1HPGA

A glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
187
structure length
187
Chain Sequence
b'VLGGGAIYGGGSRCSAAFNVTKGGARYFVTAGHCTNISANWSASSGGSVVGVREGTSFPTNDYGIVRYTDGSSPAGTVDLYNGSTQDISSAANAVVGQAIKKSGSTTKVTSGTVTAVNVTVNYGDGPVYNMVRTTACSAGGDSGGAHFAGSVALGIHSGSSGCSGTAGSAIHQPVTEALSAYGVTVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding.
pubmed doi rcsb
molecule keywords Glutamic acid specific protease
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 187
sequence length 187
ec nomenclature ec 3.4.21.82: Glutamyl endopeptidase II.
pdb deposition date 1993-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hpgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hpgA01
1BTXA 5HXFA 4NA9H 2Y7ZA 1GBMA 2GT7A 3ODDA 4X1PU 4FU9A 3SGAE 1O3OA 1V2NT 5K0HA 1KDQA 4JYVH 1C9PA 1Y3XA 1PQ5A 1QRWA 1UVOA 2FTLE 1O5EH 3KN2A 4YTAA 1WTHD 1MTNB 4B2BA 1EPTB 3TK9A 1TNKA 4MPUA 2JKHA 2OTVA 2OC7A 1GI5A 1PPFE 1H8DH 3M5LA 1IQHA 1ELFA 3BIUH 3BG4C 1D3TB 3QX5H 1GJ5H 4ZROA 2Z3DA 1LMWB 3ZZ7A 2C90B 4ZHLU 4AZ2B 3PROA 4FUIA 1GBHA 3RXFA 1B0EA 2Q1JA 3VB7A 4XDEA 1TYNA 1IQLA 1BTZA 1C2JA 2GZ9A 1EQ9A 1AFQB 1PPBH 3P8NA 4B2AA 1CA0B 1F0UA 1FDPA 3W94A 1EXFA 2CF9H 1K2I1 3RP2A 1AIXH 2Y82A 1SBWA 4JYUH 3M7TA 4D8NA 2ZFPH 4H4FA 1BTYA 2DE9A 2V3OH 1TOCB 1P03A 1GCDA 1JMOH 2ZDKA 1XVMA 1SG8B 4BAHB 1OXGA 4D9RA 4GAWA 1SMFE 2D26C 3RC4A 2C93B 1O36A 1O3BA 1NFXA 3T26A 3UTUH 2GX4A 1GCTB 4NWKA 4AB9A 1G3BA 1GI7B 2C8WB 1HAVA 4JCNA 1TA2A 1GBDA 1BBRE 1FAXA 2WUBA 1XUJA 1W7XH 2CXVA 2ZHQH 2ZTZA 4H6TA 4X2VA 1SLXB 4X6PA 1O32A 4MG3A 4H42U 4PROA 5EW1H 2QN5T 4UONA 5FX5A 3SU5A 1QRZA 1ABJH 2HPQH 2VINA 3OX7U 3BF6H 2FEQH 2A32A 4X8TH 3VGCB 2G00A 1LVOA 1WU1A 2CJIA 3M37A 5ABWA 1EAWA 1T8NA 1NU9A 1QNJA 2YOLA 1YF4A 6GCHG 1LQDB 3R3GB 3TJVA 1UJ1A 1JRSA 4IC5A 4XOJA 3SNCA 1BBRK 1GJDB 1P3CA 3GY3A 1YP9A 3CP7A 5A09A 1NC6A 1EOLA 5L2YH 1ZJKA 4AFSA 1P3EA 2A7JA 1K21H 4DURA 1H9HE 4RKJB 3LOXA 1HB0B 3ZZ4A 1ZSKA 2J94A 2ZDNA 2AEIH 3LGIA 2ZG0H 1CT2E 2P95A 2WYJA 9ESTA 3RXHA 2BD8A 2ZU4A 3PLPA 3RC5A 3RM0H 1TMBH 1DX5M 1O3NA 3TLOA 1KXDA 2F9OA 2P8OC 3GCNA 3MI4A 2BOKA 2ZCKP 1ESTA 4MNWA 1O2IA 5JBAS 4O3UA 3T25A 2VIDA 3HK3B 1UTOA 1O2LA 4O9VA 2R2MB 4ZKOU 3RXQA 3RXIA 3MH6A 5FHTA 2FI5E 1SSXA 2H9EH 2GMTB 1O5AB 2THFB 1GVZA 1SGQE 4WH6A 1TPSA 1A61H 2PKAA 1HV7A 2B9LA 2PUXB 1PQ8A 1HBTH 2FM2A 1O31A 2BX4A 1TOMH 3SU0A 1CGIE 1C1NA 3RXSA 4AG2A 3PTNA 5FPYA 1O2NA 4KGAA 1ELTA 3IG6B 4GCHG 1HDTH 3AVZA 3RLWH 2GZ7A 4INHA 1DICA 4NG9H 3ZVFA 1NO9H 3SUDA 4Y0YE 2OQUA 3STJA 1GVKB 2BVSH 3LJJA 1SL3A 2G4UA 1L4DA 1C5WB 1C5UA 4DW2U 1DLKB 4X6OA 3LGUA 1RIWC 2BZ6H 1GI1A 1OWKA 1NRQH 1QBOA 1S0QA 2B8OH 2WPKS 2XYAA 2AMDA 3BV9B 2HGTH 1ZMNA 3GYLB 4BAMB 3T28A 1ZGIA 4GVUA 5DP5A 3GCHC 1TMTH 3M7QA 5C5OA 1TONA 3Q76A 1GDNA 2EA3A 2OCVB 3BTME 3HKIB 2CMYA 3ZVAA 5F8TA 2BHGA 4YT7H 2A7HA 2NU0E 3TJNA 4TYDA 2ZDMA 1AQ7A 2C3SA 3BG8A 3BN9A 1TGSZ 2P94A 2AIPA 2Y7XA 3M7UA 1IQIA 1C5OH 2CHAC 2FI4E 1O33A 3VXFH 1NPMA 2SGFE 2BDHA 2ZHDA 3BEUA 1GBCA 4TY6A 1L1NA 1FY3A 4HTCH 5AFYH 1AE8H 3A8DA 1FN8A 1GJBB 4HFPB 2W26A 1EP5A 1DWEH 2VWNA 1V2VT 4IGDA 1IAUA 3EDXB 4QT8C 1K1NA 3FP6E 4ZXYH 3ZZ8A 2HNTF 1MKWK 2PLXA 4JK6A 1INCA 1AU8A 1LHEH 1GHWH 1HJ8A 1UTLM 2JH0D 5HM2A 1FLEE 3QLPH 1P01A 1QL8A 1O3KA 1TAWA 4MNXA 1DFPA 3A85A 1ELCA 4LXBH 3TK6A 2AGGX 1GBKA 1S82A 3OTJE 3ZVBA 1LHCH 2CV3A 1DUEA 3SBKA 2CF8H 1C2KA 3I77A 3ZZ9A 4A5TS 1GG6B 1P57B 3A89A 3E0PB 3QK1A 1VCQA 2FOGA 4I8HA 2Y5FA 2UWLA 2VH6A 3GDSA 4MPWA 3UIRA 3ZVCA 1LHDH 2Z9KA 5GWZA 2EI6A 5FBEA 3DFLA 5BPEA 3AW0A 1O5CB 1O35A 1CT4E 2HWLB 1PPHE 1O2TA 3TJOA 3I29A 4TWWA 4BXSA 1Y3WA 3D65E 2BY9X 2V3HH 1FV9A 2UWOA 1W10U 3BTGE 4YOGA 5G4BA 3PYHA 1KYNA 2HVXA 2BX3A 5DP6A 4CBOA 1IQGA 3PTBA 1Z8IB 5EOKA 3LH3A 1ORFA 4DIHH 4YM9A 3OYPA 4B75A 2O9QA 1C5SA 3SV9A 1DWCH 5GCHF 1DE7H 4CRAA 1HIAB 4IN2A 2A0QB 4Q7ZA 2GCHF 4K8BA 1O3PB 1BTWA 5AFZH 1T7CA 1XUFA 2UUFB 4ISNA 4BOHA 3GY8A 1OWDA 2FS9A 3RXJA 4OGYA 3ATLA 1O3HA 1XUIA 2QY0B 3BG4B 1O3CA 5PTPA 2FYQA 3L33A 2A7CA 2XBWA 3F9FA 4X1QU 1SLVB 3RMNH 1XMNB 2Y81A 5C3NA 2A4GA 1FY8E 4NGAH 5E8EH 3U8TH 1VCPA 3A88A 1EZXC 7ESTE 4DVAU 1HAXB 4FUBA 1SGTA 2ZHWH 3BTEE 4RKOB 4XSKU 1GBJA 4VGCC 1OKXA 1PFXC 1BJVA 4BTTB 5F6MA 1GBEA 2XWBI 5AF9H 2AIQA 1LPKB 2PSXA 1MZAA 1NTPA 1T8MA 4A6LA 1FZZA 2A31A 1O2GH 5HM9A 2EC9H 4K2YA 4DGJA 1QJ1B 4LK4A 3AAVA 2G5NA 2W5EA 3NKKA 3SNEA 1PYTD 1W0ZU 5DP7A 3K2UA 1JRTA 3FAOA 2PFEA 1CHGA 2XC4A 4A92A 2A4OA 2PSYA 3LIWA 2ASUB 4ZHMU 2UUKB 4Q7YA 4DJZB 3E91A 1GPZA 3ZVGA 8ESTE 5JBTA 2BDAA 2D8WA 4XE4A 1YPEH 1AGJA 2GV6A 1W14U 1YPGH 1ZTLA 1BRCE 3ITIA 7LPRA 2ZGBH 1QB6A 4MTBA 3FVFB 1CT0E 4HZHA 2BB4A 1YGCH 2VWOA 4FUEA 1L1GA 4GHQA 2ILNA 1D3DB 2VGCC 3JZ2B 3EA8A 2QYIA 3NXPA 1FIZA 3MMGA 3SNBA 1C2GA 2FMJA 5GPIB 1MUEB 3MH5A 3A7WA 1CO7E 2VIVA 2BDGA 3VB4A 1ZZZA 2HLCA 1T4UH 4Y8YA 1EUFA 1A5HA 5T3HA 2ZF0H 3JZ1B 3UUZA 1EATA 1SQOA 5GCHG 4X1RU 1BJUA 2C8YB 2OD3B 4FUFA 1JWTA 1THSH 1D6RA 4NIXA 3V7TA 2GCHG 3R0FA 1W7GH 1LPZB 3D49H 3K65B 4Y79A 3LU9B 3DHKH 3GDVA 2G5VA 2FXRA 1D9IA 1GBAA 3PO1B 4BNRA 2A45B 5EQQA 2A5KA 2PGQB 1N8OC 1BRUP 5EGMA 2FO9A 2OXSA 1O2MA 3P17H 5I25A 1DOJA 3UR6A 1UTNA 1H1BA 2ZFFH 4IS5A 4TWYA 2DUCA 1P2KA 3E6PH 4R8TB 2AMPA 3RU4T 1A0HB 1DSUA 1ARCA 1WAYB 2STAE 5AHGH 2P8OB 1OS8A 4WXVA 1MCVA 1FUJA 1BTPA 2AFQB 1QRXA 1X7AC 1A46H 1K1OA 4JMYA 2GT8A 1ANEA 2AH4X 4DOQA 2NU1E 3Q3KA 1O5DH 4A1TA 4IMZA 3ZZ5A 4A7IB 5H4IB 3LGWA 4ABIA 1MTVA 4BAKB 1LQEA 1O2QA 2BY7X 1UMAH 3QTVH 4IW4E 1GGDC 1ELEE 3ENSB 6ESTA 1TRMA 3SORA 3RXMA 2GCTB 3V3MA 3M3VA 1G32B 5CHAC 1BITA 1LTOA 1Y5UT 2FZZA 1H8IH 2GV7A 1HAPH 1DM4B 3LGVA 5FCKA 3M5MA 1GL0E 1TX6A 4K8YA 1ANCA 1SGDE 1OP8A 3OSYA 3NCLA 3TGIE 1FNIA 1TMUH 4X0WU 4HI3A 1PPZA 1SB1H 3FP8E 1XUHA 3E90B 2F9UA 1MQ6A 1Y59T 3LDXH 3P8GA 4WVPE 1PPEE 1GJAB 1NRSH 3P6ZB 3MYWA 2I6QA 3RXTA 1TWXB 4SGBE 1PPGE 1SR5C 2BQ6B 4MQAA 1RIWB 4UD9H 5C1YA 1G37A 1MAXA 4I8LA 1MD8A 3LPRA 4E06H 1O38A 1FY4A 2O8LA 3Q00A 2VWMA 4FUHA 3PMHB 3V13A 3RXCA 1BRBE 1RS0A 4NCYA 3WY8A 5DP9A 1WV7H 1O34A 5E0HA 3ESTA 3SHCH 3UR9A 5C2ZA 1J8AA 4A1VA 1E36B 2BD5A 2CHAB 1MQ5A 1NU7B 2ZNKH 1XM1A 1O3AA 2Z9IA 1GBLA 2OC8A 1IHSH 1TB6H 5HMAA 3MU1A 4UFFH 1V2QT 2BY5X 1O3JA 3C27B 2J4IA 2GD4B 2V35A 2TGPZ 1GHVH 4NIYA 2PTNA 4KP0A 1EPTA 1O2HA 1C1WH 1C2MA 2HALA 3TIUA 3MO9A 1VR1H 3A8BA 1G2LA 3E3TA 1SVPA 5EXNA 3Q3XA 1D3PB 2WPLS 4I7YH 2Z94A 4X2YA 4KTCA 3M61U 1GJ9B 1L1JA 1C1OA 2W7UA 1SOTA 1V2WT 3NPSA 4NSVA 2AYWA 4XBDA 1ZPCA 3SNDA 2XBXA 1AKSB 1DXWA 2ZZUH 1CU1A 2BZAA 1C1UH 2OBQA 3PV4A 3LH1A 1O2KA 1V2MT 3O8DA 1YCPH 1P9UA 4K1SA 1HAYB 1MH0A 2BXTH 2F91A 3SUGA 1GBFA 4AX9H 1LO6A 1DY8A 1IOEA 1L2EA 2R9PA 5C20A 1ARBA 3SJIA 5DGJA 1WUNH 4ZMAH 1GL1A 3SV6A 1B0FA 4B71A 4K60A 1ZHPA 1OP2A 1VZQH 5DP8A 4CRGA 2QXJA 1F0TA 2EEKA 1E35B 3U1IB 3TH3H 1Z7KA 2ZU5A 5E2OA 1A1RA 2ZGHA 1LKAA 4UFGH 4WXIA 1RJXB 1UK2A 1HAIH 4CR5A 4Y10E 1TPOA 2QXHA 1W11U 3MO6A 1O5GH 3TNTA 4ABBA 1UCYH 3M5OA 3IITA 5FPSA 1BMNH 1O3EA 9LPRA 3B23B 1DANH 5F8ZA 2A2QH 5K7RA 1OYTH 2BLQA 2BTCE 3A7VA 1EX3A 3KNXA 2I6SA 1P2OA 4AFUA 1NFYA 1XVOA 2J9NA 2XNIA 3CS7A 3PMAB 4Y76A 1O2XA 5EW2H 1GHZA 2WPMS 1P2JA 3AAUA 1H4WA 1HAZB 1ZMJA 1TGTA 4FUDA 1TA6A 1TQ7B 2B5TB 2R3UA 1O5FH 3LT3A 5FX6A 4NZLA 2VH0A 7GCHF 3KQEA 4E7RG 4MDSA 4FU7A 2ZO3H 1CA8B 1Y3YA 1GHXH 1BRAA 2JH5D 1FI8A 1Y5AT 4VGCB 3S7KB 3ATIA 4IMQA 1BZXE 3UY9A 1EZSC 4FXGH 1GMCF 1C1MA 3F1SB 4I31A 3GCTF 4CRCA 3SV2H 1AVXA 3MU0A 4U32A 1HGTH 1GI6A 2QC2A 3VPKA 1FPHH 1P8VC 1CGHA 1TE0A 4ABEA 4AYVB 3GCOA 1SGCA 1TX7A 5LGOA 3TNSA 2ZHEH 1J16A 1O37A 2F9VA 4ZKSU 1BHXF 1UHBB 1CBWB 2ODYB 1BBRH 1DITH 2TGAA 4D7FA 2GVFA 1O3LA 3M3TA 4YLUA 2ZCLP 1Z8GA 3MNCA 1YLCA 3KQDA 1GI8B 1BUIA 2UWPA 3URCA 5T6GA 1G3DA 3GY5A 5LPEA 1MTWA 1C4U2 2VGCB 3B9FH 4GLYA 5T6DA 2VIWA 3T2NA 3ZZCA 1ZRKA 3N7OA 3ODFA 1UK4A 1MU6B 1Z1IA 3STIA 1FN6A 1PQAA 4RSPA 1ABIH 1MKXK 2QA9E 2QXGA 3DT0H 2Z3EA 4D9QA 2AERH 3L6PA 2ZC9H 2V0BA 4YZUA 4BAOB 1YPLH 4NA8A 4CHAC 4GHTA 1ESAA 1CSOE 3SU4A 1THPB 2ZECA 3PMBB 1NN6A 4FUCA 4B1TA 2CGAA 1UO6A 1JIRA 4X1SU 1A4WH 2FOCA 2BVXH 5EXLA 2TGTA 2ZGJA 4THNH 3HK6B 1WOFA 1UVSH 1NRPH 3S9AA 1C5RA 1EZUC 4Q80A 4NWLA 1J9CH 3CENA 5GDSH 3UNSA 1ZPBA 3TVJB 3U9AH 3S0NA 2NU3E 2FX4A 3P8FA 3RDZA 4YOJA 1PPCE 3OU0A 2BD9A 1ETTH 3LJOA 1ZTJA 1HPGA 1SGRE 2VIQA 1EZQA 1XUGA 1HJAC 7GCHG 1QCPA 2ZGXH 1FAKH 1EJMA 1G36A 4X8UH 2ZFSA 2F83A 4B76A 1QGFA 3W95A 2YNAA 2ZU1A 4JZEH 2C4FH 2P93A 4O97A 3GCTG 4FVDA 1FJSA 4JZDH 1GGDB 1RD3B 2JETB 3HGPA 2OUAA 3H7TA 1Y8TA 5CHAB 1H9LB 1RGQA 5E0JA 1Q2WA 1VCWA 1YPHE 4ISLA 2ZWLH 1NRRH 5F8XA 1MTNC 4OS2A 5J4QA 4D7GA 3SQHE 1CHOF 1GJ6A 3PMJA 4CRFA 1ETSH 2ZQ2A 1TFXA 1HJ9A 2GDEH 4KKDA 3F6UH 3EAJA 1K1JA 1C5VA 1AB9C 1MKWH 1UTMA 1TX8A 2P59A 3K6ZA 4Y7BA 1DY9A 4K1TA 4HGCA 5DG6A 4BAQB 1O2PA 1K1PA 1UTKA 1W0YH 3HPTB 1KXEA 4B73A 2ALVA 4WMEA 3C1KA 2XRCA 4Y7AA 1S83A 1F2SE 2GDDA 4LZ1H 1HRTH 4K5ZA 1AFQC 3SU3A 4ISHH 1ZPZA 4ESTE 1C5XB 1L0ZA 6LPRA 2OC1A 1C2IA 3RXKA 1PJPA 1NFUA 1SC8U 5JB9S 3P8OA 3QGJA 1C4V2 3H5CB 1ZGVA 1O2VA 2Z6BD 3SI3H 3M36A 3O8CA 2SFAA 2HRVA 4BTIB 5JB8S 3LKWA 2FWWA 2VIPA 5A8XA 1NFWA 2A5IA 2RCEA 1HIAA 5HGGA 1TIOA 2D1JA 2BDYA 3GY2A 1DDJA 3TPIZ 3RXPA 1YKTA 1QB1A 3BTDE 1AVGH 3SGQE 1QA7A 2J95A 1YPMH 3B8JA 2Y6TA 1Z71A 4CR9A 3P70B 3T29A 4F49A 1O2JA 3O8BA 4I8KA 4DG4A 5TJXA 4AB8A 1V6DA 2BY6X 1P10A 2FOEA 4X2XA 3ATWA 1JXPA 3SJKA 4OS4A 5A0BA 1TLDA 1MD7A 1F5LA 1WQVH 1XKAC 1CGJE 3GY6A 2VNTA 4YT6H 3KL6A 4E05H 4OS5A 1IQKA 3EE0B 4FU8A 4O3TA 4Z6AH 4CH2B 1AN1E 1C1QA 3D23A 3VGCC 2PW8H 3MFJA 1ZSJA 1A0LA 1TGCA 4ABFA 3HGNA 3TITA 2SGDE 2Q6DA 1KXFA 3T27A 2ZIQH 5F03A 3ZYDA 3SN8A 1TNIA 1BCUH 1ZSLA 4TPYA 3LGTA 1GI4A 3VEQB 3MH7A 1E0FD 3GICB 2VWLA 2QF3A 1A7SA 2H5CA 1DXPA 5T6FA 2P3UB 1YCPM 4XFQA 1S0RA 3UNRA 2ZPSA 2QCYA 3SO3A 1UVPA 1K1LA 1MZDA 4JZFH 1C5ZB 1CHOG 5E2PA 1GMHF 1AWHB 1IQNA 4X8VH 1LKBA 3GY4A 2P3FH 3D62A 3UOUA 2W3IA 2GTBA 2W3KA 1KXAA 1HCGA 2W7SA 2G4TA 3PLKA 1BA8B 3E1XB 1BOQA 1T8OA 1JOUB 2FESH 3BTKE 4INLA 3NZIA 1LDTT 3RUOA 2WUCA 1SGYE 1AE5A 4CBNA 1AI8H 2ZU3A 1RTLA 1VITF 2TRMA 1O2SA 1SLUB 1DWBH 3GY7A 1ACBE 3RMOH 5ETXA 3F9HA 1T8LA 4YOIA 1XX9A 3QTOH 3A7ZA 1O2OA 2Q6GA 1GJ7B 2A2XH 1BT7A 2O8MA 2Y80A 2XXLA 4YESB 1QHRB 1BHXB 1V2OT 3FANA 3FFGA 2ULLA 1LVBA 1FPCH 4X6MA 2VVUA 4ZAEA 4CH8B 4FUJA 5IYTA 3ZZ6A 4AOQA 3OY6U 2XTTB 1TNHA 1GJ8B 3RLYH 3BTFE 1BMLA 1Z6EA 3A86A 3SQEE 3U8OH 4BTUB 1TPAE 4ZUHA 7KMEH 3QDZB 2HNTE 1ZHMA 3BTWE 1N6YA 5JPMH 5I46H 1RRKA 1TBQH 1W13U 2FP7B 1TNLA 5A0AE 3ZZBA 3UOPA 3A8AA 1BB0B 2ALPA 4WJG2 1DS2E 4AORA 3TK5A 2BVRH 2ANMH 1HAOH 2BMGB 2FOFA 3UREA 1EAXA 4NZQA 3MNBA 1ZRBA 1ANBA 1P02A 1WYKA 3FP7E 1C2DA 1FXYA 1KTTB 3GDUA 1C5MD 2Q6FA 2SGEE 4B74A 1N1LA 4AGJA 3E8LA 2LNCA 3CS0A 5BRRE 2O8TA 1XKBC 3E16B 4Y0ZE 1O39A 4CHAB 2RA0A 1LVYA 2IJOB 2H2ZA 4KELA 5EQRA 3VXEH 1IQMA 1UTPA 1C2FA 3L3TA 4GPGA 2IN2A 2PWXA 2OINA 1E34B 3UQOA 1GMHG 3QWCH 1RXPA 1AY6H 1TRYA 4WF8A 3QZQA 4JZ1A 3KQCA 1IQFA 3Q3YA 5EODA 1QA0A 1OOKB 1C2EA 2G55A 3S9BA 1P2NA 1S5SA 2XW9A 3MO3A 8GCHF 3A87A 2M5TA 2ZCHP 3MHWU 3SZNA 2H6MA 3GCHB 4K69A 1ELAA 1QJ6B 4AG1A 2NWNA 3M3SA 1WBGB 4UE7H 2Z7FE 5DK1A 1SFIA 1VITG 1P11E 1HJAB 2SGAA 2VJ1A 1TALA 2ANWA 4ZKRU 3LC3A 1KXCA 2XBVA 3TGJE 3V0XA 5J4SA 1EAUA 1D4PB 1QB9A 4LOYH 2WYGA 3NK8A 1ZMLA 1C9TA 1AZZA 4GSOA 4WMFA 4GUXA 1ETRH 4MNVA 4OS1A 1WQSA 1LCYA 1P09A 3H7OA 5DP4A 5EU8A 1SFQB 2KAIB 3SUFA 4BANB 2KAIA 4WWYA 1QTFA 4MNYA 5EPYA 3SJ9A 1C1TA 3RXAA 2WPJS 2A4QA 3AW1A 3URDA 1JIMA 1QJ7B 1NROH 1GI0A 4Y8XA 1ZHRA 1KDQB 1W8BH 1YBWA 1C5LH 1HXEH 1OP0A 2PUQH 3UPEA 1UCYE 1YCPK 3U69H 1EB2A 1AKSA 1AVWA 1QBNA 1Z6JH 1GI2A 3SI4H 1EKBB 3MH4A 3U1JB 1C5YB 1C2LA 2FYRA 3VB6A 4MVNA 2GGVB 4ABHA 1QFKH 4UEHH 1P2MA 3A80A 1AWFH 4H6SB 2FLBH 1AB9B 1BMMH 3MTYA 3F9EA 2FX6A 1TBZH 4ISOA 4ABGA 1YPHC 3ZZDA 4X8SH 2VVCA 1B7XB 1P12E 3G01A 1OPHB 4M7GA 2ZPRA 2XC5A 2OQ5A 4FVBA 5FPTA 1SGEE 2F9PA 4DCDA 1BQYA 5FAHA 1NZQH 2FOMB 3KF2A 1HXFH 1CE5A 2VIOA 2BQWB 4CREA 1UCYK 2ANKH 2V6NA 2ZPQA 4XBBA 1Y3UA 4UFEH 3K6YA 1E38B 2CN0H 3PB1E 3SJOA 2VB0A 5C5NA 2WV4A 3M35A 3GOVB 3ZYEA 1XUKA 3RXDA 1KLJH 1VGCC 2G52A 3PWCA 4GCHF 3EA7A 1C1VH 3EQ0H 1PYTC 1DUAA 3BEFB 2FIRH 1G3CA 4LZ4B 2PHBA 3SW2B 3QUMP 2ESTE 8GCHG 1O3MA 3P95A 1HAVB 2G51A 1O3IA 1FMGA 4TY7A 3ZV9A 1CVWH 2GP9B 1J17T 2SGQE 3FZDA 3MWIU 3QN7A 4U30A 1ELDE 1THRH 2FDAA 4KTSA 4U01A 1GBBA 1F5KU 4WMDA 1QQ4A 3SJ8A 3QZRA 4MPVA 4Y11E 1DPOA 2BY8X 3MU4A 1S81A 3DA9B 2P16A 4IN1A 3RXUA 1DSTA 4UFDH 1UK3A 1SQAA 3P92A 1D3QB 1C1PA 1H9IE 1C2HA 3IWMA 1GMDF 1EOJA 4TPIZ 1BTHH 1VITH 2GZ8A 1TNGA 2ZDAH 3UNQA 4CRBA 1P0SH 2R2WU 1FY5A 1O2UA 2FI3E 2ZHFH 1V2PT 1SGFG 1C5PA 2B0FA 1OWJA 1O2ZA 1U6QA 1UHBA 1A2CH 1A0JA 3LONA 1SGIB 4ABDA 3I78A 2BLOA 3EYDA 1EASA 3V12A 3PO1C 2RDLA 3NUMA 1NS3A 1QIXB 3A7YA 4RN6A 1UTQA 5JBBS 2Z9LA 4YLQH 2C8ZB 5DPAA 1SPJA 1K9OE 2EI8A 3U8RH 1RTFB 1K1MA 1C5TA 3GISB 1E37B 3LGYA 4AYYB 1Y5BT 2BOHB 2VU8E 5A8ZA 1N6XA 2ZA5A 3SU6A 2H9HA 1AUTC 1S84A 3NWUA 1Z8JB 5LH8A 2BM2A 1D6WA 1UVUH 2PKSC 3E0NB 4DIIH 3S69A 4CRDA 1GHAF 4Y71A 1NY22 1IQEA 3UQVA 1ZLRA 2AS9A 3RMLH 1C4Y2 1VJ9U 1DLEA 3ZV8A 4I8JA 2XCFA 2ODPA 1C5NH 2PKAB 1GDUA 2O8WA 2F9BH 1LVMA 2ZEBA 2GCTC 2OLGA 1VJAU 1IQJA 3DFJA 1BIOA 2UUYA 1A5GH 1WSSH 2GKVE 1AMHA 3PM3A 1BTUA 5DKMA 4ASHA 1MKXH 2Z9GA 1N8OB 1G30B 5L6NH 1YLDA 4ZKNU 3MNXA 1O3GA 3A81A 2BD7A 1QL7A 2FPZA 2F3CE 2BLWA 1MCTA 4NIVA 1GI3A 1QQUA 4AFQA 6CHAC 1HFDA 3KEEA 3BTTE 3RXVA 3TGKE 1MMJN 1P05A 2A4RA 5SGAE 4WH8A 4OS6A 3SOSA 4X2WA 2TBSA 1KSNA 2K1QA 3UWIA 1QURH 2A5AA 5ESBA 3UFAA 1V2KT 1AZ8A 4U2WA 1GMCG 1HYLA 2HNTC 2JH6D 2OP9A 1V2ST 2ZP0H 3SNAA 2BDBA 1OYQA 1GMDG 2IPHA 3MU8A 4IBLH 1Z1JA 1UTJA 2QGRA 1TBRH 1A3BH 2P3TB 3ZZ3A 2QXIA 1P06A 2ZDVH 2BD2A 1EPTC 2ZTYA 2RA3A 2R3YA 5JBCS 1HLTH 2WV5A 3AASA 2ZI2H 2STBE 5C1XA 3MU5A 1V2RT 3TJUA 2J92A 5EXMA 1ZYOA 4K1EA 1SLWB 2UUJB 1FY1A 4ZXXH 1A5IA 2TPIZ 1UVTH 4Q7XA 1GJCB 1AHTH 4AFZA 1YYY1 4JYTA 1F5RA 1G2MA 5DP3A 2D2DA 2XC0A 1O2YA 4I32A 2J34A 4NFFA 2J38A 1HUTH 1CA0C 1O0DH 4AN7A 4ZHAA 3ATKA 1GHAG 2Z9JA 2SNWA 2WPHS 1KTSB 1TGBA 3SV7A 5CMXH 5GIBA 2VVVA 2QAAA 5C67A 1TNJA 2XCNA 4FUGA 5ESTE 2FODA 3SU1A 1J15A 5B6OA 3T62A 2NU4E 1SGFA 5DJ7A 1EAIA 1HAHH 2BDCA 4J2YB 1YPKH 3SUEA 2Z3CA 2ZDLA 1MBMA 2BXUH 1ELVA 3UWJH 1G9IE 1GCTC 3KQBA 1RFNA 3QO6A 5L30H 1L4ZA 1SGPE 3ZVEA 2BD3A 1SHYA 1T4VH 2HPPH 2RG3A 3A7TA 1NT1A 1GWAA 1O2RA 1EJNA 2R0LA 3A84A 1C1RA 1DVAH 3RXBA 3BTQE 3RXEA 2TIOA 2Y5HA 1OSSA 1FQ3A 2AGEX 2ANYA 1DWDH 1GI9B 2BLVA 3KCGH 3SV8A 3TH4H 5C1UA 3EGKH 2Y5GA 1TRNA 1MTSA 1KXBA 1SGNE 3F9GA 2DE8A 3A82A 1C1SA 3EA9A 3VFEA 4I33A 3PLBA 1CQQA 3ATMA 1TQ0B 1O3DA 2R0KA 1ZR0A 2PTCE 1KLIH 1GDQA 1ZOMA 3DD2H 5EG4A 1QY6A 2OBOA 1GBIA 2QIQA 1Z8RA 1KY9A 2B7DH 4K3JA 3M5NA 1V2LT 1S85A 1T32A 2TGDA 3ZVDA 3GYMA 3SGBE 3ZZAA 1GHYH 2QV1A 3DUXH 4SGAE 5EPNA 1LHGH 1HAGE 1C5QA 1VGCB 3RMMH 1ZJDA 3SHAH 1GHBF 5CE1A 3T5FH 1AD8H 1AUJA 5A2MH 1NM6A 1CBWC 3RXLA 1OX1A 2H9TH 1EP6A 4ISIH 1IHTH 2ZTXA 1GBTA 1KLTA 4X1NU 1V2JT 2O8UA 4KTUA 2FOBA 4I8GA 5FBIA 1YM0A 1MBQA 2HOBA 5GJ4B 4JK5A 2LPRA 4DY7B 4ZH8A 3TU7H 1O5BB 2GMTC 1TGNA 1TPPA 5GXPA 3RU4E 2H1UA 4Z0KA 2A1DB 4ABAA 3RXRA 3U98H 2QF0A 4NIWA 3FZZA 4XBCA 5EQSA 2FOAA 5DO4H 4DT7B 1O3FA 1P9SA 4Q2KA 1W2KH 1BDAA 5LPFA 1BMAA 1EJAA 1HNEE 4UDWH 5TCAA 3TH2H 1NESE 2WINI 3RM2H 4WY3A 3F68H 4E7NA 4OGXA 3A83A 3KIDU 4MLFB 1AFEH 5L2ZH 1QR3E 1MU8B 3BSQA 4X6NA 1PQ7A 2FS8A 2ZFRH 4OS7A 2EI7A 5A8YA 1QL9A 1F0RA 4NFEA 1SI5H 1G3EA 1OWHA 2ZQ1A 2IOTA 1OWIA 1Q3XA 1W3CA 4D76A 3MOCA 4Y6DA 1V2TT 3SU2A 1MAYA 1O2WA 1F92A 1S6FA 2SGPE 2ZFTA 4AGKA 1SHHB 1MTUA 4IC6A 4R0IA 2PR3A 1P2QA 4NA7A 1JBUH 2ZFQH 3OY5U 1ELBA 1LHFH 1OWEA 1YPJH 2ZKSA 1XXFA 3VB5A 3O8RA 1Q31A 4NSYA 4J1YA 2YNBA 4ABJA 2PKSB 2BD4A 2WPIS 5FXLA 3HATH 1M9UA 3ELAH 3RU4D 1LPGB 1B5GH 5JDUB 3BTHE 1ID5H 3VB3A 3K9XB 5A0CA 3HKJB 4Y8ZA 1KIGH 2XBYA 1GJ4H 1NRNH 2PV9B 2FLRH 1SQTA 3BEIB 3QGNB 2JETC 4A1XA 4O03A 1FONA 4MPXA 4F4OC 1ESBA 2FOHA 2NU2E 3PWBA 1WCZA 5TCCA 1A3EH 1Y3VA 2BDIA 3BIVH 3KGPA 2AGIX 3Q77A 2F9NA 1FIWA 4JZIA 4YO9A 2SNVA 1GHBG 2G81E 1O30A 1GVLA 2ODQA 2ZU2A 3LC5A 5LPRA 2BQ7B 1T31A 1S6HA 1GG6C 1K28D 1K1IA 1K22H 2J2UA 5JYIA 3RXOA 1ZTKA 5IDKA 4B2CA 5AVDA 3A8CA 8LPRA 2BYAX 1QBVH 6CHAB 1TABE 3S9CA 2XWAA 1ANDA 5E0GA 1F0SA 1AO5A 2FTMA 1SOZA 1P04A 2ZGCA 3MNSA 1YC0A 1V3XA 2H5DA 1V2UT 1XXDA 4INKA 2PGBB 5HYOA 3RC6A 1W12U 1J14A 3KHVA 8KME2 1DT2A 1P2IA 1WTGH 2AMQA 2C8XB 1EB1H 1F7ZA 2G8TA 2OC0A 3RXGA 6GCHF 3S7HB 4BXWA 5FCRA 3A7XA 1RTKA 1ELGA
chains in the Genus database with same CATH superfamily
1BTXA 5HXFA 4NA9H 2Y7ZA 1GBMA 2GT7A 3ODDA 2WSSD 4X1PU 4FU9A 3SGAE 1O3OA 1V2NT 5K0HA 1KDQA 4JYVH 1C9PA 1Y3XA 1PQ5A 1QRWA 1UVOA 2FTLE 1O5EH 3KN2A 4YTAA 1WTHD 1MTNB 4B2BA 1EPTB 3TK9A 1TNKA 4MPUA 2JKHA 2OTVA 2OC7A 1GI5A 1PPFE 1H8DH 3M5LA 1IQHA 1ELFA 3BIUH 3BG4C 1D3TB 1E79D 3QX5H 2OK5A 1GJ5H 4RT1A 4ZROA 2Z3DA 1LMWB 3ZZ7A 2C90B 4ZHLU 4AZ2B 3PROA 4FUIA 1UW7A 4FOUC 1GBHA 5C0UA 3RXFA 1B0EA 2Q1JA 3VB7A 4XDEA 1TYNA 1IQLA 1BTZA 1C2JA 2GZ9A 1EQ9A 1AFQB 1PPBH 3P8NA 4B2AA 1CA0B 1F0UA 1FDPA 3W94A 1EXFA 2CF9H 3PRDA 1K2I1 3RP2A 1AIXH 2Y82A 1SBWA 4JYUH 3M7TA 4D8NA 2ZFPH 2KFWA 4H4FA 1BTYA 2DE9A 2V3OH 1TOCB 1P03A 1GCDA 1JMOH 2ZDKA 1XVMA 1SG8B 4BAHB 1OXGA 4D9RA 4GAWA 1SMFE 2D26C 3RC4A 2C93B 1O36A 1O3BA 1NFXA 3T26A 3UTUH 2GX4A 1GCTB 4NWKA 4AB9A 1G3BA 1GI7B 2C8WB 1HAVA 4JCNA 1TA2A 1GBDA 1BBRE 1FAXA 2WUBA 1XUJA 1W7XH 2CXVA 2ZHQH 2ZTZA 4H6TA 4X2VA 1SLXB 4X6PA 1O32A 4MG3A 4H42U 4PROA 5EW1H 2QN5T 4UONA 5FX5A 3SU5A 1QRZA 1ABJH 2HPQH 2VINA 3OX7U 3BF6H 2FEQH 2A32A 4X8TH 3VGCB 2G00A 1LVOA 1WU1A 2CJIA 3M37A 5ABWA 1EAWA 1T8NA 1NU9A 1QNJA 2YOLA 1YF4A 6GCHG 1LQDB 3R3GB 3TJVA 1UJ1A 1JRSA 4IC5A 4XOJA 3SNCA 1BBRK 1GJDB 1P3CA 3GY3A 1YP9A 3CP7A 5A09A 1NC6A 1EOLA 5L2YH 1ZJKA 4AFSA 1P3EA 2A7JA 1K21H 4DURA 1H9HE 4RKJB 3LOXA 1HB0B 3ZZ4A 1ZSKA 2J94A 2ZDNA 2AEIH 3LGIA 2ZG0H 1CT2E 2P95A 2KZ4A 2WYJA 9ESTA 3RXHA 2BD8A 2ZU4A 3PLPA 2YMSC 3RC5A 3RM0H 1TMBH 1DX5M 1O3NA 3TLOA 1KXDA 2F9OA 2P8OC 3GCNA 3MI4A 2BOKA 2ZCKP 1ESTA 4MNWA 1O2IA 1OHHD 5JBAS 4O3UA 2IJD1 3T25A 2VIDA 3HK3B 1UTOA 1O2LA 4O9VA 2R2MB 4ZKOU 3RXQA 3RXIA 3MH6A 5FHTA 2FI5E 1SSXA 2H9EH 2GMTB 1O5AB 2THFB 1GVZA 1SGQE 4WH6A 1TPSA 1A61H 2PKAA 1HV7A 2B9LA 2PUXB 1PQ8A 1HBTH 2FM2A 1O31A 2BX4A 1TOMH 3SU0A 5KGOA 1CGIE 1C1NA 3RXSA 4AG2A 3PTNA 5FPYA 1O2NA 4KGAA 1ELTA 3IG6B 4GCHG 1HDTH 3AVZA 3RLWH 2GZ7A 4INHA 1DICA 2LP6A 4NG9H 3ZVFA 1NO9H 3SUDA 4Y0YE 3DSOA 2OQUA 3STJA 1GVKB 2BVSH 3LJJA 1NBMD 1SL3A 2G4UA 1L4DA 1C5WB 1C5UA 4DW2U 1DLKB 4X6OA 3LGUA 1RIWC 2BZ6H 3OE7D 1GI1A 1OWKA 1NRQH 1WXRA 1QBOA 1S0QA 2B8OH 2WPKS 2XYAA 2AMDA 3BV9B 2HGTH 1ZMNA 3GYLB 4BAMB 3T28A 1ZGIA 4GVUA 5DP5A 3GCHC 1TMTH 3M7QA 5C5OA 3VG8A 1SKYE 1TONA 3Q76A 1GDNA 2EA3A 2OCVB 3BTME 3HKIB 2CMYA 3ZVAA 5F8TA 2BHGA 2QE7D 4YT7H 2A7HA 2NU0E 3TJNA 4TYDA 2ZDMA 1AQ7A 2C3SA 3BG8A 3BN9A 1TGSZ 2P94A 2AIPA 2Y7XA 3M7UA 1IQIA 1C5OH 2CHAC 2FI4E 1O33A 3VXFH 1NPMA 2SGFE 2BDHA 2ZHDA 3BEUA 1GBCA 4TY6A 1L1NA 1FY3A 4HTCH 5AFYH 1AE8H 3A8DA 1FN8A 1GJBB 4HFPB 2W26A 1EP5A 1DWEH 2VWNA 1V2VT 4IGDA 1IAUA 3EDXB 4QT8C 1K1NA 3FP6E 4ZXYH 3ZZ8A 2HNTF 1MKWK 2PLXA 4JK6A 1INCA 2L6OA 1AU8A 1LHEH 1GHWH 1HJ8A 1UTLM 2JH0D 5HM2A 1FLEE 3QLPH 1P01A 2V7QD 1QL8A 1O3KA 1TAWA 4MNXA 1DFPA 3A85A 1ELCA 4LXBH 3TK6A 2AGGX 1GBKA 1S82A 3OTJE 3ZVBA 1LHCH 2CV3A 1DUEA 3SBKA 2CF8H 1C2KA 3I77A 3ZZ9A 4A5TS 1GG6B 1P57B 3A89A 3E0PB 3QK1A 1VCQA 2FOGA 4I8HA 2Y5FA 2UWLA 2VH6A 3GDSA 4MPWA 3UIRA 3ZVCA 1LHDH 5CHBA 2Z9KA 5GWZA 2EI6A 5FBEA 3DFLA 5BPEA 3AW0A 1O5CB 1O35A 1CT4E 2HWLB 5FL7D 1PPHE 1O2TA 3TJOA 3I29A 4TWWA 4BXSA 1Y3WA 3D65E 2BY9X 2V3HH 1FV9A 2UWOA 1W10U 3BTGE 4YOGA 5G4BA 3PYHA 1KYNA 2HVXA 2BX3A 5DP6A 4CBOA 1IQGA 3PTBA 1Z8IB 5EOKA 3LH3A 1ORFA 1K0HA 4DIHH 4YM9A 3OYPA 4B75A 2O9QA 1C5SA 3SV9A 1DWCH 5GCHF 1DE7H 5IK2D 4CRAA 1HIAB 4IN2A 2A0QB 4Q7ZA 2GCHF 4K8BA 1O3PB 1BTWA 5AFZH 1T7CA 1XUFA 2UUFB 4ISNA 4BOHA 3GY8A 1OWDA 2FS9A 3RXJA 4OGYA 3ATLA 1O3HA 1XUIA 2QY0B 3BG4B 1O3CA 5PTPA 2FYQA 3L33A 2A7CA 2XBWA 3F9FA 4X1QU 1SLVB 3RMNH 1XMNB 2Y81A 5C3NA 2A4GA 1FY8E 4NGAH 5E8EH 3U8TH 1VCPA 3A88A 1EZXC 7ESTE 4DVAU 1HAXB 4FUBA 1SGTA 2JDID 2ZHWH 3BTEE 4RKOB 4XSKU 1GBJA 4VGCC 1OKXA 1PFXC 1BJVA 4BTTB 5F6MA 1GBEA 2XWBI 5AF9H 2AIQA 1LPKB 2PSXA 1MZAA 1NTPA 1T8MA 4A6LA 1FZZA 2A31A 1O2GH 2EQNA 5HM9A 2EC9H 4K2YA 4DGJA 1QJ1B 4LK4A 3AAVA 2G5NA 2W5EA 3NKKA 3SNEA 1PYTD 1W0ZU 5DP7A 3K2UA 1JRTA 3FAOA 2PFEA 1CHGA 2XC4A 4A92A 2A4OA 2PSYA 3LIWA 2ASUB 4ZHMU 2UUKB 4Q7YA 4DJZB 3E91A 1GPZA 3ZVGA 8ESTE 5JBTA 2BDAA 2D8WA 4XE4A 1YPEH 1AGJA 2GV6A 1W14U 1YPGH 1ZTLA 1BRCE 2HLDD 3ITIA 7LPRA 2ZGBH 1QB6A 4MTBA 3FVFB 1CT0E 4HZHA 2BB4A 1YGCH 2VWOA 4FUEA 1L1GA 4GHQA 2ILNA 1D3DB 2VGCC 3JZ2B 3EA8A 3MQKC 2QYIA 3NXPA 1FIZA 3FOAA 3MMGA 3SNBA 1C2GA 2FMJA 5GPIB 1MUEB 5C94A 3KYGA 3MH5A 3A7WA 1CO7E 2VIVA 2BDGA 3VB4A 1ZZZA 2HLCA 1T4UH 4Y8YA 5EJLA 1EUFA 1MABB 1A5HA 5T3HA 1COWD 2ZF0H 3JZ1B 3UUZA 1EATA 1SQOA 5GCHG 2HVYB 2J97A 4X1RU 1BJUA 2C8YB 2OD3B 4FUFA 1JWTA 1THSH 1D6RA 4NIXA 3V7TA 2GCHG 3R0FA 5EIYA 3FKSD 1W7GH 1LPZB 3D49H 3K65B 4Y79A 3LU9B 3DHKH 3GDVA 2G5VA 2FXRA 1D9IA 1GBAA 3PO1B 4BNRA 2A45B 5EQQA 2A5KA 2PGQB 1N8OC 1BRUP 2KCPA 5EGMA 2FO9A 2OXSA 1O2MA 3P17H 5I25A 1DOJA 3UR6A 1UTNA 1H1BA 2ZFFH 4IS5A 4TWYA 2DUCA 1P2KA 3E6PH 4R8TB 3U28C 2AMPA 3RU4T 1A0HB 1DSUA 2YMSB 1ARCA 1WAYB 2STAE 5AHGH 2P8OB 1OS8A 4WXVA 1MCVA 1FUJA 1BTPA 2AFQB 1QRXA 1X7AC 1A46H 1K1OA 4JMYA 3OFND 4FETA 2GT8A 1ANEA 2AH4X 3F0PA 4DOQA 2NU1E 3Q3KA 1O5DH 4A1TA 4IMZA 3ZZ5A 4A7IB 5H4IB 3LGWA 3F0OA 4ABIA 1MTVA 4BAKB 1LQEA 1O2QA 2BY7X 1UMAH 3QTVH 4IW4E 1GGDC 1ELEE 3ENSB 6ESTA 1TRMA 3SORA 3FN8A 3RXMA 2GCTB 3V3MA 3M3VA 1G32B 5CHAC 1BITA 1LTOA 1Y5UT 2FZZA 1H8IH 2GV7A 1HAPH 1DM4B 3LGVA 5FCKA 3M5MA 1YWUA 1GL0E 1TX6A 4K8YA 1ANCA 1SGDE 1OP8A 1VKYA 3OSYA 3NCLA 3TGIE 1FNIA 1TMUH 4X0WU 4HI3A 1PPZA 1SB1H 3FP8E 1XUHA 3E90B 2F9UA 1MQ6A 1Y59T 3LDXH 3P8GA 4WVPE 1PPEE 1GJAB 1NRSH 3P6ZB 3MYWA 2I6QA 3RXTA 1TWXB 4SGBE 1PPGE 3PV5A 1SR5C 2BQ6B 4MQAA 1RIWB 4UD9H 5C1YA 1G37A 1MAXA 4I8LA 1MD8A 3LPRA 4E06H 1O38A 1FY4A 2O8LA 3Q00A 2VWMA 4FUHA 3PMHB 3V13A 3RXCA 1BRBE 1RS0A 4NCYA 3WY8A 5DP9A 1WV7H 1O34A 5E0HA 3ESTA 3SHCH 3UR9A 5C2ZA 1J8AA 4A1VA 1E36B 2BD5A 3WWBA 2CHAB 1MQ5A 1NU7B 2ZNKH 1XM1A 1O3AA 2Z9IA 1GBLA 4ASUD 2RFKC 2OC8A 1IHSH 2F43B 1TB6H 5HMAA 3MU1A 4UFFH 1V2QT 2BY5X 1O3JA 3C27B 2J4IA 2GD4B 2V35A 2TGPZ 1GHVH 2EY4C 4NIYA 2PTNA 4KP0A 1EPTA 1O2HA 1C1WH 1H8HD 1C2MA 2HALA 3TIUA 3MO9A 1VR1H 5C17A 3A8BA 1G2LA 3E3TA 1SVPA 5EXNA 3Q3XA 1D3PB 2WPLS 4I7YH 2Z94A 4X2YA 4KTCA 3M61U 1GJ9B 1L1JA 1C1OA 2W7UA 1SOTA 1V2WT 3NPSA 4NSVA 2AYWA 4XBDA 1ZPCA 3SNDA 2XBXA 1AKSB 1DXWA 2ZZUH 1CU1A 2BZAA 1C1UH 2OBQA 3PV4A 2J98B 3LH1A 1O2KA 1V2MT 3O8DA 1YCPH 1P9UA 4K1SA 1HAYB 1MH0A 2BXTH 2F91A 3SUGA 1GBFA 4AX9H 1LO6A 1DY8A 1IOEA 1L2EA 2R9PA 5C20A 1ARBA 3SJIA 5DGJA 1WUNH 4ZMAH 1GL1A 3SV6A 1S6LA 1B0FA 4B71A 4K60A 1ZHPA 1OP2A 1VZQH 5DP8A 4CRGA 2QXJA 1F0TA 2EEKA 5HKKD 1E35B 3U1IB 3TH3H 1Z7KA 4HG6A 2ZU5A 5E2OA 1A1RA 2ZGHA 1LKAA 4UFGH 4WXIA 1RJXB 1UK2A 1HAIH 4CR5A 4Y10E 1TPOA 2QXHA 1W11U 3MO6A 1O5GH 3TNTA 4ABBA 1UCYH 3M5OA 3IITA 5FPSA 1BMNH 1O3EA 9LPRA 3B23B 1DANH 5F8ZA 2A2QH 5K7RA 3F2FA 1OYTH 2BLQA 2BTCE 3A7VA 1EX3A 1E1RD 3KNXA 2I6SA 3CNRA 1P2OA 4AFUA 1NFYA 1XVOA 2J9NA 2XNIA 3CS7A 3PMAB 4Y76A 1O2XA 5EW2H 1GHZA 2WPMS 1P2JA 3AAUA 1H4WA 1HAZB 1ZMJA 1TGTA 4FUDA 1TA6A 1TQ7B 2B5TB 2R3UA 1O5FH 3LT3A 5FX6A 4NZLA 2VH0A 4RT0A 7GCHF 3KQEA 4E7RG 4MDSA 4FU7A 2ZO3H 1CA8B 1Y3YA 1GHXH 1BRAA 2JH5D 1FI8A 1Y5AT 4VGCB 4DT4A 3S7KB 3ATIA 3UAIC 3OEHD 4IMQA 1BZXE 3UY9A 2PP6A 1EZSC 4FXGH 1GMCF 1C1MA 3F1SB 4I31A 3GCTF 4CRCA 3SV2H 1AVXA 3MU0A 4U32A 1HGTH 1NBME 1GI6A 2QC2A 3VPKA 1FPHH 1P8VC 1CGHA 1TE0A 4ABEA 4AYVB 3GCOA 1SGCA 1TX7A 3PRBA 5LGOA 3TNSA 2ZHEH 1J16A 1O37A 3DSPA 2F9VA 4ZKSU 1BHXF 1UHBB 1CBWB 2ODYB 1BBRH 1DITH 2TGAA 4D7FA 2GVFA 1O3LA 3M3TA 4YLUA 2ZCLP 1Z8GA 3MNCA 1YLCA 3KQDA 1GI8B 1BUIA 3OAAD 2UWPA 3WW7A 3URCA 5T6GA 3F2HA 4XD7D 1G3DA 2GJGA 3GY5A 5LPEA 1MTWA 1C4U2 2VGCB 3B9FH 4GLYA 5T6DA 2VIWA 3T2NA 3ZZCA 1ZRKA 3N7OA 3ODFA 1UK4A 1MU6B 1Z1IA 2M2AA 3STIA 1FN6A 1PQAA 4RSPA 1ABIH 1MKXK 2QA9E 2QXGA 3DT0H 2Z3EA 4AC9A 2AERH 3L6PA 4D9QA 2ZC9H 2V0BA 4YZUA 3OTPA 4BAOB 1YPLH 4NA8A 4CHAC 4GHTA 1ESAA 1CSOE 3SU4A 1THPB 2ZECA 3EE7A 5CDFE 3PMBB 1NN6A 4FUCA 4B1TA 2CGAA 1UO6A 1JIRA 4X1SU 5C0TA 1A4WH 2FOCA 2BVXH 5EXLA 2TGTA 2ZGJA 4THNH 3HK6B 1WOFA 1UVSH 1NRPH 3S9AA 1C5RA 3ZIAD 1EZUC 4Q80A 4NWLA 1J9CH 3CENA 5GDSH 3UNSA 4OM9A 1ZPBA 3TVJB 3U9AH 3S0NA 2NU3E 2FX4A 3P8FA 3RDZA 4YOJA 1PPCE 5T1VA 3KQ5A 3OU0A 2BD9A 1ETTH 3LJOA 1ZTJA 1HPGA 1SGRE 2JJ1D 2VIQA 2W6ID 1EZQA 1XUGA 1HJAC 7GCHG 1QCPA 2ZGXH 1FAKH 1EJMA 1G36A 4X8UH 2ZFSA 2F83A 4B76A 1QGFA 3W95A 2YNAA 2ZU1A 4JZEH 2C4FH 2P93A 4O97A 3GCTG 4FVDA 1FJSA 3WWFA 4JZDH 1GGDB 1RD3B 2JETB 3HGPA 2OUAA 3H7TA 1Y8TA 5CHAB 1H9LB 1RGQA 5E0JA 1Q2WA 1VCWA 1YPHE 4ISLA 2ZWLH 1NRRH 5F8XA 1MTNC 4OS2A 5J4QA 4D7GA 3SQHE 1CHOF 1GJ6A 3PMJA 4CRFA 1ETSH 2ZQ2A 1TFXA 1HJ9A 2GDEH 4KKDA 3F6UH 3EAJA 1K1JA 1C5VA 1AB9C 1MKWH 1UTMA 1TX8A 2P59A 3K6ZA 4Y7BA 1DY9A 4K1TA 4HGCA 5DG6A 4BAQB 1O2PA 1K1PA 1UTKA 1W0YH 3HPTB 1KXEA 4B73A 2ALVA 4WMEA 3C1KA 2XRCA 4Y7AA 1S83A 1F2SE 2GDDA 2KR7A 4LZ1H 1HRTH 4K5ZA 1AFQC 3SU3A 4ISHH 1ZPZA 4ESTE 1C5XB 1L0ZA 6LPRA 2OC1A 1C2IA 3RXKA 1PJPA 1NFUA 1SC8U 5JB9S 3P8OA 3QGJA 1C4V2 3H5CB 1ZGVA 1O2VA 2Z6BD 3SI3H 3M36A 3O8CA 2SFAA 2HRVA 4BTIB 5JB8S 3LKWA 2FWWA 2VIPA 5A8XA 1NFWA 2A5IA 2RCEA 1HIAA 5HGGA 1TIOA 2D1JA 2BDYA 3GY2A 1DDJA 3TPIZ 3RXPA 1YKTA 1QB1A 3BTDE 1AVGH 3SGQE 1QA7A 2J95A 1YPMH 3B8JA 2Y6TA 1Z71A 2WV9A 4CR9A 3P70B 3T29A 4F49A 1O2JA 3O8BA 4I8KA 4DG4A 5TJXA 4AB8A 1V6DA 2BY6X 4F48B 1P10A 2FOEA 4X2XA 3ATWA 1JXPA 3SJKA 4OS4A 5A0BA 1TLDA 1MD7A 1F5LA 5F53A 1WQVH 2KCOA 1XKAC 1CGJE 3GY6A 2VNTA 4YT6H 3KL6A 4E05H 4OS5A 5KECA 1IQKA 3EE0B 4FU8A 4O3TA 4Z6AH 4CH2B 1AN1E 1C1QA 3D23A 3VGCC 3SYJA 2PW8H 3MFJA 1ZSJA 1A0LA 1TGCA 2WZQA 4ABFA 3HGNA 3TITA 2SGDE 2Q6DA 3KYFA 1KXFA 3T27A 2ZIQH 5F03A 3ZYDA 3SN8A 1TNIA 1BCUH 1ZSLA 4TPYA 3LGTA 1GI4A 3VEQB 3MH7A 1E0FD 3GICB 2VWLA 2QF3A 1A7SA 2H5CA 1DXPA 4I86A 5T6FA 2P3UB 1YCPM 4XFQA 1S0RA 3UNRA 3DCLA 2ZPSA 2QCYA 3SO3A 1UVPA 1K1LA 1MZDA 4JZFH 1C5ZB 1CHOG 5E2PA 1GMHF 1AWHB 1IQNA 4X8VH 1LKBA 3GS9A 3GY4A 2P3FH 3D62A 3UOUA 2W3IA 2GTBA 2W3KA 1KXAA 1HCGA 2W7SA 2G4TA 3PLKA 1BA8B 3E1XB 1BOQA 1T8OA 1JOUB 2FESH 3BTKE 4INLA 3NZIA 1LDTT 3RUOA 2WUCA 1SGYE 1AE5A 3N99A 4CBNA 1AI8H 2ZU3A 1RTLA 1VITF 2TRMA 1O2SA 1SLUB 1SQRA 1DWBH 2WHXA 3GY7A 1ACBE 3RMOH 5ETXA 3F9HA 1T8LA 4YOIA 1XX9A 3QTOH 3A7ZA 1O2OA 2Q6GA 4B6FA 3NRLA 1GJ7B 2A2XH 1BT7A 2O8MA 2Y80A 2XXLA 4YESB 1QHRB 4ACBA 1BHXB 1V2OT 3FANA 3FFGA 2ULLA 1LVBA 1FPCH 4X6MA 2VVUA 4ZAEA 4CH8B 2IPQX 4FUJA 5IYTA 3ZZ6A 4AOQA 2YMSD 3OY6U 2XTTB 1TNHA 1GJ8B 3RLYH 3BTFE 1BMLA 1Z6EA 3A86A 3SQEE 3U8OH 4BTUB 1TPAE 4ZUHA 7KMEH 3QDZB 2HNTE 1KMHB 1ZHMA 3BTWE 1N6YA 5JPMH 5I46H 1RRKA 1TBQH 1W13U 2FP7B 1TNLA 5A0AE 3ZZBA 3UOPA 3A8AA 1BB0B 2ALPA 4WJG2 1DS2E 4AORA 3TK5A 2BVRH 2ANMH 1HAOH 2BMGB 2L74A 2FOFA 3UREA 1EAXA 4NZQA 3MNBA 1ZRBA 1ANBA 1P02A 1WYKA 3FP7E 1C2DA 1FXYA 1KTTB 3GDUA 1C5MD 2Q6FA 2SGEE 4B74A 1N1LA 4AGJA 3E8LA 2LNCA 3CS0A 5BRRE 2O8TA 1XKBC 3E16B 4Y0ZE 1O39A 4CHAB 2RA0A 1LVYA 2IJOB 2H2ZA 4KELA 5EQRA 3VXEH 3AK5A 1IQMA 1UTPA 1C2FA 3L3TA 4GPGA 2IN2A 2PWXA 2OINA 1E34B 3UQOA 1GMHG 3QWCH 1RXPA 1AY6H 1TRYA 4WF8A 3QZQA 4JZ1A 3KQCA 1IQFA 3Q3YA 2XNDD 5EODA 1QA0A 1OOKB 1C2EA 2G55A 3S9BA 1P2NA 1S5SA 2XW9A 3MO3A 8GCHF 3A87A 2M5TA 2ZCHP 3MHWU 3SZNA 2H6MA 3GCHB 4K69A 1ELAA 1QJ6B 4AG1A 2NWNA 3M3SA 1WBGB 4UE7H 2Z7FE 5DK1A 1SFIA 1VITG 1P11E 1HJAB 2SGAA 2VJ1A 1TALA 2ANWA 4ZKRU 3LC3A 1KXCA 2XBVA 3TGJE 3V0XA 5J4SA 1EAUA 1D4PB 1QB9A 4LOYH 2WYGA 3NK8A 1ZMLA 1C9TA 1AZZA 4GSOA 4WMFA 4GUXA 1ETRH 4MNVA 4OS1A 1WQSA 1LCYA 1P09A 3H7OA 5DP4A 5EU8A 1SFQB 2KAIB 3SUFA 4BANB 2KAIA 4WWYA 1QTFA 4MNYA 5EPYA 3SJ9A 1C1TA 3RXAA 2WPJS 2A4QA 3AW1A 3URDA 2XOKD 1JIMA 1QJ7B 1NROH 1GI0A 4Y8XA 1ZHRA 1KDQB 1W8BH 1YBWA 1C5LH 1HXEH 1OP0A 2PUQH 3F2GA 3UPEA 1UCYE 1YCPK 3U69H 1EB2A 1AKSA 1AVWA 1QBNA 1Z6JH 1GI2A 3SI4H 1EKBB 3N7DA 3PV2A 3MH4A 2J98A 3U1JB 1C5YB 1C2LA 2FYRA 3VB6A 4MVNA 2GGVB 4ABHA 1QFKH 4UEHH 1P2MA 3A80A 1AWFH 4H6SB 2FLBH 1AB9B 2LELA 1BMMH 3MTYA 3F9EA 2FX6A 1TBZH 4ISOA 4ABGA 1YPHC 3ZZDA 4X8SH 2VVCA 4TSFD 1B7XB 1P12E 3G01A 1OPHB 4M7GA 2ZPRA 2XC5A 2OQ5A 4FVBA 5FPTA 1SGEE 2F9PA 4DCDA 1BQYA 2RDEA 1NZQH 2FOMB 3KF2A 5FAHA 1HXFH 1CE5A 2VIOA 2BQWB 4CREA 1UCYK 2ANKH 2V6NA 2ZPQA 4XBBA 1Y3UA 4UFEH 3K6YA 1E38B 2CN0H 3PB1E 3SJOA 2VB0A 5C5NA 2WV4A 3M35A 3GOVB 3ZYEA 1XUKA 3RXDA 1KLJH 1H8ED 1VGCC 2G52A 3PWCA 4GCHF 3EA7A 1C1VH 3EQ0H 1PYTC 1DUAA 1WDIA 2FIRH 1G3CA 2QF4A 2PHBA 3BEFB 4LZ4B 3SW2B 3F3BA 3QUMP 2ESTE 8GCHG 1O3MA 3P95A 1HAVB 2G51A 1O3IA 1FMGA 4TY7A 3ZV9A 1CVWH 2GP9B 1J17T 2SGQE 2KM0A 2KX4A 3FZDA 3MWIU 3QN7A 4U30A 1ELDE 1THRH 2FDAA 4KTSA 4U01A 1GBBA 1F5KU 4WMDA 1QQ4A 3SJ8A 3QZRA 4MPVA 2K8IA 4Y11E 1DPOA 2BY8X 3MU4A 1S81A 3DA9B 2P16A 4IN1A 3RXUA 1DSTA 4UFDH 1UK3A 1SQAA 3P92A 1D3QB 1C1PA 1H9IE 1C2HA 3IWMA 1GMDF 1EOJA 4TPIZ 1BTHH 1VITH 2GZ8A 1TNGA 2ZDAH 3UNQA 4CRBA 1P0SH 2R2WU 1FY5A 1O2UA 2FI3E 2ZHFH 1V2PT 1SGFG 1C5PA 2B0FA 1OWJA 1O2ZA 1U6QA 1UHBA 1A2CH 1A0JA 3LONA 1E1QD 1SGIB 3I78A 4ABDA 2BLOA 3EYDA 1EASA 3V12A 3PO1C 2RDLA 3NUMA 1NS3A 1QIXB 3A7YA 4RN6A 1UTQA 5JBBS 2KCAA 2Z9LA 4YLQH 2C8ZB 5DPAA 2VBCA 1SPJA 1K9OE 2EI8A 3U8RH 1RTFB 1K1MA 1C5TA 3GISB 1E37B 3LGYA 4AYYB 1Y5BT 2BOHB 2VU8E 5A8ZA 1N6XA 2ZA5A 3SU6A 2H9HA 1AUTC 2J5UA 1S84A 3NWUA 1Z8JB 5LH8A 2BM2A 2QF5A 1D6WA 1UVUH 2PKSC 3E0NB 4DIIH 1FX0B 3S69A 4ACAA 4CRDA 1GHAF 4Y71A 1NY22 1IQEA 3UQVA 1ZLRA 2AS9A 3RMLH 1C4Y2 1VJ9U 1DLEA 3ZV8A 4I8JA 2XCFA 2ODPA 1C5NH 3N7EA 2PKAB 1GDUA 2O8WA 2F9BH 1LVMA 2ZEBA 2GCTC 2OLGA 1VJAU 1IQJA 3DFJA 1BIOA 2UUYA 1A5GH 1WSSH 2GKVE 1AMHA 3PM3A 1BTUA 5DKMA 4ASHA 1MKXH 2Z9GA 1N8OB 1QZ8A 1G30B 5L6NH 1YLDA 4ZKNU 3MNXA 1O3GA 3A81A 2BD7A 1QL7A 2FPZA 2F3CE 2JIZD 2BLWA 1MCTA 4NIVA 1GI3A 1QQUA 4AFQA 6CHAC 1HFDA 3KEEA 3BTTE 3RXVA 3TGKE 1MMJN 4YXWD 1P05A 2A4RA 5SGAE 4WH8A 4OS6A 3SOSA 4X2WA 2TBSA 1KSNA 2K1QA 3UWIA 5EJZA 1QURH 2A5AA 5ESBA 3UFAA 1V2KT 1AZ8A 4U2WA 1GMCG 1HYLA 2HNTC 2JH6D 3DSGA 2F4LA 2OP9A 1V2ST 2ZP0H 3SNAA 2BDBA 1OYQA 1GMDG 2IPHA 3MU8A 4IBLH 1Z1JA 3FO8D 1UTJA 2QGRA 1TBRH 1A3BH 2P3TB 3ZZ3A 2QXIA 1P06A 2ZDVH 2BD2A 3H09A 5B6LA 1EPTC 2ZTYA 1BMFD 2RA3A 2R3YA 5JBCS 1HLTH 2WV5A 3AASA 2ZI2H 2STBE 5C1XA 3MU5A 1V2RT 3TJUA 2J92A 5HIZA 5EXMA 1ZYOA 4K1EA 1SLWB 2UUJB 1FY1A 4ZXXH 1A5IA 2W6JD 2TPIZ 1UVTH 4Q7XA 1GJCB 1AHTH 4AFZA 1YYY1 4JYTA 1F5RA 1G2MA 5DP3A 2D2DA 2XC0A 1O2YA 4I32A 2J34A 4NFFA 2J38A 1HUTH 1CA0C 1O0DH 4AN7A 4ZHAA 3ATKA 5EJ1A 1GHAG 2Z9JA 2SNWA 2WPHS 1KTSB 1TGBA 3SV7A 5CMXH 5GIBA 2VVVA 2QAAA 5C67A 1TNJA 2XCNA 4FUGA 5ESTE 2FODA 5DN6D 3SU1A 1J15A 5B6OA 3T62A 2NU4E 1SGFA 1W0JD 5DJ7A 1EAIA 1HAHH 2BDCA 3W1EA 4J2YB 1YPKH 3SUEA 2Z3CA 2ZDLA 1MBMA 2BXUH 1ELVA 3UWJH 1G9IE 1GCTC 3KQBA 1RFNA 3QO6A 5L30H 1L4ZA 1SGPE 3ZVEA 2BD3A 1SHYA 1T4VH 2HPPH 2V3MA 1YLNA 2RG3A 3A7TA 4B6EA 1NT1A 1GWAA 1O2RA 1EJNA 2R0LA 3A84A 1C1RA 1DVAH 3RXBA 3BTQE 4M9FA 3RXEA 2TIOA 2Y5HA 1OSSA 2KCYA 1FQ3A 2AGEX 2WPDD 2ANYA 1DWDH 1GI9B 2BLVA 3KCGH 3SV8A 3TH4H 5C1UA 3EGKH 2Y5GA 1TRNA 1MTSA 1KXBA 1SGNE 3F9GA 2DE8A 3A82A 1C1SA 3EA9A 3VFEA 4I33A 3PLBA 1CQQA 3ATMA 1TQ0B 1O3DA 2R0KA 1ZR0A 2PTCE 1KLIH 1GDQA 1ZOMA 3DD2H 5EG4A 1QY6A 2OBOA 1GBIA 2QIQA 1Z8RA 1KY9A 2B7DH 4K3JA 5KEDA 3M5NA 3SZEA 1V2LT 1S85A 1T32A 2TGDA 3ZVDA 3GYMA 3SGBE 3ZZAA 1GHYH 2QV1A 3DUXH 4SGAE 5EPNA 1LHGH 1HAGE 3UB0A 1C5QA 1VGCB 3RMMH 1ZJDA 3SHAH 1GHBF 5GNDA 5CE1A 3T5FH 1AD8H 1AUJA 5A2MH 1NM6A 4TT3D 1CBWC 3RXLA 1OX1A 2H9TH 1EP6A 4ISIH 1IHTH 2ZTXA 1GBTA 1KLTA 4X1NU 1V2JT 3OEED 2O8UA 4KTUA 2FOBA 4I8GA 5FBIA 1YM0A 4Q63A 1MBQA 2HOBA 4ZCNA 4Q4LA 5GJ4B 4JK5A 2LPRA 4DY7B 4ZH8A 3TU7H 1O5BB 2GMTC 1TGNA 1TPPA 5GXPA 3RU4E 2H1UA 1YY3A 4Z0KA 2A1DB 4ABAA 3RXRA 3U98H 2QF0A 4NIWA 3FZZA 4XBCA 5EQSA 2FOAA 5DO4H 4DT7B 1O3FA 1EFRD 1P9SA 1W2KH 4Q2KA 2CK3D 1BDAA 4F55A 5LPFA 1BMAA 1EJAA 1HNEE 4UDWH 2K0QA 5TCAA 3TH2H 1NESE 2WINI 3RM2H 4WY3A 3F68H 4E7NA 4OGXA 3A83A 3KIDU 4MLFB 1AFEH 5L2ZH 1QR3E 1MU8B 3BSQA 4X6NA 1PQ7A 2FS8A 2ZFRH 4OS7A 2EI7A 5A8YA 1QL9A 1F0RA 4NFEA 1W0KD 1SI5H 1G3EA 1OWHA 2ZQ1A 2IOTA 1OWIA 1Q3XA 1W3CA 4D76A 3MOCA 4Y6DA 1V2TT 3SU2A 4Z1MD 1MAYA 1O2WA 1F92A 1S6FA 2SGPE 2ZFTA 4AGKA 1SHHB 1MTUA 4IC6A 4R0IA 2PR3A 1P2QA 4NA7A 1JBUH 2ZFQH 3OY5U 1ELBA 1LHFH 1OWEA 1YPJH 2ZKSA 1XXFA 3VB5A 3O8RA 1Q31A 4NSYA 4J1YA 2YNBA 4ABJA 2PKSB 2BD4A 2WPIS 5FXLA 3HATH 1M9UA 3ELAH 3RU4D 1LPGB 1B5GH 5JDUB 5HIYA 3BTHE 1ID5H 3VB3A 4P02A 3K9XB 5A0CA 3HKJB 4Y8ZA 1KIGH 2XBYA 1GJ4H 4XRNA 1NRNH 2PV9B 2FLRH 1SQTA 3BEIB 3QGNB 2JETC 4P00A 4O03A 4A1XA 1FONA 4MPXA 4F4OC 1ESBA 2FOHA 2NU2E 3PWBA 1WCZA 5TCCA 1A3EH 1Y3VA 2BDIA 3BIVH 3KGPA 2AGIX 3Q77A 2F9NA 1FIWA 4JZIA 4YO9A 2SNVA 1GHBG 2G81E 1O30A 1GVLA 2ODQA 2ZU2A 3LC5A 5LPRA 2BQ7B 1T31A 1S6HA 1GG6C 1K28D 1K1IA 4RI0A 1K22H 2J2UA 5JYIA 3RXOA 1ZTKA 5IDKA 4B2CA 5AVDA 3A8CA 8LPRA 2BYAX 1QBVH 6CHAB 1TABE 3S9CA 2XWAA 1ANDA 5E0GA 1F0SA 1AO5A 2FTMA 1SOZA 1P04A 2ZGCA 3MNSA 1YC0A 1V3XA 2H5DA 1V2UT 1XXDA 4INKA 2PGBB 5HYOA 3RC6A 1W12U 1J14A 3KHVA 8KME2 1DT2A 5DSFA 1P2IA 2JJ2D 1WTGH 2AHME 2AMQA 2C8XB 1EB1H 1F7ZA 2G8TA 2OC0A 3RXGA 6GCHF 3S7HB 4BXWA 5FCRA 3A7XA 1RTKA 1ELGA
chains in the Genus database with same CATH topology
1BTXA 5HXFA 4NA9H 2Y7ZA 1GBMA 2GT7A 3ODDA 4X1PU 4FU9A 3SGAE 1O3OA 1V2NT 5K0HA 1KDQA 4JYVH 1C9PA 1Y3XA 1PQ5A 1QRWA 1UVOA 2FTLE 1O5EH 3KN2A 4YTAA 1WTHD 1MTNB 4B2BA 1EPTB 3TK9A 1TNKA 4MPUA 2JKHA 2OTVA 2OC7A 1GI5A 1PPFE 1H8DH 3M5LA 1IQHA 1ELFA 3BIUH 3BG4C 1D3TB 3QX5H 1GJ5H 4ZROA 2Z3DA 1LMWB 3ZZ7A 2C90B 4ZHLU 4AZ2B 3PROA 4FUIA 1GBHA 3RXFA 1B0EA 2Q1JA 3VB7A 4XDEA 1TYNA 1IQLA 1BTZA 1C2JA 2GZ9A 1EQ9A 1AFQB 1PPBH 3P8NA 4B2AA 1CA0B 1F0UA 1FDPA 3W94A 1EXFA 2CF9H 1K2I1 3RP2A 1AIXH 2Y82A 1SBWA 4JYUH 3M7TA 4D8NA 2ZFPH 4H4FA 1BTYA 2DE9A 2V3OH 1TOCB 1P03A 1GCDA 1JMOH 2ZDKA 1XVMA 1SG8B 4BAHB 1OXGA 4D9RA 4GAWA 1SMFE 2D26C 3RC4A 2C93B 1O36A 1O3BA 1NFXA 3T26A 3UTUH 2GX4A 1GCTB 4NWKA 4AB9A 1G3BA 1GI7B 2C8WB 1HAVA 4JCNA 1TA2A 1GBDA 1BBRE 1FAXA 2WUBA 1XUJA 1W7XH 2CXVA 2ZHQH 2ZTZA 4H6TA 4X2VA 1SLXB 4X6PA 1O32A 4MG3A 4H42U 4PROA 5EW1H 2QN5T 4UONA 5FX5A 3SU5A 1QRZA 1ABJH 2HPQH 2VINA 3OX7U 3BF6H 2FEQH 2A32A 4X8TH 3VGCB 2G00A 1LVOA 1WU1A 2CJIA 3M37A 5ABWA 1EAWA 1T8NA 1NU9A 1QNJA 2YOLA 1YF4A 6GCHG 1LQDB 3R3GB 3TJVA 1UJ1A 1JRSA 4IC5A 4XOJA 3SNCA 1BBRK 1GJDB 1P3CA 3GY3A 1YP9A 3CP7A 5A09A 1NC6A 1EOLA 5L2YH 1ZJKA 4AFSA 1P3EA 2A7JA 1K21H 4DURA 1H9HE 4RKJB 3LOXA 1HB0B 3ZZ4A 1ZSKA 2J94A 2ZDNA 2AEIH 3LGIA 2ZG0H 1CT2E 2P95A 2WYJA 9ESTA 3RXHA 2BD8A 2ZU4A 3PLPA 3RC5A 3RM0H 1TMBH 1DX5M 1O3NA 3TLOA 1KXDA 2F9OA 2P8OC 3GCNA 3MI4A 2BOKA 2ZCKP 1ESTA 4MNWA 1O2IA 5JBAS 4O3UA 3T25A 2VIDA 3HK3B 1UTOA 1O2LA 4O9VA 2R2MB 4ZKOU 3RXQA 3RXIA 3MH6A 5FHTA 2FI5E 1SSXA 2H9EH 2GMTB 1O5AB 2THFB 1GVZA 1SGQE 4WH6A 1TPSA 1A61H 2PKAA 1HV7A 2B9LA 2PUXB 1PQ8A 1HBTH 2FM2A 1O31A 2BX4A 1TOMH 3SU0A 1CGIE 1C1NA 3RXSA 4AG2A 3PTNA 5FPYA 1O2NA 4KGAA 1ELTA 3IG6B 4GCHG 1HDTH 3AVZA 3RLWH 2GZ7A 4INHA 1DICA 4NG9H 3ZVFA 1NO9H 3SUDA 4Y0YE 2OQUA 3STJA 1GVKB 2BVSH 3LJJA 1SL3A 2G4UA 1L4DA 1C5WB 1C5UA 4DW2U 1DLKB 4X6OA 3LGUA 1RIWC 2BZ6H 1GI1A 1OWKA 1NRQH 1QBOA 1S0QA 2B8OH 2WPKS 2XYAA 2AMDA 3BV9B 2HGTH 1ZMNA 3GYLB 4BAMB 3T28A 1ZGIA 4GVUA 5DP5A 3GCHC 1TMTH 3M7QA 5C5OA 1TONA 3Q76A 1GDNA 2EA3A 2OCVB 3BTME 3HKIB 2CMYA 3ZVAA 5F8TA 2BHGA 4YT7H 2A7HA 2NU0E 3TJNA 4TYDA 2ZDMA 1AQ7A 2C3SA 3BG8A 3BN9A 1TGSZ 2P94A 2AIPA 2Y7XA 3M7UA 1IQIA 1C5OH 2CHAC 2FI4E 1O33A 3VXFH 1NPMA 2SGFE 2BDHA 2ZHDA 3BEUA 1GBCA 4TY6A 1L1NA 1FY3A 4HTCH 5AFYH 1AE8H 3A8DA 1FN8A 1GJBB 4HFPB 2W26A 1EP5A 1DWEH 2VWNA 1V2VT 4IGDA 1IAUA 3EDXB 4QT8C 1K1NA 3FP6E 4ZXYH 3ZZ8A 2HNTF 1MKWK 2PLXA 4JK6A 1INCA 1AU8A 1LHEH 1GHWH 1HJ8A 1UTLM 2JH0D 5HM2A 1FLEE 3QLPH 1P01A 1QL8A 1O3KA 1TAWA 4MNXA 1DFPA 3A85A 1ELCA 4LXBH 3TK6A 2AGGX 1GBKA 1S82A 3OTJE 3ZVBA 1LHCH 2CV3A 1DUEA 3SBKA 2CF8H 1C2KA 3I77A 3ZZ9A 4A5TS 1GG6B 1P57B 3A89A 3E0PB 3QK1A 1VCQA 2FOGA 4I8HA 2Y5FA 2UWLA 2VH6A 3GDSA 4MPWA 3UIRA 3ZVCA 1LHDH 2Z9KA 5GWZA 2EI6A 5FBEA 3DFLA 5BPEA 3AW0A 1O5CB 1O35A 1CT4E 2HWLB 1PPHE 1O2TA 3TJOA 3I29A 4TWWA 4BXSA 1Y3WA 3D65E 2BY9X 2V3HH 1FV9A 2UWOA 1W10U 3BTGE 4YOGA 5G4BA 3PYHA 1KYNA 2HVXA 2BX3A 5DP6A 4CBOA 1IQGA 3PTBA 1Z8IB 5EOKA 3LH3A 1ORFA 4DIHH 4YM9A 3OYPA 4B75A 2O9QA 1C5SA 3SV9A 1DWCH 5GCHF 1DE7H 4CRAA 1HIAB 4IN2A 2A0QB 4Q7ZA 2GCHF 4K8BA 1O3PB 1BTWA 5AFZH 1T7CA 1XUFA 2UUFB 4ISNA 4BOHA 3GY8A 1OWDA 2FS9A 3RXJA 4OGYA 3ATLA 1O3HA 1XUIA 2QY0B 3BG4B 1O3CA 5PTPA 2FYQA 3L33A 2A7CA 2XBWA 3F9FA 4X1QU 1SLVB 3RMNH 1XMNB 2Y81A 5C3NA 2A4GA 1FY8E 4NGAH 5E8EH 3U8TH 1VCPA 3A88A 1EZXC 7ESTE 4DVAU 1HAXB 4FUBA 1SGTA 2ZHWH 3BTEE 4RKOB 4XSKU 1GBJA 4VGCC 1OKXA 1PFXC 1BJVA 4BTTB 5F6MA 1GBEA 2XWBI 5AF9H 2AIQA 1LPKB 2PSXA 1MZAA 1NTPA 1T8MA 4A6LA 1FZZA 2A31A 1O2GH 5HM9A 2EC9H 4K2YA 4DGJA 1QJ1B 4LK4A 3AAVA 2G5NA 2W5EA 3NKKA 3SNEA 1PYTD 1W0ZU 5DP7A 3K2UA 1JRTA 3FAOA 2PFEA 1CHGA 2XC4A 4A92A 2A4OA 2PSYA 3LIWA 2ASUB 4ZHMU 2UUKB 4Q7YA 4DJZB 3E91A 1GPZA 3ZVGA 8ESTE 5JBTA 2BDAA 2D8WA 4XE4A 1YPEH 1AGJA 2GV6A 1W14U 1YPGH 1ZTLA 1BRCE 3ITIA 7LPRA 2ZGBH 1QB6A 4MTBA 3FVFB 1CT0E 4HZHA 2BB4A 1YGCH 2VWOA 4FUEA 1L1GA 4GHQA 2ILNA 1D3DB 2VGCC 3JZ2B 3EA8A 2QYIA 3NXPA 1FIZA 3MMGA 3SNBA 1C2GA 2FMJA 5GPIB 1MUEB 3MH5A 3A7WA 1CO7E 2VIVA 2BDGA 3VB4A 1ZZZA 2HLCA 1T4UH 4Y8YA 1EUFA 1A5HA 5T3HA 2ZF0H 3JZ1B 3UUZA 1EATA 1SQOA 5GCHG 4X1RU 1BJUA 2C8YB 2OD3B 4FUFA 1JWTA 1THSH 1D6RA 4NIXA 3V7TA 2GCHG 3R0FA 1W7GH 1LPZB 3D49H 3K65B 4Y79A 3LU9B 3DHKH 3GDVA 2G5VA 2FXRA 1D9IA 1GBAA 3PO1B 4BNRA 2A45B 5EQQA 2A5KA 2PGQB 1N8OC 1BRUP 5EGMA 2FO9A 2OXSA 1O2MA 3P17H 5I25A 1DOJA 3UR6A 1UTNA 1H1BA 2ZFFH 4IS5A 4TWYA 2DUCA 1P2KA 3E6PH 4R8TB 2AMPA 3RU4T 1A0HB 1DSUA 1ARCA 1WAYB 2STAE 5AHGH 2P8OB 1OS8A 4WXVA 1MCVA 1FUJA 1BTPA 2AFQB 1QRXA 1X7AC 1A46H 1K1OA 4JMYA 2GT8A 1ANEA 2AH4X 4DOQA 2NU1E 3Q3KA 1O5DH 4A1TA 4IMZA 3ZZ5A 4A7IB 5H4IB 3LGWA 4ABIA 1MTVA 4BAKB 1LQEA 1O2QA 2BY7X 1UMAH 3QTVH 4IW4E 1GGDC 1ELEE 3ENSB 6ESTA 1TRMA 3SORA 3RXMA 2GCTB 3V3MA 3M3VA 1G32B 5CHAC 1BITA 1LTOA 1Y5UT 2FZZA 1H8IH 2GV7A 1HAPH 1DM4B 3LGVA 5FCKA 3M5MA 1GL0E 1TX6A 4K8YA 1ANCA 1SGDE 1OP8A 3OSYA 3NCLA 3TGIE 1FNIA 1TMUH 4X0WU 4HI3A 1PPZA 1SB1H 3FP8E 1XUHA 3E90B 2F9UA 1MQ6A 1Y59T 3LDXH 3P8GA 4WVPE 1PPEE 1GJAB 1NRSH 3P6ZB 3MYWA 2I6QA 3RXTA 1TWXB 4SGBE 1PPGE 1SR5C 2BQ6B 4MQAA 1RIWB 4UD9H 5C1YA 1G37A 1MAXA 4I8LA 1MD8A 3LPRA 4E06H 1O38A 1FY4A 2O8LA 3Q00A 2VWMA 4FUHA 3PMHB 3V13A 3RXCA 1BRBE 1RS0A 4NCYA 3WY8A 5DP9A 1WV7H 1O34A 5E0HA 3ESTA 3SHCH 3UR9A 5C2ZA 1J8AA 4A1VA 1E36B 2BD5A 2CHAB 1MQ5A 1NU7B 2ZNKH 1XM1A 1O3AA 2Z9IA 1GBLA 2OC8A 1IHSH 1TB6H 5HMAA 3MU1A 4UFFH 1V2QT 2BY5X 1O3JA 3C27B 2J4IA 2GD4B 2V35A 2TGPZ 1GHVH 4NIYA 2PTNA 4KP0A 1EPTA 1O2HA 1C1WH 1C2MA 2HALA 3TIUA 3MO9A 1VR1H 3A8BA 1G2LA 3E3TA 1SVPA 5EXNA 3Q3XA 1D3PB 2WPLS 4I7YH 2Z94A 4X2YA 4KTCA 3M61U 1GJ9B 1L1JA 1C1OA 2W7UA 1SOTA 1V2WT 3NPSA 4NSVA 2AYWA 4XBDA 1ZPCA 3SNDA 2XBXA 1AKSB 1DXWA 2ZZUH 1CU1A 2BZAA 1C1UH 2OBQA 3PV4A 3LH1A 1O2KA 1V2MT 3O8DA 1YCPH 1P9UA 4K1SA 1HAYB 1MH0A 2BXTH 2F91A 3SUGA 1GBFA 4AX9H 1LO6A 1DY8A 1IOEA 1L2EA 2R9PA 5C20A 1ARBA 3SJIA 5DGJA 1WUNH 4ZMAH 1GL1A 3SV6A 1B0FA 4B71A 4K60A 1ZHPA 1OP2A 1VZQH 5DP8A 4CRGA 2QXJA 1F0TA 2EEKA 1E35B 3U1IB 3TH3H 1Z7KA 2ZU5A 5E2OA 1A1RA 2ZGHA 1LKAA 4UFGH 4WXIA 1RJXB 1UK2A 1HAIH 4CR5A 4Y10E 1TPOA 2QXHA 1W11U 3MO6A 1O5GH 3TNTA 4ABBA 1UCYH 3M5OA 3IITA 5FPSA 1BMNH 1O3EA 9LPRA 3B23B 1DANH 5F8ZA 2A2QH 5K7RA 1OYTH 2BLQA 2BTCE 3A7VA 1EX3A 3KNXA 2I6SA 1P2OA 4AFUA 1NFYA 1XVOA 2J9NA 2XNIA 3CS7A 3PMAB 4Y76A 1O2XA 5EW2H 1GHZA 2WPMS 1P2JA 3AAUA 1H4WA 1HAZB 1ZMJA 1TGTA 4FUDA 1TA6A 1TQ7B 2B5TB 2R3UA 1O5FH 3LT3A 5FX6A 4NZLA 2VH0A 7GCHF 3KQEA 4E7RG 4MDSA 4FU7A 2ZO3H 1CA8B 1Y3YA 1GHXH 1BRAA 2JH5D 1FI8A 1Y5AT 4VGCB 3S7KB 3ATIA 4IMQA 1BZXE 3UY9A 1EZSC 4FXGH 1GMCF 1C1MA 3F1SB 4I31A 3GCTF 4CRCA 3SV2H 1AVXA 3MU0A 4U32A 1HGTH 1GI6A 2QC2A 3VPKA 1FPHH 1P8VC 1CGHA 1TE0A 4ABEA 4AYVB 3GCOA 1SGCA 1TX7A 5LGOA 3TNSA 2ZHEH 1J16A 1O37A 2F9VA 4ZKSU 1BHXF 1UHBB 1CBWB 2ODYB 1BBRH 1DITH 2TGAA 4D7FA 2GVFA 1O3LA 3M3TA 4YLUA 2ZCLP 1Z8GA 3MNCA 1YLCA 3KQDA 1GI8B 1BUIA 2UWPA 3URCA 5T6GA 1G3DA 3GY5A 5LPEA 1MTWA 1C4U2 2VGCB 3B9FH 4GLYA 5T6DA 2VIWA 3T2NA 3ZZCA 1ZRKA 3N7OA 3ODFA 1UK4A 1MU6B 1Z1IA 3STIA 1FN6A 1PQAA 4RSPA 1ABIH 1MKXK 2QA9E 2QXGA 3DT0H 2Z3EA 4D9QA 2AERH 3L6PA 2ZC9H 2V0BA 4YZUA 4BAOB 1YPLH 4NA8A 4CHAC 4GHTA 1ESAA 1CSOE 3SU4A 1THPB 2ZECA 3PMBB 1NN6A 4FUCA 4B1TA 2CGAA 1UO6A 1JIRA 4X1SU 1A4WH 2FOCA 2BVXH 5EXLA 2TGTA 2ZGJA 4THNH 3HK6B 1WOFA 1UVSH 1NRPH 3S9AA 1C5RA 1EZUC 4Q80A 4NWLA 1J9CH 3CENA 5GDSH 3UNSA 1ZPBA 3TVJB 3U9AH 3S0NA 2NU3E 2FX4A 3P8FA 3RDZA 4YOJA 1PPCE 3OU0A 2BD9A 1ETTH 3LJOA 1ZTJA 1HPGA 1SGRE 2VIQA 1EZQA 1XUGA 1HJAC 7GCHG 1QCPA 2ZGXH 1FAKH 1EJMA 1G36A 4X8UH 2ZFSA 2F83A 4B76A 1QGFA 3W95A 2YNAA 2ZU1A 4JZEH 2C4FH 2P93A 4O97A 3GCTG 4FVDA 1FJSA 4JZDH 1GGDB 1RD3B 2JETB 3HGPA 2OUAA 3H7TA 1Y8TA 5CHAB 1H9LB 1RGQA 5E0JA 1Q2WA 1VCWA 1YPHE 4ISLA 2ZWLH 1NRRH 5F8XA 1MTNC 4OS2A 5J4QA 4D7GA 3SQHE 1CHOF 1GJ6A 3PMJA 4CRFA 1ETSH 2ZQ2A 1TFXA 1HJ9A 2GDEH 4KKDA 3F6UH 3EAJA 1K1JA 1C5VA 1AB9C 1MKWH 1UTMA 1TX8A 2P59A 3K6ZA 4Y7BA 1DY9A 4K1TA 4HGCA 5DG6A 4BAQB 1O2PA 1K1PA 1UTKA 1W0YH 3HPTB