1HPGA

A glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
187
structure length
187
Chain Sequence
VLGGGAIYGGGSRCSAAFNVTKGGARYFVTAGHCTNISANWSASSGGSVVGVREGTSFPTNDYGIVRYTDGSSPAGTVDLYNGSTQDISSAANAVVGQAIKKSGSTTKVTSGTVTAVNVTVNYGDGPVYNMVRTTACSAGGDSGGAHFAGSVALGIHSGSSGCSGTAGSAIHQPVTEALSAYGVTVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamic acid specific protease
total genus 52
structure length 187
sequence length 187
ec nomenclature ec 3.4.21.82: Glutamyl endopeptidase II.
pdb deposition date 1993-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hpgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hpgA01
4DGJA 2BD9A 1K1PA 2FWWA 3BIUH 3OY6U 4K1TA 2ZECA 1LPKB 3TIUA 3NKKA 3ZYDA 1ZPCA 1GI3A 5AFYH 2C8WB 1UVUH 4AFUA 3K65B 2V35A 1VZQH 3TJVA 3PTNA 1O35A 3SUDA 3FFGA 1GBFA 1HJ8A 2ZGBH 4DG4A 1SGFG 4GHQA 1DSUA 5EW1H 2A1DB 2QC2A 4R8TB 4UONA 2YOLA 2G4TA 2OBOA 8KME2 1QRXA 4BTUB 1DVAH 2CGAA 5TCAA 4NIVA 1PQ8A 3EA8A 2TGAA 2PTNA 5IYTA 2P59A 3KN2A 1UTPA 2ULLA 1PQ7A 1SL3A 3M5OA 1OP2A 2ZFFH 3EA9A 2FLRH 1D6WA 3C1KA 3T29A 3VB6A 2OUAA 5FX5A 3HK3B 2BOKA 1ORFA 1P9SA 3Q77A 5JB8S 4X6MA 5F8XA 8LPRA 2IJOB 4CHAC 3RU4E 3VB5A 1ZMLA 2RA3A 1C5UA 1IQFA 4DT7B 1D3PB 3UY9A 8GCHF 4DW2U 1N6YA 2ZFQH 2CJIA 1OWHA 1BRBE 2ALPA 1A0LA 3MH5A 5GJ4B 1CQQA 2UWOA 2ZCKP 3SNBA 1FY4A 1IQIA 4FUIA 2FIRH 4CRCA 2G55A 1UTNA 1HRTH 4GPGA 1ZJDA 2IOTA 5LPEA 4OS4A 3VB3A 5F8TA 1F5RA 1ZOMA 4RKOB 3RXQA 3S7KB 1Y3UA 1MAXA 1J16A 3K6ZA 3MTYA 2B5TB 4H42U 4X8UH 3GCNA 3U98H 3GCTG 9ESTA 1ABIH 2ILNA 4UE7H 2DE8A 5A8YA 3VGCB 3BTTE 3ZZBA 3OY5U 1FXYA 1O2TA 1AN1E 1KDQA 1O2JA 1SGRE 1QY6A 1Y3VA 1GI5A 2C8YB 1JIRA 1N1LA 2KAIB 1H8IH 3M37A 1ZHRA 2Y7ZA 4D9QA 1Z71A 1BTHH 4Y11E 5C1XA 3KHVA 1GBTA 3PB1E 1B7XB 3STJA 1K1MA 1TQ7B 2PUXB 1C5MD 1W12U 4YT6H 4YOGA 4B74A 3G01A 3UWJH 1TA6A 5GDSH 3RXHA 1O2KA 5GCHG 3ZVAA 2ZTZA 3SGQE 5T6GA 1L2EA 2V0BA 1TMUH 4FUCA 5FX6A 2ZDMA 1ELGA 3LDXH 2Z9JA 2QXGA 4BAHB 5FAHA 4D8NA 1V2UT 4RKJB 5JDUB 1NFYA 4IC5A 2D2DA 5GIBA 4IN2A 2G8TA 5ESBA 3ZVDA 2XXLA 4LOYH 1O3KA 1IQLA 2P16A 1YPEH 4MG3A 3PTBA 1P3EA 2ZFSA 1N8OB 3MFJA 1QTFA 2BZ6H 2PKAA 1O3LA 3MI4A 1G32B 1O2XA 3OX7U 3RM0H 1Q31A 3P8OA 1YF4A 1C5RA 1EPTC 4IS5A 1EB1H 3MO9A 4X1QU 3RXFA 1Z8GA 1EAXA 1ZZZA 3SO3A 4MTBA 3BEUA 1V2PT 3GDVA 5E0GA 1TABE 3KCGH 1HV7A 4MLFB 2DUCA 2M5TA 4HGCA 3SNCA 3T5FH 1S6HA 3LGUA 4GSOA 3I77A 1T4VH 3SZNA 4YT7H 2FOMB 4WF8A 2OBQA 2Z9KA 1BMAA 3QGNB 1SG8B 1H9LB 4MDSA 2BLWA 5ESTE 1ELEE 1O2IA 3BG4C 2ZEBA 1XXDA 4B75A 5IDKA 1O2NA 3A80A 1CE5A 1DWBH 2GMTB 2CN0H 4INLA 1EJNA 3TGJE 2K1QA 2H9EH 4X1NU 1O0DH 1FV9A 1K1IA 1QL7A 2BYAX 1TB6H 1YM0A 1C1NA 1S6FA 1SOTA 2C93B 2OQ5A 2GTBA 2NWNA 1DICA 3RLYH 1MD7A 4AORA 1L0ZA 1THSH 3E90B 2OP9A 4PROA 1O2OA 3O8CA 1OWEA 3KIDU 1MQ5A 2VJ1A 3V13A 1SGFA 1Q2WA 3URCA 1G2LA 2GT7A 1LMWB 2AGGX 3LU9B 1TBQH 2ZP0H 3DT0H 5EQQA 3MNBA 1C5ZB 1O2WA 1DLEA 1DY9A 4UFEH 4WY3A 2A4GA 5J4QA 2FOEA 2R3UA 1AFEH 2B8OH 1Z8JB 5FPSA 1GBAA 4Q2KA 3RXTA 1Y3XA 4BXSA 3M3TA 1UJ1A 3VFEA 4E7NA 3ZVBA 2ZFPH 2TPIZ 1XXFA 3SW2B 1L4ZA 2J34A 1YLDA 1YP9A 1FJSA 1FZZA 4X0WU 3B8JA 3GY2A 3AAVA 1OYTH 3RXEA 2VWNA 1HPGA 1FN8A 1O3IA 2C90B 1ZGVA 1S81A 5DKMA 1J9CH 3JZ2B 4O3TA 7KMEH 2VVVA 1H9HE 2GV6A 1TGNA 2ZHEH 1TPSA 1G37A 3M3SA 2A32A 2NU1E 1ZMNA 3IWMA 1KY9A 1KDQB 1O5DH 1OOKB 3MU4A 2ZPRA 4WXIA 2F83A 2A5AA 3D49H 1P0SH 3MNCA 3KL6A 4X8SH 3A8DA 1YPJH 1P10A 2RA0A 1CBWB 2P8OC 5EXLA 4A92A 1DX5M 3S0NA 3QUMP 2A45B 4FVDA 3T62A 1BHXB 1BMMH 2TIOA 1KYNA 1CT2E 4I8HA 1QB9A 1P3CA 1CA0B 1O5AB 2ZZUH 1FONA 1O5BB 1WV7H 2PGBB 1C9PA 2H9HA 2AERH 3F1SB 3QGJA 1IQNA 5B6OA 2W3KA 1V2KT 5HM2A 3GISB 4MPWA 2Q6DA 4U32A 1VGCB 2BD2A 2ZTXA 1HAYB 3FVFB 3OU0A 4NIWA 1DXWA 4FUJA 4JCNA 2D26C 4DIHH 2PR3A 1O38A 1Y5BT 5GWZA 4E05H 5HMAA 4NWLA 4K2YA 3TNTA 1V2OT 2VGCB 5FCRA 1JXPA 1TLDA 4AYVB 2FXRA 2V3OH 1UTMA 4MNWA 4FUGA 4HZHA 1QBOA 2BDIA 4OGYA 3L33A 2FS8A 1QB1A 1GHYH 2O8MA 1BTZA 3M3VA 4YOIA 3SOSA 3MMGA 4B1TA 3V7TA 1QJ1B 4TWWA 1SOZA 3SI4H 1H8DH 3Q3YA 4CR9A 1NRQH 3RXOA 2W5EA 2XC5A 3RUOA 1MTVA 2Z9IA 4I8JA 2WV4A 3RC5A 3H7OA 1UVTH 4X2YA 2JH6D 5C2ZA 1MKXK 1P57B 1O30A 2VVCA 3LC3A 2XBYA 4GCHF 3L3TA 3KQEA 1P03A 3WY8A 2BOHB 1UK3A 4B2BA 2VNTA 2LNCA 2UUJB 3E6PH 1DDJA 1GG6B 3KNXA 2VINA 1J14A 3MO3A 1C2HA 4JYVH 4WMDA 3SNDA 5F03A 2FDAA 4ESTE 2ZQ1A 1QL9A 2P8OB 1TFXA 1K1LA 2I6QA 1FAKH 3C27B 4KELA 1KXEA 5A2MH 1YPGH 1EJMA 1GJCB 4NWKA 1JIMA 4DOQA 3RXAA 3H7TA 2FTMA 4ZXXH 1AB9C 1C5LH 2STAE 1W3CA 1W11U 5DPAA 1J15A 1AVXA 6CHAB 1ELBA 4X6NA 1QFKH 1Y3WA 2AMDA 5EXNA 3GICB 3UREA 1PYTD 3LJJA 1LVBA 1ZRKA 1XX9A 2GZ7A 3MU5A 3ATIA 3P70B 3QDZB 4JYUH 1AZZA 2PFEA 1JBUH 1P2JA 1ANEA 1GBMA 2SGDE 3TJUA 1BT7A 4Y8ZA 1ELTA 1EZXC 1OWJA 1DT2A 4NCYA 1O3FA 1F0SA 2Z3EA 1GGDB 1ABJH 9LPRA 1YPKH 3MO6A 2ZGHA 3URDA 4VGCC 1BRAA 4KTUA 3F9HA 4IBLH 1CVWH 4CRBA 1G3DA 4GVUA 2HNTF 3RXLA 2B7DH 1TBRH 4Q7ZA 2W7SA 7GCHG 2J4IA 4B2CA 1P02A 1GHAG 1TMBH 4FUFA 1DFPA 1C5TA 1HAIH 1A5IA 4ZAEA 1A3EH 3MU1A 2XBXA 3TU7H 4ABJA 3LC5A 1DUAA 1SGTA 5L2YH 3SGAE 2QV1A 3ZZCA 3M61U 1IQMA 4IC6A 2VIVA 5E2PA 2AIPA 1F5LA 3MNSA 2O9QA 3Q3XA 1SLVB 1TWXB 5T6DA 3DFJA 3ZZ3A 2JH5D 4NA7A 1C1UH 3RC4A 2BQ6B 3GDUA 1C2FA 2FS9A 1EPTA 1VCWA 1SBWA 2UWLA 4OS6A 1BDAA 1LHEH 2OINA 5CMXH 4WMFA 2Z6BD 1C4V2 3GCTF 2R2MB 1IHSH 1CSOE 1HJ9A 1TONA 1SGIB 2ZPQA 1SGPE 1C2MA 1XM1A 2SGQE 3ZZDA 2Y82A 2VIOA 1KSNA 1W0ZU 1GL0E 2A5KA 1C1QA 1LDTT 3RMNH 4BTIB 2RDLA 3BEIB 3SU4A 3TLOA 2TGDA 1ZJKA 2PKSC 4ZMAH 1S85A 5C5OA 2J95A 2UWPA 5C67A 4I8KA 1C1WH 1MUEB 2F9PA 1MKWK 3NXPA 1OWDA 1U6QA 4XSKU 3U8RH 2G51A 3RXJA 1V2LT 4DURA 2WPMS 1P05A 1NFWA 1SB1H 2FX6A 3U1IB 3SUGA 4BNRA 2ZO3H 3P8FA 4BXWA 5DP5A 2ZFTA 2FESH 7LPRA 1DOJA 1EPTB 4ISLA 4HFPB 5I25A 1AQ7A 1HAVA 1THPB 1HDTH 1ANBA 1YGCH 2G5VA 1VCQA 5A0AE 1V6DA 1MU8B 3RXDA 3PMHB 4KKDA 3NPSA 1A0JA 3MH4A 1N6XA 2GT8A 3SQHE 4BOHA 3T25A 4E06H 3HGPA 2P94A 2ANYA 4DY7B 1OP0A 1TNGA 3BTFE 1PPCE 2ZF0H 2PTCE 5DP3A 2STBE 1C5OH 2BY6X 3ZZAA 1GHBF 1GHAF 2HWLB 1AUJA 3RXVA 1DLKB 1GJDB 3CENA 2BY9X 2BDAA 1OWKA 2PSXA 3HKIB 5EG4A 2WINI 1FAXA 1GVLA 2Z3CA 2BHGA 4U01A 1IHTH 2BVSH 1GVKB 1HCGA 3Q3KA 1A5GH 1PPFE 3BF6H 1S5SA 2VVUA 1OKXA 2Z7FE 3TH3H 1L4DA 1AFQB 1ZHPA 2BDHA 4GAWA 2JH0D 4X8TH 2BVXH 2WPJS 1V2JT 8ESTE 4DCDA 1GHVH 5DP8A 3A82A 1AUTC 4OS2A 1HLTH 1Y8TA 2BDYA 1FDPA 1TNKA 1F92A 1E36B 3LGTA 5A0BA 2H5CA 2A5IA 2QXIA 4UFFH 1BRCE 2C8XB 4YM9A 1P09A 2V3HH 3CP7A 1ZYOA 4I31A 1QB6A 4A1VA 1O3BA 3SBKA 1ARCA 3HATH 1TGSZ 4YLQH 1LPZB 1T4UH 3NZIA 2CV3A 1BBRE 3E0PB 3ATMA 1V2QT 2ZHFH 1O3HA 2ANWA 2H2ZA 5DO4H 2ZGJA 1NC6A 4XDEA 2ZKSA 1AD8H 1HAXB 1D9IA 3M7UA 5DP4A 3RXIA 1O37A 1GBCA 1O2LA 3A86A 3UUZA 4A1TA 1GMHG 1NM6A 1JRTA 2QCYA 4ZH8A 5EPYA 2GDEH 4IN1A 4JYTA 5LPFA 3GOVB 3ZVGA 1MTUA 1TMTH 3HGNA 4BAOB 1WTHD 4X2XA 2W26A 2O8UA 2FEQH 3UTUH 1MAYA 3SV2H 3O8RA 3ODDA 2TRMA 3LIWA 4JMYA 2A0QB 5C1UA 2BLOA 1BJVA 3PLBA 1B5GH 2RCEA 1O3AA 1E37B 3RXMA 3QTVH 4Q80A 5CE1A 2GCHF 3VPKA 1UK4A 3E0NB 4Y8YA 4NG9H 2Y80A 1C5WB 1MH0A 2FZZA 3TGKE 1X7AC 1E35B 1D3DB 5FPYA 1EUFA 4BANB 3SJIA 4O3UA 1S83A 1EZQA 3LJOA 4MPUA 4AX9H 2BTCE 1GHZA 2RG3A 1O2ZA 2ZU5A 1CHGA 5E2OA 1HAVB 4ZUHA 2VB0A 1HXFH 4K1EA 1WQVH 1O2QA 1HAGE 3FP7E 2YNBA 2ZWLH 3EYDA 1GBIA 3RXSA 3O8BA 3KEEA 2G81E 3MOCA 1SC8U 4MNXA 2AMQA 1ZLRA 4Y0YE 1PPZA 2WV5A 3LH1A 1K22H 1BBRH 2ZCLP 1UCYH 4ZKNU 1AWFH 3S9AA 3SU5A 1PQAA 1VITG 1XUFA 4TY7A 3UOPA 1JWTA 1DWDH 3SU6A 1KLTA 1P2OA 1C4U2 1GJAB 1ZSLA 3SJ9A 1T8LA 4CHAB 1MTSA 1OWIA 4KTCA 3LPRA 1NESE 1OPHB 1QIXB 4ABHA 3SU3A 5JBTA 2ODYB 1QCPA 1MBMA 4ZXYH 1FNIA 1ELDE 3RMLH 1V2VT 4K8YA 1QL8A 1RTKA 1GJ4H 4J2YB 3QN7A 2FI3E 2HLCA 4RN6A 1ACBE 1SQOA 4Y8XA 3TGIE 2AFQB 3LH3A 2Y6TA 2OD3B 3BTWE 3SHCH 2A2QH 4AFQA 4E7RG 4K8BA 1TRNA 2PKSB 1DITH 1EAWA 2XCNA 2FYQA 1BOQA 2XYAA 1NY22 1T7CA 1C5VA 1CT4E 1P2NA 3SV8A 5C1YA 2CMYA 5TJXA 4JZFH 1SSXA 1TX7A 2FI4E 2G00A 1BJUA 1XUIA 5DP7A 4TY6A 3ZZ6A 2ZDLA 4UFGH 2SGAA 1GMDG 1B0EA 1ZTJA 1UTOA 1FY8E 3GYLB 1QRWA 1D3TB 1C1VH 1FQ3A 2ZGCA 1KXBA 2D8WA 3B9FH 3R0FA 1YCPH 1LHDH 1ZPBA 1KXCA 1QQUA 1ZHMA 2ESTE 3RDZA 3Q00A 1EXFA 3AAUA 2OC1A 3SNEA 2BVRH 1O3EA 5DG6A 1K21H 1Z6EA 1MMJN 4ABFA 1FY5A 2BD8A 1GCTB 2BXTH 2GV7A 2F9UA 4FUBA 4KGAA 3VB4A 2O8WA 4IMZA 3BTDE 3GCHC 1XUKA 4I8GA 1C2EA 3PLPA 1UCYK 2BM2A 3W94A 4OS5A 1HFDA 4GLYA 1LVOA 1G36A 5LGOA 4SGAE 4ZKOU 3PROA 1NFUA 1Y59T 3BTQE 1SGEE 5T6FA 5CHAC 3CS0A 1GWAA 3ATWA 3ELAH 1C5SA 3F9GA 1O3MA 1NZQH 1A7SA 3KQDA 4Y7AA 3MU0A 1QGFA 3PM3A 1ID5H 1GJ7B 2FOGA 1GL1A 1A2CH 3OTJE 3VXEH 1YPHE 1PPEE 5GPIB 3PMJA 4ZKSU 4ASHA 3A88A 3HPTB 1C5QA 1TE0A 4F4OC 3UWIA 1L1GA 4K69A 2J92A 1HAHH 2J94A 1TNLA 1YYY1 2ZFRH 4FXGH 3RMMH 2BD7A 1P06A 6CHAC 3E16B 1SQTA 1C1RA 2TGPZ 4X1RU 1NRSH 3QLPH 3E8LA 1GMHF 1IQJA 1W10U 3I78A 2ALVA 3QO6A 1AVGH 1FY3A 1UVSH 2GX4A 5L30H 4K60A 2UUYA 4TPIZ 3RM2H 1DM4B 1O3OA 1HIAA 4MQAA 4ABGA 1GDNA 1AO5A 2OTVA 1SFIA 1ESTA 4FUDA 1QURH 3JZ1B 2XW9A 1L1JA 4DIIH 5GCHF 2R2WU 4LZ1H 1Z6JH 2FOFA 2QF0A 2WPKS 2H5DA 3AASA 5C3NA 1GJBB 1GG6C 1V2WT 3RXCA 3K9XB 4JK5A 3SJOA 1GBEA 2VU8E 1SFQB 1CGJE 2HPPH 3SU1A 2GCTB 1RIWC 1BBRK 3P92A 3M35A 1FN6A 1QR3E 2BD3A 4HI3A 4WJG2 1E34B 3A89A 3R3GB 1EX3A 4U30A 2ZCHP 3TVJB 1RJXB 3AVZA 3KGPA 2EI7A 3A7VA 2FOCA 1SGDE 5FPTA 2EI6A 1NRNH 2BLVA 1Y5UT 1Z8RA 1BTPA 1C5YB 1C1PA 3M36A 4RSPA 1NU7B 1S84A 5FHTA 2EC9H 2QN5T 1C1TA 1SGQE 1T32A 3EAJA 1EOJA 3LGWA 1DWCH 4AG1A 1FMGA 5EOKA 1LKAA 2A7CA 1CGHA 2JETC 3RU4T 1K28D 2R0KA 1C2IA 2XBWA 2EI8A 1Y5AT 2WUBA 1LPGB 2GP9B 1RFNA 4MPXA 1TAWA 3A7ZA 1NRPH 2FI5E 1GMCG 1K9OE 4WMEA 3SUFA 1GDQA 1S0QA 3RXUA 4BAKB 4CRFA 1ZTKA 1AB9B 2XWAA 3SV9A 1W0YH 4JZDH 1GJ8B 1AFQC 2XBVA 1BQYA 1TPPA 2HVXA 1EOLA 2Z3DA 1H4WA 1IQHA 1G9IE 4NZLA 3S9CA 1K1JA 1MKWH 2ZU2A 3FZZA 3BTME 3P8GA 2PGQB 1BITA 2QAAA 3HKJB 3LGIA 2O8LA 2BD4A 5ETXA 4WH6A 4I8LA 4YZUA 1W14U 2B9LA 3UQVA 1O2SA 1HJAC 1RTFB 4AFSA 3ITIA 3AW0A 3U8OH 3SNAA 4NA9H 1WTGH 3S69A 1F0RA 4CBNA 4AZ2B 2GDDA 1IQKA 2XRCA 1CA8B 4OS7A 1CBWC 2ZHWH 3M5MA 1RTLA 2PW8H 3TPIZ 1QQ4A 4AN7A 2FMJA 5AFZH 3M5NA 4KP0A 5A09A 1WBGB 1GMCF 2SNWA 7ESTE 2HGTH 2FOBA 1AHTH 5HM9A 2IN2A 3UQOA 1P2QA 1V2RT 6GCHG 3F6UH 3A7WA 3QZRA 5FBEA 4O9VA 1K2I1 3V12A 3P8NA 4B2AA 1EZSC 2C8ZB 1O3CA 4K3JA 1HNEE 3U69H 1O3JA 1LVMA 1Z7KA 2BY8X 3A87A 3PLKA 2Y5GA 5LH8A 3BTHE 1DY8A 1SLUB 3KQCA 4AOQA 1YCPM 3MWIU 1V2ST 3PMAB 1B0FA 3ATLA 5DGJA 1CGIE 2OC7A 3SJ8A 2P93A 2TGTA 2ANMH 2ZG0H 1OXGA 4X8VH 1LHCH 1PFXC 1AWHB 1BMLA 2ODQA 3IG6B 4WH8A 1MCVA 1TGCA 3GY7A 5EODA 3SUEA 1TOCB 1BTUA 3GY4A 2SGFE 3MHWU 3W95A 1DE7H 3LOXA 5JBBS 3ZVEA 2LPRA 1W2KH 1FY1A 1RGQA 4ISHH 1MTWA 3IITA 1UTLM 3MH7A 1J8AA 3H5CB 4UD9H 2PWXA 7GCHF 1NN6A 4JK6A 3K6YA 3SU2A 2GZ9A 3PO1C 4BAQB 1J17T 3B23B 1GI0A 3ZZ7A 2OC8A 1ARBA 2CHAB 3ZV8A 3NUMA 1SHYA 2NU2E 1P12E 4XE4A 4MNVA 3Q76A 1IOEA 1O34A 2PKAB 4KTSA 3A8CA 1SLWB 1V2TT 2DE9A 4JZ1A 1DXPA 3A84A 5BRRE 1A1RA 2YNAA 2GMTC 4INKA 2BZAA 3RP2A 1V3XA 4JZIA 2R9PA 3DHKH 1LQEA 1UCYE 2VH6A 4WXVA 4UEHH 3F9FA 1OS8A 1VJ9U 1DS2E 1S0RA 1C9TA 4MPVA 2ZU3A 1O2GH 4DJZB 1YPMH 1ZMJA 1EATA 3TK6A 2IPHA 1MBQA 4I32A 5JPMH 3NK8A 1NPMA 4B76A 1JMOH 4XBBA 4A1XA 1Y3YA 1Z8IB 3GY8A 3VB7A 2ZDAH 3SV6A 2QY0B 1SPJA 4X2VA 1SR5C 5EU8A 5H4IB 2ZDVH 1O5EH 1WOFA 5EPNA 3SQEE 1UHBB 2ZDKA 1ZPZA 4NFFA 3PYHA 1GDUA 2BD5A 4R0IA 3RXBA 3A7YA 2VWOA 4X1SU 1N8OC 2CF8H 2HRVA 3QTOH 2QYIA 3STIA 1MTNC 3GYMA 1GBJA 4YOJA 1QNJA 4NFEA 1EZUC 1C2GA 3OSYA 1UVPA 2QGRA 5AVDA 5GXPA 1F0TA 2VGCC 1BTYA 3BG8A 2QA9E 1MZAA 3LONA 1YCPK 1BZXE 3E3TA 4H6SB 2I6SA 4YO9A 1C2JA 3ZVCA 5G4BA 1F2SE 2Y5FA 4XBDA 1O5CB 4TYDA 1DPOA 2AS9A 4Y6DA 3SHAH 5FBIA 2F91A 2EA3A 1NFXA 2XTTB 4QT8C 3UFAA 1GJ9B 4Y0ZE 4D7FA 4CH8B 4MNYA 2UUKB 1H9IE 1GBBA 2Q6GA 1FPHH 5ABWA 2ASUB 1BMNH 3FP6E 5BPEA 1ZRBA 3RXRA 1AE8H 5EQSA 1ELVA 3M5LA 2GD4B 1FIWA 1GGDC 2GGVB 3GY3A 2WYGA 3D62A 3ZZ8A 5JYIA 2ZTYA 4ZHMU 4THNH 4I33A 2QXJA 2ZHQH 1WU1A 4MVNA 4ABAA 4ISNA 2BLQA 2OCVB 2A4QA 2Z94A 4TWYA 3PMBB 5F6MA 4WVPE 4BTTB 5C5NA 2AH4X 3A85A 1A3BH 4ABEA 4AFZA 1QBVH 3GY6A 1C2KA 1YKTA 1YBWA 3QWCH 2F9NA 3GY5A 3ODFA 4GUXA 4U2WA 1W8BH 1ANDA 2AIQA 2ZGXH 1WUNH 1GI7B 1KLIH 1O32A 3DUXH 1C5PA 3P95A 1O3PB 5JBCS 4FUHA 4NSVA 2R3YA 4J1YA 4NIYA 3BTEE 1EJAA 1UO6A 4Z6AH 1GJ6A 4Q7YA 5EQRA 5F8ZA 4NIXA 3SORA 3UR9A 1QA0A 1EP5A 3FAOA 2F9OA 1NO9H 3E1XB 1P9UA 2PHBA 1TNHA 3BTKE 1O31A 2F9BH 1A5HA 2BY5X 1GBLA 1GI1A 2AMPA 2CF9H 4H6TA 1HAPH 2EEKA 5HXFA 1O2MA 1S82A 4F49A 1MTNB 3MH6A 1D6RA 3I29A 5HYOA 3F9EA 1TRYA 1ETRH 3PO1B 2WUCA 1LHGH 2H1UA 1SGCA 1GCDA 2NU3E 1CO7E 1VCPA 1SI5H 1AZ8A 1TX8A 3SJKA 2J38A 2VIDA 1GI6A 3DD2H 1BHXF 2ZU4A 4LK4A 3TITA 2SGEE 1P8VC 4CREA 2GKVE 4K1SA 1THRH 1SLXB 4OGXA 2Y81A 4Z0KA 3EDXB 1ELCA 1XVMA 2R0LA 2VWLA 1GJ5H 3EA7A 4GCHG 1CT0E 3NWUA 2FOAA 3QZQA 2VIWA 4ZHLU 1HAZB 3LT3A 1OX1A 5A0CA 3V0XA 3RXGA 1LKBA 3RU4D 3TK9A 1BCUH 3SU0A 1KXAA 2BX3A 2A31A 1DANH 5JBAS 2HNTC 1LTOA 1G3EA 4UFDH 4Y71A 4AB8A 2FYRA 1E38B 1T8MA 1TOMH 3MNXA 2ZNKH 1AKSB 2GCTC 2A4RA 2FX4A 2P95A 2W7UA 4AGKA 3EQ0H 1QHRB 2J2UA 3DA9B 3RC6A 1SGNE 3N7OA 2A7JA 3T2NA 2QF3A 2FLBH 5FXLA 1O2UA 3S7HB 1CA0C 3BSQA 1XUGA 5EXMA 1F7ZA 3ZYEA 4X6PA 1P04A 2WYJA 1W13U 1VITH 1MU6B 2BDCA 2THFB 3P6ZB 4NZQA 1XVOA 2CHAC 2QXHA 1C5NH 5HGGA 1A0HB 3EE0B 1FUJA 1O39A 2KAIA 5C20A 1HUTH 4X1PU 4AG2A 3TJOA 1G2MA 4A6LA 2GCHG 5L6NH 1TX6A 2BDBA 4D7GA 4O03A 1O2PA 2PV9B 2ZDNA 4ZKRU 4GHTA 3TNSA 3PWCA 4FU9A 1ZSJA 3ZVFA 4ABIA 3EGKH 1A4WH 4YTAA 1HAOH 1TBZH 1LO6A 3U9AH 5K0HA 1F0UA 1ZR0A 3SV7A 2SNVA 2CXVA 1G3BA 2BDGA 2VH0A 1F5KU 1H1BA 1UTKA 3A8BA 4CRGA 1OSSA 1GBHA 1EAUA 1PYTC 1ETTH 1D4PB 4B71A 2A7HA 1C1MA 2G4UA 1KIGH 1O3NA 1AU8A 2VWMA 4LXBH 4VGCB 1D3QB 2UUFB 4IGDA 4FUEA 2HALA 4I7YH 3P17H 4Y7BA 1P11E 5K7RA 1FLEE 4X2WA 4DVAU 1M9UA 2OQUA 3DFLA 5LPRA 1GVZA 3NCLA 4OS1A 3VGCC 1EP6A 1IQGA 3PV4A 3FANA 1Z1JA 4NGAH 4YESB 1Q3XA 1EB2A 1HXEH 2Y7XA 1P2IA 3A7XA 1A46H 3UNRA 2ZPSA 1EKBB 3RXKA 3ZZ4A 1GBDA 2TBSA 1LVYA 4D76A 1SVPA 4FU7A 1T8OA 1O36A 1SQAA 1Z1IA 2D1JA 3MU8A 4CRAA 5EW2H 4AB9A 1T31A 1QBNA 2Y5HA 1XUHA 1HIAB 2ANKH 4FU8A 4CR5A 2NU4E 2BMGB 2SGPE 2F9VA 1AGJA 3KF2A 6GCHF 3ZZ5A 3UIRA 2BX4A 1AMHA 4A5TS 4IMQA 2FM2A 4FVBA 4XBCA 4H4FA 3BV9B 1C2LA 2O8TA 2BQWB 3BG4B 1TNJA 3MYWA 3M7TA 1ZTLA 5TCCA 3OYPA 1NTPA 1KXFA 1HGTH 2XC4A 1CHOG 2HOBA 1YLCA 1UTQA 4UDWH 3M7QA 1VITF 1A61H 2P3FH 1QJ6B 2FODA 1GI2A 3UNSA 4Y76A 4NA8A 1TA2A 2B0FA 2FP7B 1GI4A 1INCA 1K1OA 5L2ZH 4CRDA 2H9TH 2PUQH 2XC0A 1ANCA 5DK1A 1UTJA 3KQBA 2V6NA 6ESTA 3T26A 1XUJA 1DWEH 4NSYA 4D9RA 4INHA 3ENSB 4TPYA 5FCKA 1PPBH 1FIZA 1LQDB 2ZA5A 1FI8A 3LGVA 5SGAE 1IAUA 2C3SA 1O33A 2AGIX 1ESBA 2BB4A 1P2MA 2FOHA 2SFAA 2P3TB 1QRZA 2VIPA 1VJAU 2P3UB 1O3GA 5CHAB 1YPLH 1SGYE 1O2RA 6LPRA 3K2UA 1TPOA 4YLUA 1QA7A 1TPAE 4O97A 3ESTA 1UVOA 1MD8A 2XWBI 5DP9A 2F3CE 1HJAB 1HBTH 2OC0A 3D23A 1MZDA 1RS0A 1EAIA 4AYYB 1NROH 1C4Y2 1BB0B 1JRSA 1BA8B 1PJPA 1VGCC 3PWBA 4ISOA 3TH4H 1O5GH 4SGBE 3BN9A 1AE5A 5I46H 3TH2H 1BTWA 2ZQ2A 1GCTC 1O3DA 1WYKA 1O5FH 5AHGH 3ZZ9A 1O2YA 3UNQA 5J4SA 3ATKA 1ELAA 1XMNB 1TGBA 1XKAC 2GVFA 3RLWH 1PPGE 2Z9LA 1DUEA 3A81A 2JETB 5JB9S 1GBKA 1RXPA 3LKWA 2XCFA 1GI9B 2WPIS 1E0FD 3S9BA 1TGTA 1BIOA 1G3CA 1KLJH 3U8TH 1HB0B 5PTPA 5A8XA 1ELFA 1TALA 1O2VA 1RD3B 3T27A 3A8AA 4ZROA 1NT1A 1KTTB 3SGBE 2FO9A 5A8ZA 3A83A 3UOUA 1WSSH 1SMFE 3QX5H 1SHHB 3SI3H 2BXUH 2JKHA 1NRRH 1O2HA 4ABBA 4A7IB 3VXFH 2GZ8A 2OXSA 1VR1H 1DSTA 3VEQB 3RXPA 4X6OA 2HNTE 1OP8A 1IQEA 1NS3A 5T3HA 4AGJA 1BUIA 3FZDA 4ABDA 3BIVH 1TNIA 1TIOA 2ZC9H 1YC0A 2C4FH 2J9NA 4B73A 1GHWH 2W3IA 4JZEH 1UHBA 2PSYA 1ESAA 3A7TA 1PQ5A 1WCZA 3ZV9A 1C5XB 1V2MT 2AYWA 1GI8B 1ETSH 2G52A 3UPEA 1FPCH 2Z9GA 1ZGIA 1TRMA 1KXDA 5E0JA 2BQ7B 2A4OA 1C1SA 1CHOF 3QK1A 3UR6A 8GCHG 3L6PA 4ZHAA 4CBOA 3E91A 4K5ZA 3CS7A 2BY7X 4Y10E 1XKBC 1GPZA 3BTGE 1AVWA 3FP8E 1W7XH 1WQSA 2NU0E 4XOJA 1BTXA 1MCTA 5E8EH 1PPHE 1AKSA 4LZ4B 4M7GA 3D65E 3AW1A 1P2KA 2FTLE 1V2NT 2AGEX 3O8DA 3TK5A 3SN8A 2WPLS 2XNIA 1K1NA 2WPHS 4HTCH 4WWYA 1UMAH 3GCOA 4BAMB 2A2XH 1CU1A 1OYQA 5E0HA 1JOUB 4Y79A 2AEIH 2Q6FA 1MKXH 1GHXH 1ZSKA 1GHBG 5DP6A 1BRUP 1NU9A 1T8NA 2ZI2H 1W7GH 4CH2B 4IW4E 2OLGA 3LGYA 1LCYA 4ISIH 1GMDF 3GCHB 3RMOH 2VIQA 1TQ0B 3V3MA 1HYLA 5AF9H 1AY6H 2ZU1A 1AI8H 1KTSB 2ZIQH 2FPZA 1EASA 3GDSA 1EQ9A 2HPQH 4XFQA 2PLXA 3U1JB 5EGMA 1G30B 2H6MA 4Q7XA 2G5NA 3F68H 5DJ7A 1P01A 1C2DA 3BEFB 2ODPA 3TJNA 2Q1JA 1RRKA 1RIWB 1QJ7B 1AIXH 2QIQA 1UK2A 1WAYB 1MQ6A 2ZHDA 1C1OA 1LHFH 3HK6B 1L1NA 1TYNA 3T28A 1YPHC
chains in the Genus database with same CATH superfamily
4DGJA 2BD9A 1K1PA 2FWWA 3BIUH 3OY6U 4K1TA 2ZECA 1LPKB 3TIUA 1OHHD 3NKKA 3ZYDA 1ZPCA 1GI3A 5AFYH 2C8WB 1UVUH 4AFUA 3K65B 2V35A 1VZQH 3TJVA 3U28C 4B6EA 3PTNA 4RT0A 1O35A 3SUDA 5DN6D 3DCLA 3FFGA 1GBFA 1HJ8A 2ZGBH 4DG4A 1SGFG 4GHQA 1DSUA 5EW1H 2A1DB 2QC2A 4R8TB 4UONA 2YOLA 2G4TA 2OBOA 8KME2 1QRXA 4BTUB 1DVAH 2CGAA 5TCAA 4NIVA 1PQ8A 3EA8A 2TGAA 2PTNA 5IYTA 2P59A 3KN2A 1UTPA 2ULLA 1PQ7A 1SL3A 3M5OA 1OP2A 2ZFFH 3EA9A 2FLRH 1D6WA 3C1KA 3T29A 3VB6A 2OUAA 5FX5A 3HK3B 2BOKA 1ORFA 1P9SA 2WV9A 3Q77A 5JB8S 4X6MA 5F8XA 8LPRA 2IJOB 4CHAC 3RU4E 3VB5A 1ZMLA 2RA3A 1C5UA 1IQFA 4DT7B 1D3PB 3UY9A 2YMSB 8GCHF 4DW2U 1N6YA 2ZFQH 2CJIA 1OWHA 1BRBE 2ALPA 1A0LA 3W1EA 3MH5A 5GJ4B 3F0PA 1CQQA 2UWOA 2ZCKP 3SNBA 1FY4A 1IQIA 4FUIA 2FIRH 4CRCA 2G55A 1UTNA 1HRTH 4GPGA 1ZJDA 2IOTA 5LPEA 4OS4A 3VB3A 5F8TA 1F5RA 1ZOMA 4RKOB 3RXQA 3S7KB 1Y3UA 1MAXA 1J16A 3K6ZA 3FO8D 3MTYA 2B5TB 4H42U 4X8UH 3GCNA 3U98H 3GCTG 9ESTA 1ABIH 2ILNA 4UE7H 2CK3D 2DE8A 2EQNA 5A8YA 3VGCB 3BTTE 3ZZBA 3OY5U 1FXYA 1O2TA 1AN1E 1KDQA 1O2JA 1SGRE 1QY6A 1Y3VA 1GI5A 2C8YB 1JIRA 1N1LA 2KAIB 1H8IH 3M37A 1ZHRA 2Y7ZA 4D9QA 1Z71A 1BTHH 4Y11E 5C1XA 3KHVA 1GBTA 3PB1E 1B7XB 3STJA 1K1MA 1TQ7B 2PUXB 1C5MD 1W12U 4YT6H 4YOGA 4B74A 3G01A 3UWJH 1TA6A 5GDSH 3RXHA 1O2KA 5GCHG 3ZVAA 2ZTZA 3SGQE 5T6GA 3FKSD 1L2EA 2V0BA 1TMUH 4FUCA 5FX6A 2ZDMA 1ELGA 3LDXH 2Z9JA 2QXGA 4BAHB 5FAHA 4D8NA 1V2UT 4RKJB 5JDUB 1NFYA 4IC5A 2D2DA 5GIBA 4IN2A 4FETA 2G8TA 5ESBA 3ZVDA 2XXLA 4LOYH 1O3KA 1IQLA 2P16A 1YPEH 4MG3A 3PTBA 2LELA 1P3EA 2ZFSA 1N8OB 3MFJA 1QTFA 2BZ6H 2PKAA 1O3LA 3MI4A 1G32B 1O2XA 3OX7U 3RM0H 2AHME 1Q31A 3P8OA 1YF4A 1C5RA 1EPTC 4IS5A 1EB1H 3MO9A 4X1QU 3RXFA 1Z8GA 1EAXA 1ZZZA 3SO3A 4MTBA 3BEUA 1V2PT 2M2AA 3GDVA 5E0GA 1TABE 3KCGH 1HV7A 4YXWD 4MLFB 2DUCA 2M5TA 4HGCA 3WW7A 3SNCA 3T5FH 1S6LA 1S6HA 3LGUA 4GSOA 3I77A 1T4VH 3SZNA 4YT7H 2FOMB 4WF8A 2OBQA 2Z9KA 1BMAA 3QGNB 1SG8B 1H9LB 4MDSA 2BLWA 5ESTE 1ELEE 1O2IA 3BG4C 2ZEBA 1XXDA 4B75A 5IDKA 1O2NA 3A80A 1CE5A 1DWBH 2GMTB 2CN0H 4INLA 1EJNA 5GNDA 3TGJE 2K1QA 2H9EH 4X1NU 1O0DH 1FV9A 1K1IA 1QL7A 2BYAX 1TB6H 1YM0A 1C1NA 2OQ5A 1S6FA 1SOTA 2C93B 2GTBA 2NWNA 1DICA 3RLYH 1MD7A 4AORA 1L0ZA 1THSH 3E90B 2OP9A 4PROA 1O2OA 3O8CA 1OWEA 3KIDU 1MQ5A 2VJ1A 3V13A 1SGFA 1Q2WA 3URCA 1G2LA 2GT7A 1LMWB 2AGGX 3LU9B 1TBQH 2ZP0H 3DT0H 5EQQA 3MNBA 1C5ZB 1O2WA 1DLEA 1DY9A 4UFEH 4WY3A 2A4GA 5C17A 2FOEA 2R3UA 5J4QA 1AFEH 2B8OH 4AC9A 1Z8JB 5FPSA 1GBAA 4Q2KA 3RXTA 1Y3XA 1W0JD 3M3TA 1UJ1A 3VFEA 4BXSA 4E7NA 3ZVBA 2ZFPH 2TPIZ 1XXFA 3SW2B 1L4ZA 2J34A 1YLDA 1YP9A 1FJSA 1FZZA 4X0WU 3B8JA 3GY2A 3AAVA 1OYTH 3RXEA 1HPGA 2VWNA 1FN8A 1O3IA 2C90B 1ZGVA 2QF5A 1S81A 5DKMA 1J9CH 3JZ2B 4O3TA 7KMEH 2VVVA 4Q63A 1H9HE 2GV6A 1TGNA 2ZHEH 1TPSA 1G37A 3M3SA 2A32A 2NU1E 1ZMNA 3IWMA 1KY9A 5C94A 1KDQB 1O5DH 1OOKB 3MU4A 2ZPRA 4WXIA 2F83A 2A5AA 3D49H 1P0SH 3MNCA 3KL6A 4X8SH 3A8DA 1YPJH 1P10A 2RA0A 4F55A 1CBWB 2P8OC 2L6OA 5EXLA 4A92A 1DX5M 3S0NA 3QUMP 2A45B 4FVDA 3T62A 1BHXB 1BMMH 2TIOA 1KYNA 1CT2E 4I8HA 1QB9A 1P3CA 1CA0B 1O5AB 2ZZUH 1FONA 1O5BB 1WV7H 2PGBB 1C9PA 2H9HA 2AERH 3F1SB 3QGJA 1IQNA 5B6OA 2W3KA 1V2KT 5HM2A 3GISB 2RDEA 4MPWA 2Q6DA 4U32A 1VGCB 2BD2A 2ZTXA 1HAYB 3FVFB 3OU0A 4NIWA 1DXWA 5B6LA 4FUJA 4JCNA 2D26C 4DIHH 2PR3A 1O38A 1YWUA 1Y5BT 5GWZA 4E05H 5HMAA 4NWLA 4K2YA 3TNTA 1V2OT 2VGCB 5FCRA 1JXPA 1TLDA 4AYVB 2FXRA 2V3OH 1UTMA 4MNWA 4FUGA 4HZHA 1QBOA 2BDIA 4OGYA 3L33A 2FS8A 2O8MA 1QB1A 1GHYH 1QZ8A 1BTZA 3M3VA 3EE7A 4YOIA 3SOSA 3MMGA 4B1TA 4ZCNA 3V7TA 1QJ1B 4TWWA 1SOZA 3SI4H 1H8DH 3Q3YA 4CR9A 1NRQH 3RXOA 2W5EA 2XC5A 3RUOA 1MTVA 2Z9IA 4I8JA 2WV4A 3RC5A 3H7OA 1UVTH 4X2YA 2JH6D 5C2ZA 1MKXK 1P57B 1O30A 2VVCA 3LC3A 2XBYA 4GCHF 3L3TA 3KQEA 1P03A 3WY8A 2BOHB 1UK3A 4DT4A 4B2BA 2VNTA 2LNCA 2UUJB 3E6PH 1DDJA 2JJ1D 1GG6B 3KNXA 2VINA 1J14A 3MO3A 1C2HA 4JYVH 4WMDA 3SNDA 5F03A 2FDAA 4ESTE 2ZQ1A 1QL9A 3F3BA 3WWBA 2P8OB 2LP6A 1TFXA 1K1LA 2I6QA 1FAKH 3C27B 4KELA 1KXEA 5A2MH 1YPGH 1EJMA 1GJCB 4NWKA 1JIMA 4DOQA 3RXAA 3SYJA 3H7TA 2FTMA 4ZXXH 1AB9C 2STAE 1C5LH 1W3CA 3H09A 1W11U 5DPAA 1J15A 1AVXA 6CHAB 1ELBA 4P02A 4X6NA 5HKKD 1QFKH 1Y3WA 2AMDA 5EXNA 3GICB 3UREA 1PYTD 3LJJA 1LVBA 1ZRKA 1XX9A 2GZ7A 3MU5A 3ATIA 3P70B 3QDZB 4JYUH 1AZZA 2PFEA 4XRNA 1UW7A 1JBUH 1P2JA 1ANEA 1GBMA 2SGDE 3TJUA 1BT7A 4Y8ZA 1ELTA 1EZXC 1OWJA 4F48B 1DT2A 4NCYA 1O3FA 1F0SA 2Z3EA 1GGDB 1ABJH 9LPRA 1YPKH 2K8IA 3MO6A 2WHXA 2ZGHA 3URDA 4VGCC 1BRAA 4KTUA 3F9HA 4IBLH 1CVWH 4CRBA 1G3DA 4GVUA 2HNTF 3PRDA 3RXLA 2B7DH 1TBRH 4Q7ZA 2W7SA 7GCHG 3F0OA 2J4IA 4B2CA 1P02A 1GHAG 1TMBH 4FUFA 1DFPA 1C5TA 1BMFD 1HAIH 1A5IA 4ZAEA 1A3EH 3MU1A 2XBXA 3TU7H 4ABJA 3LC5A 1DUAA 1SGTA 5L2YH 3SGAE 2KCYA 2QV1A 3ZZCA 3M61U 1IQMA 4IC6A 2VIVA 2W6JD 1SKYE 5E2PA 2AIPA 1F5LA 3MNSA 2O9QA 3Q3XA 1SLVB 1TWXB 5T6DA 3DFJA 3ZZ3A 2JH5D 4NA7A 1C1UH 3RC4A 2BQ6B 3GDUA 1C2FA 2FS9A 1EPTA 1VCWA 1SBWA 2UWLA 4OS6A 1BDAA 1LHEH 2OINA 5CMXH 4WMFA 2Z6BD 1C4V2 3GCTF 2R2MB 1IHSH 3DSPA 1CSOE 1HJ9A 1TONA 1SGIB 2ZPQA 1SGPE 1C2MA 1XM1A 2SGQE 3ZZDA 2Y82A 2VIOA 1KSNA 1W0ZU 1GL0E 2A5KA 1C1QA 1LDTT 3N7DA 3RMNH 4BTIB 4B6FA 2RDLA 3BEIB 3SU4A 3TLOA 2TGDA 1ZJKA 2PKSC 4ZMAH 1S85A 5C5OA 2J95A 2UWPA 5C67A 4I8KA 1C1WH 1MUEB 2F9PA 1MKWK 2IJD1 3NXPA 5HIZA 1OWDA 1U6QA 4XSKU 3U8RH 2G51A 3RXJA 3WWFA 1V2LT 2L74A 4DURA 1P05A 2WPMS 1NFWA 1SB1H 2FX6A 3U1IB 3MQKC 3SUGA 4BNRA 2ZO3H 3P8FA 4BXWA 5DP5A 2ZFTA 2FESH 7LPRA 1DOJA 1EPTB 4ISLA 4HFPB 5I25A 1AQ7A 1HAVA 1MABB 1THPB 1HDTH 2JJ2D 1ANBA 1YGCH 1E1QD 2G5VA 3N99A 1VCQA 5A0AE 1V6DA 1MU8B 3RXDA 3PMHB 4KKDA 3NPSA 1A0JA 3MH4A 1N6XA 2GT8A 3SQHE 4BOHA 3T25A 2WPDD 4E06H 3FOAA 3HGPA 2P94A 2ANYA 4DY7B 1OP0A 1TNGA 3BTFE 1PPCE 2ZF0H 3OAAD 2PTCE 5DP3A 2STBE 1C5OH 2BY6X 3ZZAA 1GHBF 1GHAF 2HWLB 1AUJA 3RXVA 1DLKB 1GJDB 3CENA 2BY9X 2BDAA 1OWKA 2PSXA 2YMSC 3HKIB 5EG4A 2WINI 1FAXA 1GVLA 2Z3CA 2BHGA 4U01A 1IHTH 2BVSH 1GVKB 1HCGA 3Q3KA 1A5GH 1PPFE 3BF6H 1S5SA 2VVUA 1OKXA 2Z7FE 3TH3H 1L4DA 1AFQB 1ZHPA 2BDHA 4GAWA 2JH0D 4X8TH 2BVXH 2WPJS 1V2JT 8ESTE 4DCDA 1GHVH 5DP8A 3A82A 1AUTC 4OS2A 1HLTH 1Y8TA 2BDYA 1FDPA 1TNKA 1F92A 1E36B 3LGTA 5A0BA 2H5CA 2A5IA 2QXIA 4UFFH 1BRCE 2C8XB 4YM9A 1P09A 2V3HH 3CP7A 1ZYOA 4I31A 1QB6A 4A1VA 1O3BA 3SBKA 1ARCA 3HATH 1TGSZ 4YLQH 1LPZB 1T4UH 3NZIA 2CV3A 1BBRE 3E0PB 3ATMA 1V2QT 2ZHFH 5EJZA 1O3HA 2ANWA 2H2ZA 4TSFD 5DO4H 2ZGJA 1NC6A 4XDEA 2ZKSA 1AD8H 1KMHB 1HAXB 1D9IA 3M7UA 4I86A 5DP4A 3F2HA 3RXIA 1O37A 1GBCA 1O2LA 3A86A 3UUZA 4A1TA 1GMHG 1NM6A 1JRTA 1W0KD 2QCYA 4ZH8A 5EPYA 2GDEH 4IN1A 4JYTA 5LPFA 3GOVB 3ZIAD 3ZVGA 1MTUA 1TMTH 3HGNA 4BAOB 1FX0B 1WTHD 4X2XA 2O8UA 2W26A 2FEQH 3UTUH 1MAYA 3SV2H 3O8RA 3ODDA 2TRMA 3LIWA 4P00A 4JMYA 2A0QB 5C1UA 2BLOA 2KX4A 1BJVA 3PLBA 1B5GH 2RCEA 1O3AA 1E37B 3RXMA 3QTVH 4Q80A 3KYGA 5CE1A 2GCHF 3VPKA 1UK4A 3E0NB 4Y8YA 4NG9H 2Y80A 1C5WB 1MH0A 2FZZA 3TGKE 1X7AC 1E35B 1D3DB 5FPYA 1EUFA 4BANB 3SJIA 4O3UA 1S83A 1EZQA 3LJOA 4MPUA 4AX9H 2BTCE 1GHZA 2RG3A 1O2ZA 2ZU5A 1CHGA 5E2OA 1HAVB 4ZUHA 2HLDD 2VB0A 1HXFH 4K1EA 1WQVH 1O2QA 2J98B 1HAGE 3FP7E 2YNBA 2ZWLH 3EYDA 1GBIA 3RXSA 3O8BA 3KEEA 2G81E 3MOCA 1SC8U 4MNXA 2AMQA 1ZLRA 4Y0YE 1PPZA 2WV5A 3LH1A 1K22H 1BBRH 2ZCLP 1UCYH 4ZKNU 4OM9A 1AWFH 3S9AA 3SU5A 1PQAA 1VITG 1XUFA 4TY7A 3UOPA 1JWTA 1DWDH 3SU6A 2IPQX 1KLTA 1P2OA 1C4U2 1GJAB 1ZSLA 3SJ9A 1T8LA 5CDFE 4CHAB 1MTSA 1OWIA 4KTCA 3LPRA 1NESE 1OPHB 1QIXB 4ABHA 3SU3A 5JBTA 2ODYB 1QCPA 1MBMA 4ZXYH 1FNIA 1ELDE 3RMLH 1V2VT 2J98A 4K8YA 1QL8A 1RTKA 1GJ4H 4J2YB 3QN7A 2FI3E 2HLCA 4RN6A 1ACBE 1SQOA 4Y8XA 3TGIE 2AFQB 3LH3A 2Y6TA 2OD3B 3BTWE 3SHCH 2A2QH 4AFQA 4E7RG 4K8BA 1TRNA 2PKSB 1DITH 1EAWA 2XCNA 2FYQA 1BOQA 2XYAA 1NY22 1T7CA 1C5VA 1CT4E 1P2NA 3SV8A 5C1YA 2CMYA 5TJXA 4JZFH 1SSXA 1TX7A 2FI4E 2G00A 1BJUA 1XUIA 5DP7A 4TY6A 3ZZ6A 2ZDLA 4UFGH 2SGAA 1GMDG 1B0EA 1ZTJA 1UTOA 1FY8E 3GYLB 1QRWA 1D3TB 1C1VH 1FQ3A 2ZGCA 1KXBA 2D8WA 3B9FH 3R0FA 1YCPH 1LHDH 1ZPBA 1KXCA 1QQUA 1ZHMA 2ESTE 3RDZA 3Q00A 1EXFA 3AAUA 2OC1A 5EJLA 3SNEA 2BVRH 1O3EA 5DG6A 1K21H 1Z6EA 1MMJN 4ABFA 1FY5A 2BD8A 1GCTB 2BXTH 2GV7A 2F9UA 4FUBA 4KGAA 3VB4A 2WZQA 2O8WA 4IMZA 3BTDE 3GCHC 1XUKA 4I8GA 1C2EA 5IK2D 3PLPA 1SQRA 1UCYK 2BM2A 3W94A 4OS5A 1HFDA 4GLYA 1LVOA 1G36A 5LGOA 4SGAE 4ZKOU 3PROA 1NFUA 1Y59T 3BTQE 1SGEE 5T6FA 4HG6A 5CHAC 3CS0A 1GWAA 3ATWA 3ELAH 1C5SA 3F9GA 1O3MA 1NZQH 1A7SA 3KQDA 4Y7AA 3MU0A 1QGFA 3PM3A 1ID5H 1GJ7B 2FOGA 1GL1A 1A2CH 3OTJE 3UB0A 3VXEH 1YPHE 1PPEE 5GPIB 3PMJA 4ZKSU 4ASHA 3A88A 3HPTB 1C5QA 1TE0A 4F4OC 3UWIA 1L1GA 4K69A 2J92A 1HAHH 2J94A 1TNLA 1YYY1 2ZFRH 4FXGH 3RMMH 2BD7A 3UAIC 1P06A 6CHAC 3E16B 1SQTA 1C1RA 2TGPZ 4X1RU 1NRSH 3QLPH 3E8LA 1GMHF 1IQJA 1W10U 3I78A 2ALVA 3QO6A 1AVGH 1FY3A 1UVSH 2GX4A 5L30H 4K60A 2UUYA 4TPIZ 3RM2H 1DM4B 1O3OA 1HIAA 4MQAA 5EJ1A 4ABGA 1GDNA 1AO5A 5F53A 2OTVA 1SFIA 1ESTA 4FUDA 1QURH 3JZ1B 2XW9A 2KCOA 1L1JA 4DIIH 5GCHF 2R2WU 4LZ1H 1Z6JH 2FOFA 2QF0A 2WPKS 2H5DA 3AASA 5C3NA 4Q4LA 1GJBB 1GG6C 1V2WT 3RXCA 3K9XB 4JK5A 2KCAA 1GBEA 2VU8E 3SJOA 1SFQB 1CGJE 2HPPH 3SU1A 2GCTB 1RIWC 5EIYA 1BBRK 3P92A 3M35A 1FN6A 1QR3E 2BD3A 4HI3A 4WJG2 1E34B 3A89A 3R3GB 1EX3A 4U30A 2J97A 2ZCHP 3TVJB 1RJXB 3AVZA 3KGPA 2EI7A 3A7VA 2FOCA 1K0HA 1SGDE 2KZ4A 5FPTA 2EI6A 1NRNH 2BLVA 1Y5UT 1Z8RA 1BTPA 1C5YB 1C1PA 3M36A 4RSPA 1NU7B 1S84A 5FHTA 2EC9H 2QN5T 1C1TA 1SGQE 1T32A 3EAJA 1EOJA 3LGWA 1DWCH 1E1RD 4AG1A 1FMGA 5EOKA 1LKAA 2A7CA 1CGHA 2JETC 3RU4T 1K28D 2R0KA 1C2IA 2XBWA 2EI8A 1Y5AT 2WUBA 1LPGB 2GP9B 1RFNA 4MPXA 1TAWA 3A7ZA 1NRPH 2FI5E 1GMCG 1K9OE 4WMEA 3SUFA 1GDQA 1S0QA 3RXUA 4BAKB 4CRFA 1ZTKA 1AB9B 2XWAA 3SV9A 1W0YH 4TT3D 4JZDH 1GJ8B 1AFQC 2XBVA 1BQYA 1TPPA 5T1VA 2HVXA 1EOLA 2Z3DA 1H4WA 2KFWA 1IQHA 1G9IE 4NZLA 3S9CA 1K1JA 1MKWH 2ZU2A 3FZZA 1NBME 3BTME 3P8GA 2PGQB 3KQ5A 1BITA 2QAAA 3HKJB 3LGIA 2O8LA 2BD4A 5ETXA 4WH6A 4I8LA 4YZUA 1W14U 2B9LA 3UQVA 1O2SA 1HJAC 1RTFB 4AFSA 3ITIA 3AW0A 3U8OH 3SNAA 4NA9H 2WSSD 1WTGH 3S69A 1F0RA 4CBNA 4AZ2B 2GDDA 1IQKA 2XRCA 1CA8B 4OS7A 1CBWC 2ZHWH 3M5MA 1RTLA 2PW8H 3TPIZ 1QQ4A 4AN7A 2FMJA 5AFZH 3M5NA 4KP0A 5A09A 1WBGB 1GMCF 2SNWA 7ESTE 2HGTH 2FOBA 1AHTH 5HM9A 2IN2A 3UQOA 1P2QA 1V2RT 6GCHG 3F6UH 3A7WA 3QZRA 1YY3A 5FBEA 4O9VA 1K2I1 3V12A 3P8NA 4B2AA 1EZSC 2C8ZB 1O3CA 4K3JA 1HNEE 3U69H 1O3JA 1LVMA 1Z7KA 2BY8X 3A87A 3PLKA 2Y5GA 5LH8A 3BTHE 1DY8A 1SLUB 3KQCA 4AOQA 1YCPM 3MWIU 1V2ST 3PMAB 1B0FA 3ATLA 5DGJA 1CGIE 2OC7A 3SJ8A 2P93A 2TGTA 2ANMH 5KGOA 2ZG0H 1OXGA 4X8VH 1LHCH 1PFXC 1AWHB 1BMLA 2ODQA 3IG6B 4WH8A 1MCVA 1TGCA 3GY7A 5EODA 3SUEA 1TOCB 1BTUA 3GY4A 2SGFE 3MHWU 3W95A 3PV5A 1DE7H 3LOXA 5JBBS 3ZVEA 2LPRA 1W2KH 1FY1A 1RGQA 4ISHH 1MTWA 3IITA 1UTLM 3MH7A 1J8AA 3H5CB 4UD9H 2PWXA 7GCHF 1NN6A 4JK6A 3K6YA 3SU2A 2GZ9A 3PO1C 4BAQB 1J17T 3B23B 1GI0A 3ZZ7A 2OC8A 1ARBA 2CHAB 3ZV8A 3NUMA 1SHYA 2NU2E 1P12E 4XE4A 4MNVA 3Q76A 1IOEA 1O34A 2PKAB 4KTSA 3A8CA 1SLWB 1V2TT 2DE9A 4JZ1A 1DXPA 3A84A 5BRRE 1A1RA 2YNAA 2GMTC 1VKYA 4INKA 2BZAA 3RP2A 1V3XA 4JZIA 2R9PA 3DHKH 1LQEA 1UCYE 2VH6A 4WXVA 4UEHH 3F9FA 1OS8A 1VJ9U 1DS2E 1S0RA 5DSFA 1C9TA 4MPVA 2ZU3A 1O2GH 4DJZB 3PRBA 1YPMH 1ZMJA 1EATA 3TK6A 2IPHA 1MBQA 4I32A 3PV2A 5JPMH 3NK8A 1NPMA 4B76A 1JMOH 4XBBA 4A1XA 1Y3YA 1Z8IB 3GY8A 3VB7A 3OTPA 2K0QA 2ZDAH 3SV6A 2QY0B 1SPJA 4X2VA 1SR5C 2KM0A 5EU8A 5H4IB 2ZDVH 1O5EH 1WOFA 5EPNA 3OEHD 3SQEE 1UHBB 2ZDKA 1H8HD 1ZPZA 4NFFA 3PYHA 1GDUA 2BD5A 4M9FA 4R0IA 3RXBA 3A7YA 2VWOA 4X1SU 1N8OC 2CF8H 2HRVA 3QTOH 2QYIA 3STIA 1MTNC 3GYMA 1GBJA 4YOJA 1QNJA 4NFEA 1EZUC 1C2GA 3OSYA 1UVPA 2QGRA 5AVDA 5GXPA 1F0TA 2KR7A 2VGCC 1BTYA 3BG8A 2QA9E 1MZAA 3LONA 1YCPK 1BZXE 3E3TA 4H6SB 2I6SA 4YO9A 1C2JA 3ZVCA 5G4BA 1F2SE 2J5UA 2Y5FA 5KECA 4XBDA 1O5CB 3SZEA 4TYDA 1DPOA 2AS9A 4Y6DA 3SHAH 5FL7D 3OFND 5FBIA 2F91A 2EA3A 1NFXA 2XTTB 4QT8C 3UFAA 1GJ9B 4Y0ZE 4D7FA 4CH8B 4MNYA 2UUKB 1H9IE 1GBBA 3FN8A 2Q6GA 1FPHH 5ABWA 2ASUB 1BMNH 3FP6E 5BPEA 1ZRBA 3RXRA 1AE8H 5EQSA 1ELVA 3KYFA 2GD4B 3M5LA 1FIWA 1GGDC 2GGVB 3GY3A 2WYGA 3D62A 3ZZ8A 5JYIA 2ZTYA 4ZHMU 4THNH 4I33A 2QXJA 2ZHQH 1WU1A 4MVNA 2QF4A 4ABAA 4ISNA 2BLQA 2OCVB 2A4QA 2Z94A 4TWYA 3PMBB 5F6MA 2PP6A 4WVPE 4BTTB 5C5NA 2AH4X 3A85A 1A3BH 4ABEA 4AFZA 1QBVH 3GY6A 1C2KA 1YKTA 1YBWA 3QWCH 2F9NA 3GY5A 3ODFA 4GUXA 4U2WA 1W8BH 1ANDA 2AIQA 2ZGXH 1WUNH 1GI7B 1KLIH 1O32A 3DUXH 1C5PA 3P95A 1O3PB 5JBCS 4FUHA 4NSVA 2R3YA 4J1YA 4NIYA 3BTEE 1EJAA 1UO6A 4Z6AH 1GJ6A 3DSGA 4Q7YA 5EQRA 5F8ZA 4NIXA 3SORA 3UR9A 1QA0A 1EP5A 3FAOA 2F9OA 1NO9H 4FOUC 3E1XB 1P9UA 2PHBA 1TNHA 3BTKE 1O31A 2F9BH 1A5HA 2BY5X 1GBLA 1H8ED 1GI1A 2AMPA 2CF9H 4H6TA 1HAPH 2EEKA 5HXFA 1O2MA 1S82A 4F49A 1MTNB 3F2FA 3MH6A 1D6RA 3I29A 5HYOA 3F9EA 1TRYA 1ETRH 3PO1B 2WUCA 2F4LA 4XD7D 4ACBA 1LHGH 4RT1A 2H1UA 1SGCA 1GCDA 2NU3E 2F43B 1CO7E 1VCPA 1SI5H 1AZ8A 1TX8A 3SJKA 2J38A 2VIDA 1GI6A 3DD2H 1BHXF 2ZU4A 4LK4A 3TITA 2SGEE 1P8VC 4CREA 2GKVE 4K1SA 1THRH 1SLXB 4OGXA 2Y81A 4Z0KA 3EDXB 1ELCA 1XVMA 2R0LA 2VWLA 1GJ5H 3EA7A 4GCHG 1CT0E 3VG8A 3NWUA 2FOAA 3QZQA 2VIWA 4ZHLU 1HAZB 3LT3A 1OX1A 5A0CA 3V0XA 3RXGA 1LKBA 3RU4D 3TK9A 1BCUH 3SU0A 1KXAA 2BX3A 2A31A 3AK5A 1DANH 5JBAS 2HNTC 1LTOA 1G3EA 4UFDH 4Y71A 4AB8A 5HIYA 2FYRA 1E38B 1T8MA 1TOMH 3MNXA 2ZNKH 1AKSB 2GCTC 2A4RA 2FX4A 2P95A 2W7UA 4AGKA 3EQ0H 1QHRB 2J2UA 3DA9B 3RC6A 1SGNE 3N7OA 2A7JA 3T2NA 2QF3A 2FLBH 1E79D 5FXLA 1O2UA 3S7HB 1CA0C 3BSQA 1XUGA 5EXMA 1F7ZA 3ZYEA 4X6PA 1P04A 2WYJA 1W13U 1VITH 1MU6B 2BDCA 2THFB 3P6ZB 4NZQA 1XVOA 2CHAC 2QXHA 1C5NH 5HGGA 1A0HB 3EE0B 1FUJA 1O39A 2KAIA 5C20A 1HUTH 4X1PU 4AG2A 3TJOA 1G2MA 2EY4C 4A6LA 2GCHG 5L6NH 1TX6A 2BDBA 4D7GA 4O03A 1O2PA 2PV9B 2ZDNA 4ZKRU 4GHTA 3TNSA 3PWCA 4FU9A 1ZSJA 3ZVFA 4ABIA 3EGKH 1A4WH 4YTAA 1HAOH 1TBZH 1LO6A 3U9AH 2JDID 5K0HA 1F0UA 1ZR0A 3SV7A 2SNVA 2CXVA 1G3BA 2BDGA 2VH0A 1F5KU 1H1BA 1UTKA 3A8BA 4CRGA 1OSSA 1GBHA 2RFKC 1EAUA 1PYTC 3GS9A 1ETTH 1D4PB 4B71A 4Z1MD 2A7HA 1C1MA 2G4UA 1KIGH 1O3NA 1AU8A 2VWMA 4LXBH 4VGCB 1D3QB 2UUFB 4IGDA 4FUEA 2HALA 4I7YH 3P17H 4Y7BA 1P11E 5K7RA 1FLEE 4X2WA 4DVAU 1M9UA 2OQUA 3DFLA 5LPRA 1GVZA 3NCLA 4OS1A 2YMSD 3VGCC 1EP6A 1IQGA 3PV4A 3FANA 1Z1JA 4NGAH 4ASUD 4YESB 1Q3XA 1EB2A 1HXEH 2Y7XA 1P2IA 3A7XA 1A46H 3UNRA 2ZPSA 1EKBB 3RXKA 3ZZ4A 1GBDA 2TBSA 1LVYA 4D76A 1SVPA 4FU7A 1T8OA 1O36A 1SQAA 1Z1IA 2D1JA 3MU8A 4CRAA 5EW2H 4AB9A 1T31A 1QBNA 2Y5HA 1XUHA 1HIAB 2ANKH 4FU8A 4CR5A 2NU4E 2BMGB 3DSOA 2SGPE 2F9VA 1AGJA 3KF2A 6GCHF 3ZZ5A 3UIRA 2BX4A 1AMHA 4RI0A 4A5TS 4IMQA 2FM2A 4FVBA 4XBCA 4H4FA 3BV9B 3CNRA 1C2LA 2O8TA 2BQWB 3BG4B 1TNJA 3MYWA 2VBCA 3M7TA 2GJGA 1ZTLA 5TCCA 3OYPA 1NTPA 1KXFA 1HGTH 2XC4A 1CHOG 2HOBA 1YLCA 1UTQA 4UDWH 3M7QA 1VITF 1A61H 2P3FH 1QJ6B 2FODA 1GI2A 3UNSA 4Y76A 4NA8A 1TA2A 2B0FA 2FP7B 1GI4A 1INCA 1K1OA 5L2ZH 4CRDA 2H9TH 2PUQH 2XC0A 1ANCA 1WXRA 5DK1A 1UTJA 3KQBA 2V6NA 6ESTA 3T26A 1XUJA 1DWEH 4NSYA 4D9RA 4INHA 5C0TA 3ENSB 4TPYA 5FCKA 1PPBH 1FIZA 1LQDB 2ZA5A 1FI8A 3LGVA 5SGAE 1IAUA 2C3SA 1O33A 2AGIX 2KCPA 1ESBA 2BB4A 1P2MA 2FOHA 2SFAA 2P3TB 1QRZA 2VIPA 1VJAU 2P3UB 1O3GA 5CHAB 1YPLH 1SGYE 1O2RA 6LPRA 3K2UA 1TPOA 4YLUA 1QA7A 1TPAE 4O97A 3ESTA 1UVOA 1MD8A 2XWBI 5DP9A 2F3CE 1HJAB 1HBTH 2OC0A 3D23A 1MZDA 1RS0A 1EAIA 4AYYB 1NROH 1C4Y2 1BB0B 1JRSA 1BA8B 1PJPA 1VGCC 3PWBA 4ISOA 3TH4H 1O5GH 4SGBE 3BN9A 1AE5A 5I46H 3TH2H 1BTWA 2XNDD 1GCTC 2ZQ2A 1O3DA 1WYKA 1O5FH 2V7QD 5AHGH 3ZZ9A 1O2YA 3UNQA 5J4SA 3ATKA 1ELAA 3N7EA 1XMNB 1TGBA 1XKAC 2GVFA 3RLWH 1WDIA 1PPGE 2Z9LA 1DUEA 3A81A 3OEED 2JETB 5JB9S 1GBKA 1RXPA 3LKWA 2XCFA 1GI9B 2WPIS 1E0FD 3S9BA 1TGTA 1BIOA 1G3CA 1KLJH 3U8TH 4ACAA 1HB0B 5PTPA 5A8XA 1ELFA 2XOKD 1TALA 1O2VA 1RD3B 3T27A 3A8AA 4ZROA 1NT1A 1KTTB 3SGBE 3OE7D 2FO9A 5A8ZA 3A83A 3UOUA 1WSSH 1SMFE 3QX5H 1SHHB 3SI3H 5C0UA 2BXUH 2JKHA 1NRRH 1O2HA 4ABBA 4A7IB 3VXFH 2GZ8A 2OXSA 1VR1H 1DSTA 3VEQB 3RXPA 4X6OA 2HNTE 1OP8A 1IQEA 1NS3A 5T3HA 4AGJA 1BUIA 3FZDA 4ABDA 3BIVH 1TNIA 1TIOA 2ZC9H 1YC0A 2C4FH 2J9NA 1COWD 4B73A 1GHWH 2W3IA 4JZEH 1UHBA 2PSYA 1ESAA 3A7TA 1PQ5A 1WCZA 3ZV9A 1C5XB 1V2MT 2AYWA 1GI8B 1ETSH 2G52A 3UPEA 1FPCH 2Z9GA 1ZGIA 1TRMA 1KXDA 5E0JA 2BQ7B 2A4OA 1C1SA 1CHOF 3QK1A 3UR6A 8GCHG 3L6PA 4ZHAA 4CBOA 3E91A 4K5ZA 3CS7A 2BY7X 4Y10E 1XKBC 2HVYB 2JIZD 1GPZA 3BTGE 1AVWA 3NRLA 3FP8E 1W7XH 1WQSA 2NU0E 4XOJA 1BTXA 1MCTA 5E8EH 1PPHE 1AKSA 4LZ4B 4M7GA 3D65E 3AW1A 2V3MA 1P2KA 2FTLE 1V2NT 2AGEX 3O8DA 3TK5A 3SN8A 2WPLS 5KEDA 2XNIA 1K1NA 2WPHS 4HTCH 4WWYA 1UMAH 3GCOA 4BAMB 2A2XH 1CU1A 1OYQA 5E0HA 1JOUB 4Y79A 2AEIH 2Q6FA 1MKXH 1GHXH 1ZSKA 1GHBG 5DP6A 1BRUP 1EFRD 1NU9A 1T8NA 3F2GA 2ZI2H 1W7GH 4CH2B 4IW4E 2OLGA 3LGYA 1LCYA 4ISIH 1GMDF 3GCHB 3RMOH 2VIQA 1TQ0B 3V3MA 1HYLA 5CHBA 5AF9H 1AY6H 2ZU1A 1AI8H 1KTSB 2ZIQH 2FPZA 1EASA 3GDSA 1EQ9A 2HPQH 4XFQA 2PLXA 2QE7D 3U1JB 5EGMA 1G30B 2H6MA 4Q7XA 2G5NA 3F68H 5DJ7A 1P01A 1C2DA 3BEFB 2ODPA 3TJNA 2Q1JA 1RRKA 1RIWB 1QJ7B 1AIXH 2QIQA 1UK2A 2W6ID 1NBMD 1WAYB 1MQ6A 2ZHDA 1C1OA 1LHFH 3HK6B 1L1NA 1TYNA 1YLNA 3T28A 2OK5A 1YPHC
chains in the Genus database with same CATH topology
4DGJA 2BD9A 1K1PA 2FWWA 3BIUH 3OY6U 4K1TA 2ZECA 1LPKB 3TIUA 3NKKA 3ZYDA 1ZPCA 1GI3A 5AFYH 2C8WB 1UVUH 4AFUA 3K65B 2V35A 1VZQH 3TJVA 3PTNA 1O35A 3SUDA 3FFGA 1GBFA 1HJ8A 2ZGBH 4DG4A 1SGFG 4GHQA 1DSUA 5EW1H 2A1DB 2QC2A 4R8TB 4UONA 2YOLA 2G4TA 2OBOA 8KME2 1QRXA 4BTUB 1DVAH 2CGAA 5TCAA 4NIVA 1PQ8A 3EA8A 2TGAA 2PTNA 5IYTA 2P59A 3KN2A 1UTPA 2ULLA 1PQ7A 1SL3A 3M5OA 1OP2A 2ZFFH 3EA9A 2FLRH 1D6WA 3C1KA 3T29A 3VB6A 2OUAA 5FX5A 3HK3B 2BOKA 1ORFA 1P9SA 3Q77A 5JB8S 4X6MA 5F8XA 8LPRA 2IJOB 4CHAC 3RU4E 3VB5A 1ZMLA 2RA3A 1C5UA 1IQFA 4DT7B 1D3PB 3UY9A 8GCHF 4DW2U 1N6YA 2ZFQH 2CJIA 1OWHA 1BRBE 2ALPA 1A0LA 3MH5A 5GJ4B 1CQQA 2UWOA 2ZCKP 3SNBA 1FY4A 1IQIA 4FUIA 2FIRH 4CRCA 2G55A 1UTNA 1HRTH 4GPGA 1ZJDA 2IOTA 5LPEA 4OS4A 3VB3A 5F8TA 1F5RA 1ZOMA 4RKOB 3RXQA 3S7KB 1Y3UA 1MAXA 1J16A 3K6ZA 3MTYA 2B5TB 4H42U 4X8UH 3GCNA 3U98H 3GCTG 9ESTA 1ABIH 2ILNA 4UE7H 2DE8A 5A8YA 3VGCB 3BTTE 3ZZBA 3OY5U 1FXYA 1O2TA 1AN1E 1KDQA 1O2JA 1SGRE 1QY6A 1Y3VA 1GI5A 2C8YB 1JIRA 1N1LA 2KAIB 1H8IH 3M37A 1ZHRA 2Y7ZA 4D9QA 1Z71A 1BTHH 4Y11E 5C1XA 3KHVA 1GBTA 3PB1E 1B7XB 3STJA 1K1MA 1TQ7B 2PUXB 1C5MD 1W12U 4YT6H 4YOGA 4B74A 3G01A 3UWJH 1TA6A 5GDSH 3RXHA 1O2KA 5GCHG 3ZVAA 2ZTZA 3SGQE 5T6GA 1L2EA 2V0BA 1TMUH 4FUCA 5FX6A 2ZDMA 1ELGA 3LDXH 2Z9JA 2QXGA 4BAHB 5FAHA 4D8NA 1V2UT 4RKJB 5JDUB 1NFYA 4IC5A 2D2DA 5GIBA 4IN2A 2G8TA 5ESBA 3ZVDA 2XXLA 4LOYH 1O3KA 1IQLA 2P16A 1YPEH 4MG3A 3PTBA 1P3EA 2ZFSA 1N8OB 3MFJA 1QTFA 2BZ6H 2PKAA 1O3LA 3MI4A 1G32B 1O2XA 3OX7U 3RM0H 1Q31A 3P8OA 1YF4A 1C5RA 1EPTC 4IS5A 1EB1H 3MO9A 4X1QU 3RXFA 1Z8GA 1EAXA 1ZZZA 3SO3A 4MTBA 3BEUA 1V2PT 3GDVA 5E0GA 1TABE 3KCGH 1HV7A 4MLFB 2DUCA 2M5TA 4HGCA 3SNCA 3T5FH 1S6HA 3LGUA 4GSOA 3I77A 1T4VH 3SZNA 4YT7H 2FOMB 4WF8A 2OBQA 2Z9KA 1BMAA 3QGNB 1SG8B 1H9LB 4MDSA 2BLWA 5ESTE 1ELEE 1O2IA 3BG4C 2ZEBA 1XXDA 4B75A 5IDKA 1O2NA 3A80A 1CE5A 1DWBH 2GMTB 2CN0H 4INLA 1EJNA 3TGJE 2K1QA 2H9EH 4X1NU 1O0DH 1FV9A 1K1IA 1QL7A 2BYAX 1TB6H 1YM0A 1C1NA 1S6FA 1SOTA 2C93B 2OQ5A 2GTBA 2NWNA 1DICA 3RLYH 1MD7A 4AORA 1L0ZA 1THSH 3E90B 2OP9A 4PROA 1O2OA 3O8CA 1OWEA 3KIDU 1MQ5A 2VJ1A 3V13A 1SGFA 1Q2WA 3URCA 1G2LA 2GT7A 1LMWB 2AGGX 3LU9B 1TBQH 2ZP0H 3DT0H 5EQQA 3MNBA 1C5ZB 1O2WA 1DLEA 1DY9A 4UFEH 4WY3A 2A4GA 5J4QA 2FOEA 2R3UA 1AFEH 2B8OH 1Z8JB 5FPSA 1GBAA 4Q2KA 3RXTA 1Y3XA 4BXSA 3M3TA 1UJ1A 3VFEA 4E7NA 3ZVBA 2ZFPH 2TPIZ 1XXFA 3SW2B 1L4ZA 2J34A 1YLDA 1YP9A 1FJSA 1FZZA 4X0WU 3B8JA 3GY2A 3AAVA 1OYTH 3RXEA 2VWNA 1HPGA 1FN8A 1O3IA 2C90B 1ZGVA 1S81A 5DKMA 1J9CH 3JZ2B 4O3TA 7KMEH 2VVVA 1H9HE 2GV6A 1TGNA 2ZHEH 1TPSA 1G37A 3M3SA 2A32A 2NU1E 1ZMNA 3IWMA 1KY9A 1KDQB 1O5DH 1OOKB 3MU4A 2ZPRA 4WXIA 2F83A 2A5AA 3D49H 1P0SH 3MNCA 3KL6A 4X8SH 3A8DA 1YPJH 1P10A 2RA0A 1CBWB 2P8OC 5EXLA 4A92A 1DX5M 3S0NA 3QUMP 2A45B 4FVDA 3T62A 1BHXB 1BMMH 2TIOA 1KYNA 1CT2E 4I8HA 1QB9A 1P3CA 1CA0B 1O5AB 2ZZUH 1FONA 1O5BB 1WV7H 2PGBB 1C9PA 2H9HA 2AERH 3F1SB 3QGJA 1IQNA 5B6OA 2W3KA 1V2KT 5HM2A 3GISB 4MPWA 2Q6DA 4U32A 1VGCB 2BD2A 2ZTXA 1HAYB 3FVFB 3OU0A 4NIWA 1DXWA 4FUJA 4JCNA 2D26C 4DIHH 2PR3A 1O38A 1Y5BT 5GWZA 4E05H 5HMAA 4NWLA 4K2YA 3TNTA 1V2OT 2VGCB 5FCRA 1JXPA 1TLDA 4AYVB 2FXRA 2V3OH 1UTMA 4MNWA 4FUGA 4HZHA 1QBOA 2BDIA 4OGYA 3L33A 2FS8A 1QB1A 1GHYH 2O8MA 1BTZA 3M3VA 4YOIA 3SOSA 3MMGA 4B1TA 3V7TA 1QJ1B 4TWWA 1SOZA 3SI4H 1H8DH 3Q3YA 4CR9A 1NRQH 3RXOA 2W5EA 2XC5A 3RUOA 1MTVA 2Z9IA 4I8JA 2WV4A 3RC5A 3H7OA 1UVTH 4X2YA 2JH6D 5C2ZA 1MKXK 1P57B 1O30A 2VVCA 3LC3A 2XBYA 4GCHF 3L3TA 3KQEA 1P03A 3WY8A 2BOHB 1UK3A 4B2BA 2VNTA 2LNCA 2UUJB 3E6PH 1DDJA 1GG6B 3KNXA 2VINA 1J14A 3MO3A 1C2HA 4JYVH 4WMDA 3SNDA 5F03A 2FDAA 4ESTE 2ZQ1A 1QL9A 2P8OB 1TFXA 1K1LA 2I6QA 1FAKH 3C27B 4KELA 1KXEA 5A2MH 1YPGH 1EJMA 1GJCB 4NWKA 1JIMA 4DOQA 3RXAA 3H7TA 2FTMA 4ZXXH 1AB9C 1C5LH 2STAE 1W3CA 1W11U 5DPAA 1J15A 1AVXA 6CHAB 1ELBA 4X6NA 1QFKH 1Y3WA 2AMDA 5EXNA 3GICB 3UREA 1PYTD 3LJJA 1LVBA 1ZRKA 1XX9A 2GZ7A 3MU5A 3ATIA 3P70B 3QDZB 4JYUH 1AZZA 2PFEA 1JBUH 1P2JA 1ANEA 1GBMA 2SGDE 3TJUA 1BT7A 4Y8ZA 1ELTA 1EZXC 1OWJA 1DT2A 4NCYA 1O3FA 1F0SA 2Z3EA 1GGDB 1ABJH 9LPRA 1YPKH 3MO6A 2ZGHA 3URDA 4VGCC 1BRAA 4KTUA 3F9HA 4IBLH 1CVWH 4CRBA 1G3DA 4GVUA 2HNTF 3RXLA 2B7DH 1TBRH 4Q7ZA 2W7SA 7GCHG 2J4IA 4B2CA 1P02A 1GHAG 1TMBH 4FUFA 1DFPA 1C5TA 1HAIH 1A5IA 4ZAEA 1A3EH 3MU1A 2XBXA 3TU7H 4ABJA 3LC5A 1DUAA 1SGTA 5L2YH 3SGAE 2QV1A 3ZZCA 3M61U 1IQMA 4IC6A 2VIVA 5E2PA 2AIPA 1F5LA 3MNSA 2O9QA 3Q3XA 1SLVB 1TWXB 5T6DA 3DFJA 3ZZ3A 2JH5D 4NA7A 1C1UH 3RC4A 2BQ6B 3GDUA 1C2FA 2FS9A 1EPTA 1VCWA 1SBWA 2UWLA 4OS6A 1BDAA 1LHEH 2OINA 5CMXH 4WMFA 2Z6BD 1C4V2 3GCTF 2R2MB 1IHSH 1CSOE 1HJ9A 1TONA 1SGIB 2ZPQA 1SGPE 1C2MA 1XM1A 2SGQE 3ZZDA 2Y82A 2VIOA 1KSNA 1W0ZU 1GL0E 2A5KA 1C1QA 1LDTT 3RMNH 4BTIB 2RDLA 3BEIB 3SU4A 3TLOA 2TGDA 1ZJKA 2PKSC 4ZMAH 1S85A 5C5OA 2J95A 2UWPA 5C67A 4I8KA 1C1WH 1MUEB 2F9PA 1MKWK 3NXPA 1OWDA 1U6QA 4XSKU 3U8RH 2G51A 3RXJA 1V2LT 4DURA 2WPMS 1P05A 1NFWA 1SB1H 2FX6A 3U1IB 3SUGA 4BNRA 2ZO3H 3P8FA 4BXWA 5DP5A 2ZFTA 2FESH 7LPRA 1DOJA 1EPTB 4ISLA 4HFPB 5I25A 1AQ7A 1HAVA 1THPB 1HDTH 1ANBA 1YGCH 2G5VA 1VCQA 5A0AE 1V6DA 1MU8B 3RXDA 3PMHB 4KKDA 3NPSA 1A0JA 3MH4A 1N6XA 2GT8A 3SQHE 4BOHA 3T25A 4E06H 3HGPA 2P94A 2ANYA 4DY7B 1OP0A 1TNGA 3BTFE 1PPCE 2ZF0H 2PTCE 5DP3A 2STBE 1C5OH 2BY6X 3ZZAA 1GHBF 1GHAF 2HWLB 1AUJA 3RXVA 1DLKB 1GJDB 3CENA 2BY9X 2BDAA 1OWKA 2PSXA 3HKIB 5EG4A 2WINI 1FAXA 1GVLA 2Z3CA 2BHGA 4U01A 1IHTH 2BVSH 1GVKB 1HCGA 3Q3KA 1A5GH 1PPFE 3BF6H 1S5SA 2VVUA 1OKXA 2Z7FE 3TH3H 1L4DA 1AFQB 1ZHPA 2BDHA 4GAWA 2JH0D 4X8TH 2BVXH 2WPJS 1V2JT 8ESTE 4DCDA 1GHVH 5DP8A 3A82A 1AUTC 4OS2A 1HLTH 1Y8TA 2BDYA 1FDPA 1TNKA 1F92A 1E36B 3LGTA 5A0BA 2H5CA 2A5IA 2QXIA 4UFFH 1BRCE 2C8XB 4YM9A 1P09A 2V3HH 3CP7A 1ZYOA 4I31A 1QB6A 4A1VA 1O3BA 3SBKA 1ARCA 3HATH 1TGSZ 4YLQH 1LPZB 1T4UH 3NZIA 2CV3A 1BBRE 3E0PB 3ATMA 1V2QT 2ZHFH 1O3HA 2ANWA 2H2ZA 5DO4H 2ZGJA 1NC6A 4XDEA 2ZKSA 1AD8H 1HAXB 1D9IA 3M7UA 5DP4A 3RXIA 1O37A 1GBCA 1O2LA 3A86A 3UUZA 4A1TA 1GMHG 1NM6A 1JRTA 2QCYA 4ZH8A 5EPYA 2GDEH 4IN1A 4JYTA 5LPFA 3GOVB 3ZVGA 1MTUA 1TMTH 3HGNA 4BAOB 1WTHD 4X2XA 2W26A 2O8UA 2FEQH 3UTUH 1MAYA 3SV2H 3O8RA 3ODDA 2TRMA 3LIWA 4JMYA 2A0QB 5C1UA 2BLOA 1BJVA 3PLBA 1B5GH 2RCEA 1O3AA 1E37B 3RXMA 3QTVH 4Q80A 5CE1A 2GCHF 3VPKA 1UK4A 3E0NB 4Y8YA 4NG9H 2Y80A 1C5WB 1MH0A 2FZZA 3TGKE 1X7AC 1E35B 1D3DB 5FPYA 1EUFA 4BANB 3SJIA 4O3UA 1S83A 1EZQA 3LJOA 4MPUA 4AX9H 2BTCE 1GHZA 2RG3A 1O2ZA 2ZU5A 1CHGA 5E2OA 1HAVB 4ZUHA 2VB0A 1HXFH 4K1EA 1WQVH 1O2QA 1HAGE 3FP7E 2YNBA 2ZWLH 3EYDA 1GBIA 3RXSA 3O8BA 3KEEA 2G81E 3MOCA 1SC8U 4MNXA 2AMQA 1ZLRA 4Y0YE 1PPZA 2WV5A 3LH1A 1K22H 1BBRH 2ZCLP 1UCYH 4ZKNU 1AWFH 3S9AA 3SU5A 1PQAA 1VITG 1XUFA 4TY7A 3UOPA 1JWTA 1DWDH 3SU6A 1KLTA 1P2OA 1C4U2 1GJAB 1ZSLA 3SJ9A 1T8LA 4CHAB 1MTSA 1OWIA 4KTCA 3LPRA 1NESE 1OPHB 1QIXB 4ABHA 3SU3A 5JBTA 2ODYB 1QCPA 1MBMA 4ZXYH 1FNIA 1ELDE 3RMLH 1V2VT 4K8YA 1QL8A 1RTKA 1GJ4H 4J2YB 3QN7A 2FI3E 2HLCA 4RN6A 1ACBE 1SQOA 4Y8XA 3TGIE 2AFQB 3LH3A 2Y6TA 2OD3B 3BTWE 3SHCH 2A2QH 4AFQA 4E7RG 4K8BA 1TRNA 2PKSB 1DITH 1EAWA 2XCNA 2FYQA 1BOQA 2XYAA 1NY22 1T7CA 1C5VA 1CT4E 1P2NA 3SV8A 5C1YA 2CMYA 5TJXA 4JZFH 1SSXA 1TX7A 2FI4E 2G00A 1BJUA 1XUIA 5DP7A 4TY6A 3ZZ6A 2ZDLA 4UFGH 2SGAA 1GMDG 1B0EA 1ZTJA 1UTOA 1FY8E 3GYLB 1QRWA 1D3TB 1C1VH 1FQ3A 2ZGCA 1KXBA 2D8WA 3B9FH 3R0FA 1YCPH 1LHDH 1ZPBA 1KXCA 1QQUA 1ZHMA 2ESTE 3RDZA 3Q00A 1EXFA 3AAUA 2OC1A 3SNEA 2BVRH 1O3EA 5DG6A 1K21H 1Z6EA 1MMJN 4ABFA 1FY5A 2BD8A 1GCTB 2BXTH 2GV7A 2F9UA 4FUBA 4KGAA 3VB4A 2O8WA 4IMZA 3BTDE 3GCHC 1XUKA 4I8GA 1C2EA 3PLPA 1UCYK 2BM2A 3W94A 4OS5A 1HFDA 4GLYA 1LVOA 1G36A 5LGOA 4SGAE 4ZKOU 3PROA 1NFUA 1Y59T 3BTQE 1SGEE 5T6FA 5CHAC 3CS0A 1GWAA 3ATWA 3ELAH 1C5SA 3F9GA 1O3MA 1NZQH 1A7SA 3KQDA 4Y7AA 3MU0A 1QGFA 3PM3A 1ID5H 1GJ7B 2FOGA 1GL1A 1A2CH 3OTJE 3VXEH 1YPHE 1PPEE 5GPIB 3PMJA 4ZKSU 4ASHA 3A88A 3HPTB 1C5QA 1TE0A 4F4OC 3UWIA 1L1GA 4K69A 2J92A 1HAHH 2J94A 1TNLA 1YYY1 2ZFRH 4FXGH 3RMMH 2BD7A 1P06A 6CHAC 3E16B 1SQTA 1C1RA 2TGPZ 4X1RU 1NRSH 3QLPH 3E8LA 1GMHF 1IQJA 1W10U 3I78A