2ZGJA

Crystal structure of d86n-gzmm complexed with its optimal synthesized substrate
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
231
structure length
231
Chain Sequence
IIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENNLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Granzyme M
publication title Structural basis for proteolytic specificity of the human apoptosis-inducing granzyme M
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 231
sequence length 231
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zgjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zgjA02
2QA9E 1UTLM 1A46H 1UK3A 4D9QA 1O2SA 4IGDA 1KY9A 1C2EA 1AUJA 2QN5T 1DITH 3TIUA 1GL1A 2WPLS 1ABIH 2FYQA 3FFGA 3LC5A 2XBYA 4X8TH 3UOPA 2WPKS 2XW9A 1EAIA 3PV4A 1ANBA 3KQDA 4E06H 4D7FA 4ISOA 1C2FA 2BZ6H 1GI3A 2ZU5A 4OGXA 4ASHA 1OKXA 4I32A 4E7RG 2VNTA 2ANWA 3MTYA 2P3FH 1MMJN 1K21H 5E0HA 1GG6C 5JBTA 2ZGHA 1EASA 2JH5D 4AFZA 4BAQB 3ZZ4A 1RRKA 1ANCA 1WSSH 2FS8A 3BEIB 2BLOA 1NRNH 1O3MA 1KXDA 5A0BA 1GJ5H 4IMQA 4NG9H 2BVRH 1W12U 2FOGA 3LGUA 3KQEA 1VITG 1L1NA 3BSQA 2Z94A 3K65B 3S7KB 1HAOH 1TNIA 4ABGA 3M5NA 5FBIA 3UNQA 4I7YH 1ESTA 4ESTE 1TX6A 1SFQB 2UWPA 3BTGE 5JBAS 1C5UA 2CV3A 1C9PA 1AUTC 1DWBH 1HJ9A 2WV5A 1NC6A 5JPMH 1C1WH 3SV7A 5A8XA 2Y7ZA 3U8RH 5L2YH 3RXDA 2GZ9A 3RXAA 3LPRA 1ZHRA 4ZHAA 1L2EA 1W13U 4WWYA 2BZAA 1RS0A 3A85A 3M7TA 1MD8A 1SGEE 1WTHD 5DP5A 1TONA 2BY7X 3S9BA 1J8AA 2FLRH 1UTQA 3F9GA 2D8WA 4HZHA 1G2MA 5HGGA 1MCVA 1SGDE 1NU9A 5FHTA 1O2PA 1CBWC 1TQ7B 3RXGA 3A7ZA 3RXHA 2ZEBA 2ZU4A 2UUFB 2V3HH 1GDQA 5EG4A 1O3FA 4K8BA 3MO6A 4X6PA 1C2LA 1CA8B 5DG6A 1C5LH 2F91A 3MU4A 2V6NA 1WTGH 2NU0E 1ARBA 1GI8B 1C1RA 1SGYE 4OS2A 5FPSA 1CU1A 2Q6FA 3WY8A 2WPIS 3RM2H 1LHGH 1O2GH 1TNKA 5EQSA 4X2YA 3CP7A 1S85A 1O2XA 1GI4A 2ZHQH 3UTUH 4BNRA 2ZGXH 3A7WA 3R0FA 4B2AA 4JZFH 1C1UH 2BX3A 1Y3VA 1RD3B 3MNBA 1V2JT 1EOJA 1GBTA 2AMQA 3ATKA 2C8XB 3OX7U 3SNCA 3A86A 4DY7B 4U2WA 1WYKA 2H5CA 1P06A 1O32A 2QAAA 2WPHS 4GSOA 4AYVB 1O2NA 4CHAB 5T6DA 3AASA 3A7YA 2XNIA 4LK4A 1VJ9U 1LMWB 1AKSB 2O8TA 2FM2A 2ANYA 2OCVB 3NXPA 2ZGCA 3F68H 1AVWA 2GD4B 4ZXYH 2J94A 1C5OH 2W7UA 1D3PB 1UO6A 2F9PA 4B74A 2A4QA 1AE8H 3SJOA 2XCNA 4RN6A 2BTCE 1W11U 1MD7A 2WV4A 4U30A 1TMUH 2XC4A 1O2IA 3BTKE 1ZMJA 1ZTLA 2TBSA 3ZZ9A 1GJ6A 5GIBA 1BMLA 2A7CA 1KXFA 3HKJB 4K5ZA 4YLQH 1C1NA 3A8BA 1CE5A 4NIYA 1HB0B 1O5DH 1SL3A 1YYY1 3UWJH 4AORA 1ARCA 2HOBA 4SGBE 1W10U 2G52A 5DKMA 3LT3A 3SGQE 1TALA 1YLDA 2VIPA 1YF4A 3ENSB 3L3TA 1PPEE 4H4FA 2J2UA 3RC4A 4WMEA 3SUFA 3DFJA 1HUTH 1D6RA 1A0HB 5L2ZH 3PWCA 3ZZ6A 2FOEA 6CHAC 1DUAA 5JBCS 4ZHMU 2R9PA 3AVZA 2XBVA 1KYNA 5L6NH 4NCYA 3TH2H 1THSH 3DUXH 2W26A 3LGIA 2G4UA 3A83A 2QXIA 1IQEA 5E8EH 2GCTC 5AFZH 4X2WA 1LCYA 4MVNA 4AG2A 4AX9H 3RM0H 3VGCC 3ATWA 1TGNA 4X0WU 1O2JA 2DE8A 1C4Y2 2B5TB 5JBBS 2VIOA 1NRPH 2XC0A 4NFFA 1OYTH 1AZZA 1BMMH 1AWFH 3SNEA 1THPB 2ZHDA 4U32A 3TJUA 1KLIH 4JZIA 3VPKA 1IAUA 1M9UA 1ZJDA 1TGSZ 4MNXA 2BDYA 2AS9A 2BY8X 1K1OA 4CBOA 1G9IE 3SU0A 1GBCA 1AKSA 2A5IA 1ZGIA 2FOBA 2W3KA 1VZQH 3TU7H 1Y5UT 3ZVDA 2VWNA 1BTXA 1UTPA 1QR3E 3M37A 1AFQB 1ETRH 2P16A 2RA0A 1DDJA 4Q7YA 1O5EH 5DP4A 4Y0YE 3A8CA 3RDZA 4FU9A 1HIAA 1UK2A 1ACBE 2PTCE 3RMLH 5I25A 1TYNA 1ZLRA 3A80A 3V3MA 4R8TB 1XUGA 3RXOA 1EZUC 2BY6X 1YM0A 3DT0H 1MAXA 3G01A 3S0NA 4BXWA 2BVXH 4NGAH 1L1GA 1S83A 2Z9IA 3EYDA 1NO9H 1GBMA 5EQRA 2C8ZB 1GBFA 3QN7A 3UQOA 3V12A 3U1JB 2BHGA 8KME2 1AMHA 2Z9KA 3GY6A 1XUFA 3MFJA 1V2WT 4UFDH 2ZFTA 3BEUA 2ESTE 3R3GB 3BTFE 1G2LA 1GMDF 4X8VH 3P70B 9LPRA 5IDKA 2HPPH 2A4GA 1ELVA 2B7DH 4Z0KA 3ZZCA 1N6XA 3GCHB 1ELTA 8GCHF 5BPEA 4JMYA 2Y82A 1FY4A 5C2ZA 3PLKA 1QL7A 1MQ5A 1BJUA 1FAKH 2RA3A 4TPIZ 3RC6A 1G32B 1W7XH 2ODPA 4BAHB 2Z3DA 1OPHB 1JIRA 3RLWH 1CVWH 1TA6A 5A0AE 3JZ1B 2J38A 4AZ2B 2ZZUH 4UD9H 4IN2A 1GVZA 1TIOA 1O3BA 3L33A 1QCPA 1GMHF 3MI4A 3UFAA 2A4RA 1VCWA 1GI1A 3T5FH 7ESTE 1GHVH 4CH2B 2BD8A 3JZ2B 1NN6A 2H2ZA 3PMAB 1LPZB 1K2I1 1Z1IA 2CN0H 2Z9LA 2A4OA 2J34A 2TRMA 2G8TA 3Q3YA 4OS1A 4K60A 2BY9X 4K1EA 3MNSA 1S82A 4XBCA 1S81A 1BRCE 3T27A 1B5GH 4AOQA 1UTJA 1FPCH 1PPHE 5C5OA 4FUCA 1IQFA 1GJ8B 1HAPH 5IYTA 3P8OA 4UFGH 4K8YA 1FQ3A 3RXUA 3MU5A 2BVSH 3SV9A 1QTFA 1MKXH 1XUKA 2CHAB 3U9AH 2V35A 3I29A 1C5NH 1C2IA 1B0EA 1MUEB 4IMZA 2QXJA 4TWYA 2C8WB 2OLGA 5LPRA 1KTTB 4DJZB 1KDQB 3SUEA 4Y8ZA 5K0HA 1TMBH 2AIQA 4Y11E 1ZTKA 3M7UA 1TBZH 4FUBA 1V2LT 1XUIA 4I8KA 4D9RA 1FV9A 1H9HE 4YM9A 4JK5A 4CH8B 2Z3EA 2ZCKP 1CA0C 3LJJA 3KCGH 2PR3A 1FY8E 4U01A 3E16B 1TGTA 3TJOA 3ZV8A 3GY4A 1H9LB 2OBQA 1TRYA 1SLWB 4YT7H 1SGQE 5H4IB 3VB5A 5JB8S 3MOCA 1VITF 4ISLA 3OY6U 1HXFH 3GY7A 2A2XH 1THRH 1GHAG 3RXTA 2IN2A 4WH8A 1QL8A 1O2LA 1TWXB 1C1OA 2VVVA 3E8LA 5GPIB 1H9IE 1GI2A 4CRFA 1L4ZA 1PPBH 1SC8U 2IJOB 3U8TH 2BM2A 2QXGA 1AFQC 2OC8A 3UWIA 2BY5X 1ZPCA 1EP6A 2BLQA 5E0JA 1EKBB 4ZAEA 4AFQA 1B7XB 1TAWA 3O8DA 1K9OE 4WJG2 4Z6AH 1N1LA 1PQAA 2BD2A 2DUCA 3A8AA 3QUMP 1W7GH 1P3EA 4IW4E 5C1UA 3PB1E 1O2ZA 4IC6A 2HVXA 1C5XB 4BTUB 3QZQA 1D4PB 1C5PA 1P8VC 1AE5A 4NZLA 4NA7A 1HAZB 1EATA 2KAIB 1ANDA 4A92A 1A4WH 3EA8A 1GWAA 3I78A 3T26A 5E0GA 1G3BA 3T62A 4WH6A 1QURH 1IQNA 1D3DB 1C4V2 3GY3A 2P59A 4DURA 2OQ5A 4TY7A 1ETTH 3S7HB 2BOHB 1K1NA 3QWCH 2JETC 4Y7BA 1SQTA 4WMDA 1WCZA 4H42U 3D65E 3D62A 3I77A 1PYTC 1HJ8A 3GCHC 3AAUA 1UMAH 3A81A 1KIGH 3NPSA 1TNHA 1HYLA 1UTKA 1GHBG 1P2JA 1PFXC 1O3EA 5GCHF 2CGAA 2GDDA 4Y71A 1P01A 1ID5H 1O3PB 2ZF0H 2C3SA 1TRNA 1GBDA 1Z71A 4MPWA 1FY1A 3BTTE 3B9FH 1UHBB 1F0TA 1GHZA 2ULLA 4TPYA 2H6MA 3KQBA 3NK8A 1A5IA 1DXWA 3LGWA 1F5LA 1C9TA 1ZYOA 4KTCA 1IQJA 1EP5A 2TGAA 3H7TA 3SV8A 1C2KA 2GMTB 6GCHG 1MKXK 3M5MA 5CE1A 1KDQA 1MZDA 1TOMH 2WPJS 3P8GA 5TCCA 1A5GH 3SOSA 2XC5A 1QBNA 1BBRE 5C1YA 4UFEH 1XKBC 1BJVA 4XSKU 3GDUA 4YOJA 3FP8E 3V13A 2SGDE 2B9LA 3MYWA 3VXFH 4THNH 1XUHA 1SB1H 1IHSH 4CRDA 4NIWA 4B76A 2OXSA 1FIZA 2V3OH 7GCHG 1JIMA 2W5EA 1BHXB 1ZHMA 1YGCH 3UIRA 1WQVH 1V2MT 5CMXH 4O97A 4WXVA 1EQ9A 4YT6H 5L30H 2CHAC 1V2OT 1IQLA 1MTVA 1GI0A 2FOFA 2P93A 1UTMA 2ZFFH 3A88A 3M3TA 3MH6A 2QF3A 1WUNH 3KEEA 4OGYA 4DIIH 1C5VA 3NWUA 3ZZAA 1S0RA 4YESB 1KLJH 4BAOB 6LPRA 5T3HA 1YPGH 2ZCLP 1O3IA 1DFPA 1LQEA 1G30B 1HV7A 1F2SE 1GMCF 3IG6B 3FZDA 5K7RA 1GJ9B 1GCTC 3FANA 3RXRA 1W2KH 1UJ1A 1NRSH 1SG8B 4IS5A 5LH8A 3FVFB 1BBRK 2CJIA 5AF9H 4R0IA 1BRBE 1NRQH 2CF8H 5A8ZA 5EW1H 3ATLA 3FAOA 1C5WB 2VB0A 2F83A 5DGJA 2VIVA 1KXEA 2ZQ2A 2XWBI 3SHCH 1CHOF 4X6MA 2ZFRH 1LKBA 1G3CA 1ELBA 3EGKH 2OUAA 2H5DA 4BOHA 3T29A 3LDXH 1VITH 3K6YA 3GCTG 2VH0A 2Q6DA 4UDWH 3RXIA 2TGDA 3B23B 1TMTH 3ZZ3A 3S9AA 1DT2A 1AHTH 1DY9A 2UUYA 2ZU2A 5DJ7A 5C20A 3MNXA 2AGEX 2R3UA 5HYOA 1GDUA 1OWEA 1GJAB 4NFEA 1MQ6A 1JBUH 1T8MA 1V2VT 4D76A 3Q00A 4ZH8A 1UHBA 1SGTA 2B8OH 2GV7A 3RXSA 2PFEA 1Z8RA 1J16A 1PPGE 1DLEA 1W0YH 1SGIB 1GHWH 6ESTA 1KTSB 1NM6A 1SGNE 3KN2A 4Y10E 5GJ4B 1OWIA 2A31A 1DSTA 4ISIH 7LPRA 1O3LA 2D2DA 4ZMAH 1ZGVA 1ELFA 3TNSA 1DSUA 5LPEA 3TGJE 1TGCA 2FEQH 2RDLA 1UVTH 1BTWA 3TH3H 1PJPA 1TA2A 2QV1A 3IWMA 5F8TA 1XKAC 4NSYA 3P95A 1MH0A 1ZSJA 2F9OA 3RXFA 2RCEA 2WINI 1UVPA 1TPSA 2BOKA 2TIOA 4JZDH 4AGKA 3QTVH 2ODQA 1HJAB 4MQAA 1C2JA 1NFWA 2FI5E 2FS9A 1GJBB 4J1YA 4WVPE 2HLCA 4RSPA 1NZQH 4ABIA 4X1PU 1C1VH 1NFXA 1O3KA 1QIXB 4FUJA 4KTSA 1V6DA 2AGGX 1QNJA 1D3TB 1EX3A 1SGCA 2C4FH 1VJAU 3LGTA 5CHAB 5A2MH 1T31A 1BDAA 2JKHA 1XXDA 3LU9B 4XFQA 2G81E 1O3JA 7KMEH 2ZDKA 4ZKSU 3SJ8A 4ISNA 2WUCA 2GMTC 4Y76A 2AMDA 2UUKB 1A7SA 3SUDA 1O2QA 2ZGJA 1H4WA 1EPTB 1MAYA 3E3TA 2F3CE 3QZRA 3ZV9A 1LTOA 3SV2H 3A7XA 3FP7E 1EAUA 1K22H 3VB7A 2HNTC 1C1MA 3DHKH 1E35B 4X1NU 1HBTH 2ASUB 1A0JA 2OC0A 5F03A 3VFEA 2WPMS 3MHWU 5LPFA 1HLTH 1C1QA 1INCA 1ESBA 4ABHA 4AFSA 1FN8A 4X6NA 3MU1A 2ZG0H 3SU6A 1P2NA 1HAXB 2PWXA 4X1RU 5EQQA 4NZQA 2NU3E 3SQHE 4DCDA 1HXEH 1O5GH 1O3OA 1V2RT 1N6YA 3C1KA 2F9NA 3MO9A 4CBNA 5A0CA 4TYDA 3ZYDA 1WQSA 1HCGA 3SORA 3F1SB 3SN8A 2BDBA 3CENA 1OYQA 4B2BA 3RXMA 2IOTA 1B0FA 2TGPZ 1QJ6B 4FUFA 1A5HA 1L4DA 3GDVA 3SQEE 2BLVA 2I6SA 1Y59T 3URDA 1EJAA 4HFPB 2AERH 1CGIE 3GOVB 5EXMA 1O3AA 2GZ8A 1ZHPA 2TPIZ 3LGYA 1SOZA 1OWKA 2PGQB 3V7TA 1YPEH 2PLXA 2XWAA 1V2QT 4FUGA 3ODFA 1K1LA 1OWJA 2ZWLH 1O2YA 4ABEA 1TPPA 4OS4A 4HTCH 1E0FD 2ZU1A 3TJVA 1UTNA 3SI4H 2GCHF 3RLYH 4AB8A 1A3BH 4GCHF 3ODDA 2HGTH 1JMOH 1O2KA 3SO3A 2SGEE 2AFQB 2VVUA 3A7VA 1ZPBA 3AW0A 1AIXH 1TABE 2ILNA 2VU8E 1C2DA 1VCQA 1ZOMA 2SGPE 1UK4A 2FODA 5AHGH 5DO4H 2Y7XA 1N8OB 1PQ7A 3SBKA 2ZTYA 5BRRE 3ITIA 2PGBB 3BTHE 5FBEA 4NA9H 4BXSA 5GXPA 1EAXA 5HM2A 1OP0A 4A7IB 4K69A 1LQDB 2GT8A 1HDTH 1RTFB 1YCPH 1O2WA 3ESTA 3LOXA 3PYHA 3RXCA 1EPTA 1IQIA 2ZTZA 1LPGB 2O9QA 2FI3E 1GPZA 2XXLA 3PTBA 1CGHA 2CF9H 2J95A 4NIVA 1HJAC 3SNAA 2FIRH 5TCAA 2GKVE 2SGAA 3MU0A 1O2VA 2GTBA 1QB9A 1CGJE 2XBXA 1Y3WA 1O5AB 2VWMA 3RUOA 2ZFPH 2BDHA 5CHAC 1P2MA 4I8GA 3TK6A 2VWLA 2EI6A 3TH4H 3VXEH 3ZVGA 4CHAC 1J14A 2LNCA 1XVMA 4AGJA 1RTLA 1TNJA 5FCRA 3W95A 2JH0D 2ALVA 3EDXB 4FU7A 3GISB 4JZ1A 3Q3XA 2Y5FA 2VIWA 3TJNA 1EPTC 3E0PB 3SUGA 4I31A 3BG4B 2AMPA 2GT7A 4UE7H 4FXGH 3E6PH 1C4U2 4INHA 1FY5A 1UVUH 4OS6A 3HKIB 2G5NA 2M5TA 1SGFA 5J4SA 3BTWE 3SI3H 2BDCA 3A87A 3EA9A 2PSXA 3OYPA 2OTVA 3EA7A 1J15A 1W0ZU 3NCLA 1LDTT 1ZSKA 2VIQA 5DP9A 3UNSA 4CRAA 4CRCA 2BDIA 4MG3A 1DWCH 1O37A 1NFYA 3PWBA 4YO9A 4K3JA 3PLPA 1AB9B 1ELGA 1K1MA 6GCHF 1ZMNA 1DXPA 2HPQH 4DT7B 1P10A 1F5RA 1P3CA 2ZDAH 1FZZA 3SJKA 1EOLA 1TPAE 4MNYA 2DE9A 3RMNH 3RXPA 2UWOA 2ZTXA 1BOQA 1JOUB 4Q2KA 3SGBE 1ZR0A 1GI6A 1SBWA 1DS2E 1MTNB 2BD5A 3PO1B 4OS7A 1SI5H 1GDNA 5I46H 2SFAA 1NROH 2YNBA 3OSYA 1S6FA 4WMFA 1LHEH 2QXHA 1DPOA 2XBWA 1MKWH 3DA9B 1QB6A 2AYWA 2FESH 3N7OA 2PKSB 2H9EH 1SLUB 1GI7B 1CO7E 1WBGB 1TX7A 1FDPA 4JZEH 1EB2A 2XTTB 1DWDH 1DUEA 3RU4T 1NU7B 1CQQA 2BX4A 5EGMA 4YLUA 1ORFA 1ESAA 4HI3A 1P05A 4Y8XA 1K28D 4I8HA 1QA7A 1YPHC 3P92A 1P2QA 2EI8A 1YCPK 3T2NA 1W14U 1AO5A 4DOQA 1SR5C 2V0BA 1HAYB 3E1XB 5FPYA 1FN6A 1O2RA 1NTPA 4YTAA 1P2KA 1O3NA 2P94A 1O2OA 4B2CA 3Q77A 1N8OC 3H5CB 3RC5A 5A8YA 5HM9A 3S69A 1LVOA 2P3TB 3TITA 4CRGA 3PLBA 3F9EA 3V0XA 1YC0A 3RMMH 1ELCA 4HGCA 4WY3A 1GVKB 1GBEA 5B6OA 2ALPA 3RXEA 1P11E 4LXBH 1GJ4H 2R2MB 1V3XA 3HPTB 1PPCE 1P03A 4A1VA 1SHHB 2G00A 2NU1E 1S6HA 2NWNA 2VH6A 3GYLB 3E91A 3UNRA 1O39A 3GCTF 5A09A 1BZXE 2EA3A 2Z9JA 3OTJE 1G37A 1GHYH 2J9NA 2ZPSA 1BBRH 1C2MA 3GDSA 3E90B 3RU4E 4XBDA 1G3DA 3SNDA 3UR9A 1DLKB 1FMGA 3OU0A 3P6ZB 1KSNA 3M61U 3E0NB 4MPVA 2BQ7B 3BTME 2Y5HA 1PQ5A 1BQYA 2GGVB 3M7QA 1LVYA 1W8BH 2D1JA 4MNVA 1A2CH 1A61H 5F8XA 1O3DA 1T8NA 4QT8C 4FUIA 2GP9B 2SNVA 2D26C 2SGQE 4A1TA 4K1TA 3SJIA 3BG4C 1ZRBA 2VVCA 5FX5A 4Q80A 1C1PA 2EC9H 1C5YB 1BHXF 1TNLA 1FUJA 1EB1H 1RJXB 3KQCA 2CMYA 4ABAA 4DGJA 3T28A 2F9VA 3K6ZA 1P57B 3BIVH 5FX6A 5FAHA 2QIQA 2Q6GA 2OBOA 1FJSA 1UVOA 3SW2B 2TGTA 2STAE 1T8LA 4XBBA 8ESTE 1GMDG 3KIDU 4IBLH 1O2TA 1TE0A 4Y79A 2SGFE 3OY5U 3HK6B 2XCFA 1NY22 1GGDB 1MKWK 1QGFA 1RFNA 4BANB 1Z8JB 3ZVCA 1GVLA 1AB9C 1T8OA 8GCHG 1BTZA 1E36B 1TLDA 2AIPA 1GHXH 4I8LA 1HNEE 2VJ1A 4Y6DA 3LH3A 1HGTH 1V2UT 1DX5M 4CRBA 1RTKA 1DE7H 1MTNC 1QQ4A 3BV9B 1GMHG 3PO1C 1ELDE 3RXBA 4UONA 1C2GA 1E37B 2AH4X 3GICB 5AFYH 2PSYA 2ANKH 1PPFE 5FCKA 4A1XA 4IC5A 1SLVB 2PKSC 3CS0A 1PPZA 3GY5A 1O0DH 3KL6A 4MPXA 1FLEE 3TVJB 3T25A 4X6OA 5JDUB 3QGNB 2VGCB 3PTNA 2ZFQH 5EPNA 5DP6A 2FOAA 4F4OC 2O8LA 4NWKA 2FDAA 2PW8H 1EZQA 3SV6A 1FAXA 3TGKE 2ZHEH 3A8DA 1KXAA 1IOEA 4KELA 3VB4A 1Z8GA 3RP2A 3U8OH 1HAIH 4INKA 2O8MA 4ZKNU 4ZXXH 3QTOH 1O34A 1QL9A 1BCUH 4YZUA 2Z3CA 1Z8IB 2ZGBH 1Y3YA 5C67A 1ZZZA 1LPKB 1SSXA 4ABBA 1L1JA 1TX8A 2FTLE 4AN7A 3PROA 1H8IH 2BD7A 1EJMA 2PUXB 3SJ9A 1S84A 5EU8A 2GVFA 3B8JA 4DG4A 1QA0A 2KAIA 3PM3A 3QLPH 2Z9GA 3SU3A 1C5QA 1TPOA 3MH5A 3A84A 3TK9A 2A0QB 4ISHH 2GZ7A 1Y8TA 3VB3A 2QCYA 1BTUA 1F0UA 2ZPRA 3K9XB 3BTQE 5DP8A 3BG8A 1XX9A 2ZECA 2SNWA 1AQ7A 1DVAH 3QDZB 3MU8A 1QQUA 2FOCA 4XOJA 6CHAB 2OINA 3HGNA 1LHCH 1MCTA 1MU8B 2GX4A 3ELAH 1SLXB 2NU2E 1YP9A 2BQ6B 4GHTA 4BTIB 3RXKA 4GLYA 4GPGA 2GCTB 4MDSA 3TK5A 1K1PA 2WYJA 5C1XA 1H1BA 1O33A 1UVSH 2BD9A 4CR9A 2HALA 1PQ8A 1C2HA 4FU8A 3ZZDA 3VGCB 4JYTA 2ZDMA 2QF0A 2CXVA 3STJA 1QRWA 2H1UA 1ANEA 1Y5AT 1BT7A 4KTUA 1NT1A 1Y3XA 3BEFB 2A2QH 1IQHA 2QGRA 4K2YA 2J4IA 3LC3A 2ZP0H 3BTDE 4MNWA 1LVBA 2OC7A 4ZUHA 4FVBA 1RXPA 3O8RA 2C8YB 2PHBA 2ZPQA 2ANMH 2H9TH 1AN1E 3SZNA 4DW2U 1YPMH 1IQMA 1ZJKA 5GDSH 3W94A 3NUMA 2RG3A 5DPAA 2OP9A 1E38B 3PMHB 4X1QU 3ZVAA 1IQGA 1LHDH 1ZTJA 4GUXA 1SGRE 2JH6D 1WU1A 1GGDC 1YCPM 3VB6A 1NPMA 2Q1JA 4KKDA 2R2WU 2Z7FE 1YPKH 1QBOA 4INLA 1GBBA 1U6QA 1SMFE 1LHFH 1GI5A 2FI4E 5GCHG 1AD8H 2UUJB 1A0LA 3AAVA 3PMBB 2UWLA 1VGCB 5ESTE 1DWEH 1O36A 1TGBA 1Z6EA 3EQ0H 4MLFB 1GBLA 4O3UA 1Q2WA 3M5OA 1H8DH 4A5TS 2ZDNA 3PMJA 3NZIA 1XXFA 1GCDA 1AFEH 1TNGA 4RKJB 4WXIA 2FP7B 3D49H 5T6FA 1C5TA 1DOJA 1T7CA 3GYMA 3ZZ7A 4JYVH 1C1TA 2O8UA 3ATMA 2VINA 2VGCC 3ATIA 3HGPA 3ZVBA 1GJCB 1MBMA 1SVPA 1HIAB 1NS3A 3L6PA 1JWTA 1MBQA 4FUDA 1CT2E 1HAHH 3QGJA 4GAWA 1QRXA 2Y5GA 1FY3A 1O2UA 2NU4E 1D9IA 3LGVA 4BTTB 3UY9A 1GBHA 2XYAA 3UREA 1OOKB 1IHTH 1TB6H 1Z7KA 5EXNA 1BIOA 2AEIH 2ZFSA 1V2PT 4LZ1H 2A7HA 1OS8A 1UTOA 2BD3A 4ZHLU 4FUEA 3LONA 2ZNKH 1MU6B 3LKWA 1BTYA 4J2YB 1C1SA 1QRZA 1LVMA 3AW1A 2A45B 5EOKA 2C93B 1GBAA 1Y3UA 1ZMLA 3M36A 2R0LA 1SGPE 1EUFA 4XDEA 2HNTE 1GMCG 1A1RA 3KF2A 1DY8A 3A82A 4O9VA 4E05H 1XMNB 2ZI2H 1QJ1B 1O38A 1GBKA 2BQWB 3RXVA 1QHRB 1SFIA 3BF6H 1A3EH 2Y80A 5DK1A 4MTBA 3BN9A 1D3QB 2FYRA 2PUQH 1Q3XA 3DFLA 2ZC9H 2A32A 1CHOG 1BA8B 1TOCB 4X2XA 3BIUH 2YOLA 1SQOA 1HAVB 3UQVA 2EI7A 2A7JA 4NIXA 4UEHH 4YOGA 4JK6A 2G51A 2PKAB 5ETXA 1GHAF 2FPZA 1T4VH 1P04A 1O2HA 1QB1A 4RKOB 1V2KT 1CA0B 4A6LA 1C5ZB 2ZQ1A 2QY0B 3M5LA 3MH4A 4D7GA 3SU1A 1JRSA 2ZIQH 4VGCB 5PTPA 4BAMB 2G4TA 1WOFA 3HK3B 5SGAE 4X8SH 1MTWA 4WF8A 4AFUA 1ZPZA 2FLBH 3Q3KA 1SOTA 5LGOA 4CREA 2QC2A 1AVXA 1ELEE 3LIWA 3MMGA 5J4QA 4K1SA 1YKTA 2WUBA 1SPJA 4AYYB 1CT4E 1CT0E 4ZROA 3HATH 1BRUP 3TGIE 2FXRA 1S0QA 2WYGA 1QJ7B 5JYIA 4ABJA 2A5KA 5EODA 3MH7A 3P17H 1UCYH 1QFKH 3U1IB 3U98H 1OP8A 1YBWA 5GWZA 3SHAH 4UFFH 3M3SA 4YOIA 1IQKA 1XVOA 2ZKSA 1BTPA 1TBQH 3EAJA 1VGCC 4TWWA 1DICA 1NFUA 1BITA 2BB4A 4ABFA 5EW2H 1T32A 3IITA 3UOUA 4GHQA 1GHBF 2ZCHP 3M3VA 2BD4A 4NWLA 2H9HA 1O35A 1VR1H 4I33A 1MZAA 4O03A 2A1DB 3P8FA 1X7AC 5HXFA 1GBJA 3LH1A 1SGFG 4BAKB 1EJNA 5EPYA 2JETB 3H7OA 4JCNA 2AGIX 2PV9B 2K1QA 1BTHH 1JRTA 1O3CA 1VCPA 3SU4A 4X8UH 4B73A 4O3TA 3GY2A 4XE4A 2ZHWH 5C5NA 3FP6E 5ESBA 3KGPA 4FUHA 1TBRH 1O5CB 1V2NT 3GY8A 1O30A 4LZ4B 1Q31A 1RIWB 1HPGA 4TY6A 5EXLA 3SU5A 1QBVH 1KXBA 4B75A 1AWHB 1T4UH 3D23A 4B1TA 1BMNH 2PTNA 3TLOA 1FXYA 4SGAE 4GVUA 2FTMA 1L0ZA 2FMJA 3RXQA 1EZSC 1OSSA 1HFDA 4H6SB 1HAVA 1O5BB 1UCYE 3RU4D 3M35A 4ZKOU 7GCHF 1NESE 3ZZBA 3GCNA 1DANH 1J9CH 1P2IA 4MPUA 3RMOH 2O8WA 1YLCA 2BXUH 2PKAA 5E2OA 1Z6JH 4DVAU 2GV6A 2P3UB 1O31A 3O8CA 2A5AA 2P8OB 1AVGH 3STIA 4E7NA 1P9SA 2ZDLA 3BTEE 2FO9A 2THFB 3KNXA 1F92A 1AI8H 1JXPA 5T6GA 1F7ZA 1TQ0B 2F9UA 4CR5A 3EE0B 4PROA 1WV7H 4M7GA 2BXTH 1P2OA 3F9FA 1ABJH 5HMAA 1W3CA 1HAGE 2Y81A 1AU8A 2Z6BD 1O5FH 2G55A 3UPEA 2C90B 4NSVA 4X1SU 1P9UA 2STBE 5FPTA 3RXJA 4AB9A 1ZRKA 3RXLA 2EEKA 1AZ8A 3Q76A 1CSOE 1C5MD 2GCHG 1E34B 1F5KU 3QK1A 3ZVFA 2FOMB 4GCHG 2HWLB 3K2UA 1GG6B 1DM4B 1GJDB 1TFXA 3SGAE 1CHGA 3FZZA 1FI8A 1J17T 1OP2A 1V2ST 4KGAA 1EZXC 1UCYK 2FWWA 2FOHA 1GCTB 3ZZ5A 5JB9S 4DIHH 1C5RA 4VGCC 3F9HA 2FZZA 5DP3A 3ZYEA 2BYAX 5F6MA 1BRAA 1FPHH 3S9CA 4Q7XA 4Q7ZA 3NKKA 2R0KA 1XM1A 1MTUA 4H6TA 1XUJA 1Y5BT 2W3IA 1K1JA 4JYUH 3SU2A 1FIWA 2ZU3A 3TPIZ 3SNBA 1YPHE 1ZSLA 3P8NA 1BMAA 3GCOA 3U69H 2QYIA 1FNIA 4OS5A 1SQAA 1GBIA 1OX1A 3UUZA 4B71A 1PYTD 5TJXA 1MTSA 1QY6A 1Z1JA 4LOYH 3A89A 2ZO3H 1S5SA 1GI9B 2ZHFH 4Y0ZE 1V2TT 2OD3B 2J92A 1GJ7B 1P02A 2LPRA 4Y8YA 4ABDA 1TRMA 1O2MA 4D8NA 1KXCA 1CBWB 2FX6A 1OWHA 1WAYB 5AVDA 1P12E 1OWDA 4I8JA 1G3EA 2B0FA 1HRTH 9ESTA 1ELAA 3ZVEA 5C3NA 2Y6TA 4KP0A 3F6UH 1BB0B 2P95A 2HNTF 3A7TA 3MO3A 3C27B 4NA8A 3TNTA 1ETSH 1KLTA 1YPLH 4X2VA 5F8ZA 1AY6H 8LPRA 2G5VA 3QX5H 3MWIU 3URCA 1P0SH 2FX4A 2ZDVH 4AG1A 1EAWA 1RGQA 1D6WA 4FVDA 5E2PA 3ZZ8A 1O3HA 5G4BA 2BDAA 1EXFA 2I6QA 3MNCA 2VWOA 1RIWC 2XRCA 2ZA5A 3QO6A 2BMGB 3UR6A 1LO6A 2IPHA 1LKAA 4Y7AA 1K1IA 1FONA 3VEQB 2F9BH 5DP7A 2OC1A 3CS7A 3KHVA 3O8BA 1BUIA 1F0RA 1GL0E 2BLWA 5FXLA 3DD2H 2W7SA 5ABWA 2HRVA 1P09A 2OQUA 3LJOA 2YNAA 1AGJA 1YPJH 1NRRH 1C5SA 1O3GA 2GDEH 1G36A 1SHYA 2P8OC 4IN1A 2VIDA 4ZKRU 1F0SA 2ODYB 2R3YA 1OXGA 4F49A 2BDGA
chains in the Genus database with same CATH superfamily
2QA9E 1UTLM 1A46H 1UK3A 4D9QA 1O2SA 4IGDA 1KY9A 1C2EA 1AUJA 2QN5T 1DITH 3TIUA 1GL1A 2WPLS 1ABIH 5T1VA 2FYQA 3FFGA 3LC5A 2XBYA 4X8TH 3UOPA 2VBCA 2WPKS 2XW9A 1EAIA 3PV4A 1ANBA 3KQDA 4E06H 4D7FA 4ISOA 1C2FA 2BZ6H 1GI3A 3F0OA 2ZU5A 4OGXA 4ASHA 1OKXA 4I32A 4E7RG 2VNTA 2ANWA 3MTYA 2P3FH 1MMJN 1K21H 5E0HA 1GG6C 5JBTA 2ZGHA 1EASA 2JH5D 4AFZA 4BAQB 3ZZ4A 1RRKA 1ANCA 1WSSH 2FS8A 3BEIB 2BLOA 1NRNH 1O3MA 1KXDA 5A0BA 1GJ5H 4IMQA 4NG9H 2BVRH 1W12U 2FOGA 3LGUA 3KQEA 1VITG 1L1NA 3BSQA 2Z94A 3K65B 3S7KB 1HAOH 1TNIA 4ABGA 3M5NA 5FBIA 3UNQA 4I7YH 1ESTA 4ESTE 1TX6A 1SFQB 2UWPA 3BTGE 5JBAS 1C5UA 2CV3A 1C9PA 1AUTC 1DWBH 1HJ9A 2WV5A 1NC6A 5JPMH 1C1WH 3SV7A 5A8XA 2Y7ZA 3U8RH 5L2YH 3RXDA 2GZ9A 3RXAA 3LPRA 1W0KD 1ZHRA 4ZHAA 1L2EA 1W13U 4WWYA 2BZAA 1RS0A 3A85A 3M7TA 1MD8A 1SGEE 1WTHD 5DP5A 1TONA 2BY7X 3S9BA 1J8AA 2FLRH 1UTQA 3F9GA 2D8WA 4HZHA 1G2MA 5HGGA 1MCVA 1SGDE 1NU9A 5FHTA 1O2PA 1CBWC 1TQ7B 3RXGA 3A7ZA 3RXHA 2ZEBA 2ZU4A 2UUFB 2V3HH 2YMSD 1GDQA 2KCPA 5EG4A 1O3FA 4K8BA 3MO6A 4X6PA 1C2LA 1CA8B 1OHHD 5DG6A 1C5LH 2IPQX 2F91A 3MU4A 2V6NA 1WTGH 2NU0E 1ARBA 1GI8B 1C1RA 1SGYE 4OS2A 5FPSA 1CU1A 2Q6FA 3WY8A 2WPIS 3RM2H 1LHGH 1O2GH 1TNKA 5EQSA 4X2YA 3CP7A 4FETA 1S85A 1O2XA 1GI4A 2ZHQH 3UTUH 4BNRA 2ZGXH 3A7WA 3R0FA 4B2AA 4JZFH 1C1UH 2BX3A 1Y3VA 1RD3B 3MNBA 1V2JT 2JIZD 1EOJA 1GBTA 2AMQA 3ATKA 2C8XB 3OX7U 3SNCA 3A86A 4DY7B 4U2WA 1WYKA 2H5CA 1P06A 1O32A 2QAAA 2WPHS 4GSOA 4AYVB 1O2NA 4CHAB 5T6DA 3AASA 3A7YA 2XNIA 4LK4A 1VJ9U 1LMWB 1AKSB 2O8TA 2FM2A 2ANYA 2OCVB 4ASUD 3NXPA 5B6LA 2KZ4A 2ZGCA 3F68H 3OAAD 1AVWA 2GD4B 4ZXYH 2J94A 1C5OH 2W7UA 1D3PB 1UO6A 2F9PA 4B74A 2A4QA 1AE8H 3SJOA 2XCNA 4RN6A 2BTCE 1W11U 1MD7A 2WV4A 4U30A 1TMUH 2XC4A 1O2IA 3BTKE 1ZMJA 1ZTLA 2TBSA 3ZZ9A 1GJ6A 5GIBA 1BMLA 2A7CA 1KXFA 3HKJB 4K5ZA 4YLQH 1C1NA 3A8BA 1CE5A 4NIYA 1HB0B 1O5DH 1SL3A 4ACBA 1YYY1 3UWJH 4AORA 1ARCA 2HOBA 4RT1A 4SGBE 1W10U 2G52A 3F2FA 3LT3A 5DKMA 3SGQE 1TALA 1YLDA 2VIPA 1YF4A 3ENSB 3L3TA 1PPEE 4H4FA 2J2UA 2QE7D 4WMEA 3RC4A 3SUFA 3DFJA 1HUTH 3EE7A 1D6RA 1A0HB 2IJD1 5L2ZH 3PWCA 3ZIAD 3ZZ6A 4XRNA 2FOEA 6CHAC 1DUAA 5JBCS 4ZHMU 2R9PA 3AVZA 2XBVA 1KYNA 5L6NH 4NCYA 3TH2H 1THSH 3DUXH 2W26A 3LGIA 2G4UA 3A83A 1BMFD 2QXIA 1IQEA 5E8EH 2GCTC 5AFZH 4X2WA 1LCYA 2LP6A 4MVNA 4AG2A 2KX4A 4AX9H 3RM0H 3VGCC 3ATWA 1TGNA 4X0WU 1O2JA 2DE8A 1C4Y2 2B5TB 5JBBS 2VIOA 1NRPH 2XC0A 4NFFA 1OYTH 1AZZA 1BMMH 1AWFH 3SNEA 1THPB 2ZHDA 4U32A 3TJUA 1KLIH 2OK5A 4JZIA 3VPKA 1IAUA 1M9UA 1ZJDA 1TGSZ 4MNXA 2BDYA 2AS9A 2BY8X 1K1OA 4CBOA 1G9IE 3SU0A 1GBCA 1AKSA 2A5IA 1ZGIA 2FOBA 2W3KA 1VZQH 3TU7H 1Y5UT 3ZVDA 2VWNA 1BTXA 1UTPA 1QR3E 3M37A 1AFQB 1ETRH 2P16A 2RA0A 5KEDA 1DDJA 4Q7YA 1O5EH 5DP4A 4Y0YE 3A8CA 3RDZA 4FU9A 1HIAA 1UK2A 1ACBE 2PTCE 3RMLH 5I25A 1TYNA 1ZLRA 3A80A 3V3MA 4R8TB 1XUGA 3RXOA 1EZUC 2BY6X 1YM0A 3DT0H 1MAXA 3G01A 3S0NA 4BXWA 3KYGA 2BVXH 4NGAH 1L1GA 1S83A 2Z9IA 3EYDA 1NO9H 1GBMA 3F2GA 2C8ZB 1GBFA 3QN7A 5EQRA 3UQOA 3V12A 3U1JB 2BHGA 8KME2 1AMHA 2Z9KA 3GY6A 3WW7A 1XUFA 3MFJA 1V2WT 4UFDH 2ZFTA 1WDIA 3BEUA 2ESTE 3R3GB 3BTFE 1G2LA 1GMDF 4X8VH 3P70B 9LPRA 5IDKA 2HPPH 2A4GA 1ELVA 3DSPA 1WXRA 2B7DH 4Z0KA 5C0TA 3ZZCA 1N6XA 3GCHB 1ELTA 8GCHF 5BPEA 4JMYA 2Y82A 1FY4A 5C2ZA 3PLKA 1QL7A 1MQ5A 1BJUA 1FAKH 2RA3A 4TPIZ 5C0UA 3RC6A 1G32B 1W7XH 2ODPA 2QF4A 4BAHB 2Z3DA 1OPHB 1JIRA 3RLWH 3KQ5A 1CVWH 1TA6A 5A0AE 3JZ1B 2J38A 4AZ2B 2ZZUH 4UD9H 4IN2A 1GVZA 1FX0B 1TIOA 1O3BA 3L33A 1QCPA 1GMHF 3MI4A 3UFAA 2A4RA 1VCWA 1GI1A 3T5FH 7ESTE 1GHVH 4CH2B 2BD8A 3JZ2B 1NN6A 2H2ZA 3PMAB 1LPZB 1K2I1 1Z1IA 2CN0H 3OFND 2Z9LA 2A4OA 2J34A 2TRMA 2G8TA 3Q3YA 4OS1A 4K60A 3CNRA 2BY9X 4K1EA 3MNSA 1S82A 4XBCA 1S81A 5EJ1A 2JJ2D 1BRCE 3T27A 1B5GH 4AOQA 1UTJA 1EFRD 4FOUC 1FPCH 1PPHE 3OE7D 5C5OA 5HIYA 3WWBA 4FUCA 1IQFA 2GJGA 1GJ8B 1HAPH 5IYTA 3P8OA 4UFGH 4K8YA 1FQ3A 3RXUA 3MU5A 2BVSH 3SV9A 1QTFA 1MKXH 1XUKA 2CHAB 3U9AH 2V35A 3I29A 1C5NH 1C2IA 1B0EA 1MUEB 4IMZA 2QXJA 4TWYA 2C8WB 2OLGA 1SKYE 1KTTB 5LPRA 4DJZB 1KDQB 3SUEA 4Y8ZA 5K0HA 1TMBH 2AIQA 4Y11E 1ZTKA 3M7UA 1TBZH 4FUBA 1V2LT 1XUIA 3KYFA 4I8KA 4D9RA 1FV9A 1H9HE 4I86A 4JK5A 4CH8B 4YM9A 2Z3EA 2ZCKP 4RI0A 1CA0C 3LJJA 3KCGH 2PR3A 1FY8E 4U01A 3E16B 1TGTA 3TJOA 3ZV8A 3GY4A 1H9LB 2LELA 2OBQA 1TRYA 1SLWB 4YT7H 1SGQE 5H4IB 3VB5A 5JB8S 3MOCA 1VITF 4ISLA 3OY6U 5FL7D 1HXFH 3GY7A 2A2XH 1THRH 1GHAG 3RXTA 2IN2A 4WH8A 1QL8A 1O2LA 1TWXB 1C1OA 2VVVA 3E8LA 5GPIB 1H9IE 1GI2A 4CRFA 1L4ZA 1PPBH 1SC8U 2IJOB 3U8TH 2BM2A 2QXGA 1AFQC 2OC8A 3UWIA 2BY5X 1ZPCA 1EP6A 2BLQA 5E0JA 1EKBB 4ZAEA 4AFQA 1B7XB 1TAWA 3O8DA 1K9OE 4WJG2 4Z6AH 1N1LA 1PQAA 2BD2A 2DUCA 3A8AA 3QUMP 1W7GH 1P3EA 4IW4E 5C1UA 3PB1E 1O2ZA 4IC6A 2HVXA 1C5XB 4BTUB 3QZQA 5CHBA 1D4PB 1C5PA 1P8VC 1AE5A 4NZLA 4NA7A 1HAZB 1EATA 2KAIB 1ANDA 4A92A 1A4WH 3EA8A 1GWAA 3I78A 3T26A 2XNDD 1G3BA 5E0GA 3T62A 4WH6A 1QURH 1IQNA 1D3DB 1C4V2 3GY3A 2P59A 4DURA 2OQ5A 4TY7A 1ETTH 3S7HB 2BOHB 1K1NA 3QWCH 2JETC 4Y7BA 3F2HA 1SQTA 4WMDA 1WCZA 4H42U 3D65E 3D62A 3I77A 1PYTC 1HJ8A 3GCHC 3AAUA 1UMAH 3A81A 1KIGH 3NPSA 1TNHA 1HYLA 1UTKA 1GHBG 1P2JA 1PFXC 1O3EA 3N7EA 5GCHF 2CGAA 2GDDA 4Y71A 1P01A 1ID5H 1O3PB 2ZF0H 2C3SA 1TRNA 1GBDA 1Z71A 4MPWA 1FY1A 3BTTE 3B9FH 1UHBB 1F0TA 1GHZA 2ULLA 4TPYA 2H6MA 2YMSB 3KQBA 1A5IA 3NK8A 1DXWA 3LGWA 1F5LA 1C9TA 1ZYOA 4KTCA 1IQJA 1EP5A 5C17A 2TGAA 3H7TA 3SV8A 1C2KA 2GMTB 6GCHG 1MKXK 3M5MA 5CE1A 1KDQA 1MZDA 1TOMH 2WPJS 3P8GA 5TCCA 1A5GH 3SOSA 2XC5A 1QBNA 1BBRE 5C1YA 4UFEH 1XKBC 1BJVA 4XSKU 2PP6A 3GDUA 4YOJA 3FP8E 3SZEA 5HKKD 3V13A 2SGDE 2B9LA 3MYWA 3VXFH 4THNH 1XUHA 1COWD 1SB1H 1IHSH 4CRDA 4NIWA 4B76A 2OXSA 1FIZA 2V3OH 7GCHG 1JIMA 3DCLA 2W5EA 1BHXB 1ZHMA 4M9FA 1YGCH 3UIRA 1WQVH 1V2MT 5CMXH 4O97A 4WXVA 1EQ9A 4YT6H 5L30H 2CHAC 1V2OT 1IQLA 1MTVA 1GI0A 2FOFA 2P93A 1UTMA 2ZFFH 3A88A 3M3TA 3MH6A 3UAIC 2QF3A 1WUNH 3KEEA 4OGYA 4DIIH 1C5VA 3NWUA 3ZZAA 1S0RA 4YESB 1KLJH 4BAOB 6LPRA 5T3HA 1YPGH 2ZCLP 1O3IA 1DFPA 1LQEA 1G30B 1HV7A 1F2SE 1GMCF 3IG6B 3FZDA 5K7RA 1GJ9B 1GCTC 3FANA 3RXRA 1W2KH 1UJ1A 1NRSH 1SG8B 4IS5A 5LH8A 3FVFB 1BBRK 2CJIA 3FO8D 5AF9H 4R0IA 1BRBE 1NRQH 2CF8H 5A8ZA 5EW1H 3ATLA 3FAOA 1C5WB 2VB0A 2F83A 5DGJA 2VIVA 1KXEA 2ZQ2A 2XWBI 3SHCH 1CHOF 4X6MA 2ZFRH 1LKBA 1G3CA 1ELBA 3EGKH 2OUAA 2H5DA 4BOHA 3T29A 3LDXH 1VITH 3K6YA 3GCTG 2VH0A 2Q6DA 4UDWH 3RXIA 2TGDA 3B23B 1TMTH 3ZZ3A 3S9AA 1DT2A 1AHTH 1DY9A 2UUYA 2ZU2A 5DJ7A 5C20A 3MNXA 2AGEX 2R3UA 5HYOA 1GDUA 2JDID 2F43B 1OWEA 1GJAB 4NFEA 5GNDA 1MQ6A 1JBUH 1T8MA 1V2VT 4D76A 3Q00A 4ZH8A 1UHBA 1SGTA 2B8OH 2GV7A 2AHME 2RDEA 2PFEA 3FKSD 3RXSA 1Z8RA 1J16A 1PPGE 1DLEA 1W0YH 1SGIB 1GHWH 6ESTA 1KTSB 1NM6A 1SGNE 3KN2A 4Y10E 5GJ4B 1OWIA 2A31A 1DSTA 4ISIH 7LPRA 1O3LA 2D2DA 4ZMAH 1ZGVA 5DN6D 1ELFA 3TNSA 1DSUA 5LPEA 3TGJE 1TGCA 2FEQH 2RDLA 1UVTH 1BTWA 3TH3H 1PJPA 1TA2A 2QV1A 3IWMA 5F8TA 1XKAC 4NSYA 3P95A 1MH0A 1ZSJA 2F9OA 3RXFA 2RCEA 2WINI 1UVPA 1TPSA 2BOKA 2TIOA 4JZDH 4AGKA 3QTVH 5CDFE 2ODQA 1HJAB 4MQAA 1C2JA 2J97A 1NFWA 2FI5E 2FS9A 1GJBB 4J1YA 4WVPE 2HLCA 4RSPA 1NZQH 4ABIA 4X1PU 1C1VH 1NFXA 1O3KA 1QIXB 4FUJA 4KTSA 1V6DA 2AGGX 1QNJA 1D3TB 1EX3A 1SGCA 2C4FH 1VJAU 2YMSC 3LGTA 5CHAB 5A2MH 1T31A 1BDAA 2JKHA 1XXDA 3LU9B 4XFQA 2G81E 1O3JA 7KMEH 2ZDKA 4ZKSU 3SJ8A 2W6ID 4ISNA 2WUCA 2GMTC 4F48B 4Y76A 2AMDA 2UUKB 1A7SA 3SUDA 1O2QA 2ZGJA 1H4WA 1UW7A 1EPTB 1MAYA 3E3TA 2WV9A 2F3CE 3QZRA 3W1EA 3ZV9A 1LTOA 3SV2H 3A7XA 3FP7E 1EAUA 1K22H 2V3MA 3VB7A 2HNTC 1C1MA 3DHKH 1E35B 1W0JD 4X1NU 1HBTH 2ASUB 1A0JA 2OC0A 5F03A 3VFEA 2WPMS 3MHWU 5LPFA 1HLTH 1C1QA 1INCA 1ESBA 4ABHA 4AFSA 1FN8A 4X6NA 3MU1A 2ZG0H 3SU6A 1P2NA 1HAXB 2PWXA 4X1RU 5EQQA 4NZQA 3GS9A 2NU3E 3SQHE 4DCDA 1HXEH 1O5GH 1O3OA 1V2RT 1N6YA 3C1KA 2F9NA 3MO9A 4CBNA 5A0CA 4TYDA 3ZYDA 1WQSA 1HCGA 3SORA 3F1SB 3SN8A 2BDBA 3CENA 1OYQA 4B2BA 3RXMA 2IOTA 1B0FA 2TGPZ 1QJ6B 4FUFA 1A5HA 1L4DA 3GDVA 3F3BA 4B6EA 3SQEE 2BLVA 2I6SA 1Y59T 3URDA 1EJAA 4HFPB 2AERH 1CGIE 3GOVB 5EXMA 1O3AA 3N99A 2GZ8A 1ZHPA 2TPIZ 3LGYA 1SOZA 1OWKA 2PGQB 1YWUA 3V7TA 4XD7D 1YPEH 2PLXA 2XWAA 2L6OA 1V2QT 4FUGA 3ODFA 1K1LA 1OWJA 2ZWLH 1O2YA 4ABEA 1TPPA 4OS4A 4HTCH 1E0FD 2KCAA 2ZU1A 3TJVA 1UTNA 3SI4H 2GCHF 3RLYH 4AB8A 1A3BH 4GCHF 3ODDA 2HGTH 1JMOH 1O2KA 3SO3A 2SGEE 2AFQB 2VVUA 3A7VA 1ZPBA 3AW0A 1AIXH 1TABE 2ILNA 2VU8E 1C2DA 5KECA 1VCQA 1ZOMA 2SGPE 1UK4A 1K0HA 2FODA 5AHGH 5DO4H 2Y7XA 1N8OB 1PQ7A 3SBKA 2ZTYA 5BRRE 3ITIA 2PGBB 3BTHE 5FBEA 4NA9H 4BXSA 5GXPA 1EAXA 5HM2A 1OP0A 4A7IB 4K69A 1LQDB 2GT8A 1HDTH 1RTFB 3FOAA 1YCPH 1O2WA 3ESTA 3LOXA 3PYHA 3RXCA 1EPTA 1IQIA 2ZTZA 2KCYA 1LPGB 2O9QA 2FI3E 1GPZA 2XXLA 3PTBA 5IK2D 1CGHA 2CF9H 2J95A 4NIVA 1HJAC 3SNAA 2FIRH 5TCAA 2GKVE 2SGAA 3MU0A 1O2VA 2GTBA 1QB9A 1CGJE 2XBXA 1Y3WA 1O5AB 2VWMA 3RUOA 2ZFPH 2BDHA 5CHAC 1P2MA 4I8GA 3TK6A 2VWLA 2EI6A 3TH4H 3VXEH 3ZVGA 4CHAC 1J14A 2LNCA 1XVMA 1NBMD 4AGJA 1RTLA 1TNJA 5FCRA 3W95A 2JH0D 2ALVA 3EDXB 4FU7A 3GISB 4JZ1A 3Q3XA 2Y5FA 2VIWA 3TJNA 1EPTC 3E0PB 3SUGA 4I31A 3BG4B 2AMPA 2GT7A 4UE7H 4FXGH 3E6PH 1C4U2 4INHA 1FY5A 1UVUH 4OS6A 3HKIB 2G5NA 2M5TA 1SGFA 5J4SA 3BTWE 3SI3H 2BDCA 3A87A 3EA9A 2PSXA 3OYPA 2OTVA 3EA7A 1J15A 1W0ZU 3NCLA 4RT0A 1LDTT 1ZSKA 2VIQA 5DP9A 3UNSA 4CRAA 4CRCA 2BDIA 4MG3A 1DWCH 1O37A 1NFYA 3PWBA 4YO9A 4K3JA 3PLPA 3PV2A 1AB9B 1ELGA 1K1MA 6GCHF 1ZMNA 1SQRA 1DXPA 2HPQH 4DT7B 1P10A 3DSOA 1F5RA 1P3CA 2ZDAH 1FZZA 3SJKA 1EOLA 1TPAE 4MNYA 2DE9A 3RMNH 3RXPA 2UWOA 2ZTXA 1BOQA 1JOUB 4Q2KA 3SGBE 1ZR0A 5EJLA 1GI6A 1SBWA 1DS2E 1MTNB 2BD5A 3PO1B 4OS7A 1SI5H 1GDNA 5I46H 2SFAA 1NROH 2J98B 2YNBA 3OSYA 1S6FA 4WMFA 1LHEH 2QXHA 2M2AA 1DPOA 2XBWA 1MKWH 3DA9B 1QB6A 2AYWA 2FESH 3N7OA 2PKSB 2H9EH 1SLUB 1GI7B 1CO7E 1WBGB 1TX7A 1FDPA 4JZEH 1NBME 1EB2A 2XTTB 1DWDH 3F0PA 1DUEA 3RU4T 1NU7B 1CQQA 2BX4A 5EGMA 4YLUA 1ORFA 1ESAA 4HI3A 1P05A 4Y8XA 1K28D 4I8HA 1QA7A 1YPHC 3P92A 1P2QA 2EI8A 1YCPK 3T2NA 1W14U 1AO5A 4DOQA 1SR5C 2V0BA 1HAYB 3E1XB 5FPYA 1FN6A 1O2RA 1NTPA 4YTAA 1P2KA 1O3NA 2P94A 1O2OA 4Z1MD 4B2CA 3Q77A 1N8OC 3H5CB 1MABB 3RC5A 5A8YA 5HM9A 2HVYB 3S69A 1LVOA 2P3TB 3TITA 4CRGA 3OEED 3PLBA 3F9EA 3V0XA 1YC0A 3RMMH 1S6LA 1ELCA 4HGCA 4WY3A 1GVKB 1GBEA 5B6OA 2ALPA 3RXEA 1P11E 4LXBH 1GJ4H 2R2MB 1V3XA 3HPTB 1PPCE 1P03A 4A1VA 1SHHB 2G00A 2NU1E 1S6HA 2NWNA 2VH6A 3GYLB 3E91A 3UNRA 1O39A 3GCTF 5A09A 1BZXE 2EA3A 1H8ED 2Z9JA 3OTJE 1G37A 1GHYH 2J9NA 2ZPSA 1BBRH 2EY4C 1C2MA 3GDSA 3E90B 3RU4E 4XBDA 1G3DA 3SNDA 3UR9A 3VG8A 1DLKB 1FMGA 3OU0A 3P6ZB 1KSNA 3M61U 3E0NB 4MPVA 2BQ7B 3BTME 2Y5HA 1PQ5A 1BQYA 2GGVB 3M7QA 1LVYA 1W8BH 2D1JA 4MNVA 1A2CH 1A61H 5F8XA 4P02A 1O3DA 1T8NA 4QT8C 4FUIA 2W6JD 2GP9B 2SNVA 2D26C 2SGQE 4A1TA 4K1TA 3SJIA 3BG4C 1ZRBA 2VVCA 4HG6A 5FX5A 4Q80A 1C1PA 2EC9H 1C5YB 1E79D 1BHXF 1TNLA 1FUJA 1EB1H 2KCOA 1RJXB 3KQCA 2CMYA 4ABAA 4DGJA 3T28A 2J98A 2F9VA 3K6ZA 1P57B 3BIVH 5FX6A 5FAHA 2QIQA 2Q6GA 1FJSA 2OBOA 1UVOA 3SW2B 2TGTA 2STAE 1T8LA 4XBBA 5EJZA 8ESTE 1GMDG 3KIDU 4IBLH 1O2TA 4OM9A 1TE0A 4Y79A 2SGFE 3OY5U 3HK6B 2XCFA 1NY22 1GGDB 1MKWK 1QGFA 1RFNA 4BANB 1Z8JB 3ZVCA 1GVLA 1AB9C 1T8OA 8GCHG 1BTZA 1E36B 1TLDA 2AIPA 1GHXH 4I8LA 3PRBA 1HNEE 2VJ1A 4Y6DA 3LH3A 1HGTH 1V2UT 1DX5M 4CRBA 1RTKA 1DE7H 1MTNC 1QQ4A 3BV9B 1GMHG 3PO1C 1ELDE 3RXBA 4UONA 1C2GA 1E37B 2AH4X 3GICB 5AFYH 2PSYA 2ANKH 1PPFE 5FCKA 4A1XA 2K8IA 1SLVB 4IC5A 2PKSC 3CS0A 3OTPA 2J5UA 1PPZA 3GY5A 1O0DH 3KL6A 4MPXA 1FLEE 3PRDA 3TVJB 3T25A 4X6OA 5JDUB 3QGNB 2VGCB 3PTNA 2ZFQH 5EPNA 5DP6A 1YY3A 2FOAA 4F4OC 3WWFA 2O8LA 4NWKA 2FDAA 2PW8H 1EZQA 3SV6A 1FAXA 3TGKE 2ZHEH 2HLDD 3A8DA 3DSGA 1KXAA 1IOEA 4KELA 3VB4A 1Z8GA 3RP2A 3U8OH 1HAIH 4INKA 2O8MA 4ZKNU 4ZXXH 3QTOH 1O34A 1QL9A 1BCUH 4YZUA 2Z3CA 1Z8IB 2ZGBH 1Y3YA 5DSFA 5C67A 1ZZZA 1LPKB 1SSXA 4ABBA 1L1JA 1TX8A 2FTLE 4AN7A 3PROA 1H8IH 2BD7A 1EJMA 2PUXB 3SJ9A 1S84A 5EU8A 2GVFA 3B8JA 4DG4A 4ACAA 1QA0A 2KAIA 3PM3A 3QLPH 2Z9GA 3SU3A 1C5QA 1TPOA 3MH5A 3A84A 3TK9A 2A0QB 4ISHH 2GZ7A 1Y8TA 3VB3A 2QCYA 1BTUA 1F0UA 2ZPRA 3K9XB 3BTQE 5DP8A 3BG8A 1XX9A 2ZECA 2SNWA 1AQ7A 1DVAH 3QDZB 3MU8A 1QQUA 2FOCA 4XOJA 6CHAB 2OINA 3HGNA 1LHCH 1MCTA 1MU8B 2GX4A 3ELAH 1SLXB 3FN8A 2NU2E 1YP9A 2BQ6B 4GHTA 2KM0A 4BTIB 3H09A 3RXKA 4GLYA 4GPGA 2GCTB 4MDSA 3TK5A 1K1PA 2WYJA 5C1XA 1H1BA 1O33A 1UVSH 2BD9A 4CR9A 2HALA 1PQ8A 1C2HA 4FU8A 3ZZDA 2XOKD 3VGCB 4JYTA 1E1RD 2ZDMA 2QF0A 2CXVA 2JJ1D 3STJA 1QRWA 2H1UA 1ANEA 1Y5AT 1BT7A 3AK5A 4KTUA 1NT1A 1Y3XA 3BEFB 2A2QH 1IQHA 2QGRA 4K2YA 2J4IA 3LC3A 2ZP0H 3BTDE 4MNWA 1LVBA 2OC7A 4ZUHA 4FVBA 1RXPA 3O8RA 2C8YB 2PHBA 2ZPQA 2ANMH 2H9TH 1AN1E 3SZNA 4DW2U 1YPMH 1IQMA 1ZJKA 5GDSH 3W94A 3NUMA 5EIYA 2RG3A 1QZ8A 5DPAA 2OP9A 1E38B 3PMHB 5KGOA 4X1QU 3ZVAA 3OEHD 1IQGA 1LHDH 1ZTJA 4GUXA 1SGRE 2JH6D 1WU1A 1GGDC 1YCPM 3VB6A 1NPMA 2Q1JA 4KKDA 2R2WU 2Z7FE 1YPKH 1QBOA 4INLA 1GBBA 1U6QA 1SMFE 1LHFH 1GI5A 2FI4E 5GCHG 1AD8H 2UUJB 1A0LA 3AAVA 3PMBB 2UWLA 1VGCB 2L74A 5ESTE 1DWEH 1O36A 1TGBA 1Z6EA 1YLNA 3EQ0H 4MLFB 1GBLA 4O3UA 1Q2WA 3M5OA 1H8DH 4A5TS 2ZDNA 3PMJA 3NZIA 1XXFA 1GCDA 2RFKC 1AFEH 1TNGA 4RKJB 4B6FA 4WXIA 2FP7B 3D49H 5T6FA 1C5TA 1DOJA 1T7CA 3GYMA 3ZZ7A 4JYVH 1C1TA 2O8UA 3ATMA 2VINA 2VGCC 3ATIA 3HGPA 3ZVBA 1GJCB 1MBMA 1SVPA 4ZCNA 1HIAB 1NS3A 3L6PA 1JWTA 1MBQA 4FUDA 1CT2E 1HAHH 3QGJA 4GAWA 1QRXA 2Y5GA 1FY3A 1O2UA 2NU4E 1D9IA 3LGVA 4BTTB 3UY9A 1GBHA 2XYAA 3NRLA 3UREA 1OOKB 1IHTH 1TB6H 1Z7KA 5EXNA 1BIOA 2AEIH 2ZFSA 1V2PT 4LZ1H 2A7HA 1OS8A 1UTOA 2BD3A 4ZHLU 4FUEA 3LONA 2ZNKH 1MU6B 3LKWA 1BTYA 4J2YB 1C1SA 1QRZA 1LVMA 3AW1A 2A45B 4TT3D 5EOKA 2C93B 1GBAA 4YXWD 1Y3UA 1ZMLA 3M36A 2R0LA 1SGPE 1EUFA 4XDEA 2HNTE 1GMCG 1A1RA 3KF2A 1DY8A 3A82A 4O9VA 4E05H 1XMNB 2ZI2H 1QJ1B 1O38A 1GBKA 2BQWB 2F4LA 3RXVA 1QHRB 1SFIA 3BF6H 1A3EH 2Y80A 4F55A 5DK1A 4MTBA 2WHXA 3BN9A 1D3QB 2FYRA 2PUQH 1Q3XA 3DFLA 2ZC9H 2A32A 1CHOG 1BA8B 1TOCB 4X2XA 3BIUH 2YOLA 1SQOA 1HAVB 3UQVA 2EI7A 2A7JA 4NIXA 4UEHH 4YOGA 4JK6A 2G51A 2PKAB 5ETXA 1GHAF 2FPZA 1T4VH 1P04A 1O2HA 1QB1A 4RKOB 1V2KT 1CA0B 4A6LA 1C5ZB 1H8HD 2ZQ1A 2QY0B 3M5LA 3MH4A 4D7GA 3SU1A 1JRSA 2ZIQH 4VGCB 5PTPA 4BAMB 2G4TA 1WOFA 3HK3B 5SGAE 2KR7A 1MTWA 4WF8A 4X8SH 4AFUA 1ZPZA 3MQKC 2FLBH 3Q3KA 1SOTA 5LGOA 4CREA 2QC2A 1AVXA 1ELEE 3LIWA 3MMGA 5J4QA 4K1SA 1YKTA 2WUBA 1SPJA 4AYYB 1CT4E 1CT0E 4ZROA 3HATH 1BRUP 3TGIE 2FXRA 1S0QA 2WYGA 1QJ7B 5JYIA 4ABJA 2A5KA 5EODA 3MH7A 3P17H 1UCYH 1QFKH 3U1IB 3U98H 1OP8A 1YBWA 5GWZA 3SHAH 4UFFH 3M3SA 4YOIA 1IQKA 1XVOA 2ZKSA 1BTPA 1TBQH 3EAJA 1VGCC 4TWWA 1DICA 1NFUA 1BITA 2BB4A 4ABFA 5EW2H 1T32A 3IITA 3UOUA 4GHQA 1GHBF 2ZCHP 3M3VA 2BD4A 4NWLA 2H9HA 1O35A 1VR1H 4I33A 4Q4LA 1MZAA 4O03A 3PV5A 2A1DB 3P8FA 1X7AC 5HXFA 1GBJA 2QF5A 3LH1A 1SGFG 4BAKB 1EJNA 5EPYA 2JETB 3H7OA 4JCNA 2AGIX 2PV9B 2K1QA 1BTHH 1JRTA 1O3CA 1VCPA 3SU4A 4X8UH 4B73A 4O3TA 3GY2A 4XE4A 2ZHWH 5C5NA 3FP6E 5ESBA 3KGPA 4FUHA 1TBRH 1O5CB 1V2NT 3GY8A 1O30A 4LZ4B 1Q31A 1RIWB 1HPGA 4TY6A 5EXLA 3SU5A 1QBVH 1KXBA 4B75A 1AWHB 1T4UH 3D23A 4B1TA 1BMNH 2PTNA 4P00A 3TLOA 1FXYA 4SGAE 4GVUA 2FTMA 1VKYA 3U28C 1L0ZA 2FMJA 3RXQA 1EZSC 1OSSA 2V7QD 1HFDA 4H6SB 1HAVA 1O5BB 1UCYE 3RU4D 3M35A 4ZKOU 7GCHF 1NESE 3ZZBA 3GCNA 1DANH 1J9CH 1P2IA 4MPUA 3RMOH 2O8WA 1YLCA 2BXUH 2PKAA 5E2OA 1Z6JH 4DVAU 2GV6A 2P3UB 1O31A 2K0QA 3O8CA 2A5AA 2P8OB 1AVGH 3STIA 4E7NA 1P9SA 2EQNA 2ZDLA 3BTEE 2FO9A 2THFB 3KNXA 1F92A 1AI8H 1JXPA 5T6GA 1F7ZA 1TQ0B 2F9UA 4CR5A 3EE0B 4PROA 1WV7H 4M7GA 2BXTH 1P2OA 3F9FA 1ABJH 5HMAA 1W3CA 1HAGE 2Y81A 1AU8A 2Z6BD 1O5FH 2G55A 3UPEA 2C90B 4NSVA 4X1SU 1P9UA 2STBE 5FPTA 3RXJA 4AB9A 1ZRKA 3SYJA 3RXLA 2EEKA 1AZ8A 3Q76A 1CSOE 1C5MD 2GCHG 1E34B 1F5KU 3QK1A 3ZVFA 2FOMB 4GCHG 2HWLB 3K2UA 1GG6B 1DM4B 1GJDB 1TFXA 3SGAE 1CHGA 3FZZA 1FI8A 1J17T 1OP2A 1V2ST 4KGAA 1EZXC 1UCYK 2FWWA 4Q63A 2FOHA 1GCTB 3ZZ5A 5JB9S 4DIHH 5F53A 1C5RA 4VGCC 3F9HA 2FZZA 5DP3A 3ZYEA 2BYAX 5F6MA 1BRAA 1FPHH 3S9CA 4Q7XA 4Q7ZA 3NKKA 2R0KA 1XM1A 1MTUA 4H6TA 1XUJA 1Y5BT 2W3IA 1K1JA 4JYUH 3SU2A 1FIWA 2ZU3A 3TPIZ 4TSFD 3SNBA 1YPHE 1ZSLA 3P8NA 3N7DA 1BMAA 3GCOA 3U69H 2QYIA 1FNIA 4OS5A 1SQAA 1GBIA 1OX1A 3UUZA 4B71A 2WPDD 1PYTD 5TJXA 1MTSA 1QY6A 1Z1JA 1KMHB 4LOYH 3A89A 3UB0A 2ZO3H 1S5SA 1GI9B 2ZHFH 4Y0ZE 1V2TT 2OD3B 2J92A 1GJ7B 1P02A 2LPRA 4Y8YA 4ABDA 1TRMA 1O2MA 5HIZA 1KXCA 1CBWB 2FX6A 1OWHA 4D8NA 1WAYB 5AVDA 1P12E 4DT4A 1OWDA 4I8JA 1G3EA 2B0FA 1HRTH 9ESTA 1ELAA 3ZVEA 5C3NA 2Y6TA 4KP0A 3F6UH 1BB0B 2P95A 2HNTF 3A7TA 3MO3A 3C27B 4NA8A 3TNTA 1ETSH 1KLTA 1E1QD 1YPLH 4X2VA 1AY6H 5F8ZA 8LPRA 2G5VA 3QX5H 3MWIU 5C94A 3URCA 4AC9A 1P0SH 2FX4A 2KFWA 2ZDVH 4AG1A 1EAWA 1RGQA 1D6WA 4FVDA 5E2PA 3ZZ8A 1O3HA 5G4BA 2BDAA 1EXFA 2I6QA 3MNCA 2VWOA 1RIWC 2XRCA 2ZA5A 3QO6A 2BMGB 3UR6A 1LO6A 2IPHA 1LKAA 4Y7AA 1K1IA 1FONA 3VEQB 2F9BH 5DP7A 2OC1A 3CS7A 2CK3D 3KHVA 3O8BA 1BUIA 1F0RA 1GL0E 2BLWA 5FXLA 3DD2H 2W7SA 5ABWA 2HRVA 1P09A 2OQUA 2WZQA 3LJOA 2YNAA 2WSSD 1AGJA 1YPJH 1NRRH 1C5SA 1O3GA 2GDEH 1G36A 1SHYA 2P8OC 4IN1A 2VIDA 4ZKRU 1F0SA 2ODYB 2R3YA 1OXGA 4F49A 2BDGA
chains in the Genus database with same CATH topology
2QA9E 1UTLM 1A46H 1UK3A 4D9QA 1O2SA 4IGDA 1KY9A 1C2EA 1AUJA 2QN5T 1DITH 3TIUA 1GL1A 2WPLS 1ABIH 2FYQA 3FFGA 3LC5A 2XBYA 4X8TH 3UOPA 2WPKS 2XW9A 1EAIA 3PV4A 1ANBA 3KQDA 4E06H 4D7FA 4ISOA 1C2FA 2BZ6H 1GI3A 2ZU5A 4OGXA 4ASHA 1OKXA 4I32A 4E7RG 2VNTA 2ANWA 3MTYA 2P3FH 1MMJN 1K21H 5E0HA 1GG6C 5JBTA 2ZGHA 1EASA 2JH5D 4AFZA 4BAQB 3ZZ4A 1RRKA 1ANCA 1WSSH 2FS8A 3BEIB 2BLOA 1NRNH 1O3MA 1KXDA 5A0BA 1GJ5H 4IMQA 4NG9H 2BVRH 1W12U 2FOGA 3LGUA 3KQEA 1VITG 1L1NA 3BSQA 2Z94A 3K65B 3S7KB 1HAOH 1TNIA 4ABGA 3M5NA 5FBIA 3UNQA 4I7YH 1ESTA 4ESTE 1TX6A 1SFQB 2UWPA 3BTGE 5JBAS 1C5UA 2CV3A 1C9PA 1AUTC 1DWBH 1HJ9A 2WV5A 1NC6A 5JPMH 1C1WH 3SV7A 5A8XA 2Y7ZA 3U8RH 5L2YH 3RXDA 2GZ9A 3RXAA 3LPRA 1ZHRA 4ZHAA 1L2EA 1W13U 4WWYA 2BZAA 1RS0A 3A85A 3M7TA 1MD8A 1SGEE 1WTHD 5DP5A 1TONA 2BY7X 3S9BA 1J8AA 2FLRH 1UTQA 3F9GA 2D8WA 4HZHA 1G2MA 5HGGA 1MCVA 1SGDE 1NU9A 5FHTA 1O2PA 1CBWC 1TQ7B 3RXGA 3A7ZA 3RXHA 2ZEBA 2ZU4A 2UUFB 2V3HH 1GDQA 5EG4A 1O3FA 4K8BA 3MO6A 4X6PA 1C2LA 1CA8B 5DG6A 1C5LH 2F91A 3MU4A 2V6NA 1WTGH 2NU0E 1ARBA 1GI8B 1C1RA 1SGYE 4OS2A 5FPSA 1CU1A 2Q6FA 3WY8A 2WPIS 3RM2H 1LHGH 1O2GH 1TNKA 5EQSA 4X2YA 3CP7A 1S85A 1O2XA 1GI4A 2ZHQH 3UTUH 4BNRA 2ZGXH 3A7WA 3R0FA 4B2AA 4JZFH 1C1UH 2BX3A 1Y3VA 1RD3B 3MNBA 1V2JT 1EOJA 1GBTA 2AMQA 3ATKA 2C8XB 3OX7U 3SNCA 3A86A 4DY7B 4U2WA 1WYKA 2H5CA 1P06A 1O32A 2QAAA 2WPHS 4GSOA 4AYVB 1O2NA 4CHAB 5T6DA 3AASA 3A7YA 2XNIA 4LK4A 1VJ9U 1LMWB 1AKSB 2O8TA 2FM2A 2ANYA 2OCVB 3NXPA 2ZGCA 3F68H 1AVWA 2GD4B 4ZXYH 2J94A 1C5OH 2W7UA 1D3PB 1UO6A 2F9PA 4B74A 2A4QA 1AE8H 3SJOA 2XCNA 4RN6A 2BTCE 1W11U 1MD7A 2WV4A 4U30A 1TMUH 2XC4A 1O2IA 3BTKE 1ZMJA 1ZTLA 2TBSA 3ZZ9A 1GJ6A 5GIBA 1BMLA 2A7CA 1KXFA 3HKJB 4K5ZA 4YLQH 1C1NA 3A8BA 1CE5A 4NIYA 1HB0B 1O5DH 1SL3A 1YYY1 3UWJH 4AORA 1ARCA 2HOBA 4SGBE 1W10U 2G52A 5DKMA 3LT3A 3SGQE 1TALA 1YLDA 2VIPA 1YF4A 3ENSB 3L3TA 1PPEE 4H4FA 2J2UA 3RC4A 4WMEA 3SUFA 3DFJA 1HUTH 1D6RA 1A0HB 5L2ZH 3PWCA 3ZZ6A 2FOEA 6CHAC 1DUAA 5JBCS 4ZHMU 2R9PA 3AVZA 2XBVA 1KYNA 5L6NH 4NCYA 3TH2H 1THSH 3DUXH 2W26A 3LGIA 2G4UA 3A83A 2QXIA 1IQEA 5E8EH 2GCTC 5AFZH 4X2WA 1LCYA 4MVNA 4AG2A 4AX9H 3RM0H 3VGCC 3ATWA 1TGNA 4X0WU 1O2JA 2DE8A 1C4Y2 2B5TB 5JBBS 2VIOA 1NRPH 2XC0A 4NFFA 1OYTH 1AZZA 1BMMH 1AWFH 3SNEA 1THPB 2ZHDA 4U32A 3TJUA 1KLIH 4JZIA 3VPKA 1IAUA 1M9UA 1ZJDA 1TGSZ 4MNXA 2BDYA 2AS9A 2BY8X 1K1OA 4CBOA 1G9IE 3SU0A 1GBCA 1AKSA 2A5IA 1ZGIA 2FOBA 2W3KA 1VZQH 3TU7H 1Y5UT 3ZVDA 2VWNA 1BTXA 1UTPA 1QR3E 3M37A 1AFQB 1ETRH 2P16A 2RA0A 1DDJA 4Q7YA 1O5EH 5DP4A 4Y0YE 3A8CA 3RDZA 4FU9A 1HIAA 1UK2A 1ACBE 2PTCE 3RMLH 5I25A 1TYNA 1ZLRA 3A80A 3V3MA 4R8TB 1XUGA 3RXOA 1EZUC 2BY6X 1YM0A 3DT0H 1MAXA 3G01A 3S0NA 4BXWA 2BVXH 4NGAH 1L1GA 1S83A 2Z9IA 3EYDA 1NO9H 1GBMA 5EQRA 2C8ZB 1GBFA 3QN7A 3UQOA 3V12A 3U1JB 2BHGA 8KME2 1AMHA 2Z9KA 3GY6A 1XUFA 3MFJA 1V2WT 4UFDH 2ZFTA 3BEUA 2ESTE 3R3GB 3BTFE 1G2LA 1GMDF 4X8VH 3P70B 9LPRA 5IDKA 2HPPH 2A4GA 1ELVA 2B7DH 4Z0KA 3ZZCA 1N6XA 3GCHB 1ELTA 8GCHF 5BPEA 4JMYA 2Y82A 1FY4A 5C2ZA 3PLKA 1QL7A 1MQ5A 1BJUA 1FAKH 2RA3A 4TPIZ 3RC6A 1G32B 1W7XH 2ODPA 4BAHB 2Z3DA 1OPHB 1JIRA 3RLWH 1CVWH 1TA6A 5A0AE 3JZ1B 2J38A 4AZ2B 2ZZUH 4UD9H 4IN2A 1GVZA 1TIOA 1O3BA 3L33A 1QCPA 1GMHF 3MI4A 3UFAA 2A4RA 1VCWA 1GI1A 3T5FH 7ESTE 1GHVH 4CH2B 2BD8A 3JZ2B 1NN6A 2H2ZA 3PMAB 1LPZB 1K2I1 1Z1IA 2CN0H 2Z9LA 2A4OA 2J34A 2TRMA 2G8TA 3Q3YA 4OS1A 4K60A 2BY9X 4K1EA 3MNSA 1S82A 4XBCA 1S81A 1BRCE 3T27A 1B5GH 4AOQA 1UTJA 1FPCH 1PPHE 5C5OA 4FUCA 1IQFA 1GJ8B 1HAPH 5IYTA 3P8OA 4UFGH 4K8YA 1FQ3A 3RXUA 3MU5A 2BVSH 3SV9A 1QTFA 1MKXH 1XUKA 2CHAB 3U9AH 2V35A 3I29A 1C5NH 1C2IA 1B0EA 1MUEB 4IMZA 2QXJA 4TWYA 2C8WB 2OLGA 5LPRA 1KTTB 4DJZB 1KDQB 3SUEA 4Y8ZA 5K0HA 1TMBH 2AIQA 4Y11E 1ZTKA 3M7UA 1TBZH 4FUBA 1V2LT 1XUIA 4I8KA 4D9RA 1FV9A 1H9HE 4YM9A 4JK5A 4CH8B 2Z3EA 2ZCKP 1CA0C 3LJJA 3KCGH 2PR3A 1FY8E 4U01A 3E16B 1TGTA 3TJOA 3ZV8A 3GY4A 1H9LB 2OBQA 1TRYA 1SLWB 4YT7H 1SGQE 5H4IB 3VB5A 5JB8S 3MOCA 1VITF 4ISLA 3OY6U 1HXFH 3GY7A 2A2XH 1THRH 1GHAG 3RXTA 2IN2A 4WH8A 1QL8A 1O2LA 1TWXB 1C1OA 2VVVA 3E8LA 5GPIB 1H9IE 1GI2A 4CRFA 1L4ZA 1PPBH 1SC8U 2IJOB 3U8TH 2BM2A 2QXGA 1AFQC 2OC8A 3UWIA 2BY5X 1ZPCA 1EP6A 2BLQA 5E0JA 1EKBB 4ZAEA 4AFQA 1B7XB 1TAWA 3O8DA 1K9OE 4WJG2 4Z6AH 1N1LA 1PQAA 2BD2A 2DUCA 3A8AA 3QUMP 1W7GH 1P3EA 4IW4E 5C1UA 3PB1E 1O2ZA 4IC6A 2HVXA 1C5XB 4BTUB 3QZQA 1D4PB 1C5PA 1P8VC 1AE5A 4NZLA 4NA7A 1HAZB 1EATA 2KAIB 1ANDA 4A92A 1A4WH 3EA8A 1GWAA 3I78A 3T26A 5E0GA 1G3BA 3T62A 4WH6A 1QURH 1IQNA 1D3DB 1C4V2 3GY3A 2P59A 4DURA 2OQ5A 4TY7A 1ETTH 3S7HB 2BOHB 1K1NA 3QWCH 2JETC 4Y7BA 1SQTA 4WMDA 1WCZA 4H42U 3D65E 3D62A 3I77A 1PYTC 1HJ8A 3GCHC 3AAUA 1UMAH 3A81A 1KIGH 3NPSA 1TNHA 1HYLA 1UTKA 1GHBG 1P2JA 1PFXC 1O3EA 5GCHF 2CGAA 2GDDA 4Y71A 1P01A 1ID5H 1O3PB 2ZF0H 2C3SA 1TRNA 1GBDA 1Z71A 4MPWA 1FY1A 3BTTE 3B9FH 1UHBB 1F0TA 1GHZA 2ULLA 4TPYA 2H6MA 3KQBA 3NK8A 1A5IA 1DXWA 3LGWA 1F5LA 1C9TA 1ZYOA 4KTCA 1IQJA 1EP5A 2TGAA 3H7TA 3SV8A 1C2KA 2GMTB 6GCHG 1MKXK 3M5MA 5CE1A 1KDQA 1MZDA 1TOMH 2WPJS 3P8GA 5TCCA 1A5GH 3SOSA 2XC5A 1QBNA 1BBRE 5C1YA 4UFEH 1XKBC 1BJVA 4XSKU 3GDUA 4YOJA 3FP8E 3V13A 2SGDE 2B9LA 3MYWA 3VXFH 4THNH 1XUHA 1SB1H 1IHSH 4CRDA 4NIWA 4B76A 2OXSA 1FIZA 2V3OH 7GCHG 1JIMA 2W5EA 1BHXB 1ZHMA 1YGCH 3UIRA 1WQVH 1V2MT 5CMXH 4O97A 4WXVA 1EQ9A 4YT6H 5L30H 2CHAC 1V2OT 1IQLA 1MTVA 1GI0A 2FOFA 2P93A 1UTMA 2ZFFH 3A88A 3M3TA 3MH6A 2QF3A 1WUNH 3KEEA 4OGYA 4DIIH 1C5VA 3NWUA 3ZZAA 1S0RA 4YESB 1KLJH 4BAOB 6LPRA 5T3HA 1YPGH 2ZCLP 1O3IA 1DFPA 1LQEA 1G30B 1HV7A 1F2SE 1GMCF 3IG6B 3FZDA 5K7RA 1GJ9B 1GCTC 3FANA 3RXRA 1W2KH 1UJ1A 1NRSH 1SG8B 4IS5A 5LH8A 3FVFB 1BBRK 2CJIA 5AF9H 4R0IA 1BRBE 1NRQH 2CF8H 5A8ZA 5EW1H 3ATLA 3FAOA 1C5WB 2VB0A 2F83A 5DGJA 2VIVA 1KXEA 2ZQ2A 2XWBI 3SHCH 1CHOF 4X6MA 2ZFRH 1LKBA 1G3CA 1ELBA 3EGKH 2OUAA 2H5DA 4BOHA 3T29A 3LDXH 1VITH 3K6YA 3GCTG 2VH0A 2Q6DA 4UDWH 3RXIA 2TGDA 3B23B 1TMTH 3ZZ3A 3S9AA 1DT2A 1AHTH 1DY9A 2UUYA 2ZU2A 5DJ7A 5C20A 3MNXA 2AGEX 2R3UA 5HYOA 1GDUA 1OWEA 1GJAB 4NFEA 1MQ6A 1JBUH 1T8MA 1V2VT 4D76A 3Q00A 4ZH8A 1UHBA 1SGTA 2B8OH 2GV7A 3RXSA 2PFEA 1Z8RA 1J16A 1PPGE 1DLEA 1W0YH 1SGIB 1GHWH 6ESTA 1KTSB 1NM6A 1SGNE 3KN2A 4Y10E 5GJ4B 1OWIA 2A31A 1DSTA 4ISIH 7LPRA 1O3LA 2D2DA 4ZMAH 1ZGVA 1ELFA 3TNSA 1DSUA 5LPEA 3TGJE 1TGCA 2FEQH 2RDLA 1UVTH 1BTWA 3TH3H 1PJPA 1TA2A 2QV1A 3IWMA 5F8TA 1XKAC 4NSYA 3P95A 1MH0A 1ZSJA 2F9OA 3RXFA 2RCEA 2WINI 1UVPA 1TPSA 2BOKA 2TIOA 4JZDH 4AGKA 3QTVH 2ODQA 1HJAB 4MQAA 1C2JA 1NFWA 2FI5E 2FS9A 1GJBB 4J1YA 4WVPE 2HLCA 4RSPA 1NZQH 4ABIA 4X1PU 1C1VH 1NFXA 1O3KA 1QIXB 4FUJA 4KTSA 1V6DA 2AGGX 1QNJA 1D3TB 1EX3A 1SGCA 2C4FH 1VJAU 3LGTA 5CHAB 5A2MH 1T31A 1BDAA 2JKHA 1XXDA 3LU9B 4XFQA 2G81E 1O3JA 7KMEH 2ZDKA 4ZKSU 3SJ8A 4ISNA 2WUCA 2GMTC 4Y76A 2AMDA 2UUKB 1A7SA 3SUDA 1O2QA 2ZGJA 1H4WA 1EPTB 1MAYA 3E3TA 2F3CE 3QZRA 3ZV9A 1LTOA 3SV2H 3A7XA 3FP7E 1EAUA 1K22H 3VB7A 2HNTC 1C1MA 3DHKH 1E35B 4X1NU 1HBTH 2ASUB 1A0JA 2OC0A 5F03A 3VFEA 2WPMS 3MHWU 5LPFA 1HLTH 1C1QA 1INCA 1ESBA 4ABHA 4AFSA 1FN8A 4X6NA 3MU1A 2ZG0H 3SU6A 1P2NA 1HAXB 2PWXA 4X1RU 5EQQA 4NZQA 2NU3E 3SQHE 4DCDA 1HXEH 1O5GH 1O3OA 1V2RT 1N6YA 3C1KA 2F9NA 3MO9A 4CBNA 5A0CA 4TYDA 3ZYDA 1WQSA 1HCGA 3SORA 3F1SB 3SN8A 2BDBA 3CENA 1OYQA 4B2BA 3RXMA 2IOTA 1B0FA 2TGPZ 1QJ6B 4FUFA 1A5HA 1L4DA 3GDVA 3SQEE 2BLVA 2I6SA 1Y59T 3URDA 1EJAA 4HFPB 2AERH 1CGIE 3GOVB 5EXMA 1O3AA 2GZ8A 1ZHPA 2TPIZ 3LGYA 1SOZA 1OWKA 2PGQB 3V7TA 1YPEH 2PLXA 2XWAA 1V2QT 4FUGA 3ODFA 1K1LA 1OWJA 2ZWLH 1O2YA 4ABEA 1TPPA 4OS4A 4HTCH 1E0FD 2ZU1A 3TJVA 1UTNA 3SI4H 2GCHF 3RLYH 4AB8A 1A3BH 4GCHF 3ODDA 2HGTH 1JMOH 1O2KA 3SO3A 2SGEE 2AFQB 2VVUA 3A7VA 1ZPBA 3AW0A 1AIXH 1TABE 2ILNA 2VU8E 1C2DA 1VCQA 1ZOMA 2SGPE 1UK4A 2FODA 5AHGH 5DO4H 2Y7XA 1N8OB 1PQ7A 3SBKA 2ZTYA 5BRRE 3ITIA 2PGBB 3BTHE 5FBEA 4NA9H 4BXSA 5GXPA 1EAXA 5HM2A 1OP0A 4A7IB 4K69A 1LQDB 2GT8A 1HDTH 1RTFB 1YCPH 1O2WA 3ESTA 3LOXA 3PYHA 3RXCA 1EPTA 1IQIA 2ZTZA 1LPGB 2O9QA 2FI3E 1GPZA 2XXLA 3PTBA 1CGHA 2CF9H 2J95A 4NIVA 1HJAC 3SNAA 2FIRH 5TCAA 2GK