1HPGA

A glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
187
structure length
187
Chain Sequence
VLGGGAIYGGGSRCSAAFNVTKGGARYFVTAGHCTNISANWSASSGGSVVGVREGTSFPTNDYGIVRYTDGSSPAGTVDLYNGSTQDISSAANAVVGQAIKKSGSTTKVTSGTVTAVNVTVNYGDGPVYNMVRTTACSAGGDSGGAHFAGSVALGIHSGSSGCSGTAGSAIHQPVTEALSAYGVTVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamic acid specific protease
publication title A glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 187
sequence length 187
ec nomenclature ec 3.4.21.82: Glutamyl endopeptidase II.
pdb deposition date 1993-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hpgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hpgA01
3VGCB 3LJJA 4A1TA 4NIVA 5C67A 1AFEH 4I31A 1TX8A 2ZDAH 1GDNA 4MPXA 1SLWB 3PLKA 1V2OT 2SFAA 1FIWA 1F0UA 2F9PA 3Q00A 3SU4A 3BEUA 2ALPA 2XYAA 2ZTXA 2QCYA 1JRTA 5T6FA 5FPTA 1O2MA 2PGBB 1GI8B 1MU8B 1MTWA 2D2DA 1GI3A 1RTFB 3KF2A 3RXPA 3BEIB 1QR3E 1EPTC 1TONA 3RXAA 3SU3A 1O31A 3BTTE 2FOBA 5FCRA 2WPLS 3K2UA 1WTHD 1F5LA 4ZKOU 5L2ZH 8LPRA 5HM9A 2XWBI 3SNCA 3A8DA 2ZDNA 4OS6A 3SV8A 1P06A 3NWUA 2ZFTA 4DIHH 1FY3A 1O5BB 1P9SA 1NTPA 2FYRA 2AMDA 5DK1A 3SGQE 4IS5A 4X8VH 1ZLRA 2F9UA 4K69A 1EP6A 3Q3KA 1O2XA 5GCHF 2NU4E 3GCHB 4INLA 2DE8A 1A0JA 4BANB 4LZ1H 1GBAA 2O9QA 3F9EA 2PKSC 3TH4H 1GI9B 1PQ7A 3JZ1B 3A86A 4RKOB 1QCPA 3MNSA 3ITIA 1YCPH 3RMNH 1MZAA 1HAGE 4CRDA 1NY22 1F0SA 1SGRE 3SQHE 1HXFH 3BF6H 3UY9A 5GDSH 3ZZAA 1GL1A 1QHRB 2J34A 2GTBA 1Y3VA 4A92A 4IW4E 2GZ9A 3FZDA 2A1DB 1C2DA 2J4IA 1OP2A 1GHBG 1O32A 2PSYA 5JB9S 4NA7A 1OX1A 2H9TH 3ENSB 4D9QA 1BMLA 1MD7A 1UTMA 1NRRH 1UVTH 2QAAA 3KQDA 2BXTH 1ELDE 3D23A 1HAIH 1KTSB 3P8FA 1MCVA 2XWAA 5K7RA 2G81E 3SUDA 1YCPK 3E8LA 2FOFA 3KN2A 3MO9A 7LPRA 2UUFB 4VGCB 1UJ1A 3O8RA 4Y10E 3SV9A 3U8TH 2ZTYA 1MKXH 3ATMA 1B7XB 1T8NA 2AEIH 1BTXA 2NU0E 3M5LA 4Y7BA 1NPMA 1TNGA 2WV4A 3RXUA 4F4OC 1GMCG 3LKWA 4AN7A 1E37B 1BTZA 3LH1A 1PQ8A 1FUJA 2C3SA 3A89A 2OC8A 3MU1A 1C2GA 2OCVB 1CT0E 4GHQA 1AZ8A 4YLUA 1C9TA 2ZU3A 3KCGH 2XBVA 1TGTA 4K3JA 5BPEA 3SNEA 3VPKA 1C2IA 1GVZA 2P8OB 1MKXK 4ZUHA 3SNBA 1N6XA 1U6QA 1AMHA 2QGRA 1AO5A 3ZZDA 1BT7A 3S7HB 1HYLA 3TPIZ 4U30A 3H5CB 4ZMAH 1O5FH 1GJBB 2BY7X 3ZZBA 1EZQA 2TGDA 1TPPA 1D3DB 1O5CB 1C5MD 3QX5H 2BQ7B 2O8WA 1TX7A 1F5KU 3A85A 2ZGXH 5FCKA 2O8TA 4MNXA 1AVWA 1THPB 4XOJA 4AYVB 1YYY1 1BIOA 1O34A 2AYWA 2ULLA 2ZFQH 2A7HA 3NPSA 2BOHB 1DFPA 1JIMA 1HRTH 3VB3A 3FFGA 1YPEH 3GOVB 1DXWA 1GHWH 1E0FD 3A7VA 3GCHC 3RMLH 2ASUB 1ZPCA 5CE1A 1P2OA 4JZIA 4CH8B 3BTEE 1TPAE 4U32A 1TMTH 2ZGBH 2VVCA 1QTFA 5FXLA 3ZZ8A 1C5TA 3GICB 4I8KA 4TY7A 2ZFFH 2ESTE 3LPRA 1C4U2 1W0ZU 4KP0A 1LPZB 4MG3A 1LPGB 2P95A 4TY6A 4D9RA 5IDKA 4I33A 1QRWA 5HM2A 4NSVA 2ZGJA 3S9BA 3A7ZA 2PTCE 5EU8A 1YKTA 4UFDH 1GJ9B 3EE0B 4MNYA 4ZHMU 1LVBA 2B7DH 1ESBA 1YPGH 3DUXH 3UIRA 1GBLA 1SGEE 1AFQB 4WXVA 5L6NH 1TNJA 5BRRE 1ARBA 3GY2A 1O3LA 3K65B 2RA3A 2BVSH 3ZVGA 3P17H 1SGFA 4VGCC 3A82A 3PWBA 3ZYDA 5DP3A 3PO1B 3M61U 1ZMJA 4FU7A 1ZTKA 1RFNA 1CA8B 2D26C 3F9FA 1S82A 1C5YB 2HOBA 2ANMH 1CU1A 2BLWA 2HWLB 4CRBA 3PMJA 1FPCH 5C20A 1MTUA 5HMAA 4ISLA 1NFUA 1S0RA 1JOUB 1YLDA 4CR9A 2FOEA 1YPHC 1SHHB 4ABAA 3ZVFA 1O2PA 4AGKA 1OWJA 3BTDE 3BTWE 3RDZA 3TJVA 1JBUH 2ANWA 3GCNA 4MPVA 1TLDA 1LDTT 1GBTA 1GI0A 1GI7B 4X2XA 1PQ5A 2UUYA 4BTIB 3FANA 3RXQA 3ATIA 4IC5A 1Y5BT 3SHCH 4CH2B 3UQOA 3RXLA 1SOTA 2BXUH 1P0SH 1E38B 1MTNB 1KXDA 4DGJA 3C27B 3TITA 1ZSJA 4XSKU 3RLWH 3ZVBA 1NRPH 3ZVDA 2RA0A 4BNRA 1FY1A 3CENA 2ZWLH 1WOFA 3D49H 3UFAA 3ZYEA 5EPYA 3MNXA 1VITG 4K1EA 5EW1H 4ESTE 1ZHRA 1Y3XA 3S9CA 1GDQA 2BY5X 1KXEA 5B6OA 4I8GA 2SGAA 3NK8A 4AB9A 2OUAA 3D65E 1ETRH 3H7OA 3LC5A 1DANH 2A45B 3RMOH 1ZSLA 2ZHFH 1Y8TA 1FV9A 4O03A 4B2CA 3A88A 3URCA 3B8JA 4CRFA 2ZFSA 1TRYA 1VITH 3RXFA 5LH8A 1IQKA 3A8AA 2FMJA 3MNCA 1G2LA 3VXEH 2YNBA 1WCZA 1LKAA 1DY9A 1O5AB 1FJSA 4TPIZ 1V2MT 2CHAB 3TIUA 1UHBA 1J15A 1HCGA 4YZUA 4I32A 4FUEA 4RSPA 2BVXH 1TNIA 2JETB 1T8MA 4X6NA 3IWMA 2RG3A 1MQ5A 1K1IA 2EC9H 4DOQA 2ZCLP 1NZQH 2YNAA 4K1SA 1DLKB 1XMNB 2P16A 1O2GH 3SV7A 1QB1A 2F3CE 2FWWA 2VJ1A 3OYPA 3E1XB 4AG2A 1GJ6A 2CF8H 3BSQA 3UQVA 3GDVA 1OWDA 2A4GA 1AZZA 2R2WU 2NWNA 3T26A 1GJ4H 2V3OH 3QWCH 1CVWH 1DUEA 4Y0YE 2EI6A 3PO1C 1IAUA 1W8BH 1GCTC 3STIA 5SGAE 1TX6A 1BJVA 3BIUH 3GDSA 1ANBA 3ATKA 2W26A 2ZA5A 2WINI 4GCHG 1C1OA 3OTJE 3RC6A 9LPRA 1HFDA 2BZAA 2ZP0H 3ODDA 3A7YA 4ABGA 3S9AA 1Q31A 3FVFB 2TGTA 1RTLA 5H4IB 1QL9A 3NZIA 1JIRA 1GBIA 1G30B 5A8XA 1FY5A 1MD8A 2XBWA 3IG6B 1WBGB 1VCWA 1C5PA 1ABIH 2AERH 2NU2E 4AX9H 2ODPA 3SU0A 3RLYH 1TQ7B 5DP5A 2ZQ1A 1X7AC 1HAVA 1K1LA 4Y79A 3DA9B 3EA7A 4MQAA 3ZVAA 1DPOA 3TK5A 4A7IB 3UOPA 5L2YH 1CGJE 1SQOA 1HIAA 4Y8XA 3DFLA 1Z7KA 1C5RA 3A7XA 6GCHG 2Y7XA 3TVJB 5ESTE 1UTOA 1XVOA 1BHXF 1ZJKA 5DKMA 2Z9JA 1MTNC 1C5XB 7GCHF 1OP0A 3ZVEA 5EODA 4CBOA 2Z3CA 4WF8A 2O8LA 2OC0A 3RP2A 2C8YB 3HKIB 2QV1A 3Q77A 4R0IA 1EJAA 4QT8C 3SZNA 1ZGIA 5EGMA 1V2LT 3AAVA 4THNH 1V2PT 3DT0H 1C5OH 3MHWU 1ELAA 1O2JA 2XC5A 1B0EA 3UWJH 2GDDA 1WYKA 1EASA 1NU9A 1O3GA 1MU6B 4OGXA 1E34B 1KLIH 1S83A 4WXIA 4RN6A 2OXSA 2WYGA 4O3UA 3T27A 2UWLA 2NU3E 1YPJH 4ABDA 1G37A 2PKSB 1CHOF 1E36B 1DICA 1F7ZA 1DT2A 3MU4A 5JB8S 4B1TA 1W7GH 2A4OA 1P02A 5A2MH 3F6UH 3F68H 1RS0A 4JYTA 3MO6A 8GCHG 1BZXE 1HJ9A 3EAJA 4UD9H 2JETC 3SGAE 1OWHA 1O2IA 2XCNA 4K5ZA 4MNVA 1GWAA 1YPLH 1NESE 2R3UA 3TJNA 1GG6B 1OYQA 2FTLE 1GHAF 4O9VA 1ELCA 3U8RH 1HPGA 5IYTA 2ANYA 2SGPE 1BITA 3A8BA 3LGVA 1BRUP 2AIQA 1H8IH 3H7TA 4ISNA 3AW1A 1S0QA 1M9UA 4KKDA 4MLFB 4K1TA 3SJOA 1FY8E 3TK9A 4YOIA 1PJPA 4ZKNU 5DP7A 1V2UT 1QBOA 2CV3A 1ELBA 1P3EA 4DT7B 1A3EH 2SGDE 3MNBA 1QQ4A 1F0TA 2B0FA 1AB9C 1TGSZ 1VGCC 1C2HA 1C1NA 2JH5D 2WUBA 2Y5FA 5E0JA 1AKSB 3OX7U 1SSXA 2Y5GA 2XW9A 3SU5A 2QC2A 5AHGH 4SGBE 4ASHA 1GPZA 2FODA 2HLCA 3GISB 2C8XB 3K9XB 2OP9A 3GCOA 2BQWB 4DURA 2I6SA 4CBNA 1D3PB 2BQ6B 4A1VA 2OD3B 4DG4A 1EKBB 3A84A 4FUBA 1ZMLA 2PV9B 4JK6A 3E16B 2Y5HA 2VWNA 2A2QH 5C2ZA 1T31A 4LZ4B 2QF0A 1Y3YA 3MTYA 4NCYA 2BM2A 2ZPSA 1HNEE 4DJZB 2VINA 2FLRH 1ELFA 2H2ZA 4Y7AA 4YOJA 2H5DA 1XX9A 2A4RA 1RTKA 1CGIE 1O38A 3BTME 1XM1A 2IPHA 3U8OH 1C2JA 1S6FA 2GGVB 4GUXA 4X1QU 1ZMNA 4YOGA 1O2WA 5E2PA 2BD4A 2VWLA 3PV4A 4X1RU 1EAWA 1D6WA 3G01A 1THRH 3MH6A 1GJDB 4MVNA 5FPSA 2F9OA 2BDGA 1J16A 1BMNH 1KIGH 3ATLA 2K1QA 3TH3H 4NIWA 3PTNA 1GJ7B 1RJXB 1EOJA 3FP6E 3ZZ7A 1QBNA 3PYHA 2EEKA 2Y80A 1BTUA 3A8CA 2ALVA 2P3FH 2VVVA 2R0LA 2W3KA 1SGCA 1P09A 4X2WA 3RMMH 2BDIA 2ZEBA 1UTPA 1ZSKA 4X0WU 1TBZH 2WPKS 1ELVA 3M3VA 3M5MA 1ZOMA 1TAWA 2GCHG 2ZGCA 4AORA 1O2UA 2AGIX 2HNTF 3SJKA 4X1NU 2WUCA 1SFQB 1C1WH 3SUGA 3S0NA 1BMAA 1AI8H 1LVOA 4NSYA 1NRSH 2ZNKH 3UNQA 1O30A 5AFYH 4WH8A 1K1PA 5EXLA 1GG6C 1TMBH 2P59A 1O3AA 5J4SA 1G32B 2VWOA 4J1YA 4FU9A 2G5VA 3SJIA 4ISIH 2FP7B 2VIPA 4A5TS 1O2VA 1GMHG 3MH7A 3BG4B 2QY0B 2F83A 1FZZA 2HNTE 2QXHA 3A83A 4F49A 1RGQA 1OWEA 4D76A 4Y8YA 2XXLA 1FPHH 4Q80A 1SVPA 4JCNA 1MAYA 1DXPA 2FIRH 2B5TB 1P10A 5TJXA 2W3IA 5JBTA 4JZEH 1EB2A 1V2QT 1YC0A 2XTTB 4Z0KA 1YM0A 2TIOA 4IN2A 1HUTH 2CJIA 4JYUH 5EW2H 5E0GA 2Z9IA 2P93A 2Y7ZA 1PPEE 5LPFA 1KDQB 1Z8JB 1O5DH 4K60A 1SR5C 3U1JB 5K0HA 1HBTH 2GX4A 1ZYOA 1GBHA 2OC1A 1O3KA 2FS9A 1Z8IB 2GDEH 2FOCA 2PW8H 1LHDH 4H6TA 3QZRA 2VNTA 1SOZA 2GP9B 2UUJB 1FMGA 4YTAA 4ZH8A 2QXGA 1O3NA 4KTUA 1CBWC 3U9AH 1V2VT 3SV2H 1TA2A 1QGFA 5FX5A 2AH4X 3RM2H 1PPZA 1O39A 5C5NA 5T3HA 4YT6H 3TJOA 2PHBA 3VB6A 1T4UH 1OOKB 3RXHA 3ZVCA 4NG9H 1QA7A 5GWZA 4AB8A 4K8BA 5T6DA 5F8XA 3P8OA 1PPFE 2WV5A 2ZHQH 3UUZA 2H1UA 4I8LA 1GL0E 3T28A 3U98H 3HPTB 2PKAA 1C2LA 6LPRA 1ABJH 3TH2H 2R3YA 4NWLA 2BVRH 1O3EA 1LCYA 3NKKA 3ELAH 3SHAH 3R0FA 4B75A 3LH3A 1MBMA 2FXRA 1HB0B 1WU1A 4WH6A 1O35A 4X8UH 3TNTA 1C1SA 1GMDF 5TCAA 3T5FH 1OS8A 4FVBA 4AFZA 1NRNH 1PPHE 3SW2B 2VB0A 2QXIA 2J95A 1GBFA 3VB7A 2ZQ2A 1CA0B 3OU0A 2WPJS 1C5LH 5GCHG 1HAPH 4E06H 1ETSH 1BTWA 2FTMA 2Q6FA 3QTOH 2GV6A 2D8WA 1ZHMA 3B23B 1SGYE 1PPCE 1NT1A 2P94A 1OP8A 2FPZA 1XXDA 1TPSA 2VH6A 3DD2H 1GCTB 3QDZB 1LPKB 4Q7YA 2OQ5A 2RCEA 1GBEA 3BG4C 3VB5A 3ZZ5A 4BAKB 3EA9A 1W13U 1SGQE 2CF9H 2FI5E 4Q7XA 1DLEA 1AD8H 4WY3A 1JXPA 3SO3A 5GIBA 1C5VA 1XUKA 1BOQA 4X6PA 2AIPA 4H4FA 1FN6A 1TE0A 1ZTLA 1Y5AT 1HDTH 1N8OC 1GI6A 1O3CA 1L1NA 1O3PB 1V2JT 3AASA 4X8SH 3SBKA 2HPQH 2AFQB 3TK6A 3UNSA 4FUJA 4HI3A 1LMWB 1NFXA 1P04A 2HGTH 1B0FA 3GCTF 3U69H 2GCTB 1HV7A 3MOCA 4RKJB 1AE5A 4ABIA 5FX6A 2BDBA 2BDCA 1DUAA 4BOHA 1N6YA 1WUNH 3GYMA 1UCYE 4GPGA 1K1JA 4ZXXH 1BQYA 2QN5T 1C1RA 2ODYB 3EA8A 5A0BA 2SGFE 1EAUA 1QA0A 3PWCA 1BB0B 1DWBH 1CHGA 2C4FH 4UFGH 1W0YH 1F0RA 1MQ6A 1XUJA 3KHVA 1EPTA 2XBYA 1V2KT 1GDUA 2QXJA 1JWTA 4I8JA 4IC6A 1Y59T 1SHYA 2GT8A 2ZGHA 3QZQA 1C1UH 1L1GA 3F9HA 1TNLA 1EAIA 1K28D 2H9HA 2VGCB 1S5SA 1ZZZA 4HZHA 4FUIA 1V2TT 1GI4A 2XNIA 3U1IB 1H9IE 3UOUA 1A1RA 3LOXA 2FOMB 2FZZA 1BHXB 2AS9A 2Y81A 1H1BA 2IN2A 1N1LA 2KAIB 5FPYA 3TGJE 4JK5A 3M7UA 3L6PA 1AUJA 4AFUA 4TWWA 1UVUH 1O3OA 1RD3B 1TYNA 3OY5U 2Z7FE 1DSTA 3RC4A 1GBJA 1QL8A 1TBRH 1C1VH 4Y0ZE 2B9LA 2BD3A 1NFYA 4E05H 5LGOA 3ZZ6A 1UTJA 2SGQE 5AF9H 2FO9A 2G8TA 1CA0C 2FEQH 5J4QA 1TGCA 3UR9A 1WSSH 3RXOA 3RXMA 1H4WA 5EQRA 1AVXA 1YBWA 1O2LA 1UVPA 3F9GA 3QO6A 4WJG2 1W14U 1ZPBA 1ANEA 1ZHPA 3C1KA 2F9NA 1S6HA 1P9UA 2W7UA 3W94A 1EOLA 3V13A 1XXFA 1O2NA 1FLEE 4NZLA 3UTUH 4YO9A 1IQJA 2A5KA 1O3JA 2ZFPH 3RXRA 1Z6JH 1O36A 7ESTE 2W7SA 3GY7A 2A5AA 5DO4H 3RXJA 1QNJA 1AB9B 2BX4A 1EUFA 1GI5A 2PGQB 4Y8ZA 4ABBA 1EJNA 4R8TB 4K8YA 5ESBA 1VGCB 3TJUA 4IMZA 1O2TA 1DS2E 4ABFA 1PFXC 3SU6A 5A09A 2VVUA 1AQ7A 5EOKA 1LHCH 2DUCA 4K2YA 3F1SB 1WQSA 3LGWA 2OINA 2ODQA 1V2WT 2TGPZ 4TYDA 3RU4D 2GCTC 2C8WB 4XBDA 3BIVH 1ARCA 5G4BA 1MTSA 2Q6DA 2QF3A 4X2VA 1A2CH 1AWHB 1SQTA 2W5EA 2J92A 1C1PA 1UMAH 2GMTB 2FI4E 1A5GH 1AWFH 2TPIZ 1MUEB 1C1TA 1FN8A 2Q1JA 2ZU5A 3PROA 4JYVH 3EDXB 4DCDA 3VXFH 8ESTE 1S85A 2FLBH 2Z9GA 2A5IA 5CMXH 3M37A 3PMHB 3I77A 3M35A 3P8GA 4D7FA 2A7JA 3UR6A 1GBCA 3MYWA 4NFFA 3A80A 5F8ZA 3V0XA 1TB6H 3RXVA 1VZQH 1SL3A 2BTCE 3GYLB 2F91A 1J17T 1MKWH 3MU0A 4XFQA 4X8TH 1YGCH 1V2ST 5EQSA 3M36A 1YF4A 2GZ7A 1IQGA 2G5NA 2AMQA 2PUQH 3SUFA 1MH0A 4BTTB 2LPRA 2ZCKP 2BDAA 2VGCC 1ELGA 1GHXH 1P01A 1S84A 3KGPA 4FUDA 4ISHH 1QIXB 4JZFH 3LGIA 4H6SB 5DP8A 1BJUA 1JRSA 1PPBH 1UTQA 3RXDA 4J2YB 1GHBF 2LNCA 3PLPA 3ZZ4A 2FX6A 4IMQA 1MKWK 3GY8A 1A61H 3CS0A 1ELEE 3RXGA 1O2SA 1DWDH 6ESTA 4X2YA 1OSSA 1O2YA 1SFIA 2ZPRA 3PB1E 3SNDA 2ZCHP 4B73A 1Z71A 3SJ9A 2J9NA 3HKJB 5T6GA 1BDAA 3WY8A 3RM0H 3B9FH 8KME2 1L4ZA 3DHKH 5F8TA 4B2AA 2UWOA 2VIQA 3URDA 1O0DH 2FDAA 1TOMH 1GMCF 2J38A 1SGDE 4INHA 4CRGA 4OS7A 5FAHA 1F2SE 1KXCA 2THFB 3I78A 1V2RT 3RU4E 2CN0H 1BA8B 1A46H 3QLPH 2ZF0H 1FQ3A 2XBXA 4YM9A 1P2IA 3GY3A 3A81A 1A4WH 3BTHE 1LO6A 2IOTA 1ZTJA 3KQBA 1E35B 2ZDLA 3E3TA 1Z8RA 1BTHH 1S81A 4D8NA 2YOLA 1IOEA 3P70B 1C5SA 3PMBB 3UREA 1TOCB 4Y71A 1EQ9A 4ISOA 1YP9A 3BTKE 2NU1E 3PTBA 1J14A 1Z6EA 5CHAB 1LVYA 3UNRA 2GD4B 1T8LA 1AU8A 3EYDA 1AN1E 3OSYA 4XBBA 1OKXA 4FUHA 1GBBA 1H8DH 3BG8A 2XC0A 3AW0A 4GSOA 1HIAB 2G4TA 5LPEA 2OQUA 1V6DA 1AGJA 2P3UB 1BBRH 5TCCA 3AVZA 2ZG0H 1RIWB 1WV7H 5A8YA 4JMYA 3P95A 2GMTC 2BZ6H 2VIWA 2BY6X 3TLOA 1WAYB 1SGIB 4UEHH 1XUFA 4AZ2B 1P12E 1HLTH 4TPYA 4GLYA 3LJOA 1SG8B 1YCPM 5JYIA 1KXAA 1FAKH 3GY4A 4NZQA 4Q7ZA 1O37A 1XKAC 1QBVH 1CBWB 1L4DA 3KL6A 1C5WB 4ABHA 1HAHH 1NROH 3MMGA 3LC3A 1TWXB 1HAOH 1IQEA 4DIIH 1PQAA 1F92A 1KDQA 1GJ8B 3SORA 1A5IA 3BTGE 2BLQA 1DOJA 1SMFE 1HJ8A 2Y82A 5EPNA 4ZHLU 1BBRK 1BCUH 3CP7A 4O3TA 1K1NA 5JBBS 1A3BH 4FUGA 1G2MA 2XRCA 2A2XH 1DDJA 4OS1A 1GCDA 4A6LA 1C2MA 2CMYA 1QQUA 1SPJA 3R3GB 1ZJDA 2C90B 4OS4A 4ZXYH 3ZV9A 4AG1A 7GCHG 4CREA 1LHGH 1NN6A 1B5GH 5PTPA 2P3TB 1O2QA 2Z6BD 3LGYA 3P8NA 4B71A 5GPIB 1EB1H 1IHSH 1QJ1B 2BMGB 2ZHWH 1A0LA 3LDXH 2BD7A 3HGPA 5FBEA 5C5OA 5I25A 3O8BA 1WTGH 2VH0A 1P2NA 3KNXA 1NRQH 2BLVA 1GHZA 2C93B 1K22H 1UTKA 4U01A 1GJCB 1UK4A 4HFPB 1EAXA 2SGEE 2OLGA 4GAWA 4M7GA 1P2KA 1KTTB 3T29A 1CHOG 1FAXA 1CE5A 1L1JA 1SGNE 1Y3UA 1O3DA 1UTLM 1GJAB 1SGFG 3PMAB 3QN7A 1O2ZA 1AVGH 1HAYB 5EXNA 2ZDKA 5GXPA 1D6RA 1BRAA 1O5EH 3M7TA 4MDSA 4BTUB 3ZV8A 1O3FA 1VJ9U 1P2MA 3RC5A 2HNTC 2ZPQA 4GVUA 5EQQA 4UONA 1QURH 3SV6A 1HGTH 1A7SA 1GVLA 4MPWA 1P11E 1LQDB 5DP9A 4FU8A 1FDPA 3SU1A 1N8OB 1DWEH 3ZZ3A 1DY8A 2PLXA 3A7WA 1KLJH 1SC8U 5CHAC 1IQLA 2BOKA 3S69A 3S7KB 2BHGA 3RUOA 1ZGVA 1GHAG 1OYTH 4HTCH 5L30H 1BRCE 3SU2A 3VGCC 4OS2A 3FZZA 3O8DA 2XCFA 2A4QA 2ZZUH 4NA8A 1RIWC 2FESH 3ATWA 5FBIA 2R9PA 2AGGX 1VITF 1TABE 3BTFE 3P92A 1DSUA 2G55A 4E7RG 1MAXA 1ZRBA 2O8MA 4BXWA 4UDWH 2C8ZB 4Y6DA 3QGJA 1WQVH 2AMPA 1YPMH 1AHTH 3ZZCA 2CXVA 2ZC9H 1EZSC 1UK3A 2BYAX 1O3MA 1W12U 1G9IE 2WPMS 5DG6A 9ESTA 1GHYH 4IBLH 1O3HA 1RRKA 1W2KH 2WYJA 4X1PU 1GBMA 3M7QA 1Y3WA 2J2UA 1HJAB 1KXBA 2ZIQH 1K21H 5HXFA 1C5NH 1ZR0A 1YLCA 2Y6TA 7KMEH 1K9OE 2FOAA 1GJ5H 5F03A 3LT3A 4KELA 2Z3EA 1NC6A 1QJ7B 1NFWA 3QK1A 2D1JA 4DVAU 1VCQA 2EA3A 1VR1H 1ORFA 1FY4A 1O3BA 3OY6U 4DW2U 4ZAEA 5HYOA 2FS8A 4LOYH 4WMFA 1QY6A 3T25A 3ESTA 1TALA 1QJ6B 1C9PA 3TGIE 1CGHA 4Z6AH 1KYNA 1SI5H 1CT2E 4AFSA 1Z1JA 1NO9H 1TFXA 4NIYA 2STBE 4LXBH 3KIDU 4XBCA 1P8VC 3RXEA 4FUCA 4AGJA 1W3CA 4TWYA 1G3EA 6CHAB 1IQHA 1K1OA 1TBQH 2KAIA 1G3DA 3E0PB 1DX5M 3P6ZB 4B2BA 1F5RA 1AY6H 2QA9E 3FP8E 1LHEH 3W95A 4CHAB 1H9HE 4GCHF 1BMMH 4E7NA 1QRZA 2G00A 3MFJA 1HXEH 4LK4A 5JBAS 2ZECA 2BDHA 3BEFB 3SI4H 4BAOB 5DP6A 3V3MA 2OBQA 1G36A 1SLVB 2Z3DA 1K1MA 1PYTD 5C1YA 2ZHDA 1TNHA 2PWXA 5DJ7A 3K6ZA 1W10U 2H5CA 2UWPA 4JZ1A 3NXPA 1LQEA 1SLXB 4WVPE 2V6NA 3VFEA 4X1SU 1BTYA 4WMDA 3MH5A 2WPIS 3AAUA 3QGNB 4INKA 3T62A 1EJMA 1A5HA 2VWMA 2ILNA 1BTPA 1QRXA 2VIOA 4KTSA 1Q3XA 1XKBC 5C1XA 2V0BA 4FUFA 1OPHB 4CRCA 1T4VH 4IN1A 4X6OA 1IQNA 1DVAH 1SQAA 3ODFA 4AOQA 6GCHF 3RXIA 3SNAA 3M5OA 1ACBE 3HK6B 2OTVA 1TIOA 1IQFA 2GKVE 3NCLA 2GV7A 4NIXA 3E6PH 1K2I1 1HAZB 1Q2WA 4YLQH 1ESTA 1G3BA 4ZKSU 2BY8X 4I7YH 2ZU2A 3SGBE 3VEQB 1YPHE 4XDEA 3DFJA 3HK3B 5A0CA 5AFZH 5JPMH 3V7TA 3I29A 4KTCA 1XVMA 1C2KA 1QL7A 1TGNA 1IQIA 2B8OH 2JKHA 3LIWA 4JZDH 5C3NA 1RXPA 2TBSA 2ZHEH 2P8OC 2ANKH 3SQEE 4NA9H 3MH4A 3LGUA 1SB1H 1XUGA 1W7XH 2A31A 2AGEX 3Q3XA 1P2QA 3UPEA 4MPUA 1T8OA 1C5QA 4Y76A 1C2FA 2BLOA 3CS7A 2A7CA 3LONA 4H42U 1HJAC 2PSXA 2ZU4A 4B76A 1DM4B 1FNIA 3FAOA 3QUMP 1LTOA 1D3TB 4YT7H 1TA6A 2HPPH 2PKAB 1ID5H 3D62A 1GBDA 3TGKE 2BD8A 4NWKA 2CGAA 5C1UA 8GCHF 2ZTZA 3ZZ9A 4ABJA 3SOSA 1EXFA 3STJA 3MO3A 1KY9A 1DITH 2BB4A 2GVFA 2ZDVH 1J8AA 2QYIA 5DP4A 1D9IA 1PYTC 1ESAA 4GHTA 4B74A 2HVXA 2V3HH 1A0HB 1LKBA 1EZXC 4SGAE 2ZU1A 1YPKH 1GVKB 3TU7H 5ABWA 1GI2A 2BY9X 2FI3E 1UO6A 2A32A 3BV9B 1TNKA 3KEEA 1LHFH 2FX4A 6CHAC 2WPHS 1TRMA 1UVOA 1MMJN 5I46H 1ETTH 1O2KA 4CHAC 1CSOE 5A0AE 3PLBA 3E0NB 1GGDB 3QTVH 3RXTA 1P05A 1ZPZA 1J9CH 3RXKA 1NS3A 3N7OA 4NGAH 4NFEA 1FI8A 4WWYA 3BN9A 4YESB 3SI3H 1O5GH 3SUEA 1CQQA 1O2HA 2R2MB 1QFKH 4OS5A 2VIVA 3MWIU 2F9VA 4MTBA 1KSNA 1AFQC 1O33A 3GDUA 1GMDG 1O3IA 3RU4T 1O2RA 2BDYA 2F9BH 2SNVA 2Z9KA 5E0HA 3KQCA 1EZUC 1DE7H 1XUHA 4UFEH 2STAE 1AE8H 1UVSH 4U2WA 2ZKSA 1BBRE 2O8UA 1LVMA 1P3CA 4O97A 3O8CA 4WMEA 4IGDA 3EGKH 1C4Y2 1QB9A 4PROA 4X6MA 3IITA 1O2OA 2EI7A 4ZKRU 3RXSA 1MCTA 4MNWA 1ANDA 5GJ4B 1L2EA 1GHVH 1P57B 2GZ8A 2RDLA 2G4UA 3KQEA 5F6MA 3GY5A 3LU9B 2J94A 3M3TA 2PFEA 1OXGA 1AKSA 1V3XA 2SNWA 1BUIA 2G52A 2JH6D 2FYQA 2R0KA 5E8EH 1PPGE 1EPTB 4BXSA 1MTVA 2UUKB 1C5ZB 1XUIA 2BD5A 1EP5A 3Q3YA 3GY6A 2BX3A 2VIDA 1AIXH 2EI8A 1W11U 3FP7E 1TGBA 1C2EA 1JMOH 4A1XA 1GBKA 1SGPE 1Y5UT 2VU8E 1P03A 4OGYA 4UE7H 5HGGA 2H9EH 1C4V2 1ZRKA 1SGTA 1Z1IA 3GCTG 4HGCA 5EXMA 3RXBA 2BD9A 2FM2A 1UCYH 2GT7A 4UFFH 1D3QB 5A8ZA 3M3SA 5FHTA 3MU5A 2OBOA 3MU8A 4ABEA 2GCHF 1KXFA 1T7CA 4KGAA 5ETXA 1T32A 2TGAA 2M5TA 1P2JA 3SN8A 4D7GA 2IJOB 3L3TA 1INCA 2JH0D 2FOGA 3RXCA 5DGJA 1UHBB 3A7TA 3HGNA 4XE4A 2FOHA 2V35A 5E2OA 3BTQE 1SBWA 3Q76A 4BAMB 1VCPA 2OC7A 1CT4E 1G3CA 2ZFRH 3HATH 4Q2KA 2ZDMA 1VJAU 2PTNA 4FVDA 1TRNA 4ZROA 1IHTH 5EG4A 3VB4A 1UK2A 5JBCS 1DWCH 4I8HA 1UCYK 1OWIA 1GMHF 4Y11E 1EATA 1NU7B 1ANCA 3V12A 4DY7B 2Z9LA 1Z8GA 1UTNA 1GGDC 2CHAC 5DPAA 2XC4A 1EX3A 3LGTA 3E90B 1V2NT 1FIZA 3PM3A 4CRAA 4AYYB 1IQMA 2ZI2H 2QIQA 3A87A 2HALA 1OWKA 3E91A 1BRBE 4BAHB 1C1MA 3UWIA 1CO7E 3K6YA 4CR5A 1THSH 3SJ8A 2G51A 1D4PB 2PR3A 3TNSA 3NUMA 2ZO3H 1C5UA 5JDUB 5LPRA 2Q6GA 4BAQB 1MZDA 4ZHAA 2A0QB 2TRMA 3MI4A 1H9LB 1L0ZA 1KLTA 3L33A 2I6QA 1SLUB 1FONA 1FXYA 3JZ2B 1MBQA 3T2NA 1AUTC 1GI1A 1C1QA 2Z94A 2H6MA 4AFQA 1TPOA 3EQ0H 1HAVB 1QB6A 1HAXB 1TQ0B 2DE9A 2HRVA 1ELTA 5AVDA 4FXGH 1TMUH 2BD2A 3M5NA 2PUXB 1NM6A
chains in the Genus database with same CATH superfamily
3VGCB 3SYJA 3LJJA 4A1TA 4NIVA 5C67A 1AFEH 4I31A 1TX8A 2ZDAH 1GDNA 4MPXA 1SLWB 3PLKA 1V2OT 2SFAA 1FIWA 1F0UA 2F9PA 3Q00A 3SU4A 4Q4LA 3BEUA 2ALPA 2XYAA 2ZTXA 2QCYA 2LELA 1JRTA 5T6FA 5FPTA 1O2MA 2PGBB 1GI8B 1MU8B 1MTWA 2D2DA 1GI3A 1RTFB 3KF2A 3RXPA 3BEIB 1QR3E 1EPTC 1TONA 3RXAA 3SU3A 1O31A 3BTTE 2FOBA 5FCRA 2WPLS 3K2UA 1WTHD 1F5LA 4ZKOU 5L2ZH 8LPRA 5HM9A 2XWBI 3SNCA 3A8DA 2ZDNA 4OS6A 3SV8A 3FO8D 1P06A 3NWUA 2ZFTA 4DIHH 1FY3A 1O5BB 1P9SA 1NTPA 2FYRA 2AMDA 5DK1A 3SGQE 4IS5A 4X8VH 1ZLRA 2F9UA 4K69A 1EP6A 4AC9A 3Q3KA 1O2XA 5GCHF 2LP6A 2NU4E 3GCHB 4INLA 2DE8A 1A0JA 4BANB 4LZ1H 1GBAA 1SKYE 2O9QA 3F9EA 2PKSC 3TH4H 1GI9B 3KYGA 1PQ7A 3JZ1B 3A86A 4RKOB 3F2FA 1QCPA 3MNSA 3UAIC 3ITIA 1YCPH 3RMNH 1MZAA 1HAGE 4CRDA 1NY22 1F0SA 1SGRE 3SQHE 1HXFH 3BF6H 3UY9A 5GDSH 3ZZAA 1YWUA 1GL1A 1QHRB 2J34A 2GTBA 1Y3VA 4A92A 2XOKD 4IW4E 2GZ9A 1UW7A 3FZDA 2A1DB 1C2DA 2J4IA 4B6FA 1OP2A 1GHBG 1O32A 2PSYA 5JB9S 4NA7A 1OX1A 2H9TH 3ENSB 4D9QA 1BMLA 1MD7A 2VBCA 1UTMA 1NRRH 1UVTH 2QAAA 3KQDA 2BXTH 1ELDE 3D23A 1HAIH 1KTSB 3P8FA 1MCVA 2XWAA 5K7RA 2G81E 3SUDA 1YCPK 3E8LA 2FOFA 3KN2A 3MO9A 7LPRA 2UUFB 4VGCB 1MABB 5CDFE 1UJ1A 3O8RA 4Y10E 3SV9A 3U8TH 2ZTYA 1MKXH 3ATMA 1B7XB 5HIYA 1T8NA 2AEIH 1BTXA 2NU0E 3M5LA 4Y7BA 1NPMA 1TNGA 2WV4A 3RXUA 4F4OC 1GMCG 3LKWA 4AN7A 1E37B 1BTZA 3LH1A 1PQ8A 1FUJA 2C3SA 3A89A 2OC8A 3MU1A 1C2GA 2OCVB 1CT0E 4GHQA 1AZ8A 4YLUA 1C9TA 3F0PA 2ZU3A 3KCGH 2XBVA 1TGTA 4K3JA 5BPEA 3SNEA 3VPKA 1C2IA 1GVZA 2P8OB 1MKXK 4ZUHA 3SNBA 1N6XA 1U6QA 1AMHA 2QGRA 1AO5A 2CK3D 3ZZDA 1BT7A 3S7HB 1HYLA 3TPIZ 4U30A 3H5CB 4ZMAH 1O5FH 1GJBB 2BY7X 3ZZBA 1EZQA 2TGDA 1TPPA 1D3DB 1O5CB 1C5MD 3QX5H 2BQ7B 2O8WA 1TX7A 1F5KU 3A85A 2ZGXH 5FCKA 2O8TA 4MNXA 1AVWA 1THPB 4XOJA 4AYVB 1YYY1 5KECA 1BIOA 1O34A 2JJ2D 2AYWA 2ULLA 2ZFQH 2A7HA 3NPSA 2BOHB 4FETA 1DFPA 1JIMA 1HRTH 3VB3A 3FFGA 1YPEH 3GOVB 1DXWA 1GHWH 1E0FD 3A7VA 3GCHC 3RMLH 2ASUB 1ZPCA 5CE1A 1P2OA 4JZIA 4CH8B 5C17A 3BTEE 1TPAE 4U32A 1H8ED 1TMTH 2ZGBH 2VVCA 4P02A 1QTFA 3DCLA 5FXLA 2KCYA 3ZZ8A 1C5TA 3GICB 4I8KA 4TY7A 2ZFFH 2ESTE 3LPRA 1C4U2 1W0ZU 4KP0A 1LPZB 4MG3A 1LPGB 2P95A 4TY6A 4D9RA 5IDKA 4I33A 1QRWA 5HM2A 4NSVA 2ZGJA 3S9BA 3A7ZA 2PTCE 5EU8A 1YKTA 4RI0A 4UFDH 1GJ9B 3EE0B 4MNYA 4ZHMU 1LVBA 2B7DH 1ESBA 1YPGH 3DUXH 3UIRA 1GBLA 1SGEE 1AFQB 2KCPA 4WXVA 5L6NH 1TNJA 5BRRE 1ARBA 3GY2A 1O3LA 3K65B 2RA3A 2BVSH 3ZVGA 3P17H 2WPDD 1SGFA 4VGCC 3A82A 3PWBA 5FL7D 3ZYDA 5DP3A 3PO1B 3M61U 1ZMJA 4FU7A 1ZTKA 1RFNA 1CA8B 2D26C 2IPQX 3F9FA 3OE7D 1S82A 2GJGA 1E79D 1C5YB 2HOBA 3SZEA 2ANMH 1CU1A 2BLWA 2HWLB 4CRBA 3PMJA 1FPCH 5C20A 1MTUA 5HMAA 4ISLA 1NFUA 1S0RA 1JOUB 1YLDA 4CR9A 2FOEA 1YPHC 1SHHB 4ABAA 3ZVFA 1O2PA 4AGKA 1OWJA 3BTDE 3BTWE 3RDZA 3TJVA 1JBUH 2ANWA 3GCNA 4MPVA 1TLDA 1LDTT 1GBTA 1GI0A 4OM9A 1GI7B 4X2XA 1PQ5A 2UUYA 4BTIB 3FANA 3RXQA 3ATIA 4IC5A 1Y5BT 3SHCH 4CH2B 5EIYA 2J98A 3UQOA 1FX0B 3RXLA 2OK5A 1SOTA 2BXUH 1P0SH 1E38B 1MTNB 1KXDA 4DGJA 3C27B 3TITA 1ZSJA 4XSKU 3RLWH 3N7EA 3ZVBA 1NRPH 3ZVDA 2RA0A 4BNRA 1FY1A 3CENA 2ZWLH 1WOFA 3D49H 3UFAA 3PRDA 3ZYEA 5EPYA 3MNXA 1VITG 4K1EA 5EW1H 3AK5A 4ESTE 1E1QD 1ZHRA 1Y3XA 3S9CA 1GDQA 2BY5X 1KXEA 5B6OA 4I8GA 2SGAA 4RT1A 3NK8A 4AB9A 2OUAA 3D65E 1ETRH 3H7OA 3LC5A 1DANH 2A45B 3RMOH 1ZSLA 5C0TA 2ZHFH 1Y8TA 1FV9A 4O03A 4B2CA 3A88A 3URCA 3B8JA 4CRFA 2ZFSA 1TRYA 1VITH 3RXFA 5LH8A 1IQKA 3A8AA 2FMJA 3MNCA 1G2LA 3VXEH 2YNBA 1WCZA 1LKAA 1DY9A 1O5AB 1FJSA 4TPIZ 1V2MT 2CHAB 3TIUA 1UHBA 1J15A 1HCGA 4YZUA 4I32A 4FUEA 4RSPA 2BVXH 1TNIA 2JETB 1T8MA 4X6NA 3IWMA 2RG3A 1MQ5A 1K1IA 2EC9H 4DOQA 2ZCLP 1NZQH 2YNAA 4K1SA 1DLKB 5C94A 1XMNB 2P16A 1O2GH 3SV7A 4I86A 1QB1A 2F3CE 2FWWA 2VJ1A 3OYPA 3E1XB 3PRBA 1GJ6A 4AG2A 2CF8H 3BSQA 3UQVA 3GDVA 1OWDA 2A4GA 1AZZA 2R2WU 2NWNA 3T26A 1GJ4H 2V3OH 3QWCH 1CVWH 1DUEA 4Y0YE 2EI6A 3PO1C 1IAUA 1W8BH 1GCTC 3STIA 5SGAE 4F55A 1TX6A 4Q63A 1BJVA 3BIUH 3GDSA 1ANBA 3ATKA 2W26A 2ZA5A 2WINI 4GCHG 1C1OA 3OTJE 3RC6A 9LPRA 1HFDA 2BZAA 2ZP0H 2JDID 3ODDA 3A7YA 4ABGA 3S9AA 1Q31A 3FVFB 2TGTA 1RTLA 5H4IB 3MQKC 1QL9A 3NZIA 3PV5A 1JIRA 1GBIA 1G30B 4ASUD 1FY5A 1MD8A 1E1RD 2XBWA 5A8XA 3IG6B 1WBGB 1VCWA 1C5PA 1ABIH 2AERH 2NU2E 4AX9H 2ODPA 3SU0A 3RLYH 1TQ7B 5DP5A 2ZQ1A 1X7AC 1HAVA 1K1LA 4Y79A 3DA9B 3EA7A 4MQAA 3ZVAA 1DPOA 3TK5A 4A7IB 3UOPA 5L2YH 1CGJE 1SQOA 1HIAA 4Y8XA 3DFLA 1Z7KA 1C5RA 3A7XA 6GCHG 3U28C 2Y7XA 3TVJB 5ESTE 1UTOA 4Z1MD 1XVOA 1BHXF 1ZJKA 5DKMA 2Z9JA 1MTNC 1C5XB 7GCHF 1OP0A 3ZVEA 5EODA 4CBOA 2Z3CA 4WF8A 2O8LA 2OC0A 3RP2A 2J97A 2C8YB 3HKIB 2QV1A 3Q77A 4R0IA 1EJAA 4QT8C 3SZNA 1ZGIA 5EGMA 1V2LT 3AAVA 4THNH 1V2PT 3DT0H 1C5OH 3MHWU 1ELAA 1O2JA 2XC5A 3OFND 1B0EA 3UWJH 2GDDA 1WYKA 1EASA 1NU9A 1O3GA 2XNDD 1MU6B 4OGXA 1E34B 1KLIH 1S83A 4WXIA 1KMHB 4RN6A 2OXSA 2WYGA 4O3UA 3T27A 2UWLA 2NU3E 1WXRA 1YPJH 4ABDA 3F2HA 1G37A 2PKSB 1CHOF 1E36B 1DICA 1F7ZA 1DT2A 3MU4A 5JB8S 4B1TA 1W7GH 2A4OA 2RFKC 1P02A 5A2MH 3F6UH 3F68H 1RS0A 4JYTA 3MO6A 8GCHG 1BZXE 1HJ9A 3EAJA 4UD9H 2JETC 3SGAE 1OWHA 1W0KD 1O2IA 2XCNA 4K5ZA 4MNVA 1GWAA 1YPLH 1NESE 2R3UA 3TJNA 1GG6B 1OYQA 2FTLE 1GHAF 4O9VA 1ELCA 3U8RH 1HPGA 5IYTA 2ANYA 2SGPE 1BITA 3A8BA 3LGVA 1BRUP 2AIQA 1H8IH 3H7TA 4ISNA 3AW1A 1S0QA 1M9UA 4KKDA 4MLFB 4K1TA 3SJOA 1FY8E 3OAAD 3TK9A 4YOIA 1PJPA 4ZKNU 5DP7A 1V2UT 2KX4A 1QBOA 2CV3A 1ELBA 1P3EA 4DT7B 1A3EH 2SGDE 3MNBA 1OHHD 1NBME 3OTPA 1QQ4A 1F0TA 2B0FA 1AB9C 1TGSZ 2QE7D 1VGCC 1C2HA 1C1NA 2JH5D 2WUBA 2Y5FA 5E0JA 1AKSB 3OX7U 1SSXA 2Y5GA 4XD7D 2XW9A 2M2AA 3SU5A 1SQRA 2QC2A 5AHGH 4SGBE 4ASHA 1GPZA 2FODA 2KFWA 4ZCNA 2HLCA 3GISB 2C8XB 3K9XB 2OP9A 3GCOA 2BQWB 4DURA 2I6SA 4CBNA 1D3PB 2BQ6B 4A1VA 2OD3B 4DG4A 1EKBB 3A84A 4FUBA 1ZMLA 2PV9B 4JK6A 3E16B 2Y5HA 2J5UA 2VWNA 2A2QH 5C2ZA 1T31A 4LZ4B 2QF0A 1VKYA 1Y3YA 3MTYA 4NCYA 2BM2A 2ZPSA 1HNEE 4DJZB 2VINA 2FLRH 1ELFA 2H2ZA 4Y7AA 4YOJA 2H5DA 1XX9A 2A4RA 1RTKA 1CGIE 1O38A 3BTME 1XM1A 2IPHA 2EQNA 3U8OH 1C2JA 1S6FA 2GGVB 4GUXA 4X1QU 1ZMNA 2IJD1 4YOGA 1O2WA 5E2PA 2BD4A 2VWLA 3PV4A 4X1RU 1EAWA 1D6WA 3G01A 1THRH 3MH6A 1GJDB 4MVNA 5FPSA 2F9OA 2BDGA 1J16A 1BMNH 1KIGH 3ATLA 2K1QA 3TH3H 4NIWA 3PTNA 1GJ7B 1RJXB 1EOJA 3FP6E 3ZZ7A 1QBNA 3PYHA 2EEKA 2Y80A 1BTUA 3A8CA 2ALVA 2P3FH 2VVVA 2R0LA 2W3KA 4M9FA 1SGCA 1P09A 4X2WA 3RMMH 2BDIA 2ZEBA 1UTPA 1ZSKA 4X0WU 1TBZH 2WPKS 1ELVA 3M3VA 3M5MA 1ZOMA 1TAWA 2GCHG 2ZGCA 4AORA 1O2UA 2AGIX 2HNTF 3SJKA 4X1NU 2WUCA 1SFQB 1C1WH 3SUGA 3S0NA 1BMAA 1AI8H 1LVOA 4NSYA 1NRSH 2ZNKH 3GS9A 3UNQA 1O30A 5AFYH 4WH8A 1K1PA 5EXLA 1GG6C 1TMBH 2P59A 1O3AA 5J4SA 1G32B 2VWOA 4J1YA 4FU9A 2G5VA 3SJIA 2WHXA 4ISIH 2FP7B 2VIPA 4A5TS 1O2VA 1GMHG 3MH7A 3BG4B 2QY0B 2F83A 1FZZA 2HNTE 2QXHA 3A83A 4F49A 1RGQA 2K8IA 1OWEA 4D76A 4Y8YA 2XXLA 1FPHH 4Q80A 1SVPA 2K0QA 4JCNA 1MAYA 1DXPA 3WW7A 2FIRH 2B5TB 1P10A 5TJXA 2W3IA 5JBTA 4JZEH 1EB2A 1V2QT 1YC0A 2XTTB 4Z0KA 1YM0A 2TIOA 4IN2A 1HUTH 2CJIA 4JYUH 5EW2H 5E0GA 2Z9IA 2P93A 2Y7ZA 1PPEE 5LPFA 4TSFD 1KDQB 1Z8JB 1O5DH 4K60A 1SR5C 3U1JB 5K0HA 1HBTH 2GX4A 1ZYOA 1GBHA 2OC1A 1O3KA 2FS9A 1Z8IB 2GDEH 2FOCA 2PW8H 1LHDH 1K0HA 4H6TA 3QZRA 1BMFD 2VNTA 1SOZA 2GP9B 2UUJB 1FMGA 4YTAA 4ZH8A 2QXGA 1O3NA 4KTUA 1CBWC 3U9AH 1V2VT 3SV2H 1TA2A 1QGFA 5FX5A 2AH4X 3RM2H 1PPZA 1O39A 5C5NA 5T3HA 4YT6H 3TJOA 2PHBA 3VB6A 2KCOA 1T4UH 1OOKB 3RXHA 3ZVCA 4FOUC 1QA7A 4NG9H 5GWZA 4AB8A 4K8BA 5T6DA 5F8XA 3P8OA 1PPFE 2WV5A 2ZHQH 3UUZA 2H1UA 4I8LA 1GL0E 3T28A 3U98H 3HPTB 2PKAA 1C2LA 6LPRA 1ABJH 3TH2H 2R3YA 4NWLA 2BVRH 1O3EA 1LCYA 3NKKA 3ELAH 3SHAH 3R0FA 4B75A 3LH3A 1MBMA 2FXRA 1HB0B 1WU1A 3WWFA 4WH6A 1O35A 4X8UH 3TNTA 1C1SA 1GMDF 5TCAA 3T5FH 1OS8A 4FVBA 4AFZA 1NRNH 1PPHE 3SW2B 2VB0A 2QXIA 2J95A 1GBFA 3VB7A 2F4LA 2ZQ2A 1CA0B 3OU0A 2WPJS 2WSSD 1C5LH 5GCHG 1HAPH 4E06H 1ETSH 1BTWA 2FTMA 2Q6FA 3QTOH 2GV6A 2D8WA 4RT0A 1ZHMA 3B23B 1SGYE 1PPCE 1NT1A 2P94A 1OP8A 2FPZA 1XXDA 1TPSA 2VH6A 3DD2H 1GCTB 5KGOA 3QDZB 1LPKB 4Q7YA 2OQ5A 2RCEA 1GBEA 3BG4C 3VB5A 3ZZ5A 4BAKB 3EA9A 1W13U 1SGQE 2CF9H 2FI5E 4Q7XA 1DLEA 1AD8H 4WY3A 1JXPA 3SO3A 5GIBA 1C5VA 1XUKA 1BOQA 4X6PA 2AIPA 4H4FA 1FN6A 1TE0A 1ZTLA 1Y5AT 1HDTH 1N8OC 1GI6A 1O3CA 1L1NA 1O3PB 1V2JT 3AASA 3CNRA 4X8SH 3SBKA 2HPQH 2AFQB 3TK6A 3UNSA 4FUJA 4HI3A 1LMWB 1NFXA 1P04A 2HGTH 1B0FA 3GCTF 3U69H 2GCTB 1HV7A 3MOCA 4RKJB 5C0UA 1AE5A 4ABIA 5FX6A 2BDBA 2BDCA 1DUAA 4BOHA 1N6YA 1WUNH 3GYMA 1UCYE 4GPGA 1K1JA 3FN8A 4ZXXH 5EJ1A 1BQYA 2QN5T 1C1RA 5HIZA 2ODYB 3EA8A 5A0BA 2SGFE 1EAUA 1QA0A 3PWCA 1BB0B 1DWBH 1CHGA 2C4FH 4UFGH 1W0YH 1F0RA 1MQ6A 1XUJA 3KHVA 1EPTA 2XBYA 1V2KT 1GDUA 2QXJA 1JWTA 5GNDA 4I8JA 4IC6A 2KCAA 1Y59T 1SHYA 2GT8A 2ZGHA 3QZQA 4ACAA 1C1UH 1L1GA 3F9HA 1TNLA 1EAIA 1K28D 2H9HA 2VGCB 1S5SA 1ZZZA 4HZHA 4FUIA 1V2TT 1GI4A 2XNIA 3U1IB 1H9IE 3UOUA 1A1RA 3LOXA 2FOMB 2FZZA 1EFRD 1BHXB 2AS9A 2KM0A 2Y81A 1S6LA 1H1BA 2IN2A 1N1LA 2KAIB 5FPYA 3TGJE 4JK5A 3M7UA 3L6PA 2JJ1D 1AUJA 4AFUA 4TWWA 1UVUH 1O3OA 1RD3B 1TYNA 3OY5U 2Z7FE 1DSTA 3RC4A 1GBJA 1QL8A 1TBRH 3W1EA 1C1VH 4Y0ZE 2B9LA 2BD3A 1NFYA 4E05H 5LGOA 4TT3D 3ZZ6A 1UTJA 2SGQE 5AF9H 2FO9A 2G8TA 1CA0C 2FEQH 5J4QA 1TGCA 3UR9A 1WSSH 3RXOA 3RXMA 1H4WA 5EQRA 1AVXA 1YBWA 1O2LA 1UVPA 3F9GA 3QO6A 4WJG2 1W14U 3PV2A 1ZPBA 1ANEA 1ZHPA 3C1KA 2F9NA 1S6HA 1P9UA 2W7UA 3W94A 1EOLA 3V13A 1XXFA 1O2NA 1FLEE 4NZLA 3UTUH 4YO9A 1IQJA 2A5KA 1O3JA 2ZFPH 3RXRA 1Z6JH 1O36A 7ESTE 2W7SA 3GY7A 2A5AA 5DO4H 3RXJA 1QNJA 1AB9B 2BX4A 1EUFA 1GI5A 2PGQB 3WWBA 4Y8ZA 4ABBA 1EJNA 4R8TB 4K8YA 5ESBA 1VGCB 5DN6D 3TJUA 4IMZA 1O2TA 1DS2E 4ABFA 1PFXC 3SU6A 5A09A 2VVUA 1AQ7A 5EOKA 1LHCH 2DUCA 4K2YA 3F1SB 1WQSA 3LGWA 2OINA 2ODQA 1V2WT 2TGPZ 4TYDA 3RU4D 2GCTC 2C8WB 4XBDA 3BIVH 1ARCA 5G4BA 1MTSA 2Q6DA 2QF3A 4X2VA 1A2CH 1AWHB 1SQTA 2J98B 2W5EA 2J92A 1C1PA 1UMAH 2GMTB 2FI4E 1A5GH 1AWFH 2TPIZ 3F3BA 1MUEB 1C1TA 1FN8A 2Q1JA 2ZU5A 3PROA 4P00A 4JYVH 3EDXB 4DCDA 3VXFH 8ESTE 1S85A 1NBMD 2FLBH 2Z9GA 2A5IA 5CMXH 3M37A 2YMSB 3PMHB 3I77A 3M35A 3P8GA 4D7FA 2A7JA 3UR6A 1GBCA 3MYWA 4NFFA 3A80A 5F8ZA 3V0XA 1TB6H 3RXVA 1VZQH 1SL3A 2BTCE 3GYLB 4ACBA 2F91A 1J17T 1MKWH 3MU0A 4XFQA 4X8TH 1YGCH 1V2ST 5EQSA 3M36A 1YF4A 3DSGA 3H09A 2GZ7A 2PP6A 1IQGA 2G5NA 2AMQA 2PUQH 3SUFA 1MH0A 4BTTB 2LPRA 2ZCKP 2BDAA 2VGCC 1ELGA 1GHXH 1P01A 1S84A 3KGPA 4FUDA 4ISHH 1QIXB 3DSOA 4JZFH 5F53A 3LGIA 4H6SB 4DT4A 5DP8A 1BJUA 1JRSA 1PPBH 1UTQA 3RXDA 4J2YB 2YMSD 1GHBF 2LNCA 3PLPA 3ZZ4A 2FX6A 4B6EA 4IMQA 1MKWK 3GY8A 4F48B 1A61H 3CS0A 1ELEE 3RXGA 1O2SA 1DWDH 6ESTA 4X2YA 1OSSA 5HKKD 2EY4C 1O2YA 1SFIA 2ZPRA 3PB1E 3SNDA 2ZCHP 4B73A 1Z71A 3SJ9A 2J9NA 3HKJB 5T6GA 1BDAA 3WY8A 3RM0H 3B9FH 8KME2 1L4ZA 3DHKH 5F8TA 5EJZA 4B2AA 2UWOA 5IK2D 2VIQA 3URDA 1O0DH 2FDAA 1TOMH 1GMCF 2J38A 1SGDE 4INHA 4CRGA 4OS7A 5FAHA 1F2SE 1KXCA 2THFB 3I78A 1V2RT 3RU4E 2CN0H 1BA8B 1A46H 3QLPH 2ZF0H 1FQ3A 2XBXA 4YM9A 1P2IA 3GY3A 3A81A 1A4WH 3BTHE 1LO6A 2IOTA 2KR7A 1ZTJA 3KQBA 1E35B 2ZDLA 3E3TA 1Z8RA 1BTHH 1S81A 4D8NA 2YOLA 1IOEA 3P70B 1C5SA 2WZQA 3VG8A 3PMBB 3UREA 1TOCB 4Y71A 1EQ9A 4ISOA 1YP9A 2HLDD 2NU1E 3BTKE 3PTBA 1J14A 1Z6EA 5CHAB 1LVYA 3UNRA 2GD4B 1T8LA 1AU8A 3EYDA 1AN1E 3OSYA 4XBBA 1OKXA 4FUHA 1GBBA 1H8DH 3BG8A 2XC0A 3AW0A 4GSOA 1HIAB 2G4TA 5LPEA 2OQUA 1V6DA 1AGJA 2P3UB 1BBRH 5TCCA 3AVZA 2ZG0H 1RIWB 1WV7H 5A8YA 1W0JD 4JMYA 3P95A 2GMTC 2BZ6H 2VIWA 2BY6X 3TLOA 1WAYB 1SGIB 4UEHH 1XUFA 4AZ2B 1P12E 1HLTH 3F2GA 4TPYA 4GLYA 3LJOA 1SG8B 3OEHD 1YCPM 5JYIA 1KXAA 1FAKH 1YY3A 3GY4A 4NZQA 4Q7ZA 2YMSC 1O37A 1XKAC 1QBVH 1CBWB 1L4DA 3KL6A 1C5WB 4ABHA 1HAHH 1NROH 3MMGA 3LC3A 1TWXB 1HAOH 1IQEA 4DIIH 1PQAA 1F92A 1KDQA 1GJ8B 3SORA 1A5IA 3BTGE 2BLQA 1DOJA 1SMFE 1HJ8A 2Y82A 3N7DA 5EPNA 4ZHLU 1BBRK 1QZ8A 1BCUH 3CP7A 4O3TA 1K1NA 5JBBS 1A3BH 3EE7A 4FUGA 2WV9A 1G2MA 5CHBA 2XRCA 2A2XH 1DDJA 4OS1A 1GCDA 4A6LA 1C2MA 2CMYA 1QQUA 1SPJA 3R3GB 1ZJDA 2C90B 4OS4A 4ZXYH 3ZV9A 4AG1A 7GCHG 4CREA 1LHGH 1NN6A 1B5GH 5PTPA 2P3TB 1O2QA 2Z6BD 3LGYA 3P8NA 4B71A 5GPIB 1EB1H 1IHSH 1QJ1B 2BMGB 4XRNA 2L74A 2ZHWH 1A0LA 3LDXH 2BD7A 3HGPA 5FBEA 5C5OA 5I25A 3O8BA 1WTGH 2VH0A 1P2NA 3KNXA 1NRQH 2BLVA 1GHZA 2C93B 1K22H 1UTKA 4U01A 1GJCB 1UK4A 4HFPB 1EAXA 2SGEE 2OLGA 4GAWA 2AHME 4M7GA 1P2KA 5B6LA 1KTTB 3T29A 1CHOG 1FAXA 1CE5A 1L1JA 1SGNE 1Y3UA 1O3DA 1UTLM 1GJAB 1SGFG 3PMAB 3QN7A 1O2ZA 1AVGH 1HAYB 5EXNA 4YXWD 2ZDKA 5GXPA 1D6RA 1BRAA 1O5EH 3M7TA 4MDSA 4BTUB 3ZV8A 1O3FA 1VJ9U 1P2MA 3RC5A 2HNTC 2ZPQA 4GVUA 5EQQA 4UONA 1QURH 3SV6A 1HGTH 1A7SA 1GVLA 4MPWA 1P11E 1LQDB 5DP9A 4FU8A 1FDPA 3SU1A 1N8OB 1DWEH 3ZZ3A 1DY8A 2PLXA 3A7WA 1KLJH 1SC8U 5CHAC 1IQLA 2BOKA 3S69A 3S7KB 2BHGA 3RUOA 1ZGVA 1GHAG 1OYTH 4HTCH 5L30H 1BRCE 3SU2A 3VGCC 4OS2A 3FZZA 3O8DA 2XCFA 2A4QA 2ZZUH 4NA8A 1RIWC 2FESH 3ATWA 5FBIA 2R9PA 2AGGX 1VITF 1TABE 3BTFE 3P92A 1DSUA 2G55A 4E7RG 1MAXA 1ZRBA 2O8MA 4BXWA 4UDWH 2C8ZB 4Y6DA 3QGJA 1WQVH 2AMPA 1YPMH 1AHTH 3ZZCA 2CXVA 2ZC9H 1EZSC 1UK3A 2BYAX 1O3MA 1W12U 1G9IE 2WPMS 5DG6A 9ESTA 1GHYH 4IBLH 1O3HA 1RRKA 2V7QD 1W2KH 5KEDA 2WYJA 4X1PU 1GBMA 3M7QA 1Y3WA 2J2UA 1HJAB 1KXBA 2ZIQH 1K21H 5HXFA 1C5NH 1ZR0A 1YLCA 2Y6TA 7KMEH 3KYFA 1K9OE 2FOAA 1GJ5H 5F03A 3LT3A 4KELA 2Z3EA 1NC6A 1QJ7B 1NFWA 3QK1A 3F0OA 2D1JA 4DVAU 1VCQA 2EA3A 1H8HD 1VR1H 1ORFA 1FY4A 1O3BA 3OY6U 5DSFA 4DW2U 4ZAEA 5HYOA 2FS8A 4LOYH 4WMFA 1QY6A 3T25A 3ESTA 1TALA 1QJ6B 1C9PA 3TGIE 1CGHA 4Z6AH 1KYNA 1SI5H 1CT2E 4AFSA 1Z1JA 1NO9H 1TFXA 4NIYA 2STBE 4LXBH 3KIDU 4XBCA 4HG6A 1P8VC 3RXEA 4FUCA 4AGJA 1W3CA 4TWYA 1G3EA 6CHAB 1IQHA 1K1OA 1TBQH 2KAIA 1G3DA 3E0PB 1DX5M 3P6ZB 4B2BA 1F5RA 1AY6H 2QA9E 3FP8E 1LHEH 3W95A 4CHAB 1H9HE 4GCHF 1BMMH 1WDIA 1QRZA 2G00A 3MFJA 1HXEH 4LK4A 4E7NA 5JBAS 2ZECA 2BDHA 3BEFB 3SI4H 4BAOB 5DP6A 3V3MA 2OBQA 1G36A 1SLVB 2Z3DA 1K1MA 1PYTD 5C1YA 2ZHDA 1TNHA 2PWXA 5DJ7A 3ZIAD 3K6ZA 1W10U 2H5CA 2UWPA 4JZ1A 3NXPA 1LQEA 2W6JD 1SLXB 4WVPE 2V6NA 3VFEA 4X1SU 1BTYA 4WMDA 3MH5A 2WPIS 3AAUA 3QGNB 4INKA 3T62A 1EJMA 1YLNA 2QF4A 1A5HA 2VWMA 2ILNA 1BTPA 1QRXA 2L6OA 2VIOA 4KTSA 1Q3XA 1XKBC 5C1XA 2V0BA 4FUFA 1OPHB 4CRCA 1T4VH 4IN1A 4X6OA 1IQNA 1DVAH 1SQAA 3ODFA 4AOQA 6GCHF 3RXIA 3SNAA 3M5OA 1ACBE 3HK6B 2OTVA 1TIOA 1IQFA 2GKVE 3NCLA 2GV7A 4NIXA 3E6PH 1K2I1 1HAZB 1Q2WA 4YLQH 1ESTA 1G3BA 4ZKSU 2BY8X 4I7YH 2ZU2A 3SGBE 3VEQB 1YPHE 4XDEA 3DFJA 3HK3B 5A0CA 5AFZH 5JPMH 3V7TA 3I29A 4KTCA 1XVMA 1C2KA 1QL7A 1TGNA 1IQIA 2B8OH 2JKHA 3LIWA 4JZDH 5C3NA 1RXPA 2TBSA 2ZHEH 2P8OC 2ANKH 3SQEE 3OEED 4NA9H 3MH4A 3LGUA 1SB1H 1XUGA 1W7XH 2A31A 2AGEX 3Q3XA 1P2QA 3UPEA 4MPUA 1T8OA 1C5QA 4Y76A 1C2FA 2BLOA 3CS7A 2A7CA 3LONA 4H42U 1HJAC 2PSXA 2ZU4A 5T1VA 4B76A 1DM4B 1FNIA 3FAOA 3QUMP 1LTOA 1D3TB 4YT7H 1TA6A 2HPPH 2PKAB 1ID5H 3D62A 1GBDA 3TGKE 2BD8A 4NWKA 2CGAA 5C1UA 8GCHF 2ZTZA 3ZZ9A 4ABJA 3SOSA 1EXFA 3STJA 3MO3A 1KY9A 1DITH 2BB4A 2GVFA 2ZDVH 1J8AA 2QYIA 5DP4A 1D9IA 1PYTC 1ESAA 4GHTA 4B74A 2HVXA 2V3HH 1A0HB 1LKBA 1EZXC 4SGAE 2ZU1A 1YPKH 1GVKB 3TU7H 5ABWA 1GI2A 2BY9X 2FI3E 1UO6A 2A32A 3BV9B 1TNKA 3KEEA 1LHFH 2FX4A 6CHAC 2WPHS 1TRMA 1UVOA 1MMJN 5I46H 1ETTH 1O2KA 4CHAC 1CSOE 5A0AE 3PLBA 3E0NB 1GGDB 3QTVH 3RXTA 1P05A 1ZPZA 1J9CH 3RXKA 1NS3A 3KQ5A 3N7OA 4NGAH 4NFEA 1FI8A 4WWYA 3BN9A 4YESB 3SI3H 1O5GH 3SUEA 1CQQA 1O2HA 2R2MB 1QFKH 4OS5A 2VIVA 3MWIU 2F9VA 4MTBA 1KSNA 1AFQC 1O33A 3GDUA 1GMDG 1O3IA 3RU4T 1O2RA 2BDYA 2F9BH 2SNVA 2Z9KA 5E0HA 3KQCA 1EZUC 1DE7H 1XUHA 4UFEH 2STAE 1AE8H 1UVSH 4U2WA 2ZKSA 1BBRE 2O8UA 1LVMA 2HVYB 1P3CA 2V3MA 4O97A 3O8CA 4WMEA 4IGDA 3EGKH 1C4Y2 1QB9A 4PROA 4X6MA 3IITA 1O2OA 2EI7A 4ZKRU 3RXSA 1MCTA 4MNWA 1ANDA 5GJ4B 1L2EA 1GHVH 1P57B 2GZ8A 2RDLA 2G4UA 3KQEA 5F6MA 3GY5A 3LU9B 2J94A 3M3TA 2PFEA 1OXGA 1AKSA 1V3XA 2SNWA 1BUIA 2W6ID 2G52A 2JH6D 2FYQA 2R0KA 5E8EH 1PPGE 1EPTB 4BXSA 1MTVA 2UUKB 1C5ZB 1XUIA 2BD5A 1EP5A 2F43B 2QF5A 3Q3YA 3GY6A 2BX3A 2VIDA 1AIXH 2EI8A 1W11U 3FP7E 1TGBA 1C2EA 1JMOH 2KZ4A 4A1XA 3FOAA 1GBKA 1SGPE 1Y5UT 2VU8E 1P03A 4OGYA 4UE7H 5HGGA 3UB0A 2H9EH 3NRLA 1C4V2 1ZRKA 1SGTA 1Z1IA 3GCTG 4HGCA 5EXMA 3RXBA 2BD9A 2FM2A 1UCYH 2GT7A 4UFFH 1D3QB 5A8ZA 3M3SA 5FHTA 3MU5A 2OBOA 3MU8A 4ABEA 2GCHF 1KXFA 3N99A 1T7CA 4KGAA 5ETXA 1T32A 2TGAA 2M5TA 1P2JA 3SN8A 4D7GA 2IJOB 3L3TA 1INCA 2JH0D 2FOGA 3RXCA 5DGJA 1UHBB 3A7TA 3HGNA 4XE4A 2FOHA 2V35A 5E2OA 3BTQE 1SBWA 3Q76A 4BAMB 1VCPA 2OC7A 1CT4E 1G3CA 2ZFRH 3HATH 4Q2KA 2ZDMA 1VJAU 2PTNA 4FVDA 1TRNA 4ZROA 1IHTH 5EJLA 5EG4A 3VB4A 1UK2A 5JBCS 1DWCH 2JIZD 4I8HA 1UCYK 1OWIA 1GMHF 4Y11E 1EATA 1NU7B 1ANCA 3V12A 4DY7B 2Z9LA 1Z8GA 1UTNA 1GGDC 2CHAC 5DPAA 2XC4A 1EX3A 3LGTA 3E90B 1V2NT 1FIZA 3PM3A 4CRAA 4AYYB 1IQMA 2ZI2H 2QIQA 3A87A 2HALA 1OWKA 3E91A 1BRBE 4BAHB 1C1MA 3UWIA 1CO7E 3K6YA 4CR5A 1THSH 3DSPA 3SJ8A 2G51A 1D4PB 2PR3A 3TNSA 1COWD 3NUMA 2ZO3H 1C5UA 5JDUB 5LPRA 2Q6GA 4BAQB 1MZDA 4ZHAA 2A0QB 2TRMA 3MI4A 1H9LB 1L0ZA 1KLTA 3L33A 2I6QA 1SLUB 1FONA 1FXYA 3JZ2B 1MBQA 3T2NA 1AUTC 3FKSD 1GI1A 1C1QA 2Z94A 2H6MA 2RDEA 4AFQA 1TPOA 3EQ0H 1HAVB 1QB6A 1HAXB 1TQ0B 2DE9A 2HRVA 1ELTA 5AVDA 4FXGH 1TMUH 2BD2A 3M5NA 2PUXB 1NM6A
chains in the Genus database with same CATH topology
3VGCB 3LJJA 4A1TA 4NIVA 5C67A 1AFEH 4I31A 1TX8A 2ZDAH 1GDNA 4MPXA 1SLWB 3PLKA 1V2OT 2SFAA 1FIWA 1F0UA 2F9PA 3Q00A 3SU4A 3BEUA 2ALPA 2XYAA 2ZTXA 2QCYA 1JRTA 5T6FA 5FPTA 1O2MA 2PGBB 1GI8B 1MU8B 1MTWA 2D2DA 1GI3A 1RTFB 3KF2A 3RXPA 3BEIB 1QR3E 1EPTC 1TONA 3RXAA 3SU3A 1O31A 3BTTE 2FOBA 5FCRA 2WPLS 3K2UA 1WTHD 1F5LA 4ZKOU 5L2ZH 8LPRA 5HM9A 2XWBI 3SNCA 3A8DA 2ZDNA 4OS6A 3SV8A 1P06A 3NWUA 2ZFTA 4DIHH 1FY3A 1O5BB 1P9SA 1NTPA 2FYRA 2AMDA 5DK1A 3SGQE 4IS5A 4X8VH 1ZLRA 2F9UA 4K69A 1EP6A 3Q3KA 1O2XA 5GCHF 2NU4E 3GCHB 4INLA 2DE8A 1A0JA 4BANB 4LZ1H 1GBAA 2O9QA 3F9EA 2PKSC 3TH4H 1GI9B 1PQ7A 3JZ1B 3A86A 4RKOB 1QCPA 3MNSA 3ITIA 1YCPH 3RMNH 1MZAA 1HAGE 4CRDA 1NY22 1F0SA 1SGRE 3SQHE 1HXFH 3BF6H 3UY9A 5GDSH 3ZZAA 1GL1A 1QHRB 2J34A 2GTBA 1Y3VA 4A92A 4IW4E 2GZ9A 3FZDA 2A1DB 1C2DA 2J4IA 1OP2A 1GHBG 1O32A 2PSYA 5JB9S 4NA7A 1OX1A 2H9TH 3ENSB 4D9QA 1BMLA 1MD7A 1UTMA 1NRRH 1UVTH 2QAAA 3KQDA 2BXTH 1ELDE 3D23A 1HAIH 1KTSB 3P8FA 1MCVA 2XWAA 5K7RA 2G81E 3SUDA 1YCPK 3E8LA 2FOFA 3KN2A 3MO9A 7LPRA 2UUFB 4VGCB 1UJ1A 3O8RA 4Y10E 3SV9A 3U8TH 2ZTYA 1MKXH 3ATMA 1B7XB 1T8NA 2AEIH 1BTXA 2NU0E 3M5LA 4Y7BA 1NPMA 1TNGA 2WV4A 3RXUA 4F4OC 1GMCG 3LKWA 4AN7A 1E37B 1BTZA 3LH1A 1PQ8A 1FUJA 2C3SA 3A89A 2OC8A 3MU1A 1C2GA 2OCVB 1CT0E 4GHQA 1AZ8A 4YLUA 1C9TA 2ZU3A 3KCGH 2XBVA 1TGTA 4K3JA 5BPEA 3SNEA 3VPKA 1C2IA 1GVZA 2P8OB 1MKXK 4ZUHA 3SNBA 1N6XA 1U6QA 1AMHA 2QGRA 1AO5A 3ZZDA 1BT7A 3S7HB 1HYLA 3TPIZ 4U30A 3H5CB 4ZMAH 1O5FH 1GJBB 2BY7X 3ZZBA 1EZQA 2TGDA 1TPPA 1D3DB 1O5CB 1C5MD 3QX5H 2BQ7B 2O8WA 1TX7A 1F5KU 3A85A 2ZGXH 5FCKA 2O8TA 4MNXA 1AVWA 1THPB 4XOJA 4AYVB 1YYY1 1BIOA 1O34A 2AYWA 2ULLA 2ZFQH 2A7HA 3NPSA 2BOHB 1DFPA 1JIMA 1HRTH 3VB3A 3FFGA 1YPEH 3GOVB 1DXWA 1GHWH 1E0FD 3A7VA 3GCHC 3RMLH 2ASUB 1ZPCA 5CE1A 1P2OA 4JZIA 4CH8B 3BTEE 1TPAE 4U32A 1TMTH 2ZGBH 2VVCA 1QTFA 5FXLA 3ZZ8A 1C5TA 3GICB 4I8KA 4TY7A 2ZFFH 2ESTE 3LPRA 1C4U2 1W0ZU 4KP0A 1LPZB 4MG3A 1LPGB 2P95A 4TY6A 4D9RA 5IDKA 4I33A 1QRWA 5HM2A 4NSVA 2ZGJA 3S9BA 3A7ZA 2PTCE 5EU8A 1YKTA 4UFDH 1GJ9B 3EE0B 4MNYA 4ZHMU 1LVBA 2B7DH 1ESBA 1YPGH 3DUXH 3UIRA 1GBLA 1SGEE 1AFQB 4WXVA 5L6NH 1TNJA 5BRRE 1ARBA 3GY2A 1O3LA 3K65B 2RA3A 2BVSH 3ZVGA 3P17H 1SGFA 4VGCC 3A82A 3PWBA 3ZYDA 5DP3A 3PO1B 3M61U 1ZMJA 4FU7A 1ZTKA 1RFNA 1CA8B 2D26C 3F9FA 1S82A 1C5YB 2HOBA 2ANMH 1CU1A 2BLWA 2HWLB 4CRBA 3PMJA 1FPCH 5C20A 1MTUA 5HMAA 4ISLA 1NFUA 1S0RA 1JOUB 1YLDA 4CR9A 2FOEA 1YPHC 1SHHB 4ABAA 3ZVFA 1O2PA 4AGKA 1OWJA 3BTDE 3BTWE 3RDZA 3TJVA 1JBUH 2ANWA 3GCNA 4MPVA 1TLDA 1LDTT 1GBTA 1GI0A 1GI7B 4X2XA 1PQ5A 2UUYA 4BTIB 3FANA 3RXQA 3ATIA 4IC5A 1Y5BT 3SHCH 4CH2B 3UQOA 3RXLA 1SOTA 2BXUH 1P0SH 1E38B 1MTNB 1KXDA 4DGJA 3C27B 3TITA 1ZSJA 4XSKU 3RLWH 3ZVBA 1NRPH 3ZVDA 2RA0A 4BNRA 1FY1A 3CENA 2ZWLH 1WOFA 3D49H 3UFAA 3ZYEA 5EPYA 3MNXA 1VITG 4K1EA 5EW1H 4ESTE 1ZHRA 1Y3XA 3S9CA 1GDQA 2BY5X 1KXEA 5B6OA 4I8GA 2SGAA 3NK8A 4AB9A 2OUAA 3D65E 1ETRH 3H7OA 3LC5A 1DANH 2A45B 3RMOH 1ZSLA 2ZHFH 1Y8TA 1FV9A 4O03A 4B2CA 3A88A 3URCA 3B8JA 4CRFA 2ZFSA 1TRYA 1VITH 3RXFA 5LH8A 1IQKA 3A8AA 2FMJA 3MNCA 1G2LA 3VXEH 2YNBA 1WCZA 1LKAA 1DY9A 1O5AB 1FJSA 4TPIZ 1V2MT 2CHAB 3TIUA 1UHBA 1J15A 1HCGA 4YZUA 4I32A 4FUEA 4RSPA 2BVXH 1TNIA 2JETB 1T8MA 4X6NA 3IWMA 2RG3A 1MQ5A 1K1IA 2EC9H 4DOQA 2ZCLP 1NZQH 2YNAA 4K1SA 1DLKB 1XMNB 2P16A 1O2GH 3SV7A 1QB1A 2F3CE 2FWWA 2VJ1A 3OYPA 3E1XB 4AG2A 1GJ6A 2CF8H 3BSQA 3UQVA 3GDVA 1OWDA 2A4GA 1AZZA 2R2WU 2NWNA 3T26A 1GJ4H 2V3OH 3QWCH 1CVWH 1DUEA 4Y0YE 2EI6A 3PO1C 1IAUA 1W8BH 1GCTC 3STIA 5SGAE 1TX6A 1BJVA 3BIUH 3GDSA 1ANBA 3ATKA 2W26A 2ZA5A 2WINI 4GCHG 1C1OA 3OTJE 3RC6A 9LPRA 1HFDA 2BZAA 2ZP0H 3ODDA 3A7YA 4ABGA 3S9AA 1Q31A 3FVFB 2TGTA 1RTLA 5H4IB 1QL9A 3NZIA 1JIRA 1GBIA 1G30B 5A8XA 1FY5A 1MD8A 2XBWA 3IG6B 1WBGB 1VCWA 1C5PA 1ABIH 2AERH 2NU2E 4AX9H 2ODPA 3SU0A 3RLYH 1TQ7B 5DP5A 2ZQ1A 1X7AC 1HAVA 1K1LA 4Y79A 3DA9B 3EA7A 4MQAA 3ZVAA 1DPOA 3TK5A 4A7IB 3UOPA 5L2YH 1CGJE 1SQOA 1HIAA 4Y8XA 3DFLA 1Z7KA 1C5RA 3A7XA 6GCHG 2Y7XA 3TVJB 5ESTE 1UTOA 1XVOA 1BHXF 1ZJKA 5DKMA 2Z9JA 1MTNC 1C5XB 7GCHF 1OP0A 3ZVEA 5EODA 4CBOA 2Z3CA 4WF8A 2O8LA 2OC0A 3RP2A 2C8YB 3HKIB 2QV1A 3Q77A 4R0IA 1EJAA 4QT8C 3SZNA 1ZGIA 5EGMA 1V2LT 3AAVA 4THNH 1V2PT 3DT0H 1C5OH 3MHWU 1ELAA 1O2JA 2XC5A 1B0EA 3UWJH 2GDDA 1WYKA 1EASA 1NU9A 1O3GA 1MU6B 4OGXA 1E34B 1KLIH 1S83A 4WXIA 4RN6A 2OXSA 2WYGA 4O3UA 3T27A 2UWLA 2NU3E 1YPJH 4ABDA 1G37A 2PKSB 1CHOF 1E36B 1DICA 1F7ZA 1DT2A 3MU4A 5JB8S 4B1TA 1W7GH 2A4OA 1P02A 5A2MH 3F6UH 3F68H 1RS0A 4JYTA 3MO6A 8GCHG 1BZXE 1HJ9A 3EAJA 4UD9H 2JETC 3SGAE 1OWHA 1O2IA 2XCNA 4K5ZA 4MNVA 1GWAA 1YPLH 1NESE 2R3UA 3TJNA 1GG6B 1OYQA 2FTLE 1GHAF 4O9VA 1ELCA 3U8RH 1HPGA 5IYTA 2ANYA 2SGPE 1BITA 3A8BA 3LGVA 1BRUP 2AIQA 1H8IH 3H7TA 4ISNA 3AW1A 1S0QA 1M9UA 4KKDA 4MLFB 4K1TA 3SJOA 1FY8E 3TK9A 4YOIA 1PJPA 4ZKNU 5DP7A 1V2UT 1QBOA 2CV3A 1ELBA 1P3EA 4DT7B 1A3EH 2SGDE 3MNBA 1QQ4A 1F0TA 2B0FA 1AB9C 1TGSZ 1VGCC 1C2HA 1C1NA 2JH5D 2WUBA 2Y5FA 5E0JA 1AKSB 3OX7U 1SSXA 2Y5GA 2XW9A 3SU5A 2QC2A 5AHGH 4SGBE 4ASHA 1GPZA 2FODA 2HLCA 3GISB 2C8XB 3K9XB 2OP9A 3GCOA 2BQWB 4DURA 2I6SA 4CBNA 1D3PB 2BQ6B 4A1VA 2OD3B 4DG4A 1EKBB 3A84A 4FUBA 1ZMLA 2PV9B 4JK6A 3E16B 2Y5HA 2VWNA 2A2QH 5C2ZA 1T31A 4LZ4B 2QF0A 1Y3YA 3MTYA 4NCYA 2BM2A 2ZPSA 1HNEE 4DJZB 2VINA 2FLRH 1ELFA 2H2ZA 4Y7AA 4YOJA 2H5DA 1XX9A 2A4RA 1RTKA 1CGIE 1O38A 3BTME 1XM1A 2IPHA 3U8OH 1C2JA 1S6FA 2GGVB 4GUXA 4X1QU 1ZMNA 4YOGA 1O2WA 5E2PA 2BD4A 2VWLA 3PV4A 4X1RU 1EAWA 1D6WA 3G01A 1THRH 3MH6A 1GJDB 4MVNA 5FPSA 2F9OA 2BDGA 1J16A 1BMNH 1KIGH 3ATLA 2K1QA 3TH3H 4NIWA 3PTNA 1GJ7B 1RJXB 1EOJA 3FP6E 3ZZ7A 1QBNA 3PYHA 2EEKA 2Y80A 1BTUA 3A8CA 2ALVA 2P3FH 2VVVA 2R0LA 2W3KA 1SGCA 1P09A 4X2WA 3RMMH 2BDIA 2ZEBA 1UTPA 1ZSKA 4X0WU 1TBZH 2WPKS 1ELVA 3M3VA 3M5MA 1ZOMA 1TAWA 2GCHG 2ZGCA 4AORA 1O2UA 2AGIX 2HNTF 3SJKA 4X1NU 2WUCA 1SFQB 1C1WH 3SUGA 3S0NA 1BMAA 1AI8H 1LVOA 4NSYA 1NRSH 2ZNKH 3UNQA 1O30A 5AFYH 4WH8A 1K1PA 5EXLA 1GG6C 1TMBH 2P59A 1O3AA 5J4SA 1G32B 2VWOA 4J1YA 4FU9A 2G5VA 3SJIA 4ISIH 2FP7B 2VIPA 4A5TS 1O2VA 1GMHG 3MH7A 3BG4B 2QY0B 2F83A 1FZZA 2HNTE 2QXHA 3A83A 4F49A 1RGQA 1OWEA 4D76A 4Y8YA 2XXLA 1FPHH 4Q80A 1SVPA 4JCNA 1MAYA 1DXPA 2FIRH 2B5TB 1P10A 5TJXA 2W3IA 5JBTA 4JZEH 1EB2A 1V2QT 1YC0A 2XTTB 4Z0KA 1YM0A 2TIOA 4IN2A 1HUTH 2CJIA 4JYUH 5EW2H 5E0GA 2Z9IA 2P93A 2Y7ZA 1PPEE 5LPFA 1KDQB 1Z8JB 1O5DH 4K60A 1SR5C 3U1JB 5K0HA 1HBTH 2GX4A 1ZYOA 1GBHA 2OC1A 1O3KA 2FS9A 1Z8IB 2GDEH 2FOCA 2PW8H 1LHDH 4H6TA 3QZRA 2VNTA 1SOZA 2GP9B 2UUJB 1FMGA 4YTAA 4ZH8A 2QXGA 1O3NA 4KTUA 1CBWC 3U9AH 1V2VT 3SV2H 1TA2A 1QGFA 5FX5A 2AH4X 3RM2H 1PPZA 1O39A 5C5NA 5T3HA 4YT6H 3TJOA 2PHBA 3VB6A 1T4UH 1OOKB 3RXHA 3ZVCA 4NG9H 1QA7A 5GWZA 4AB8A 4K8BA 5T6DA 5F8XA 3P8OA 1PPFE 2WV5A 2ZHQH 3UUZA 2H1UA 4I8LA 1GL0E 3T28A 3U98H 3HPTB 2PKAA 1C2LA 6LPRA 1ABJH 3TH2H 2R3YA 4NWLA 2BVRH 1O3EA 1LCYA 3NKKA 3ELAH 3SHAH 3R0FA 4B75A 3LH3A 1MBMA 2FXRA 1HB0B 1WU1A 4WH6A 1O35A 4X8UH 3TNTA 1C1SA 1GMDF 5TCAA 3T5FH 1OS8A 4FVBA 4AFZA 1NRNH 1PPHE 3SW2B 2VB0A 2QXIA 2J95A 1GBFA 3VB7A 2ZQ2A 1CA0B 3OU0A 2WPJS 1C5LH 5GCHG 1HAPH 4E06H 1ETSH 1BTWA 2FTMA 2Q6FA 3QTOH 2GV6A 2D8WA 1ZHMA 3B23B 1SGYE 1PPCE 1NT1A 2P94A 1OP8A 2FPZA 1XXDA 1TPSA 2VH6A 3DD2H 1GCTB 3QDZB 1LPKB 4Q7YA 2OQ5A 2RCEA 1GBEA 3BG4C 3VB5A 3ZZ5A 4BAKB 3EA9A 1W13U 1SGQE 2CF9H 2FI5E 4Q7XA 1DLEA 1AD8H 4WY3A 1JXPA 3SO3A 5GIBA 1C5VA 1XUKA 1BOQA 4X6PA 2AIPA 4H4FA 1FN6A 1TE0A 1ZTLA 1Y5AT 1HDTH 1N8OC 1GI6A 1O3CA 1L1NA 1O3PB 1V2JT 3AASA 4X8SH 3SBKA 2HPQH 2AFQB 3TK6A 3UNSA 4FUJA 4HI3A 1LMWB 1NFXA 1P04A 2HGTH 1B0FA 3GCTF 3U69H 2GCTB 1HV7A 3MOCA 4RKJB 1AE5A 4ABIA 5FX6A 2BDBA 2BDCA 1DUAA 4BOHA 1N6YA 1WUNH 3GYMA 1UCYE 4GPGA 1K1JA 4ZXXH 1BQYA 2QN5T 1C1RA 2ODYB 3EA8A 5A0BA 2SGFE 1EAUA 1QA0A 3PWCA 1BB0B 1DWBH 1CHGA 2C4FH 4UFGH 1W0YH 1F0RA 1MQ6A 1XUJA 3KHVA 1EPTA 2XBYA 1V2KT 1GDUA 2QXJA 1JWTA 4I8JA 4IC6A 1Y59T 1SHYA 2GT8A 2ZGHA 3QZQA 1C1UH 1L1GA 3F9HA 1TNLA 1EAIA 1K28D 2H9HA 2VGCB 1S5SA 1ZZZA 4HZHA 4FUIA 1V2TT 1GI4A 2XNIA 3U1IB 1H9IE 3UOUA 1A1RA 3LOXA 2FOMB 2FZZA