3SGQE

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgqE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sgqE01
1THPB 1ZR0A 3OX7U 1EZUC 1NPMA 2EI8A 2O9QA 2SFAA 2SGFE 1AVWA 4OS7A 2FLBH 1AZ8A 4DJZB 2AGEX 1GI4A 3P92A 1O31A 5HM2A 5EW2H 1HYLA 2FYQA 2F9UA 3HKIB 1J14A 2V6NA 2ZFQH 3RXOA 4GHQA 1SFQB 2K1QA 1FN6A 5ESBA 4X1NU 3Q00A 1X7AC 1RGQA 1FY3A 1A3EH 1P3EA 1THSH 1KTTB 1GMDG 1ELAA 1ZYOA 4B2CA 1KY9A 3ODFA 1V2QT 1GCTC 1CVWH 3NUMA 3V12A 2FI5E 5GWZA 1MH0A 4X1SU 2WPJS 1V2NT 3RXJA 3EYDA 2BD4A 3SN8A 1MMJN 1TBQH 1FY5A 4FUEA 5JPMH 3V3MA 1P03A 2QYIA 2G51A 1E0FD 1EQ9A 1F5RA 3BG4C 1BBRE 1XUIA 1IOEA 1C5PA 3G01A 2ZIQH 3SNDA 1HPGA 1K21H 3RXDA 1UTMA 4BOHA 3A7TA 4CRCA 3MH6A 1TPOA 3SOSA 3H5CB 4OS1A 1P8VC 3VEQB 1SBWA 4CH8B 1CHOG 1H8IH 1IQNA 1O2WA 1MKXH 1GDQA 4Y7BA 4INKA 5HXFA 1DSTA 4ABFA 2BD9A 1C2GA 4O9VA 5C3NA 1ANCA 2ALVA 2TGAA 1UO6A 3JZ1B 2ZDMA 1FY4A 3BG4B 1ZTJA 5DP7A 2WPKS 2Y5FA 3AVZA 5F8ZA 1RJXB 1P2NA 1QIXB 2P8OB 2FIRH 1AY6H 4YT6H 3AASA 8GCHF 5E2PA 1Z8JB 2TPIZ 3QGJA 4MNWA 1TX7A 1P9SA 2A7HA 4JK5A 2FYRA 2PV9B 1P2QA 4BXSA 4ZROA 1EASA 5FCKA 1CSOE 1GWAA 1H9LB 1TA2A 1C5LH 1XXDA 1WCZA 4SGAE 4BAQB 1MQ6A 5FPYA 2Z3CA 1W3CA 4KTUA 1V2LT 1BMMH 4IN2A 2ZHQH 1O2LA 4Y11E 1XKBC 3ZZ9A 4WY3A 1GJAB 2XBWA 1SOTA 5E8EH 3U8TH 2B9LA 2WUBA 2UWOA 4FUGA 4U2WA 5GJ4B 1QTFA 2BY7X 2D26C 1GHAF 1AB9C 1H9HE 1CT2E 2DE8A 3H7TA 4ZHAA 4JZDH 4HGCA 5A0AE 3ZVCA 2VIWA 3RM2H 4ZKOU 2ZECA 4A1VA 1BRAA 3SW2B 5HYOA 4NIWA 3DD2H 5JBAS 3EA8A 1GMHF 1L1GA 1DXWA 2ZPQA 2ZU1A 4NIXA 2PWXA 1NRPH 5DJ7A 1SGNE 4TYDA 5A0BA 3S9AA 1O2UA 1K1MA 1O3IA 5J4QA 1AB9B 3IG6B 3BEUA 1WTGH 2BDCA 1MTNC 1F5LA 2ANKH 3GY4A 1MZDA 1EAXA 1IQLA 2XBYA 3DA9B 3JZ2B 1LO6A 1GBJA 2Y6TA 3ZZ4A 2OLGA 2W26A 1TPAE 1W7GH 3RC4A 4MPWA 4E05H 3F9EA 4J1YA 3M3SA 3C1KA 2A7CA 3RU4T 4ZKNU 3K6ZA 3MHWU 1O34A 1KSNA 3ZZ6A 1QBNA 4B1TA 4ZKSU 2HVXA 1OWIA 1C2JA 4PROA 4BAHB 1SG8B 1GI9B 1WV7H 1IQHA 1LHEH 1MTNB 2AEIH 3SNCA 1VGCC 1WU1A 2FWWA 1SI5H 4GLYA 4NA9H 3A8DA 4FU8A 3RXEA 4D7GA 1GVLA 1V2MT 3F68H 1CA0B 1HJ9A 2OQUA 2A4RA 4XFQA 4FVBA 1SGYE 2OBOA 4LK4A 1TONA 1YCPK 2OCVB 1AVGH 1YGCH 3UWJH 1MU8B 4B71A 2H1UA 3P70B 4NA8A 3UOUA 3CS0A 5FX5A 3CS7A 1ZPBA 3HGNA 4ABHA 5T3HA 1NY22 1FY1A 3MTYA 4I8LA 4UFDH 1ZLRA 4U01A 3E1XB 1C1TA 1HAIH 3PLBA 4HTCH 1GBLA 8GCHG 2AMQA 5EPNA 1EPTB 3R3GB 4CH2B 3QZQA 1JIRA 1LVYA 2H5DA 3URDA 2ZHWH 4Q80A 2FOHA 4K60A 3AAVA 4JCNA 3SJ8A 4ZH8A 4A92A 1FZZA 1HAZB 5JB8S 3PO1B 4X0WU 2ZFTA 1GL0E 4FUJA 2VJ1A 5A2MH 4X1QU 1UVPA 4I31A 2I6QA 2PKSB 1YPKH 1TQ7B 4ABDA 1BDAA 4FUCA 3E90B 2FOCA 5B6OA 5I46H 2SNWA 3O8CA 1DLKB 4YZUA 3FZDA 1CBWB 1GHAG 3T5FH 3A82A 1LHDH 4INHA 3LKWA 3SNEA 2FODA 4UONA 1RD3B 3RXPA 1NO9H 1FJSA 1ANEA 2GDDA 1P02A 3VGCC 1O2ZA 1ARCA 1GMHG 4GUXA 3MMGA 2F91A 9ESTA 3PWCA 4K1SA 1DY8A 5F8XA 3KL6A 4NWLA 3PROA 1D6RA 1Y3UA 3L6PA 1DLEA 1G3BA 4JYVH 5FHTA 2OXSA 3FVFB 5FBIA 1F0UA 2IJOB 1HIAA 1INCA 1VCPA 1C1MA 4K2YA 1O3AA 1DANH 2FEQH 1NRQH 3BF6H 1Y3XA 1O5BB 2ZWLH 4X8TH 3VGCB 1DICA 1FQ3A 3GCOA 4UEHH 1F0TA 3EE0B 2BOKA 4Y8YA 2Z9KA 2GV7A 3NK8A 1SPJA 2ZFFH 1AFQB 1YC0A 2CXVA 3SNBA 1XVOA 3Q3XA 1QL9A 5IDKA 2BDHA 2QCYA 1OOKB 3T28A 1TRMA 1NTPA 3VB7A 2Z3EA 2G5NA 1YPLH 2BDIA 3M37A 2ODYB 1BOQA 1FN8A 3A88A 5CHAC 1SVPA 1IQKA 4X2XA 4RN6A 1BBRK 6CHAB 2ZHDA 3UTUH 1WYKA 4RKOB 1ZRKA 1Y3WA 1YLCA 4AG2A 2ZC9H 3BTME 2AGIX 3A89A 1SB1H 2QF0A 1MD7A 2FESH 1RS0A 1J9CH 1QCPA 4MPXA 3EA7A 1W7XH 3QWCH 1TPSA 1XUKA 1MCTA 1T8MA 1KXCA 2Y82A 2G4TA 4FUBA 1GJCB 5LPEA 3RXAA 1Z8GA 5LPFA 4IMZA 5CHAB 1W10U 5K7RA 4CRGA 2OC7A 3KN2A 3E0PB 1GHVH 3KF2A 2ESTE 1G3DA 3RUOA 4WF8A 5ESTE 1EATA 1ABJH 2ZGHA 2M5TA 2BDAA 3RC5A 3SU1A 1F2SE 2QA9E 1NRNH 1B0FA 1O38A 1P11E 3Q3KA 3ZVGA 1GI0A 1DE7H 2Z9GA 1TIOA 2RG3A 2KAIA 1FIWA 4IW4E 1O30A 1WQVH 5AHGH 1ZRBA 3UNSA 1OP8A 2B5TB 2A32A 3TVJB 2H6MA 1AWFH 4I8KA 1W2KH 1GL1A 1XUFA 1O5EH 2ZFPH 2ULLA 2BXUH 3BTWE 1DWBH 1EUFA 2V3OH 4RSPA 1SGQE 3SHAH 1BA8B 1UTPA 2Z6BD 1ZHPA 2ZHFH 3QGNB 4RKJB 3TNSA 1O2XA 3GY6A 2RCEA 4J2YB 2G8TA 3ZVAA 2Z9JA 1Z8RA 3ZV8A 3TJNA 3BEIB 3E16B 1Z7KA 5SGAE 3ZVDA 2ZI2H 3UQOA 5A8XA 1C9PA 1GHYH 1O3KA 2RA3A 2LPRA 2QXJA 4ESTE 2UWPA 3MH5A 1A0JA 5IYTA 1NS3A 5F6MA 3SZNA 1BHXF 4H4FA 2OUAA 4NGAH 5CMXH 3P8FA 3PTBA 1IQGA 4NIYA 1Y3VA 4JZIA 4X8VH 2RDLA 3Q77A 2CV3A 3ZZAA 1NZQH 1ZPZA 3ZZBA 3S9BA 1MTWA 3RXCA 4ABIA 2QY0B 4CREA 2H9TH 2FMJA 3E0NB 3KQCA 3Q3YA 4MNYA 2WV4A 1LVOA 3QX5H 4AGKA 1ID5H 5TCCA 1A3BH 1E34B 1C2LA 3UY9A 3BTTE 3UQVA 3KIDU 3RXSA 3UNRA 3EQ0H 1T8OA 4Q7YA 1P09A 3FAOA 2ZGCA 2IN2A 1VR1H 1EXFA 1ETTH 1NROH 1GJ5H 2HALA 3PLPA 1OXGA 1ELBA 1AE8H 4O3UA 4ASHA 5GXPA 1BMNH 3UNQA 1Q2WA 1QL7A 1ZHMA 1L1NA 4UE7H 2A45B 1G2LA 3GCNA 1N8OC 2JETC 1W0YH 3P95A 4A5TS 1C1SA 4GHTA 1O2SA 1O36A 1BRUP 2PHBA 4A7IB 3MO3A 1J15A 1LHFH 1KLTA 3RXVA 1O2JA 4CRBA 4WMFA 1VCQA 1SGDE 2BZAA 2QN5T 4FUFA 1ACBE 4DCDA 3TGJE 1HXEH 1GHBF 3A7XA 3LH1A 3DUXH 1QL8A 4AN7A 3W94A 2QC2A 1PQ8A 3SI4H 1O2PA 1GDUA 5K0HA 4B75A 3SBKA 1DS2E 1D3TB 2WYJA 1GGDC 5EODA 4YOJA 2XXLA 2PFEA 4MNVA 1LVMA 1UHBB 3FP8E 7ESTE 2VWNA 1O2YA 3HPTB 1IHSH 2P3TB 2ZTXA 4YOGA 1ESBA 1OSSA 1ZSJA 3RU4E 1TNJA 2D1JA 2Y5HA 2C8ZB 1HLTH 3MH7A 2W3KA 1ELDE 1TX8A 3S9CA 1H9IE 4D76A 5TCAA 3SV6A 1CHGA 1TB6H 2ZDNA 3GY3A 3VPKA 2ZPRA 1FONA 3QDZB 1EOLA 2FS8A 2F3CE 3RXGA 3SU5A 2BD3A 4YLQH 4BTUB 3MU8A 2JH6D 1WOFA 1SQOA 3A8BA 3AW1A 2EA3A 3F1SB 2BVXH 1UTQA 4ZHLU 2OC8A 4WMEA 3RXTA 1GJ8B 1F0RA 3TITA 2A5IA 1G9IE 1BB0B 2YOLA 2P16A 2F9NA 1DUAA 1TABE 2Q6FA 2G55A 2B7DH 3ZVFA 1QBVH 1LCYA 1QGFA 1D6WA 4Y79A 3UR9A 2VGCC 2VVVA 2O8LA 2XC0A 3SUFA 1QQ4A 1HAHH 3VXEH 3SGQE 2GMTC 1WBGB 3KGPA 1MKWK 2ZF0H 3A8AA 4FU9A 1NU7B 2P93A 3GCTG 2BMGB 1PPFE 4I33A 3UFAA 5LH8A 2FM2A 2WINI 1D3PB 1QR3E 1EJMA 2SGEE 2SGPE 2VNTA 1LVBA 5E0JA 1JRSA 1DX5M 2XNIA 2P94A 4MVNA 1B7XB 3ATMA 2VGCB 1HJAC 1HNEE 5A8YA 2UUKB 1O2GH 1ELTA 1SOZA 1BTHH 1C4Y2 1GCTB 3GCHC 3LGUA 3SJOA 3SV2H 1GVKB 1S84A 1LQDB 2A2QH 2A5KA 4AYVB 3CENA 2OD3B 4KKDA 3ZYEA 2QIQA 4M7GA 2QXHA 3BTEE 5GIBA 1CA8B 4WWYA 1QB1A 8KME2 3UPEA 4A1XA 1AUTC 1CT0E 4TY7A 1O5DH 2BDGA 2XW9A 2A7JA 2ZA5A 5G4BA 2PGBB 1P2IA 3RXLA 2R0KA 4KTCA 3SQHE 3LDXH 1TE0A 4AB8A 4DIHH 2G4UA 2VH6A 2GCTC 4IBLH 1O3PB 1VITG 1M9UA 2ALPA 3NCLA 2BLVA 1AN1E 5L2ZH 1AI8H 4H42U 1HAVB 3QTVH 2BLQA 3QO6A 3MO9A 1ELCA 3NKKA 1GHBG 1SQTA 1C1NA 1NFUA 4SGBE 1BT7A 1T8NA 1TX6A 1HAYB 3MH4A 1O2HA 2FI4E 5C5NA 3B9FH 3MFJA 3KQEA 1A7SA 2PW8H 4D9QA 2OC0A 1LHGH 4O03A 3KHVA 1Y5AT 4OGXA 3ZZ8A 1AD8H 1A5GH 1UTOA 3FP6E 1K9OE 1TA6A 3QUMP 1GBBA 1BRBE 5DKMA 2UUFB 1HB0B 1SGPE 3ATKA 4A1TA 5H4IB 5F8TA 1V2TT 1O33A 1MCVA 3TJUA 4ZUHA 1BJVA 3URCA 1A46H 3PM3A 1L4DA 1C5OH 1BQYA 3PV4A 2ZU2A 4DOQA 1F7ZA 2FOBA 3UR6A 2OP9A 2Z9IA 3RXUA 3GICB 4LOYH 2GVFA 1Z8IB 2FPZA 3T29A 3GDUA 5EQSA 1Y5BT 1TMTH 2BD2A 1OWDA 2CN0H 1DVAH 2AS9A 4HZHA 1T4VH 1KTSB 2BQ7B 5FPSA 3B23B 3SUEA 4TWYA 2D8WA 4E7NA 2WPIS 2VH0A 3ZV9A 3U8OH 1WAYB 1KIGH 2FOAA 2G81E 4JYUH 2PKAA 1DFPA 3PMAB 1P0SH 5C1UA 5HM9A 1LPGB 3SHCH 1K22H 1O5CB 1QJ7B 4B76A 2J95A 3TK5A 1B5GH 1D3DB 3AW0A 1EJAA 2QF3A 4IC5A 1C2IA 3P8NA 1ESAA 2C4FH 3TH2H 1YBWA 4JZFH 3IITA 4IS5A 5JBTA 1GI8B 3H7OA 2GV6A 4ISLA 2JH5D 3HKJB 2TGPZ 2PUQH 1UCYH 3O8DA 4AYYB 3LC3A 1P04A 1ZTKA 2TGDA 2ZQ1A 4ISIH 2F9BH 5LPRA 4ZKRU 1ETRH 2HRVA 3CP7A 1JOUB 1VGCB 2Y7ZA 1ZSLA 1BUIA 1C1RA 1EZQA 1O3GA 1L4ZA 1YPJH 1UVUH 2WPHS 1ETSH 3GY2A 3U8RH 2H2ZA 1QNJA 2SGQE 2XCNA 4X2VA 4WH6A 3EGKH 3M3TA 1O3OA 4Q7ZA 1ANDA 1O39A 4NZQA 4UFGH 4X8SH 3STIA 2STAE 3NXPA 3A81A 4AORA 1E38B 1CE5A 1OWHA 4YOIA 1U6QA 2GZ9A 2TIOA 2WYGA 4LZ1H 1BITA 1MKWH 2XCFA 4WMDA 4CRDA 2VIVA 2GT7A 2C8WB 3WY8A 3TH4H 4INLA 3ZVEA 1J16A 1JRTA 3RMNH 4YT7H 1SL3A 1QA0A 1A5IA 1G36A 1XUJA 1W8BH 2V3HH 1C1UH 3QN7A 1Z1JA 5EXNA 2VIPA 1C5ZB 2FTMA 3EAJA 3D62A 2ZG0H 3EA9A 1TGSZ 3BSQA 1Z6EA 4UDWH 1C2HA 3A7VA 5E2OA 4DIIH 1AKSA 1C5UA 4AGJA 4KELA 1YLDA 2CMYA 3KNXA 3O8BA 1LKAA 1OYTH 3M7QA 1GJBB 2ZHEH 2R3YA 4K8YA 1EZSC 1UK3A 2HPQH 1V6DA 1SQAA 5E0GA 2PTCE 6LPRA 1G37A 1SGCA 2ZEBA 4BANB 3TIUA 2WV5A 2OINA 1C9TA 1XMNB 3SJKA 1KDQA 1JBUH 1C5YB 3VB5A 4GSOA 1G32B 3OTJE 2STBE 1UTJA 2BM2A 3KEEA 1ZMLA 1S6FA 2GD4B 1FPCH 4WXVA 4TY6A 1K1IA 1XKAC 1SGRE 1DWDH 2FDAA 4NCYA 3DHKH 1F0SA 4NG9H 1TMBH 2ZDKA 3SNAA 5L30H 2Z7FE 1SGFA 1ELVA 4AX9H 1WSSH 4B2BA 1P3CA 2PUXB 5DP4A 1LKBA 1OS8A 3BTFE 3D65E 1ELFA 1GJ9B 1N1LA 4XBBA 5LGOA 3E91A 1DWEH 2GT8A 5DP6A 2ZCKP 5L6NH 3P17H 2NU2E 1A5HA 2G52A 2G00A 1YPHE 3QK1A 5BPEA 3KCGH 2BD7A 1GHWH 3ZZ3A 1L2EA 2BQ6B 2O8MA 3K2UA 5EU8A 1TNKA 2ZTYA 3I29A 1UTNA 4BAOB 1O35A 1MUEB 4Y6DA 1ZOMA 1J17T 2TGTA 1YPHC 1QB6A 2GCHF 1HJ8A 3D23A 1OWJA 1O3HA 1LMWB 1SGIB 1FDPA 2AGGX 2Z94A 4Q2KA 2ZGJA 5A8ZA 4X6PA 2EI6A 1GG6C 1G3CA 4NWKA 1S6HA 2DUCA 4DW2U 1J8AA 5EGMA 5DP3A 4AG1A 4YM9A 1O37A 1NC6A 1SLVB 1CQQA 3GISB 1MAYA 2AIPA 1A2CH 2ZU4A 3VB3A 4GAWA 1ZGVA 3M3VA 4K1TA 3MU1A 2HNTF 2BHGA 4UFEH 3GY5A 2D2DA 1G2MA 2BTCE 3ZZ5A 5AFYH 1OKXA 2NU4E 4Y71A 5JBBS 1THRH 2ZTZA 5F03A 2QXIA 1EAIA 4DG4A 1O2NA 3ESTA 1UVOA 1XX9A 1OWKA 1H1BA 2QXGA 2XBVA 1W12U 1MD8A 1K1LA 2A4QA 4KGAA 2GTBA 3M7UA 4TPIZ 1QHRB 4X6OA 1D9IA 1C2EA 1UJ1A 2UWLA 3C27B 3M35A 3RLWH 1OP2A 4E7RG 1YP9A 4ISNA 3PMJA 1C2DA 1VCWA 2J38A 2SGDE 2ZFSA 3SUGA 4DGJA 1GCDA 3BTGE 1YYY1 1O3LA 2FTLE 1HAXB 4BTIB 4D7FA 1O3NA 1IQFA 1MAXA 1MKXK 2C8YB 2SGAA 1JWTA 2BLOA 1PQAA 1F5KU 1O2MA 5EQRA 3S7KB 2HNTE 4XDEA 3TH3H 1TNGA 4ABAA 1T4UH 1YCPH 1PFXC 1C5QA 3LGVA 3DFJA 4LXBH 3UREA 4K1EA 1W0ZU 4B2AA 1PPBH 3KQBA 1DXPA 3LH3A 1E36B 3A84A 3UWIA 2CF9H 2HNTC 1A4WH 2BX4A 1L0ZA 4IC6A 5EG4A 4TWWA 1ZJDA 2ZKSA 3RLYH 1DM4B 1VJ9U 2A2XH 4Y8XA 1UTKA 3LJOA 2VB0A 4Q7XA 2WPLS 1SLWB 1JIMA 5FCRA 5GCHF 2ASUB 5E0HA 1O2RA 5JBCS 4ZAEA 3MO6A 3MI4A 1FV9A 1O2IA 3ATWA 3LT3A 1P10A 1EB2A 1Y8TA 1AFEH 4I7YH 4D8NA 4FUDA 5JB9S 1IQJA 3TPIZ 3R0FA 3MNSA 3Q76A 2XWBI 4U30A 3BTKE 2DE9A 4YESB 2P3FH 1ANBA 5DK1A 3OY6U 4AZ2B 1AGJA 2FX4A 3S0NA 2PR3A 1Y5UT 4NFFA 1C2KA 4KP0A 1GVZA 1CGJE 5DPAA 1NFWA 5JDUB 4CR5A 4GCHF 2UUYA 2HLCA 1VITH 3M5OA 3A83A 2GCHG 1HFDA 1PPZA 1C5TA 1WUNH 1P2OA 2VWMA 1N8OB 3QLPH 2JETB 2BVRH 1HAGE 3FP7E 2G5VA 2BD8A 2Y80A 5C1XA 1C5RA 4K69A 3STJA 7GCHF 4QT8C 1FLEE 1S0QA 3PMBB 4WXIA 1EP6A 1BHXB 1N6YA 1IQMA 3HATH 2CHAC 3BIVH 1TGTA 3SGBE 1BTUA 3A7WA 5AVDA 5EW1H 2W7UA 2ZQ2A 4I32A 1QBOA 1L1JA 2ZZUH 3AAUA 3NWUA 3RXKA 2CF8H 1G3EA 1EPTA 2BD5A 5ETXA 1GGDB 1HGTH 4Z0KA 2C90B 3SU3A 1V2JT 1YM0A 4GPGA 1GBEA 1GI7B 3DT0H 1GBFA 2F9VA 1QQUA 2FI3E 3A87A 3RXHA 3SORA 1S82A 4XBDA 2J34A 2ODQA 2ANMH 4K3JA 4YTAA 3MNBA 3EDXB 1NM6A 1T32A 5DP9A 1CT4E 4CR9A 3T25A 1HDTH 3SQEE 3ZVBA 4H6SB 1WQSA 1P2MA 1BBRH 2ZGXH 1V2VT 3A8CA 5DG6A 1O2VA 1ORFA 1HIAB 1GBKA 2A31A 1WTHD 4AFSA 1GJ6A 3FANA 1P2JA 4Y76A 3A7YA 3T62A 3SJIA 1C5MD 2ZP0H 3RU4D 2WUCA 1AQ7A 3GOVB 3ITIA 3PTNA 1P12E 1C4V2 3RP2A 2A4GA 1A1RA 2FP7B 2THFB 4BAMB 2F9OA 1DDJA 1TGBA 1BJUA 1DUEA 1K1JA 3SU4A 1D3QB 1GBTA 1NT1A 1DOJA 2R2WU 4X8UH 1BIOA 5GCHG 3OYPA 1K28D 1GBAA 4HFPB 4MPUA 1HV7A 2TBSA 2GMTB 3GY7A 4NSYA 3E8LA 1PJPA 2ZCLP 4U32A 1Y3YA 1EOJA 4CRAA 1EX3A 3MWIU 1GI6A 3SI3H 5T6GA 2ZU3A 1A0LA 1P9UA 3ENSB 1BMLA 1NFYA 2ZO3H 1RIWC 4D9RA 1YPEH 2R3UA 1W13U 2EI7A 4DVAU 2TRMA 1T8LA 1GDNA 1SLXB 2P8OC 3ODDA 1K2I1 1LTOA 1XXFA 3TNTA 3MU0A 3U98H 1HJAB 2ZU5A 1NU9A 1QJ6B 3MYWA 1C5WB 3GCHB 1C2MA 1SGFG 5FX6A 3ZZ7A 1OP0A 2J94A 4ZHMU 1YKTA 1GBIA 1QRZA 4GCHG 5ABWA 5C1YA 3U1IB 3MNCA 1C5XB 1V2KT 1RIWB 3VFEA 4WVPE 2A4OA 3ZZDA 1P01A 1S5SA 1PPCE 1A0HB 3K9XB 4ISHH 1MBQA 4WJG2 1H8DH 4NZLA 1ZPCA 3P6ZB 2KAIB 2GCTB 3FZZA 3VXFH 3BTDE 1QRWA 1N6XA 2XYAA 7GCHG 1OPHB 2P59A 1TOCB 2AMPA 4YO9A 1UTLM 1KXBA 1C1VH 4X1PU 1TFXA 2GP9B 1GBCA 1FIZA 3T2NA 1C1PA 5EQQA 4DY7B 1F92A 2AMDA 3RXFA 1P06A 1UVSH 3V7TA 1MU6B 2GZ7A 4CHAC 1AE5A 2NU1E 2Z9LA 1TGCA 5DGJA 2R0LA 4AB9A 2P95A 2VVUA 1TRYA 2Y7XA 3LIWA 4DT7B 4NA7A 3SUDA 1TNIA 1HUTH 1AMHA 3S7HB 3L3TA 3MU5A 4NIVA 1V2ST 2BY9X 2BY8X 4BNRA 3M5MA 3M7TA 3A86A 1SMFE 1LQEA 5EXLA 1CGIE 3F9HA 3DFLA 1LHCH 2C8XB 1FY8E 1O3FA 3ATLA 1TLDA 1VZQH 3RMOH 1UK4A 5BRRE 1BTYA 4TPYA 1ARBA 2W5EA 4CHAB 2Q6GA 1DWCH 3TJOA 1C1QA 1O2KA 3TGKE 5FXLA 2BB4A 3UOPA 5L2YH 1C4U2 2FOFA 4X2WA 4AFUA 5DP5A 2JKHA 2ZDLA 4I8GA 1LPZB 3TJVA 1E37B 6GCHF 1TNLA 3SO3A 4XE4A 2XBXA 7LPRA 1KLJH 3M5LA 1BRCE 3SV7A 3LGYA 3SU6A 1PPEE 1SR5C 1HBTH 3BV9B 2BOHB 2R2MB 1B0EA 3LONA 1CA0C 2UUJB 1RFNA 3LC5A 1XUGA 3TLOA 1TBRH 1AWHB 1P2KA 2C93B 1MTSA 1TYNA 3RMLH 2FOEA 1HXFH 1Q31A 5EPYA 5DO4H 3T27A 1FUJA 1O2TA 1Z71A 2PSYA 4Y0ZE 3PMHB 4K8BA 1RRKA 1FMGA 3L33A 1LDTT 3LGTA 1MQ5A 5FAHA 3GDVA 4ZMAH 2Y81A 1O3BA 6ESTA 2W7SA 3U1JB 1GBHA 4BAKB 1IQIA 2SNVA 4JMYA 1BTZA 1NRRH 3M36A 1AZZA 2FLRH 4WH8A 4F4OC 1PQ5A 1O5GH 1GHZA 3GY8A 1A61H 1EPTC 3HK3B 2FXRA 3M5NA 1LPKB 3MOCA 5I25A 5J4SA 1O32A 1ABIH 3PYHA 4R0IA 1VJAU 3PO1C 1W14U 5C67A 3LGIA 1V2WT 1O3CA 1S0RA 1ZMNA 2XC4A 5HMAA 1GI2A 1O3MA 4MTBA 1O2OA 2PKSC 4ABBA 4CBOA 2VWOA 1FAXA 2FZZA 4MNXA 1IAUA 2BDBA 3QTOH 2HOBA 2BY5X 4OS2A 1GJDB 1C1OA 1CBWC 1FAKH 2QAAA 1UCYE 4CRFA 3NZIA 5A0CA 3N7OA 1MBMA 1D4PB 5EOKA 1AO5A 4A6LA 2FOGA 4UD9H 1V2RT 1RTLA 2OBQA 1UHBA 3LJJA 1O2QA 3A85A 1V2PT 3GDSA 1HAPH 1BTPA 2ZGBH 2NWNA 3F6UH 1EZXC 2P3UB 1YF4A 2VIOA 7KMEH 4IMQA 1IHTH 3V13A 3TGIE 1QFKH 2AERH 2W3IA 5AFZH 1S81A 2OC1A 4THNH 3BIUH 3RXIA 3P8OA 2I6SA 1O3JA 2BX3A 1YPMH 2F9PA 1TWXB 1ZHRA 2FX6A 3KQDA 2C3SA 2PSXA 3MU4A 2O8UA 1FI8A 1ZGIA 1KYNA 1Q3XA 4VGCC 4JK6A 1TRNA 1ZTLA 4FUHA 2VU8E 1EJNA 1MTVA 3FFGA 4IGDA 2YNBA 3I77A 1RXPA 4JZEH 1ZZZA 3IWMA 1KLIH 2ILNA 2ZFRH 4X1RU 2J4IA 6GCHG 1GJ7B 3BG8A 1AFQC 2VVCA 1FXYA 1E35B 4ISOA 4I8JA 1AUJA 5C5OA 2J2UA 4OS5A 2J9NA 1OYQA 1NN6A 3RDZA 1TALA 4MG3A 2OTVA 1ELEE 3RMMH 3F9GA 1W11U 2VIQA 4DURA 4VGCB 9LPRA 2VINA 4ZXXH 3SJ9A 4BTTB 1C1WH 4ABGA 2GGVB 1HAOH 1C2FA 1G30B 2BZ6H 3U9AH 1HCGA 6CHAC 1RTFB 2A1DB 1GMCF 1JMOH 1SSXA 4UFFH 1NESE 4FU7A 3A80A 1PPHE 3LOXA 1KXAA 1UVTH 3E3TA 4K5ZA 2CGAA 3SV9A 4ABEA 1UK2A 4B74A 3MNXA 2XC5A 1Y59T 5FPTA 1C5VA 1UMAH 1BMAA 1KXEA 1SHYA 3LGWA 3M61U 1XVMA 1K1OA 2BLWA 1TOMH 4O97A 2GX4A 2BQWB 3P8GA 1ELGA 1V2OT 4FXGH 4KTSA 3SU0A 2BDYA 1CO7E 2GZ8A 3LPRA 3OSYA 4O3TA 3GYLB 1EP5A 3BTHE 2QGRA 3UIRA 1JXPA 1C5SA 4GVUA 2R9PA 3TU7H 3HGPA 1T7CA 1EAWA 2ODPA 1SC8U 2FS9A 1O5AB 1HAVA 1TGNA 3V0XA 4CBNA 1P57B 1PPGE 4XSKU 1P05A 4ZXYH 4NSVA 2JH0D 1GG6B 1BTXA 4X6NA 3W95A 1AHTH 1KXFA 2OQ5A 1KXDA 1GI3A 1K1NA 5PTPA 5T6FA 2HGTH 2BVSH 5T6DA 2WPMS 1MTUA 2HWLB 1AIXH 2H5CA 2O8TA 1C5NH 1ZMJA 4Y0YE 2Z3DA 1GI1A 2O8WA 3K6YA 1O3EA 3I78A 5JYIA 2GKVE 3HK6B 3LU9B 1T31A 1QA7A 8LPRA 1DY9A 1SGTA 1V2UT 4FUIA 3ATIA 4HI3A 1GJ4H 8ESTE 2V0BA 4AOQA 2BY6X 3OY5U 4OS6A 1BTWA 3PLKA 5HGGA 2J92A 4MQAA 4XBCA 1HRTH 1SLUB 3VB4A 3PWBA 1TMUH 3B8JA 3D49H 3F9FA 2NU0E 2A5AA 1GBMA 2AH4X 1RTKA 3O8RA 1YCPM 4OGYA 3TK6A 3RXQA 2CJIA 1BZXE 4FVDA 1GBDA 2XTTB 2VIDA 1TBZH 1K1PA 3SGAE 2BXTH 2HPPH 2H9HA 3OU0A 1GMDF 2ZPSA 4MLFB 3SV8A 1O0DH 3SU2A 1XUHA 2Y5GA 5CE1A 1OX1A 2EEKA 1ZSKA 1AU8A 1SHHB 2PKAB 4NFEA 3PB1E 1FNIA 3GCTF 2AFQB 4BXWA 2VWLA 3ELAH 1TPPA 2B0FA 1GHXH 2V35A 2PTNA 5A09A 1NFXA 1TQ0B 1EAUA 1QY6A 1O3DA 2Q6DA 1Z1IA 1CGHA 4E06H 1QJ1B 4JZ1A 4Z6AH 2AIQA 2B8OH 4OS4A 1EKBB 2XWAA 4F49A 2ANWA 3GYMA 2IPHA 4AFQA 1QRXA 2QV1A 1GMCG 1AVXA 1CHOF 2ANYA 5EXMA 1S85A 1TNHA 3RXMA 1PYTC 5DP8A 3QZRA 1ESTA 1CU1A 1V3XA 3RXRA 1DT2A 3E6PH 3ZZCA 3NPSA 2ZNKH 1Z6JH 1S83A 4R8TB 1XM1A 1FPHH 2RA0A 1DSUA 1MZAA 5GPIB 1VITF 3BN9A 5GDSH 1GI5A 2YNAA 3RXBA 2BYAX 1TAWA 1IQEA 1YPGH 5C2ZA 4H6TA 1PQ7A 2NU3E 4Y7AA 2FO9A 1ZJKA 4I8HA 2ZDVH 5FBEA 1SGEE 3TK9A 4IN1A 4MDSA 2F83A 2Q1JA 4ABJA 2IOTA 2EC9H 3S69A 3ZYDA 2PLXA 5C20A 1O5FH 5TJXA 3UUZA 1GPZA 2H9EH 1PYTD 1SFIA 4Y8ZA 1H4WA 1OWEA 2AYWA 2LNCA 2FOMB 3T26A 1AKSB 4JYTA 1DITH 1DPOA 1QB9A 4XOJA 4MPVA 4B73A 1NRSH 3K65B 2PGQB 3RC6A 2A0QB 3A7ZA 4X2YA 3RM0H 3BTQE 5AF9H 4X6MA 3U69H 2ZDAH 1BCUH 3BEFB 4LZ4B 1EB1H 4AFZA 2ZCHP 1KDQB 2CHAB 1QURH 4Y10E 1UCYK 2XRCA 2GDEH 4YLUA 3VB6A
chains in the Genus database with same CATH superfamily
1THPB 1ZR0A 3OX7U 1EZUC 1NPMA 2EI8A 2O9QA 2SFAA 2SGFE 1AVWA 1H8ED 4OS7A 2FLBH 1AZ8A 4DJZB 2AGEX 1GI4A 3P92A 1O31A 5HM2A 5EW2H 1HYLA 2FYQA 2F9UA 3HKIB 1J14A 2V6NA 2ZFQH 3RXOA 4GHQA 1SFQB 2K1QA 1FN6A 5ESBA 4X1NU 3OEED 3Q00A 1X7AC 1RGQA 5CHBA 1FY3A 1A3EH 1P3EA 1THSH 1KTTB 1GMDG 1ELAA 1ZYOA 4B2CA 4FETA 1KY9A 3ODFA 1V2QT 1GCTC 1CVWH 3NUMA 3V12A 2FI5E 2CK3D 5GWZA 1MH0A 4X1SU 3VG8A 2WPJS 1V2NT 3RXJA 3CNRA 2WZQA 3EYDA 2L6OA 2BD4A 4ACAA 3SN8A 1MMJN 1TBQH 1FY5A 4FUEA 5JPMH 3V3MA 1P03A 2QYIA 2G51A 1E0FD 1EQ9A 1F5RA 3BG4C 1BBRE 1XUIA 1IOEA 4I86A 1C5PA 3G01A 2ZIQH 3SNDA 1HPGA 1K21H 3RXDA 1UTMA 4BOHA 3A7TA 4CRCA 3MH6A 1TPOA 3SOSA 3H5CB 4OS1A 1P8VC 3VEQB 1SBWA 4CH8B 1CHOG 1H8IH 1IQNA 1O2WA 1MKXH 1GDQA 4Y7BA 4INKA 5HXFA 1DSTA 4ABFA 2BD9A 1C2GA 3AK5A 4O9VA 5C3NA 1ANCA 2ALVA 2TGAA 1UO6A 3JZ1B 2ZDMA 1FY4A 3BG4B 1ZTJA 5DP7A 2WPKS 2KR7A 2Y5FA 3AVZA 5F8ZA 1RJXB 1P2NA 1QIXB 2P8OB 2FIRH 1AY6H 4YT6H 3AASA 8GCHF 5E2PA 1Z8JB 2TPIZ 3QGJA 4MNWA 3WWBA 4B6EA 1TX7A 1P9SA 2A7HA 4JK5A 2FYRA 2PV9B 1P2QA 4BXSA 4ZROA 1EASA 5FCKA 1CSOE 1GWAA 1H9LB 1TA2A 3OAAD 1C5LH 1XXDA 1WCZA 4SGAE 4BAQB 1MQ6A 5FPYA 2Z3CA 1W3CA 4KTUA 1V2LT 1BMMH 4IN2A 2ZHQH 1O2LA 4HG6A 4Y11E 1XKBC 3ZZ9A 4WY3A 1GJAB 2XBWA 1SOTA 5E8EH 3U8TH 3PV5A 2B9LA 2WUBA 2UWOA 4FUGA 4U2WA 5GJ4B 1QTFA 2BY7X 2D26C 1GHAF 4YXWD 1FX0B 1AB9C 1H9HE 1CT2E 2DE8A 3H7TA 5C17A 4ZHAA 4JZDH 4HGCA 5A0AE 3ZVCA 2VIWA 3RM2H 4ZKOU 2ZECA 4A1VA 1BRAA 3SW2B 5HYOA 4NIWA 3DD2H 5JBAS 3EA8A 1GMHF 1L1GA 1DXWA 2ZPQA 2ZU1A 4NIXA 2PWXA 1NRPH 3F2HA 5DJ7A 1SGNE 4TYDA 5A0BA 3S9AA 5EIYA 1O2UA 1K1MA 1O3IA 5J4QA 1AB9B 3IG6B 3BEUA 1WTGH 5HIYA 2BDCA 1MTNC 1F5LA 2ANKH 3GY4A 1MZDA 5IK2D 1EAXA 1IQLA 2XBYA 2EQNA 3DA9B 3MQKC 3JZ2B 1LO6A 4B6FA 1GBJA 2Y6TA 3ZZ4A 2OLGA 2W26A 1TPAE 1W7GH 3RC4A 1EFRD 4MPWA 3N99A 4E05H 3F9EA 4J1YA 3M3SA 3C1KA 2LP6A 2A7CA 3RU4T 5EJZA 4ZKNU 3K6ZA 3MHWU 1O34A 1KSNA 3ZZ6A 1QBNA 4B1TA 4ZKSU 2HVXA 1OWIA 1C2JA 4PROA 4BAHB 1SG8B 1GI9B 1WV7H 1IQHA 1LHEH 1MTNB 3OEHD 2AEIH 3SNCA 1BMFD 1VGCC 1WU1A 2FWWA 1SI5H 4GLYA 4NA9H 3A8DA 4FU8A 3RXEA 4D7GA 1GVLA 1V2MT 3F68H 1CA0B 1HJ9A 2OQUA 2A4RA 4XFQA 4FVBA 1SGYE 2OBOA 4LK4A 1TONA 1KMHB 1YCPK 2OCVB 1AVGH 1YGCH 3UWJH 1MU8B 4B71A 3WWFA 3UAIC 2H1UA 3P70B 4NA8A 3UOUA 3CS0A 5FX5A 3CS7A 1ZPBA 3HGNA 4ABHA 5T3HA 1NY22 1FY1A 3MTYA 4I8LA 4UFDH 1ZLRA 4U01A 3E1XB 1C1TA 1HAIH 3PLBA 4HTCH 1GBLA 8GCHG 2AMQA 5EPNA 2XNDD 2K8IA 1EPTB 3R3GB 4CH2B 3QZQA 1JIRA 1LVYA 2H5DA 3URDA 2ZHWH 4Q80A 2FOHA 4K60A 3AAVA 4JCNA 3SJ8A 4ZH8A 4A92A 1FZZA 1HAZB 5JB8S 3PO1B 4X0WU 2ZFTA 1GL0E 4FUJA 2VJ1A 5A2MH 4X1QU 1UVPA 3PRBA 4I31A 2RDEA 3DCLA 2I6QA 2PKSB 1YPKH 5C0UA 1TQ7B 4ABDA 1BDAA 4FUCA 3E90B 2FOCA 5B6OA 5I46H 2SNWA 3O8CA 1DLKB 4YZUA 5EJ1A 3FZDA 1CBWB 1GHAG 3T5FH 3A82A 4AC9A 1LHDH 4INHA 3LKWA 3SNEA 2FODA 4UONA 1RD3B 3RXPA 1NO9H 1FJSA 1ANEA 2GDDA 1P02A 3VGCC 1O2ZA 1ARCA 1GMHG 4GUXA 2GJGA 3MMGA 2F91A 9ESTA 3PWCA 4K1SA 1DY8A 5F8XA 3KL6A 4NWLA 3PROA 1D6RA 1Y3UA 3L6PA 1DLEA 1G3BA 4JYVH 5FHTA 2OXSA 3FVFB 5FBIA 1F0UA 2IJOB 1HIAA 1INCA 1VCPA 1C1MA 4K2YA 1O3AA 1DANH 2FEQH 1NRQH 3BF6H 1Y3XA 1O5BB 2ZWLH 4X8TH 3VGCB 1DICA 1FQ3A 3GCOA 4UEHH 1F0TA 2KCOA 3EE0B 2YMSC 2BOKA 4Y8YA 2Z9KA 2GV7A 3NK8A 1SPJA 2ZFFH 1AFQB 1YC0A 2CXVA 3SNBA 1XVOA 3Q3XA 1QL9A 5IDKA 2BDHA 2QCYA 1OOKB 3T28A 1TRMA 1NTPA 3VB7A 2Z3EA 2G5NA 1YPLH 2BDIA 3M37A 2ODYB 1BOQA 1FN8A 3A88A 5CHAC 1SVPA 1IQKA 4X2XA 4RN6A 1BBRK 6CHAB 2ZHDA 3UTUH 1WYKA 4RKOB 1ZRKA 1Y3WA 1YLCA 4AG2A 2ZC9H 3BTME 2AGIX 3A89A 1SB1H 2QF0A 1MD7A 2FESH 1RS0A 1J9CH 1QCPA 4MPXA 2YMSD 3NRLA 3EA7A 1W7XH 3QWCH 1TPSA 3F2GA 1XUKA 1MCTA 1T8MA 1KXCA 2Y82A 2G4TA 2JDID 4FUBA 1GJCB 5LPEA 3RXAA 1Z8GA 5LPFA 4IMZA 5CHAB 1W10U 5K7RA 4CRGA 2OC7A 3KN2A 3E0PB 1GHVH 3KF2A 2ESTE 1G3DA 3RUOA 1S6LA 2QF5A 4WF8A 5ESTE 1EATA 1ABJH 2ZGHA 1VKYA 2M5TA 2BDAA 3RC5A 3SU1A 1F2SE 2QA9E 1NRNH 1B0FA 1O38A 1P11E 3Q3KA 3ZVGA 1GI0A 1DE7H 2Z9GA 1TIOA 2RG3A 2KAIA 1FIWA 4IW4E 1O30A 1NBME 1WQVH 5AHGH 1ZRBA 3UNSA 1OP8A 2B5TB 2A32A 3TVJB 2H6MA 1AWFH 4I8KA 1W2KH 1GL1A 1XUFA 1O5EH 2ZFPH 2ULLA 2BXUH 3BTWE 1DWBH 1EUFA 5HIZA 2V3OH 4RSPA 1SGQE 3SHAH 1BA8B 1UTPA 2Z6BD 1ZHPA 2ZHFH 3QGNB 4RKJB 3TNSA 1O2XA 2J98A 2RCEA 3GY6A 2G8TA 4J2YB 3ZVAA 2Z9JA 1Z8RA 3ZV8A 3TJNA 3BEIB 3E16B 1Z7KA 5SGAE 3ZVDA 2ZI2H 3UQOA 5B6LA 5A8XA 1C9PA 1GHYH 1O3KA 2RA3A 2LPRA 2QXJA 4ESTE 2UWPA 3MH5A 1A0JA 5IYTA 1NS3A 5F6MA 3SZNA 1BHXF 4H4FA 2OUAA 4NGAH 5CMXH 3P8FA 3PTBA 1IQGA 4NIYA 1Y3VA 4JZIA 4X8VH 2RDLA 3Q77A 2CV3A 4Q4LA 3ZZAA 1NZQH 1ZPZA 3ZZBA 3S9BA 1MTWA 3RXCA 4ABIA 2QY0B 4CREA 2H9TH 2FMJA 3E0NB 3KQCA 3Q3YA 4MNYA 2WV4A 3FO8D 1LVOA 1NBMD 3QX5H 4AGKA 4M9FA 1ID5H 4Z1MD 5TCCA 1A3BH 4ASUD 1E34B 1C2LA 2W6ID 3UY9A 3BTTE 3UQVA 3KIDU 3RXSA 3UNRA 2HVYB 3EQ0H 1T8OA 4Q7YA 1P09A 3FAOA 2AHME 2ZGCA 2IN2A 1VR1H 1EXFA 1ETTH 1NROH 1GJ5H 2HALA 3PLPA 1OXGA 1ELBA 1AE8H 4O3UA 4ASHA 5GXPA 1BMNH 3UNQA 1Q2WA 3N7EA 1QL7A 1ZHMA 1L1NA 4UE7H 2A45B 3FN8A 1G2LA 3GCNA 1N8OC 2JETC 1W0YH 3P95A 4A5TS 1QZ8A 1C1SA 4GHTA 1O2SA 1O36A 1BRUP 2PHBA 4A7IB 3MO3A 1J15A 1LHFH 1KLTA 3RXVA 1O2JA 4CRBA 4WMFA 1VCQA 1SGDE 2BZAA 2QN5T 4FUFA 1ACBE 4DCDA 3TGJE 1HXEH 1GHBF 3A7XA 3LH1A 3DUXH 1QL8A 4AN7A 3W94A 2QC2A 1PQ8A 3SI4H 1O2PA 1GDUA 4DT4A 5K0HA 4B75A 3SBKA 1DS2E 1D3TB 2WYJA 1GGDC 5EODA 4YOJA 2XXLA 2PFEA 4MNVA 1LVMA 1UHBB 3FP8E 7ESTE 2VWNA 1O2YA 1WXRA 3HPTB 1IHSH 2P3TB 2ZTXA 4RT0A 4YOGA 1ESBA 1OSSA 1ZSJA 3RU4E 1TNJA 2D1JA 4XRNA 2Y5HA 2C8ZB 1HLTH 3MH7A 2W3KA 3F0PA 1ELDE 1TX8A 3S9CA 1H9IE 4D76A 5TCAA 3SV6A 1CHGA 1TB6H 2ZDNA 3GY3A 3VPKA 2ZPRA 1FONA 3QDZB 1EOLA 2FS8A 2F3CE 3RXGA 3SU5A 2BD3A 4YLQH 4BTUB 3MU8A 2JH6D 1WOFA 1SQOA 3A8BA 3AW1A 2EA3A 3F1SB 2BVXH 1UTQA 4ZHLU 2OC8A 4WMEA 3RXTA 1GJ8B 1F0RA 3TITA 2A5IA 1G9IE 1BB0B 2YOLA 2P16A 2F9NA 1DUAA 1TABE 2Q6FA 2G55A 2B7DH 3ZVFA 1QBVH 1LCYA 1QGFA 1D6WA 4Y79A 3UR9A 2VGCC 2VVVA 2O8LA 2XC0A 3SUFA 1QQ4A 1HAHH 3VXEH 3SGQE 2GMTC 1WBGB 3KGPA 1MKWK 2ZF0H 3A8AA 4FU9A 5HKKD 1NU7B 2P93A 3GCTG 2BMGB 1PPFE 4ACBA 2KX4A 4I33A 3UFAA 5LH8A 2FM2A 2WINI 1D3PB 1QR3E 1EJMA 2SGEE 2SGPE 2VNTA 1LVBA 5E0JA 1JRSA 1DX5M 2XNIA 2P94A 1W0KD 4MVNA 1B7XB 1OHHD 3ATMA 2VGCB 1HJAC 1HNEE 5A8YA 2UUKB 1O2GH 1ELTA 1SOZA 1BTHH 1C4Y2 1GCTB 3GCHC 3LGUA 3SJOA 3SV2H 1GVKB 2A5KA 1LQDB 1S84A 2A2QH 4AYVB 3CENA 2OD3B 4KKDA 3ZYEA 2QIQA 4M7GA 2QXHA 3BTEE 5GIBA 1CA8B 4WWYA 1QB1A 8KME2 3UPEA 4A1XA 1AUTC 1CT0E 4TY7A 1O5DH 2BDGA 2XW9A 2A7JA 2ZA5A 5G4BA 2PGBB 1P2IA 3RXLA 2R0KA 4KTCA 3SQHE 3LDXH 1TE0A 3KQ5A 4AB8A 4DIHH 2G4UA 2VH6A 2GCTC 4IBLH 1O3PB 1VITG 1M9UA 2ALPA 3NCLA 2BLVA 1AN1E 5L2ZH 1AI8H 4H42U 1HAVB 3QTVH 2BLQA 3QO6A 3MO9A 1ELCA 3NKKA 1GHBG 1SQTA 1C1NA 1NFUA 3F3BA 4SGBE 1BT7A 1T8NA 1TX6A 1HAYB 3MH4A 1O2HA 2FI4E 1SQRA 5C5NA 3B9FH 3KYFA 3MFJA 3KQEA 1A7SA 2PW8H 4D9QA 2OC0A 5KGOA 1LHGH 4O03A 3KHVA 4ZCNA 1Y5AT 4OGXA 3ZZ8A 1AD8H 1A5GH 1UTOA 3FP6E 1K9OE 1TA6A 3QUMP 1GBBA 1BRBE 5DKMA 2UUFB 1HB0B 1SGPE 3ATKA 4A1TA 5H4IB 5F8TA 2OK5A 1V2TT 3DSOA 1O33A 1MCVA 3TJUA 4ZUHA 1BJVA 3URCA 1A46H 3PM3A 1L4DA 1C5OH 1BQYA 3PV4A 2ZU2A 4DOQA 1F7ZA 2FOBA 3UR6A 2OP9A 2Z9IA 3RXUA 3GICB 4LOYH 2GVFA 1Z8IB 2FPZA 3T29A 3GDUA 5EQSA 1Y5BT 1TMTH 2BD2A 1OWDA 2CN0H 1DVAH 2AS9A 4HZHA 1T4VH 1KTSB 2BQ7B 5FPSA 3B23B 3SUEA 4TWYA 2D8WA 4E7NA 2WPIS 2VH0A 3ZV9A 3U8OH 1WAYB 1KIGH 2FOAA 2G81E 2K0QA 4JYUH 2PKAA 4P00A 1DFPA 3PMAB 3SYJA 1P0SH 5C1UA 5HM9A 1LPGB 3SHCH 1K22H 1O5CB 1QJ7B 4B76A 2J95A 3TK5A 1B5GH 1D3DB 3AW0A 1EJAA 2QF3A 4IC5A 1C2IA 3P8NA 1ESAA 2C4FH 3TH2H 1YBWA 4JZFH 1UW7A 3IITA 4IS5A 5JBTA 1GI8B 3H7OA 2GV6A 4ISLA 2JH5D 3HKJB 2TGPZ 2PUQH 1UCYH 3O8DA 4AYYB 3LC3A 1P04A 1ZTKA 2TGDA 1W0JD 2ZQ1A 4ISIH 2F9BH 5LPRA 4ZKRU 1ETRH 2HRVA 3CP7A 1JOUB 1VGCB 3VB6A 2Y7ZA 1E1RD 1ZSLA 1BUIA 1C1RA 1EZQA 1O3GA 1L4ZA 1YPJH 1UVUH 2WPHS 1ETSH 3GY2A 3U8RH 2H2ZA 1QNJA 2SGQE 2XCNA 4X2VA 4WH6A 3EGKH 3M3TA 1O3OA 4Q7ZA 1ANDA 1O39A 3PV2A 4NZQA 4UFGH 4X8SH 3STIA 2STAE 3NXPA 3A81A 4AORA 1E38B 1CE5A 1OWHA 4YOIA 1U6QA 2GZ9A 2TIOA 2WYGA 4LZ1H 1BITA 1MKWH 2XCFA 4WMDA 4CRDA 2VIVA 3U28C 2GT7A 2C8WB 3WY8A 3TH4H 4INLA 3ZVEA 1J16A 1JRTA 3RMNH 2XOKD 4YT7H 1SL3A 1QA0A 5EJLA 1A5IA 1G36A 1XUJA 1W8BH 2V3HH 1C1UH 3QN7A 1Z1JA 2JJ1D 2VIPA 5EXNA 1C5ZB 2FTMA 3EAJA 3D62A 2ZG0H 3EA9A 1TGSZ 3BSQA 1Z6EA 4UDWH 1C2HA 5GNDA 3A7VA 5E2OA 4DIIH 1AKSA 1C5UA 4AGJA 2QE7D 4KELA 1YLDA 2CMYA 3KNXA 3O8BA 1LKAA 1OYTH 3M7QA 1GJBB 5C94A 2ZHEH 2R3YA 4K8YA 1EZSC 1UK3A 2HPQH 1V6DA 1SQAA 5E0GA 2PTCE 6LPRA 1G37A 1SGCA 2ZEBA 2M2AA 4BANB 3TIUA 2WV5A 2OINA 1C9TA 1XMNB 3SJKA 1KDQA 1JBUH 1C5YB 3VB5A 4GSOA 1G32B 3OTJE 2STBE 1UTJA 3KYGA 2BM2A 3KEEA 1ZMLA 1S6FA 2GD4B 1FPCH 4WXVA 4TY6A 1K1IA 1XKAC 1SGRE 1DWDH 2FDAA 4NCYA 3DHKH 1F0SA 4NG9H 1TMBH 2ZDKA 3SNAA 5L30H 2Z7FE 1SGFA 1ELVA 4AX9H 5FL7D 1WSSH 4B2BA 1P3CA 2PUXB 5DP4A 1LKBA 1YY3A 1OS8A 3BTFE 3D65E 1ELFA 1GJ9B 1N1LA 4XBBA 5LGOA 3E91A 2RFKC 1DWEH 2GT8A 5DP6A 2ZCKP 5L6NH 3P17H 2NU2E 1A5HA 2G52A 2G00A 1YPHE 3QK1A 5BPEA 3KCGH 2BD7A 1GHWH 3FOAA 1L2EA 3ZZ3A 2BQ6B 2O8MA 3K2UA 5EU8A 1TNKA 2ZTYA 3SZEA 3I29A 1UTNA 4BAOB 2YMSB 1O35A 1MUEB 4Y6DA 1ZOMA 1J17T 2TGTA 1YPHC 1QB6A 2GCHF 1HJ8A 3D23A 1OWJA 1O3HA 1LMWB 1SGIB 1FDPA 2AGGX 2Z94A 4Q2KA 2ZGJA 5A8ZA 4X6PA 2EI6A 1GG6C 1G3CA 4NWKA 1S6HA 2DUCA 4DW2U 1J8AA 5EGMA 5DP3A 4AG1A 4YM9A 1O37A 1NC6A 1SLVB 1CQQA 3GISB 1E1QD 1MAYA 2AIPA 1A2CH 2ZU4A 3VB3A 4GAWA 1ZGVA 3M3VA 4K1TA 3MU1A 2HNTF 2BHGA 4UFEH 3GY5A 2D2DA 1G2MA 2BTCE 3ZZ5A 5AFYH 1OKXA 2NU4E 4Y71A 5JBBS 1THRH 2ZTZA 5F03A 2QXIA 1EAIA 4DG4A 1O2NA 3ESTA 1UVOA 1XX9A 1OWKA 1H1BA 2QXGA 2XBVA 1W12U 1MD8A 1K1LA 2A4QA 4KGAA 2GTBA 3M7UA 4TPIZ 1QHRB 4X6OA 1D9IA 1C2EA 1UJ1A 2UWLA 3C27B 3M35A 3RLWH 1OP2A 4E7RG 1YP9A 4ISNA 3PMJA 3F2FA 1C2DA 1VCWA 2J38A 2SGDE 2ZFSA 3SUGA 4DGJA 1GCDA 3BTGE 1YYY1 4XD7D 1O3LA 2FTLE 1HAXB 4BTIB 4D7FA 1O3NA 1IQFA 1MAXA 5CDFE 1MKXK 2C8YB 2SGAA 1JWTA 2BLOA 1PQAA 1F5KU 1O2MA 3EE7A 5EQRA 3S7KB 2HNTE 1SKYE 4XDEA 3TH3H 1TNGA 4ABAA 1T4UH 1YCPH 1PFXC 1C5QA 3LGVA 3DFJA 4LXBH 3UREA 4K1EA 1W0ZU 4B2AA 1PPBH 3KQBA 1DXPA 3LH3A 1E36B 3A84A 3UWIA 2CF9H 2HNTC 5T1VA 1A4WH 4Q63A 2BX4A 1L0ZA 4IC6A 5EG4A 4TWWA 1ZJDA 2ZKSA 3RLYH 1DM4B 1VJ9U 2A2XH 4Y8XA 1UTKA 3LJOA 2VB0A 4Q7XA 2WPLS 1SLWB 1JIMA 5FCRA 5GCHF 2ASUB 5E0HA 1O2RA 5JBCS 4ZAEA 3MO6A 3MI4A 1FV9A 1O2IA 3ATWA 3LT3A 1P10A 1EB2A 1Y8TA 1AFEH 4I7YH 4D8NA 4FUDA 5JB9S 1IQJA 3TPIZ 3R0FA 3MNSA 3Q76A 2XWBI 4U30A 3BTKE 2DE9A 4YESB 2P3FH 1ANBA 5DK1A 3OY6U 4AZ2B 1AGJA 2FX4A 3S0NA 2PR3A 1Y5UT 4NFFA 1C2KA 4KP0A 1GVZA 1CGJE 5DPAA 1NFWA 5JDUB 4CR5A 1YWUA 4GCHF 2UUYA 2HLCA 1VITH 3M5OA 3A83A 2GCHG 1HFDA 1PPZA 1C5TA 3N7DA 1WUNH 1P2OA 1K0HA 2VWMA 1N8OB 3QLPH 2JETB 2BVRH 1HAGE 3FP7E 2G5VA 2BD8A 2Y80A 5C1XA 1C5RA 4K69A 3STJA 7GCHF 4QT8C 1FLEE 2PP6A 1S0QA 1COWD 3PMBB 4WXIA 1EP6A 1BHXB 1N6YA 1IQMA 3HATH 2CHAC 3BIVH 1TGTA 3SGBE 1BTUA 3A7WA 5AVDA 5EW1H 2W7UA 2ZQ2A 4I32A 1QBOA 1L1JA 2ZZUH 3AAUA 3NWUA 3RXKA 2CF8H 1G3EA 1EPTA 2BD5A 5ETXA 1GGDB 1HGTH 4Z0KA 3ZIAD 2C90B 3SU3A 2L74A 1V2JT 1YM0A 4GPGA 1GBEA 1GI7B 3DT0H 1GBFA 2F9VA 1QQUA 2FI3E 3A87A 3RXHA 3SORA 1S82A 4XBDA 2J34A 2ODQA 2ANMH 4K3JA 4YTAA 3MNBA 3EDXB 1NM6A 1T32A 5DP9A 1CT4E 4CR9A 3T25A 1HDTH 3SQEE 3ZVBA 4H6SB 1WQSA 1P2MA 1BBRH 2ZGXH 1V2VT 3A8CA 5DG6A 1O2VA 1WDIA 1ORFA 1HIAB 1GBKA 2A31A 1WTHD 4AFSA 1GJ6A 3FANA 4OM9A 1P2JA 4Y76A 2VBCA 3A7YA 3T62A 3SJIA 1C5MD 5C0TA 2ZP0H 3RU4D 2WUCA 1AQ7A 3GOVB 3ITIA 3PTNA 1P12E 1C4V2 2WV9A 3RP2A 2A4GA 1A1RA 2FP7B 2THFB 4BAMB 2F9OA 1DDJA 1TGBA 1BJUA 1DUEA 1K1JA 3SU4A 1D3QB 1GBTA 1NT1A 1DOJA 2R2WU 4X8UH 1BIOA 5GCHG 3OYPA 1K28D 1GBAA 4HFPB 4MPUA 1HV7A 2TBSA 2GMTB 3GY7A 4NSYA 3E8LA 1PJPA 2ZCLP 4U32A 1Y3YA 1EOJA 4CRAA 1EX3A 3MWIU 1GI6A 3SI3H 5T6GA 2ZU3A 1A0LA 1P9UA 3ENSB 2KFWA 1BMLA 1NFYA 2ZO3H 3GS9A 1RIWC 4D9RA 1YPEH 2R3UA 1W13U 2EI7A 4DVAU 2TRMA 1T8LA 1GDNA 1SLXB 2P8OC 3ODDA 1K2I1 1LTOA 1XXFA 3TNTA 3MU0A 3U98H 1HJAB 2ZU5A 1NU9A 1QJ6B 3MYWA 1C5WB 3GCHB 1C2MA 1SGFG 5DSFA 5FX6A 3ZZ7A 1OP0A 2J94A 4ZHMU 1YKTA 1GBIA 1QRZA 4TSFD 4GCHG 5ABWA 5C1YA 3U1IB 3MNCA 4F48B 1C5XB 1V2KT 1RIWB 3VFEA 4WVPE 2A4OA 2F4LA 3ZZDA 1P01A 1S5SA 1PPCE 1A0HB 2J97A 3K9XB 1MBQA 4ISHH 4WJG2 1H8DH 4NZLA 1ZPCA 2V7QD 3P6ZB 2KAIB 2GCTB 3FZZA 3VXFH 3BTDE 1QRWA 1N6XA 2XYAA 7GCHG 1OPHB 2P59A 1TOCB 2AMPA 4YO9A 1UTLM 1KXBA 2JIZD 1C1VH 4X1PU 1TFXA 2GP9B 1GBCA 1FIZA 3T2NA 1C1PA 5EQQA 4DY7B 1F92A 2AMDA 3RXFA 3OFND 1P06A 1UVSH 3V7TA 2KCYA 1MU6B 2J98B 2GZ7A 4CHAC 1AE5A 4F55A 2NU1E 2Z9LA 1TGCA 2KCPA 2R0LA 5DGJA 2P95A 2VVUA 1TRYA 2Y7XA 4AB9A 3LIWA 4DT7B 4NA7A 3SUDA 5KECA 1TNIA 1HUTH 1AMHA 3S7HB 3L3TA 3MU5A 4NIVA 1V2ST 2BY9X 2BY8X 4BNRA 3M5MA 3M7TA 3A86A 1SMFE 1LQEA 5EXLA 1CGIE 3F9HA 3DFLA 1LHCH 2C8XB 1FY8E 1O3FA 3ATLA 1TLDA 1VZQH 3RMOH 1UK4A 5BRRE 1BTYA 4TPYA 1ARBA 2W5EA 4CHAB 2Q6GA 1DWCH 3TJOA 1C1QA 1O2KA 3TGKE 5FXLA 2BB4A 3UOPA 5L2YH 1C4U2 2FOFA 4X2WA 4AFUA 5DP5A 2JKHA 2ZDLA 4I8GA 1LPZB 3TJVA 1E37B 6GCHF 1TNLA 3SO3A 4XE4A 2XBXA 7LPRA 1KLJH 3M5LA 1BRCE 2WPDD 3SV7A 3LGYA 1E79D 3SU6A 1PPEE 1SR5C 1HBTH 3BV9B 2BOHB 2R2MB 1B0EA 3LONA 2KM0A 1CA0C 2UUJB 1RFNA 3LC5A 1XUGA 3TLOA 1TBRH 1AWHB 2KCAA 1P2KA 2LELA 2C93B 1MTSA 1TYNA 3RMLH 2FOEA 1HXFH 1Q31A 5EPYA 5DO4H 3T27A 1FUJA 1O2TA 1Z71A 2PSYA 4Y0ZE 3PMHB 4K8BA 1RRKA 1FMGA 3L33A 1LDTT 3LGTA 1MQ5A 2WHXA 5FAHA 3GDVA 4ZMAH 2Y81A 1O3BA 6ESTA 2W7SA 3U1JB 1GBHA 4BAKB 1IQIA 2SNVA 4JMYA 1BTZA 1NRRH 3M36A 1AZZA 2FLRH 3PRDA 4WH8A 4F4OC 1PQ5A 1O5GH 1GHZA 3GY8A 1A61H 1EPTC 3HK3B 2FXRA 3M5NA 1LPKB 3MOCA 5I25A 5J4SA 1O32A 1ABIH 3PYHA 4R0IA 1VJAU 4RI0A 3PO1C 1W14U 5C67A 3LGIA 2V3MA 1V2WT 1O3CA 1S0RA 1ZMNA 2XC4A 2EY4C 5HMAA 1GI2A 1O3MA 4MTBA 1O2OA 2PKSC 4ABBA 4CBOA 2VWOA 1FAXA 2FZZA 4MNXA 1IAUA 2BDBA 3QTOH 2HOBA 2BY5X 4OS2A 1YLNA 1GJDB 1C1OA 1CBWC 1FAKH 2QAAA 1UCYE 4CRFA 3NZIA 5A0CA 3N7OA 1MBMA 1D4PB 5EOKA 1AO5A 4A6LA 2FOGA 4UD9H 1V2RT 1RTLA 2OBQA 1UHBA 3LJJA 2KZ4A 1O2QA 3A85A 1V2PT 3GDSA 1HAPH 1BTPA 2ZGBH 2NWNA 3F6UH 1EZXC 2P3UB 1YF4A 2VIOA 7KMEH 3OE7D 4IMQA 1IHTH 3V13A 3TGIE 1QFKH 2AERH 2W3IA 5AFZH 1H8HD 1S81A 2OC1A 3BIUH 4THNH 3RXIA 3P8OA 2I6SA 1O3JA 2BX3A 3DSPA 1YPMH 2F9PA 1TWXB 1ZHRA 2FX6A 3KQDA 5DN6D 2C3SA 2PSXA 3MU4A 2O8UA 1FI8A 1ZGIA 1KYNA 1Q3XA 4VGCC 4JK6A 1TRNA 1ZTLA 4FUHA 2VU8E 1EJNA 1MTVA 3FFGA 4IGDA 2HLDD 2YNBA 3UB0A 3I77A 1RXPA 4JZEH 3WW7A 1ZZZA 3IWMA 1KLIH 2ILNA 2ZFRH 5F53A 4X1RU 2J4IA 6GCHG 1GJ7B 3BG8A 1AFQC 3H09A 2VVCA 1FXYA 1E35B 4ISOA 4I8JA 2J5UA 1AUJA 5C5OA 2J2UA 4OS5A 2J9NA 1OYQA 1NN6A 3RDZA 1TALA 4MG3A 2OTVA 1ELEE 3RMMH 3F9GA 1W11U 2VIQA 4RT1A 4DURA 4VGCB 9LPRA 2VINA 4ZXXH 3SJ9A 4BTTB 1C1WH 4ABGA 2GGVB 2IPQX 1HAOH 1C2FA 1G30B 2BZ6H 3U9AH 1HCGA 6CHAC 1RTFB 2A1DB 1GMCF 1JMOH 1SSXA 4UFFH 1NESE 4FU7A 3A80A 1PPHE 3LOXA 1KXAA 1UVTH 3E3TA 4K5ZA 2CGAA 3SV9A 4ABEA 1UK2A 4B74A 3MNXA 2XC5A 1Y59T 5FPTA 1C5VA 1UMAH 1BMAA 1KXEA 1SHYA 3LGWA 3M61U 1XVMA 1K1OA 2BLWA 2WSSD 1TOMH 4O97A 2GX4A 2BQWB 3P8GA 1ELGA 1V2OT 4FXGH 4KTSA 3SU0A 2BDYA 1CO7E 2GZ8A 3LPRA 3OSYA 4O3TA 3GYLB 1EP5A 2W6JD 3BTHE 2QGRA 3UIRA 1JXPA 1C5SA 4GVUA 2R9PA 3TU7H 2JJ2D 3HGPA 5KEDA 1T7CA 1EAWA 2ODPA 1SC8U 2FS9A 1MABB 1O5AB 1HAVA 1TGNA 3V0XA 4CBNA 1P57B 1PPGE 4XSKU 1P05A 4ZXYH 4NSVA 2JH0D 1GG6B 1BTXA 4X6NA 3W95A 1AHTH 1KXFA 2OQ5A 2IJD1 1KXDA 1GI3A 1K1NA 5PTPA 5T6FA 2HGTH 2BVSH 5T6DA 2WPMS 1MTUA 2HWLB 1AIXH 2H5CA 2O8TA 1C5NH 1ZMJA 4Y0YE 2Z3DA 1GI1A 2O8WA 3K6YA 1O3EA 3I78A 5JYIA 2GKVE 3HK6B 3LU9B 1T31A 1QA7A 8LPRA 1DY9A 1SGTA 1V2UT 4FUIA 3ATIA 4HI3A 1GJ4H 8ESTE 2F43B 2V0BA 4AOQA 2BY6X 3OY5U 4OS6A 1BTWA 3PLKA 5HGGA 2J92A 4MQAA 4XBCA 1HRTH 1SLUB 3VB4A 3PWBA 1TMUH 3B8JA 3D49H 3F9FA 2NU0E 2A5AA 1GBMA 2AH4X 1RTKA 3O8RA 1YCPM 4OGYA 3TK6A 3RXQA 2CJIA 1BZXE 4FVDA 1GBDA 2XTTB 2VIDA 1TBZH 1K1PA 3SGAE 2BXTH 2HPPH 2H9HA 3OU0A 1GMDF 2ZPSA 4MLFB 3SV8A 1O0DH 3SU2A 1XUHA 2Y5GA 3W1EA 4TT3D 5CE1A 1OX1A 2EEKA 1ZSKA 1AU8A 1SHHB 2PKAB 4NFEA 3PB1E 2QF4A 1FNIA 3GCTF 2AFQB 4BXWA 2VWLA 3ELAH 1TPPA 2B0FA 1GHXH 2V35A 2PTNA 5A09A 1NFXA 1TQ0B 1EAUA 1QY6A 1O3DA 2Q6DA 1Z1IA 1CGHA 4E06H 1QJ1B 4JZ1A 4Z6AH 2AIQA 2B8OH 4OS4A 1EKBB 2XWAA 4F49A 2ANWA 3GYMA 2IPHA 4AFQA 1QRXA 2QV1A 1GMCG 1AVXA 1CHOF 2ANYA 5EXMA 1S85A 1TNHA 3RXMA 1PYTC 5DP8A 3QZRA 1ESTA 1CU1A 1V3XA 3RXRA 3OTPA 1DT2A 3E6PH 3ZZCA 3NPSA 2ZNKH 1Z6JH 1S83A 4R8TB 1XM1A 1FPHH 2RA0A 1DSUA 1MZAA 5GPIB 1VITF 3BN9A 5GDSH 1GI5A 2YNAA 3RXBA 2BYAX 1TAWA 1IQEA 1YPGH 5C2ZA 4H6TA 1PQ7A 2NU3E 4Y7AA 2FO9A 1ZJKA 4I8HA 2ZDVH 5FBEA 1SGEE 3TK9A 4IN1A 4MDSA 2F83A 2Q1JA 4ABJA 2IOTA 2EC9H 3S69A 3ZYDA 2PLXA 5C20A 1O5FH 5TJXA 3UUZA 1GPZA 2H9EH 3F0OA 1PYTD 1SFIA 4Y8ZA 1H4WA 1OWEA 2AYWA 2LNCA 2FOMB 3T26A 1AKSB 4JYTA 3FKSD 1DITH 1DPOA 1QB9A 4XOJA 4MPVA 4B73A 1NRSH 3K65B 2PGQB 3RC6A 2A0QB 3A7ZA 4X2YA 3RM0H 3BTQE 5AF9H 3DSGA 4X6MA 3U69H 2ZDAH 1BCUH 4P02A 3BEFB 4LZ4B 1EB1H 4AFZA 2ZCHP 1KDQB 2CHAB 1QURH 4Y10E 1UCYK 2XRCA 2GDEH 4YLUA 4FOUC
chains in the Genus database with same CATH topology
1THPB 1ZR0A 3OX7U 1EZUC 1NPMA 2EI8A 2O9QA 2SFAA 2SGFE 1AVWA 4OS7A 2FLBH 1AZ8A 4DJZB 2AGEX 1GI4A 3P92A 1O31A 5HM2A 5EW2H 1HYLA 2FYQA 2F9UA 3HKIB 1J14A 2V6NA 2ZFQH 3RXOA 4GHQA 1SFQB 2K1QA 1FN6A 5ESBA 4X1NU 3Q00A 1X7AC 1RGQA 1FY3A 1A3EH 1P3EA 1THSH 1KTTB 1GMDG 1ELAA 1ZYOA 4B2CA 1KY9A 3ODFA 1V2QT 1GCTC 1CVWH 3NUMA 3V12A 2FI5E 5GWZA 1MH0A 4X1SU 2WPJS 1V2NT 3RXJA 3EYDA 2BD4A 3SN8A 1MMJN 1TBQH 1FY5A 4FUEA 5JPMH 3V3MA 1P03A 2QYIA 2G51A 1E0FD 1EQ9A 1F5RA 3BG4C 1BBRE 1XUIA 1IOEA 1C5PA 3G01A 2ZIQH 3SNDA 1HPGA 1K21H 3RXDA 1UTMA 4BOHA 3A7TA 4CRCA 3MH6A 1TPOA 3SOSA 3H5CB 4OS1A 1P8VC 3VEQB 1SBWA 4CH8B 1CHOG 1H8IH 1IQNA 1O2WA 1MKXH 1GDQA 4Y7BA 4INKA 5HXFA 1DSTA 4ABFA 2BD9A 1C2GA 4O9VA 5C3NA 1ANCA 2ALVA 2TGAA 1UO6A 3JZ1B 2ZDMA 1FY4A 3BG4B 1ZTJA 5DP7A 2WPKS 2Y5FA 3AVZA 5F8ZA 1RJXB 1P2NA 1QIXB 2P8OB 2FIRH 1AY6H 4YT6H 3AASA 8GCHF 5E2PA 1Z8JB 2TPIZ 3QGJA 4MNWA 1TX7A 1P9SA 2A7HA 4JK5A 2FYRA 2PV9B 1P2QA 4BXSA 4ZROA 1EASA 5FCKA 1CSOE 1GWAA 1H9LB 1TA2A 1C5LH 1XXDA 1WCZA 4SGAE 4BAQB 1MQ6A 5FPYA 2Z3CA 1W3CA 4KTUA 1V2LT 1BMMH 4IN2A 2ZHQH 1O2LA 4Y11E 1XKBC 3ZZ9A 4WY3A 1GJAB 2XBWA 1SOTA 5E8EH 3U8TH 2B9LA 2WUBA 2UWOA 4FUGA 4U2WA 5GJ4B 1QTFA 2BY7X 2D26C 1GHAF 1AB9C 1H9HE 1CT2E 2DE8A 3H7TA 4ZHAA 4JZDH 4HGCA 5A0AE 3ZVCA 2VIWA 3RM2H 4ZKOU 2ZECA 4A1VA 1BRAA 3SW2B 5HYOA 4NIWA 3DD2H 5JBAS 3EA8A 1GMHF 1L1GA 1DXWA 2ZPQA 2ZU1A 4NIXA 2PWXA 1NRPH 5DJ7A 1SGNE 4TYDA 5A0BA 3S9AA 1O2UA 1K1MA 1O3IA 5J4QA 1AB9B 3IG6B 3BEUA 1WTGH 2BDCA 1MTNC 1F5LA 2ANKH 3GY4A 1MZDA 1EAXA 1IQLA 2XBYA 3DA9B 3JZ2B 1LO6A 1GBJA 2Y6TA 3ZZ4A 2OLGA 2W26A 1TPAE 1W7GH 3RC4A 4MPWA 4E05H 3F9EA 4J1YA 3M3SA 3C1KA 2A7CA 3RU4T 4ZKNU 3K6ZA 3MHWU 1O34A 1KSNA 3ZZ6A 1QBNA 4B1TA 4ZKSU 2HVXA 1OWIA 1C2JA 4PROA 4BAHB 1SG8B 1GI9B 1WV7H 1IQHA 1LHEH 1MTNB 2AEIH 3SNCA 1VGCC 1WU1A 2FWWA 1SI5H 4GLYA 4NA9H 3A8DA 4FU8A 3RXEA 4D7GA 1GVLA 1V2MT 3F68H 1CA0B 1HJ9A 2OQUA 2A4RA 4XFQA 4FVBA 1SGYE 2OBOA 4LK4A 1TONA 1YCPK 2OCVB 1AVGH 1YGCH 3UWJH 1MU8B 4B71A 2H1UA 3P70B 4NA8A 3UOUA 3CS0A 5FX5A 3CS7A 1ZPBA 3HGNA 4ABHA 5T3HA 1NY22 1FY1A 3MTYA 4I8LA 4UFDH 1ZLRA 4U01A 3E1XB 1C1TA 1HAIH 3PLBA 4HTCH 1GBLA 8GCHG 2AMQA 5EPNA 1EPTB 3R3GB 4CH2B 3QZQA 1JIRA 1LVYA 2H5DA 3URDA 2ZHWH 4Q80A 2FOHA 4K60A 3AAVA 4JCNA 3SJ8A 4ZH8A 4A92A 1FZZA 1HAZB 5JB8S 3PO1B 4X0WU 2ZFTA 1GL0E 4FUJA 2VJ1A 5A2MH 4X1QU 1UVPA 4I31A 2I6QA 2PKSB 1YPKH 1TQ7B 4ABDA 1BDAA 4FUCA 3E90B 2FOCA 5B6OA 5I46H 2SNWA 3O8CA 1DLKB 4YZUA 3FZDA 1CBWB 1GHAG 3T5FH 3A82A 1LHDH 4INHA 3LKWA 3SNEA 2FODA 4UONA 1RD3B 3RXPA 1NO9H 1FJSA 1ANEA 2GDDA 1P02A 3VGCC 1O2ZA 1ARCA 1GMHG 4GUXA 3MMGA 2F91A 9ESTA 3PWCA 4K1SA 1DY8A 5F8XA 3KL6A 4NWLA 3PROA 1D6RA 1Y3UA 3L6PA 1DLEA 1G3BA 4JYVH 5FHTA 2OXSA 3FVFB 5FBIA 1F0UA 2IJOB 1HIAA 1INCA 1VCPA 1C1MA 4K2YA 1O3AA 1DANH 2FEQH 1NRQH 3BF6H 1Y3XA 1O5BB 2ZWLH 4X8TH 3VGCB 1DICA 1FQ3A 3GCOA 4UEHH 1F0TA 3EE0B 2BOKA 4Y8YA 2Z9KA 2GV7A 3NK8A 1SPJA 2ZFFH 1AFQB 1YC0A 2CXVA 3SNBA 1XVOA 3Q3XA 1QL9A 5IDKA 2BDHA 2QCYA 1OOKB 3T28A 1TRMA 1NTPA 3VB7A 2Z3EA 2G5NA 1YPLH 2BDIA 3M37A 2ODYB 1BOQA 1FN8A 3A88A 5CHAC 1SVPA 1IQKA 4X2XA 4RN6A 1BBRK 6CHAB 2ZHDA 3UTUH 1WYKA 4RKOB 1ZRKA 1Y3WA 1YLCA 4AG2A 2ZC9H 3BTME 2AGIX 3A89A 1SB1H 2QF0A 1MD7A 2FESH 1RS0A 1J9CH 1QCPA 4MPXA 3EA7A 1W7XH 3QWCH 1TPSA 1XUKA 1MCTA 1T8MA 1KXCA 2Y82A 2G4TA 4FUBA 1GJCB 5LPEA 3RXAA 1Z8GA 5LPFA 4IMZA 5CHAB 1W10U 5K7RA 4CRGA 2OC7A 3KN2A 3E0PB 1GHVH 3KF2A 2ESTE 1G3DA 3RUOA 4WF8A 5ESTE 1EATA 1ABJH 2ZGHA 2M5TA 2BDAA 3RC5A 3SU1A 1F2SE 2QA9E 1NRNH 1B0FA 1O38A 1P11E 3Q3KA 3ZVGA 1GI0A 1DE7H 2Z9GA 1TIOA 2RG3A 2KAIA 1FIWA 4IW4E 1O30A 1WQVH 5AHGH 1ZRBA 3UNSA 1OP8A 2B5TB 2A32A 3TVJB 2H6MA 1AWFH 4I8KA 1W2KH 1GL1A 1XUFA 1O5EH 2ZFPH 2ULLA 2BXUH 3BTWE 1DWBH 1EUFA 2V3OH 4RSPA 1SGQE 3SHAH 1BA8B 1UTPA 2Z6BD 1ZHPA 2ZHFH 3QGNB 4RKJB 3TNSA 1O2XA 3GY6A 2RCEA 4J2YB 2G8TA 3ZVAA 2Z9JA 1Z8RA 3ZV8A 3TJNA 3BEIB 3E16B 1Z7KA 5SGAE 3ZVDA 2ZI2H 3UQOA 5A8XA 1C9PA 1GHYH 1O3KA 2RA3A 2LPRA 2QXJA 4ESTE 2UWPA 3MH5A 1A0JA 5IYTA 1NS3A 5F6MA 3SZNA 1BHXF 4H4FA 2OUAA 4NGAH 5CMXH 3P8FA 3PTBA 1IQGA 4NIYA 1Y3VA 4JZIA 4X8VH 2RDLA 3Q77A 2CV3A 3ZZAA 1NZQH 1ZPZA 3ZZBA 3S9BA 1MTWA 3RXCA 4ABIA 2QY0B 4CREA 2H9TH 2FMJA 3E0NB 3KQCA 3Q3YA 4MNYA 2WV4A 1LVOA 3QX5H 4AGKA 1ID5H 5TCCA 1A3BH 1E34B 1C2LA 3UY9A 3BTTE 3UQVA 3KIDU 3RXSA 3UNRA 3EQ0H 1T8OA 4Q7YA 1P09A 3FAOA 2ZGCA 2IN2A 1VR1H 1EXFA 1ETTH 1NROH 1GJ5H 2HALA 3PLPA 1OXGA 1ELBA 1AE8H 4O3UA 4ASHA 5GXPA 1BMNH 3UNQA 1Q2WA 1QL7A 1ZHMA 1L1NA 4UE7H 2A45B 1G2LA 3GCNA 1N8OC 2JETC 1W0YH 3P95A 4A5TS 1C1SA 4GHTA 1O2SA 1O36A 1BRUP 2PHBA 4A7IB 3MO3A 1J15A 1LHFH 1KLTA 3RXVA 1O2JA 4CRBA 4WMFA 1VCQA 1SGDE 2BZAA 2QN5T 4FUFA 1ACBE 4DCDA 3TGJE 1HXEH 1GHBF 3A7XA 3LH1A 3DUXH 1QL8A 4AN7A 3W94A 2QC2A 1PQ8A 3SI4H 1O2PA 1GDUA 5K0HA 4B75A 3SBKA 1DS2E 1D3TB 2WYJA 1GGDC 5EODA 4YOJA 2XXLA 2PFEA 4MNVA 1LVMA 1UHBB 3FP8E 7ESTE 2VWNA 1O2YA 3HPTB 1IHSH 2P3TB 2ZTXA 4YOGA 1ESBA 1OSSA 1ZSJA 3RU4E 1TNJA 2D1JA 2Y5HA 2C8ZB 1HLTH 3MH7A 2W3KA 1ELDE 1TX8A 3S9CA 1H9IE 4D76A 5TCAA 3SV6A 1CHGA 1TB6H 2ZDNA 3GY3A 3VPKA 2ZPRA 1FONA 3QDZB 1EOLA 2FS8A 2F3CE 3RXGA 3SU5A 2BD3A 4YLQH 4BTUB 3MU8A 2JH6D 1WOFA 1SQOA 3A8BA 3AW1A 2EA3A 3F1SB 2BVXH 1UTQA 4ZHLU 2OC8A 4WMEA 3RXTA 1GJ8B 1F0RA 3TITA 2A5IA 1G9IE 1BB0B 2YOLA 2P16A 2F9NA 1DUAA 1TABE 2Q6FA 2G55A 2B7DH 3ZVFA 1QBVH 1LCYA 1QGFA 1D6WA 4Y79A 3UR9A 2VGCC 2VVVA 2O8LA 2XC0A 3SUFA 1QQ4A 1HAHH 3VXEH 3SGQE 2GMTC 1WBGB 3KGPA 1MKWK 2ZF0H 3A8AA 4FU9A 1NU7B 2P93A 3GCTG 2BMGB 1PPFE 4I33A 3UFAA 5LH8A 2FM2A 2WINI 1D3PB 1QR3E 1EJMA 2SGEE 2SGPE 2VNTA 1LVBA 5E0JA 1JRSA 1DX5M 2XNIA 2P94A 4MVNA 1B7XB 3ATMA 2VGCB 1HJAC 1HNEE 5A8YA 2UUKB 1O2GH 1ELTA 1SOZA 1BTHH 1C4Y2 1GCTB 3GCHC 3LGUA 3SJOA 3SV2H 1GVKB 1S84A 1LQDB 2A2QH 2A5KA 4AYVB 3CENA 2OD3B 4KKDA 3ZYEA 2QIQA 4M7GA 2QXHA 3BTEE 5GIBA 1CA8B 4WWYA 1QB1A 8KME2 3UPEA 4A1XA 1AUTC 1CT0E 4TY7A 1O5DH 2BDGA 2XW9A 2A7JA 2ZA5A 5G4BA 2PGBB 1P2IA 3RXLA 2R0KA 4KTCA 3SQHE 3LDXH 1TE0A 4AB8A 4DIHH 2G4UA 2VH6A 2GCTC 4IBLH 1O3PB 1VITG 1M9UA 2ALPA 3NCLA 2BLVA 1AN1E 5L2ZH 1AI8H 4H42U 1HAVB 3QTVH 2BLQA 3QO6A 3MO9A 1ELCA 3NKKA 1GHBG 1SQTA 1C1NA 1NFUA 4SGBE 1BT7A 1T8NA 1TX6A 1HAYB 3MH4A 1O2HA 2FI4E 5C5NA 3B9FH 3MFJA 3KQEA 1A7SA 2PW8H 4D9QA 2OC0A 1LHGH 4O03A 3KHVA 1Y5AT 4OGXA 3ZZ8A 1AD8H 1A5GH 1UTOA 3FP6E 1K9OE 1TA6A 3QUMP 1GBBA 1BRBE 5DKMA 2UUFB 1HB0B 1SGPE 3ATKA 4A1TA 5H4IB 5F8TA 1V2TT 1O33A 1MCVA 3TJUA 4ZUHA 1BJVA 3URCA 1A46H 3PM3A 1L4DA 1C5OH 1BQYA 3PV4A 2ZU2A 4DOQA 1F7ZA 2FOBA 3UR6A 2OP9A 2Z9IA 3RXUA 3GICB 4LOYH 2GVFA 1Z8IB 2FPZA 3T29A 3GDUA 5EQSA 1Y5BT 1TMTH 2BD2A 1OWDA 2CN0H 1DVAH 2AS9A 4HZHA 1T4VH 1KTSB 2BQ7B 5FPSA 3B23B 3SUEA 4TWYA 2D8WA 4E7NA 2WPIS 2VH0A 3ZV9A 3U8OH 1WAYB 1KIGH 2FOAA 2G81E 4JYUH 2PKAA 1DFPA 3PMAB 1P0SH 5C1UA 5HM9A 1LPGB 3SHCH 1K22H 1O5CB 1QJ7B 4B76A 2J95A 3TK5A 1B5GH 1D3DB 3AW0A 1EJAA 2QF3A 4IC5A 1C2IA 3P8NA 1ESAA 2C4FH 3TH2H 1YBWA 4JZFH 3IITA 4IS5A 5JBTA 1GI8B 3H7OA 2GV6A 4ISLA 2JH5D 3HKJB 2TGPZ 2PUQH 1UCYH 3O8DA 4AYYB 3LC3A 1P04A 1ZTKA 2TGDA 2ZQ1A 4ISIH 2F9BH 5LPRA 4ZKRU 1ETRH 2HRVA 3CP7A 1JOUB 1VGCB 2Y7ZA 1ZSLA 1BUIA 1C1RA 1EZQA 1O3GA 1L4ZA 1YPJH 1UVUH 2WPHS 1ETSH 3GY2A 3U8RH 2H2ZA 1QNJA 2SGQE 2XCNA 4X2VA 4WH6A 3EGKH 3M3TA 1O3OA 4Q7ZA 1ANDA 1O39A 4NZQA 4UFGH 4X8SH 3STIA 2STAE 3NXPA 3A81A 4AORA 1E38B 1CE5A 1OWHA 4YOIA 1U6QA 2GZ9A 2TIOA 2WYGA 4LZ1H 1BITA 1MKWH 2XCFA 4WMDA 4CRDA 2VIVA 2GT7A 2C8WB 3WY8A 3TH4H 4INLA 3ZVEA 1J16A 1JRTA 3RMNH 4YT7H 1SL3A 1QA0A 1A5IA 1G36A 1XUJA 1W8BH 2V3HH 1C1UH 3QN7A 1Z1JA 5EXNA 2VIPA 1C5ZB 2FTMA 3EAJA 3D62A 2ZG0H 3EA9A 1TGSZ 3BSQA 1Z6EA 4UDWH 1C2HA 3A7VA 5E2OA 4DIIH 1AKSA 1C5UA 4AGJA 4KELA 1YLDA 2CMYA 3KNXA 3O8BA 1LKAA 1OYTH 3M7QA 1GJBB 2ZHEH 2R3YA 4K8YA 1EZSC 1UK3A 2HPQH 1V6DA 1SQAA 5E0GA 2PTCE 6LPRA 1G37A 1SGCA 2ZEBA 4BANB 3TIUA 2WV5A 2OINA 1C9TA 1XMNB 3SJKA 1KDQA 1JBUH 1C5YB 3VB5A 4GSOA 1G32B 3OTJE 2STBE 1UTJA 2BM2A 3KEEA 1ZMLA 1S6FA 2GD4B 1FPCH 4WXVA 4TY6A 1K1IA 1XKAC 1SGRE 1DWDH 2FDAA 4NCYA 3DHKH