2ZKSA

Structural insights into the proteolytic machinery of apoptosis-inducing granzyme m
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
231
structure length
231
Chain Sequence
IIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme M
publication title Structural basis for proteolytic specificity of the human apoptosis-inducing granzyme M
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 231
sequence length 231
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zksA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zksA02
1C5LH 2VVUA 4INKA 3W95A 2ZU2A 1K1IA 4I8HA 2M5TA 2OC1A 1LMWB 3SQHE 2GP9B 5EXLA 3SHAH 1PQAA 4GHQA 1D6WA 1K28D 2AMQA 1NFWA 4ABEA 1DX5M 2A4OA 4NFEA 1T4UH 4MNWA 3BEFB 1C2LA 3HKIB 2QYIA 3K9XB 1W3CA 5F6MA 2J94A 3GCTF 4D7GA 4NGAH 3RXGA 2BOHB 3ZZ4A 1HJAB 1P09A 3VXEH 5L2ZH 1QCPA 5TJXA 4QT8C 2KAIB 3UWIA 1C1VH 1TYNA 4WXIA 3TNSA 1HXFH 5J4QA 4X8SH 4E7NA 1RTFB 2HPPH 1NT1A 1ZPBA 5GPIB 4DGJA 3EA7A 1GL0E 1DVAH 5GCHF 1SL3A 1MAYA 1Y3YA 3O8CA 2OUAA 1IQFA 3KF2A 4ISNA 4NCYA 2CN0H 1PPGE 4IW4E 1UCYH 1GI8B 3DFJA 1GCDA 3SJ9A 6GCHG 2H5CA 1FY5A 2XC0A 3GY5A 2ZTYA 1GBBA 3KNXA 3MYWA 1O3KA 2P94A 2CMYA 2WPKS 1FDPA 2BB4A 1SGDE 1XM1A 1GI0A 1FPHH 1MU6B 3SUGA 1C1TA 1ZJKA 4YLUA 1CU1A 3PMAB 1EAIA 2FOEA 2BDYA 1CA0B 3ELAH 4X8UH 1TBRH 1AN1E 1ZMNA 2UWPA 2ZTZA 4MPUA 3ZZ3A 4CRBA 3ZZBA 3H7TA 2BXTH 1HUTH 1K1NA 4U01A 2J4IA 3TJUA 3F68H 4DOQA 1SC8U 2A2QH 4YT7H 1O2LA 1P02A 2R2WU 3A8AA 1WQSA 1WSSH 1C5YB 1Z6JH 1TBQH 2ZCKP 4ABBA 1C5SA 1LTOA 1HAIH 2OINA 3RMNH 4FUEA 3UTUH 1F0SA 2BD2A 4FUIA 1O2WA 3TU7H 1SLWB 2WPLS 1CQQA 1Z8RA 1BIOA 1C2MA 2GDEH 5C67A 2EEKA 1Y3VA 2W5EA 5K7RA 2A5IA 1VGCB 4OS1A 2BY9X 1P57B 1Y5UT 1KXFA 3D62A 1BJVA 2EI7A 2OP9A 3QLPH 1XUHA 4CRFA 1YPHC 5FX6A 1O2MA 4ZKNU 3QTVH 4VGCB 2ALPA 1WOFA 1DSUA 4X8TH 2J38A 2AGEX 3A8BA 4A6LA 1JMOH 2GGVB 2IJOB 1ZMJA 3ZV9A 3SUEA 2F9NA 1NM6A 5EPNA 3UNSA 1Z8GA 3SU4A 2GCTC 1QFKH 2O8LA 1DY8A 2BD7A 3F6UH 1DWEH 5FPYA 5C5NA 3FVFB 4R0IA 1TX6A 1GCTC 2CXVA 3ENSB 2ZHDA 1BMMH 1ELEE 3TH2H 3ZVAA 1MCTA 1NS3A 3PWCA 3RLYH 4X8VH 2B8OH 4ISLA 3RDZA 4E06H 1BRUP 1G3DA 1ELVA 1UTNA 2GV6A 1NU9A 3DHKH 2BVXH 3SNDA 4A1XA 1DPOA 1K22H 3SNAA 3E6PH 3V3MA 3LKWA 4IMQA 2Y5HA 7GCHF 1W2KH 4NFFA 1XX9A 1BMAA 1DXWA 1MMJN 1S0RA 2WV5A 2Y7XA 1SGYE 1FY1A 3E3TA 1XUKA 2VB0A 2Z7FE 1E36B 1P0SH 2AMDA 3LJJA 4ZH8A 1ZJDA 2OBOA 2PHBA 1YPLH 1OXGA 2FOGA 1PPFE 1QY6A 3PTBA 4AX9H 4A5TS 4YOJA 3BTHE 1AKSB 4B74A 2A7CA 3RC6A 1TRYA 1EASA 1EJMA 1G3EA 1EPTA 1SGCA 1PPEE 3RXMA 4XOJA 5EGMA 5FPSA 2ODQA 4MG3A 2WPJS 2IOTA 1UHBB 1QHRB 1GI7B 5FX5A 3OYPA 3ZVCA 2F91A 4CR9A 1GJ6A 2BLWA 2P16A 3UNRA 4B71A 1DITH 5LPEA 4F4OC 2BLOA 4YZUA 1KIGH 2FLBH 3P8NA 1RGQA 4UE7H 3EGKH 1K9OE 2I6QA 3TLOA 2AERH 4NZLA 2V35A 1TQ7B 1SGIB 1TX7A 3ODFA 3T62A 3A7ZA 5HM2A 2C3SA 2W3KA 3EYDA 3UOPA 1H9IE 2XRCA 1IQNA 1F7ZA 3T25A 1NRPH 3LGIA 2B5TB 4B2CA 2ILNA 1NY22 4ZHMU 3SI4H 3KQEA 1GG6B 3GDUA 4X1SU 4BAKB 2GD4B 3B9FH 5L6NH 3UQVA 3RXTA 2GZ8A 1GI4A 1H9HE 3GY6A 1P2MA 3A7VA 3VGCB 3SU0A 4NA9H 1QL7A 3BIUH 1KTTB 1UJ1A 1C5WB 3SNBA 4AG1A 3VPKA 4B2AA 5ABWA 1GWAA 1QBNA 2TPIZ 1MAXA 1QRWA 5AFZH 1E0FD 2CGAA 4X6PA 2BQ7B 4X0WU 1SGNE 2TGAA 1UCYE 2BMGB 4I31A 5DP4A 2BDAA 3F9FA 3BV9B 2P59A 1BITA 1BJUA 1ORFA 2UUYA 1FIWA 2ZU3A 1L2EA 1OYTH 1A0HB 2BXUH 3CENA 3HPTB 1GPZA 3TJNA 1A2CH 2DUCA 1MD8A 3SV8A 1C1NA 2DE8A 2ZF0H 3RXFA 1YPMH 4NA8A 1AO5A 1QBVH 3LGWA 3QZQA 1BTPA 1V2QT 1HAYB 4UONA 3QK1A 3D23A 1EATA 1ZTJA 3ZYEA 4AB9A 4FU7A 1TBZH 1G3CA 3RXBA 2R2MB 3T29A 2UUKB 2H9HA 4AG2A 1GI2A 3NWUA 5C1XA 2O8WA 1D3TB 1O2UA 1BRAA 7ESTE 4MTBA 2ZHFH 3UIRA 2QXHA 1HIAB 3M7UA 2A0QB 1ARBA 1TA2A 1QRXA 1V2MT 1GDNA 1QTFA 1MTUA 2J95A 3A87A 2TIOA 1Y3UA 9ESTA 2FZZA 2G8TA 2ZO3H 4UFGH 3UR6A 5DP5A 2Y5FA 2JH5D 2XC5A 2VH0A 1KXEA 1KTSB 1H9LB 3PM3A 1NFXA 3SGQE 2QGRA 5A8XA 1BRCE 3GY7A 1TGNA 4CH8B 1K21H 1GBDA 1UVOA 4XE4A 1GMHG 1XMNB 3K2UA 3JZ1B 3MU8A 4UFEH 5F03A 2G51A 1O35A 1SG8B 5F8XA 3ZVGA 4WMFA 2BDGA 1Y5BT 2FYRA 2ZDMA 4ABHA 1O37A 1JRTA 4WY3A 2WYJA 3M5MA 1T7CA 1PQ5A 4TY7A 1HXEH 1SMFE 2BVSH 2WUBA 5L2YH 8LPRA 2ZPSA 1O3FA 5JBCS 1Y3XA 5E2PA 1GJ7B 5HM9A 4LXBH 1X7AC 1G36A 1G9IE 1O2TA 3RXLA 1YP9A 2QA9E 1TRMA 3LU9B 1HGTH 1GI9B 1A1RA 4BOHA 5DP7A 3A81A 1P05A 1P2NA 1O3JA 2TGDA 1TNIA 1O3NA 1TPAE 1W12U 5EOKA 4CRCA 1BTUA 1OWIA 4JK6A 1L4ZA 4I7YH 1YCPK 4B2BA 3MU1A 1QB6A 1FZZA 2PUXB 5LPRA 1GBMA 4FVBA 3SI3H 3ZZDA 4D8NA 4ZUHA 1NRQH 1C5OH 3F9HA 3O8BA 1W14U 5GDSH 1BBRH 4FXGH 4X1RU 3Q00A 5EQQA 2Z9GA 1BT7A 3BEIB 4YESB 1A4WH 4Y7AA 4DIIH 1MTNC 1OOKB 1LVOA 4MNVA 1CBWC 5FPTA 2VWOA 4K1TA 1IQMA 5GXPA 2BX4A 4NIYA 3CS7A 1EX3A 1TABE 4JYTA 3RU4T 1FLEE 1GHWH 2ZFTA 1WV7H 1EPTC 4BXWA 5C2ZA 5A0AE 2GV7A 1NC6A 3BTWE 4CRGA 1N6XA 1T32A 3E0PB 1RIWC 4HFPB 1O3CA 3GICB 1INCA 2FODA 4DG4A 3BIVH 5AHGH 3NPSA 2ZEBA 1C2IA 1DUAA 2VIDA 3PLPA 4OGYA 3LC5A 1B7XB 4MLFB 3BTFE 3ATMA 3BTTE 3SV9A 1C1SA 3JZ2B 1GHVH 1YPJH 5C5OA 3SNCA 2XXLA 1GHBG 2C93B 3G01A 4M7GA 1W10U 3GCOA 2F9UA 3ZZAA 3VB6A 5JYIA 2G4UA 3UPEA 1DICA 4DURA 1SPJA 1P9SA 3V12A 2PKSB 1SOZA 1O2KA 3SOSA 3PROA 3URDA 5G4BA 2R3UA 2EI6A 4UFDH 2GVFA 1WTGH 2ULLA 1CT2E 1BB0B 2Q6DA 1KLJH 1UCYK 2ANWA 1O2HA 3P8OA 1OWHA 1SGPE 5E0JA 3U9AH 4NZQA 3ZVFA 4LZ1H 2P8OB 4B1TA 2HWLB 1LVYA 1H4WA 1IQEA 3A80A 3MMGA 5AF9H 2C8WB 2QF0A 3SUDA 1UTJA 1DS2E 1NFYA 1P2JA 4ZHLU 3P70B 1W7GH 4NWLA 3BG4C 4DW2U 5EQSA 4OS2A 1E37B 1CA8B 1O5FH 2HVXA 1SHYA 3MH4A 1ELGA 1YLDA 2GT8A 2CHAB 2V3OH 5ESBA 4YLQH 3EDXB 1C1OA 1NRSH 1C4Y2 3PMBB 3E8LA 1WAYB 3E1XB 5T6GA 1DANH 3WY8A 4LOYH 1DXPA 4X6MA 2STBE 1GJBB 1T8NA 2OLGA 1QGFA 2ZGCA 1ID5H 3M5NA 1U6QA 1E35B 1OSSA 4ESTE 3GOVB 3LH3A 3RXKA 1EZUC 3AVZA 4Y8YA 5C1YA 1M9UA 1BTXA 4R8TB 1DWCH 2JETC 1QNJA 1THPB 1TIOA 3MNSA 1WTHD 1BUIA 1OWDA 2HALA 3HKJB 3SGBE 2WV4A 3SORA 4AFZA 4K1SA 2ZHQH 2QC2A 1ELFA 3KGPA 1O2ZA 1MD7A 1PQ7A 1TMBH 1W13U 2VVVA 4FUCA 1CHOG 3CS0A 1Z7KA 1FIZA 1E38B 2D1JA 1A5GH 1FY4A 1F5KU 1E34B 1YC0A 2PUQH 4FUDA 4U32A 1BTHH 3ATWA 1EZQA 1TNHA 3DUXH 3ZVDA 1SQAA 2VVCA 5F8TA 3U8RH 3BG8A 2C8XB 1DLEA 1EZSC 1OWKA 1V2VT 1UTOA 4TPIZ 1SLVB 3FFGA 1MU8B 1J14A 3LIWA 1IQIA 1C9PA 4MPWA 3MOCA 3TJVA 2GCHG 1A3BH 2ZFRH 1WU1A 1VCPA 5JBTA 2RG3A 5PTPA 2ANMH 2QXIA 5BPEA 2Y82A 3D65E 2ODPA 3AAUA 3LGVA 3MNXA 2B0FA 1JIMA 1HAGE 3IG6B 3V7TA 1SHHB 2I6SA 1HRTH 1C2GA 4B75A 2IN2A 3BSQA 2OC8A 2VH6A 4ABAA 3RM2H 2XW9A 1IQLA 1O30A 1BQYA 1ETTH 5E0HA 4A1VA 4K69A 1ZHPA 2TBSA 3RXDA 3ZZ5A 1G30B 4UEHH 2ZC9H 1TWXB 2J2UA 2VWMA 1XVOA 5E2OA 2Z9KA 4HZHA 2BLVA 5FCKA 1VCQA 1O3MA 4F49A 4GSOA 3HK6B 3M3SA 1JWTA 4BAMB 4Y6DA 4YT6H 5JBBS 2A4QA 3LONA 4ZHAA 1AFQB 1FAXA 2BHGA 4MVNA 2VGCB 4J1YA 1QQUA 1N8OC 2FOMB 2Z3DA 3RU4D 2F9BH 1C1WH 1NESE 2G81E 2BD9A 4YOGA 3RMMH 3I78A 3SN8A 1EPTB 5DP9A 1ETRH 1W7XH 3A7XA 1O5AB 1QA0A 3LDXH 2BD4A 2QV1A 3MO3A 1QRZA 2BQWB 5ETXA 4O3UA 3Q3YA 4BAOB 1V2JT 1C5RA 2QF3A 3PB1E 2PKAA 3GCTG 1AHTH 3SZNA 4YO9A 3A7TA 5DGJA 3RLWH 2C4FH 3UR9A 1O3EA 2FI4E 1ZRBA 1F92A 1OP0A 4BTIB 4ZROA 2ZGXH 2ZHEH 1AGJA 2ZCLP 4GUXA 2ZDVH 5DPAA 1QBOA 4ZMAH 1UVUH 2ZIQH 2BYAX 3KQBA 3ESTA 6CHAC 1C5XB 2OBQA 1CGIE 1S84A 4FUHA 1GVZA 5GCHG 1SBWA 1YPGH 1H1BA 4UDWH 1O5DH 3MNBA 1UO6A 3VB5A 1O3PB 1LPKB 2KAIA 3R0FA 1SI5H 1KYNA 1GBJA 3L3TA 1AE8H 2ZU4A 1EJNA 4JMYA 4FUFA 2A7HA 2SGEE 1SGRE 4KELA 2R9PA 1A3EH 3F9EA 1W0ZU 1NU7B 1MCVA 4TWWA 1ZPZA 4Y0ZE 4JYUH 1ESTA 1GGDC 3P8FA 3NCLA 1YCPM 1SGFA 1HAZB 1XKAC 2FIRH 2XCFA 1C2KA 3A82A 2G00A 1HAOH 1NRNH 5T6FA 1O2PA 1V2RT 4Y11E 1GHAF 1V2ST 1LKAA 1MZAA 4YTAA 1G37A 1VR1H 3T28A 4K3JA 1XUGA 4AZ2B 1C2EA 2JKHA 4KTCA 1YLCA 4K2YA 1YBWA 1TLDA 3P6ZB 1UK3A 3Q77A 1B5GH 1V2UT 1V6DA 2XBWA 4ABGA 3FP8E 3TGIE 1GDQA 3VB3A 2Z9LA 2P3FH 3B23B 3O8DA 1GHXH 1SR5C 4CRDA 3PO1C 2GMTC 2HOBA 3KHVA 2RA3A 4X1NU 2PWXA 1J16A 1P10A 2NU1E 1GI1A 3K6ZA 1WBGB 1GBAA 1K1LA 2ZGHA 2BY8X 2CF9H 1QL9A 1ANBA 3ATIA 1O2OA 4AGKA 2A5AA 2YNBA 1G2LA 2XCNA 1YYY1 1ZSLA 5EPYA 3AAVA 4GVUA 1AUTC 1TOCB 2V3HH 2VIOA 1GMCF 3QDZB 5DJ7A 3GY8A 2FYQA 1EP5A 1QJ7B 1UMAH 1L1JA 3ZZ7A 1DDJA 4NWKA 2VIWA 1GJDB 1BMLA 1EAXA 1P8VC 4X1QU 2HNTE 2R0KA 4NG9H 5H4IB 4O03A 2W26A 4FUGA 4XFQA 4YM9A 1UTQA 3FP7E 2IPHA 1KLTA 4CBOA 3QN7A 2ZU1A 3GYLB 2ZFSA 1O33A 1WQVH 1O34A 2ZG0H 1GI3A 1QJ1B 4I33A 3F1SB 4A92A 1SQOA 4AGJA 1O39A 1PYTD 3TPIZ 4Y0YE 1HAVA 4MPVA 1K1OA 4JZDH 1EOJA 3BTKE 1J8AA 1VITF 3VFEA 1EB1H 4ASHA 1UTLM 5CHAC 3U69H 1CE5A 3P17H 1C2FA 2EI8A 3BEUA 3MO9A 1HCGA 7GCHG 2GTBA 1N1LA 1D9IA 2SGQE 3SUFA 8KME2 1DT2A 1BDAA 2ZQ2A 1QIXB 2FEQH 1O3LA 1SFQB 2BY5X 3LPRA 2Z9IA 2FESH 1GHAG 1YGCH 3DD2H 3E91A 4TWYA 1DM4B 1CGJE 1ZR0A 4XBBA 3SU2A 1H8IH 1BTWA 1GMDF 1DUEA 5C3NA 1XXFA 3MHWU 3RU4E 2XNIA 1LPGB 1BBRK 2NU4E 4I8GA 5JB8S 3RXSA 4K8YA 3KEEA 3SQEE 2VINA 4THNH 2PR3A 1J15A 1HFDA 5F8ZA 1J9CH 1OS8A 2AH4X 3KCGH 4DVAU 1TGBA 2VIQA 5DG6A 4D9RA 2SGPE 2OTVA 1DWBH 2Q6GA 5J4SA 2HPQH 4WWYA 3FAOA 1UK4A 3LC3A 4BAQB 2C90B 2FOAA 4D7FA 1LPZB 3VXFH 3SU6A 1THSH 3IWMA 4AB8A 2ANKH 5FBIA 3AASA 2Z3EA 2PLXA 2QN5T 1HPGA 1FN8A 1O3HA 1S81A 1AVGH 3QTOH 3SJIA 1GVLA 4FUJA 5EODA 2A31A 1K2I1 5E8EH 4H4FA 4CR5A 3F9GA 4KGAA 4Y71A 3A7WA 2G4TA 2D26C 1EB2A 4IN1A 1S85A 4IN2A 1LHDH 3KIDU 3TK9A 4O97A 1VZQH 2FWWA 2W7SA 3S0NA 1ZRKA 2XC4A 5T3HA 1O2XA 3RXEA 3GY2A 1ANCA 2GCTB 2HLCA 4OS4A 4K60A 1A46H 4DT7B 2QXGA 4PROA 1GCTB 1PJPA 4JCNA 4H6TA 3UOUA 1SB1H 4K8BA 1O38A 1O2QA 3H7OA 3GCNA 3RMLH 1HJAC 2QIQA 2G52A 2ZFQH 5GWZA 1CVWH 3LGYA 4Y76A 3S9CA 3M37A 3U98H 2VWNA 4ABIA 3U8OH 2G5NA 1YPKH 3PLBA 3MTYA 1SGTA 1NZQH 1ZTKA 4NSYA 3ATKA 2SNWA 4JZIA 1BCUH 4X6OA 2A1DB 1TMUH 4XBDA 1TPSA 1OP8A 1V2OT 2HGTH 3P95A 1C1RA 1MQ5A 2OQUA 1CGHA 1XVMA 5AFYH 4MNYA 1IQKA 1NTPA 5C20A 1C2DA 3TGJE 1D4PB 2O9QA 1FNIA 2UUJB 1AIXH 3RUOA 4AYYB 1TA6A 3EAJA 3Q3KA 3E90B 4Q7YA 2RCEA 5EG4A 4AFSA 2Z94A 1C4V2 1EUFA 1IQHA 2WYGA 1AQ7A 8GCHF 5JPMH 1JXPA 1XUIA 3A83A 2GDDA 3UFAA 3SJOA 1A7SA 2JH0D 4WH6A 5LPFA 2BLQA 2GZ7A 1ABIH 1AVWA 3U1JB 1HDTH 2XYAA 2Q6FA 1ELBA 2AGGX 1CT0E 1S6HA 1V3XA 1P2QA 1ZSJA 3C27B 1AB9C 1EAWA 1LHFH 1P9UA 4YOIA 3QZRA 3SHCH 2P95A 2V0BA 1GI5A 3SU3A 1TGSZ 1V2PT 1S83A 4IGDA 1LDTT 1IHTH 1JOUB 1O3DA 4SGAE 1VCWA 2QCYA 2BOKA 5FCRA 1C1PA 4DCDA 1G32B 1ACBE 2ZKSA 4BNRA 1C1QA 1VGCC 3U8TH 1SGFG 4WF8A 2XWAA 4O3TA 1P03A 1P2IA 1V2NT 4JZFH 2Y6TA 2FTMA 3P8GA 3I29A 5A0BA 4H6SB 1S82A 1L0ZA 1P11E 3ITIA 3SO3A 1ZPCA 3FANA 4RKJB 3ZZ6A 1C5QA 1SLXB 2NWNA 2BM2A 4ZXXH 1EZXC 1DSTA 1GBEA 2FI5E 2RDLA 2BD5A 4Z0KA 4ZKSU 3A85A 1O31A 3T26A 2CJIA 1MBMA 1FUJA 1UTKA 2AMPA 2VIPA 3PWBA 4I8JA 2FPZA 3TITA 1NROH 1NPMA 3SNEA 3GISB 4RSPA 1G2MA 3M3TA 1TB6H 1O3BA 3MH7A 2AYWA 1AFEH 4JYVH 4JZEH 1ZGVA 2Y81A 1AE5A 4HI3A 1NN6A 3S69A 1SFIA 1C5NH 5T6DA 1O2YA 3QGNB 1ELCA 2ZFFH 6GCHF 1Y8TA 1MBQA 1TFXA 4NIVA 1A0JA 1F5LA 1L1NA 3RXJA 1MUEB 1LHCH 1T4VH 5DO4H 2ZDAH 3KQDA 8GCHG 5DK1A 2H5DA 3BN9A 1RXPA 1Y3WA 1S0QA 3GCHC 3GYMA 4MPXA 1FMGA 5EU8A 2ZI2H 3M36A 1AZZA 2Y80A 2BDCA 2R3YA 2FTLE 1SGEE 2QAAA 4FU8A 2Z9JA 2P3UB 5CE1A 2ZDLA 4D76A 1LKBA 2PKAB 3BTQE 1MQ6A 1YPEH 2OC7A 1AD8H 1ZHMA 3T27A 2A4RA 2C8ZB 2BD3A 3L33A 4RN6A 2BTCE 2BY6X 3M35A 1C5UA 2XBVA 2AFQB 1TONA 3TIUA 1GJAB 3QO6A 3SU1A 3NXPA 1O0DH 3RXHA 3W94A 1ANDA 1HNEE 5HYOA 3QX5H 1UK2A 1BRBE 1ZTLA 3RXPA 2PGQB 4I8LA 2Q1JA 3A86A 2HRVA 2PW8H 3M7QA 1ARCA 3E0NB 1QR3E 1A5HA 2BZ6H 3A88A 1V2KT 2Z3CA 1G3BA 2F83A 1O2SA 1C5TA 1O2GH 3RMOH 2B7DH 2P3TB 3OSYA 1AY6H 1P06A 1GG6C 2V6NA 2Z6BD 3MU0A 3T2NA 2G5VA 5TCAA 3MI4A 1OWJA 3PMHB 1C1UH 2FXRA 1O32A 3VGCC 1DLKB 3ATLA 3A8DA 4Q80A 5DKMA 4X2WA 1C2HA 1EKBB 1L4DA 4KTSA 3S9BA 1BOQA 1MKWH 3Q3XA 3FP6E 2ZWLH 3ZZCA 2H1UA 2G55A 3T5FH 5I25A 1GHZA 2WINI 1SGQE 4WMEA 1FN6A 3PYHA 5I46H 2F9PA 4ISHH 7LPRA 5EW1H 2A32A 1MTNB 3D49H 3BTGE 1CBWB 4NIXA 1BBRE 1RS0A 1O3AA 2EA3A 1P12E 2PSYA 3R3GB 3ZV8A 1TNJA 2XTTB 5B6OA 1T31A 1NRRH 2VNTA 4NSVA 5EXNA 1GBFA 4XSKU 3EQ0H 1VITH 4TY6A 1RIWB 5TCCA 1FV9A 3MU5A 1AI8H 1P2OA 2H9EH 1ZYOA 4NA7A 4IMZA 1QURH 6LPRA 1EQ9A 1LHEH 1P3EA 1WCZA 4A1TA 3BF6H 4TPYA 1TQ0B 2FX4A 1HAXB 1AB9B 1KDQA 4D9QA 1MKXH 1RTLA 1D3PB 2H6MA 5FHTA 3LT3A 2W7UA 1FJSA 2PGBB 4AFQA 2R0LA 1LO6A 2BD8A 5L30H 3M7TA 1GJ8B 2ESTE 3LGUA 2TRMA 3ZVEA 1Q3XA 5CMXH 1MH0A 1F5RA 1KXCA 1P04A 1RTKA 1GBHA 1AWFH 4ABFA 1O2IA 1O5BB 1TOMH 2PTCE 3MO6A 5EQRA 3AW0A 4FU9A 3HATH 3M61U 1MTSA 3LGTA 2AS9A 1WYKA 3VB4A 3M5OA 4AN7A 2QY0B 4SGBE 1ZOMA 2PV9B 1HJ8A 2ZPQA 1XXDA 1HAVB 2ZDKA 1PQ8A 3A84A 4IS5A 1BTZA 5IDKA 3RC4A 1NO9H 1YPHE 1W8BH 1XKBC 1KY9A 4AORA 2ZPRA 3MWIU 1BA8B 4HGCA 2F9OA 1BHXF 2AEIH 2FLRH 5EW2H 3GY3A 2A2XH 1A61H 3BTEE 2TGTA 1C2JA 3RXQA 3MNCA 4OS6A 1O36A 4BAHB 1ELTA 1O3OA 4BTUB 1MTVA 3PLKA 2C8YB 3FZZA 6ESTA 4UD9H 2CV3A 4KTUA 3BG4B 1LVBA 1Q31A 5E0GA 2FDAA 4TYDA 1A0LA 1KXAA 5A8YA 3RXVA 1UTPA 4X6NA 3M5LA 1B0EA 1D3QB 4FVDA 3UY9A 3STJA 1W11U 2CF8H 1HB0B 1C5VA 4FUBA 1AVXA 5EXMA 4DIHH 4MNXA 1HBTH 3U1IB 2HNTF 1ANEA 2SFAA 3GCHB 4ABDA 1C5ZB 2H9TH 1QL8A 1O3GA 3DA9B 1KLIH 3RXUA 1AU8A 2WUCA 1FY8E 3TK6A 1GBIA 1OP2A 1HAPH 2D2DA 2JETB 3VEQB 1Z1JA 1DE7H 1SOTA 5JBAS 3BTDE 3FZDA 4LK4A 2GX4A 5A8ZA 2ZGBH 4KP0A 1FQ3A 1IOEA 4K5ZA 3SV2H 3OX7U 2ZA5A 3NK8A 2OCVB 1EAUA 2TGPZ 1ESAA 4ZAEA 2HNTC 3ODDA 1N6YA 4OGXA 1LCYA 3S7KB 1TX8A 3RXOA 2FP7B 5HXFA 1EOLA 4WJG2 3I77A 3QWCH 1FI8A 1Z6EA 4KKDA 5A09A 3TNTA 1S5SA 3ZZ8A 4Q2KA 3ZYDA 3DFLA 4X2YA 5DP3A 2FS8A 4CHAC 3HGPA 4OS7A 1LVMA 3K6YA 5IYTA 2YNAA 2BY7X 1PPBH 4WMDA 3PV4A 3EE0B 3GY4A 2FO9A 1UTMA 1W0YH 1O2VA 1GL1A 4JK5A 2ZNKH 5K0HA 1FPCH 2GT7A 2SNVA 1F0RA 3HGNA 2W3IA 1SQTA 1GMHF 2AGIX 4MDSA 3EA9A 2ZDNA 2PKSC 1S6FA 4INHA 1EJAA 4X2VA 4ISIH 4BANB 1TE0A 3MH6A 1KSNA 1H8DH 5HGGA 1T8MA 1RD3B 1ZGIA 1PPZA 2ZTXA 4U30A 1TRNA 1V2TT 4NIWA 2VIVA 1TPPA 3E16B 1GHYH 1SLUB 3RXRA 4UFFH 3OU0A 1JRSA 2D8WA 1EP6A 2RA0A 1RJXB 2YOLA 4IC6A 1C1MA 1ZMLA 2WPIS 1GBTA 3LH1A 4A7IB 1YM0A 2WPHS 2P8OC 2LNCA 4WVPE 1TGTA 1TMTH 1D6RA 1N8OB 1GDUA 3UREA 5FBEA 3SV7A 4AYVB 4HTCH 2P93A 1ELDE 2FOHA 5GIBA 3UNQA 2FS9A 4GAWA 4AOQA 1RRKA 2Y5GA 1TGCA 3TH4H 3V0XA 4DY7B 1AZ8A 1L1GA 3TGKE 2BDIA 4GCHF 1IAUA 3LOXA 4CH2B 2CHAC 3S9AA 3M3VA 1AKSA 1O3IA 1F2SE 2ODYB 2O8MA 1GMCG 3ZZ9A 2FOCA 1LQEA 5JB9S 3URCA 2OXSA 1P01A 3PTNA 3EA8A 5DP8A 5HMAA 1C4U2 5GJ4B 2QXJA 4ISOA 3SGAE 1O5EH 2BDBA 4ZXYH 1UHBA 1UVPA 3KN2A 4XBCA 1BTYA 2PSXA 2ZZUH 1JIRA 1K1PA 2AIQA 6CHAB 1D3DB 3UWJH 2SGDE 3UQOA 1IQGA 4BXSA 1B0FA 3GDSA 2BX3A 3QGJA 4INLA 2NU2E 2BVRH 5AVDA 2THFB 2BDHA 1T8OA 2VJ1A 5LH8A 1LHGH 1THRH 1O5GH 1BZXE 1MZDA 1DFPA 1VITG 3IITA 1ETSH 2F9VA 1GJCB 3O8RA 2FX6A 1GHBF 2K1QA 1XUFA 1J17T 3VB7A 4GPGA 2NU3E 1DOJA 4GHTA 1A5IA 1GVKB 2Y7ZA 2GZ9A 2O8TA 3STIA 1HV7A 5SGAE 1DWDH 1FAKH 9LPRA 1GGDB 1EXFA 3SW2B 2FOBA 1TAWA 1DY9A 2A45B 2SGFE 1CT4E 4Y10E 1CHGA 4Q7XA 5BRRE 2FOFA 1C5PA 2H2ZA 4Y7BA 1YF4A 1C5MD 1GMDG 1ZHRA 5JDUB 1VJ9U 1HJ9A 2LPRA 1UVTH 1TNGA 4IBLH 2ZCHP 3KL6A 3A8CA 1RFNA 4ZKOU 1Z8JB 2J9NA 1OKXA 2JH6D 4Y8ZA 1IHSH 1BHXB 1F0UA 1VJAU 2VU8E 1Z8IB 4H42U 5FAHA 3MU4A 3RM0H 1CO7E 2UWLA 1ZZZA 4X2XA 4JZ1A 5A0CA 1ABJH 1ESBA 2O8UA 2UWOA 5ESTE 3RXCA 3L6PA 1XUJA 1KXBA 3UUZA 3ZVBA 1HYLA 2ZQ1A 1CA0C 1O2JA 3MH5A 3SV6A 3PO1B 2GMTB 3BTME 3A89A 4IC5A 1WUNH 2A5KA 4GCHG 2ZP0H 5FXLA 3C1KA 3HK3B 4O9VA 3SBKA 1P2KA 1GJ5H 3OY5U 1GBKA 2BZAA 1Q2WA 1Y5AT 3KQCA 2AIPA 3N7OA 1HAHH 3SJKA 1PPCE 4Y79A 1AFQC 3AW1A 2VGCC 3OY6U 1IQJA 4CBNA 4OS5A 3LJOA 1SSXA 1MTWA 1PYTC 1HIAA 4WXVA 4U2WA 3QUMP 2ZGJA 5A2MH 3TH3H 4BTTB 1QA7A 4ABJA 3NZIA 3SU5A 2UUFB 3A7YA 1GBLA 4I8KA 4Q7ZA 4RKOB 8ESTE 4MQAA 3TK5A 4B76A 4DJZB 4X1PU 4CHAB 4E7RG 1GI6A 2OD3B 1C9TA 2XWBI 2F3CE 3RC5A 1HLTH 1TALA 2SGAA 3SJ8A 2PTNA 1PPHE 4VGCC 1LQDB 1AWHB 1O5CB 1V2LT 1ELAA 2A7JA 1CHOF 2XBXA 3P92A 1TNLA 1JBUH 5CHAB 1F0TA 1OPHB 2J92A 2ZFPH 5C1UA 1KXDA 3K65B 3Q76A 1CSOE 4Z6AH 1Z71A 2ANYA 3TJOA 2FI3E 2ZU5A 3DT0H 3OTJE 1AUJA 5LGOA 1K1JA 3MFJA 5DP6A 1UVSH 2NU0E 4K1EA 1OYQA 4ZKRU 1BMNH 1MKWK 3CP7A 4Y8XA 1O2RA 1T8LA 2GCHF 1ZLRA 2VWLA 1GBCA 2GKVE 1FXYA 4J2YB 2STAE 3RP2A 1YCPH 2BQ6B 4I32A 3RXIA 4XDEA 3GDVA 2PFEA 1OWEA 2OQ5A 3S7HB 2J34A 4GLYA 1TNKA 1OX1A 1O2NA 2ALVA 2ZHWH 1Y59T 1PFXC 2A4GA 1AMHA 1ZSKA 4B73A 2ASUB 2XBYA 4WH8A 1GJ9B 2FMJA 3TVJB 3NUMA 2WPMS 3V13A 4LZ4B 1QJ6B 3H5CB 1P3CA 1QQ4A 1TPOA 1V2WT 1NFUA 3NKKA 1K1MA 2OC0A 3B8JA 2ZECA 1QB1A 4CRAA 1GJ4H 1SVPA 7KMEH 1FONA 1FY3A 2DE9A 1KDQB 1YKTA 1Z1IA 4AFUA 3RXAA 1MKXK 4E05H 4CREA 2EC9H 1QB9A 3PMJA 2FM2A 2B9LA
chains in the Genus database with same CATH superfamily
1C5LH 2VVUA 4INKA 3W95A 2ZU2A 1K1IA 4I8HA 2M5TA 2OC1A 1LMWB 3SQHE 2GP9B 5EXLA 3SHAH 1PQAA 4GHQA 1D6WA 1K28D 2AMQA 1NFWA 4ABEA 1DX5M 2A4OA 4NFEA 1T4UH 4MNWA 3BEFB 1C2LA 3HKIB 2QYIA 3K9XB 1W3CA 5F6MA 2J94A 3GCTF 4D7GA 4NGAH 3RXGA 2BOHB 3ZZ4A 5C17A 1HJAB 1P09A 3VXEH 5L2ZH 1QCPA 5TJXA 4QT8C 2KAIB 3UWIA 1C1VH 1TYNA 2QF4A 4WXIA 3TNSA 1HXFH 5J4QA 2KCAA 1WXRA 4X8SH 4E7NA 1RTFB 2HPPH 2KZ4A 1NT1A 1ZPBA 5GPIB 4DGJA 3EA7A 1GL0E 1DVAH 3F2HA 5GCHF 1SL3A 1MAYA 4F48B 1Y3YA 3O8CA 2OUAA 1IQFA 3KF2A 4ISNA 4NCYA 2CN0H 1PPGE 4IW4E 1UCYH 1GI8B 3DFJA 1GCDA 3SJ9A 6GCHG 2H5CA 1FY5A 2XC0A 3GY5A 2ZTYA 1GBBA 3KNXA 3MYWA 1O3KA 2P94A 2CMYA 2WPKS 1FDPA 2BB4A 1SGDE 1XM1A 1GI0A 1FPHH 1MU6B 3SUGA 1C1TA 1ZJKA 4YLUA 1CU1A 3PMAB 1EAIA 2FOEA 2BDYA 1CA0B 3ELAH 4X8UH 1TBRH 1AN1E 1ZMNA 2UWPA 2ZTZA 4MPUA 3ZZ3A 4CRBA 3ZZBA 3H7TA 2HVYB 2BXTH 2M2AA 1HUTH 1K1NA 4U01A 2J4IA 3TJUA 3F68H 4DOQA 1SC8U 2A2QH 4YT7H 1O2LA 1P02A 2R2WU 3A8AA 1WQSA 2KCOA 1WSSH 1C5YB 1Z6JH 1TBQH 2ZCKP 4ABBA 1C5SA 1LTOA 1HAIH 2OINA 3RMNH 4FUEA 2W6JD 3UTUH 1F0SA 2BD2A 4FUIA 1O2WA 4TSFD 3TU7H 1SLWB 2WPLS 1CQQA 1Z8RA 1BIOA 1C2MA 2GDEH 5C67A 2EEKA 1Y3VA 2W5EA 5K7RA 2A5IA 1VGCB 4OS1A 2BY9X 1P57B 1Y5UT 1KXFA 3D62A 1BJVA 2EI7A 2OP9A 2CK3D 3QLPH 1XUHA 4CRFA 1YPHC 5FX6A 1O2MA 4ZKNU 3QTVH 4VGCB 2ALPA 1WOFA 1DSUA 4P02A 4X8TH 2J38A 2AGEX 3A8BA 4A6LA 1JMOH 2GGVB 2IJOB 1ZMJA 3ZV9A 3SUEA 2F9NA 3WW7A 1NM6A 5EPNA 3UNSA 1Z8GA 3SU4A 2GCTC 1QFKH 2O8LA 1DY8A 2BD7A 3F6UH 1DWEH 5FPYA 5C5NA 3FVFB 4R0IA 1TX6A 1GCTC 2CXVA 3ENSB 2ZHDA 1BMMH 1ELEE 3TH2H 3ZVAA 1MCTA 1NS3A 3PWCA 3RLYH 4X8VH 2B8OH 4ISLA 3RDZA 4E06H 1BRUP 1G3DA 1ELVA 1UTNA 2GV6A 1NU9A 3DHKH 2BVXH 3SNDA 4A1XA 1DPOA 1K22H 3SNAA 3E6PH 3V3MA 3LKWA 4IMQA 2Y5HA 7GCHF 1W2KH 4NFFA 1XX9A 1BMAA 1DXWA 1MMJN 1S0RA 2WV5A 2Y7XA 1SGYE 1FY1A 3E3TA 1XUKA 2VB0A 2Z7FE 1E36B 1P0SH 2AMDA 3LJJA 4ZH8A 1ZJDA 2OBOA 2PHBA 1YPLH 1OXGA 2FOGA 1PPFE 1QY6A 3PTBA 4ZCNA 4AX9H 4A5TS 4YOJA 3FKSD 3BTHE 3N7EA 1AKSB 4B74A 2A7CA 3RC6A 1TRYA 1EASA 1EJMA 1G3EA 1EPTA 1SGCA 1PPEE 3RXMA 4XOJA 5EGMA 5FPSA 2ODQA 4MG3A 2WPJS 2IOTA 1UHBB 1QHRB 3WWFA 1GI7B 5FX5A 3OYPA 3ZVCA 2F91A 4CR9A 1GJ6A 2BLWA 2P16A 3UNRA 4B71A 1DITH 5LPEA 4F4OC 2BLOA 4YZUA 1KIGH 2FLBH 3P8NA 2KM0A 1RGQA 4UE7H 3EGKH 1K9OE 2I6QA 3TLOA 2AERH 4NZLA 2V35A 1TQ7B 1SGIB 3AK5A 1TX7A 3ODFA 3T62A 3A7ZA 5HM2A 2C3SA 2W3KA 4RI0A 3EYDA 3UOPA 1H9IE 2XRCA 1IQNA 1F7ZA 3T25A 1NRPH 3LGIA 2B5TB 4B2CA 2V3MA 2ILNA 1NY22 4ZHMU 3SI4H 3KQEA 1GG6B 3GDUA 4X1SU 4BAKB 2GD4B 3B9FH 5L6NH 3UQVA 3RXTA 2GZ8A 1GI4A 1H9HE 3GY6A 1P2MA 3A7VA 3VGCB 3SU0A 4NA9H 1QL7A 3BIUH 1KTTB 1UJ1A 1C5WB 2QF5A 3SNBA 4AG1A 3VPKA 4B2AA 5ABWA 1GWAA 1QBNA 2TPIZ 1MAXA 1QRWA 5AFZH 1E0FD 2CGAA 4X6PA 2BQ7B 4X0WU 1SGNE 2TGAA 1UCYE 2BMGB 4I31A 5DP4A 2BDAA 3F9FA 3BV9B 2P59A 1BITA 1BJUA 1ORFA 2UUYA 1FIWA 2ZU3A 1L2EA 1OYTH 1A0HB 2BXUH 5HKKD 3CENA 1NBME 3HPTB 1GPZA 3TJNA 4TT3D 1A2CH 2DUCA 1MD8A 3SV8A 1C1NA 2DE8A 2ZF0H 3RXFA 1YPMH 4NA8A 3H09A 1AO5A 1QBVH 3LGWA 3QZQA 1BTPA 1V2QT 2KX4A 1HAYB 4UONA 3DSPA 3D23A 1EATA 1ZTJA 3QK1A 3ZYEA 4AB9A 4FU7A 1TBZH 1G3CA 3RXBA 2R2MB 3T29A 2UUKB 2H9HA 4AG2A 1GI2A 3NWUA 5C1XA 2O8WA 1D3TB 1O2UA 1BRAA 7ESTE 4MTBA 2ZHFH 3UIRA 2QXHA 1HIAB 3M7UA 2A0QB 1ARBA 3W1EA 1TA2A 1QRXA 1V2MT 1GDNA 1QTFA 1MTUA 2J95A 3A87A 2TIOA 1Y3UA 9ESTA 2FZZA 2G8TA 2ZO3H 4UFGH 3UR6A 5DP5A 2Y5FA 2JH5D 2XC5A 2VH0A 1KXEA 1KTSB 1H9LB 3PM3A 1NFXA 3SGQE 2QGRA 5A8XA 1BRCE 3GY7A 1TGNA 1SKYE 4CH8B 1K21H 1GBDA 1UVOA 4XE4A 1GMHG 1XMNB 3K2UA 3JZ1B 3MU8A 4UFEH 5F03A 2G51A 1O35A 1SG8B 5F8XA 4B6EA 3ZVGA 4WMFA 2RDEA 5KECA 2BDGA 1Y5BT 2FYRA 2ZDMA 4ABHA 1O37A 1JRTA 4WY3A 2WYJA 3F0PA 3M5MA 1T7CA 1PQ5A 4TY7A 1HXEH 1SMFE 2BVSH 2WUBA 5L2YH 8LPRA 2ZPSA 1O3FA 5JBCS 1Y3XA 5E2PA 1GJ7B 2XOKD 5HM9A 4LXBH 1X7AC 1G36A 1G9IE 1O2TA 3RXLA 4F55A 1YP9A 2QA9E 1TRMA 3LU9B 1HGTH 1GI9B 1A1RA 4BOHA 5DP7A 3A81A 1P05A 1P2NA 1O3JA 2TGDA 1TNIA 4M9FA 1O3NA 1TPAE 1W12U 5EOKA 4CRCA 1BTUA 1OWIA 4JK6A 1L4ZA 4I7YH 1YCPK 4B2BA 3UB0A 3MU1A 1QB6A 1FZZA 2PUXB 5LPRA 1GBMA 4FVBA 3SI3H 3ZZDA 4D8NA 4ZUHA 1NRQH 1C5OH 3F9HA 3O8BA 3DSOA 1W14U 5GDSH 1BBRH 4FXGH 4X1RU 3Q00A 5EQQA 2VBCA 2Z9GA 1BT7A 3BEIB 4YESB 1A4WH 4Y7AA 4DIIH 1MTNC 1OOKB 1LVOA 4MNVA 1CBWC 3F3BA 5FPTA 4YXWD 2VWOA 4K1TA 1IQMA 5GXPA 2BX4A 4NIYA 3CS7A 1EX3A 1TABE 4JYTA 3RU4T 1FLEE 1GHWH 2ZFTA 1WV7H 1EPTC 4BXWA 5C2ZA 5A0AE 2GV7A 1NC6A 3BTWE 4CRGA 1N6XA 1T32A 2KCYA 1RIWC 3E0PB 4HFPB 1O3CA 3GICB 1INCA 2FODA 4DG4A 3BIVH 5AHGH 3NPSA 2ZEBA 1C2IA 1H8HD 1DUAA 2VIDA 3PLPA 4OGYA 3LC5A 1B7XB 5CDFE 4MLFB 3BTFE 3ATMA 3BTTE 3SV9A 1C1SA 3JZ2B 1GHVH 1YPJH 5C5OA 3SNCA 2XXLA 1GHBG 2C93B 2WSSD 3G01A 4M7GA 1W10U 3GCOA 2F9UA 3ZZAA 4OM9A 3VB6A 5JYIA 2G4UA 3UPEA 2K8IA 1DICA 4DURA 1SPJA 1P9SA 3V12A 2PKSB 1SOZA 1O2KA 3SOSA 2WPDD 3PROA 3URDA 5G4BA 2R3UA 2EI6A 4UFDH 2GVFA 1WTGH 2ULLA 1CT2E 1BB0B 2Q6DA 1KLJH 1UCYK 2ANWA 4RT0A 1O2HA 3P8OA 1OWHA 5GNDA 1SGPE 5E0JA 3U9AH 4NZQA 5F53A 3ZVFA 4LZ1H 2P8OB 5FL7D 4B1TA 2HWLB 1LVYA 1H4WA 3FOAA 1IQEA 3A80A 5B6LA 3MMGA 5AF9H 2C8WB 2QF0A 3SUDA 1UTJA 1DS2E 1NFYA 1P2JA 4ZHLU 2QE7D 1W7GH 3P70B 4NWLA 3BG4C 4DW2U 5EQSA 4OS2A 1E37B 1CA8B 1O5FH 2HVXA 1SHYA 3MH4A 1ELGA 1YLDA 2GT8A 2CHAB 2V3OH 5ESBA 4YLQH 3EDXB 1C1OA 1NRSH 1C4Y2 3PMBB 3E8LA 1WAYB 3E1XB 5T6GA 1DANH 3WY8A 4LOYH 1DXPA 4X6MA 2STBE 1GJBB 1T8NA 2OLGA 1QGFA 2ZGCA 1ID5H 3M5NA 1U6QA 3NRLA 1E35B 1OSSA 4ESTE 3GOVB 3LH3A 3RXKA 1EZUC 3AVZA 4Y8YA 5C1YA 1M9UA 1BTXA 4R8TB 4ASUD 1DWCH 2JETC 2RFKC 1QNJA 1THPB 1TIOA 3MNSA 1WTHD 1BUIA 1OWDA 2HALA 3HKJB 3SGBE 2WV4A 4DT4A 3SORA 4AFZA 4K1SA 2ZHQH 2QC2A 1ELFA 3KGPA 1O2ZA 1MD7A 1PQ7A 1TMBH 1W13U 2VVVA 4FUCA 1CHOG 3CS0A 1Z7KA 1FIZA 4Q4LA 1E38B 2D1JA 1A5GH 1FY4A 1F5KU 1E34B 1YC0A 2PUQH 4FUDA 4U32A 1BTHH 3ATWA 1EZQA 1TNHA 3DUXH 3ZVDA 1SQAA 2VVCA 5F8TA 3U8RH 3BG8A 2C8XB 1DLEA 1EZSC 1OWKA 1V2VT 1UTOA 4TPIZ 1SLVB 3FFGA 1MU8B 1J14A 3LIWA 1IQIA 1C9PA 4MPWA 3MOCA 3TJVA 5KEDA 2GCHG 1A3BH 2ZFRH 1WU1A 1VCPA 5JBTA 2RG3A 5PTPA 2ANMH 2QXIA 3EE7A 5BPEA 2Y82A 3D65E 2ODPA 3AAUA 3LGVA 3MNXA 2B0FA 1JIMA 1HAGE 3IG6B 3V7TA 1SHHB 2I6SA 1HRTH 1C2GA 4B75A 2IN2A 3BSQA 2OC8A 2VH6A 4ABAA 3RM2H 2XW9A 1IQLA 2J97A 1O30A 1BQYA 1ETTH 5E0HA 4A1VA 4K69A 1ZHPA 2TBSA 3RXDA 3ZZ5A 1G30B 4UEHH 2ZC9H 1TWXB 3GS9A 2J2UA 2VWMA 1XVOA 5E2OA 2Z9KA 4HZHA 2BLVA 5FCKA 3KYFA 1VCQA 1O3MA 4F49A 4GSOA 3HK6B 3M3SA 1JWTA 4BAMB 4Y6DA 4YT6H 5JBBS 2A4QA 3LONA 4ZHAA 1AFQB 1FAXA 2BHGA 4MVNA 2VGCB 4J1YA 1QQUA 1N8OC 2FOMB 2Z3DA 3RU4D 2F9BH 1C1WH 1NESE 2G81E 2BD9A 4YOGA 3RMMH 3I78A 3SN8A 2EQNA 1EPTB 5DP9A 1ETRH 1W7XH 3A7XA 1O5AB 1QA0A 3LDXH 2BD4A 2QV1A 3MO3A 1QRZA 2BQWB 5ETXA 4O3UA 2YMSC 3Q3YA 4BAOB 1V2JT 1C5RA 2QF3A 3PB1E 5EJZA 2PKAA 3GCTG 1AHTH 3SZNA 4YO9A 2JDID 3A7TA 5DGJA 3RLWH 2C4FH 3UR9A 1O3EA 2FI4E 1ZRBA 1F92A 1OP0A 3WWBA 4BTIB 4ZROA 2ZGXH 1MABB 2ZHEH 1AGJA 2ZCLP 4GUXA 2ZDVH 5DPAA 1QBOA 4ZMAH 1UVUH 2LELA 2ZIQH 2BYAX 3KQBA 3ESTA 6CHAC 1C5XB 2OBQA 1CGIE 1S84A 4FUHA 1GVZA 5GCHG 1SBWA 1YPGH 1H1BA 4UDWH 1O5DH 3MNBA 1UO6A 3VB5A 1O3PB 1LPKB 2KAIA 3R0FA 1SI5H 1KYNA 1GBJA 3L3TA 1AE8H 2ZU4A 1EJNA 4JMYA 4FUFA 2A7HA 2SGEE 1SGRE 4KELA 2R9PA 1A3EH 3F9EA 1W0ZU 1NU7B 1MCVA 4TWWA 1ZPZA 2AHME 3OAAD 4Y0ZE 4JYUH 1ESTA 1GGDC 3P8FA 3NCLA 1YCPM 5C0TA 1SGFA 1HAZB 1XKAC 2FIRH 2XCFA 1C2KA 3A82A 2G00A 1HAOH 1NRNH 5T6FA 1O2PA 1V2RT 1E1QD 4Y11E 1GHAF 1V2ST 1LKAA 3UAIC 1MZAA 4YTAA 1G37A 1VR1H 3T28A 4K3JA 1XUGA 4AZ2B 1C2EA 2JKHA 4KTCA 1YLCA 3KQ5A 4K2YA 1YBWA 1TLDA 3P6ZB 1UK3A 3Q77A 1B5GH 1V2UT 1V6DA 2XBWA 3N99A 4ABGA 3FP8E 3TGIE 2K0QA 1GDQA 2XNDD 3VB3A 2Z9LA 2P3FH 3B23B 3O8DA 1GHXH 1SR5C 4CRDA 3PO1C 2GMTC 2HOBA 3KHVA 2RA3A 4X1NU 2PWXA 1J16A 3F0OA 1P10A 2NU1E 1GI1A 1S6LA 3K6ZA 1WBGB 1GBAA 1K1LA 2ZGHA 2BY8X 2CF9H 1QL9A 1ANBA 3ATIA 1O2OA 4AGKA 2A5AA 1SQRA 2YNBA 1G2LA 2XCNA 1YYY1 1ZSLA 5EPYA 3AAVA 4GVUA 1AUTC 1TOCB 2KFWA 2V3HH 2VIOA 1GMCF 3QDZB 5DJ7A 3GY8A 2FYQA 1EP5A 1QJ7B 1UMAH 1L1JA 3ZZ7A 1BMFD 1DDJA 4NWKA 2VIWA 1GJDB 1BMLA 1KMHB 1EAXA 1P8VC 4X1QU 2HNTE 2R0KA 4NG9H 4ACAA 5H4IB 4O03A 2W26A 4FUGA 4XFQA 4YM9A 1UTQA 3FP7E 2IPHA 1KLTA 4CBOA 3QN7A 2ZU1A 3GYLB 2ZFSA 1O33A 1WQVH 1O34A 2ZG0H 1GI3A 1QJ1B 4I33A 3F1SB 4A92A 1SQOA 4AGJA 1O39A 1PYTD 3TPIZ 4Y0YE 1HAVA 4MPVA 1K1OA 4JZDH 1EOJA 3BTKE 1J8AA 1VITF 3VFEA 1EB1H 2IPQX 1UTLM 5CHAC 4ASHA 3U69H 1CE5A 3P17H 1C2FA 2EI8A 3BEUA 3MO9A 1HCGA 7GCHG 2GTBA 1N1LA 1D9IA 2SGQE 3SUFA 8KME2 1DT2A 1BDAA 2ZQ2A 1QIXB 2FEQH 1O3LA 1SFQB 2BY5X 3LPRA 2Z9IA 2FESH 1GHAG 1YGCH 3SZEA 3DD2H 3E91A 4TWYA 1DM4B 4ACBA 1CGJE 1ZR0A 4XBBA 3SU2A 1H8IH 1BTWA 1GMDF 1DUEA 5C3NA 1XXFA 3MHWU 3RU4E 2XNIA 3N7DA 2LP6A 1LPGB 1BBRK 2NU4E 4I8GA 2WZQA 5JB8S 3RXSA 2KCPA 4K8YA 3KEEA 3SQEE 2VINA 4THNH 2PR3A 1J15A 1HFDA 5F8ZA 1J9CH 1OS8A 2AH4X 3KCGH 4DVAU 1TGBA 2VIQA 5DG6A 4D9RA 2SGPE 2OTVA 1DWBH 4FOUC 2Q6GA 5J4SA 2HPQH 5HIYA 4WWYA 3FAOA 1UK4A 3LC3A 4BAQB 2C90B 2FOAA 4D7FA 1LPZB 3VXFH 3SU6A 3CNRA 1THSH 3IWMA 1W0KD 4AB8A 2ANKH 5FBIA 3AASA 2Z3EA 2PLXA 2QN5T 1HPGA 1FN8A 1O3HA 5EIYA 1S81A 1AVGH 3QTOH 3SJIA 1GVLA 4FUJA 5EODA 2A31A 1K2I1 5E8EH 4H4FA 4CR5A 3F9GA 4KGAA 4Y71A 3A7WA 2G4TA 2D26C 2PP6A 1EB2A 4IN1A 1S85A 4IN2A 1LHDH 3KIDU 3TK9A 4O97A 1VZQH 2FWWA 2W7SA 3S0NA 1ZRKA 2XC4A 5T3HA 1O2XA 3RXEA 3GY2A 1ANCA 2GCTB 2HLCA 4OS4A 4K60A 1A46H 4DT7B 2QXGA 4PROA 1GCTB 1PJPA 4JCNA 4H6TA 1VKYA 3UOUA 1SB1H 4K8BA 1O38A 1O2QA 1YY3A 3H7OA 3GCNA 3RMLH 1HJAC 2QIQA 2G52A 2ZFQH 5GWZA 1CVWH 3LGYA 2IJD1 4Y76A 3S9CA 3M37A 3U98H 2VWNA 4ABIA 3U8OH 2G5NA 1YPKH 3PLBA 3MTYA 1SGTA 1NZQH 1ZTKA 4NSYA 3ATKA 2SNWA 4JZIA 1BCUH 4X6OA 2A1DB 1TMUH 4XBDA 2GJGA 1TPSA 1OP8A 1V2OT 2HGTH 2J98A 3P95A 1C1RA 1MQ5A 2OQUA 1CGHA 1XVMA 5AFYH 4MNYA 1IQKA 3PV2A 1NTPA 5C20A 1C2DA 3TGJE 1D4PB 2O9QA 1FNIA 2UUJB 1AIXH 3RUOA 4AYYB 1TA6A 3EAJA 3Q3KA 3E90B 4Q7YA 2RCEA 5EG4A 4AFSA 2Z94A 1C4V2 1EUFA 1IQHA 2WYGA 2J5UA 1AQ7A 8GCHF 5JPMH 1JXPA 1XUIA 3A83A 2GDDA 3UFAA 3SJOA 1A7SA 2JH0D 4WH6A 5LPFA 2BLQA 2GZ7A 1ABIH 1AVWA 3U1JB 1HDTH 2XYAA 2Q6FA 1ELBA 2AGGX 1CT0E 1S6HA 1V3XA 1P2QA 1ZSJA 3C27B 1AB9C 1EAWA 1LHFH 1P9UA 4YOIA 3QZRA 3SHCH 2P95A 2V0BA 1GI5A 3SU3A 1TGSZ 1V2PT 1S83A 4IGDA 4XRNA 1LDTT 1IHTH 1JOUB 1O3DA 4SGAE 1VCWA 2QCYA 2BOKA 5FCRA 1C1PA 4DCDA 1G32B 1ACBE 2ZKSA 4BNRA 1C1QA 1VGCC 3U8TH 1SGFG 4WF8A 2XWAA 4O3TA 1P03A 1P2IA 1V2NT 4JZFH 2Y6TA 2FTMA 3P8GA 3I29A 5A0BA 4H6SB 1S82A 5KGOA 1L0ZA 1YWUA 1P11E 3ITIA 3SO3A 1ZPCA 3FANA 4RKJB 3ZZ6A 1C5QA 1SLXB 2NWNA 2BM2A 4ZXXH 1EZXC 1DSTA 1GBEA 2FI5E 2RDLA 2BD5A 4Z0KA 4ZKSU 3A85A 1O31A 3T26A 3DSGA 2CJIA 1MBMA 1FUJA 1UTKA 2AMPA 2VIPA 3PWBA 4I8JA 2FPZA 3TITA 1NROH 1NPMA 3SNEA 3GISB 4RSPA 1G2MA 3M3TA 1TB6H 1O3BA 3MH7A 2AYWA 1AFEH 4JYVH 4JZEH 1ZGVA 2Y81A 1AE5A 4HI3A 1NN6A 3S69A 1SFIA 1C5NH 5T6DA 1O2YA 3QGNB 1ELCA 2ZFFH 6GCHF 1Y8TA 1MBQA 1TFXA 4NIVA 2L74A 1A0JA 1F5LA 1L1NA 3RXJA 5DSFA 1MUEB 1LHCH 1T4VH 5DO4H 2ZDAH 3KQDA 8GCHG 5DK1A 2H5DA 1EFRD 3BN9A 1RXPA 1Y3WA 2WHXA 1S0QA 3GCHC 3GYMA 4MPXA 1FMGA 3PRDA 5EU8A 2ZI2H 3M36A 1AZZA 2Y80A 2BDCA 2R3YA 2FTLE 1SGEE 2QAAA 4FU8A 2Z9JA 2P3UB 5CE1A 2ZDLA 4D76A 1LKBA 2PKAB 3BTQE 2F43B 1MQ6A 1YPEH 3PV5A 2OC7A 1AD8H 1ZHMA 3T27A 2A4RA 2C8ZB 4P00A 2BD3A 3L33A 4RN6A 2BTCE 2BY6X 3M35A 1C5UA 2XBVA 2AFQB 1TONA 4Q63A 1GJAB 3TIUA 1K0HA 3QO6A 3SU1A 3NXPA 1O0DH 3RXHA 2JJ2D 3W94A 1ANDA 3F2GA 1HNEE 1COWD 5HYOA 3QX5H 1UK2A 1BRBE 1ZTLA 3RXPA 2PGQB 4I8LA 2Q1JA 3A86A 2HRVA 2PW8H 3M7QA 1ARCA 3E0NB 1QR3E 1A5HA 2JJ1D 5HIZA 2BZ6H 3A88A 1V2KT 2Z3CA 1G3BA 2F83A 1O2SA 1C5TA 1O2GH 3RMOH 2B7DH 2P3TB 3OSYA 1AY6H 1P06A 1GG6C 2V6NA 2Z6BD 3MU0A 3T2NA 2G5VA 5TCAA 3MI4A 1OWJA 3PMHB 1C1UH 5EJ1A 2FXRA 1O32A 3VGCC 1DLKB 1E1RD 3A8DA 3ATLA 4Q80A 4X2WA 5DKMA 5EJLA 1C2HA 1EKBB 1L4DA 4KTSA 3S9BA 1BOQA 1MKWH 3Q3XA 3FP6E 2ZWLH 3ZZCA 2H1UA 2G55A 3T5FH 5I25A 1GHZA 2WINI 1SGQE 4WMEA 1FN6A 3PYHA 5I46H 2F9PA 4ISHH 7LPRA 5EW1H 2A32A 1MTNB 3D49H 3BTGE 1CBWB 4NIXA 1BBRE 1RS0A 1O3AA 2EA3A 1P12E 2PSYA 3R3GB 3ZV8A 1TNJA 2XTTB 5B6OA 1T31A 1NRRH 2VNTA 3KYGA 4NSVA 5EXNA 1GBFA 4XSKU 3EQ0H 1VITH 4TY6A 1RIWB 5TCCA 1FV9A 3MU5A 1AI8H 1P2OA 2H9EH 1ZYOA 4NA7A 4IMZA 1QURH 6LPRA 1EQ9A 1LHEH 1P3EA 1NBMD 1WCZA 4A1TA 3BF6H 4TPYA 1TQ0B 2F4LA 2FX4A 1HAXB 1AB9B 1KDQA 4D9QA 1MKXH 1RTLA 1D3PB 2H6MA 5FHTA 3LT3A 2W7UA 1FJSA 2PGBB 4AFQA 2R0LA 1LO6A 2BD8A 5L30H 3M7TA 4B6FA 1GJ8B 2ESTE 3LGUA 2TRMA 3ZVEA 1Q3XA 5CMXH 1MH0A 1F5RA 1KXCA 1P04A 1RTKA 1GBHA 1AWFH 4ABFA 1O2IA 1O5BB 4AC9A 1TOMH 2PTCE 3MO6A 5EQRA 3AW0A 4FU9A 3HATH 3M61U 1MTSA 3LGTA 2AS9A 1WYKA 3VB4A 3M5OA 4AN7A 2QY0B 4SGBE 1ZOMA 3ZIAD 2PV9B 1HJ8A 2EY4C 2ZPQA 1XXDA 1HAVB 2ZDKA 1PQ8A 3A84A 4IS5A 1BTZA 5IDKA 3RC4A 1NO9H 1YPHE 1W8BH 1XKBC 1KY9A 5T1VA 4AORA 2ZPRA 3MWIU 1BA8B 1H8ED 4HGCA 2F9OA 1BHXF 2AEIH 1OHHD 2FLRH 5EW2H 3GY3A 2A2XH 1A61H 3BTEE 2TGTA 1C2JA 3RXQA 3MNCA 4OS6A 1O36A 4BAHB 1ELTA 1O3OA 4BTUB 5CHBA 1MTVA 3PLKA 2C8YB 3FZZA 5C0UA 6ESTA 4UD9H 2HLDD 2CV3A 4KTUA 3BG4B 1LVBA 1Q31A 5E0GA 2FDAA 4TYDA 1A0LA 1KXAA 5A8YA 3RXVA 2L6OA 1UTPA 4X6NA 3M5LA 1B0EA 1D3QB 5DN6D 2JIZD 4FVDA 4Z1MD 3UY9A 3STJA 1W11U 2CF8H 1HB0B 1C5VA 4FUBA 1AVXA 5EXMA 3VG8A 4RT1A 4DIHH 4MNXA 1QZ8A 1HBTH 3U1IB 2HNTF 1ANEA 2SFAA 3GCHB 3SYJA 4ABDA 1C5ZB 2H9TH 1QL8A 1O3GA 3DA9B 1KLIH 3RXUA 1AU8A 2WUCA 1FY8E 3TK6A 1GBIA 1OP2A 1HAPH 2D2DA 2JETB 3VEQB 1Z1JA 1DE7H 1SOTA 5JBAS 3BTDE 3FZDA 4LK4A 2GX4A 5A8ZA 1E79D 2ZGBH 4KP0A 1FQ3A 1IOEA 4K5ZA 3SV2H 3OX7U 2ZA5A 3NK8A 2OCVB 1EAUA 2TGPZ 1ESAA 4ZAEA 2HNTC 3ODDA 1N6YA 4OGXA 1LCYA 3S7KB 1TX8A 4XD7D 3RXOA 2FP7B 5HXFA 1EOLA 4WJG2 3I77A 3QWCH 1FI8A 1Z6EA 4KKDA 5A09A 3TNTA 1S5SA 3ZZ8A 4Q2KA 3ZYDA 3DFLA 4X2YA 5DP3A 2FS8A 4CHAC 3HGPA 4OS7A 1LVMA 3K6YA 5IYTA 2YNAA 2BY7X 1PPBH 4WMDA 3PV4A 3EE0B 3GY4A 2FO9A 1UTMA 1W0YH 1O2VA 1GL1A 4JK5A 2ZNKH 3OFND 5K0HA 1FPCH 2GT7A 2SNVA 1F0RA 3HGNA 2W3IA 1SQTA 1GMHF 2AGIX 4MDSA 3EA9A 2ZDNA 2PKSC 1S6FA 4INHA 1EJAA 4X2VA 4ISIH 4BANB 1TE0A 3MH6A 1KSNA 1H8DH 5HGGA 1T8MA 1RD3B 2J98B 1ZGIA 1PPZA 2ZTXA 4U30A 1TRNA 1V2TT 4NIWA 1WDIA 2VIVA 1TPPA 3E16B 1GHYH 1SLUB 3RXRA 4UFFH 3OU0A 1JRSA 2D8WA 1EP6A 2RA0A 1RJXB 2YOLA 2WV9A 4IC6A 1C1MA 1ZMLA 2WPIS 1GBTA 3LH1A 4A7IB 1YM0A 2WPHS 2LNCA 2P8OC 4WVPE 1TGTA 1TMTH 1D6RA 1N8OB 1W0JD 1GDUA 3UREA 5FBEA 3SV7A 4AYVB 4HTCH 2P93A 1ELDE 2FOHA 5GIBA 3UNQA 2FS9A 4GAWA 4AOQA 1RRKA 2Y5GA 1TGCA 3TH4H 3V0XA 4DY7B 1AZ8A 1L1GA 2YMSB 3TGKE 2BDIA 4GCHF 1IAUA 3LOXA 4CH2B 2W6ID 2CHAC 3S9AA 3M3VA 1AKSA 1O3IA 1F2SE 2ODYB 2O8MA 1GMCG 3ZZ9A 2FOCA 1LQEA 5JB9S 3URCA 2OXSA 2OK5A 1P01A 3PTNA 3EA8A 5DP8A 5HMAA 1C4U2 5GJ4B 2QXJA 4ISOA 3SGAE 1O5EH 2BDBA 4ZXYH 3DCLA 1UHBA 1UVPA 3KN2A 4XBCA 1BTYA 2PSXA 2ZZUH 1JIRA 1K1PA 2AIQA 3OEHD 6CHAB 1D3DB 3UWJH 2SGDE 3FO8D 3UQOA 1IQGA 4BXSA 1B0FA 3GDSA 2BX3A 3QGJA 4INLA 2NU2E 2BVRH 5AVDA 2THFB 2BDHA 1T8OA 2VJ1A 5LH8A 1LHGH 1THRH 1O5GH 1BZXE 1MZDA 1DFPA 1VITG 3IITA 1ETSH 2F9VA 1GJCB 3O8RA 2FX6A 1GHBF 2K1QA 1XUFA 1J17T 3VB7A 4GPGA 2NU3E 1DOJA 4GHTA 1A5IA 1GVKB 2Y7ZA 2GZ9A 2KR7A 2O8TA 3STIA 1HV7A 5SGAE 1DWDH 1FAKH 9LPRA 1GGDB 1EXFA 3SW2B 2FOBA 1TAWA 1DY9A 2A45B 2SGFE 1CT4E 4Y10E 1CHGA 4Q7XA 4I86A 5BRRE 2FOFA 1C5PA 2H2ZA 4Y7BA 1YF4A 1C5MD 1GMDG 1ZHRA 5JDUB 1VJ9U 1HJ9A 2LPRA 1UVTH 1TNGA 4IBLH 2ZCHP 3KL6A 3PRBA 3A8CA 1RFNA 4ZKOU 1Z8JB 2J9NA 1OKXA 2JH6D 4Y8ZA 1IHSH 1BHXB 1F0UA 1VJAU 2VU8E 1Z8IB 4H42U 5FAHA 3MU4A 3RM0H 1CO7E 2UWLA 1ZZZA 4X2XA 4JZ1A 5A0CA 1ABJH 1ESBA 2O8UA 2UWOA 5ESTE 3RXCA 3L6PA 1XUJA 1KXBA 3UUZA 3ZVBA 1HYLA 2ZQ1A 1CA0C 1O2JA 3MH5A 3SV6A 3PO1B 2GMTB 3BTME 3A89A 4IC5A 1WUNH 2A5KA 4GCHG 2ZP0H 3U28C 5FXLA 3C1KA 3HK3B 4O9VA 3SBKA 1P2KA 1GJ5H 3OY5U 1GBKA 2BZAA 1Q2WA 1Y5AT 3KQCA 2AIPA 3N7OA 1HAHH 3SJKA 1PPCE 4Y79A 1AFQC 3AW1A 3OE7D 2VGCC 3OY6U 1IQJA 4CBNA 4OS5A 3LJOA 1FX0B 1MTWA 1SSXA 1PYTC 1HIAA 4WXVA 4U2WA 3QUMP 2ZGJA 5A2MH 3TH3H 4BTTB 1QA7A 4ABJA 3NZIA 3SU5A 2UUFB 3A7YA 1GBLA 4I8KA 4Q7ZA 4RKOB 8ESTE 4MQAA 3TK5A 4B76A 4DJZB 4X1PU 4HG6A 1UW7A 4CHAB 4E7RG 1GI6A 2OD3B 1C9TA 2XWBI 2F3CE 3OEED 3RC5A 1HLTH 1TALA 2SGAA 3SJ8A 2PTNA 1PPHE 4VGCC 1LQDB 1AWHB 1O5CB 1V2LT 1ELAA 2A7JA 1CHOF 2V7QD 2XBXA 3P92A 2YMSD 1TNLA 1JBUH 5CHAB 1F0TA 1OPHB 2J92A 2ZFPH 5C1UA 1KXDA 3K65B 3Q76A 1CSOE 4Z6AH 3F2FA 1Z71A 2ANYA 3TJOA 2FI3E 2ZU5A 3DT0H 3OTJE 1AUJA 4FETA 1K1JA 3MFJA 5DP6A 5LGOA 1UVSH 2NU0E 4K1EA 1OYQA 4ZKRU 1BMNH 1MKWK 3OTPA 3CP7A 4Y8XA 1O2RA 1T8LA 2GCHF 1ZLRA 2VWLA 5IK2D 1GBCA 2GKVE 1FXYA 4J2YB 2STAE 3RP2A 1YCPH 2BQ6B 4I32A 3RXIA 4XDEA 3GDVA 2PFEA 1OWEA 2OQ5A 3S7HB 2J34A 4GLYA 1TNKA 1OX1A 1O2NA 2ALVA 2ZHWH 1Y59T 1PFXC 2A4GA 1AMHA 1ZSKA 4B73A 3MQKC 2ASUB 2XBYA 1YLNA 4WH8A 1GJ9B 2FMJA 5C94A 3TVJB 3NUMA 2WPMS 3V13A 4LZ4B 1QJ6B 3H5CB 1P3CA 1QQ4A 1TPOA 1V2WT 1NFUA 3NKKA 1K1MA 2OC0A 3B8JA 2ZECA 1QB1A 4CRAA 1GJ4H 1SVPA 7KMEH 1FONA 1FY3A 2DE9A 1KDQB 1YKTA 1Z1IA 4AFUA 3RXAA 3FN8A 1MKXK 4E05H 4CREA 2EC9H 1QB9A 3PMJA 2FM2A 2B9LA
chains in the Genus database with same CATH topology
1C5LH 2VVUA 4INKA 3W95A 2ZU2A 1K1IA 4I8HA 2M5TA 2OC1A 1LMWB 3SQHE 2GP9B 5EXLA 3SHAH 1PQAA 4GHQA 1D6WA 1K28D 2AMQA 1NFWA 4ABEA 1DX5M 2A4OA 4NFEA 1T4UH 4MNWA 3BEFB 1C2LA 3HKIB 2QYIA 3K9XB 1W3CA 5F6MA 2J94A 3GCTF 4D7GA 4NGAH 3RXGA 2BOHB 3ZZ4A 1HJAB 1P09A 3VXEH 5L2ZH 1QCPA 5TJXA 4QT8C 2KAIB 3UWIA 1C1VH 1TYNA 4WXIA 3TNSA 1HXFH 5J4QA 4X8SH 4E7NA 1RTFB 2HPPH 1NT1A 1ZPBA 5GPIB 4DGJA 3EA7A 1GL0E 1DVAH 5GCHF 1SL3A 1MAYA 1Y3YA 3O8CA 2OUAA 1IQFA 3KF2A 4ISNA 4NCYA 2CN0H 1PPGE 4IW4E 1UCYH 1GI8B 3DFJA 1GCDA 3SJ9A 6GCHG 2H5CA 1FY5A 2XC0A 3GY5A 2ZTYA 1GBBA 3KNXA 3MYWA 1O3KA 2P94A 2CMYA 2WPKS 1FDPA 2BB4A 1SGDE 1XM1A 1GI0A 1FPHH 1MU6B 3SUGA 1C1TA 1ZJKA 4YLUA 1CU1A 3PMAB 1EAIA 2FOEA 2BDYA 1CA0B 3ELAH 4X8UH 1TBRH 1AN1E 1ZMNA 2UWPA 2ZTZA 4MPUA 3ZZ3A 4CRBA 3ZZBA 3H7TA 2BXTH 1HUTH 1K1NA 4U01A 2J4IA 3TJUA 3F68H 4DOQA 1SC8U 2A2QH 4YT7H 1O2LA 1P02A 2R2WU 3A8AA 1WQSA 1WSSH 1C5YB 1Z6JH 1TBQH 2ZCKP 4ABBA 1C5SA 1LTOA 1HAIH 2OINA 3RMNH 4FUEA 3UTUH 1F0SA 2BD2A 4FUIA 1O2WA 3TU7H 1SLWB 2WPLS 1CQQA 1Z8RA 1BIOA 1C2MA 2GDEH 5C67A 2EEKA 1Y3VA 2W5EA 5K7RA 2A5IA 1VGCB 4OS1A 2BY9X 1P57B 1Y5UT 1KXFA 3D62A 1BJVA 2EI7A 2OP9A 3QLPH 1XUHA 4CRFA 1YPHC 5FX6A 1O2MA 4ZKNU 3QTVH 4VGCB 2ALPA 1WOFA 1DSUA 4X8TH 2J38A 2AGEX 3A8BA 4A6LA 1JMOH 2GGVB 2IJOB 1ZMJA 3ZV9A 3SUEA 2F9NA 1NM6A 5EPNA 3UNSA 1Z8GA 3SU4A 2GCTC 1QFKH 2O8LA 1DY8A 2BD7A 3F6UH 1DWEH 5FPYA 5C5NA 3FVFB 4R0IA 1TX6A 1GCTC 2CXVA 3ENSB 2ZHDA 1BMMH 1ELEE 3TH2H 3ZVAA 1MCTA 1NS3A 3PWCA 3RLYH 4X8VH 2B8OH 4ISLA 3RDZA 4E06H 1BRUP 1G3DA 1ELVA 1UTNA 2GV6A 1NU9A 3DHKH 2BVXH 3SNDA 4A1XA 1DPOA 1K22H 3SNAA 3E6PH 3V3MA 3LKWA 4IMQA 2Y5HA 7GCHF 1W2KH 4NFFA 1XX9A 1BMAA 1DXWA 1MMJN 1S0RA 2WV5A 2Y7XA 1SGYE 1FY1A 3E3TA 1XUKA 2VB0A 2Z7FE 1E36B 1P0SH 2AMDA 3LJJA 4ZH8A 1ZJDA 2OBOA 2PHBA 1YPLH 1OXGA 2FOGA 1PPFE 1QY6A 3PTBA 4AX9H 4A5TS 4YOJA 3BTHE 1AKSB 4B74A 2A7CA 3RC6A 1TRYA 1EASA 1EJMA 1G3EA 1EPTA 1SGCA 1PPEE 3RXMA 4XOJA 5EGMA 5FPSA 2ODQA 4MG3A 2WPJS 2IOTA 1UHBB 1QHRB 1GI7B 5FX5A 3OYPA 3ZVCA 2F91A 4CR9A 1GJ6A 2BLWA 2P16A 3UNRA 4B71A 1DITH 5LPEA 4F4OC 2BLOA 4YZUA 1KIGH 2FLBH 3P8NA 1RGQA 4UE7H 3EGKH 1K9OE 2I6QA 3TLOA 2AERH 4NZLA 2V35A 1TQ7B 1SGIB 1TX7A 3ODFA 3T62A 3A7ZA 5HM2A 2C3SA 2W3KA 3EYDA 3UOPA 1H9IE 2XRCA 1IQNA 1F7ZA 3T25A 1NRPH 3LGIA 2B5TB 4B2CA 2ILNA 1NY22 4ZHMU 3SI4H 3KQEA 1GG6B 3GDUA 4X1SU 4BAKB 2GD4B 3B9FH 5L6NH 3UQVA 3RXTA 2GZ8A 1GI4A 1H9HE 3GY6A 1P2MA 3A7VA 3VGCB 3SU0A 4NA9H 1QL7A 3BIUH 1KTTB 1UJ1A 1C5WB 3SNBA 4AG1A 3VPKA 4B2AA 5ABWA 1GWAA 1QBNA 2TPIZ 1MAXA 1QRWA 5AFZH 1E0FD 2CGAA 4X6PA 2BQ7B 4X0WU 1SGNE 2TGAA 1UCYE 2BMGB 4I31A 5DP4A 2BDAA 3F9FA 3BV9B 2P59A 1BITA 1BJUA 1ORFA 2UUYA 1FIWA 2ZU3A 1L2EA 1OYTH 1A0HB 2BXUH 3CENA 3HPTB 1GPZA 3TJNA 1A2CH 2DUCA 1MD8A 3SV8A 1C1NA 2DE8A 2ZF0H 3RXFA 1YPMH 4NA8A 1AO5A 1QBVH 3LGWA 3QZQA 1BTPA 1V2QT 1HAYB 4UONA 3QK1A 3D23A 1EATA 1ZTJA 3ZYEA 4AB9A 4FU7A 1TBZH 1G3CA 3RXBA 2R2MB 3T29A 2UUKB 2H9HA 4AG2A 1GI2A 3NWUA 5C1XA 2O8WA 1D3TB 1O2UA 1BRAA 7ESTE 4MTBA 2ZHFH 3UIRA 2QXHA 1HIAB 3M7UA 2A0QB 1ARBA 1TA2A 1QRXA 1V2MT 1GDNA 1QTFA 1MTUA 2J95A 3A87A 2TIOA 1Y3UA 9ESTA 2FZZA 2G8TA 2ZO3H 4UFGH 3UR6A 5DP5A 2Y5FA 2JH5D 2XC5A 2VH0A 1KXEA 1KTSB 1H9LB 3PM3A 1NFXA 3SGQE 2QGRA 5A8XA 1BRCE 3GY7A 1TGNA 4CH8B 1K21H 1GBDA 1UVOA 4XE4A 1GMHG 1XMNB 3K2UA 3JZ1B 3MU8A 4UFEH 5F03A 2G51A 1O35A 1SG8B 5F8XA 3ZVGA 4WMFA 2BDGA 1Y5BT 2FYRA 2ZDMA 4ABHA 1O37A 1JRTA 4WY3A 2WYJA 3M5MA 1T7CA 1PQ5A 4TY7A 1HXEH 1SMFE 2BVSH 2WUBA 5L2YH 8LPRA 2ZPSA 1O3FA 5JBCS 1Y3XA 5E2PA 1GJ7B 5HM9A 4LXBH 1X7AC 1G36A 1G9IE 1O2TA 3RXLA 1YP9A 2QA9E 1TRMA 3LU9B 1HGTH 1GI9B 1A1RA 4BOHA 5DP7A 3A81A 1P05A 1P2NA 1O3JA 2TGDA 1TNIA 1O3NA 1TPAE 1W12U 5EOKA 4CRCA 1BTUA 1OWIA 4JK6A 1L4ZA 4I7YH 1YCPK 4B2BA 3MU1A 1QB6A 1FZZA 2PUXB 5LPRA 1GBMA 4FVBA 3SI3H 3ZZDA 4D8NA 4ZUHA 1NRQH 1C5OH 3F9HA 3O8BA 1W14U 5GDSH 1BBRH 4FXGH 4X1RU 3Q00A 5EQQA 2Z9GA 1BT7A 3BEIB 4YESB 1A4WH 4Y7AA 4DIIH 1MTNC 1OOKB 1LVOA 4MNVA 1CBWC 5FPTA 2VWOA 4K1TA 1IQMA 5GXPA 2BX4A 4NIYA 3CS7A 1EX3A 1TABE 4JYTA 3RU4T 1FLEE 1GHWH 2ZFTA 1WV7H 1EPTC 4BXWA 5C2ZA 5A0AE 2GV7A 1NC6A 3BTWE 4CRGA 1N6XA 1T32A 3E0PB 1RIWC 4HFPB 1O3CA 3GICB 1INCA 2FODA 4DG4A 3BIVH 5AHGH 3NPSA 2ZEBA 1C2IA 1DUAA 2VIDA 3PLPA 4OGYA 3LC5A 1B7XB 4MLFB 3BTFE 3ATMA 3BTTE 3SV9A 1C1SA 3JZ2B 1GHVH 1YPJH 5C5OA 3SNCA 2XXLA 1GHBG 2C93B 3G01A 4M7GA 1W10U 3GCOA 2F9UA 3ZZAA 3VB6A 5JYIA 2G4UA 3UPEA 1DICA 4DURA 1SPJA 1P9SA 3V12A 2PKSB 1SOZA 1O2KA 3SOSA 3PROA 3URDA 5G4BA 2R3UA 2EI6A 4UFDH 2GVFA 1WTGH 2ULLA 1CT2E 1BB0B 2Q6DA 1KLJH 1UCYK 2ANWA 1O2HA 3P8OA 1OWHA 1SGPE 5E0JA 3U9AH 4NZQA 3ZVFA 4LZ1H 2P8OB 4B1TA 2HWLB 1LVYA 1H4WA 1IQEA 3A80A 3MMGA 5AF9H 2C8WB 2QF0A 3SUDA 1UTJA 1DS2E 1NFYA 1P2JA 4ZHLU 3P70B 1W7GH 4NWLA 3BG4C 4DW2U 5EQSA 4OS2A 1E37B 1CA8B 1O5FH 2HVXA 1SHYA 3MH4A 1ELGA 1YLDA 2GT8A 2CHAB 2V3OH 5ESBA 4YLQH 3EDXB 1C1OA 1NRSH 1C4Y2 3PMBB 3E8LA 1WAYB 3E1XB 5T6GA 1DANH 3WY8A 4LOYH 1DXPA 4X6MA 2STBE 1GJBB 1T8NA 2OLGA 1QGFA 2ZGCA 1ID5H 3M5NA 1U6QA 1E35B 1OSSA 4ESTE 3GOVB 3LH3A 3RXKA 1EZUC 3AVZA 4Y8YA 5C1YA 1M9UA 1BTXA 4R8TB 1DWCH 2JETC 1QNJA 1THPB 1TIOA 3MNSA 1WTHD 1BUIA 1OWDA 2HALA 3HKJB 3SGBE 2WV4A 3SORA 4AFZA 4K1SA 2ZHQH 2QC2A 1ELFA 3KGPA 1O2ZA 1MD7A 1PQ7A 1TMBH 1W13U 2VVVA 4FUCA 1CHOG 3CS0A 1Z7KA 1FIZA 1E38B 2D1JA 1A5GH 1FY4A 1F5KU 1E34B 1YC0A 2PUQH 4FUDA 4U32A 1BTHH 3ATWA 1EZQA 1TNHA 3DUXH 3ZVDA 1SQAA 2VVCA 5F8TA 3U8RH 3BG8A 2C8XB 1DLEA 1EZSC 1OWKA 1V2VT 1UTOA 4TPIZ 1SLVB 3FFGA 1MU8B 1J14A 3LIWA 1IQIA 1C9PA 4MPWA 3MOCA 3TJVA 2GCHG 1A3BH 2ZFRH 1WU1A 1VCPA 5JBTA 2RG3A 5PTPA 2ANMH 2QXIA 5BPEA 2Y82A 3D65E 2ODPA 3AAUA 3LGVA 3MNXA 2B0FA 1JIMA 1HAGE 3IG6B 3V7TA 1SHHB 2I6SA 1HRTH 1C2GA 4B75A 2IN2A 3BSQA 2OC8A 2VH6A 4ABAA 3RM2H 2XW9A 1IQLA 1O30A 1BQYA 1ETTH 5E0HA 4A1VA 4K69A 1ZHPA 2TBSA 3RXDA 3ZZ5A 1G30B 4UEHH 2ZC9H 1TWXB 2J2UA 2VWMA 1XVOA 5E2OA 2Z9KA 4HZHA 2BLVA 5FCKA 1VCQA 1O3MA 4F49A 4GSOA 3HK6B 3M3SA 1JWTA 4BAMB 4Y6DA 4YT6H 5JBBS 2A4QA 3LONA 4ZHAA 1AFQB 1FAXA 2BHGA 4MVNA 2VGCB 4J1YA 1QQUA 1N8OC 2FOMB 2Z3DA 3RU4D 2F9BH 1C1WH 1NESE 2G81E 2BD9A 4YOGA 3RMMH 3I78A 3SN8A 1EPTB 5DP9A 1ETRH 1W7XH 3A7XA 1O5AB 1QA0A 3LDXH 2BD4A 2QV1A 3MO3A 1QRZA 2BQWB 5ETXA 4O3UA 3Q3YA 4BAOB 1V2JT 1C5RA 2QF3A 3PB1E 2PKAA 3GCTG 1AHTH 3SZNA 4YO9A 3A7TA 5DGJA 3RLWH 2C4FH 3UR9A 1O3EA 2FI4E 1ZRBA 1F92A 1OP0A 4BTIB 4ZROA 2ZGXH 2ZHEH 1AGJA 2ZCLP 4GUXA 2ZDVH 5DPAA 1QBOA 4ZMAH 1UVUH 2ZIQH 2BYAX 3KQBA 3ESTA 6CHAC 1C5XB 2OBQA 1CGIE 1S84A 4FUHA 1GVZA 5GCHG 1SBWA 1YPGH 1H1BA 4UDWH 1O5DH 3MNBA 1UO6A 3VB5A 1O3PB 1LPKB 2KAIA 3R0FA 1SI5H 1KYNA 1GBJA 3L3TA 1AE8H 2ZU4A 1EJNA 4JMYA 4FUFA 2A7HA 2SGEE 1SGRE 4KELA 2R9PA 1A3EH 3F9EA 1W0ZU 1NU7B 1MCVA 4TWWA 1ZPZA 4Y0ZE 4JYUH 1ESTA 1GGDC 3P8FA 3NCLA 1YCPM 1SGFA 1HAZB 1XKAC 2FIRH 2XCFA 1C2KA 3A82A 2G00A 1HAOH 1NRNH 5T6FA 1O2PA 1V2RT 4Y11E 1GHAF 1V2ST 1LKAA 1MZAA 4YTAA 1G37A 1VR1H 3T28A 4K3JA 1XUGA 4AZ2B 1C2EA 2JKHA 4KTCA 1YLCA 4K2YA 1YBWA 1TLDA 3P6ZB 1UK3A 3Q77A 1B5GH 1V2UT 1V6DA 2XBWA 4ABGA 3FP8E 3TGIE 1GDQA 3VB3A 2Z9LA 2P3FH 3B23B 3O8DA 1GHXH 1SR5C 4CRDA 3PO1C 2GMTC 2HOBA 3KHVA 2RA3A 4X1NU 2PWXA 1J16A 1P10A 2NU1E 1GI1A 3K6ZA 1WBGB 1GBAA 1K1LA 2ZGHA 2BY8X 2CF9H 1QL9A 1ANBA 3ATIA 1O2OA 4AGKA 2A5AA 2YNBA 1G2LA 2XCNA 1YYY1 1ZSLA 5EPYA 3AAVA 4GVUA 1AUTC 1TOCB 2V3HH 2VIOA 1GMCF 3QDZB 5DJ7A 3GY8A 2FYQA 1EP5A 1QJ7B 1UMAH 1L1JA 3ZZ7A 1DDJA 4NWKA 2VIWA 1GJDB 1BMLA 1EAXA 1P8VC 4X1QU 2HNTE 2R0KA 4NG9H 5H4IB 4O03A 2W26A 4FUGA 4XFQA 4YM9A 1UTQA 3FP7E 2IPHA 1KLTA 4CBOA 3QN7A 2ZU1A 3GYLB 2ZFSA 1O33A 1WQVH 1O34A 2ZG0H 1GI3A 1QJ1B 4I33A 3F1SB 4A92A 1SQOA 4AGJA 1O39A 1PYTD 3TPIZ 4Y0YE 1HAVA 4MPVA 1K1OA 4JZDH 1EOJA 3BTKE 1J8AA 1VITF 3VFEA 1EB1H 4ASHA 1UTLM 5CHAC 3U69H 1CE5A 3P17H 1C2FA 2EI8A 3BEUA 3MO9A 1HCGA 7GCHG 2GTBA 1N1LA 1D9IA 2SGQE 3SUFA 8KME2 1DT2A 1BDAA 2ZQ2A 1QIXB 2FEQH 1O3LA 1SFQB 2BY5X 3LPRA 2Z9IA 2FESH 1GHAG 1YGCH 3DD2H 3E91A 4TWYA 1DM4B 1CGJE 1ZR0A 4XBBA 3SU2A 1H8IH 1BTWA 1GMDF 1DUEA