GI9B 1FY1A 1PPFE 2FLRH 3RXTA 1O2OA 3RXQA 1AB9C 1KXAA 3TH3H 1G3EA 1EAIA 4XFQA 2NU4E 4UEHH 3TGJE 4WMFA 1CT2E 1BTHH 1GJ9B 2PKAA 2QXJA 1FAKH 1XKAC 2H9EH 3P17H 4WY3A 3MI4A 3A87A 3QDZB 1KXCA 1Z7KA 3T27A 2ZDMA 1PQ8A 4INKA 1C4U2 1O2GH 4FU9A 4I8LA 1OX1A 2STBE 4ISNA 1ZZZA 4B71A 1M9UA 3Q3KA 1SSXA 5EOKA 4BTIB 2XYAA 2TGDA 1XXDA 1JIMA 1CGJE 2BLOA 1O2XA 2G52A 1FUJA 3KQBA 1MU8B 3RC5A 5JYIA 1AE5A 2IN2A 4Z6AH 5A0AE 3AVZA 4O03A 4HGCA 2BD4A 2D2DA 1HJAB 3KIDU 2HPQH 2BLQA 4NZQA 1GMHF 4I33A 1FJSA 1ELDE 3KHVA 1MD7A 1GI8B 3KN2A 1AZ8A 2CHAC 3MU1A 5E2OA 3RXRA 2UWOA 2Y7XA 3LU9B 1LDTT 2J2UA 1DUEA 1KTSB 2PTCE 3BTHE 5JBCS 1DY9A 1MTWA 1WCZA 2XW9A 4I31A 4U2WA 3U1JB 2ZU5A 3SUDA 4Q7XA 1MQ5A 1O3CA 1WQVH 2GCTB 1FY8E 1EB2A 1OS8A 3KCGH 1TPOA 1DS2E 4FUBA 4I7YH 4MDSA 2FWWA 1UVTH 3ZVFA 1GHYH 1T31A 1ZSJA 1K21H 1IAUA 2BOHB 5E0JA 4TPYA 1WOFA 1PPBH 4CRAA 2H6MA 2NU0E 3PYHA 2AIPA 6GCHF 2HLCA 1Y3YA 1UTMA 1GBMA 1THRH 2Z3EA 2A32A 2R2WU 1THSH 1OP2A 1K1IA 2G8TA 1P12E 4LK4A 1V3XA 1V2VT 1QQ4A 3Q3XA 3SU1A 2UWPA 4HTCH 4JK5A 1HXFH 4Y7AA 2ALVA 1S0RA 1P10A 1XMNB 4MLFB 3SV9A 1A1RA 2EI6A 1AU8A 1GBCA 3BTQE 1SBWA 3GDUA 1GG6C 5T3HA 2ZPRA 4X8VH 1OOKB 4X8UH 2R0KA 1TRYA 5DP8A 3UNSA 5C1UA 2GKVE 1YGCH 1HRTH 4FVBA 5L2ZH 2W26A 2A5KA 2G81E 1G9IE 2B9LA 2FS8A 4IMQA 1SGPE 5C1YA 3PTNA 2PLXA 3LGUA 3U8RH 1O2UA 1FDPA 1ELEE 1C5QA 4DG4A 1C1VH 4TYDA 1K9OE 2F9UA 4TPIZ 2ULLA 2QAAA 1XXFA 2FOAA 3ATKA 1H8IH 4D8NA 5FPTA 3UUZA 1SC8U 2Q6GA 4ZH8A 2ZFTA 1AVXA 1C1UH 5SGAE 4YESB 4O3TA 1UK3A 1XUKA 1IOEA 2ZGHA 2CMYA 1LPGB 1QBNA 2AYWA 1IQEA 3ATIA 1RD3B 1LMWB 2CN0H 1LPZB 3UTUH 1EOLA 1P2OA 2XRCA 3LC5A 3SHCH 1NRPH 1TNJA 3A7XA 1GHAF 1OWKA 1G2LA 3BTME 1TB6H 1H4WA 5I46H 2J4IA 3QGNB 3SW2B 3M37A 4MPWA 2ZTXA 1HDTH 3TNTA 3ZZDA 1C2IA 1IQIA 4NCYA 2TGAA 4CH2B 1L1GA 1GHBF 1E37B 1SGFG 3E8LA 3RXKA 3A7TA 1FIZA 4XSKU 4Q80A 1HAHH 1PPHE 5AVDA 1GVLA 1C2LA 1IQNA 1FQ3A 3LC3A 1HJAC 2H5DA 1DT2A 4PROA 2O8TA 1EJMA 3LOXA 1ABJH 2R2MB 1GJ7B 2GT7A 4XBDA 1C5OH 3VXFH 2FLBH 3EE0B 4ZROA 4MNYA 1FY4A 1NC6A 4MTBA 1GL1A 3GCOA 1CQQA 1JWTA 5EG4A 2GCTC 4A1TA 3GDVA 1Q31A 4AORA 3A80A 3MNXA 1Z71A 3CS7A 3URDA 4DJZB 2IJOB 3RXIA 4BAMB 2QF0A 3T29A 1OPHB 1MCTA 3RXOA 1QURH 1O2VA 4DIHH 1YPGH 1G3DA 2NU3E 4DOQA 1YPJH 1GBIA 1SLVB 2ESTE 2ZHEH 3HK3B 4WXVA 4ISOA 5F6MA 3BTWE 5IYTA 2GP9B 1WU1A 8GCHF 3IWMA 5FX5A 1QR3E 3UWJH 3A82A 4X0WU 3HK6B 1KXEA 3Q3YA 3ELAH 4BXSA 5DP5A 2A0QB 1OWDA 2P8OB 2OXSA 1EOJA 1QNJA 1ZMLA 1O5GH 5CE1A 1O2TA 5HM2A 2QIQA 3MH6A 3RXLA 4SGAE 1Y5BT 2AMPA 4JCNA 4JYTA 1O3JA 1FY3A 1ORFA 2ALPA 2QV1A 5JDUB 3MOCA 3ITIA 5A0BA 3SQHE 3UR9A 3UOPA 1WV7H 1BJVA 2R3YA 9ESTA 4GPGA 4X6PA 2WPKS 1DWBH 2OQUA 3RC4A 1AO5A 5DG6A 2Z9GA 1MBQA 4FUHA 2BY7X 1DVAH 1VGCB 2ZZUH 2OBQA 1IHSH 5A8XA 3B23B 2ZPQA 3T2NA 2NWNA 3RXVA 1H9LB 3ZVBA 1BB0B 1SI5H 1C5XB 2PR3A 2F83A 1A2CH 1GCTB 1ZHPA 1CHGA 1VCWA 3A86A 1C1SA 3FAOA 1S83A 1LVOA 2TRMA 4WJG2 1ZRKA 3SQEE 2ANYA 1SG8B 2ZFFH 1HFDA 1YLDA 4ABBA 5AF9H 1YBWA 2EC9H 1T7CA 2P3UB 2P94A 3TLOA 2F9NA 3RXEA 3LJJA 3RXGA 3A8AA 1GBJA 1C2HA 3OY6U 4ESTE 1AUJA 2PSXA 4AZ2B 1C1TA 1ZHMA 4D7GA 3K65B 3S9AA 1LQDB 1AY6H 5GPIB 2UUFB 1LO6A 1O3PB 1ZJDA 3GCTF 1V2RT 1BIOA 1C2KA 2A2XH 3O8RA 1A0LA 1QJ1B 2ASUB 1XUFA 3PLPA 3S69A 1W7XH 2C8ZB 2PSYA 2VIPA 1EJAA 1S6HA 3R3GB 2A1DB 3RM0H 4MNWA 3NUMA 2KAIB 3SBKA 5I25A 2HVXA 3BG4B 3SUEA 4RN6A 1Y8TA 1LCYA 2JH0D 5B6OA 2Y5HA 3ZZ9A 4IS5A 2GMTB 1O36A 1ARBA 2ZGBH 1C5UA 1O2JA 3MU0A 2BD9A 1NO9H 1JOUB 3A7WA 1C2GA 2Z94A 1DANH 1EUFA 5DK1A 3E3TA 3NK8A 4KGAA 3ZYEA 1MUEB 4UFEH 5EPNA 2O8UA 1N1LA 2O8WA 3ESTA 1YKTA 1TBQH 1TOMH 1MBMA 3RUOA 7ESTE 1LHDH 1MH0A 1MTSA 3T25A 4WH6A 4DVAU 4I8KA 1XUIA 2Z9JA 3RXCA 2Y7ZA 3P92A 5EPYA 2P93A 2FODA 2B8OH 2XC4A 3M36A 1EX3A 4IN2A 1XUJA 1O2WA 4XDEA 1P9SA 2P8OC 3ATWA 2ZI2H 2SGFE 4OS1A 1G36A 1ZGVA 2V6NA 7GCHG 1PQ7A 3M7UA 2BD2A 4H4FA 1PFXC 1TGSZ 4X2XA 4J1YA 4MVNA 1HAPH 5C67A 4IGDA 3SU6A 3NXPA 1YF4A 4NIVA 5TCAA 1IQGA 2VH6A 7LPRA 1UK2A 2FMJA 3TK6A 4RKOB 1QA0A 2J38A 3DT0H 3QZQA 1AD8H 2ZGXH 2RDLA 3MTYA 1A4WH 1O2QA 3B9FH 3SUGA 1G32B 2W7UA 3UFAA 1QQUA 4R8TB 1BMAA 3ZVDA 4X1QU 2FOHA 1ANBA 1J16A 1O2MA 2FOMB 4Y0ZE 1C1NA 1HIAA 2BVXH 3BF6H 1O3GA 4CRDA 1DDJA 1QRXA 1VGCC 4GSOA 1ESTA 4UDWH 2PFEA 3ZZBA 2JKHA 3VB5A 3LGWA 3AAVA 5K7RA 1G37A 5C5OA 3TIUA 1DX5M 1GCTC 1NPMA 3F68H 3AASA 1MD8A 1NESE 4X1PU 1GI7B 3U69H 1K1NA 1QBOA 2VWMA 1SGEE 4KKDA 2QYIA 1Z6EA 1UVUH 3K2UA 2Z3DA 1UTPA 4Y0YE 5GWZA 4Q7YA 1HLTH 4KTCA 1U6QA 1O33A 5EQQA 2ZG0H 1AN1E 1GHWH 3PV4A 1SFIA 4IW4E 2BYAX 4KP0A 4LXBH 1SB1H 1UVOA 5AHGH 1AI8H 4AYVB 2GD4B 1GJ4H 3M7QA 1MKXH 3URCA 4JZ1A 1SGFA 1BHXF 3RDZA 1UVPA 4BAQB 1Y59T 1UTJA 5EGMA 1L0ZA 3UNRA 1P04A 1O32A 1KY9A 2FXRA 3ZZ7A 1UTKA 3VPKA 3E0PB 1YP9A 2BQ6B 3BEFB 2QY0B 2CJIA 1OWEA 3HGNA 1A61H 1SLUB 1OXGA 4B2AA 1NZQH 3BTEE 1GGDB 4JZEH 3VB6A 1LVYA 3RMOH 1Q3XA 1NRQH 1UTLM 1F2SE 2BMGB 3UREA 3BG4C 2J94A 3RXBA 1YCPK 5K0HA 3OTJE 1VCPA 2GMTC 1V2QT 2Z3CA 4OS4A 1SLWB 3LGYA 2AERH 2F91A 2D8WA 3SI3H 1KXDA 2ANKH 4GUXA 1GI6A 1MZAA 3OX7U 2Q6FA 1JMOH 3QZRA 3MHWU 1P01A 3SGAE 1T8OA 3GY4A 7KMEH 4AB9A 3QTOH 3STIA 1GBTA