1HPGA

A glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
187
structure length
187
Chain Sequence
VLGGGAIYGGGSRCSAAFNVTKGGARYFVTAGHCTNISANWSASSGGSVVGVREGTSFPTNDYGIVRYTDGSSPAGTVDLYNGSTQDISSAANAVVGQAIKKSGSTTKVTSGTVTAVNVTVNYGDGPVYNMVRTTACSAGGDSGGAHFAGSVALGIHSGSSGCSGTAGSAIHQPVTEALSAYGVTVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamic acid specific protease
publication title A glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 187
sequence length 187
ec nomenclature ec 3.4.21.82: Glutamyl endopeptidase II.
pdb deposition date 1993-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hpgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hpgA01
2XBYA 3BTKE 3KEEA 2STBE 4IN2A 3CENA 2CF8H 1FN8A 2SGPE 1C2HA 3BIVH 1EZQA 2BD3A 2AGIX 4GHQA 2F9PA 2AMPA 1A5IA 4ZH8A 1BRAA 3NWUA 3S0NA 2A7CA 1ZMJA 2GX4A 1TGSZ 1HUTH 4AG2A 1C1SA 2SNVA 3LPRA 1ETTH 1NRNH 3GYMA 3UWJH 3LGVA 2GV7A 2BX3A 1YLCA 1AI8H 2HALA 1VR1H 1GI9B 4X8SH 1HJAB 2G51A 2BLWA 1OWIA 4WH8A 1C1OA 3HPTB 4Q80A 2H1UA 1BBRE 3ESTA 1HAXB 3AW0A 1GHBG 1B7XB 1SGEE 1HIAA 4DCDA 3S7KB 1XKAC 4KGAA 1NM6A 1YCPM 1E35B 3K65B 3LH3A 1W7XH 1XVMA 5HM2A 5DO4H 2GMTC 4CR9A 2WV4A 2ANYA 3SU4A 3LH1A 1O2JA 3PLBA 4GPGA 1HAIH 4BAMB 1GVZA 1LVBA 2P8OB 4KTSA 4NA9H 2EA3A 2FOFA 1GCTB 3DT0H 5F8ZA 1TABE 5I46H 1XX9A 1C1MA 1A0HB 2Z6BD 5A0CA 4GHTA 3UOUA 5C5OA 2SGAA 3MWIU 1XUHA 2TRMA 4UFEH 4AYVB 1BHXF 1QBNA 3STIA 4BTIB 1IAUA 3MNSA 3UPEA 4ZMAH 4D9QA 1BJVA 4FUGA 1FY1A 1YPGH 4Q7XA 1O2HA 2UUJB 2GTBA 1AVXA 1AWFH 1DDJA 3TPIZ 1MQ6A 5AHGH 2J92A 1GJAB 1TWXB 2VIQA 1KY9A 4ABBA 3P8OA 1S85A 4TPYA 1BTXA 3OSYA 3VXEH 4AORA 1O2OA 1Y59T 5E2PA 4XE4A 1O38A 2RA3A 2Y6TA 2QV1A 2NU4E 3SQHE 1C5OH 1O31A 5JBCS 3MNCA 3UFAA 2R0KA 3OU0A 1GJ6A 1WTGH 5T3HA 1BT7A 1GDQA 1ESBA 1OWEA 1Y5AT 3RXHA 3KHVA 2PHBA 2PKSC 2CV3A 1FNIA 2VIOA 1GL1A 2C90B 2GCHF 1MZAA 1ETSH 1ZGIA 2J34A 4AN7A 5L2YH 1ZJKA 2NU1E 1UTKA 3RDZA 1UCYE 2DUCA 1O5FH 1U6QA 1BMNH 3VGCC 1JBUH 4X6NA 5BPEA 1K1PA 3GCTG 2WUCA 1JRTA 2JH5D 1J17T 1GPZA 1KXDA 3FP6E 3GISB 2OC7A 2FESH 1G2LA 3A7XA 1P01A 3SU6A 2SGQE 1AFQC 1MAYA 3E90B 4K5ZA 2I6SA 2WPMS 1DXPA 2BD7A 1MUEB 3U8RH 1CVWH 3UNQA 3SBKA 1Y3WA 4RSPA 4YTAA 5A8YA 4CRDA 2AGEX 3KQCA 1C5RA 1AVGH 1T31A 2VH0A 2Z7FE 1BB0B 1C2LA 2UUYA 3SV7A 1RIWB 2NU2E 1BTYA 2DE8A 4B2CA 2TBSA 1MTSA 2Z3EA 4MNWA 4E7RG 2QXIA 1O2IA 1SGDE 4X2VA 1SGQE 1HJ9A 2YNAA 3TJOA 1PPCE 4Y71A 2VU8E 2GT8A 5CHAB 3EDXB 1S5SA 2GGVB 2Y5GA 4NA7A 1AZZA 3AAUA 5F8TA 4NFFA 3BEIB 4DOQA 1O3PB 1P2NA 3B9FH 2ZFPH 1F92A 2ZFRH 4CHAB 2Z9JA 1PPFE 1O2NA 1O2KA 3H7OA 4VGCC 1GG6B 2G81E 1C5VA 1H8IH 2BLVA 1A0JA 1GHAG 3QX5H 4UFGH 1MBQA 1A1RA 2EI6A 3ITIA 4I8GA 1CT4E 3DFLA 3MFJA 1EOJA 1Y3YA 1QL7A 4ISHH 1GJDB 1DS2E 3VPKA 4GAWA 1EQ9A 3A85A 3SNEA 5A09A 2AYWA 4AGKA 1P02A 4ISNA 1BTWA 1K1MA 1RD3B 1P9SA 3M7TA 5L30H 1Y3UA 1LQEA 1C1VH 3GDVA 1TQ0B 2FEQH 1O5CB 2P94A 3DHKH 4LZ1H 1SGFG 1VJ9U 2FX6A 4E06H 2FTMA 3SUFA 1Z8IB 2V0BA 4ABIA 1MTNB 2H5CA 1F2SE 1IQKA 1IQHA 2ZF0H 3BTDE 1YC0A 5A8XA 1FQ3A 4I7YH 2TPIZ 1GJ8B 2ALVA 2A4QA 1T8OA 3E0NB 2BY9X 3BN9A 5GWZA 3SJ8A 2CJIA 2D1JA 1S81A 4HZHA 4YLQH 2M5TA 1BMLA 1LKAA 2BVXH 3WY8A 3BTQE 3NKKA 1FUJA 2H9HA 4H6SB 5DPAA 3O8BA 3A8CA 3HKIB 2FIRH 2GKVE 1LQDB 1HV7A 2PUQH 1B0EA 1V2WT 1W13U 3K6ZA 1SGPE 1DLKB 1BA8B 3GOVB 1NPMA 1QY6A 2C4FH 4ABEA 2ZQ1A 2A5KA 1BRUP 1C4Y2 4ZKSU 1IQJA 6LPRA 1J14A 1RTLA 4NIXA 5C1XA 5EXMA 1QA7A 1LPGB 3QGNB 4XFQA 1G3CA 2WV5A 3GDSA 4JYTA 4X6OA 3M37A 5A8ZA 4MNVA 4UFFH 4BAHB 1O2VA 1OKXA 3HK6B 1TNIA 2TGAA 1UVUH 2F3CE 3ZYDA 3Q77A 1GHBF 2V6NA 1V2NT 2ZQ2A 5DP6A 4X1SU 5FCRA 1QBOA 1VCWA 1P2OA 1TE0A 3IWMA 4MDSA 4DY7B 3TH2H 3RP2A 2BD2A 1TA6A 1KXEA 3M5OA 1LDTT 2P93A 1L4DA 3SJKA 2O8TA 1LHDH 3M7UA 3TH3H 2BLOA 3E3TA 2ZGBH 4JK5A 1KLJH 2NU3E 2BDGA 2R3YA 3U98H 1NROH 3B23B 1AMHA 1K9OE 2GP9B 4O9VA 1BRCE 1D4PB 1L1JA 1SGIB 3MH7A 1TOCB 1HJAC 1ANBA 4U32A 1E0FD 5BRRE 1EOLA 1NTPA 1G3BA 3UWIA 3D49H 3E16B 3NZIA 1WYKA 1AQ7A 1LVMA 1WTHD 2STAE 3VEQB 5JB9S 2IPHA 7KMEH 2G8TA 1Q2WA 2P8OC 2PKSB 1GCTC 1KTSB 5FBIA 3SUEA 1TNJA 2W3KA 3K6YA 5C20A 3QZQA 4Y6DA 1V6DA 2D26C 3TK5A 2EEKA 2ZTXA 1F0RA 3SU2A 1TRNA 3B8JA 2SGEE 3T5FH 3SU3A 5FPSA 3ZZ8A 2ZDKA 1C9PA 2ZZUH 2ZGCA 4DGJA 2ZGXH 1SLXB 1KIGH 1TX8A 1LCYA 4YZUA 3E0PB 1LPKB 1CGIE 1V2OT 1WQVH 2A2XH 4Y10E 3I78A 1N6YA 1C2JA 1OP8A 3SHAH 1E34B 1F7ZA 2G4TA 1QB9A 5C1UA 2ODPA 3ZVDA 3GCTF 2HPQH 1O3EA 2FI3E 2GCHG 2FO9A 1O5BB 3SN8A 2THFB 4Y8YA 1UTJA 2A4GA 2BM2A 2F83A 2OBQA 3UREA 2HGTH 1KXAA 3S9BA 1NT1A 5GDSH 2PTCE 1MMJN 1DICA 1T8LA 1DUAA 1TGBA 2UWOA 3S69A 1TPSA 3SNDA 4IBLH 1GBFA 2R2MB 1P0SH 3ATIA 3A82A 1A46H 3C27B 3EQ0H 2ZGHA 1O5EH 4Y8ZA 5DP9A 3SGQE 4FU7A 3G01A 1AU8A 1P2IA 2AH4X 2UUKB 3Q76A 4XSKU 3TNSA 1NRQH 1KTTB 4NIYA 1NZQH 3RXTA 1T8MA 1GMHF 3UTUH 4B2AA 4FUJA 5K7RA 3RC5A 2Z3DA 3LDXH 5IYTA 4A1XA 5LPRA 3LOXA 1QL8A 2ZWLH 1C5WB 2QXJA 1CQQA 3GY6A 1QHRB 3M3TA 1SL3A 2JH6D 1QCPA 3VB6A 2R3UA 1RFNA 4X2YA 4TPIZ 1AVWA 3U1JB 1FY8E 1MTUA 2O8MA 1TGNA 4MG3A 1AE5A 1SGTA 1KXBA 2VVUA 1GHAF 3RXEA 1SG8B 1Z7KA 1RIWC 1HNEE 3LIWA 1YKTA 1KDQA 1L1NA 1IQNA 1Z1JA 1GBHA 1CGJE 3A7WA 4H42U 4YOJA 5CHAC 1P09A 4FUBA 1IQGA 5DP3A 1W7GH 3ODDA 1NU7B 1K1OA 2OQUA 1FAXA 3FP8E 1UTPA 4ZXYH 4ABHA 1EPTC 4HTCH 1ELFA 4CR5A 5A0BA 3MU8A 1P03A 1F5RA 3O8DA 2HLCA 4A5TS 1TBZH 2FDAA 3SORA 5FHTA 5DGJA 1OS8A 1YPHC 1PPEE 1ETRH 2VJ1A 5LH8A 1GG6C 4K8BA 1EAUA 5FX5A 1CA8B 1BQYA 2ULLA 4OS2A 4UE7H 4ABDA 2CHAB 1E37B 3SNCA 1C1PA 3RXPA 1V2QT 2BD8A 1S83A 1C2IA 1S6FA 2O8WA 5EODA 1FPCH 1GHYH 1DWBH 2H9EH 3ZZDA 3ZZAA 3SHCH 1O3FA 2WPIS 4J2YB 3ZZBA 3R3GB 3Q3XA 1EJMA 2ZDLA 1YP9A 1NS3A 4UDWH 5FX6A 4E05H 1IQFA 1J9CH 4ASHA 1WBGB 3GCOA 6CHAB 3KQEA 1V3XA 5F6MA 4TWYA 1HLTH 4BANB 1C5UA 2V35A 3BTME 3MNXA 1QJ1B 2KAIB 1EUFA 1MTNC 1K1LA 1TB6H 1TX7A 3P6ZB 4I8JA 2H2ZA 1ELBA 1AE8H 2OTVA 2CN0H 1WU1A 2VWMA 3LC5A 1F0UA 4NZQA 3SI4H 1HBTH 4MPVA 1LO6A 2FTLE 2A5IA 2GCTB 2F9VA 5K0HA 3GY3A 5GPIB 1HPGA 2QAAA 3KIDU 1YPEH 1ZR0A 5JYIA 5E0HA 1ELTA 1E38B 1O33A 2Y7ZA 1O2XA 3RXJA 4OGYA 4B71A 4Q7ZA 1UHBA 1QFKH 3E6PH 3MOCA 7ESTE 1C9TA 4K3JA 2K1QA 4ZXXH 4K2YA 1ZRKA 1NC6A 4FUDA 4AGJA 1XUFA 1K28D 1C5XB 1JIMA 4OGXA 5F03A 5J4SA 3RXAA 4ZROA 1YLDA 1TLDA 4IGDA 1HAPH 1WAYB 4XBDA 2W5EA 1KDQB 4CRCA 1SGYE 3HKJB 4Y0ZE 1INCA 1GHWH 4LXBH 4OS5A 4DVAU 1G37A 1W11U 1EPTA 1HAVA 1LMWB 4X0WU 4QT8C 2GVFA 3RXGA 4WH6A 3TITA 1MU6B 4UEHH 1KXFA 5DP7A 2BTCE 3M5LA 1XUKA 2BQ7B 2A7HA 1ID5H 4I31A 1FONA 1N1LA 3AW1A 3FZZA 1WV7H 4DT7B 4A92A 2V3OH 4Q2KA 3JZ2B 4B74A 5EG4A 3GY7A 7LPRA 3VB7A 2P3TB 2VIDA 1DANH 2YOLA 1THRH 2WPJS 4BOHA 2J2UA 3RXBA 3SV9A 1L1GA 1C2KA 3IITA 4DIIH 4J1YA 2Z9GA 1D3TB 1VGCB 5HM9A 1DXWA 1O35A 1GJCB 4UFDH 5DP5A 1EXFA 1W12U 1W0ZU 3PTBA 1ZTLA 1VCQA 4DW2U 1QQUA 1THSH 3PMBB 5FCKA 3AASA 4INHA 3P92A 3Q00A 2ZTYA 4B2BA 2CXVA 2PGBB 5E2OA 1H9IE 5EOKA 1G36A 4K8YA 1EZXC 1DPOA 3DFJA 4FVDA 2ALPA 1EP5A 5EW1H 4MNYA 2A45B 1SGCA 3SO3A 3RXRA 4CBOA 1AN1E 1C1TA 3MH5A 3DA9B 5FAHA 1GMCG 4ZHAA 2B0FA 1DWDH 1ARCA 5C67A 3HGNA 2FOCA 3LGWA 1TBRH 2C93B 1NFWA 3RU4T 5HGGA 4IC6A 4CRAA 2FODA 3QWCH 2Y5FA 1V2MT 4A7IB 4UONA 4NCYA 1GI8B 3UNSA 1C5ZB 1UHBB 1O36A 2FXRA 1Q3XA 1DVAH 1O5AB 1GMHG 3A86A 1OWJA 4ISOA 3RXUA 3UQOA 5C2ZA 4UD9H 5LPEA 5FPTA 1LVOA 3A81A 3ZV9A 3GCNA 3RM2H 1P2QA 1HXEH 3MO3A 3N7OA 1V2JT 4SGBE 2WPKS 3KN2A 3BF6H 1SLUB 4BXSA 4TWWA 1P3CA 2A7JA 1DLEA 1EPTB 1HAVB 4IS5A 3M5NA 2HVXA 3PB1E 4R0IA 1P10A 1NY22 1QA0A 1GI3A 4NA8A 3D65E 2BZAA 1H1BA 1CGHA 4X1QU 2ZFQH 3A80A 1C5NH 3E8LA 3TJVA 1OSSA 4AB8A 1L0ZA 5C3NA 1CE5A 1FZZA 4FVBA 3FAOA 3ZVEA 1IOEA 4X1NU 4NSYA 1K2I1 1ANDA 1EASA 4H4FA 2EC9H 3MU0A 5GCHG 1ELDE 4BNRA 3ZZ9A 2AGGX 1MCTA 1W0YH 1QB1A 2ZU2A 1ORFA 2A2QH 2PKAB 2VGCB 4WMFA 2LNCA 2GDDA 2R2WU 2A4OA 2WPLS 3T25A 1GGDB 2A31A 4R8TB 1QB6A 1OYQA 2AFQB 3ODFA 2ZKSA 2GT7A 2FOAA 3TGIE 3GICB 4FUCA 2QF0A 1O3MA 1NFXA 4IW4E 5A0AE 4B75A 3UOPA 1V2TT 5AFYH 3LKWA 3M3VA 2XC0A 3P8GA 1P11E 1ZHMA 5ETXA 3KCGH 2XC4A 4JCNA 1TPOA 2ZP0H 3ZZ7A 2ASUB 1C2FA 3JZ1B 1O37A 3SJOA 2Q6GA 2W26A 3HK3B 1O5DH 2IOTA 1GBBA 2TGPZ 2J38A 1BBRH 4Y0YE 3EAJA 4AX9H 1C1RA 3A87A 4U2WA 1EATA 4ZAEA 4D7GA 2ZU5A 1L2EA 3LGIA 2CHAC 2PLXA 1TMUH 2A5AA 1TMBH 1MZDA 1TNHA 2BB4A 3M35A 4Y7AA 3UR9A 2GV6A 3O8RA 3GY2A 3RXSA 1TAWA 2ZC9H 4KTUA 1GI4A 3ZVBA 1HDTH 1ZPCA 2D2DA 2PSYA 1P2JA 3E91A 3MNBA 3MU1A 3RXQA 1WQSA 4I32A 5AVDA 5DP4A 2BD9A 2BX4A 4XOJA 1V2UT 1DWCH 2ODQA 2F9UA 4XDEA 5JBBS 3RU4E 4YT6H 1IQIA 2FPZA 6CHAC 2ZI2H 1EAXA 1P2MA 5T6FA 1O2SA 5HMAA 2ZDMA 2VIWA 2RDLA 3M36A 2JETB 4LK4A 3V12A 3PM3A 2QIQA 1ANCA 2Z9IA 1BHXB 4KTCA 5JBTA 3ZV8A 4A1VA 2AMQA 3U69H 3NCLA 4Q7YA 3VB4A 1ZPZA 2JH0D 1AHTH 1LHGH 3TGJE 4YESB 4AFUA 1QRWA 1TBQH 4YOGA 3QZRA 5C5NA 2P3FH 2VVVA 2GCTC 3MHWU 4OS4A 1QNJA 3RXFA 1S82A 1GJ5H 2ZGJA 4WXVA 1UVOA 9ESTA 1B5GH 1GHZA 1XKBC 2F9NA 4X2XA 1CT2E 4GLYA 4TY6A 2ZCKP 4SGAE 1FPHH 1C2EA 2XWAA 3GCHB 3MTYA 1RXPA 5E0JA 2FOMB 4RKOB 1CA0B 1O2UA 1THPB 2XYAA 2VIVA 3A7ZA 1C5SA 2FOBA 2WUBA 1BZXE 1FMGA 3SU5A 1ZMLA 1ZMNA 3LJOA 3LJJA 2G00A 4ZHLU 1OWDA 4PROA 2ZTZA 1EJAA 2SFAA 2ZA5A 5EPNA 2TGDA 4OS6A 1C2GA 4O3UA 1XUIA 1OOKB 5CMXH 1GL0E 1MQ5A 1LPZB 3H5CB 1WOFA 2ZHEH 1QRZA 1XM1A 1YGCH 2FX4A 2G52A 1YPKH 3U1IB 1SQTA 8LPRA 5TCCA 1WCZA 1PPBH 2ODYB 1XXFA 1ZHPA 3I77A 4O97A 3T26A 1UTQA 2OCVB 1GHXH 1TGTA 3NPSA 4IMQA 4ZKRU 4CBNA 2XBWA 3UNRA 2QA9E 3OY6U 2BY5X 1AO5A 1RJXB 1VJAU 1MD8A 2H6MA 6GCHG 2ZDVH 4MVNA 1IHSH 1HXFH 1SI5H 3QLPH 4LZ4B 5EQSA 1Y5UT 8GCHG 1DY9A 3EGKH 1BITA 4AOQA 2EI8A 2VWLA 5IDKA 2BLQA 1TALA 4BTTB 2PFEA 2ZFSA 4KELA 3RMMH 3FP7E 4ZUHA 2C8XB 4Y7BA 4INLA 3UQVA 2A0QB 1GMCF 1GJ4H 1YM0A 1UTOA 1ESTA 1AWHB 1GJ7B 1O3LA 1PQ7A 1VGCC 3P8FA 1FY3A 4AFQA 1UK4A 2ANWA 2WYJA 4M7GA 3QTVH 4JYUH 2PTNA 4NIWA 1B0FA 1D3QB 1O2LA 1T4UH 1SFQB 2KAIA 4WF8A 3RXMA 1D3DB 1D9IA 2I6QA 2VNTA 3GY4A 1BBRK 4WWYA 1FY4A 1PPGE 1GVKB 1EAWA 5GIBA 1UJ1A 4BAQB 2Z9LA 1GMDG 4FUEA 2GZ8A 3SGAE 2BVSH 2C8ZB 1TONA 1ZTKA 1V2RT 1JXPA 4NG9H 1PQ8A 3ATWA 1DT2A 5EGMA 4NGAH 2VVCA 2R0LA 3KL6A 1BIOA 3RXLA 2GD4B 2PW8H 2B7DH 3T27A 5FPYA 2P95A 3UUZA 1FJSA 1IQEA 1G2MA 1QRXA 1SHHB 3URDA 2B8OH 4IN1A 3E1XB 4RN6A 5TJXA 2W7SA 3ENSB 1HJ8A 3LGYA 4IC5A 1BMMH 4K69A 4NZLA 1T4VH 2O8LA 1OWHA 4WVPE 1V2PT 1YPHE 1LTOA 3QK1A 2HNTC 3KNXA 2BDYA 4KP0A 4NFEA 1PJPA 2P3UB 1NRRH 1UK3A 5GCHF 1ABIH 3KGPA 4NSVA 2J4IA 3RLYH 1TPAE 2AERH 3OYPA 3PTNA 1JRSA 1O2MA 2OC1A 1IQLA 1TGCA 1UVTH 2UWPA 3FANA 3URCA 4NWLA 2ZFTA 4U01A 1O2QA 4GVUA 4Y11E 4JK6A 2QYIA 1VITG 1S6HA 3TIUA 2UWLA 2G55A 2ZDAH 1AB9B 2R9PA 1LHEH 1TQ7B 8ESTE 1C5YB 1Z1IA 4ABGA 1BDAA 1QJ6B 3PWBA 4YLUA 2AIPA 3AAVA 3R0FA 2ZPRA 3GDUA 1TIOA 3V13A 1W2KH 1C4U2 3VFEA 3QTOH 4GSOA 3ATKA 1KYNA 1HYLA 1TNLA 3BG8A 3RXIA 4ZHMU 1P04A 3ZZ5A 3ZZ6A 2GZ7A 2VGCC 5AFZH 4U30A 4A1TA 2VINA 5EXLA 2BOHB 3ZYEA 1K22H 3PLPA 1A61H 1HFDA 1O3GA 4MPXA 1SB1H 1RTFB 1GGDC 3A8DA 4ABAA 1AUTC 1YBWA 3RXCA 3LC3A 1KXCA 1CU1A 1C1WH 4D76A 1IQMA 1FY5A 1EP6A 3TU7H 2FOHA 1O2WA 4D9RA 1SQAA 4FUFA 1LVYA 1Y5BT 1C5PA 3AVZA 4FUIA 2HOBA 1BTPA 4K1SA 1GBMA 1P3EA 2QXHA 1YPLH 4LOYH 4WY3A 3SJ9A 4X8TH 1KSNA 1QIXB 1FIZA 4X1RU 3SNAA 2YNBA 1LHCH 4TY7A 1S0QA 3PROA 4MPWA 2ANMH 1NU9A 3TNTA 2ZHQH 1GDNA 1Z6EA 1YCPH 1O3AA 1GI1A 2OD3B 1P2KA 4FU8A 2BDBA 2NWNA 3EA7A 4YT7H 2IN2A 1DOJA 1QL9A 2UUFB 1K1NA 1O3OA 3MH6A 2ZCHP 2PGQB 2WPHS 1SBWA 1O3IA 1BUIA 1ZLRA 2RA0A 1GBEA 5B6OA 1O30A 3RM0H 3LGTA 1ARBA 3BTTE 1FI8A 1P06A 3D62A 2SGFE 1ELVA 3PMJA 1UMAH 4I8KA 5TCAA 1TYNA 4X1PU 3M5MA 1C1QA 2ZHWH 2G5NA 3PWCA 2JETC 3A7YA 1K21H 2ILNA 1L4ZA 3ZVCA 1MU8B 4IMZA 3T29A 3RMOH 1Z8JB 4DURA 1RS0A 1SGFA 3GY8A 5FXLA 3F9HA 1XUJA 2BHGA 3EE0B 5DP8A 3L6PA 2FM2A 1KLTA 1VZQH 3BG4B 1SFIA 1NO9H 4X6MA 1GBTA 1A2CH 1BTHH 4B1TA 1YPJH 3Q3KA 2BDCA 1G30B 4F49A 1OX1A 3MI4A 3PMAB 1GJBB 4YM9A 1ABJH 3EA8A 4FXGH 1SPJA 3P95A 4INKA 1O39A 3RMLH 1OXGA 4K60A 3QUMP 2B9LA 2VIPA 3GCHC 1O2RA 1BOQA 4GUXA 9LPRA 1EAIA 5L6NH 2PKAA 2NU0E 1O3HA 1CA0C 4I33A 4O3TA 2BVRH 1A3BH 1JIRA 2D8WA 2CMYA 2QC2A 2ZPQA 3UY9A 3ELAH 1HAZB 4D8NA 6GCHF 4AFZA 1GBAA 1QURH 4X6PA 4CRGA 2FS9A 5LGOA 1HRTH 2FYQA 3ATLA 1X7AC 2XWBI 1TA2A 1JMOH 1UK2A 4YOIA 8GCHF 3T28A 1O3BA 3F6UH 1N6XA 3MO6A 4A6LA 3RC4A 1ZPBA 7GCHG 5T6DA 1Z71A 1ELAA 1W3CA 1TRYA 3A88A 1CO7E 2G5VA 2TIOA 3MU5A 3MH4A 1T32A 3U8OH 1PYTC 1Y3VA 1Y3XA 4AB9A 1CBWB 4OS1A 2SGDE 3OX7U 4F4OC 1P12E 2ZIQH 3QGJA 1QJ7B 4K1TA 1ELCA 4ESTE 1SVPA 2XW9A 1O34A 4YO9A 1XUGA 1V2VT 4WMDA 3PV4A 4NWKA 1EB1H 1ZTJA 1O2ZA 1GMDF 5DG6A 2W3IA 2ZNKH 2FMJA 4Z6AH 1A7SA 2OINA 2OP9A 2BXTH 4AYYB 4JMYA 4CH2B 1C5MD 4AFSA 3TVJB 4MQAA 4ISLA 3V3MA 1E36B 3LONA 3KF2A 3VB5A 1T7CA 2DE9A 2LPRA 1C5QA 2A4RA 2FOGA 3A83A 2VH6A 3LU9B 1RGQA 2BQ6B 3MYWA 4MLFB 4B76A 1GBDA 3RU4D 1YPMH 1Z8GA 3OTJE 1GBIA 2SNWA 4THNH 3SJIA 5EW2H 3NK8A 2BY6X 1OP2A 2PV9B 2BOKA 4GCHG 1DSUA 3O8CA 2ZEBA 1O2GH 3PO1B 1Z6JH 4JZDH 1YCPK 1M9UA 3SUDA 3ATMA 2QCYA 3T2NA 1A3EH 1ZSKA 1EB2A 3A7TA 3L3TA 5E8EH 3PYHA 1HIAB 2BY8X 1UO6A 1J8AA 1O2TA 1G3DA 1P9UA 1GI5A 5SGAE 1KLIH 2ZFFH 5DKMA 1OP0A 2QF3A 2J9NA 1XVOA 1O3JA 1WSSH 2B5TB 1VITF 3PLKA 2BYAX 5G4BA 1Q31A 1S0RA 1OYTH 4BTUB 3F9EA 1AZ8A 1HCGA 3F9GA 4CREA 1H4WA 3ZZ4A 2PR3A 2ZDNA 1O3CA 2OQ5A 2GDEH 1MBMA 3LT3A 3P8NA 2OXSA 2O8UA 1GI6A 3HATH 5F8XA 1GHVH 3S7HB 4XBCA 2Q6DA 1G9IE 1A4WH 1GI2A 2Y5HA 3BEFB 1MD7A 1AD8H 3RLWH 3ZVAA 1TOMH 3CS7A 3UR6A 3M7QA 2VB0A 4JZEH 5A2MH 1WUNH 4BAOB 1AFEH 1XMNB 1TRMA 4ZKOU 4XBBA 5DJ7A 2ZU4A 1SOTA 3SGBE 1N8OC 1AB9C 2BD5A 2FI5E 2C3SA 2BDIA 3A8AA 4FUHA 3QDZB 1JWTA 2FWWA 3DUXH 2BQWB 2FOEA 1W10U 1HB0B 1SGRE 1CT0E 1BTUA 5L2ZH 1GBLA 1LHFH 4WXIA 1CHOG 5ESTE 1SMFE 1SC8U 2VWOA 3GYLB 1PQAA 4BXWA 1F0SA 5EU8A 1UVPA 3A84A 1AUJA 4FU9A 1BJUA 3GY5A 1T8NA 2TGTA 1QGFA 1CSOE 1BTZA 2BXUH 2VWNA 4X8UH 5JDUB 3A8BA 1UTLM 4D7FA 2RG3A 2F9OA 3S9AA 5C1YA 3OY5U 2ZECA 1S84A 4MNXA 1O32A 1ANEA 1GWAA 1ZYOA 3P17H 1Y8TA 1MAXA 2J95A 3SQEE 2Z94A 4K1EA 1TPPA 2FLBH 3D23A 1TNKA 3KQDA 1EX3A 1C1NA 1NFUA 1DWEH 4HFPB 1MH0A 1RRKA 1VCPA 1D6RA 1DSTA 1GBJA 1MKXH 1FAKH 1GJ9B 6ESTA 5FBEA 1H8DH 1YYY1 3W95A 3RXOA 1W8BH 3M3SA 2Z9KA 2QN5T 1ZZZA 1O2YA 4WMEA 3TK6A 1QTFA 2GMTB 5EQQA 2ZPSA 3H7TA 2BDAA 1TFXA 3S9CA 1SHYA 2ZU3A 3VB3A 2JKHA 2XBXA 2RCEA 2FS8A 3CS0A 3F9FA 2BZ6H 1HAHH 1K1JA 3MU4A 2C8YB 3V7TA 1ZSLA 1LKBA 2AS9A 2EI7A 3SI3H 1TX6A 1C5TA 1C4V2 2HPPH 5J4QA 1O2PA 2OUAA 3TJUA 1D3PB 1ZRBA 1C2DA 3SU1A 2C8WB 4ISIH 1DFPA 1YF4A 1DX5M 1XXDA 3I29A 3ZVGA 3RUOA 1UCYH 3EA9A 1FLEE 1MKWH 1PFXC 1V2KT 2IJOB 1P8VC 1RTKA 2XTTB 1ACBE 1FXYA 1SLWB 1SLVB 1SSXA 3IG6B 3BTEE 1NFYA 2V3HH 2F91A 4KKDA 3A89A 1P05A 1A0LA 1MTWA 5JPMH 1NRPH 5PTPA 5JBAS 2XXLA 1VITH 1EZUC 3TH4H 3EYDA 2PUXB 1AIXH 4AZ2B 3BTWE 3T62A 3BG4C 3K2UA 3V0XA 1AGJA 1FIWA 5HYOA 1FN6A 1J16A 1GVLA 1GI7B 3SW2B 4ABJA 2PSXA 1ZGVA 3BTFE 2ZG0H 2AMDA 1UTNA 2XBVA 1GBCA 1V2LT 3ZZ3A 1PPHE 2XCFA 2XRCA 7GCHF 3CP7A 1O3NA 1BRBE 2XCNA 1A5HA 3SUGA 5CE1A 3C1KA 1K1IA 1SR5C 4TYDA 4I8HA 4BAKB 1HAOH 4ZKNU 1HAYB 4CRBA 2O9QA 3TK9A 4JZ1A 3SU0A 2QGRA 4X8VH 4Y8XA 5I25A 3RXDA 3VGCB 3ZZCA 4HGCA 2ZHDA 1MCVA 2A32A 5GJ4B 4CRFA 2AEIH 2ESTE 4DIHH 1ESAA 2Z3CA 4JZIA 2J94A 1AFQB 2P59A 2P16A 1AKSA 4MTBA 2CGAA 2CF9H 1HAGE 3KQBA 3NUMA 1P57B 2Q1JA 4B73A 1FV9A 1ZHRA 1BCUH 2FLRH 3FZDA 5H4IB 5EQRA 1GCDA 2WINI 3SV2H 2FZZA 1MTVA 2BMGB 3BV9B 1OPHB 1CBWC 2XNIA 3SZNA 4MPUA 3F1SB 1JOUB 3Q3YA 2GZ9A 2OC8A 4OS7A 3L33A 1G32B 1O0DH 3BTGE 4E7NA 2HNTE 1W14U 3TLOA 3DD2H 3PMHB 1OWKA 4X2WA 3BEUA 1BMAA 4AG1A 5EXNA 2FYRA 1O5GH 3A7VA 1EKBB 4GCHF 1O3KA 3W94A 1DUEA 1HGTH 2ANKH 1O3DA 1DY8A 5HXFA 1G3EA 3NXPA 3FFGA 2ZCLP 3QN7A 2QXGA 1C2MA 1TNGA 4CH8B 1ELEE 4VGCB 1ELGA 2HWLB 3K9XB 4RKJB 2BDHA 4JZFH 4HI3A 3MO9A 4ABFA 1SQOA 2F9BH 2ZO3H 1MKXK 3RXKA 5AF9H 2OC0A 5JB8S 2Y82A 3F68H 3RXVA 3SV6A 1NN6A 1H9LB 2ZU1A 2G4UA 1F5LA 5ESBA 3TGKE 1GI0A 2HRVA 3U9AH 3PO1C 4NIVA 1F0TA 3BSQA 1QBVH 3STJA 1PQ5A 2Y80A 1TMTH 4I8LA 1N8OB 4JYVH 5T6GA 8KME2 1Z8RA 1C1UH 3SNBA 2FP7B 1DITH 1DM4B 2XC5A 2HNTF 3MMGA 1EZSC 3SV8A 4DG4A 1UCYK 4DJZB 1MKWK 3LGUA 1C5LH 1ZSJA 1GDUA 3BIUH 3BTHE 1CHGA 3SOSA 4CHAC 2QY0B 3RMNH 1PPZA 3U8TH 4Y79A 3HGPA 2PWXA 3P70B 3ZVFA 3TJNA 1AY6H 5E0GA 2Y81A 1UTMA 5LPFA 1ZJDA 1PYTD 1IHTH 1QQ4A 2AIQA 1CHOF 1D6WA 1ZOMA 2Y7XA 1QR3E 3M61U 1SGNE 1FDPA 1NRSH 2BY7X 3RC6A 2OBOA 2WYGA 1H9HE 1F5KU 1AKSB 5ABWA 2FI4E 2ZHFH 1EJNA 2H5DA 2A1DB 3QO6A 1NESE 1J15A 2Q6FA 4WJG2 4Y76A 1DE7H 4O03A 3UIRA 3FVFB 3VXFH 1V2ST 1A5GH 4Z0KA 2BD4A 1GBKA 1SOZA 1UVSH 5GXPA 2W7UA 5EPYA 2H9TH 5DK1A 4H6TA 2OLGA
chains in the Genus database with same CATH superfamily
2XBYA 3BTKE 3KEEA 2STBE 4IN2A 3CENA 2CF8H 1FN8A 2SGPE 1C2HA 3BIVH 1EZQA 2BD3A 2AGIX 4GHQA 2F9PA 2AMPA 1A5IA 4ZH8A 1BRAA 3NWUA 3S0NA 2A7CA 1ZMJA 2GX4A 1TGSZ 1HUTH 4AG2A 1C1SA 2SNVA 3LPRA 1ETTH 1NRNH 3GYMA 3UWJH 3LGVA 2GV7A 3PRBA 2BX3A 1YLCA 1AI8H 2HALA 1VR1H 1GI9B 4X8SH 1HJAB 2G51A 2BLWA 1OWIA 4WH8A 1C1OA 3HPTB 4Q80A 2H1UA 1BBRE 2YMSC 3ESTA 1HAXB 3AW0A 1GHBG 1B7XB 1SGEE 1HIAA 4DCDA 3S7KB 1XKAC 4KGAA 1NM6A 1YCPM 1E35B 3K65B 3LH3A 1W7XH 1XVMA 5HM2A 5DO4H 2GMTC 4CR9A 2WV4A 2ANYA 3SU4A 3LH1A 1O2JA 3PLBA 4GPGA 1HAIH 4BAMB 4M9FA 1GVZA 1LVBA 2P8OB 4KTSA 4NA9H 2EA3A 2FOFA 1GCTB 3DT0H 5F8ZA 1TABE 5GNDA 4DT4A 5I46H 1XX9A 1C1MA 1A0HB 2Z6BD 5A0CA 4GHTA 3UOUA 5C5OA 2SGAA 3MWIU 1XUHA 2TRMA 4UFEH 4AYVB 1BHXF 1QBNA 3STIA 4BTIB 1IAUA 3MNSA 3UPEA 4ZMAH 4D9QA 1BJVA 4FUGA 1FY1A 1YPGH 4Q7XA 1O2HA 2UUJB 2GTBA 1AVXA 1AWFH 1DDJA 4XRNA 3TPIZ 1MQ6A 5AHGH 2J92A 1GJAB 1TWXB 2VIQA 1KY9A 4ABBA 3P8OA 3F3BA 1S85A 4TPYA 1BTXA 3OSYA 3VXEH 4AORA 1O2OA 1Y59T 5E2PA 4XE4A 1O38A 2RA3A 2Y6TA 3N7EA 2QV1A 2NU4E 3SQHE 1C5OH 4YXWD 1O31A 2W6ID 5JBCS 3MNCA 3UFAA 2R0KA 3OU0A 1GJ6A 1WTGH 5T3HA 1BT7A 1GDQA 1ESBA 1OWEA 1Y5AT 3RXHA 3KHVA 2PHBA 2PKSC 2CV3A 1FNIA 1BMFD 2VIOA 1GL1A 2C90B 5C0TA 2GCHF 1MZAA 1ETSH 1ZGIA 2J34A 4AN7A 5L2YH 1ZJKA 2NU1E 1UTKA 3RDZA 1UCYE 2DUCA 1O5FH 1U6QA 1BMNH 3VGCC 1JBUH 4X6NA 5BPEA 1K1PA 3GCTG 2WUCA 3OE7D 1JRTA 2JH5D 1J17T 1GPZA 2LP6A 1KXDA 3FP6E 3GISB 2OC7A 2FESH 1G2LA 3A7XA 1P01A 3SU6A 2SGQE 1AFQC 1MAYA 3E90B 4K5ZA 2I6SA 2WPMS 1DXPA 2BD7A 1MUEB 3U8RH 1CVWH 3UNQA 1SQRA 3SBKA 1Y3WA 1COWD 4RSPA 4YTAA 5A8YA 4CRDA 2AGEX 2J5UA 1K0HA 1E1RD 3KQCA 1C5RA 1AVGH 1T31A 2VH0A 2Z7FE 1BB0B 1C2LA 2UUYA 3SV7A 1RIWB 2NU2E 1BTYA 2DE8A 4B2CA 2TBSA 1MTSA 2Z3EA 3F2FA 4MNWA 4E7RG 2QXIA 1O2IA 1SGDE 4X2VA 1SGQE 1HJ9A 2QF4A 2YNAA 1PPCE 3TJOA 4Y71A 2VU8E 2GT8A 5CHAB 3EDXB 1S5SA 2GGVB 2Y5GA 4NA7A 2QE7D 1AZZA 3AAUA 5F8TA 4NFFA 3BEIB 4DOQA 1O3PB 1P2NA 3B9FH 2ZFPH 1F92A 2ZFRH 4CHAB 2Z9JA 1PPFE 1O2NA 1O2KA 3H7OA 4VGCC 1GG6B 2G81E 1C5VA 1H8IH 2BLVA 1A0JA 1GHAG 3QX5H 4UFGH 1MBQA 1A1RA 2EI6A 2WSSD 3ITIA 5EJ1A 4I8GA 1CT4E 3DFLA 3MFJA 3F0PA 1EOJA 1Y3YA 3WW7A 1QL7A 4ISHH 1GJDB 1DS2E 3VPKA 4GAWA 1EQ9A 3A85A 3SNEA 5A09A 2AYWA 4AGKA 1P02A 4ISNA 1BTWA 1K1MA 1RD3B 1P9SA 2PP6A 3M7TA 5L30H 1Y3UA 1LQEA 1C1VH 3GDVA 1TQ0B 2FEQH 1O5CB 2P94A 3DHKH 4LZ1H 1SGFG 1VJ9U 2FX6A 4E06H 2FTMA 3SUFA 2XOKD 1Z8IB 2V0BA 4ABIA 3FO8D 1MTNB 2H5CA 1F2SE 1IQKA 1IQHA 2ZF0H 3BTDE 1YC0A 5A8XA 1FQ3A 4I7YH 2TPIZ 1GJ8B 2ALVA 2A4QA 1T8OA 3E0NB 2BY9X 3BN9A 5GWZA 3SJ8A 3WWBA 2CJIA 2D1JA 1S81A 4HZHA 4YLQH 2M5TA 1BMLA 1LKAA 2BVXH 3WY8A 3BTQE 3NKKA 1FUJA 2H9HA 4H6SB 5DPAA 3O8BA 1NBMD 5HIZA 3A8CA 3HKIB 2FIRH 1WDIA 2GKVE 1LQDB 1HV7A 2PUQH 1B0EA 1V2WT 1W13U 3K6ZA 1SGPE 1DLKB 1BA8B 3GOVB 1YWUA 1NPMA 1QY6A 2C4FH 3H09A 4ABEA 2HVYB 2ZQ1A 2A5KA 1BRUP 1C4Y2 4ZKSU 1IQJA 6LPRA 1J14A 1RTLA 4NIXA 2YMSB 2WV9A 5C1XA 5EXMA 1QA7A 1LPGB 3QGNB 4XFQA 1G3CA 2WV5A 3GDSA 4JYTA 4X6OA 3M37A 5A8ZA 4MNVA 4UFFH 2J97A 4BAHB 1O2VA 1OKXA 3HK6B 1TNIA 2TGAA 1UVUH 2F3CE 3OEHD 3ZYDA 3Q77A 1GHBF 2V6NA 1V2NT 2ZQ2A 5DP6A 1YY3A 4X1SU 5FCRA 1QBOA 1VCWA 1P2OA 1TE0A 3IWMA 4MDSA 4DY7B 3TH2H 3RP2A 2BD2A 1TA6A 1KXEA 3M5OA 4TT3D 2J98B 1LDTT 2P93A 1L4DA 3SJKA 2O8TA 1LHDH 3M7UA 3TH3H 2BLOA 3E3TA 2ZGBH 4JK5A 1KLJH 3F0OA 2NU3E 2BDGA 2R3YA 3U98H 1NROH 3B23B 1AMHA 1K9OE 2GP9B 4O9VA 1BRCE 1D4PB 1L1JA 1SGIB 3MH7A 1TOCB 1HJAC 1ANBA 4U32A 3SZEA 1E0FD 5BRRE 1EOLA 1NTPA 1G3BA 3UWIA 3D49H 3E16B 3NZIA 1WYKA 1AQ7A 1LVMA 1WTHD 2STAE 3VEQB 5JB9S 2IPHA 3SYJA 7KMEH 2G8TA 1Q2WA 2P8OC 2PKSB 1GCTC 1KTSB 5FBIA 3SUEA 1TNJA 2W3KA 3K6YA 5C20A 3QZQA 4Y6DA 1V6DA 2D26C 5C0UA 3TK5A 2EEKA 2ZTXA 1F0RA 3SU2A 1TRNA 3B8JA 2SGEE 3T5FH 3SU3A 5FPSA 3ZZ8A 2ZDKA 1C9PA 2ZZUH 2ZGCA 4DGJA 2ZGXH 1SLXB 1KIGH 1TX8A 1LCYA 4YZUA 3E0PB 1LPKB 1CGIE 2JJ1D 1QZ8A 1V2OT 1WQVH 2A2XH 4Y10E 3I78A 2F43B 1N6YA 1C2JA 1OP8A 3SHAH 1E34B 1F7ZA 2G4TA 1QB9A 5C1UA 2ODPA 3ZVDA 3GCTF 2HPQH 1O3EA 2FI3E 2GCHG 2FO9A 1O5BB 3SN8A 2THFB 4Y8YA 1UTJA 2A4GA 2BM2A 2F83A 2OBQA 3UREA 2HGTH 1KXAA 3S9BA 1NT1A 5GDSH 3DSGA 2PTCE 1MMJN 1DICA 1T8LA 1DUAA 1TGBA 2UWOA 3S69A 1TPSA 3SNDA 2KCYA 4IBLH 1GBFA 2R2MB 1P0SH 3ATIA 3A82A 1A46H 3C27B 4Q4LA 3EQ0H 2ZGHA 1O5EH 4Y8ZA 5DP9A 3SGQE 4FU7A 3G01A 1AU8A 1P2IA 2AH4X 2UUKB 3Q76A 4XSKU 3TNSA 1NRQH 1KTTB 4NIYA 1NZQH 3RXTA 1T8MA 1GMHF 3UTUH 4B2AA 4FUJA 5K7RA 3RC5A 4F55A 2Z3DA 3LDXH 5IYTA 4A1XA 5LPRA 3LOXA 1QL8A 3KQ5A 2ZWLH 1C5WB 2QXJA 1CQQA 3GY6A 1QHRB 3M3TA 1SL3A 2JH6D 1QCPA 3VB6A 2R3UA 1RFNA 4X2YA 3FKSD 4TPIZ 1AVWA 3U1JB 1FY8E 1MTUA 2O8MA 1TGNA 4MG3A 1AE5A 1SGTA 1KXBA 2VVUA 1GHAF 3RXEA 1SG8B 1Z7KA 1RIWC 1HNEE 3LIWA 1YKTA 1KDQA 1L1NA 1IQNA 1Z1JA 1GBHA 1CGJE 3A7WA 4H42U 4YOJA 5CHAC 1P09A 4FUBA 1IQGA 4RT1A 5DP3A 1W7GH 3ODDA 1NU7B 1K1OA 2OQUA 1FAXA 3FP8E 1UTPA 4ZXYH 4ABHA 1EPTC 4HTCH 1ELFA 4CR5A 5A0BA 3MU8A 1P03A 1F5RA 3O8DA 2HLCA 4A5TS 1TBZH 2FDAA 3SORA 5FHTA 5DGJA 1OS8A 1YPHC 1PPEE 1ETRH 2VJ1A 5LH8A 1GG6C 4K8BA 1EAUA 5FX5A 1CA8B 1BQYA 2ULLA 4OS2A 4UE7H 4ABDA 5CDFE 2CHAB 1E37B 2KM0A 3SNCA 1C1PA 3RXPA 1V2QT 2BD8A 1S83A 1C2IA 1S6FA 2O8WA 5EODA 1FPCH 1GHYH 1DWBH 2H9EH 3ZZDA 3ZZAA 3SHCH 1O3FA 2WPIS 4J2YB 3ZZBA 3R3GB 3Q3XA 1EJMA 3NRLA 2ZDLA 3OAAD 3PRDA 1YP9A 1NS3A 4UDWH 5FX6A 4E05H 1IQFA 1J9CH 4ASHA 1WBGB 3GCOA 6CHAB 3KQEA 1V3XA 5F6MA 4FETA 4TWYA 1HLTH 4BANB 3U28C 1C5UA 2V35A 3BTME 3MNXA 1QJ1B 2KAIB 1EUFA 1MTNC 1K1LA 1TB6H 1TX7A 3P6ZB 1S6LA 4I8JA 2H2ZA 1ELBA 1AE8H 2OTVA 2CN0H 1WU1A 2VWMA 3LC5A 1F0UA 4NZQA 3SI4H 1HBTH 2LELA 4MPVA 1LO6A 2FTLE 2A5IA 2GCTB 2F9VA 5K0HA 3GY3A 5GPIB 1HPGA 2QAAA 3KIDU 1YPEH 1ZR0A 5JYIA 5E0HA 1ELTA 1E38B 1O33A 2Y7ZA 1O2XA 3RXJA 4OGYA 4B71A 4Q7ZA 1UHBA 1QFKH 3E6PH 3MOCA 7ESTE 1C9TA 4K3JA 2K1QA 4ZXXH 4K2YA 1ZRKA 1NC6A 4FUDA 4AGJA 1XUFA 1K28D 1C5XB 1JIMA 4OGXA 5F03A 5J4SA 3RXAA 4ZROA 1YLDA 1TLDA 4IGDA 1HAPH 1WAYB 4XBDA 2W5EA 1KDQB 4CRCA 1SGYE 3HKJB 4Y0ZE 1INCA 1GHWH 4LXBH 4OS5A 4DVAU 1G37A 1W11U 1EPTA 1HAVA 1LMWB 4X0WU 4QT8C 2GVFA 3RXGA 4WH6A 3TITA 1MU6B 4UEHH 1KXFA 5DP7A 2BTCE 3M5LA 1XUKA 4AC9A 2BQ7B 2A7HA 1ID5H 4I31A 1FONA 1N1LA 3AW1A 3FZZA 1WV7H 4DT7B 3KYFA 4A92A 2V3OH 4Q2KA 3JZ2B 4B74A 5EG4A 3GY7A 7LPRA 3VB7A 2P3TB 5HIYA 2VIDA 1DANH 2YOLA 1THRH 2WPJS 4BOHA 2J2UA 3RXBA 3SV9A 1L1GA 1C2KA 3IITA 4DIIH 4J1YA 2Z9GA 1D3TB 4TSFD 1VGCB 5HM9A 1DXWA 1O35A 1GJCB 4UFDH 5DP5A 1EXFA 1W12U 1W0ZU 3PTBA 1ZTLA 1VCQA 5B6LA 4DW2U 1QQUA 1THSH 3PMBB 5FCKA 3AASA 4INHA 3P92A 3EE7A 2ZTYA 3Q00A 4B2BA 2CXVA 2PGBB 5E2OA 1H8ED 1H9IE 5EOKA 1G36A 4K8YA 1EZXC 1DPOA 3DFJA 4FVDA 2ALPA 1EP5A 5EW1H 4MNYA 2A45B 1SGCA 3SO3A 3RXRA 5DSFA 1AN1E 4CBOA 1C1TA 3MH5A 3DA9B 5FAHA 1GMCG 4ZHAA 2B0FA 1DWDH 1ARCA 5C67A 3HGNA 2FOCA 3LGWA 1TBRH 1EFRD 2C93B 1NFWA 3RU4T 5HGGA 4IC6A 4CRAA 2FODA 5T1VA 3QWCH 2Y5FA 1V2MT 4A7IB 4UONA 4NCYA 1GI8B 3UNSA 1C5ZB 5C17A 2KCOA 1UHBB 1O36A 2FXRA 1Q3XA 1DVAH 1O5AB 1GMHG 2VBCA 3A86A 1OWJA 4ISOA 3RXUA 3OEED 3UQOA 5C2ZA 4UD9H 5LPEA 5FPTA 1LVOA 3A81A 3ZV9A 3GCNA 3RM2H 1P2QA 1HXEH 3MO3A 3N7OA 1V2JT 4SGBE 2WPKS 3KN2A 3BF6H 2WHXA 1SLUB 4BXSA 4TWWA 1P3CA 2A7JA 1DLEA 1EPTB 1HAVB 4IS5A 3M5NA 2HVXA 3PB1E 5CHBA 1W0KD 4R0IA 1P10A 1NY22 1QA0A 1GI3A 2J98A 4NA8A 3D65E 2BZAA 1H1BA 1CGHA 4X1QU 2ZFQH 3A80A 1C5NH 3E8LA 3TJVA 1OSSA 4AB8A 1L0ZA 5C3NA 2EY4C 1CE5A 1FZZA 1H8HD 4FVBA 3FAOA 3ZVEA 1IOEA 4X1NU 4NSYA 1K2I1 1ANDA 1EASA 4H4FA 2EC9H 3MU0A 5GCHG 1ELDE 4BNRA 3ZZ9A 2AGGX 2KCPA 1MCTA 1W0YH 2GJGA 1QB1A 2ZU2A 1ORFA 2A2QH 2PKAB 2VGCB 4WMFA 2LNCA 2GDDA 2R2WU 2A4OA 2WPLS 3PV2A 3T25A 1GGDB 1VKYA 2A31A 4R8TB 1QB6A 1OYQA 2AFQB 4OM9A 3ODFA 2ZKSA 2GT7A 2FOAA 3UB0A 5C94A 3TGIE 3GICB 4FUCA 2QF0A 1O3MA 1NFXA 4IW4E 5A0AE 4B75A 3UOPA 1V2TT 5AFYH 3LKWA 3M3VA 2XC0A 3P8GA 1P11E 1ZHMA 5ETXA 5KECA 3KCGH 2XC4A 4JCNA 1TPOA 2ZP0H 3ZZ7A 2ASUB 1C2FA 3JZ1B 1O37A 3SJOA 2Q6GA 2W26A 3HK3B 1O5DH 2IOTA 1GBBA 2TGPZ 2J38A 1BBRH 2L6OA 3EAJA 4Y0YE 4AX9H 1C1RA 3A87A 4U2WA 1EATA 4ZAEA 2K0QA 4D7GA 2ZU5A 1L2EA 3LGIA 2CHAC 2PLXA 1TMUH 2A5AA 1TMBH 1MZDA 1TNHA 2KCAA 2BB4A 3M35A 4Y7AA 3UR9A 2GV6A 3O8RA 3GY2A 3RXSA 5EJZA 1TAWA 2ZC9H 4KTUA 1GI4A 3ZVBA 1HDTH 1ZPCA 2D2DA 2PSYA 1P2JA 3E91A 3MNBA 3MU1A 3RXQA 1WQSA 3AK5A 4I32A 5AVDA 5DP4A 2BD9A 2F4LA 2BX4A 4XOJA 1V2UT 1DWCH 2ODQA 2F9UA 4XDEA 5JBBS 3RU4E 4YT6H 1IQIA 2FPZA 6CHAC 2ZI2H 1EAXA 1P2MA 5T6FA 1O2SA 5HMAA 2ZDMA 2VIWA 2RDLA 3M36A 2JETB 4LK4A 3V12A 3PM3A 2QIQA 2JIZD 1ANCA 2Z9IA 1BHXB 4KTCA 5JBTA 3ZV8A 4B6EA 4A1VA 2AMQA 3U69H 3NCLA 4Q7YA 3VB4A 1ZPZA 2JH0D 1AHTH 1LHGH 3TGJE 4YESB 4AFUA 1QRWA 1TBQH 4YOGA 3QZRA 5C5NA 2P3FH 2VVVA 2GCTC 3MHWU 4OS4A 1QNJA 3RXFA 1S82A 1GJ5H 2ZGJA 4WXVA 1UVOA 3UAIC 1SKYE 9ESTA 1B5GH 1GHZA 1XKBC 2F9NA 4X2XA 1CT2E 4GLYA 4TY6A 2ZCKP 4SGAE 1FPHH 1C2EA 2XWAA 3GCHB 3MTYA 1RXPA 5E0JA 2FOMB 4RKOB 1CA0B 1O2UA 1THPB 2XYAA 2VIVA 3A7ZA 1C5SA 2FOBA 2WUBA 1BZXE 1FMGA 3SU5A 1ZMLA 1ZMNA 3LJOA 3LJJA 2G00A 4ZHLU 1OWDA 4PROA 2ZTZA 1EJAA 2SFAA 2ZA5A 5EPNA 2TGDA 4OS6A 1C2GA 4O3UA 1XUIA 1OOKB 5CMXH 1GL0E 1MQ5A 1LPZB 3H5CB 1WOFA 2ZHEH 1QRZA 1XM1A 1YGCH 2FX4A 2G52A 1YPKH 3U1IB 1SQTA 8LPRA 5TCCA 1WCZA 1PPBH 2ODYB 1XXFA 1ZHPA 3I77A 4HG6A 4O97A 3T26A 1WXRA 1UTQA 2OCVB 1GHXH 1TGTA 3NPSA 4IMQA 4ZKRU 4CBNA 2XBWA 3UNRA 2QA9E 3OY6U 2BY5X 1AO5A 1RJXB 1VJAU 1MD8A 2H6MA 6GCHG 2ZDVH 4MVNA 1IHSH 1HXFH 1SI5H 3QLPH 4LZ4B 5EQSA 1Y5UT 8GCHG 1DY9A 3EGKH 1BITA 4AOQA 2EI8A 2VWLA 5IDKA 2BLQA 1TALA 4BTTB 2PFEA 3FOAA 2ZFSA 4KELA 4ACAA 3RMMH 3FP7E 4ZUHA 2C8XB 2EQNA 2IJD1 4INLA 4Y7BA 3UQVA 2A0QB 1GMCF 1GJ4H 1YM0A 1UTOA 1ESTA 1AWHB 1GJ7B 1O3LA 1PQ7A 1VGCC 3P8FA 1FY3A 4AFQA 1UK4A 2ANWA 2WYJA 4M7GA 3QTVH 4JYUH 2PTNA 4NIWA 1B0FA 1D3QB 1O2LA 1T4UH 1SFQB 2KAIA 4WF8A 2K8IA 3RXMA 1D3DB 1D9IA 2I6QA 2VNTA 3GY4A 1BBRK 4WWYA 1FY4A 1PPGE 1GVKB 1EAWA 5GIBA 1UJ1A 4BAQB 2Z9LA 1GMDG 4FUEA 2GZ8A 3SGAE 2BVSH 2C8ZB 1TONA 1ZTKA 1V2RT 1JXPA 4NG9H 1PQ8A 3ATWA 1DT2A 4Z1MD 5EGMA 4NGAH 2VVCA 2R0LA 1E79D 3KL6A 1BIOA 2YMSD 3RXLA 2GD4B 2PW8H 2B7DH 3T27A 5FPYA 2P95A 3UUZA 1FJSA 1IQEA 1G2MA 1QRXA 1SHHB 3URDA 2B8OH 4IN1A 3E1XB 5FL7D 4RN6A 5TJXA 2W7SA 3ENSB 1HJ8A 3LGYA 4IC5A 1BMMH 4K69A 4NZLA 1T4VH 2O8LA 1OWHA 4WVPE 1V2PT 1YPHE 1LTOA 3QK1A 2HNTC 3KNXA 2BDYA 4KP0A 4NFEA 1PJPA 2P3UB 1NRRH 1UK3A 5GCHF 1ABIH 3KGPA 4NSVA 2J4IA 3RLYH 1TPAE 4I86A 5EIYA 2AERH 3OYPA 3PTNA 1JRSA 1O2MA 2OC1A 1IQLA 1TGCA 1UVTH 2UWPA 3FANA 3URCA 4NWLA 2ZFTA 4U01A 1O2QA 4GVUA 2CK3D 4Y11E 4JK6A 2QYIA 1VITG 1S6HA 5HKKD 5IK2D 3TIUA 2UWLA 3W1EA 2G55A 2V7QD 2ZDAH 1AB9B 2R9PA 1LHEH 1TQ7B 8ESTE 1C5YB 1Z1IA 4ABGA 1BDAA 1QJ6B 3PWBA 4YLUA 2AIPA 3AAVA 3R0FA 2ZPRA 3GDUA 1TIOA 3V13A 1W2KH 1C4U2 3VFEA 3QTOH 4GSOA 3ATKA 1KYNA 1HYLA 1TNLA 3BG8A 3RXIA 5EJLA 4ZHMU 1P04A 3ZZ5A 3ZZ6A 2GZ7A 1FX0B 2VGCC 5AFZH 2XNDD 4U30A 4A1TA 2VINA 5EXLA 2BOHB 3ZYEA 1K22H 3PLPA 1A61H 1HFDA 1O3GA 4MPXA 1SB1H 1RTFB 1GGDC 3A8DA 3DCLA 4ABAA 4B6FA 1AUTC 1YBWA 3RXCA 3LC3A 1KXCA 1CU1A 1C1WH 4D76A 1IQMA 1FY5A 1EP6A 3TU7H 2FOHA 1O2WA 4D9RA 1SQAA 4FUFA 1LVYA 1Y5BT 1C5PA 3AVZA 2W6JD 4FUIA 2HOBA 1BTPA 4K1SA 1GBMA 1P3EA 2QXHA 1YPLH 4LOYH 4WY3A 3SJ9A 4X8TH 1KSNA 1QIXB 1FIZA 4X1RU 3SNAA 2YNBA 1LHCH 4TY7A 1S0QA 3PROA 4MPWA 2ANMH 1NU9A 3TNTA 2ZHQH 1GDNA 1Z6EA 1YCPH 1O3AA 1GI1A 2OD3B 1P2KA 4FU8A 2BDBA 2NWNA 3EA7A 4YT7H 2IN2A 1DOJA 1QL9A 2UUFB 1K1NA 1O3OA 3MH6A 2ZCHP 2PGQB 2WPHS 1SBWA 1O3IA 1BUIA 1ZLRA 2RA0A 1GBEA 5B6OA 1O30A 3RM0H 3LGTA 1ARBA 3BTTE 1FI8A 1P06A 3D62A 2SGFE 1ELVA 3PMJA 1UMAH 2WZQA 4I8KA 5TCAA 1TYNA 4X1PU 3M5MA 1C1QA 2ZHWH 2G5NA 3PWCA 2JETC 3A7YA 1K21H 2ILNA 1L4ZA 3ZVCA 1MU8B 4IMZA 3T29A 3RMOH 1Z8JB 4DURA 1RS0A 1SGFA 3GY8A 5FXLA 3F9HA 1XUJA 2BHGA 3EE0B 4P00A 5DP8A 3L6PA 2FM2A 1KLTA 1VZQH 3BG4B 1SFIA 1NO9H 5KGOA 4X6MA 1GBTA 1A2CH 1BTHH 4B1TA 1YPJH 3Q3KA 2BDCA 3CNRA 1G30B 4F49A 1OX1A 3MI4A 2KR7A 3PMAB 1GJBB 4YM9A 1ABJH 3EA8A 4FXGH 1SPJA 3P95A 4INKA 1O39A 3RMLH 1OXGA 4K60A 3QUMP 2B9LA 2VIPA 3GCHC 1O2RA 1BOQA 1E1QD 4GUXA 9LPRA 1EAIA 5L6NH 2PKAA 2NU0E 3OTPA 1O3HA 1CA0C 4I33A 4O3TA 2BVRH 1A3BH 1JIRA 2D8WA 2CMYA 2QC2A 3VG8A 2ZPQA 3UY9A 3ELAH 1HAZB 4D8NA 6GCHF 4AFZA 1GBAA 1QURH 4X6PA 4CRGA 2FS9A 5LGOA 1HRTH 2FYQA 3ATLA 1X7AC 2XWBI 1TA2A 1JMOH 1UK2A 4YOIA 8GCHF 3T28A 1O3BA 2KFWA 3F6UH 1N6XA 3MO6A 4A6LA 3RC4A 1ZPBA 7GCHG 5T6DA 1Z71A 1ELAA 1W3CA 1TRYA 3A88A 1CO7E 2JDID 2G5VA 2TIOA 3MU5A 3MH4A 1T32A 3U8OH 1PYTC 1Y3VA 2V3MA 1Y3XA 4AB9A 1CBWB 4FOUC 4OS1A 3WWFA 2SGDE 3OX7U 4F4OC 1P12E 2ZIQH 3QGJA 1QJ7B 4K1TA 1ELCA 4ESTE 1SVPA 2XW9A 1O34A 4YO9A 1XUGA 1V2VT 4WMDA 3PV4A 4NWKA 1EB1H 1ZTJA 1O2ZA 1GMDF 5DG6A 4RI0A 2W3IA 2ZNKH 2FMJA 4Z6AH 1A7SA 2OINA 2OP9A 2BXTH 4AYYB 4JMYA 4CH2B 4RT0A 1C5MD 4AFSA 3TVJB 4MQAA 4ISLA 3V3MA 1E36B 3LONA 3KF2A 3VB5A 2OK5A 1T7CA 2DE9A 2LPRA 1C5QA 2A4RA 2FOGA 3A83A 2VH6A 3LU9B 1RGQA 2BQ6B 3MYWA 4MLFB 4B76A 1GBDA 3RU4D 1YPMH 1Z8GA 3OTJE 1GBIA 2SNWA 4THNH 3SJIA 5EW2H 3NK8A 2L74A 2BY6X 1OP2A 2PV9B 2BOKA 4GCHG 1DSUA 3O8CA 2ZEBA 1O2GH 3PO1B 1Z6JH 4JZDH 1YCPK 1M9UA 3SUDA 3ATMA 2QCYA 1YLNA 3T2NA 1A3EH 1ZSKA 3N7DA 1EB2A 3A7TA 3L3TA 5E8EH 3PYHA 1HIAB 2BY8X 1UO6A 1J8AA 1O2TA 1G3DA 1P9UA 1GI5A 5SGAE 1KLIH 2ZFFH 5DKMA 1OP0A 2QF3A 2J9NA 1XVOA 1O3JA 1WSSH 2B5TB 1VITF 3PLKA 2BYAX 5G4BA 1Q31A 1S0RA 1OYTH 4BTUB 3F9EA 1AZ8A 1HCGA 3F9GA 4CREA 1H4WA 3ZZ4A 2PR3A 2ZDNA 2KX4A 1O3CA 2OQ5A 2GDEH 1MBMA 3LT3A 3P8NA 2IPQX 2OXSA 2O8UA 1GI6A 3HATH 5F8XA 1GHVH 3S7HB 4XBCA 2Q6DA 1G9IE 1A4WH 1GI2A 2Y5HA 3BEFB 1MD7A 1AD8H 3RLWH 3ZVAA 1TOMH 3CS7A 2WPDD 3UR6A 1MABB 3M7QA 2VB0A 4JZEH 5A2MH 1WUNH 4BAOB 1AFEH 1XMNB 1TRMA 4ZKOU 4XBBA 5DJ7A 2ZU4A 1SOTA 3SGBE 1N8OC 1AB9C 2BD5A 2FI5E 2C3SA 2BDIA 3A8AA 4FUHA 3QDZB 1JWTA 2FWWA 3DUXH 2BQWB 2FOEA 1W10U 1HB0B 1SGRE 1CT0E 1BTUA 5L2ZH 1GBLA 1LHFH 4WXIA 1CHOG 5ESTE 1SMFE 1SC8U 2VWOA 3GYLB 1PQAA 4BXWA 1F0SA 5EU8A 1UVPA 3A84A 1AUJA 4FU9A 1BJUA 3GY5A 3GS9A 1T8NA 2TGTA 4ASUD 1QGFA 1CSOE 1BTZA 2BXUH 2VWNA 4X8UH 5JDUB 3A8BA 1UTLM 4D7FA 2RG3A 2F9OA 3S9AA 5C1YA 3OY5U 2ZECA 1S84A 4P02A 4MNXA 1O32A 1ANEA 1GWAA 1ZYOA 3P17H 1Y8TA 1MAXA 2J95A 3SQEE 2Z94A 5KEDA 4K1EA 1TPPA 2FLBH 3D23A 1TNKA 3KQDA 1EX3A 1C1NA 1NFUA 1DWEH 4HFPB 1MH0A 1RRKA 1OHHD 1VCPA 1D6RA 1DSTA 1GBJA 1MKXH 1FAKH 1GJ9B 6ESTA 5FBEA 1H8DH 1YYY1 3W95A 3RXOA 1W8BH 3M3SA 2Z9KA 2QN5T 1ZZZA 1O2YA 4WMEA 3TK6A 1QTFA 2GMTB 5EQQA 2ZPSA 3H7TA 2BDAA 1TFXA 3S9CA 1SHYA 2ZU3A 3VB3A 2JKHA 2XBXA 2RCEA 2FS8A 3CS0A 3F9FA 2BZ6H 1HAHH 1K1JA 3MU4A 2C8YB 3V7TA 1ZSLA 1LKBA 2AS9A 2EI7A 3KYGA 3SI3H 1TX6A 1C5TA 1C4V2 2HPPH 5J4QA 1O2PA 2OUAA 3TJUA 1D3PB 1ZRBA 1C2DA 3SU1A 2C8WB 4ISIH 1DFPA 1YF4A 1DX5M 1XXDA 3I29A 3ZVGA 3RUOA 1UCYH 3EA9A 1FLEE 1MKWH 1PFXC 1V2KT 2IJOB 1P8VC 1RTKA 2XTTB 1ACBE 1FXYA 1SLWB 1SLVB 1SSXA 3IG6B 3BTEE 1NFYA 2V3HH 2F91A 4KKDA 3A89A 1P05A 5DN6D 1A0LA 3DSPA 3OFND 1MTWA 5JPMH 1NRPH 3F2GA 5PTPA 5JBAS 2XXLA 1VITH 1EZUC 3TH4H 3EYDA 2PUXB 1AIXH 4AZ2B 3BTWE 3T62A 1W0JD 3BG4C 3K2UA 3V0XA 1AGJA 1FIWA 5HYOA 1FN6A 1J16A 1GVLA 1GI7B 3SW2B 4ABJA 2PSXA 1ZGVA 3BTFE 2ZG0H 4ACBA 2AMDA 1UTNA 1UW7A 2XBVA 1GBCA 1V2LT 3ZZ3A 1PPHE 2XCFA 2XRCA 7GCHF 3CP7A 1O3NA 1BRBE 2XCNA 1A5HA 3SUGA 5CE1A 3C1KA 1K1IA 1SR5C 4TYDA 4I8HA 4BAKB 1HAOH 4ZKNU 1HAYB 4CRBA 2O9QA 3TK9A 4JZ1A 3SU0A 2QGRA 4X8VH 4Y8XA 5I25A 3RXDA 2HLDD 3VGCB 3ZZCA 4HGCA 2ZHDA 1MCVA 2A32A 2M2AA 5GJ4B 4CRFA 2AEIH 2ESTE 4DIHH 1ESAA 1NBME 2Z3CA 4JZIA 4Q63A 2J94A 1AFQB 2P59A 2P16A 1AKSA 2JJ2D 2CGAA 4MTBA 2CF9H 1HAGE 3DSOA 3KQBA 3NUMA 1P57B 2Q1JA 3ZIAD 4B73A 1FV9A 1ZHRA 1BCUH 2QF5A 2FLRH 3FZDA 5H4IB 5EQRA 1GCDA 2WINI 3SV2H 2FZZA 1MTVA 2BMGB 3BV9B 1OPHB 1CBWC 2XNIA 3SZNA 4MPUA 3F1SB 1JOUB 3Q3YA 2GZ9A 2OC8A 4OS7A 3L33A 1G32B 1O0DH 3BTGE 4E7NA 2HNTE 1W14U 3TLOA 3DD2H 3PMHB 1OWKA 4X2WA 3BEUA 1BMAA 4AG1A 5EXNA 2FYRA 1O5GH 3A7VA 4ZCNA 1EKBB 4GCHF 1O3KA 3W94A 1DUEA 1HGTH 2ANKH 1O3DA 1DY8A 5HXFA 1G3EA 3NXPA 3FFGA 2ZCLP 3QN7A 2QXGA 1C2MA 1TNGA 4CH8B 4F48B 1ELEE 4VGCB 1ELGA 2HWLB 3K9XB 4RKJB 2BDHA 4JZFH 4HI3A 3MO9A 4ABFA 1SQOA 2F9BH 2ZO3H 4XD7D 1MKXK 3RXKA 5AF9H 2OC0A 5JB8S 2Y82A 3F68H 3RXVA 3SV6A 1NN6A 1H9LB 2ZU1A 2G4UA 1F5LA 5ESBA 3TGKE 1GI0A 2HRVA 5F53A 3U9AH 3PO1C 4NIVA 1F0TA 3BSQA 1QBVH 3STJA 1PQ5A 2Y80A 1TMTH 4I8LA 1N8OB 4JYVH 5T6GA 8KME2 1Z8RA 2AHME 2RDEA 1C1UH 3SNBA 2FP7B 1DITH 1DM4B 2XC5A 2HNTF 3MMGA 1EZSC 3SV8A 4DG4A 1UCYK 4DJZB 3F2HA 1MKWK 1KMHB 3LGUA 1C5LH 1ZSJA 1GDUA 3BIUH 3BTHE 1CHGA 3SOSA 4CHAC 2QY0B 3RMNH 3MQKC 1PPZA 3N99A 3U8TH 2RFKC 4Y79A 3HGPA 2PWXA 3P70B 3ZVFA 3TJNA 1AY6H 5E0GA 3FN8A 2Y81A 1UTMA 5LPFA 1ZJDA 2KZ4A 1PYTD 1IHTH 1QQ4A 2AIQA 1CHOF 1D6WA 1ZOMA 2Y7XA 3PV5A 1QR3E 3M61U 1SGNE 1FDPA 1NRSH 2BY7X 3RC6A 2OBOA 2WYGA 1H9HE 1F5KU 1AKSB 5ABWA 2FI4E 2ZHFH 1EJNA 2H5DA 2A1DB 3QO6A 1NESE 1J15A 2Q6FA 4WJG2 4Y76A 1DE7H 4O03A 3UIRA 3FVFB 3VXFH 1V2ST 1A5GH 4Z0KA 2BD4A 1GBKA 1SOZA 1UVSH 5GXPA 2W7UA 5EPYA 2H9TH 5DK1A 4H6TA 2OLGA
chains in the Genus database with same CATH topology
2XBYA 3BTKE 3KEEA 2STBE 4IN2A 3CENA 2CF8H 1FN8A 2SGPE 1C2HA 3BIVH 1EZQA 2BD3A 2AGIX 4GHQA 2F9PA 2AMPA 1A5IA 4ZH8A 1BRAA 3NWUA 3S0NA 2A7CA 1ZMJA 2GX4A 1TGSZ 1HUTH 4AG2A 1C1SA 2SNVA 3LPRA 1ETTH 1NRNH 3GYMA 3UWJH 3LGVA 2GV7A 2BX3A 1YLCA 1AI8H 2HALA 1VR1H 1GI9B 4X8SH 1HJAB 2G51A 2BLWA 1OWIA 4WH8A 1C1OA 3HPTB 4Q80A 2H1UA 1BBRE 3ESTA 1HAXB 3AW0A 1GHBG 1B7XB 1SGEE 1HIAA 4DCDA 3S7KB 1XKAC 4KGAA 1NM6A 1YCPM 1E35B 3K65B 3LH3A 1W7XH 1XVMA 5HM2A 5DO4H 2GMTC 4CR9A 2WV4A 2ANYA 3SU4A 3LH1A 1O2JA 3PLBA 4GPGA 1HAIH 4BAMB 1GVZA 1LVBA 2P8OB 4KTSA 4NA9H 2EA3A 2FOFA 1GCTB 3DT0H 5F8ZA 1TABE 5I46H 1XX9A 1C1MA 1A0HB 2Z6BD 5A0CA 4GHTA 3UOUA 5C5OA 2SGAA 3MWIU 1XUHA 2TRMA 4UFEH 4AYVB 1BHXF 1QBNA 3STIA 4BTIB 1IAUA 3MNSA 3UPEA 4ZMAH 4D9QA 1BJVA 4FUGA 1FY1A 1YPGH 4Q7XA 1O2HA 2UUJB 2GTBA 1AVXA 1AWFH 1DDJA 3TPIZ 1MQ6A 5AHGH 2J92A 1GJAB 1TWXB 2VIQA 1KY9A 4ABBA 3P8OA 1S85A 4TPYA 1BTXA 3OSYA 3VXEH 4AORA 1O2OA 1Y59T 5E2PA 4XE4A 1O38A 2RA3A 2Y6TA 2QV1A 2NU4E 3SQHE 1C5OH 1O31A 5JBCS 3MNCA 3UFAA 2R0KA 3OU0A 1GJ6A 1WTGH 5T3HA 1BT7A 1GDQA 1ESBA 1OWEA 1Y5AT 3RXHA 3KHVA 2PHBA 2PKSC 2CV3A 1FNIA 2VIOA 1GL1A 2C90B 2GCHF 1MZAA 1ETSH 1ZGIA 2J34A 4AN7A 5L2YH 1ZJKA 2NU1E 1UTKA 3RDZA 1UCYE 2DUCA 1O5FH 1U6QA 1BMNH 3VGCC 1JBUH 4X6NA 5BPEA 1K1PA 3GCTG 2WUCA 1JRTA 2JH5D 1J17T 1GPZA 1KXDA 3FP6E 3GISB 2OC7A 2FESH 1G2LA 3A7XA 1P01A 3SU6A 2SGQE 1AFQC 1MAYA 3E90B 4K5ZA 2I6SA 2WPMS 1DXPA 2BD7A 1MUEB 3U8RH 1CVWH 3UNQA 3SBKA 1Y3WA 4RSPA 4YTAA 5A8YA 4CRDA 2AGEX 3KQCA 1C5RA 1AVGH 1T31A 2VH0A 2Z7FE 1BB0B 1C2LA 2UUYA 3SV7A 1RIWB 2NU2E 1BTYA 2DE8A 4B2CA 2TBSA 1MTSA 2Z3EA 4MNWA 4E7RG 2QXIA 1O2IA 1SGDE 4X2VA 1SGQE 1HJ9A 2YNAA 3TJOA 1PPCE 4Y71A 2VU8E 2GT8A 5CHAB 3EDXB 1S5SA 2GGVB 2Y5GA 4NA7A 1AZZA 3AAUA 5F8TA 4NFFA 3BEIB 4DOQA 1O3PB 1P2NA 3B9FH 2ZFPH 1F92A 2ZFRH 4CHAB 2Z9JA 1PPFE 1O2NA 1O2KA 3H7OA 4VGCC 1GG6B 2G81E 1C5VA 1H8IH 2BLVA 1A0JA 1GHAG 3QX5H 4UFGH 1MBQA 1A1RA 2EI6A 3ITIA 4I8GA 1CT4E 3DFLA 3MFJA 1EOJA 1Y3YA 1QL7A 4ISHH 1GJDB 1DS2E 3VPKA 4GAWA 1EQ9A 3A85A 3SNEA 5A09A 2AYWA 4AGKA 1P02A 4ISNA 1BTWA 1K1MA 1RD3B 1P9SA 3M7TA 5L30H 1Y3UA 1LQEA 1C1VH 3GDVA 1TQ0B 2FEQH 1O5CB 2P94A 3DHKH 4LZ1H 1SGFG 1VJ9U 2FX6A 4E06H 2FTMA 3SUFA 1Z8IB 2V0BA 4ABIA 1MTNB 2H5CA 1F2SE 1IQKA 1IQHA 2ZF0H 3BTDE 1YC0A 5A8XA 1FQ3A 4I7YH 2TPIZ 1GJ8B 2ALVA 2A4QA 1T8OA 3E0NB 2BY9X 3BN9A 5GWZA 3SJ8A 2CJIA 2D1JA 1S81A 4HZHA 4YLQH 2M5TA 1BMLA 1LKAA 2BVXH 3WY8A 3BTQE 3NKKA 1FUJA 2H9HA 4H6SB 5DPAA 3O8BA 3A8CA 3HKIB 2FIRH 2GKVE 1LQDB 1HV7A 2PUQH 1B0EA 1V2WT 1W13U 3K6ZA 1SGPE 1DLKB 1BA8B 3GOVB 1NPMA 1QY6A 2C4FH 4ABEA 2ZQ1A 2A5KA 1BRUP 1C4Y2 4ZKSU 1IQJA 6LPRA 1J14A 1RTLA 4NIXA 5C1XA 5EXMA 1QA7A 1LPGB 3QGNB 4XFQA 1G3CA 2WV5A 3GDSA 4JYTA 4X6OA 3M37A 5A8ZA 4MNVA 4UFFH 4BAHB 1O2VA 1OKXA 3HK6B 1TNIA 2TGAA 1UVUH 2F3CE 3ZYDA 3Q77A 1GHBF 2V6NA 1V2NT 2ZQ2A 5DP6A 4X1SU 5FCRA 1QBOA 1VCWA 1P2OA 1TE0A 3IWMA 4MDSA 4DY7B 3TH2H 3RP2A 2BD2A 1TA6A 1KXEA 3M5OA 1LDTT 2P93A 1L4DA 3SJKA 2O8TA 1LHDH 3M7UA 3TH3H 2BLOA 3E3TA 2ZGBH 4JK5A 1KLJH 2NU3E 2BDGA 2R3YA 3U98H 1NROH 3B23B 1AMHA 1K9OE 2GP9B 4O9VA 1BRCE 1D4PB 1L1JA 1SGIB 3MH7A 1TOCB 1HJAC 1ANBA 4U32A 1E0FD 5BRRE 1EOLA 1NTPA 1G3BA 3UWIA 3D49H 3E16B 3NZIA 1WYKA 1AQ7A 1LVMA 1WTHD 2STAE 3VEQB 5JB9S 2IPHA 7KMEH 2G8TA 1Q2WA 2P8OC 2PKSB 1GCTC 1KTSB 5FBIA 3SUEA 1TNJA 2W3KA 3K6YA 5C20A 3QZQA 4Y6DA 1V6DA 2D26C 3TK5A 2EEKA 2ZTXA 1F0RA 3SU2A 1TRNA 3B8JA 2SGEE 3T5FH 3SU3A 5FPSA 3ZZ8A 2ZDKA 1C9PA 2ZZUH 2ZGCA 4DGJA 2ZGXH 1SLXB 1KIGH 1TX8A 1LCYA 4YZUA 3E0PB 1LPKB 1CGIE 1V2OT 1WQVH 2A2XH 4Y10E 3I78A 1N6YA 1C2JA 1OP8A 3SHAH 1E34B 1F7ZA 2G4TA 1QB9A 5C1UA 2ODPA 3ZVDA 3GCTF 2HPQH 1O3EA 2FI3E 2GCHG 2FO9A 1O5BB 3SN8A 2THFB 4Y8YA 1UTJA 2A4GA 2BM2A 2F83A 2OBQA 3UREA 2HGTH 1KXAA 3S9BA 1NT1A 5GDSH 2PTCE 1MMJN 1DICA 1T8LA 1DUAA 1TGBA 2UWOA 3S69A 1TPSA 3SNDA 4IBLH 1GBFA 2R2MB 1P0SH 3ATIA 3A82A 1A46H 3C27B 3EQ0H 2ZGHA 1O5EH 4Y8ZA 5DP9A 3SGQE 4FU7A 3G01A 1AU8A 1P2IA 2AH4X 2UUKB 3Q76A 4XSKU 3TNSA 1NRQH 1KTTB 4NIYA 1NZQH 3RXTA 1T8MA 1GMHF 3UTUH 4B2AA 4FUJA 5K7RA 3RC5A 2Z3DA 3LDXH 5IYTA 4A1XA 5LPRA 3LOXA 1QL8A 2ZWLH 1C5WB 2QXJA 1CQQA 3GY6A 1QHRB 3M3TA 1SL3A 2JH6D 1QCPA 3VB6A 2R3UA 1RFNA 4X2YA 4TPIZ 1AVWA 3U1JB 1FY8E 1MTUA 2O8MA 1TGNA 4MG3A 1AE5A 1SGTA 1KXBA 2VVUA 1GHAF 3RXEA 1SG8B 1Z7KA 1RIWC 1HNEE 3LIWA 1YKTA 1KDQA 1L1NA 1IQNA 1Z1JA 1GBHA 1CGJE 3A7WA 4H42U 4YOJA 5CHAC 1P09A 4FUBA 1IQGA 5DP3A 1W7GH 3ODDA 1NU7B 1K1OA 2OQUA 1FAXA 3FP8E 1UTPA 4ZXYH 4ABHA 1EPTC 4HTCH 1ELFA 4CR5A 5A0BA 3MU8A 1P03A 1F5RA 3O8DA 2HLCA 4A5TS 1TBZH 2FDAA 3SORA 5FHTA 5DGJA 1OS8A 1YPHC 1PPEE 1ETRH 2VJ1A 5LH8A 1GG6C 4K8BA 1EAUA 5FX5A 1CA8B 1BQYA 2ULLA 4OS2A 4UE7H 4ABDA 2CHAB 1E37B 3SNCA 1C1PA 3RXPA 1V2QT 2BD8A 1S83A 1C2IA 1S6FA 2O8WA 5EODA 1FPCH 1GHYH 1DWBH 2H9EH 3ZZDA 3ZZAA 3SHCH 1O3FA 2WPIS 4J2YB 3ZZBA 3R3GB 3Q3XA 1EJMA 2ZDLA 1YP9A 1NS3A 4UDWH 5FX6A 4E05H 1IQFA 1J9CH 4ASHA 1WBGB 3GCOA 6CHAB 3KQEA 1V3XA 5F6MA 4TWYA 1HLTH 4BANB 1C5UA 2V35A 3BTME 3MNXA 1QJ1B 2KAIB 1EUFA 1MTNC 1K1LA 1TB6H 1TX7A 3P6ZB 4I8JA 2H2ZA 1ELBA 1AE8H 2OTVA 2CN0H 1WU1A 2VWMA 3LC5A 1F0UA 4NZQA 3SI4H 1HBTH 4MPVA 1LO6A 2FTLE 2A5IA 2GCTB 2F9VA 5K0HA 3GY3A 5GPIB 1HPGA 2QAAA 3KIDU 1YPEH 1ZR0A 5JYIA 5E0HA 1ELTA 1E38B 1O33A 2Y7ZA 1O2XA 3RXJA 4OGYA 4B71A 4Q7ZA 1UHBA 1QFKH 3E6PH 3MOCA 7ESTE 1C9TA 4K3JA 2K1QA 4ZXXH 4K2YA 1ZRKA 1NC6A 4FUDA 4AGJA 1XUFA 1K28D 1C5XB 1JIMA 4OGXA 5F03A 5J4SA 3RXAA 4ZROA 1YLDA 1TLDA 4IGDA 1HAPH 1WAYB 4XBDA 2W5EA 1KDQB 4CRCA 1SGYE 3HKJB 4Y0ZE 1INCA 1GHWH 4LXBH 4OS5A 4DVAU 1G37A 1W11U 1EPTA 1HAVA 1LMWB 4X0WU 4QT8C 2GVFA 3RXGA 4WH6A 3TITA 1MU6B 4UEHH 1KXFA 5DP7A 2BTCE 3M5LA 1XUKA 2BQ7B 2A7HA 1ID5H 4I31A 1FONA 1N1LA 3AW1A 3FZZA 1WV7H 4DT7B 4A92A 2V3OH 4Q2KA 3JZ2B 4B74A 5EG4A 3GY7A 7LPRA 3VB7A 2P3TB 2VIDA 1DANH 2YOLA 1THRH 2WPJS 4BOHA 2J2UA 3RXBA 3SV9A 1L1GA 1C2KA 3IITA 4DIIH 4J1YA 2Z9GA 1D3TB 1VGCB 5HM9A 1DXWA 1O35A 1GJCB 4UFDH 5DP5A 1EXFA 1W12U 1W0ZU 3PTBA 1ZTLA 1VCQA 4DW2U 1QQUA 1THSH 3PMBB 5FCKA 3AASA 4INHA 3P92A 3Q00A 2ZTYA 4B2BA 2CXVA 2PGBB 5E2OA 1H9IE 5EOKA 1G36A 4K8YA 1EZXC 1DPOA 3DFJA 4FVDA 2ALPA 1EP5A 5EW1H 4MNYA 2A45B 1SGCA 3SO3A 3RXRA 4CBOA 1AN1E 1C1TA 3MH5A 3DA9B 5FAHA 1GMCG 4ZHAA 2B0FA 1DWDH 1ARCA 5C67A 3HGNA 2FOCA 3LGWA 1TBRH 2C93B 1NFWA 3RU4T 5HGGA 4IC6A 4CRAA 2FODA 3QWCH 2Y5FA 1V2MT 4A7IB 4UONA 4NCYA 1GI8B 3UNSA 1C5ZB 1UHBB 1O36A 2FXRA 1Q3XA 1DVAH 1O5AB 1GMHG 3A86A 1OWJA 4ISOA 3RXUA 3UQOA 5C2ZA 4UD9H 5LPEA 5FPTA 1LVOA 3A81A 3ZV9A 3GCNA 3RM2H 1P2QA 1HXEH 3MO3A 3N7OA 1V2JT 4SGBE 2WPKS 3KN2A 3BF6H 1SLUB 4BXSA 4TWWA 1P3CA 2A7JA 1DLEA 1EPTB 1HAVB 4IS5A 3M5NA 2HVXA 3PB1E 4R0IA 1P10A 1NY22 1QA0A 1GI3A 4NA8A 3D65E 2BZAA 1H1BA 1CGHA 4X1QU 2ZFQH 3A80A 1C5NH 3E8LA 3TJVA 1OSSA 4AB8A 1L0ZA 5C3NA 1CE5A 1FZZA 4FVBA 3FAOA 3ZVEA 1IOEA 4X1NU 4NSYA 1K2I1 1ANDA 1EASA 4H4FA 2EC9H 3MU0A 5GCHG 1ELDE 4BNRA 3ZZ9A 2AGGX 1MCTA 1W0YH 1QB1A 2ZU2A 1ORFA 2A2QH 2PKAB 2VGCB 4WMFA 2LNCA 2GDDA 2R2WU 2A4OA 2WPLS 3T25A 1GGDB 2A31A 4R8TB 1QB6A 1OYQA 2AFQB 3ODFA 2ZKSA 2GT7A 2FOAA 3TGIE 3GICB 4FUCA 2QF0A 1O3MA 1NFXA 4IW4E 5A0AE 4B75A 3UOPA 1V2TT 5AFYH 3LKWA 3M3VA 2XC0A 3P8GA 1P11E 1ZHMA 5ETXA 3KCGH 2XC4A 4JCNA 1TPOA 2ZP0H 3ZZ7A 2ASUB 1C2FA 3JZ1B 1O37A 3SJOA 2Q6GA 2W26A 3HK3B 1O5DH 2IOTA 1GBBA 2TGPZ 2J38A 1BBRH 4Y0YE 3EAJA 4AX9H 1C1RA 3A87A 4U2WA 1EATA 4ZAEA 4D7GA 2ZU5A 1L2EA 3LGIA 2CHAC 2PLXA 1TMUH 2A5AA 1TMBH 1MZDA 1TNHA 2BB4A 3M35A 4Y7AA 3UR9A 2GV6A 3O8RA 3GY2A 3RXSA 1TAWA 2ZC9H 4KTUA 1GI4A 3ZVBA 1HDTH 1ZPCA 2D2DA 2PSYA 1P2JA 3E91A 3MNBA 3MU1A 3RXQA 1WQSA 4I32A 5AVDA 5DP4A 2BD9A 2BX4A 4XOJA 1V2UT 1DWCH 2ODQA 2F9UA 4XDEA 5JBBS 3RU4E 4YT6H 1IQIA 2FPZA 6CHAC 2ZI2H 1EAXA 1P2MA 5T6FA 1O2SA 5HMAA 2ZDMA 2VIWA 2RDLA 3M36A 2JETB 4LK4A 3V12A 3PM3A 2QIQA 1ANCA 2Z9IA 1BHXB 4KTCA 5JBTA 3ZV8A 4A1VA 2AMQA 3U69H 3NCLA 4Q7YA 3VB4A 1ZPZA 2JH0D 1AHTH 1LHGH 3TGJE 4YESB 4AFUA 1QRWA 1TBQH 4YOGA 3QZRA 5C5NA 2P3FH 2VVVA 2GCTC 3MHWU 4OS4A 1QNJA 3RXFA 1S82A 1GJ5H 2ZGJA 4WXVA 1UVOA