1HPGA

A glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
187
structure length
187
Chain Sequence
VLGGGAIYGGGSRCSAAFNVTKGGARYFVTAGHCTNISANWSASSGGSVVGVREGTSFPTNDYGIVRYTDGSSPAGTVDLYNGSTQDISSAANAVVGQAIKKSGSTTKVTSGTVTAVNVTVNYGDGPVYNMVRTTACSAGGDSGGAHFAGSVALGIHSGSSGCSGTAGSAIHQPVTEALSAYGVTVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamic acid specific protease
publication title A glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding.
pubmed doi rcsb
source organism Streptomyces griseus
total genus 52
structure length 187
sequence length 187
ec nomenclature ec 3.4.21.82: Glutamyl endopeptidase II.
pdb deposition date 1993-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hpgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hpgA01
3B9FH 3ZVBA 1GVZA 1J14A 3P70B 1F7ZA 2F83A 2OC0A 3DD2H 7ESTE 1CO7E 1O3NA 1XM1A 4MNXA 4DJZB 3W95A 2GCTC 2JETC 2ZTXA 4H42U 3BTWE 2B8OH 1HUTH 5FX6A 1RS0A 3SGQE 2XC4A 3L6PA 2WYGA 3SNEA 5LH8A 1P3CA 2SGDE 1KXFA 1O3LA 1HLTH 2ANMH 1DT2A 1SGFG 5E0JA 1ELAA 2VH6A 1GJDB 2GMTC 1G2LA 1AWFH 3GDUA 4AGJA 1ELFA 1ZZZA 1C1MA 3A80A 2C3SA 1TOCB 3MU4A 2A0QB 2HNTE 2VIPA 1LHEH 3BSQA 3GCHB 1A46H 4DW2U 1QTFA 1W14U 1RTLA 3HGPA 2C8XB 4IC6A 4ABDA 3M35A 1F2SE 5DPAA 3T62A 1TA2A 5PTPA 3BG4C 1P2IA 3RU4E 1UJ1A 1UTMA 4FU9A 1GI6A 3U1IB 1HAYB 5JDUB 3LC3A 2GCHG 1O36A 2XTTB 2XWAA 5C3NA 4MPXA 1OS8A 3P92A 3MH6A 3SGAE 4CRGA 1YLDA 1V2WT 3D62A 1DM4B 3ZZ6A 1RTKA 1JOUB 1D6WA 3BTTE 3ZZ4A 4OS5A 3AASA 2YNAA 1SFIA 1GBDA 1T8LA 1D9IA 4AFSA 4OS6A 1TBQH 1QB9A 2R2WU 5EOKA 1VCWA 4AB9A 2VINA 3IG6B 2R0LA 1OP8A 3BEUA 2HPQH 4B2AA 1HJ9A 3UUZA 2FWWA 4ABIA 1O35A 3MHWU 5JPMH 5EW1H 2ZPQA 2LNCA 2P3TB 4XSKU 1T4UH 1DANH 1ANBA 5JBAS 1C1VH 3ITIA 3RXLA 2FOEA 3QUMP 3Q3KA 3GICB 3URDA 1QB1A 1O2SA 2J94A 3U98H 2K1QA 3CENA 1TNKA 3PV4A 2ZP0H 1RFNA 3RU4T 3F9GA 2A7HA 3TJOA 1UVSH 4ABBA 2GCTB 3Q00A 1BT7A 2JETB 5DKMA 2A2QH 1GHZA 4GVUA 1ANEA 3TH4H 4BTTB 1D3PB 3QDZB 3BG8A 1VJ9U 1W0YH 3A7WA 3SOSA 2BXTH 2GZ9A 3A7ZA 3ZV9A 1A7SA 1YBWA 3RXOA 4X8SH 4X1RU 1BRCE 3SORA 3V7TA 1N1LA 1QJ7B 2ODQA 2J92A 8GCHF 5CMXH 1GJCB 2GMTB 1OWJA 1LHCH 1SLWB 1KTSB 1TBZH 1QRZA 1UTNA 2H9HA 3U8TH 4Y8ZA 4BTUB 1S5SA 1OWIA 2BLQA 3QK1A 1BMLA 3GYLB 1P2OA 1BTXA 2AIPA 1FJSA 1ZTLA 1AKSB 1TALA 3ODFA 1GL0E 1C5PA 2ODPA 4JZ1A 3BG4B 1HXEH 2OC7A 1SL3A 3DA9B 1PYTC 7KMEH 2Z9GA 1CA8B 3O8RA 3MU5A 4KELA 5GIBA 4AB8A 1P2MA 4IBLH 2IPHA 3MO9A 5JBCS 3LKWA 5A0BA 1DLEA 2P8OC 3BTFE 4WH6A 1Q2WA 1P01A 4Y0ZE 2A32A 1EOJA 1EX3A 2STAE 4X6MA 2FOCA 2JKHA 1AE5A 1ZPCA 2A4RA 1TPPA 1LPKB 5LPFA 4B2CA 1S84A 1Y5UT 2SNVA 1NTPA 3ODDA 1GBIA 2ZDAH 2A7CA 2A5AA 3EQ0H 1HNEE 1A0HB 1QHRB 1Y8TA 2VH0A 2PKAB 5JB9S 1ELCA 3T25A 3VXFH 1AO5A 2GKVE 1BMMH 1BBRE 1SGIB 2C8ZB 3RXCA 1XKBC 1BQYA 2FYRA 2TGAA 2F91A 2KAIB 3TITA 1J15A 3FP6E 5HM2A 3GDVA 2R2MB 3BF6H 3MNBA 4NFFA 1A5HA 1VJAU 1ZR0A 4YOIA 1BTYA 2FTLE 4BOHA 4ZHLU 1BHXB 3A8AA 1C2GA 1Z8JB 2SGAA 1JRTA 4O3UA 4JZEH 1VITG 2P95A 3A7YA 1EQ9A 3RXBA 1GI4A 3SW2B 3RXMA 2ZPSA 1HFDA 3M3SA 5C5OA 1VR1H 1DUAA 2XBYA 3SV8A 1XUFA 3RP2A 4KP0A 4I8HA 3SJKA 3V0XA 1O2MA 2VVVA 4YT6H 3GCOA 3PLBA 3FZDA 4Q2KA 1AFEH 1T31A 3LJJA 3EGKH 4O9VA 3SV2H 1BB0B 1OX1A 2GVFA 1F5RA 3UOUA 4WXIA 2H9EH 3KNXA 3QO6A 3VPKA 4I33A 2F9NA 2ZU5A 1C2FA 2BD4A 1PQ5A 2FYQA 2P8OB 4FXGH 4X0WU 4WMFA 3SU3A 1AFQC 2WUCA 1AWHB 1EP6A 4CBOA 1MU8B 1OKXA 1YP9A 2RCEA 1VCPA 2FESH 1C5RA 3PTBA 1V2VT 4WJG2 2AMDA 3ZVGA 4K60A 1H9HE 1BHXF 1B0EA 4MLFB 4SGBE 2ZDVH 1GL1A 5E2PA 1NRQH 1EOLA 1XKAC 2P93A 1AKSA 2A45B 3PMAB 3RXGA 1C5OH 5E0GA 4X2YA 1C4Y2 2B5TB 4WF8A 1GDUA 3K65B 4JYUH 1AU8A 1DY9A 1L0ZA 2WINI 2C4FH 6LPRA 2TGTA 1GJ4H 1O2TA 3RMMH 3U1JB 3PTNA 1QNJA 2GCHF 2P59A 1C5XB 1GBJA 2ZG0H 3TNTA 2ZCKP 1TMBH 4MTBA 1ELEE 5CHAC 4K69A 2QV1A 3I77A 2ZIQH 2BVSH 3OTJE 4ZKSU 5DP5A 2BY7X 1FPCH 5FX5A 5DO4H 1FAKH 1BOQA 3PMBB 3LDXH 2AFQB 3SN8A 1CGIE 2LPRA 1HAHH 1G3EA 2Z3CA 2BY6X 2JH6D 1ESAA 1IQFA 1HB0B 1PPEE 1QBNA 2ANWA 3F9HA 3QX5H 2ALVA 7GCHF 5DG6A 3C1KA 4BAMB 2O8WA 3MOCA 1IQLA 2PKAA 1C2HA 1GI5A 1QL7A 2Y5FA 3IITA 2ZFFH 5GDSH 1Z1JA 4NA8A 1GMDF 3QTOH 4AORA 4BAKB 2KAIA 3P6ZB 4JCNA 2ZFRH 2VIDA 1QJ6B 1Q3XA 4DURA 1NROH 1FQ3A 1DSTA 4UFDH 3VXEH 1FDPA 4R0IA 3VEQB 5C5NA 1P2QA 2QXHA 3SQEE 1MAXA 2RG3A 5DP6A 5DK1A 1AFQB 1HXFH 2ZDKA 3KF2A 2BDHA 1IQMA 1O33A 2UWLA 3GY7A 4UFEH 2TBSA 1W0ZU 4FUDA 3K6YA 1MUEB 1C9TA 3OU0A 4KTUA 3BIVH 1C2IA 3SNBA 1TFXA 1WCZA 3LGWA 4AFZA 2BD8A 1HRTH 1HAZB 1K1JA 1GBBA 2D2DA 3OYPA 2F9OA 2V6NA 2B7DH 3MH7A 1IQNA 4DIHH 1C9PA 1FY3A 1TX6A 1KLTA 1NRRH 4A1VA 1BTHH 4F49A 5ESBA 1TE0A 1SGPE 2F9PA 2Z9IA 1O3OA 3KEEA 4RSPA 1DWBH 4Z6AH 1ARCA 2ANYA 2FPZA 2ZU2A 3MFJA 1SHHB 1ABJH 2ZGHA 1UMAH 1YKTA 5BRRE 3GY5A 2FI4E 1ZHPA 5CHAB 2IOTA 1FZZA 1G9IE 2QY0B 2ZDLA 1OXGA 1SHYA 2PTNA 3BTME 3A83A 8GCHG 1EAIA 4NA9H 1SLVB 4GCHG 1W12U 2FIRH 3UQOA 3FANA 4DVAU 2BVXH 1YPHE 2ZHQH 1O3AA 3BTDE 1MKXH 4Y7BA 1O31A 1GMHG 1EZXC 2QA9E 1D3TB 3RLYH 3T28A 3LOXA 1JIMA 2PSYA 1LHDH 3UWIA 1XUJA 3BTKE 2BY5X 3V13A 4I32A 1BBRH 2V3OH 3RXFA 3TJVA 3SGBE 1P09A 2OTVA 3SU0A 5J4QA 1O2IA 2Y7XA 4I31A 3TK5A 2TPIZ 2HWLB 1FAXA 2SGPE 1ELVA 1PJPA 5A8YA 1K21H 4IMQA 3HGNA 4CH2B 2PSXA 3FFGA 2D1JA 4NGAH 5A2MH 1VITF 1HAOH 1LO6A 3M5LA 4IS5A 1AMHA 1EB2A 3RLWH 3QLPH 3IWMA 4AFUA 1T8NA 2HOBA 2GT8A 3D49H 2Z3EA 3GISB 3PWCA 3NPSA 1BRUP 1S6HA 4O97A 3OY6U 2JH5D 2WV4A 2G4TA 3A88A 1GJBB 1F0SA 4OS1A 3GY4A 3E0NB 1GI1A 2ZECA 2OD3B 3RXSA 2Y80A 2XBXA 1DY8A 4I7YH 2UUKB 1C1TA 3KQDA 5A8XA 2R3UA 3ZZ3A 2BQWB 2AGGX 4HI3A 5JB8S 4ABGA 1DDJA 1LVMA 3KIDU 3H7TA 1QBOA 2BY9X 4I8LA 3MMGA 2ZF0H 1O3GA 2AYWA 2ZFSA 5TCCA 1C2JA 3SO3A 1SGRE 2EA3A 1AGJA 3E91A 4FUFA 3VB7A 5JBTA 4AN7A 3VB6A 3U9AH 4CHAC 1W7GH 3EA7A 1BRAA 1QIXB 3BV9B 3SJOA 4CR5A 5SGAE 1S82A 4LZ1H 1S81A 1GBHA 1W13U 3A84A 3B8JA 2H1UA 1C5WB 4YOJA 4DOQA 3A87A 4LXBH 1O3MA 1RXPA 4NWLA 4KGAA 4MQAA 2ZNKH 1GCDA 1K1NA 3LGVA 5C67A 1PYTD 2V3HH 2DUCA 4JZFH 4BAQB 1IQKA 1YYY1 1XUHA 2XCNA 2CMYA 3T5FH 4OS4A 3SJ9A 4YLQH 3ZV8A 1BDAA 4IN2A 1T8MA 2GT7A 1FV9A 1K1MA 1HAVA 1FY4A 2NU4E 1NZQH 1PPHE 2OBOA 2VGCC 3SBKA 3ZZAA 1QY6A 2XRCA 5EXMA 4ZHMU 6CHAC 1FMGA 1GBFA 3U8RH 3SNCA 2BLVA 4FVBA 3EA9A 1PQAA 2TRMA 1GJ8B 3A82A 1V2LT 4ZAEA 4B73A 3ATLA 1O5FH 5T6DA 4D7FA 1JXPA 1P10A 1MU6B 4U2WA 1GI2A 4ABHA 1O0DH 2D8WA 2PGBB 1SGNE 3LU9B 3RMLH 1ZHMA 3SU6A 1HV7A 2BDBA 1V2JT 1UTKA 1EZUC 3MNSA 4NA7A 3T26A 1NO9H 2VWMA 5F6MA 2HLCA 3BIUH 4XDEA 2H5DA 3SI4H 1AQ7A 2BQ7B 4DG4A 1OWDA 2ZGCA 3MU8A 4IMZA 1NC6A 3KN2A 3C27B 2PTCE 1TPOA 1UTPA 3EDXB 4TPYA 1MKXK 3RXHA 3I29A 2FZZA 1GDNA 2OLGA 2TGDA 1P06A 1GJ9B 1FNIA 2OC8A 4KTSA 4XE4A 4CHAB 4CRDA 4U32A 1BTUA 1ANCA 1YF4A 2O9QA 3H5CB 4D8NA 2B9LA 4FU7A 3NKKA 1BIOA 1W10U 2BDYA 1LHGH 1SG8B 2R3YA 3CP7A 5EODA 7GCHG 1BBRK 2J4IA 2UUFB 5J4SA 1WQSA 1RIWC 1SGCA 8ESTE 2W3KA 1KLJH 1B0FA 2XC5A 3A8DA 1GCTC 1LVOA 1ZHRA 3MH4A 1O2WA 1GMDG 1L1NA 2WV5A 1TONA 1WTHD 2Z9LA 2ZHDA 1F0UA 1TGSZ 3A7XA 1EPTC 1O5DH 3Q77A 1HAGE 3M3VA 2FOMB 1V2QT 3TJUA 2Y82A 3GY3A 4Y6DA 3GY2A 3LONA 4XBBA 1IQHA 1ZTKA 1MTVA 1V2UT 2VGCB 3UIRA 1QA0A 1Z7KA 1ZSKA 5FPTA 6CHAB 3PLPA 1NM6A 4D9RA 1XUIA 1XUGA 4AG1A 3SQHE 1A3BH 1MMJN 1O2YA 3FAOA 4K3JA 3E3TA 3QTVH 5IDKA 3DUXH 2Z3DA 4GCHF 1V2TT 3ZZ7A 1C1SA 2Z7FE 1K22H 4CRCA 1PPCE 1GMHF 3F9FA 2J34A 3OSYA 2FLBH 3G01A 3TJNA 1RTFB 2ZDNA 5EQQA 3SV9A 1N8OC 4K1SA 1AZZA 1A1RA 3LGYA 1MQ5A 4BXWA 2Z9JA 2ZTZA 2SGEE 1V6DA 1F5LA 5HGGA 1MD8A 3BTGE 1TX8A 1OSSA 2O8TA 5E8EH 1NRPH 4B1TA 1T4VH 5FPYA 4DIIH 1K9OE 2QCYA 3PO1C 3QGJA 3RXUA 4FUJA 3M7UA 2XNIA 4NIYA 1W3CA 4XBCA 2ZWLH 4BXSA 5LPEA 4ZROA 1AN1E 1HAIH 1NT1A 2UUJB 3ZVFA 1TB6H 3ZVDA 1H9IE 4GHTA 3SUEA 4INHA 3RC6A 1UK3A 1YPEH 3RM0H 1JWTA 3LPRA 3QN7A 4CBNA 1YPJH 2FS9A 3RXTA 3UTUH 2ZFPH 4GLYA 1C1RA 2V35A 3A81A 3JZ1B 2G51A 4Y0YE 3F9EA 4WH8A 4YTAA 2VIQA 5L2YH 1C5VA 2EI8A 2RA0A 1YPKH 2ZQ2A 4U30A 2AGIX 1O2HA 2HRVA 1P2KA 2PGQB 4Q80A 1FONA 1GJAB 4K8BA 1RIWB 3STJA 4LK4A 2C90B 5ESTE 2GD4B 4DT7B 1C5YB 1GCTB 1NRSH 1LHFH 4ZHAA 1C2DA 2FODA 3UOPA 3O8CA 2ANKH 4X2XA 1C2KA 1EPTB 4E7NA 5EXNA 2G81E 5EGMA 3URCA 2ZCLP 1GHYH 2FXRA 2ZTYA 4HTCH 3A89A 3P17H 4TYDA 1AB9C 3M5OA 4FU8A 1CE5A 5TJXA 3KCGH 5DP7A 1O3FA 4CRAA 4KKDA 3VGCC 2CJIA 2BZ6H 1X7AC 5GWZA 1O32A 2ZGJA 5AFYH 1OWHA 5LGOA 2HPPH 2PR3A 1C1NA 3Q3XA 1H4WA 3VFEA 1QQ4A 2M5TA 1HCGA 2Z9KA 1Y5BT 2VB0A 1XVMA 2ZZUH 3TGKE 1O38A 4HZHA 5I46H 3OX7U 1O34A 1Y3YA 2C8WB 1ZLRA 4X8TH 4GAWA 2G5NA 4A6LA 3UPEA 3QWCH 3LGTA 1EJNA 4JYVH 1TGNA 4Y10E 1HJ8A 3T27A 1IQIA 1VITH 2FI5E 3ZZCA 4LOYH 4B76A 1HYLA 2STBE 4INLA 1N8OB 5B6OA 4H6SB 5T6GA 2A31A 1RJXB 1J16A 4K1EA 1C5ZB 1UK4A 4MPVA 1GBKA 1QA7A 1IAUA 2H6MA 8LPRA 4TWYA 4ZUHA 5K7RA 1ZMNA 1BCUH 4ISNA 3PO1B 1TNGA 2ZCHP 1T32A 4UEHH 1L1JA 1BTWA 3KQEA 3A7TA 1C4V2 5FHTA 5DP9A 1ZRBA 4FVDA 2JH0D 3CS7A 4NCYA 1C5SA 1UHBB 2B0FA 5EG4A 4JK6A 4LZ4B 2BDIA 1BMNH 1F92A 1D3DB 2BLOA 5C1YA 2HVXA 4NZQA 4MNYA 1A0LA 2VVCA 1TNHA 4AYVB 2BVRH 1P0SH 1DOJA 4TWWA 1AY6H 1SVPA 2BXUH 2THFB 1EASA 2WYJA 5EQRA 3ZYEA 3GDSA 4ISIH 1SQOA 3S7HB 2FLRH 3E16B 3NUMA 3O8DA 2ASUB 4OS2A 3LH1A 2NWNA 2PUXB 2CHAC 3UQVA 4WMDA 1O2ZA 1O2JA 3SV6A 2BOKA 3M7TA 1TMUH 3AAVA 1AB9B 1TBRH 4FUCA 3KQBA 3VGCB 1C2LA 3MTYA 1UTOA 1F0TA 1FY1A 2PV9B 1G3BA 5GJ4B 1GHAF 3M61U 1LQEA 3PYHA 2BQ6B 1DFPA 4Q7XA 3FVFB 1QR3E 1XVOA 1O3KA 2XWBI 4DCDA 1FY8E 1UVPA 2RDLA 3QGNB 3BEFB 1E36B 1DXWA 1TA6A 2CF9H 3SUGA 2ZO3H 2A5KA 2V0BA 1Y3UA 1SC8U 1G3DA 2BLWA 1FUJA 2PWXA 3E6PH 1GI3A 5FCRA 5FBEA 4MVNA 3RXEA 1L4DA 5DP8A 1EPTA 2ZU4A 3P8GA 3M37A 3SU4A 2A5IA 3V12A 3SI3H 5FXLA 1SGEE 1E38B 1XX9A 2YNBA 1RD3B 2BX3A 2BB4A 1N6YA 2FO9A 1KYNA 3M36A 1XXDA 3ZZDA 3P8OA 3RXDA 1MQ6A 3M7QA 1W2KH 5ABWA 4NSVA 2HNTC 1CGJE 2FMJA 1TQ7B 1O37A 4X1NU 4ZXXH 1SQTA 1VGCC 1SR5C 2AMPA 3TGJE 1ETSH 4RN6A 2GGVB 1DITH 5T3HA 2IJOB 1THSH 1SOZA 1GHVH 4KTCA 5HM9A 2VIVA 4CRFA 4GHQA 1D3QB 3PM3A 2GP9B 2BTCE 2Q6DA 3VB4A 2TGPZ 1P57B 1E34B 3STIA 1H8DH 2PLXA 2I6SA 1BUIA 2WPJS 4PROA 2PHBA 3V3MA 1TLDA 1Z6EA 1NY22 3LC5A 3MNXA 1A0JA 1LPZB 4NZLA 4AX9H 4NSYA 2CHAB 2XW9A 1UO6A 3AW1A 3TK9A 2Z94A 1HAVB 1S83A 1AZ8A 1ZJKA 1Y59T 1A3EH 4FUIA 4K1TA 2NU0E 1P02A 3T2NA 2BDCA 1BJUA 3RXVA 2H2ZA 2ILNA 2D26C 1U6QA 2CGAA 5I25A 1UHBA 1FY5A 3M5NA 4NIVA 1DPOA 4YO9A 3LGIA 1O3EA 2AEIH 2OP9A 3I78A 4O03A 1BZXE 3SU5A 1C1WH 4OGYA 4IW4E 1GDQA 4Y11E 1EJAA 2OQ5A 1QGFA 2P3UB 5E2OA 1KXEA 1UTJA 3NZIA 1DICA 4JZDH 1THRH 1KIGH 1CT0E 1P9SA 1CHOG 3GCNA 1QRWA 2ZA5A 1BTPA 3ATIA 3E0PB 1YGCH 4X1QU 1K2I1 1O3HA 4TY6A 1CA0C 1UVTH 1BITA 5AF9H 2TIOA 2QXJA 3RXKA 4GPGA 5A0AE 1GHBF 1D6RA 3KGPA 3SNDA 4CH8B 4A92A 5IYTA 1HIAB 1C5UA 1QURH 1VGCB 2FDAA 1UTQA 4OGXA 1Y5AT 1GVLA 5DP3A 1ZMJA 4ABAA 3EAJA 1LKBA 2G55A 2OINA 4ZKOU 4UONA 7LPRA 4JMYA 2UWPA 3B23B 1DLKB 3ZVCA 3GY6A 1S6FA 1KY9A 1ZJDA 4IN1A 1K1PA 3SUFA 1YLCA 1SB1H 1QB6A 4K5ZA 3RXAA 1PPBH 3LIWA 1EATA 2BD9A 4Q7YA 1MBQA 1PPGE 1ZPBA 1O2PA 3F6UH 1EJMA 1SBWA 1FPHH 1JBUH 1P8VC 2BOHB 4X1PU 4X2WA 4ABFA 5FCKA 1W11U 1MTUA 3UNQA 1K1IA 5DP4A 3ZVEA 1AI8H 3GY8A 1ORFA 1BMAA 2O8MA 1TABE 4HFPB 4THNH 1W7XH 1WTGH 3ZZ9A 3Q76A 1ELGA 4X1SU 1PQ7A 3EE0B 1HJAC 4X8UH 4XOJA 4A1TA 1CGHA 1C5NH 1UCYE 1GBEA 4DGJA 1BRBE 1P2JA 2GDEH 3H7OA 5C1UA 1UTLM 3RUOA 2VWNA 5GXPA 5TCAA 2AH4X 1OP0A 5F8TA 5FBIA 1KTTB 3ZYDA 3UNRA 2NU1E 3BEIB 3SJ8A 2OC1A 3LJOA 1BJVA 2HNTF 4X2VA 3GCTG 1C2MA 2ZKSA 2QYIA 1ZSLA 2F9VA 3EA8A 4ZKNU 3QZQA 1EAUA 5K0HA 1YPMH 2H9TH 3PMHB 1XXFA 1TOMH 1HBTH 3KL6A 2P16A 2QN5T 5F03A 1WOFA 5F8ZA 4UD9H 1DWCH 1CA0B 1GJ7B 2EEKA 1ELTA 5ETXA 3PROA 1Z1IA 3TLOA 3PWBA 3UREA 3SZNA 1GI0A 1KXDA 3DFLA 1NFYA 3M3TA 3S9BA 1MKWH 2R9PA 5HXFA 1CHGA 1O2QA 3PLKA 2P3FH 4FUBA 1GJ6A 1GBLA 2SGQE 3FZZA 2WPLS 1SPJA 2Y5GA 4A1XA 3F68H 1A5GH 1O2XA 1P05A 4WVPE 2SGFE 9LPRA 2VWLA 3NWUA 4X8VH 1O2VA 1SQAA 1C1PA 4JYTA 3SHCH 4MNVA 1B5GH 1OYTH 3TIUA 2FS8A 2VWOA 1Q31A 1A2CH 1JRSA 1S0QA 1FXYA 2G52A 1HPGA 1O3PB 1IQEA 1P12E 1WV7H 5LPRA 2I6QA 1AE8H 2FOGA 1PPZA 2AERH 2UWOA 4YM9A 5JBBS 5GCHF 3VB5A 3ZZBA 1ESBA 1G2MA 2ULLA 1TNJA 2EC9H 1IQJA 1NESE 3HK6B 3S9CA 3DT0H 3AVZA 2CN0H 3SV7A 1WSSH 4Y76A 4BNRA 1K1LA 2GZ8A 4AFQA 1OWEA 1F0RA 2BX4A 3TPIZ 4AZ2B 1IQGA 5T6FA 1IOEA 5FPSA 1HIAA 1KXAA 1GHAG 4WXVA 3Q3YA 1J17T 1HJAB 4Y79A 2WUBA 1O2RA 2YOLA 1O2UA 2FOBA 4ZXYH 3UR6A 1GVKB 1AD8H 1AVWA 1V2NT 2F9UA 2FX4A 3ENSB 1YPLH 1CBWC 3NCLA 1H9LB 1GI9B 1C5LH 1LPGB 1GG6C 1E37B 2QF0A 1ELDE 3S9AA 2QAAA 1MBMA 1QBVH 2ODYB 3M5MA 4D76A 1BTZA 1NFWA 1SGQE 3OY5U 1S85A 4UDWH 1A4WH 4ZH8A 5HMAA 4Q7ZA 1F5KU 2A4QA 4R8TB 1GMCF 1TPAE 5EPNA 2BD5A 1SMFE 2W26A 3A8BA 5BPEA 6GCHG 1EZQA 4QT8C 2OCVB 1QL8A 4H4FA 3MNCA 1GHXH 1O5GH 1C2EA 1WBGB 3RXQA 2VVUA 3E8LA 2Q1JA 1T7CA 1ID5H 1XMNB 4I8KA 1TNIA 1A5IA 3AAUA 3SU2A 3BTQE 3S7KB 1W8BH 3NXPA 4I8JA 1L1GA 1NFUA 2W7UA 4X6PA 1FIWA 2ESTE 2GTBA 1C1UH 3GYMA 1LCYA 1NFXA 3BTHE 1DX5M 1FN8A 3A85A 1DUEA 1TWXB 4E05H 4HGCA 1SLXB 1UVUH 1SSXA 4ABEA 1CHOF 1P3EA 1C5TA 1ACBE 2O8UA 4MNWA 3LGUA 1IHSH 1DVAH 1JMOH 3R3GB 4ZKRU 4CRBA 1NU9A 1V2KT 2FOHA 2H5CA 5C20A 1O5EH 2FOFA 2A7JA 1XUKA 3E90B 1ABIH 2QF3A 2ZGBH 4Y7AA 1O2KA 1L4ZA 4NIXA 5JYIA 2BD7A 2VJ1A 1MAYA 1CBWB 1WUNH 2ZHEH 1GG6B 1Z8IB 4NWKA 4BAOB 2FTMA 1B7XB 4B2BA 1O5CB 1ARBA 1O2LA 3UR9A 1O30A 3A86A 1G3CA 4RKOB 4NFEA 1LQDB 3N7OA 1N6XA 1SGYE 1JIRA 2WPKS 2FX6A 1ELBA 3TH2H 3U8OH 2A1DB 1MKWK 4B75A 5HYOA 1C1OA 1ZOMA 5E0HA 1VZQH 1DWDH 3RXPA 2W3IA 4E7RG 1GHBG 1EUFA 4VGCC 1SOTA 3K9XB 4INKA 1AVGH 1YPHC 3WY8A 4ZMAH 4A5TS 1C5QA 1ZTJA 2ZPRA 1V2PT 2FOAA 1OOKB 1RRKA 3P95A 3RU4D 2XC0A 3RXRA 1UCYH 1Z71A 4BAHB 3UY9A 2Z6BD 1QQUA 4GSOA 4E06H 3ATKA 1GGDC 4K2YA 1EAXA 2F3CE 3GOVB 3JZ2B 3SHAH 1G37A 3ZVAA 5AHGH 2G00A 3NK8A 1OPHB 1IHTH 3ATWA 1LVYA 3GCTF 1L2EA 1MZAA 2Y6TA 1OP2A 2QXIA 1YCPH 2GV6A 1NN6A 2QC2A 1GI7B 3EYDA 1O2OA 3L33A 4U01A 1K28D 4XFQA 1TYNA 3BN9A 3UWJH 3R0FA 1ZMLA 1QFKH 1GBTA 3K6ZA 3A7VA 4X6OA 3ESTA 4ABJA 2XCFA 4K8YA 1NS3A 2WPHS 1LMWB 1FIZA 3RMOH 2AGEX 3O8BA 2GV7A 1P9UA 2QXGA 3LH3A 1Z8RA 1P03A 1PFXC 2BMGB 2WPIS 8KME2 2ZHWH 1H1BA 3ZZ5A 1TX7A 4CR9A 3MI4A 4IGDA 3TK6A 1AIXH 1MCVA 3P8FA 3S0NA 1FN6A 1TGBA 2Y5HA 1PQ8A 1CQQA 2W5EA 1Z8GA 1CU1A 2BDGA 2Y7ZA 2Y81A 2ZDMA 1YM0A 1ZYOA 1SFQB 1ZGVA 1ANDA 1K1OA 2J95A 1AUTC 3RC4A 5A09A 1O5AB 4O3TA 3MU0A 2VNTA 4BTIB 1KDQB 1HGTH 1KLIH 1ZGIA 2IN2A 5A0CA 2ZU3A 2BZAA 4VGCB 1O3CA 2ZC9H 1QCPA 3AW0A 1TNLA 1TPSA 3RMNH 2G8TA 3S69A 3L3TA 1O3JA 1KXBA 5C1XA 5AVDA 1M9UA 2ZU1A 4WMEA 3TH3H 5EPYA 4MPWA 4Y8XA 1GBCA 1GGDB 5AFZH 3LT3A 1VCQA 1UVOA 1GBMA 1A61H 4Z0KA 3PB1E 4Y71A 1YC0A 3CS0A 1MTNC 4RKJB 1ZRKA 2F9BH 1EB1H 1UK2A 4M7GA 1FI8A 4AYYB 3MYWA 5GCHG 2CV3A 5EU8A 3T29A 4FUGA 2J2UA 1H8IH 2FP7B 1MTWA 2GX4A 5A8ZA 2UUYA 1MCTA 1V3XA 2QGRA 2GDDA 2ZQ1A 1PPFE 2PFEA 2PKSC 1HAXB 4AGKA 3K2UA 4A7IB 5DJ7A 2BD2A 2CXVA 1G32B 5L30H 2HGTH 2GZ7A 3VB3A 4B74A 6GCHF 2ZHFH 3QZRA 1GWAA 1G36A 4JK5A 3SUDA 5EW2H 4YESB 3MWIU 1OWKA 2AS9A 1KSNA 4H6TA 2Q6FA 1SGFA 4J1YA 1DS2E 1DE7H 5L6NH 4D9QA 2EI6A 1DSUA 1TGTA 3PMJA 3MH5A 1MTSA 2J38A 1TRYA 1J9CH 3DFJA 4WY3A 2BD3A 1MH0A 2OQUA 4UFGH 2RA3A 1GBAA 4YT7H 3BTEE 1GMCG 4JZIA 1O3IA 1TGCA 2FI3E 3MU1A 5L2ZH 1MD7A 1LKAA 1DWEH 2VIWA 1Y3VA 4ESTE 3D23A 1OYQA 1UCYK 2PUQH 1GHWH 2OXSA 2ZFTA 4ISHH 2C93B 4UFFH 1WAYB 2G5VA 4BANB 1C5MD 1FLEE 1AHTH 3TVJB 4YZUA 5C2ZA 2G4UA 4J2YB 2XYAA 1DXPA 1YCPK 2R0KA 2OUAA 2ALPA 2FEQH 1MTNB 1NU7B 5EXLA 2AIQA 1V2ST 1O2NA 1YCPM 1AUJA 4MPUA 5CE1A 1WU1A 2NU3E 1INCA 3TU7H 1SLUB 4AG2A 1ETRH 1AVXA 2O8LA 1J8AA 1O2GH 4OS7A 1SGTA 1NPMA 1C1QA 1O3BA 1D4PB 1E35B 1KDQA 3UNSA 3HK3B 4AOQA 9ESTA 2PKSB 2AMQA 3HPTB 2Q6GA 4X6NA 2OBQA 1ZPZA 1TIOA 4ISOA 4MDSA 2CF8H 1GPZA 2A4GA 4TY7A 3HATH 1TRMA 1ESTA 4CREA 4WWYA 1QL9A 4TPIZ 1CT2E 1Y3WA 2SFAA 1O39A 4FUHA 4ASHA 2XXLA 2WPMS 2VU8E 4GUXA 1V2MT 4NIWA 1EP5A 3F1SB 4SGAE 2SNWA 2A4OA 1ETTH 2XBVA 2BDAA 1WYKA 2XBWA 1V2OT 2BHGA 2ZEBA 1S0RA 1T8OA 1SGDE 2VIOA 1Y3XA 3SNAA 1E0FD 1TMTH 1G30B 2P94A 2ZFQH 2A2XH 1P2NA 3A8CA 4XBDA 5H4IB 4IC5A 1CT4E 2BYAX 3HKJB 2J9NA 3RDZA 3HKIB 1O5BB 1KXCA 1GI8B 2QIQA 3GCHC 3ATMA 4NG9H 1P11E 1YPGH 4FUEA 4DY7B 1CVWH 2ZGXH 1SI5H 1LTOA 1ZSJA 3UFAA 3TNSA 1WQVH 4I8GA 2PW8H 4UE7H 4YLUA 1THPB 4YOGA 2EI7A 6ESTA 3E1XB 4Y8YA 1EZSC 3ELAH 5EQSA 1O3DA 1LVBA 3FP8E 3P8NA 1TRNA 2W7SA 3DHKH 3W94A 5G4BA 4F4OC 2ZI2H 3TGIE 2C8YB 1C4U2 3KHVA 4B71A 2BY8X 4ISLA 3SJIA 3RC5A 1MZDA 5FAHA 1NRNH 1BA8B 1GJ5H 3D65E 2NU2E 3MO3A 1EAWA 1TAWA 3SU1A 3ZZ8A 1RGQA 1QRXA 1TQ0B 5GPIB 1HAPH 1EXFA 2HALA 2DE9A 1EKBB 5DGJA 1CSOE 4D7GA 4MG3A 1HDTH 1V2RT 1P04A 3RM2H 3RXIA 2BM2A 5F8XA 3MO6A 1Z6JH 2DE8A 3FP7E 3KQCA 3U69H 3RXJA 1LDTT 1QJ1B 2FM2A
chains in the Genus database with same CATH superfamily
3B9FH 3ZVBA 1GVZA 1J14A 3P70B 1F7ZA 2F83A 2OC0A 3DD2H 7ESTE 1CO7E 1BMFD 1O3NA 1XM1A 4MNXA 4DJZB 1W0KD 3W95A 2GCTC 2JETC 2ZTXA 4H42U 3BTWE 5HIYA 2B8OH 1HUTH 5FX6A 1RS0A 3SGQE 2XC4A 3L6PA 2WYGA 3SNEA 5LH8A 1P3CA 2SGDE 1KXFA 1O3LA 1HLTH 2ANMH 1DT2A 1SGFG 5E0JA 1ELAA 2VH6A 3W1EA 2CK3D 1GJDB 2GMTC 1G2LA 1AWFH 3GDUA 4AGJA 1ELFA 1ZZZA 1C1MA 3A80A 2C3SA 1TOCB 3MU4A 2A0QB 2HNTE 2VIPA 1LHEH 3BSQA 3GCHB 1A46H 4DW2U 1QTFA 1W14U 1RTLA 3HGPA 2C8XB 4IC6A 3VG8A 4ABDA 3FOAA 3M35A 1F2SE 5DPAA 3T62A 1TA2A 5PTPA 3BG4C 1P2IA 3RU4E 1UJ1A 1UTMA 4FU9A 1GI6A 3U1IB 1HAYB 5JDUB 3LC3A 2GCHG 1O36A 2XTTB 2XWAA 5C3NA 4MPXA 1OS8A 3P92A 1YWUA 3MH6A 3SGAE 4CRGA 1YLDA 1V2WT 3D62A 1DM4B 3ZZ6A 1RTKA 1JOUB 1D6WA 3BTTE 3ZZ4A 4OS5A 3AASA 2YNAA 1SFIA 1GBDA 1T8LA 1D9IA 2EQNA 4AFSA 4OS6A 1TBQH 1QB9A 2R2WU 5EOKA 1VCWA 4AB9A 2VINA 3IG6B 2R0LA 1OP8A 3BEUA 2HPQH 4B2AA 1HJ9A 3UUZA 2FWWA 4ABIA 1O35A 3MHWU 5JPMH 5EW1H 2ZPQA 2LNCA 2P3TB 4XSKU 1T4UH 1DANH 1ANBA 5JBAS 1C1VH 3F3BA 5CDFE 3ITIA 3RXLA 2FOEA 4XD7D 3QUMP 3Q3KA 3GICB 3URDA 1QB1A 1O2SA 2J94A 3U98H 2K1QA 3CENA 1TNKA 5B6LA 3PV4A 2ZP0H 1RFNA 3RU4T 3F9GA 2A7HA 3TJOA 1UVSH 4ABBA 2GCTB 3Q00A 1BT7A 2JETB 5DKMA 2A2QH 1GHZA 4GVUA 1ANEA 3TH4H 4BTTB 1D3PB 3QDZB 3BG8A 5GNDA 1VJ9U 1W0YH 1NBMD 3A7WA 3SOSA 2BXTH 2GZ9A 3A7ZA 3ZV9A 1A7SA 1YBWA 3RXOA 4X8SH 4X1RU 1BRCE 3SORA 3V7TA 3DSGA 1N1LA 1QJ7B 2XOKD 2ODQA 2J92A 2F4LA 8GCHF 5CMXH 1GJCB 2GMTB 1OWJA 1LHCH 1SLWB 1KTSB 1TBZH 1QRZA 1UTNA 2H9HA 3U8TH 4Y8ZA 4BTUB 1S5SA 1OWIA 3H09A 2BLQA 3QK1A 1BMLA 3GYLB 1P2OA 1BTXA 2AIPA 1FJSA 1ZTLA 1AKSB 1TALA 3ODFA 1GL0E 1C5PA 2ODPA 4JZ1A 3BG4B 2LELA 1HXEH 2OC7A 1SL3A 3DA9B 1PYTC 7KMEH 2Z9GA 1CA8B 3O8RA 2V7QD 3MU5A 4KELA 5GIBA 4AB8A 1P2MA 4IBLH 2QF5A 2IPHA 3MO9A 5JBCS 2VBCA 3LKWA 5A0BA 1DLEA 2P8OC 3BTFE 4WH6A 1Q2WA 1P01A 4Y0ZE 2A32A 5C0UA 1EOJA 1EX3A 2STAE 4X6MA 2FOCA 2JKHA 1AE5A 1ZPCA 2A4RA 2OK5A 1TPPA 1LPKB 5LPFA 4B2CA 1S84A 1Y5UT 2SNVA 1NTPA 3ODDA 1GBIA 2ZDAH 2A7CA 2KM0A 2A5AA 3EQ0H 1HNEE 1A0HB 1QHRB 1Y8TA 2VH0A 2PKAB 5JB9S 1ELCA 3T25A 3VXFH 2GJGA 1AO5A 2GKVE 1BMMH 1BBRE 1SGIB 2C8ZB 3RXCA 1XKBC 1BQYA 2FYRA 2TGAA 2F91A 2KAIB 3TITA 1J15A 3FP6E 5HM2A 3GDVA 2R2MB 3BF6H 3MNBA 4NFFA 1A5HA 1VJAU 1ZR0A 4YOIA 1BTYA 2FTLE 4BOHA 4ZHLU 1BHXB 3A8AA 1C2GA 1Z8JB 2SGAA 1JRTA 4O3UA 4JZEH 5HKKD 1VITG 2P95A 3A7YA 1EQ9A 3RXBA 1GI4A 3SW2B 3RXMA 1YY3A 2ZPSA 1HFDA 3M3SA 5C5OA 1VR1H 1DUAA 3WW7A 2XBYA 3SV8A 1XUFA 3RP2A 4KP0A 4I8HA 3SJKA 4YXWD 3V0XA 1O2MA 4Q63A 2VVVA 4YT6H 3GCOA 3PLBA 3FZDA 4Q2KA 1AFEH 1UW7A 1T31A 3LJJA 3EGKH 4O9VA 2WPDD 3SV2H 1BB0B 1OX1A 2GVFA 1F5RA 3UOUA 4WXIA 2H9EH 3KNXA 3QO6A 3VPKA 4I33A 2F9NA 2ZU5A 1C2FA 2BD4A 1PQ5A 2FYQA 2P8OB 4FXGH 4X0WU 4WMFA 3SU3A 1AFQC 2WUCA 1AWHB 1EP6A 4CBOA 1MU8B 1OKXA 5DN6D 1YP9A 3OFND 2RCEA 1VCPA 4TSFD 2FESH 1C5RA 2KCAA 3PTBA 1V2VT 4ACBA 4WJG2 2AMDA 3ZVGA 4K60A 1H9HE 1BHXF 1B0EA 4MLFB 4SGBE 2ZDVH 1GL1A 5E2PA 1NRQH 1EOLA 1XKAC 2P93A 1AKSA 2A45B 3PMAB 3RXGA 1C5OH 5E0GA 4X2YA 1C4Y2 2B5TB 4WF8A 1GDUA 3K65B 4JYUH 1AU8A 1DY9A 1L0ZA 2WINI 2C4FH 6LPRA 2TGTA 1GJ4H 1O2TA 3RMMH 3U1JB 3PTNA 1QNJA 2GCHF 2P59A 1C5XB 1GBJA 2ZG0H 3TNTA 2ZCKP 1TMBH 4MTBA 1ELEE 5CHAC 4K69A 2IPQX 2QV1A 3I77A 2ZIQH 4Z1MD 2BVSH 3OTJE 4ZKSU 5DP5A 2BY7X 1FPCH 5FX5A 5DO4H 1FAKH 1BOQA 3PMBB 3LDXH 2AFQB 3SN8A 1CGIE 2LPRA 1HAHH 1G3EA 2Z3CA 2BY6X 2JH6D 1ESAA 1IQFA 1HB0B 3WWFA 1PPEE 1QBNA 2ANWA 3F9HA 3QX5H 2ALVA 2W6ID 7GCHF 5DG6A 3C1KA 4BAMB 4DT4A 2O8WA 3MOCA 1IQLA 2PKAA 1C2HA 1GI5A 1QL7A 2Y5FA 3IITA 2ZFFH 5GDSH 1Z1JA 2WZQA 3F2HA 4NA8A 1GMDF 1E1RD 3QTOH 4AORA 4BAKB 2KAIA 3P6ZB 4JCNA 2ZFRH 2VIDA 1QJ6B 1Q3XA 4DURA 1NROH 1FQ3A 1DSTA 4UFDH 3VXEH 1FDPA 4R0IA 3VEQB 5C5NA 1P2QA 2QXHA 3SQEE 1MAXA 2RG3A 5DP6A 2J97A 5DK1A 1AFQB 1HXFH 2ZDKA 3KF2A 2BDHA 1IQMA 1O33A 2UWLA 3GY7A 4UFEH 2J5UA 2L6OA 2TBSA 1W0ZU 4FUDA 3K6YA 1MUEB 1C9TA 3OU0A 2W6JD 4KTUA 3BIVH 1C2IA 3SNBA 1TFXA 3KYFA 1WCZA 3LGWA 5EJLA 4AFZA 2BD8A 1HRTH 1HAZB 1K1JA 1GBBA 2D2DA 3OYPA 2F9OA 2V6NA 2B7DH 3MH7A 1IQNA 4DIHH 1C9PA 1FY3A 1H8HD 1KLTA 1TX6A 1NRRH 4A1VA 1BTHH 4F49A 5ESBA 1TE0A 1SGPE 3MQKC 2F9PA 2Z9IA 1O3OA 3KEEA 4RSPA 1DWBH 4Z6AH 1ARCA 2ANYA 2FPZA 2ZU2A 3MFJA 1SHHB 1ABJH 2ZGHA 1UMAH 1YKTA 5BRRE 3GY5A 2FI4E 1ZHPA 5CHAB 2IOTA 1FZZA 1G9IE 2QY0B 2ZDLA 1OXGA 1SHYA 2IJD1 2M2AA 2PTNA 3BTME 5C94A 3A83A 8GCHG 1EAIA 4NA9H 1SLVB 4GCHG 1W12U 2FIRH 3UQOA 1WXRA 3FANA 4DVAU 2BVXH 1YPHE 2ZHQH 1O3AA 3BTDE 1MKXH 4Y7BA 1O31A 1GMHG 1EZXC 2QA9E 1D3TB 3RLYH 3T28A 2KCPA 3LOXA 1JIMA 2PSYA 1LHDH 3UWIA 1XUJA 3BTKE 2BY5X 3V13A 4I32A 4F55A 1BBRH 2V3OH 3RXFA 3TJVA 2KR7A 3SGBE 1P09A 2OTVA 3SU0A 3KQ5A 5J4QA 5C0TA 1O2IA 2Y7XA 4I31A 3TK5A 2TPIZ 2HWLB 1FAXA 2SGPE 1ELVA 1PJPA 5A8YA 1K21H 4IMQA 3HGNA 4CH2B 2PSXA 3FFGA 2D1JA 4NGAH 5A2MH 5T1VA 4ACAA 1VITF 3DCLA 4ZCNA 1HAOH 1LO6A 3M5LA 4IS5A 1AMHA 1EB2A 3RLWH 3QLPH 3IWMA 4AFUA 1T8NA 2HOBA 2GT8A 3D49H 2Z3EA 3GISB 3PWCA 3NPSA 1BRUP 1S6HA 4O97A 3OY6U 2JH5D 2WV4A 2G4TA 3A88A 1GJBB 1F0SA 4OS1A 3GY4A 3E0NB 1GI1A 2ZECA 2OD3B 3RXSA 2Y80A 2XBXA 1DY8A 4I7YH 2UUKB 1C1TA 3KQDA 5A8XA 2R3UA 3ZZ3A 2BQWB 1EFRD 2AGGX 4HI3A 5JB8S 4ABGA 1DDJA 1LVMA 3KIDU 3H7TA 1QBOA 2BY9X 4I8LA 3MMGA 2ZF0H 1O3GA 2AYWA 2ZFSA 5TCCA 1C2JA 3SO3A 1SGRE 2EA3A 1AGJA 3E91A 4FUFA 3VB7A 5JBTA 4AN7A 1COWD 3VB6A 3U9AH 4CHAC 1W7GH 3EA7A 1BRAA 1QIXB 3BV9B 3SJOA 4CR5A 5SGAE 1S82A 4LZ1H 1S81A 1GBHA 1W13U 3A84A 3B8JA 2H1UA 1C5WB 4YOJA 4DOQA 3A87A 4LXBH 1O3MA 1RXPA 4NWLA 4KGAA 4MQAA 2ZNKH 1GCDA 2KCOA 1K1NA 3LGVA 5C67A 1PYTD 2V3HH 2DUCA 4JZFH 4BAQB 1IQKA 1YYY1 1XUHA 5CHBA 2XCNA 2CMYA 1K0HA 2JIZD 3T5FH 4OS4A 3SJ9A 4B6FA 4YLQH 1YLNA 3ZV8A 1BDAA 4IN2A 1T8MA 2GT7A 1FV9A 1K1MA 3UAIC 1HAVA 1FY4A 2NU4E 1NZQH 1PPHE 2OBOA 2VGCC 3SBKA 3ZZAA 1QY6A 3N7DA 2XRCA 5EXMA 4ZHMU 6CHAC 1FMGA 1GBFA 3U8RH 2V3MA 4F48B 3SNCA 2BLVA 2L74A 4FVBA 3EA9A 1PQAA 2TRMA 1GJ8B 3A82A 1V2LT 4ZAEA 4B73A 3ATLA 1O5FH 5T6DA 4D7FA 1JXPA 1P10A 1MU6B 4U2WA 1GI2A 4ABHA 1O0DH 4RT1A 2D8WA 2PGBB 1SGNE 3LU9B 3RMLH 1ZHMA 3SU6A 1HV7A 4RT0A 2BDBA 1V2JT 1UTKA 1EZUC 3MNSA 4NA7A 3T26A 1NO9H 2VWMA 5F6MA 2HLCA 3BIUH 4XDEA 2H5DA 3SI4H 1AQ7A 2BQ7B 4DG4A 1OWDA 1MABB 2ZGCA 3MU8A 4IMZA 1NC6A 3KN2A 3C27B 2PTCE 1TPOA 1UTPA 3EDXB 4TPYA 1MKXK 3RXHA 3I29A 2FZZA 1GDNA 2OLGA 2TGDA 1P06A 1GJ9B 1FNIA 2OC8A 4KTSA 4XE4A 4CHAB 4CRDA 4U32A 1BTUA 1ANCA 1YF4A 2O9QA 3H5CB 4D8NA 2B9LA 4FU7A 3NKKA 1BIOA 1W10U 2BDYA 1LHGH 1SG8B 2R3YA 3CP7A 5EODA 7GCHG 1BBRK 2J4IA 2UUFB 5J4SA 1WQSA 1RIWC 1SGCA 8ESTE 2W3KA 1KLJH 2J98B 1B0FA 2XC5A 3A8DA 1GCTC 1LVOA 1ZHRA 3MH4A 1O2WA 1GMDG 1L1NA 2WV5A 1TONA 1WTHD 2Z9LA 2ZHDA 1F0UA 1TGSZ 3A7XA 1EPTC 1O5DH 3Q77A 1HAGE 3M3VA 2FOMB 3ZIAD 3OE7D 1V2QT 3TJUA 2Y82A 3GY3A 4Y6DA 3GY2A 3LONA 4XBBA 1IQHA 1ZTKA 1MTVA 1V2UT 2VGCB 3UIRA 1FX0B 1QA0A 1Z7KA 1ZSKA 5FPTA 6CHAB 3PLPA 1NM6A 4D9RA 1XUIA 1XUGA 4AG1A 3SQHE 1A3BH 1MMJN 1O2YA 3FAOA 4K3JA 3E3TA 3QTVH 5IDKA 2JJ1D 3DUXH 2Z3DA 4GCHF 1V2TT 3ZZ7A 1C1SA 2Z7FE 1K22H 4CRCA 1PPCE 1GMHF 3F9FA 2J34A 3OSYA 2FLBH 3G01A 3TJNA 1RTFB 2ZDNA 5EQQA 3SV9A 1N8OC 3GS9A 4K1SA 1AZZA 1A1RA 3LGYA 4FOUC 1MQ5A 4BXWA 2Z9JA 2ZTZA 2SGEE 3WWBA 1V6DA 1F5LA 5HGGA 1MD8A 3BTGE 1TX8A 1OSSA 2O8TA 5E8EH 1NRPH 4B1TA 1T4VH 5FPYA 4DIIH 1K9OE 2QCYA 3PO1C 3QGJA 3SZEA 3RXUA 4FUJA 2KCYA 3M7UA 2XNIA 4NIYA 1W3CA 4XBCA 2ZWLH 4BXSA 5LPEA 4ZROA 1AN1E 1HAIH 1NT1A 2UUJB 3ZVFA 1TB6H 3ZVDA 1H9IE 4GHTA 3SUEA 4INHA 3RC6A 1UK3A 1YPEH 3RM0H 1JWTA 3LPRA 3QN7A 4CBNA 1YPJH 2FS9A 5KGOA 3RXTA 2ZFPH 3UTUH 4GLYA 1C1RA 2V35A 3A81A 3JZ1B 2G51A 4Y0YE 3F9EA 4WH8A 4YTAA 2VIQA 5L2YH 1C5VA 2EI8A 2RA0A 1YPKH 2ZQ2A 4U30A 2AGIX 1O2HA 2HRVA 1P2KA 2PGQB 4Q80A 5HIZA 1FONA 1GJAB 4K8BA 1RIWB 3STJA 4LK4A 2C90B 5ESTE 2GD4B 4DT7B 1C5YB 1GCTB 5F53A 1NRSH 1LHFH 4ZHAA 1C2DA 2FODA 3UOPA 3O8CA 2ANKH 4X2XA 1C2KA 1EPTB 4E7NA 5EXNA 2G81E 5EGMA 3URCA 4HG6A 2ZCLP 1GHYH 2FXRA 2ZTYA 4HTCH 3A89A 3P17H 4TYDA 1AB9C 3M5OA 4FU8A 1CE5A 5TJXA 3KCGH 5DP7A 1O3FA 4CRAA 4KKDA 3VGCC 2CJIA 2BZ6H 1X7AC 5GWZA 1O32A 2ZGJA 5AFYH 1OWHA 5LGOA 2HPPH 2PR3A 1C1NA 3Q3XA 1H4WA 3VFEA 1QQ4A 1VKYA 2M5TA 1HCGA 2Z9KA 1Y5BT 2VB0A 3OTPA 1XVMA 2ZZUH 3TGKE 1O38A 4HZHA 5I46H 3OX7U 1O34A 1Y3YA 2C8WB 1ZLRA 4X8TH 4GAWA 2G5NA 4A6LA 3UPEA 3QWCH 3LGTA 1EJNA 4JYVH 1TGNA 4Y10E 1HJ8A 2J98A 3T27A 1IQIA 1VITH 2FI5E 3ZZCA 4LOYH 4B76A 1HYLA 2STBE 4INLA 1N8OB 5B6OA 4H6SB 5T6GA 2A31A 1RJXB 1J16A 4K1EA 1C5ZB 1UK4A 2KZ4A 4MPVA 4P02A 1GBKA 1QA7A 1IAUA 3AK5A 2H6MA 8LPRA 4TWYA 4ZUHA 5K7RA 1ZMNA 1BCUH 4ISNA 3PO1B 1TNGA 2ZCHP 1T32A 3DSPA 4UEHH 1L1JA 1BTWA 3KQEA 3A7TA 1H8ED 1C4V2 5FHTA 5DP9A 1ZRBA 4FVDA 2JH0D 3CS7A 4NCYA 1C5SA 1UHBB 2B0FA 5EG4A 4JK6A 4LZ4B 2BDIA 1BMNH 1F92A 1D3DB 2BLOA 5C1YA 2HVXA 4NZQA 4MNYA 1A0LA 2VVCA 1TNHA 1SQRA 4AYVB 2BVRH 1P0SH 1DOJA 4TWWA 1AY6H 1SVPA 2BXUH 2THFB 1EASA 2WYJA 5EQRA 3ZYEA 3GDSA 4ISIH 1SQOA 3S7HB 2FLRH 3E16B 3NUMA 3O8DA 2ASUB 4OS2A 3LH1A 2NWNA 2PUXB 2CHAC 3UQVA 4WMDA 1O2ZA 1O2JA 3SV6A 2BOKA 3M7TA 1TMUH 3AAVA 1AB9B 1TBRH 5KEDA 4FUCA 3KQBA 3VGCB 1C2LA 3MTYA 1UTOA 1F0TA 1FY1A 2PV9B 1G3BA 2QF4A 5GJ4B 1GHAF 3M61U 1LQEA 3PYHA 2BQ6B 1DFPA 3NRLA 4Q7XA 3FVFB 1QR3E 1XVOA 1O3KA 2XWBI 4DCDA 1FY8E 1UVPA 2RDLA 3QGNB 3BEFB 1E36B 1DXWA 1TA6A 2CF9H 3SUGA 2ZO3H 2A5KA 2V0BA 1Y3UA 1SC8U 1G3DA 2BLWA 1FUJA 2PWXA 3E6PH 1GI3A 5FCRA 5FBEA 4MVNA 3RXEA 1L4DA 5DP8A 1EPTA 2ZU4A 3P8GA 3M37A 3SU4A 2A5IA 3V12A 3SI3H 5FXLA 1SGEE 1E38B 1XX9A 2YNBA 1RD3B 2BX3A 2BB4A 1N6YA 2FO9A 1KYNA 3M36A 1XXDA 3ZZDA 3P8OA 3RXDA 1MQ6A 3M7QA 1W2KH 5ABWA 4NSVA 2F43B 2HNTC 1CGJE 2FMJA 1TQ7B 1O37A 4X1NU 4ZXXH 1SQTA 1VGCC 1SR5C 2AMPA 3TGJE 1ETSH 4RN6A 2GGVB 2RFKC 1SKYE 1DITH 5T3HA 2IJOB 1THSH 1SOZA 1GHVH 4KTCA 5HM9A 2VIVA 4CRFA 5EJZA 4GHQA 1D3QB 3PM3A 2GP9B 2BTCE 2Q6DA 3VB4A 2TGPZ 1P57B 1E34B 3STIA 1H8DH 2PLXA 3PRDA 2I6SA 1BUIA 2WPJS 4PROA 1KMHB 2PHBA 3V3MA 1TLDA 1Z6EA 1NY22 3LC5A 3MNXA 1A0JA 1LPZB 4NZLA 1QZ8A 4NSYA 4AX9H 2CHAB 2XW9A 1UO6A 3AW1A 3TK9A 2Z94A 1HAVB 1S83A 1AZ8A 1ZJKA 1Y59T 1A3EH 4FUIA 4K1TA 2NU0E 1P02A 3T2NA 2BDCA 1BJUA 3RXVA 2H2ZA 2ILNA 2D26C 1U6QA 2CGAA 5I25A 1UHBA 1FY5A 3M5NA 4NIVA 1DPOA 4YO9A 3LGIA 1O3EA 2AEIH 2OP9A 3I78A 4O03A 1BZXE 3SU5A 1C1WH 4OGYA 4IW4E 1GDQA 4Y11E 1EJAA 2OQ5A 1QGFA 2P3UB 5E2OA 1KXEA 1UTJA 3NZIA 1DICA 4JZDH 1THRH 1KIGH 1CT0E 1P9SA 1CHOG 3GCNA 1QRWA 2ZA5A 1BTPA 3ATIA 3E0PB 1YGCH 3DSOA 2K8IA 1K2I1 1O3HA 4X1QU 4TY6A 1CA0C 2PP6A 1UVTH 1BITA 5AF9H 2TIOA 2QXJA 3RXKA 4GPGA 5A0AE 1GHBF 1D6RA 3KGPA 3SNDA 4CH8B 4A92A 4P00A 5IYTA 1HIAB 1C5UA 1QURH 1VGCB 3N7EA 2FDAA 1UTQA 4OGXA 1Y5AT 1GVLA 5DP3A 1ZMJA 4ABAA 3EAJA 1LKBA 2G55A 2OINA 4ZKOU 4UONA 7LPRA 4JMYA 2UWPA 3B23B 1DLKB 3ZVCA 3GY6A 1S6FA 1KY9A 1ZJDA 4IN1A 1K1PA 3SUFA 1YLCA 1SB1H 1QB6A 2QE7D 4K5ZA 1PPBH 3LIWA 3RXAA 1EATA 2BD9A 4Q7YA 1MBQA 3FO8D 1PPGE 1ZPBA 1O2PA 3F6UH 1EJMA 1SBWA 1FPHH 1JBUH 1P8VC 2BOHB 4X1PU 4X2WA 4ABFA 5FCKA 1W11U 1MTUA 3UNQA 1K1IA 5DP4A 3ZVEA 1AI8H 3GY8A 1ORFA 1BMAA 2O8MA 1TABE 1W0JD 4HFPB 4THNH 1W7XH 1WTGH 3ZZ9A 3Q76A 1NBME 1ELGA 4X1SU 1PQ7A 3EE0B 1HJAC 4X8UH 4XOJA 4A1TA 1CGHA 3OEHD 1C5NH 1UCYE 1GBEA 4DGJA 1BRBE 1P2JA 2GDEH 3H7OA 5C1UA 1UTLM 3RUOA 2VWNA 5GXPA 4FETA 5TCAA 2AH4X 1OP0A 5F8TA 5FBIA 1KTTB 3ZYDA 3UNRA 2NU1E 3BEIB 3SJ8A 2OC1A 3LJOA 1BJVA 2HNTF 4X2VA 3GCTG 1C2MA 2ZKSA 2QYIA 1ZSLA 2F9VA 3EA8A 4ZKNU 3QZQA 1EAUA 5K0HA 1YPMH 2H9TH 3PMHB 1XXFA 1TOMH 1HBTH 3KL6A 2P16A 2QN5T 5F03A 1WOFA 5F8ZA 4UD9H 5EJ1A 1DWCH 1CA0B 1GJ7B 2EEKA 1ELTA 5ETXA 3PROA 1Z1IA 3TLOA 3PWBA 3UREA 3SZNA 1GI0A 1KXDA 3DFLA 1NFYA 3M3TA 3S9BA 1MKWH 2R9PA 5HXFA 1CHGA 1O2QA 3PLKA 2P3FH 4FUBA 1GJ6A 1GBLA 2SGQE 3FZZA 2WPLS 1SPJA 2Y5GA 4A1XA 3F68H 1A5GH 1O2XA 1P05A 4WVPE 2SGFE 9LPRA 2VWLA 3NWUA 4X8VH 1O2VA 1SQAA 1C1PA 4JYTA 3SHCH 4MNVA 1B5GH 1OYTH 3TIUA 2FS8A 2VWOA 1Q31A 1A2CH 1JRSA 1S0QA 1FXYA 2G52A 1HPGA 1O3PB 1IQEA 1P12E 1WV7H 5LPRA 2I6QA 1AE8H 2FOGA 4RI0A 1PPZA 2AERH 2UWOA 4YM9A 5JBBS 5GCHF 3VB5A 3ZZBA 1ESBA 1G2MA 2ULLA 1TNJA 2EC9H 1IQJA 1NESE 3HK6B 3S9CA 3DT0H 3AVZA 2CN0H 3SV7A 1WSSH 4Y76A 4BNRA 1K1LA 2GZ8A 4AFQA 1OWEA 1F0RA 2BX4A 2WHXA 3TPIZ 4AZ2B 1IQGA 5T6FA 1IOEA 5FPSA 1HIAA 1KXAA 1GHAG 4WXVA 3Q3YA 1J17T 1HJAB 3F2GA 4Y79A 2WUBA 1O2RA 2YOLA 1O2UA 1WDIA 2XNDD 2FOBA 4ZXYH 3UR6A 1GVKB 1AD8H 1AVWA 1V2NT 2F9UA 2FX4A 3ENSB 1YPLH 1CBWC 3NCLA 1H9LB 1GI9B 1C5LH 1LPGB 1GG6C 1E37B 5EIYA 2QF0A 1ELDE 3S9AA 2QAAA 1MBMA 1QBVH 2ODYB 3M5MA 4D76A 1BTZA 1NFWA 1SGQE 3OY5U 1S85A 4UDWH 1A4WH 4ZH8A 5HMAA 4Q7ZA 1F5KU 2A4QA 4R8TB 1GMCF 1TPAE 5EPNA 2BD5A 1SMFE 2W26A 5C17A 3A8BA 5BPEA 6GCHG 1EZQA 4QT8C 2OCVB 1QL8A 4H4FA 3MNCA 1GHXH 1O5GH 1C2EA 1WBGB 3RXQA 2VVUA 3E8LA 2Q1JA 2YMSC 1T7CA 1ID5H 1XMNB 2AHME 4I8KA 1TNIA 3EE7A 1A5IA 3AAUA 3OEED 3SU2A 3BTQE 3S7KB 1W8BH 3NXPA 4I8JA 1L1GA 1NFUA 2W7UA 3F0PA 4X6PA 1FIWA 2ESTE 2GTBA 1C1UH 3GYMA 1LCYA 1NFXA 3BTHE 1DX5M 1FN8A 3A85A 1DUEA 1TWXB 4E05H 4HGCA 1SLXB 1UVUH 1SSXA 4ABEA 1CHOF 1P3EA 4M9FA 1C5TA 1ACBE 2O8UA 4MNWA 3LGUA 1IHSH 4TT3D 1DVAH 1JMOH 3R3GB 4ZKRU 4CRBA 1NU9A 1V2KT 2FOHA 2H5CA 5C20A 1O5EH 2FOFA 1E79D 5IK2D 2A7JA 1XUKA 3E90B 1ABIH 2QF3A 2ZGBH 4Y7AA 1O2KA 1L4ZA 4NIXA 5JYIA 2BD7A 2VJ1A 1MAYA 1CBWB 3F0OA 1WUNH 2ZHEH 1GG6B 1Z8IB 4NWKA 4BAOB 2FTMA 1B7XB 4B2BA 1O5CB 1ARBA 1O2LA 3UR9A 1O30A 3A86A 1G3CA 4RKOB 4OM9A 5DSFA 4NFEA 1LQDB 3N7OA 1N6XA 1SGYE 2LP6A 1JIRA 2WPKS 2FX6A 1ELBA 3TH2H 3U8OH 2A1DB 1MKWK 4B75A 5HYOA 1C1OA 1ZOMA 5E0HA 1VZQH 1DWDH 3RXPA 2W3IA 4E7RG 1GHBG 1EUFA 4VGCC 1SOTA 3K9XB 4INKA 1AVGH 1YPHC 3WY8A 4ZMAH 4A5TS 1C5QA 1ZTJA 2ZPRA 1V2PT 2FOAA 1OOKB 1RRKA 3P95A 3RU4D 2XC0A 3RXRA 1UCYH 1Z71A 4BAHB 3UY9A 2YMSB 3FKSD 5KECA 2Z6BD 3OAAD 1QQUA 4GSOA 4E06H 3ATKA 1GGDC 4K2YA 1EAXA 2F3CE 3GOVB 3JZ2B 3SHAH 1G37A 3ZVAA 5AHGH 2G00A 3NK8A 1OPHB 1IHTH 3ATWA 1LVYA 3GCTF 1L2EA 3PRBA 1MZAA 2Y6TA 1OP2A 2QXIA 1YCPH 2GV6A 1NN6A 2QC2A 1GI7B 3EYDA 1O2OA 3L33A 4U01A 1K28D 4XFQA 1TYNA 3BN9A 3UWJH 3R0FA 1ZMLA 1QFKH 1GBTA 3K6ZA 3A7VA 4X6OA 3ESTA 4ABJA 2XCFA 4K8YA 1NS3A 2WPHS 1LMWB 1FIZA 3RMOH 2AGEX 3O8BA 2GV7A 1P9UA 2QXGA 3LH3A 1Z8RA 1P03A 1PFXC 4I86A 2BMGB 2WPIS 8KME2 2ZHWH 1H1BA 3ZZ5A 1TX7A 4CR9A 3MI4A 4IGDA 3TK6A 1AIXH 1MCVA 3P8FA 3S0NA 1FN6A 1TGBA 2Y5HA 1PQ8A 1CQQA 2W5EA 1Z8GA 1CU1A 2BDGA 2Y7ZA 2Y81A 2ZDMA 1YM0A 1ZYOA 1SFQB 1ZGVA 1ANDA 1K1OA 2J95A 1AUTC 3RC4A 5A09A 1O5AB 4O3TA 3MU0A 2VNTA 4BTIB 1KDQB 1HGTH 1KLIH 1ZGIA 2IN2A 5A0CA 2ZU3A 4B6EA 2BZAA 4VGCB 1O3CA 2ZC9H 1QCPA 3AW0A 1TNLA 1TPSA 3RMNH 2G8TA 3S69A 3L3TA 1O3JA 2K0QA 1KXBA 5C1XA 5AVDA 1M9UA 2ZU1A 4WMEA 3TH3H 5EPYA 4MPWA 4Y8XA 1GBCA 1GGDB 5AFZH 3LT3A 1VCQA 1UVOA 1GBMA 1A61H 4Z0KA 3PB1E 4Y71A 1YC0A 3CS0A 2WV9A 1MTNC 4RKJB 1ZRKA 2F9BH 1EB1H 1UK2A 4M7GA 1FI8A 4AYYB 3MYWA 2JDID 5GCHG 2CV3A 5EU8A 3T29A 4FUGA 2J2UA 1H8IH 2FP7B 1MTWA 2GX4A 5A8ZA 2UUYA 1MCTA 1V3XA 2QGRA 2GDDA 2ZQ1A 1PPFE 2PFEA 2PKSC 1HAXB 4AGKA 3K2UA 4A7IB 5DJ7A 2BD2A 3FN8A 2CXVA 1G32B 5L30H 2HGTH 2GZ7A 3VB3A 4B74A 4ASUD 6GCHF 2HLDD 2ZHFH 3QZRA 3N99A 1GWAA 1G36A 3PV2A 4JK5A 3SUDA 5EW2H 4YESB 3MWIU 1OWKA 2AS9A 1KSNA 4H6TA 2Q6FA 1SGFA 4J1YA 3U28C 1DS2E 2KFWA 1DE7H 5L6NH 4D9QA 2EI6A 1DSUA 1TGTA 3PMJA 1S6LA 3MH5A 1MTSA 2J38A 2RDEA 2WSSD 1TRYA 1J9CH 3DFJA 4WY3A 2BD3A 1MH0A 2OQUA 4UFGH 2RA3A 1GBAA 4YT7H 3BTEE 1GMCG 4JZIA 1O3IA 1TGCA 2FI3E 3MU1A 5L2ZH 1MD7A 1LKAA 1DWEH 1E1QD 2VIWA 1Y3VA 4ESTE 3D23A 1OYQA 1UCYK 4AC9A 2PUQH 1GHWH 2OXSA 2ZFTA 4ISHH 2C93B 4UFFH 1WAYB 5FL7D 2G5VA 4BANB 1C5MD 1FLEE 1AHTH 3TVJB 4YZUA 5C2ZA 2G4UA 4J2YB 2XYAA 1DXPA 1YCPK 2R0KA 2OUAA 2ALPA 2FEQH 1MTNB 1NU7B 5EXLA 2AIQA 1V2ST 1O2NA 1YCPM 1AUJA 4MPUA 5CE1A 1WU1A 2NU3E 1INCA 3TU7H 1SLUB 4AG2A 2HVYB 1ETRH 1AVXA 2JJ2D 2O8LA 1J8AA 1O2GH 4OS7A 1SGTA 1NPMA 1C1QA 1O3BA 1D4PB 1E35B 1KDQA 3UNSA 3F2FA 3HK3B 4AOQA 9ESTA 2PKSB 2AMQA 3HPTB 2Q6GA 4X6NA 2KX4A 2OBQA 1ZPZA 1TIOA 4ISOA 4MDSA 2CF8H 1GPZA 2A4GA 4TY7A 3HATH 1TRMA 1ESTA 4CREA 4WWYA 1QL9A 4TPIZ 1CT2E 1Y3WA 2SFAA 1O39A 4FUHA 4ASHA 2XXLA 2WPMS 2VU8E 3PV5A 4GUXA 1V2MT 4NIWA 1EP5A 3F1SB 4SGAE 2SNWA 2A4OA 1ETTH 4XRNA 2XBVA 2BDAA 3KYGA 1WYKA 2XBWA 1V2OT 2BHGA 2ZEBA 1S0RA 1T8OA 1SGDE 2VIOA 1Y3XA 3SNAA 1E0FD 1TMTH 1G30B 2P94A 2ZFQH 2A2XH 1P2NA 3A8CA 4XBDA 5H4IB 4IC5A 1CT4E 2BYAX 3HKJB 2J9NA 3SYJA 3RDZA 3HKIB 1O5BB 1KXCA 1GI8B 2QIQA 3CNRA 3GCHC 3ATMA 4NG9H 1P11E 1YPGH 4FUEA 2EY4C 4DY7B 1CVWH 2ZGXH 1SI5H 1LTOA 1ZSJA 3UFAA 2YMSD 3TNSA 1WQVH 4I8GA 2PW8H 4UE7H 4YLUA 1THPB 4Q4LA 4YOGA 2EI7A 1OHHD 6ESTA 3E1XB 4Y8YA 1EZSC 3ELAH 5EQSA 1O3DA 1LVBA 3FP8E 3P8NA 1TRNA 2W7SA 3DHKH 3W94A 5G4BA 4F4OC 2ZI2H 3TGIE 2C8YB 1C4U2 3KHVA 4B71A 2BY8X 4ISLA 3SJIA 3RC5A 1MZDA 5FAHA 1NRNH 1BA8B 1GJ5H 3D65E 2NU2E 3MO3A 1EAWA 1TAWA 3SU1A 3ZZ8A 1RGQA 1QRXA 1TQ0B 5GPIB 1HAPH 1EXFA 2HALA 2DE9A 1EKBB 5DGJA 1CSOE 4D7GA 4MG3A 1HDTH 1V2RT 1P04A 3RM2H 3RXIA 2BM2A 3UB0A 5F8XA 3MO6A 1Z6JH 2DE8A 3FP7E 3KQCA 3U69H 3RXJA 1LDTT 1QJ1B 2FM2A
chains in the Genus database with same CATH topology
3B9FH 3ZVBA 1GVZA 1J14A 3P70B 1F7ZA 2F83A 2OC0A 3DD2H 7ESTE 1CO7E 1O3NA 1XM1A 4MNXA 4DJZB 3W95A 2GCTC 2JETC 2ZTXA 4H42U 3BTWE 2B8OH 1HUTH 5FX6A 1RS0A 3SGQE 2XC4A 3L6PA 2WYGA 3SNEA 5LH8A 1P3CA 2SGDE 1KXFA 1O3LA 1HLTH 2ANMH 1DT2A 1SGFG 5E0JA 1ELAA 2VH6A 1GJDB 2GMTC 1G2LA 1AWFH 3GDUA 4AGJA 1ELFA 1ZZZA 1C1MA 3A80A 2C3SA 1TOCB 3MU4A 2A0QB 2HNTE 2VIPA 1LHEH 3BSQA 3GCHB 1A46H 4DW2U 1QTFA 1W14U 1RTLA 3HGPA 2C8XB 4IC6A 4ABDA 3M35A 1F2SE 5DPAA 3T62A 1TA2A 5PTPA 3BG4C 1P2IA 3RU4E 1UJ1A 1UTMA 4FU9A 1GI6A 3U1IB 1HAYB 5JDUB 3LC3A 2GCHG 1O36A 2XTTB 2XWAA 5C3NA 4MPXA 1OS8A 3P92A 3MH6A 3SGAE 4CRGA 1YLDA 1V2WT 3D62A 1DM4B 3ZZ6A 1RTKA 1JOUB 1D6WA 3BTTE 3ZZ4A 4OS5A 3AASA 2YNAA 1SFIA 1GBDA 1T8LA 1D9IA 4AFSA 4OS6A 1TBQH 1QB9A 2R2WU 5EOKA 1VCWA 4AB9A 2VINA 3IG6B 2R0LA 1OP8A 3BEUA 2HPQH 4B2AA 1HJ9A 3UUZA 2FWWA 4ABIA 1O35A 3MHWU 5JPMH 5EW1H 2ZPQA 2LNCA 2P3TB 4XSKU 1T4UH 1DANH 1ANBA 5JBAS 1C1VH 3ITIA 3RXLA 2FOEA 3QUMP 3Q3KA 3GICB 3URDA 1QB1A 1O2SA 2J94A 3U98H 2K1QA 3CENA 1TNKA 3PV4A 2ZP0H 1RFNA 3RU4T 3F9GA 2A7HA 3TJOA 1UVSH 4ABBA 2GCTB 3Q00A 1BT7A 2JETB 5DKMA 2A2QH 1GHZA 4GVUA 1ANEA 3TH4H 4BTTB 1D3PB 3QDZB 3BG8A 1VJ9U 1W0YH 3A7WA 3SOSA 2BXTH 2GZ9A 3A7ZA 3ZV9A 1A7SA 1YBWA 3RXOA 4X8SH 4X1RU 1BRCE 3SORA 3V7TA 1N1LA 1QJ7B 2ODQA 2J92A 8GCHF 5CMXH 1GJCB 2GMTB 1OWJA 1LHCH 1SLWB 1KTSB 1TBZH 1QRZA 1UTNA 2H9HA 3U8TH 4Y8ZA 4BTUB 1S5SA 1OWIA 2BLQA 3QK1A 1BMLA 3GYLB 1P2OA 1BTXA 2AIPA 1FJSA 1ZTLA 1AKSB 1TALA 3ODFA 1GL0E 1C5PA 2ODPA 4JZ1A 3BG4B 1HXEH 2OC7A 1SL3A 3DA9B 1PYTC 7KMEH 2Z9GA 1CA8B 3O8RA 3MU5A 4KELA 5GIBA 4AB8A 1P2MA 4IBLH 2IPHA 3MO9A 5JBCS 3LKWA 5A0BA 1DLEA 2P8OC 3BTFE 4WH6A 1Q2WA 1P01A 4Y0ZE 2A32A 1EOJA 1EX3A 2STAE 4X6MA 2FOCA 2JKHA 1AE5A 1ZPCA 2A4RA 1TPPA 1LPKB 5LPFA 4B2CA 1S84A 1Y5UT 2SNVA 1NTPA 3ODDA 1GBIA 2ZDAH 2A7CA 2A5AA 3EQ0H 1HNEE 1A0HB 1QHRB 1Y8TA 2VH0A 2PKAB 5JB9S 1ELCA 3T25A 3VXFH 1AO5A 2GKVE 1BMMH 1BBRE 1SGIB 2C8ZB 3RXCA 1XKBC 1BQYA 2FYRA 2TGAA 2F91A 2KAIB 3TITA 1J15A 3FP6E 5HM2A 3GDVA 2R2MB 3BF6H 3MNBA 4NFFA 1A5HA 1VJAU 1ZR0A 4YOIA 1BTYA 2FTLE 4BOHA 4ZHLU 1BHXB 3A8AA 1C2GA 1Z8JB 2SGAA 1JRTA 4O3UA 4JZEH 1VITG 2P95A 3A7YA 1EQ9A 3RXBA 1GI4A 3SW2B 3RXMA 2ZPSA 1HFDA 3M3SA 5C5OA 1VR1H 1DUAA 2XBYA 3SV8A 1XUFA 3RP2A 4KP0A 4I8HA 3SJKA 3V0XA 1O2MA 2VVVA 4YT6H 3GCOA 3PLBA 3FZDA 4Q2KA 1AFEH 1T31A 3LJJA 3EGKH 4O9VA 3SV2H 1BB0B 1OX1A 2GVFA 1F5RA 3UOUA 4WXIA 2H9EH 3KNXA 3QO6A 3VPKA 4I33A 2F9NA 2ZU5A 1C2FA 2BD4A 1PQ5A 2FYQA 2P8OB 4FXGH 4X0WU 4WMFA 3SU3A 1AFQC 2WUCA 1AWHB 1EP6A 4CBOA 1MU8B 1OKXA 1YP9A 2RCEA 1VCPA 2FESH 1C5RA 3PTBA 1V2VT 4WJG2 2AMDA 3ZVGA 4K60A 1H9HE 1BHXF 1B0EA 4MLFB 4SGBE 2ZDVH 1GL1A 5E2PA 1NRQH 1EOLA 1XKAC 2P93A 1AKSA 2A45B 3PMAB 3RXGA 1C5OH 5E0GA 4X2YA 1C4Y2 2B5TB 4WF8A 1GDUA 3K65B 4JYUH 1AU8A 1DY9A 1L0ZA 2WINI 2C4FH 6LPRA 2TGTA 1GJ4H 1O2TA 3RMMH 3U1JB 3PTNA 1QNJA 2GCHF 2P59A 1C5XB 1GBJA 2ZG0H 3TNTA 2ZCKP 1TMBH 4MTBA 1ELEE 5CHAC 4K69A 2QV1A 3I77A 2ZIQH 2BVSH 3OTJE 4ZKSU 5DP5A 2BY7X 1FPCH 5FX5A 5DO4H 1FAKH 1BOQA 3PMBB 3LDXH 2AFQB 3SN8A 1CGIE 2LPRA 1HAHH 1G3EA 2Z3CA 2BY6X 2JH6D 1ESAA 1IQFA 1HB0B 1PPEE 1QBNA 2ANWA 3F9HA 3QX5H 2ALVA 7GCHF 5DG6A 3C1KA 4BAMB 2O8WA 3MOCA 1IQLA 2PKAA 1C2HA 1GI5A 1QL7A 2Y5FA 3IITA 2ZFFH 5GDSH 1Z1JA 4NA8A 1GMDF 3QTOH 4AORA 4BAKB 2KAIA 3P6ZB 4JCNA 2ZFRH 2VIDA 1QJ6B 1Q3XA 4DURA 1NROH 1FQ3A 1DSTA 4UFDH 3VXEH 1FDPA 4R0IA 3VEQB 5C5NA 1P2QA 2QXHA 3SQEE 1MAXA 2RG3A 5DP6A 5DK1A 1AFQB 1HXFH 2ZDKA 3KF2A 2BDHA 1IQMA 1O33A 2UWLA 3GY7A 4UFEH 2TBSA 1W0ZU 4FUDA 3K6YA 1MUEB 1C9TA 3OU0A 4KTUA 3BIVH 1C2IA 3SNBA 1TFXA 1WCZA 3LGWA 4AFZA 2BD8A 1HRTH 1HAZB 1K1JA 1GBBA 2D2DA 3OYPA 2F9OA 2V6NA 2B7DH 3MH7A 1IQNA 4DIHH 1C9PA 1FY3A 1TX6A 1KLTA 1NRRH 4A1VA 1BTHH 4F49A 5ESBA 1TE0A 1SGPE 2F9PA 2Z9IA 1O3OA 3KEEA 4RSPA 1DWBH 4Z6AH 1ARCA 2ANYA 2FPZA 2ZU2A 3MFJA 1SHHB 1ABJH 2ZGHA 1UMAH 1YKTA 5BRRE 3GY5A 2FI4E 1ZHPA 5CHAB 2IOTA 1FZZA 1G9IE 2QY0B 2ZDLA 1OXGA 1SHYA 2PTNA 3BTME 3A83A 8GCHG 1EAIA 4NA9H 1SLVB 4GCHG 1W12U 2FIRH 3UQOA 3FANA 4DVAU 2BVXH 1YPHE 2ZHQH 1O3AA 3BTDE 1MKXH 4Y7BA 1O31A 1GMHG 1EZXC 2QA9E 1D3TB 3RLYH 3T28A 3LOXA 1JIMA 2PSYA 1LHDH 3UWIA 1XUJA 3BTKE 2BY5X 3V13A 4I32A 1BBRH 2V3OH 3RXFA 3TJVA 3SGBE 1P09A 2OTVA 3SU0A 5J4QA 1O2IA 2Y7XA 4I31A 3TK5A 2TPIZ 2HWLB 1FAXA 2SGPE 1ELVA 1PJPA 5A8YA 1K21H 4IMQA 3HGNA 4CH2B 2PSXA 3FFGA 2D1JA 4NGAH 5A2MH 1VITF 1HAOH 1LO6A 3M5LA 4IS5A 1AMHA 1EB2A 3RLWH 3QLPH 3IWMA 4AFUA 1T8NA 2HOBA 2GT8A 3D49H 2Z3EA 3GISB 3PWCA 3NPSA 1BRUP 1S6HA 4O97A 3OY6U 2JH5D 2WV4A 2G4TA 3A88A 1GJBB 1F0SA 4OS1A 3GY4A 3E0NB 1GI1A 2ZECA 2OD3B 3RXSA 2Y80A 2XBXA 1DY8A 4I7YH 2UUKB 1C1TA 3KQDA 5A8XA 2R3UA 3ZZ3A 2BQWB 2AGGX 4HI3A 5JB8S 4ABGA 1DDJA 1LVMA 3KIDU 3H7TA 1QBOA 2BY9X 4I8LA 3MMGA 2ZF0H 1O3GA 2AYWA 2ZFSA 5TCCA 1C2JA 3SO3A 1SGRE 2EA3A 1AGJA 3E91A 4FUFA 3VB7A 5JBTA 4AN7A 3VB6A 3U9AH 4CHAC 1W7GH 3EA7A 1BRAA 1QIXB 3BV9B 3SJOA 4CR5A 5SGAE 1S82A 4LZ1H 1S81A 1GBHA 1W13U 3A84A 3B8JA 2H1UA 1C5WB 4YOJA 4DOQA 3A87A 4LXBH 1O3MA 1RXPA 4NWLA 4KGAA 4MQAA 2ZNKH 1GCDA 1K1NA 3LGVA 5C67A 1PYTD 2V3HH 2DUCA 4JZFH 4BAQB 1IQKA 1YYY1 1XUHA 2XCNA 2CMYA 3T5FH 4OS4A 3SJ9A 4YLQH 3ZV8A 1BDAA 4IN2A 1T8MA 2GT7A 1FV9A 1K1MA 1HAVA 1FY4A 2NU4E 1NZQH 1PPHE 2OBOA 2VGCC 3SBKA 3ZZAA 1QY6A 2XRCA 5EXMA 4ZHMU 6CHAC 1FMGA 1GBFA 3U8RH 3SNCA 2BLVA 4FVBA 3EA9A 1PQAA 2TRMA 1GJ8B 3A82A 1V2LT 4ZAEA 4B73A 3ATLA 1O5FH 5T6DA 4D7FA 1JXPA 1P10A 1MU6B 4U2WA 1GI2A 4ABHA 1O0DH 2D8WA 2PGBB 1SGNE 3LU9B 3RMLH 1ZHMA 3SU6A 1HV7A 2BDBA 1V2JT 1UTKA 1EZUC 3MNSA 4NA7A 3T26A 1NO9H 2VWMA 5F6MA 2HLCA 3BIUH 4XDEA 2H5DA 3SI4H 1AQ7A 2BQ7B 4DG4A 1OWDA 2ZGCA 3MU8A 4IMZA 1NC6A 3KN2A 3C27B 2PTCE 1TPOA 1UTPA 3EDXB 4TPYA 1MKXK 3RXHA 3I29A 2FZZA 1GDNA 2OLGA 2TGDA 1P06A 1GJ9B 1FNIA 2OC8A 4KTSA 4XE4A 4CHAB 4CRDA 4U32A 1BTUA 1ANCA 1YF4A 2O9QA 3H5CB 4D8NA 2B9LA 4FU7A 3NKKA 1BIOA 1W10U 2BDYA 1LHGH 1SG8B 2R3YA 3CP7A 5EODA 7GCHG 1BBRK 2J4IA 2UUFB 5J4SA 1WQSA 1RIWC 1SGCA 8ESTE 2W3KA 1KLJH 1B0FA 2XC5A 3A8DA 1GCTC 1LVOA 1ZHRA 3MH4A 1O2WA 1GMDG 1L1NA 2WV5A 1TONA 1WTHD 2Z9LA 2ZHDA 1F0UA 1TGSZ 3A7XA 1EPTC 1O5DH 3Q77A 1HAGE 3M3VA 2FOMB 1V2QT 3TJUA 2Y82A 3GY3A 4Y6DA 3GY2A 3LONA 4XBBA 1IQHA 1ZTKA 1MTVA 1V2UT 2VGCB 3UIRA 1QA0A 1Z7KA 1ZSKA 5FPTA 6CHAB 3PLPA 1NM6A 4D9RA 1XUIA 1XUGA 4AG1A 3SQHE 1A3BH 1MMJN 1O2YA 3FAOA 4K3JA 3E3TA 3QTVH 5IDKA 3DUXH 2Z3DA 4GCHF 1V2TT 3ZZ7A 1C1SA 2Z7FE 1K22H 4CRCA 1PPCE 1GMHF 3F9FA 2J34A 3OSYA 2FLBH 3G01A 3TJNA 1RTFB 2ZDNA 5EQQA 3SV9A 1N8OC 4K1SA 1AZZA 1A1RA 3LGYA 1MQ5A 4BXWA 2Z9JA 2ZTZA 2SGEE 1V6DA 1F5LA 5HGGA 1MD8A 3BTGE 1TX8A 1OSSA 2O8TA 5E8EH 1NRPH 4B1TA 1T4VH 5FPYA 4DIIH 1K9OE 2QCYA 3PO1C 3QGJA 3RXUA 4FUJA 3M7UA 2XNIA 4NIYA 1W3CA 4XBCA 2ZWLH 4BXSA 5LPEA 4ZROA 1AN1E 1HAIH 1NT1A 2UUJB 3ZVFA 1TB6H 3ZVDA 1H9IE 4GHTA 3SUEA 4INHA 3RC6A 1UK3A 1YPEH 3RM0H 1JWTA 3LPRA 3QN7A 4CBNA 1YPJH 2FS9A 3RXTA 3UTUH 2ZFPH 4GLYA 1C1RA 2V35A 3A81A 3JZ1B 2G51A 4Y0YE 3F9EA 4WH8A 4YTAA 2VIQA 5L2YH 1C5VA 2EI8A 2RA0A 1YPKH 2ZQ2A 4U30A 2AGIX 1O2HA 2HRVA 1P2KA 2PGQB 4Q80A 1FONA 1GJAB 4K8BA 1RIWB 3STJA 4LK4A 2C90B 5ESTE 2GD4B 4DT7B 1C5YB 1GCTB 1NRSH 1LHFH 4ZHAA 1C2DA 2FODA 3UOPA 3O8CA 2ANKH 4X2XA 1C2KA 1EPTB 4E7NA 5EXNA 2G81E 5EGMA 3URCA 2ZCLP 1GHYH 2FXRA 2ZTYA 4HTCH 3A89A 3P17H 4TYDA 1AB9C 3M5OA 4FU8A 1CE5A 5TJXA 3KCGH 5DP7A 1O3FA 4CRAA 4KKDA 3VGCC 2CJIA 2BZ6H 1X7AC 5GWZA 1O32A 2ZGJA 5AFYH 1OWHA 5LGOA 2HPPH 2PR3A 1C1NA 3Q3XA 1H4WA 3VFEA 1QQ4A 2M5TA 1HCGA 2Z9KA 1Y5BT 2VB0A 1XVMA 2ZZUH 3TGKE 1O38A 4HZHA 5I46H 3OX7U 1O34A 1Y3YA 2C8WB 1ZLRA 4X8TH 4GAWA 2G5NA 4A6LA 3UPEA 3QWCH 3LGTA 1EJNA 4JYVH 1TGNA 4Y10E 1HJ8A 3T27A 1IQIA 1VITH 2FI5E 3ZZCA 4LOYH 4B76A 1HYLA 2STBE 4INLA 1N8OB 5B6OA 4H6SB 5T6GA 2A31A 1RJXB 1J16A 4K1EA 1C5ZB 1UK4A 4MPVA 1GBKA 1QA7A 1IAUA 2H6MA 8LPRA 4TWYA 4ZUHA 5K7RA 1ZMNA 1BCUH 4ISNA 3PO1B 1TNGA 2ZCHP 1T32A 4UEHH 1L1JA 1BTWA 3KQEA 3A7TA 1C4V2 5FHTA 5DP9A 1ZRBA 4FVDA 2JH0D 3CS7A 4NCYA 1C5SA 1UHBB 2B0FA 5EG4A 4JK6A 4LZ4B 2BDIA 1BMNH 1F92A 1D3DB 2BLOA 5C1YA 2HVXA