2ZKSA

Structural insights into the proteolytic machinery of apoptosis-inducing granzyme m
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
231
structure length
231
Chain Sequence
IIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Granzyme M
publication title Structural basis for proteolytic specificity of the human apoptosis-inducing granzyme M
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 231
sequence length 231
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zksA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zksA02
1ID5H 2KAIB 3SNEA 4X6PA 4GPGA 2OC7A 4RSPA 1UTMA 2P95A 1J15A 1C5NH 2VVUA 3ZVAA 1C5ZB 4MPWA 4DURA 3LGTA 4CHAC 5DK1A 1SGIB 1O3MA 3KGPA 1ELEE 2PHBA 1NRPH 1Q31A 3TK5A 1WTGH 1BTXA 4AORA 1MKWK 1W11U 3M3SA 4UEHH 2UWOA 1ZTLA 1GGDC 2OP9A 4X6OA 1AFQC 4WWYA 3AAVA 2Y80A 1MZDA 1GHZA 1NS3A 4I32A 2PTCE 3RMLH 1FY1A 1UVUH 1AWHB 1LVBA 1EAIA 1P12E 2PTNA 2HWLB 3OY5U 4ASHA 1HAZB 1HNEE 1O3DA 5C20A 2OQUA 2D8WA 1AUJA 2PUXB 1W0ZU 1LVMA 3VB7A 4YTAA 2WYGA 3ZZBA 2FYRA 3URCA 3KQEA 1FQ3A 1TPSA 1A4WH 2AEIH 3UNSA 3TJVA 2ZU1A 5DP4A 2ZC9H 2NU4E 3GYMA 2CV3A 3RM0H 1LDTT 4CRDA 1ABIH 1H8DH 3SU5A 4YT6H 1A0LA 1XUIA 1SQAA 2AGEX 3QDZB 1E0FD 1CA8B 4MLFB 3LONA 1CGHA 4BANB 1DUEA 1C5WB 2FOAA 3SU1A 1EOJA 2IPHA 1RRKA 3UUZA 1BTPA 3C1KA 2HLCA 2GD4B 2NU0E 3ZZ7A 2AYWA 2BY6X 2PFEA 1FIZA 1OP8A 1T8MA 3HK6B 4ISLA 2BXUH 1TBQH 1WBGB 2QAAA 1FY3A 1A0HB 3ELAH 1RJXB 1UMAH 1ELFA 1GBMA 4NFFA 4DG4A 4E7RG 1MMJN 2VGCB 1VZQH 4F49A 4ABDA 4NCYA 1V2PT 1O34A 2GT8A 2HNTC 1SGTA 2CHAC 4XBCA 1WYKA 3TGKE 5L2YH 4CREA 3LGYA 2J4IA 1TMBH 2G5VA 2IN2A 3ZZ9A 1ETTH 1ZHRA 1C5TA 1KDQA 2Z9GA 1O35A 3KN2A 1AD8H 3BTDE 2V6NA 2G51A 1GL1A 1KIGH 1EZSC 5I46H 1NC6A 3S7HB 3E0PB 5EXNA 4GSOA 5E8EH 3SJIA 3RXEA 1UO6A 1TOCB 1TYNA 4KP0A 5ABWA 1MTVA 4AFUA 4TWWA 2QXHA 5FCRA 1ETSH 2ZFSA 2O8MA 1P3CA 1WTHD 1G32B 1T8LA 4Q7YA 1ZHPA 1SQOA 7GCHG 1O3KA 4U01A 1AE5A 2F9PA 2M5TA 4FU9A 2W7SA 3P95A 3RXIA 1IQEA 1MH0A 3A84A 4AYYB 3MYWA 3CS0A 1YBWA 1B0FA 3ZVCA 3Q3YA 2F9UA 3ZVEA 5DP7A 4XBDA 6LPRA 5CMXH 1DX5M 2G5NA 2RG3A 3F9FA 1MTWA 2BX4A 1OXGA 4X8SH 3QUMP 4BNRA 3EA9A 3GCTF 1BTYA 2EEKA 4IN2A 3JZ2B 1FXYA 1THRH 2FOEA 4XOJA 3RXPA 1IQMA 1HYLA 2RA0A 4HI3A 4IGDA 1O5EH 1WU1A 1YM0A 1EJNA 2FPZA 3V7TA 1SLWB 1XVOA 2Z3DA 4YZUA 3BTME 1GJCB 1Z71A 1EASA 2ZFFH 2A5KA 3VB5A 1EAUA 3RMMH 2A4GA 2TGTA 1KLJH 4OS4A 1TGBA 4D7GA 3EGKH 2AGGX 1INCA 5EOKA 4CH2B 1W14U 1A5HA 1AKSB 1BBRE 1TGCA 2B9LA 3LH1A 1XVMA 1D6RA 2LNCA 4YOIA 2FI5E 2C90B 4XFQA 4GHQA 4MNVA 4AB9A 3QX5H 1C2LA 4AGKA 1GBFA 5C1YA 2RDLA 3A87A 2C8ZB 3HGPA 1DXPA 1O33A 2QIQA 3MH7A 2GX4A 4OS6A 3LIWA 3A85A 4JYUH 3SJ9A 2ZEBA 2FI3E 1ARCA 2BDYA 1O2YA 1W12U 2XCNA 3VGCB 2Q1JA 2FS9A 1DM4B 4JYVH 5C3NA 4TYDA 1TX6A 4UE7H 1RFNA 1O32A 3I77A 1GI0A 1KXFA 3L6PA 5EGMA 5TCAA 4WMEA 3SUDA 2J38A 3RXUA 1GMHF 2W5EA 3QGNB 4X8UH 2LPRA 1JMOH 4QT8C 1UCYE 2QXIA 3BG4C 1ZSKA 4Y7BA 3LJOA 4LOYH 1DY9A 4X1NU 1BA8B 1E38B 1E37B 3STJA 2J92A 1A3BH 1QIXB 5AHGH 2FOGA 1NFXA 2VVVA 1TQ0B 5E0HA 2D2DA 4IS5A 2ESTE 2BLWA 1JBUH 1A61H 3BEIB 1AVGH 3O8RA 1PJPA 1P03A 1Y3XA 1BRBE 4K60A 2R2MB 5JBCS 1H1BA 2J2UA 6ESTA 5GWZA 1FIWA 3QTVH 3RU4E 3TK6A 3UREA 1TABE 1TBZH 4NWKA 3OU0A 1MZAA 1W2KH 1SL3A 1BQYA 3TGIE 3MI4A 3RXJA 5H4IB 3TLOA 1LO6A 5EW2H 2CMYA 3Q77A 1O38A 1FJSA 1LKBA 2P8OC 1BTHH 3S9CA 1MQ6A 2FEQH 1O5CB 4WXIA 1UTJA 3SOSA 4ZROA 2UUFB 1TNJA 1C2IA 3Q3XA 3RXDA 4CBNA 3A88A 1C2GA 2ZGHA 3SU0A 1ABJH 1YLCA 2PLXA 3PTBA 3LC3A 3M7UA 2UUYA 1C4Y2 1GBIA 1O3FA 3UR9A 3UWIA 1MQ5A 1XUKA 3SV9A 3M5OA 3CS7A 1S81A 5DP8A 3RXKA 5ESBA 4K1EA 3WY8A 1V2ST 1UVOA 3ATIA 3BSQA 3T26A 1FY4A 1ZTKA 4BAKB 3TJUA 4O3TA 1CGIE 2CGAA 2O8WA 1UK4A 1Z8RA 1O2MA 3U8OH 1O3JA 2P59A 3DA9B 2SFAA 2OINA 3QZQA 3N7OA 4BOHA 1JOUB 1AVXA 2XWBI 3SHAH 4DIIH 1DT2A 3UNRA 3BIVH 1GI6A 3ODDA 3SGBE 3S9AA 1G37A 3SJKA 4WMDA 1ANDA 3NK8A 4X2YA 1SQTA 5FPTA 1O5BB 2IOTA 1HAOH 1OWHA 3GY2A 3W95A 3GCTG 1NU9A 1K1OA 1ELTA 4ZMAH 1G2LA 4U32A 1EZUC 5FX6A 2VH0A 3FAOA 1A46H 1VITF 1FLEE 4ABHA 1O3NA 2GP9B 1JIRA 3QGJA 1QQ4A 4FXGH 4Y8ZA 1FPHH 2TGDA 1YPKH 3U8TH 5DP3A 1A2CH 2SGPE 3KQBA 4ZHAA 2BDAA 1AI8H 2F3CE 1F5KU 2OCVB 1V6DA 5A0BA 1YLDA 5FPSA 1CSOE 2BD8A 3UPEA 4XDEA 3ATWA 2VJ1A 3GY8A 2ZO3H 4D7FA 3H5CB 1E36B 3SNDA 4TPIZ 2UUKB 3SU6A 1CVWH 2Y81A 1Z7KA 3E91A 3ZYDA 4TY6A 1N8OC 4B1TA 2ZTYA 1YP9A 5DJ7A 3ZYEA 4X1PU 1P2JA 1O2ZA 2AMPA 2AIPA 1P2MA 1JWTA 1CHOF 1V2TT 1GJ9B 2ZHFH 3RMOH 1HPGA 1Y5BT 2XBVA 3GCHB 1ZJDA 4B75A 1V2RT 4TWYA 3URDA 1TX8A 1HJAC 1ARBA 2EI8A 2SGAA 1QJ7B 5LPRA 2R3YA 2OXSA 1D6WA 1GWAA 4CRBA 5G4BA 3ZVDA 5L2ZH 1GMCF 1TNGA 3TNSA 3A7ZA 1GMHG 1P2NA 1TNIA 4IC6A 4ISNA 1VCWA 2R3UA 2F9NA 3BTQE 4IW4E 4H6TA 4JZ1A 3FVFB 3M3VA 2F9OA 4GUXA 1YKTA 2ZGBH 3STIA 3O8CA 3OX7U 4JZIA 4O03A 1IQFA 2HNTF 2W26A 4MVNA 1C2MA 1GBJA 1G30B 5GPIB 3A8DA 2STAE 1NTPA 1TONA 2FO9A 2ZU3A 1DICA 3VXEH 2SGEE 4WMFA 3PWCA 1PQAA 1HJAB 4I7YH 4YLQH 3T5FH 1NN6A 5FAHA 4Y79A 1VJ9U 3K6ZA 1H9IE 1Q3XA 1CT2E 1W8BH 4X1QU 2ZDMA 3RC5A 3ZZCA 3SORA 5T3HA 2BY8X 1MAYA 1P11E 1TE0A 2G81E 2ZCKP 2TGPZ 2C8WB 3ZZ3A 1BB0B 3TIUA 1W0YH 1XMNB 2FOBA 1HAVA 4MQAA 4FUCA 4E7NA 1EJAA 3TITA 5AF9H 1FMGA 5BPEA 1S84A 2ANKH 2AGIX 1LKAA 1GVZA 3ATKA 1C2HA 2JH0D 1C1MA 1O3CA 1Y59T 1CQQA 1K1JA 1MTNB 2G00A 4NSYA 2ZDVH 3MU4A 3U69H 1ZOMA 2FLRH 1SGNE 3MO6A 1V3XA 5E2PA 1C2JA 2BD4A 3BF6H 2BDIA 4BTTB 6CHAB 2A4QA 1T8OA 2DE9A 2PSYA 1F0SA 1FN6A 1M9UA 3SI4H 3BTFE 1O2SA 3UIRA 3UR6A 4ISOA 2ZECA 1FY5A 3SJOA 1W7GH 3RXAA 1GCDA 4BTIB 1YPHE 2VH6A 4IC5A 3SGQE 2QF3A 3FZDA 1BRCE 1EJMA 1TWXB 1BTWA 2SNVA 2ZP0H 2HNTE 1UK2A 2YNAA 1TA6A 5LGOA 2UWLA 1RIWB 2ZI2H 4LK4A 5IYTA 2PKAA 1O3HA 1OP2A 2QCYA 1HGTH 1P2QA 2OC0A 3GY4A 1JRTA 5L6NH 3NZIA 1VITG 1KXCA 1GJ8B 4OS2A 2A2XH 1TPOA 2ALPA 5AFYH 1K1LA 1LCYA 2P3UB 1GDQA 1BHXF 7LPRA 3SN8A 3BEUA 3D65E 3DFLA 1AWFH 1TIOA 5IDKA 3BTGE 4ABFA 1O30A 2RA3A 1BIOA 1W13U 2O9QA 1QB9A 2H2ZA 3ATMA 5K0HA 4AFZA 2BLOA 1C1WH 1D4PB 1NO9H 5FXLA 2Z3EA 3H7OA 1C2FA 1PYTD 4BAMB 2G8TA 3D23A 2ZQ2A 3PB1E 4UFDH 3MU5A 1BTUA 4GAWA 2DUCA 3F6UH 4Q80A 4NIYA 4HTCH 1HJ9A 3A81A 2H6MA 1CBWC 4THNH 3PMBB 3T27A 2FODA 3RXOA 3OY6U 1UCYH 1O3EA 3EDXB 3TH3H 2VWLA 1CHOG 1BITA 2Z94A 1O3GA 1UTKA 2ZFRH 1BBRK 3QN7A 3UQOA 5B6OA 3SU2A 2BY5X 4D76A 4CHAB 4ZHLU 3K6YA 4DOQA 1V2QT 4BAQB 3PMAB 1O2NA 2B0FA 3C27B 1DWEH 1HXFH 2AFQB 1G2MA 1C1UH 1C5OH 1FAXA 3KEEA 3KF2A 4XSKU 3QTOH 4MNYA 1GGDB 1GMCG 2PGBB 1AFQB 1D9IA 1C1OA 1P0SH 2FWWA 1AIXH 3SHCH 2VU8E 3NWUA 1GJ6A 1K9OE 1LQEA 1O2LA 4UFGH 1PPBH 2BOKA 1O2HA 2HOBA 8GCHF 2TGAA 1SVPA 1P9UA 1QBVH 5J4QA 1P2IA 1ZRBA 1QRWA 2ANYA 3PLPA 3LU9B 3Q76A 1GL0E 2FOFA 3GDUA 3HATH 3VPKA 1UJ1A 1LHEH 4X6NA 1GMDF 1H4WA 2R2WU 3DHKH 1YPHC 1NT1A 4ISIH 1C4V2 1UCYK 2OLGA 2ZHEH 1LHGH 1DPOA 1HIAA 4B74A 5F03A 3B8JA 3M5NA 3S9BA 2VIOA 3KQCA 2A4OA 1IOEA 1CHGA 1HFDA 1L0ZA 1O2JA 2FX6A 2A0QB 2D26C 1O3AA 3L3TA 4RN6A 1GDNA 2OBOA 2B5TB 2GZ9A 3S0NA 2ZU4A 1YPMH 4X1RU 4H42U 1UVPA 2CF8H 1ELVA 1ZPBA 1C9TA 2SNWA 4ZAEA 2Z9KA 1QJ6B 1V2WT 4ZUHA 2W7UA 1LPGB 1ELGA 1PPCE 5TJXA 5JB9S 1NRNH 1PPZA 3F9GA 1P01A 3MNXA 4OS7A 1HUTH 3MMGA 4J1YA 1GPZA 1J14A 2F9VA 1WCZA 4AZ2B 3RXCA 3TU7H 2QGRA 2BDCA 2ZDLA 4E06H 1W7XH 2EC9H 1QFKH 4JZEH 1KYNA 1V2OT 1P04A 1OWKA 2CHAB 2TBSA 3E8LA 2C8XB 4AG2A 1QJ1B 2A45B 1C2KA 1RS0A 2VINA 1FPCH 3T28A 4NFEA 1SLXB 4B73A 4VGCC 1ESAA 1K1MA 4MDSA 4NSVA 1GHBF 1W10U 3MH6A 6GCHG 2ZU5A 4WXVA 2B7DH 3ODFA 1O2VA 1TMTH 4UDWH 3GYLB 3TVJB 1OS8A 1GBAA 2ZHDA 1EUFA 4LZ4B 3S7KB 2OUAA 4KKDA 2ANMH 3SW2B 1KDQB 3V12A 1PQ8A 3IWMA 1V2MT 1HAPH 1Z6JH 4MPUA 1AB9C 2R9PA 1LMWB 5F8ZA 1MBQA 1DY8A 1DWDH 2H9TH 1C1RA 5HMAA 1BMNH 2ALVA 1NM6A 3RLWH 2BD2A 3PLBA 1Z8JB 1ZPCA 4UFEH 1GBLA 4CRAA 2P3FH 1LHFH 2HPQH 3LGVA 5SGAE 3SUEA 4FVBA 2ZPQA 1MBMA 4UD9H 1GI2A 1QGFA 4I8HA 3HKIB 4VGCB 3PTNA 4K8YA 4AB8A 1OYTH 4Y0ZE 2AIQA 2BM2A 2Y6TA 1AU8A 4LXBH 4U30A 5L30H 2GMTC 4ABIA 1S82A 2WUBA 3AAUA 2XXLA 1ETRH 2EI7A 4J2YB 3GISB 1P2KA 1V2UT 1FAKH 1PFXC 1IHSH 1V2LT 1C1NA 1MCVA 3B23B 2ODPA 1RD3B 3GY6A 3F9HA 4WH6A 4YT7H 1L4DA 1AB9B 1Y3WA 3TGJE 2HGTH 3T25A 1VITH 1F2SE 4LZ1H 1YCPH 2QA9E 2ZFPH 3A7YA 3BIUH 1O2IA 1TGTA 1AN1E 4ZXXH 1H9HE 1GBTA 3SUGA 1D3TB 3PMHB 1MAXA 1QR3E 4KELA 2PGQB 1HV7A 2NU3E 1ZSLA 2ZWLH 3RM2H 1GVLA 3PM3A 5C2ZA 1OWDA 1BUIA 3FFGA 5GCHF 1GBBA 3E1XB 3A8CA 1FN8A 5AFZH 3LKWA 1Y3YA 3FP8E 3SV6A 1A3EH 1P06A 3IITA 3MFJA 2W3IA 2B8OH 8GCHG 2XC5A 1T4VH 2YNBA 1BMMH 5T6GA 3B9FH 3M37A 2F91A 1HCGA 2XC4A 3TK9A 5CHAC 4JMYA 1T7CA 5TCCA 4FUGA 3UNQA 1GMDG 2ZHQH 1C9PA 4R0IA 3RXMA 3A86A 2V0BA 1T4UH 3QO6A 1EP6A 2GZ8A 2GVFA 4CH8B 5DPAA 1WUNH 1O3IA 1YC0A 1YCPK 2JETC 4MNXA 1O2XA 1S0QA 1O2GH 2J95A 3DFJA 1VGCC 1JXPA 1LTOA 1PQ7A 3BG4B 1MCTA 3V0XA 1SHYA 1K2I1 1ACBE 2BVRH 1IQJA 1EB2A 4AFSA 1EPTA 2R0KA 1S6HA 4K1TA 1F7ZA 4Y8YA 1J8AA 1HDTH 9LPRA 3EYDA 1C5UA 1DE7H 1FV9A 2XW9A 1NU7B 1EPTC 2Z6BD 3MNCA 1WAYB 1G3CA 3MHWU 5FX5A 3FP6E 3SGAE 1QURH 2PKSC 3U98H 1C1TA 1L1JA 3EE0B 1VR1H 4K69A 3ATLA 4DT7B 1G3BA 2FESH 3M3TA 4D8NA 2C4FH 3K2UA 2P8OB 1DDJA 2OQ5A 3BTEE 3E3TA 2BX3A 1HXEH 2BXTH 2ZTZA 5JBAS 5E2OA 1GHWH 4GHTA 3VXFH 1GHBG 1DLEA 3NCLA 2ZGXH 5EPNA 4UONA 1WOFA 2ZFTA 3QK1A 1GG6C 2WINI 1XKBC 3F1SB 3GY7A 3EAJA 9ESTA 2NWNA 3MH4A 1MTSA 1K1NA 3KHVA 1ELAA 2H5CA 4OS5A 3TJOA 3ZVFA 1SGYE 3VEQB 5EQSA 4ABBA 1BZXE 3P70B 2FLBH 2Z9LA 2H9HA 3AVZA 4IMZA 2XRCA 2O8LA 1LPZB 1NRRH 4NZLA 1OWEA 4IBLH 2ZPSA 2GDEH 1SI5H 5EQQA 1ZRKA 2Y7XA 1NESE 1Z8IB 3M61U 4SGAE 1DXWA 4WH8A 5EODA 1YPGH 5FHTA 2BQ7B 2Y5GA 1QA0A 2OC8A 2AS9A 1EB1H 2QY0B 2QXJA 3HGNA 2GDDA 4B2CA 1BDAA 4ZKNU 3SI3H 1P9SA 1FUJA 2ODYB 1C5RA 1HBTH 5DGJA 1T8NA 3HPTB 2TIOA 3KIDU 2O8TA 5A09A 1GBDA 1UTQA 1L1NA 1SGCA 1HRTH 1VCPA 3BV9B 3EA7A 1TRYA 1RTKA 1SOTA 4YOGA 1GCTC 1B5GH 1FDPA 1EAWA 2AH4X 5K7RA 8KME2 3BG8A 3SU3A 4A6LA 1QBOA 2ZGCA 2V3OH 1EKBB 4NIWA 1QNJA 1IQHA 3GDVA 2TPIZ 3LH3A 1MTUA 1HAIH 4A1XA 1FZZA 1C1PA 1V2NT 2BVXH 2OD3B 2WUCA 3PO1C 1YF4A 3GDSA 1OSSA 1Z1IA 3EQ0H 1ZR0A 2XNIA 4B2BA 5JBBS 5T6FA 2Q6GA 1TRMA 2SGQE 4YM9A 4I33A 1ZSJA 5JPMH 5GCHG 2FTMA 2PUQH 3A7WA 3T62A 3W94A 4KGAA 1HAXB 1ANEA 3H7TA 5C5NA 4O9VA 4X6MA 4K5ZA 1N1LA 1N8OB 1QHRB 7ESTE 1AGJA 4A5TS 1MU8B 2G55A 2XTTB 3K9XB 3VB4A 4MTBA 3E6PH 5DO4H 5A0CA 1F0TA 1O5DH 1O39A 2BQWB 4I8LA 1GHXH 2FOMB 4Z6AH 3LPRA 1QTFA 5LPFA 5LPEA 5E0JA 1XX9A 2V3HH 4HFPB 3UWJH 3NXPA 1RXPA 3RXHA 2GV7A 3RXVA 4YESB 3MOCA 1GJ7B 1AO5A 3MTYA 4DGJA 2ZU2A 3P92A 1CA0C 2STBE 2QN5T 4JCNA 1OPHB 3SO3A 1QL8A 2G52A 1T32A 1D3PB 3BTKE 4Y0YE 2P94A 2GCTC 1O5FH 2OC1A 1S5SA 3A7VA 5DP5A 3SUFA 1EOLA 3UY9A 4OS1A 4BAHB 1IQIA 4FU8A 1BMLA 2JH6D 3RU4D 1GBKA 4CBOA 2GKVE 2VVCA 5AVDA 1P3EA 2CJIA 1AVWA 4WF8A 1Z8GA 2KAIA 4X2VA 2FI4E 5A0AE 1EAXA 3MU8A 3V13A 3AW1A 2Z7FE 2FS8A 2A5AA 1K28D 2HVXA 4Z0KA 3TH2H 4NIVA 5JB8S 4CR9A 4Q2KA 1UHBA 2WPIS 1O37A 5C1UA 1OKXA 1ZGVA 1RGQA 3O8BA 3KL6A 3RU4T 3U8RH 1IQNA 2Y7ZA 1J17T 5BRRE 4FUDA 6GCHF 2BD7A 3RMNH 2FTLE 3RLYH 4AG1A 1O5GH 4ZHMU 3SQEE 1O2PA 1ESTA 5HM9A 1BBRH 1DSTA 1TQ7B 2ILNA 3ZZ8A 2PSXA 1HAVB 2FX4A 1GJAB 1SLVB 1BOQA 1O2WA 3RC4A 1DITH 2FOCA 1LVYA 1TFXA 3MNSA 4X2XA 3D49H 1T31A 2XBXA 2BLQA 4NZQA 1C5MD 2EA3A 2ZIQH 2FP7B 1IQKA 2FM2A 4Y76A 1O2QA 1OP0A 1TGSZ 3SQHE 1P57B 1YPEH 2Q6DA 2WPMS 1WSSH 4HGCA 1C1QA 1TX7A 3BTHE 2ZCLP 2O8UA 5A8YA 2XC0A 2BY7X 3LT3A 4AGJA 4E05H 1KTTB 1PPEE 1K1PA 2H5DA 1LVOA 4RKOB 4AX9H 2HALA 1UHBB 3D62A 4R8TB 1SOZA 4K2YA 4JZDH 3FANA 3NUMA 1K22H 2HPPH 1X7AC 1C1VH 1YCPM 2A5IA 1A7SA 3MU0A 4GLYA 4MNWA 4WJG2 4Y7AA 3ZVBA 1G3EA 2P16A 3L33A 1NROH 3ITIA 4I8JA 2PKAB 4KTCA 3SNCA 2NU2E 1KTSB 1A1RA 3GICB 5HGGA 2WYJA 2XBYA 1S83A 3G01A 1WQSA 3M5MA 1SPJA 1ELBA 1AMHA 3TPIZ 1Y5AT 1SGEE 1TGNA 3LOXA 1BMAA 1QL9A 2G4TA 2I6SA 1OWJA 4I8KA 4AN7A 1NPMA 2BDBA 2EI6A 1O2KA 2THFB 4ISHH 1SFQB 2WPLS 1S6FA 3CENA 3TH4H 2TRMA 1QRXA 1CT0E 1PQ5A 5FBIA 4CRFA 1O2RA 1H8IH 5DP9A 4BXWA 3DT0H 1JRSA 1GJDB 4ABAA 2PR3A 2ZFQH 2VGCC 1TLDA 3I78A 3M5LA 3MO9A 1J9CH 3JZ1B 2WV5A 4NA8A 1CBWB 3ZV8A 1SFIA 1IAUA 2A2QH 4MPVA 4AFQA 1O0DH 1H9LB 1F92A 1O2TA 2ASUB 3I29A 3F9EA 1IQLA 1GI8B 2Z9JA 4WY3A 3T2NA 5HXFA 1GBHA 8ESTE 2OTVA 1CT4E 3PMJA 3ESTA 2WV4A 1S85A 1MKXH 1Q2WA 1V2KT 1AZ8A 1IQGA 1GHVH 1HLTH 1GJ5H 2J34A 5I25A 1HAHH 1NFYA 1XM1A 3OYPA 1QCPA 2GGVB 2F9BH 3VB3A 1V2VT 1TAWA 2H1UA 2YOLA 4CRGA 4X2WA 2PV9B 2OBQA 3RDZA 1QB1A 2VWMA 4A7IB 4INKA 2SGFE 3RXFA 1C5LH 1QB6A 1ANBA 3UOUA 4H4FA 5E0GA 2WPJS 1A5IA 2BTCE 3VB6A 1NRSH 3A7XA 1AFEH 1J16A 4JK5A 4DCDA 1KLIH 3V3MA 1O31A 1AE8H 1AUTC 1Y8TA 3UQVA 4KTSA 2SGDE 5FPYA 1YPLH 1VJAU 1HIAB 1WQVH 2ZNKH 4BAOB 1A5GH 1SG8B 1FI8A 2BDGA 1O5AB 3M7QA 1DWBH 3PLKA 1V2JT 1ANCA 4JK6A 1LPKB 1MKXK 1F5LA 2F83A 3P8OA 1AKSA 1O2OA 1ZYOA 1PPFE 4YOJA 1OX1A 1TPPA 1ZGIA 1P8VC 4TPYA 1HJ8A 4K1SA 2I6QA 3A8BA 1LQDB 1CO7E 2GCHF 4X8VH 2ZDKA 1TBRH 2PW8H 4AYVB 4A1TA 1GHYH 2UUJB 3A7TA 3P8GA 1G36A 1NRQH 2NU1E 4FU7A 3E16B 2WPKS 2ZDNA 1SGDE 3LC5A 1N6XA 1PPHE 2BZ6H 3PWBA 2H9EH 1BRAA 4JZFH 2BDHA 1C4U2 1JIMA 5EPYA 1XUHA 1O3PB 2AMDA 2ZQ1A 2Q6FA 4D9QA 2A32A 3SV2H 1KXEA 1FNIA 4INHA 4Q7XA 1EZQA 4D9RA 3MU1A 1C2DA 1HAGE 1TNKA 1L4ZA 4CR5A 5JYIA 3VGCC 2BB4A 1GI5A 1L2EA 2HRVA 5JDUB 3M36A 1Y3UA 1OOKB 3SNBA 3SV7A 3ZZ5A 5ETXA 2Z3CA 3OTJE 4OGYA 3LJJA 3EA8A 1D3QB 3MH5A 2XYAA 4FUHA 2VIWA 4DY7B 1P10A 1C2EA 1KY9A 4ESTE 1GI7B 4FUEA 1XXFA 3MWIU 3OSYA 1D3DB 1DS2E 4YLUA 1O36A 2Y82A 4FVDA 2FXRA 1SBWA 5F6MA 4ABGA 1QY6A 3S69A 3LGWA 1DVAH 3RXQA 4XE4A 1EQ9A 1P05A 2BY9X 4GCHF 2VNTA 3UFAA 4ABJA 3ENSB 2DE8A 3RXBA 1DOJA 1VCQA 2QF0A 5J4SA 4FUFA 5FBEA 2C8YB 1BHXB 1TMUH 3BTWE 2QXGA 3P8NA 5A2MH 4H6SB 2GMTB 2VB0A 4DW2U 3RXSA 3AW0A 2J94A 3KQDA 5HM2A 3BEFB 3A8AA 1L1GA 4WVPE 2FMJA 1FY8E 1SSXA 2BD5A 5JBTA 2GT7A 1THPB 1GI9B 3LDXH 1DFPA 4U2WA 4ZKOU 4ZKSU 2A1DB 1SMFE 3PV4A 1XUJA 2FOHA 1RTFB 4GVUA 1BJUA 3O8DA 1U6QA 2ZG0H 3TNTA 5LH8A 1SGPE 1F0RA 1EX3A 4M7GA 3TJNA 1P02A 2ZA5A 3SBKA 1BRUP 3A89A 1AQ7A 1CU1A 5F8TA 2P3TB 4FUBA 4UFFH 1UTPA 5HYOA 1Z6EA 3Q00A 2VWNA 1YGCH 1F0UA 4MG3A 1QBNA 1S0RA 1C5XB 3PROA 1HB0B 2J9NA 2CN0H 2FYQA 1BTZA 1GHAF 4TY7A 1GJ4H 4SGBE 2BLVA 1NFUA 1DLKB 1IHTH 2AERH 3HK3B 1N6YA 2XWAA 5CHAB 1XXDA 1GDUA 1G9IE 3ZZ6A 2GTBA 1GBEA 5DP6A 1YYY1 3DD2H 1PPGE 2JKHA 2Z9IA 1DSUA 3LGUA 1GJBB 1O3BA 2JETB 1SGFG 2P93A 1QA7A 3MO3A 1ORFA 4DVAU 2XCFA 1TNHA 1VGCB 1KXDA 4YO9A 5A8XA 1SGFA 2G4UA 3RXRA 2ZPRA 1QRZA 1A0JA 3LGIA 1ZMNA 5PTPA 1NZQH 3RXTA 1BJVA 1TA2A 3KCGH 4Y11E 3IG6B 4INLA 4ZKRU 3RXLA 3ZV9A 3R3GB 4IN1A 2A7CA 2GV6A 2BQ6B 5T6DA 2ZCHP 4O3UA 1EATA 2QYIA 2A4RA 3ZZDA 3VFEA 1CGJE 2GCHG 3AASA 1AHTH 2W3KA 1EPTB 1RTLA 3E90B 1DANH 4IMQA 1BT7A 4OGXA 1GBCA 3GCNA 4RKJB 4DIHH 4XBBA 5DKMA 3ZVGA 1SHHB 1UVTH 8LPRA 2PKSB 4A92A 1SR5C 2ZGJA 1ZJKA 4DJZB 1O3OA 1QL7A 1C5YB 2BZAA 4JYTA 2QV1A 1UTOA 1W3CA 1Y5UT 3FP7E 1MD7A 1OYQA 4NG9H 2ZZUH 1XUFA 1THSH 1SB1H 2GZ7A 3GCHC 2ZKSA 1GG6B 4Y10E 1NFWA 2R0LA 2AMQA 2WPHS 3M35A 1WV7H 3NKKA 2ZF0H 2C3SA 1C5SA 3T29A 1AZZA 3KNXA 3NPSA 1KXBA 1AY6H 3A80A 1TALA 3U9AH 3BTTE 1KSNA 1MUEB 4Y6DA 4B76A 1TPAE 4X0WU 1C5VA 1F5RA 1E35B 2ODQA 3A82A 1TB6H 1B7XB 1NY22 2CXVA 3A83A 5F8XA 4PROA 1EXFA 4O97A 1B0EA 3GCOA 4K3JA 4MPXA 5EQRA 2FZZA 2ZDAH 1KXAA 2VIVA 2BYAX 3FZZA 1UVSH 3M7TA 1OWIA 4NA7A 2BD9A 2UWPA 4GCHG 4I8GA 2QC2A 3SJ8A 4A1VA 2IJOB 1ZMLA 7KMEH 1DWCH 1K1IA 2Y5FA 1EZXC 4FUIA 4BXSA 4B2AA 2CF9H 3U1IB 5C1XA 1TOMH 1LHDH 5EU8A 5EXMA 3BN9A 1C5QA 3F68H 4HZHA 2VIQA 1XKAC 2VWOA 2PWXA 4NWLA 1GCTB 5EW1H 1GI3A 3R0FA 5GIBA 3PYHA 3P8FA 2BMGB 2ZTXA 1MD8A 5EXLA 2A31A 3K65B 2VIDA 3SU4A 2C93B 2BOHB 4ZH8A 1CE5A 1HAYB 1LHCH 4Y71A 2JH5D 1ZTJA 1TNLA 3PO1B 2BD3A 2V35A 3Q3KA 3RXGA 1K21H 5GXPA 1C1SA 3GOVB 1Y3VA 2ANWA 1MTNC 4AOQA 1G3DA 2RCEA 3RUOA 2K1QA 2BHGA 3E0NB 4KTUA 3SZNA 2Y5HA 1ZLRA 4FUJA 1ESBA 6CHAC 1TRNA 3MNBA 1KLTA 1ZPZA 3GY5A 5GJ4B 2FIRH 1GI4A 4Y8XA 3DUXH 2ZHWH 3SNAA 1GHAG 1GI1A 4F4OC 4I31A 1DUAA 1UK3A 3QWCH 2A7HA 1O3LA 1ZZZA 1P2OA 1SGRE 5DG6A 4ABEA 4B71A 1ELCA 3GY3A 3RC6A 2BVSH 1EP5A 5C5OA 5GDSH 2ULLA 4BTUB 3U1JB 4CRCA 1RIWC 2FDAA 2VIPA 4NIXA 1BCUH 1PYTC 5EG4A 3UTUH 5FCKA 1Z1JA 3P17H 3UOPA 1CA0B 1P09A 1UTNA 2XBWA 3SV8A 1YPJH 1SC8U 1E34B 1ZMJA 1MKWH 2GCTB 4Q7ZA 3QLPH 1O2UA 1UTLM 5C67A 1C5PA 1XUGA 4ZXYH 1SLUB 5A8ZA 7GCHF 1FONA 3P6ZB 2D1JA 1ZHMA 4X1SU 3ZZAA 3HKJB 3ZZ4A 1MU6B 4NGAH 4NA9H 1ELDE 4X8TH 5ESTE 1GVKB 5CE1A 1QQUA 3RP2A 3CP7A 2A7JA 3QZRA 4K8BA 1SGQE
chains in the Genus database with same CATH superfamily
1ID5H 2KAIB 3SNEA 4X6PA 4GPGA 2OC7A 4RSPA 1UTMA 2P95A 1J15A 1C5NH 2VVUA 2YMSC 3ZVAA 1C5ZB 4MPWA 4DURA 3LGTA 4CHAC 1NBME 5DK1A 5F53A 1SGIB 1O3MA 3KGPA 1ELEE 2PHBA 1NRPH 1Q31A 3TK5A 1WTGH 2L6OA 1BTXA 4AORA 1MKWK 1W11U 3M3SA 4UEHH 2UWOA 1ZTLA 1GGDC 2OP9A 4X6OA 1AFQC 4WWYA 3AAVA 2Y80A 3OE7D 1MZDA 1GHZA 1NS3A 4I32A 2PTCE 3RMLH 1FY1A 1UVUH 1AWHB 1LVBA 1EAIA 1P12E 2PTNA 2HWLB 3OY5U 4ASHA 1HAZB 1HNEE 1O3DA 5C20A 2OQUA 2D8WA 1AUJA 2PUXB 5B6LA 1W0ZU 2YMSB 1LVMA 3VB7A 4YTAA 2WYGA 3ZZBA 2FYRA 3URCA 3KQEA 1FQ3A 1TPSA 1A4WH 2AEIH 3UNSA 3TJVA 2ZU1A 5DP4A 2ZC9H 2NU4E 3GYMA 2CV3A 3RM0H 1LDTT 4CRDA 1ABIH 1H8DH 3SU5A 4YT6H 1A0LA 1XUIA 1SQAA 2AGEX 3QDZB 1E0FD 1CA8B 4MLFB 3LONA 1CGHA 4BANB 1DUEA 1C5WB 2FOAA 3SU1A 1EOJA 2IPHA 1RRKA 3UUZA 1BTPA 3C1KA 2HLCA 2GD4B 2NU0E 3ZZ7A 2AYWA 2BY6X 2PFEA 1FIZA 2L74A 1OP8A 5IK2D 1T8MA 3HK6B 4ISLA 2BXUH 4I86A 1TBQH 1WBGB 2QAAA 1FY3A 1A0HB 3ELAH 1RJXB 1UMAH 1ELFA 1GBMA 4NFFA 4DG4A 4E7RG 1MMJN 2VGCB 1VZQH 4F49A 4ABDA 1K0HA 4NCYA 1V2PT 1O34A 2GT8A 2HNTC 1SGTA 2CHAC 3OFND 4XBCA 1WYKA 3TGKE 5L2YH 4CREA 3LGYA 2J4IA 1TMBH 2G5VA 2IN2A 3ZZ9A 1ETTH 1ZHRA 1C5TA 1KDQA 2Z9GA 1O35A 2V7QD 1AD8H 3BTDE 2V6NA 3KN2A 2G51A 1GL1A 2V3MA 1KIGH 1EZSC 5I46H 1NC6A 3S7HB 3E0PB 5EXNA 4GSOA 5E8EH 3SJIA 3RXEA 1UO6A 1TOCB 1TYNA 2KFWA 4KP0A 5ABWA 1MTVA 5GNDA 4AFUA 1H8ED 4TWWA 2QXHA 5FCRA 1ETSH 2ZFSA 2O8MA 1P3CA 1WTHD 1G32B 1T8LA 4Q7YA 1ZHPA 1SQOA 7GCHG 1O3KA 4U01A 1AE5A 2F9PA 2M5TA 4FU9A 2W7SA 3P95A 4AC9A 2IPQX 3RXIA 1IQEA 1MH0A 3A84A 4AYYB 3MYWA 3CS0A 1YBWA 1B0FA 3ZVCA 3Q3YA 2F9UA 5EJZA 5DP7A 3ZVEA 4XBDA 6LPRA 5CMXH 1DX5M 2G5NA 2RG3A 3F9FA 1MTWA 2BX4A 1OXGA 4X8SH 3QUMP 4BNRA 3EA9A 3GCTF 1BTYA 2EEKA 4IN2A 3JZ2B 1FXYA 1THRH 2FOEA 4XOJA 3RXPA 1IQMA 1HYLA 2RA0A 4HI3A 4IGDA 1O5EH 1WU1A 1YM0A 1EJNA 2FPZA 3V7TA 1SLWB 1XVOA 2Z3DA 4YZUA 3BTME 1GJCB 1Z71A 1EASA 2ZFFH 2A5KA 3VB5A 1EAUA 3RMMH 2A4GA 5EJ1A 2TGTA 1KLJH 4OS4A 1TGBA 4D7GA 3EGKH 2AGGX 1INCA 5EOKA 4CH2B 1W14U 1A5HA 1AKSB 1BBRE 1TGCA 2B9LA 3LH1A 1XVMA 1D6RA 2LNCA 4YOIA 2FI5E 2C90B 4XFQA 4GHQA 4MNVA 4AB9A 3QX5H 1C2LA 4AGKA 1GBFA 5C1YA 2RDLA 3DSPA 3A87A 2C8ZB 3HGPA 1DXPA 1O33A 2QIQA 3MH7A 2GX4A 3EE7A 4OS6A 3LIWA 3A85A 4JYUH 3SJ9A 3PV5A 2ZEBA 2FI3E 1ARCA 1SKYE 2BDYA 1O2YA 1W12U 2XCNA 3VGCB 2Q1JA 2FS9A 1DM4B 4JYVH 5C3NA 4TYDA 1TX6A 4UE7H 1RFNA 1O32A 3I77A 1GI0A 1KXFA 3L6PA 5EGMA 5TCAA 4WMEA 3SUDA 2J38A 3RXUA 1GMHF 2W5EA 3QGNB 4X8UH 2LPRA 1JMOH 4QT8C 1UCYE 2QXIA 3BG4C 1ZSKA 4Y7BA 3KYFA 3LJOA 4LOYH 1DY9A 4X1NU 1BA8B 4XD7D 1E38B 1E37B 3STJA 2J92A 1A3BH 1QIXB 5AHGH 2FOGA 1NFXA 2VVVA 1TQ0B 5E0HA 2D2DA 4IS5A 2ESTE 2BLWA 1JBUH 1A61H 3BEIB 1AVGH 3O8RA 1PJPA 1P03A 1Y3XA 1E1RD 1BRBE 4K60A 2R2MB 5JBCS 1H1BA 2J2UA 6ESTA 5GWZA 1FIWA 3QTVH 3RU4E 3TK6A 3UREA 1TABE 1TBZH 4NWKA 3OU0A 1MZAA 1W2KH 1SL3A 1BQYA 3TGIE 3MI4A 3RXJA 5H4IB 3TLOA 1LO6A 5EW2H 2CMYA 3Q77A 1O38A 1FJSA 1LKBA 2P8OC 1BTHH 3S9CA 1MQ6A 2FEQH 1O5CB 4WXIA 1UTJA 5CHBA 3SOSA 4ZROA 2UUFB 1TNJA 1C2IA 3Q3XA 3RXDA 4CBNA 3A88A 1C2GA 2ZGHA 3SU0A 1ABJH 1YLCA 2PLXA 3PTBA 3LC3A 3M7UA 2UUYA 1C4Y2 1GBIA 1O3FA 3UR9A 3UWIA 1MQ5A 1XUKA 3SV9A 3M5OA 3CS7A 1S81A 5DP8A 3RXKA 5ESBA 4K1EA 3WY8A 1V2ST 1UVOA 3ATIA 3BSQA 3T26A 1FY4A 1ZTKA 4BAKB 3TJUA 4O3TA 1CGIE 2CGAA 3PRDA 2O8WA 3FOAA 1UK4A 1Z8RA 1O2MA 3U8OH 1O3JA 2P59A 3DA9B 2SFAA 2OINA 3QZQA 3N7OA 4BOHA 1JOUB 1AVXA 2XWBI 3SHAH 4DIIH 1DT2A 3UNRA 3BIVH 1GI6A 3ODDA 3SGBE 3S9AA 1G37A 3SJKA 4WMDA 1ANDA 3NK8A 4X2YA 1SQTA 5FPTA 1O5BB 2IOTA 4Q63A 1HAOH 1OWHA 2W6ID 3GY2A 3W95A 3GCTG 1NU9A 1K1OA 1ELTA 4ZMAH 1G2LA 4U32A 1EZUC 5FX6A 2VH0A 3FAOA 1A46H 1VITF 1FLEE 4ABHA 1O3NA 2GP9B 1JIRA 3QGJA 1QQ4A 4FXGH 4Y8ZA 1FPHH 3NRLA 2TGDA 1YPKH 3U8TH 5DP3A 1A2CH 2SGPE 3KQBA 4ZHAA 2BDAA 1AI8H 2F3CE 3VG8A 1F5KU 2OCVB 1V6DA 5A0BA 1YLDA 5FPSA 1CSOE 2BD8A 2WSSD 3UPEA 4XDEA 3ATWA 2VJ1A 3GY8A 2ZO3H 4D7FA 3H5CB 1E36B 2OK5A 3SNDA 4TPIZ 2UUKB 3SU6A 1CVWH 2Y81A 1Z7KA 3E91A 3ZYDA 3UAIC 4TY6A 1N8OC 4B1TA 2ZTYA 3DCLA 1YP9A 5DJ7A 3ZYEA 4X1PU 1P2JA 1O2ZA 2AMPA 2AIPA 1P2MA 1JWTA 1CHOF 1V2TT 1GJ9B 2ZHFH 3RMOH 1HPGA 1Y5BT 2KCYA 2XBVA 3GCHB 1ZJDA 4B75A 1V2RT 4TWYA 3URDA 1TX8A 1HJAC 1ARBA 2EI8A 2M2AA 2SGAA 1QJ7B 5LPRA 2R3YA 2OXSA 1D6WA 1GWAA 4CRBA 5G4BA 3ZVDA 5L2ZH 1GMCF 1TNGA 3TNSA 3A7ZA 1GMHG 2PP6A 1P2NA 1TNIA 4Z1MD 2QF4A 4IC6A 4ISNA 1VCWA 2R3UA 2F9NA 3BTQE 4IW4E 4H6TA 4JZ1A 3FVFB 3M3VA 2F9OA 4GUXA 1YKTA 2ZGBH 3STIA 3O8CA 3OX7U 4JZIA 4O03A 1IQFA 2HNTF 2W26A 4MVNA 1C2MA 1GBJA 1G30B 5GPIB 3A8DA 2STAE 1NTPA 1TONA 2KR7A 2FO9A 2ZU3A 1DICA 3VXEH 2SGEE 4WMFA 3PWCA 1PQAA 1HJAB 4I7YH 4YLQH 3T5FH 1NN6A 5FAHA 4Y79A 1VJ9U 3K6ZA 1H9IE 1Q3XA 1CT2E 1W8BH 4X1QU 2ZDMA 3RC5A 3ZZCA 3SORA 5T3HA 2BY8X 1MAYA 1P11E 1TE0A 2G81E 2ZCKP 2TGPZ 2C8WB 3ZZ3A 1BB0B 3TIUA 3ZIAD 1W0YH 1XMNB 2FOBA 1HAVA 2HVYB 4MQAA 4FUCA 4E7NA 1EJAA 3TITA 5AF9H 1FMGA 5BPEA 1S84A 2ANKH 4RI0A 2AGIX 1LKAA 1GVZA 3ATKA 1C2HA 2JH0D 1C1MA 1O3CA 1Y59T 1CQQA 1K1JA 1MTNB 2G00A 4NSYA 2ZDVH 3MU4A 3U69H 1ZOMA 2FLRH 1SGNE 3MO6A 1V3XA 5E2PA 1C2JA 2BD4A 3BF6H 2BDIA 4BTTB 6CHAB 2A4QA 1T8OA 2DE9A 2PSYA 1F0SA 1FN6A 1M9UA 4P00A 3SI4H 3BTFE 1O2SA 3UIRA 3UR6A 2JDID 4ISOA 2ZECA 1FY5A 3SJOA 1W7GH 3F0OA 3RXAA 1GCDA 4BTIB 1YPHE 2VH6A 4IC5A 3SGQE 2QF3A 3FZDA 2EQNA 1BRCE 1EJMA 1TWXB 1BTWA 2SNVA 2ZP0H 2HNTE 1UK2A 2YNAA 1TA6A 5LGOA 2UWLA 1RIWB 2ZI2H 4LK4A 5IYTA 2PKAA 1O3HA 1OP2A 2QCYA 1HGTH 1P2QA 2OC0A 3GY4A 3PRBA 1JRTA 3F2GA 5L6NH 3NZIA 1VITG 1KXCA 1GJ8B 4OS2A 2A2XH 1TPOA 2ALPA 5AFYH 1K1LA 1LCYA 1GDQA 2P3UB 1BHXF 7LPRA 3SN8A 3BEUA 3D65E 3DFLA 1AWFH 1TIOA 5IDKA 3BTGE 4ABFA 1O30A 2RA3A 1BIOA 1W13U 2O9QA 1QB9A 2H2ZA 3ATMA 5K0HA 4AFZA 2BLOA 1C1WH 1D4PB 1NO9H 2KM0A 5FXLA 2Z3EA 3H7OA 1C2FA 1PYTD 4BAMB 2G8TA 3D23A 2ZQ2A 3PB1E 4UFDH 3GS9A 3MU5A 1BTUA 4GAWA 2DUCA 3F6UH 4Q80A 4NIYA 4HTCH 1HJ9A 3A81A 2H6MA 1CBWC 4THNH 3PMBB 3T27A 2FODA 3RXOA 3OY6U 1UCYH 1O3EA 3EDXB 3TH3H 2VWLA 4RT1A 1CHOG 1BITA 2Z94A 1O3GA 1UTKA 2ZFRH 1BBRK 5DSFA 3QN7A 3UQOA 5B6OA 3SU2A 2BY5X 4D76A 4CHAB 4ZHLU 3K6YA 4DOQA 1V2QT 4BAQB 3PMAB 1O2NA 2B0FA 1BMFD 3C27B 1DWEH 1HXFH 2AFQB 1G2MA 1C1UH 1C5OH 1FAXA 3KEEA 3KF2A 4XSKU 3QTOH 4MNYA 1GGDB 1GMCG 2PGBB 1AFQB 1D9IA 1C1OA 1P0SH 2FWWA 1OHHD 1AIXH 2KCAA 3SHCH 2VU8E 3NWUA 1GJ6A 1K9OE 1LQEA 1O2LA 2QE7D 4UFGH 1PPBH 2BOKA 1O2HA 2HOBA 8GCHF 2TGAA 1SVPA 1P9UA 1QBVH 5J4QA 1P2IA 1ZRBA 1QRWA 2ANYA 2YMSD 3PLPA 3LU9B 3Q76A 1GL0E 3F2HA 2FOFA 3GDUA 3HATH 3VPKA 1UJ1A 1LHEH 4X6NA 1GMDF 1H4WA 2R2WU 3DHKH 1YPHC 1NT1A 4ISIH 1C4V2 1UCYK 2OLGA 2ZHEH 1LHGH 1DPOA 1HIAA 4B74A 5F03A 3B8JA 3N99A 3M5NA 3S9BA 2VIOA 3KQCA 2A4OA 1IOEA 1CHGA 1HFDA 1L0ZA 1O2JA 2FX6A 2A0QB 3F2FA 2D26C 1O3AA 3L3TA 4RN6A 1GDNA 2OBOA 2B5TB 2GZ9A 3S0NA 2ZU4A 1YPMH 4X1RU 4H42U 1UVPA 2CF8H 1ELVA 1ZPBA 1C9TA 2SNWA 4ZAEA 2Z9KA 1QJ6B 1V2WT 4ZUHA 2W7UA 1LPGB 1ELGA 1PPCE 5TJXA 5JB9S 5C17A 1NRNH 1PPZA 3F9GA 1P01A 3MNXA 4OS7A 1HUTH 3MMGA 4J1YA 1GPZA 1J14A 2F9VA 1WCZA 4AZ2B 3RXCA 4FETA 3TU7H 2KZ4A 2QGRA 2BDCA 2ZDLA 4E06H 1W7XH 4FOUC 2EC9H 1QFKH 4JZEH 1KYNA 1V2OT 1P04A 1OWKA 2CHAB 2TBSA 3E8LA 2C8XB 4AG2A 1QJ1B 2A45B 1C2KA 1RS0A 2VINA 1FPCH 3T28A 4NFEA 1SLXB 4B73A 4VGCC 1ESAA 1K1MA 4MDSA 4NSVA 1GHBF 1W10U 3MH6A 6GCHG 2ZU5A 4WXVA 2B7DH 3ODFA 1O2VA 1TMTH 4UDWH 3GYLB 3TVJB 1OS8A 1GBAA 2ZHDA 1EUFA 4LZ4B 3S7KB 2OUAA 4KKDA 2ANMH 3SW2B 1KDQB 3V12A 1PQ8A 3IWMA 1V2MT 1HAPH 1Z6JH 4OM9A 4MPUA 3F3BA 1AB9C 2R9PA 1LMWB 5F8ZA 1MBQA 1DY8A 1DWDH 2H9TH 1C1RA 5HMAA 1BMNH 2ALVA 1NM6A 3RLWH 2BD2A 3PLBA 1Z8JB 1ZPCA 4UFEH 1GBLA 4CRAA 1H8HD 2P3FH 1LHFH 2HPQH 3LGVA 5SGAE 3SUEA 4FVBA 2ZPQA 1MBMA 4UD9H 2KX4A 1GI2A 1QGFA 4I8HA 3HKIB 4VGCB 3PTNA 4K8YA 4AB8A 1OYTH 4Y0ZE 2AIQA 2BM2A 2Y6TA 1AU8A 4LXBH 4U30A 5L30H 2GMTC 4ABIA 1NBMD 1S82A 2WUBA 3AAUA 2XXLA 1ETRH 2EI7A 4J2YB 3GISB 1P2KA 1V2UT 1FAKH 1PFXC 1IHSH 1V2LT 1C1NA 1S6LA 1MCVA 3B23B 2ODPA 1RD3B 3GY6A 3F9HA 4WH6A 4YT7H 1L4DA 1AB9B 1Y3WA 3TGJE 2HGTH 3T25A 1VITH 1F2SE 4LZ1H 1YCPH 2QA9E 2ZFPH 3A7YA 3BIUH 1O2IA 1TGTA 1AN1E 4ZXXH 1H9HE 1GBTA 3SUGA 1D3TB 1W0JD 3PMHB 1MAXA 1QR3E 4KELA 2PGQB 1HV7A 2NU3E 1ZSLA 2ZWLH 3RM2H 1GVLA 3PM3A 5C2ZA 1OWDA 1BUIA 3FFGA 5GCHF 1GBBA 3E1XB 3A8CA 1FN8A 5AFZH 3OTPA 3LKWA 1Y3YA 3FP8E 3SV6A 1A3EH 1P06A 3IITA 3MFJA 2W3IA 2B8OH 8GCHG 2XC5A 1T4VH 2YNBA 1BMMH 5T6GA 3B9FH 3M37A 2F91A 1HCGA 2XC4A 5KECA 3DSGA 3TK9A 5CHAC 3PV2A 4JMYA 1T7CA 5TCCA 4FUGA 3UNQA 1GMDG 2ZHQH 1C9PA 4R0IA 3RXMA 3A86A 2V0BA 1T4UH 3QO6A 1EP6A 2GZ8A 2GVFA 4CH8B 5DPAA 1WUNH 1O3IA 1YC0A 1YCPK 2JETC 4MNXA 3F0PA 1O2XA 1S0QA 1O2GH 2J95A 3DFJA 1VGCC 1JXPA 1LTOA 1PQ7A 3BG4B 1MCTA 3V0XA 1SHYA 4Q4LA 1K2I1 2GJGA 1ACBE 2BVRH 1IQJA 1YY3A 1EB2A 4AFSA 1EPTA 2R0KA 2AHME 1S6HA 4K1TA 1F7ZA 3FN8A 4Y8YA 1J8AA 1HDTH 9LPRA 3EYDA 1C5UA 1DE7H 1FV9A 2XW9A 1NU7B 1EPTC 2Z6BD 3MNCA 1WAYB 1G3CA 3MHWU 5FX5A 3FP6E 3SGAE 1QURH 2PKSC 3U98H 1C1TA 1L1JA 3EE0B 1VR1H 4K69A 2RFKC 3ATLA 4DT7B 1G3BA 2FESH 3M3TA 4D8NA 2C4FH 3K2UA 2P8OB 1DDJA 2OQ5A 3BTEE 3E3TA 2BX3A 1HXEH 2BXTH 2ZTZA 5JBAS 4ASUD 5E2OA 1GHWH 4GHTA 3VXFH 1GHBG 1DLEA 3NCLA 2ZGXH 5EPNA 4UONA 1WOFA 2ZFTA 3QK1A 1GG6C 2WINI 1XKBC 3F1SB 3GY7A 3EAJA 9ESTA 2NWNA 3MH4A 1MTSA 1K1NA 3KHVA 1ELAA 2H5CA 4OS5A 3TJOA 3ZVFA 1SGYE 3VEQB 5EQSA 4ABBA 1BZXE 3P70B 2FLBH 2Z9LA 2H9HA 3AVZA 4IMZA 2XRCA 2O8LA 1LPZB 1NRRH 4NZLA 1OWEA 4IBLH 2ZPSA 2GDEH 1SI5H 5EQQA 1ZRKA 2Y7XA 1NESE 1Z8IB 3M61U 4SGAE 1DXWA 4WH8A 5EODA 1YPGH 5FHTA 2BQ7B 2Y5GA 1QA0A 2OC8A 2AS9A 1EB1H 2QY0B 2QXJA 3HGNA 5HIZA 2GDDA 4B2CA 1BDAA 4ZKNU 3SI3H 1P9SA 1FUJA 2ODYB 1C5RA 1HBTH 5DGJA 1T8NA 3HPTB 2TIOA 3KIDU 2O8TA 5A09A 1GBDA 1UTQA 1L1NA 1SGCA 1HRTH 1VCPA 3BV9B 3EA7A 1TRYA 1RTKA 1SOTA 4YOGA 1GCTC 1B5GH 1FDPA 1EAWA 2AH4X 5K7RA 8KME2 3BG8A 3SU3A 4A6LA 1QBOA 2ZGCA 2V3OH 1EKBB 4NIWA 1QNJA 1IQHA 3GDVA 2TPIZ 3LH3A 1MTUA 1HAIH 4A1XA 1FZZA 1C1PA 1V2NT 2BVXH 2OD3B 1COWD 2WUCA 3PO1C 1YF4A 3GDSA 1OSSA 1Z1IA 3EQ0H 5C0TA 1ZR0A 2XNIA 4B2BA 2LP6A 5JBBS 5T6FA 2Q6GA 1TRMA 3N7DA 2SGQE 4YM9A 4I33A 1ZSJA 5JPMH 5GCHG 5C94A 2FTMA 2PUQH 3A7WA 3T62A 3W94A 4KGAA 1HAXB 1ANEA 3H7TA 5C5NA 4O9VA 3DSOA 4K5ZA 4X6MA 1E1QD 1N1LA 2LELA 1N8OB 1QHRB 7ESTE 1AGJA 4A5TS 1WXRA 1MU8B 2G55A 2XTTB 2J98A 3K9XB 3VB4A 4MTBA 3E6PH 5DO4H 5A0CA 1F0TA 5FL7D 1O5DH 1O39A 2BQWB 4I8LA 1GHXH 2FOMB 4Z6AH 3LPRA 1QTFA 5LPFA 5LPEA 5E0JA 1XX9A 2V3HH 4HFPB 3UWJH 3NXPA 1RXPA 3RXHA 2GV7A 2J97A 3RXVA 4YESB 3MOCA 1GJ7B 1AO5A 3MTYA 4DGJA 1EFRD 2ZU2A 3P92A 1CA0C 2STBE 2QN5T 4JCNA 1OPHB 3SO3A 1QL8A 2G52A 1T32A 1D3PB 3BTKE 4Y0YE 2P94A 1UW7A 2GCTC 1O5FH 2OC1A 1S5SA 3A7VA 5DP5A 3SUFA 1EOLA 3UY9A 4OS1A 4BAHB 1IQIA 4FU8A 1BMLA 2JH6D 3RU4D 1GBKA 4CBOA 2GKVE 3AK5A 2VVCA 5AVDA 1QZ8A 1P3EA 2CJIA 3WW7A 1AVWA 4WF8A 1KMHB 1Z8GA 2KAIA 4X2VA 2FI4E 5A0AE 1EAXA 3MU8A 3V13A 3AW1A 2Z7FE 2FS8A 4B6EA 2F43B 2A5AA 1K28D 2HVXA 4Z0KA 3TH2H 3N7EA 4NIVA 5JB8S 4CR9A 4Q2KA 1UHBA 4HG6A 2WPIS 1O37A 5C1UA 1OKXA 1ZGVA 1RGQA 3O8BA 3KL6A 3RU4T 3U8RH 1IQNA 2Y7ZA 1J17T 5BRRE 4FUDA 6GCHF 2BD7A 3RMNH 2FTLE 3RLYH 4AG1A 1O5GH 4ZHMU 3SQEE 1O2PA 1ESTA 5HM9A 5C0UA 1BBRH 1DSTA 1TQ7B 2ILNA 3ZZ8A 2PSXA 1HAVB 2FX4A 1GJAB 1SLVB 3FO8D 1BOQA 1O2WA 3RC4A 1DITH 2FOCA 1LVYA 1TFXA 3MNSA 4P02A 4X2XA 3D49H 1T31A 2XBXA 2BLQA 4NZQA 1C5MD 2EA3A 2ZIQH 2FP7B 5CDFE 1IQKA 2FM2A 4Y76A 1E79D 1O2QA 2K8IA 3MQKC 1OP0A 1TGSZ 2WZQA 1P57B 1YPEH 3SQHE 2Q6DA 2WPMS 1WSSH 4HGCA 5HKKD 1C1QA 1TX7A 3BTHE 2ZCLP 2O8UA 5A8YA 2XC0A 2BY7X 3LT3A 4AGJA 4E05H 1KTTB 1PPEE 2H5DA 1K1PA 1LVOA 4RKOB 4AX9H 2HALA 1UHBB 1YLNA 2K0QA 3D62A 4R8TB 1SOZA 3WWFA 4K2YA 4JZDH 3FANA 3NUMA 1K22H 2HPPH 1X7AC 1C1VH 1YCPM 2A5IA 1A7SA 3MU0A 4GLYA 4MNWA 4WJG2 4Y7AA 3ZVBA 1G3EA 2P16A 2KCOA 3H09A 1MABB 3L33A 1NROH 3ITIA 4I8JA 2PKAB 4KTCA 3SNCA 2NU2E 1KTSB 1A1RA 3GICB 5HGGA 4RT0A 2WYJA 2XBYA 1S83A 3G01A 1WQSA 3OAAD 3M5MA 1SPJA 1ELBA 1AMHA 3TPIZ 1Y5AT 1SGEE 1TGNA 3LOXA 1BMAA 1QL9A 2G4TA 2I6SA 1OWJA 4I8KA 4AN7A 4F55A 1NPMA 2BDBA 2EI6A 1O2KA 2THFB 4ISHH 1SFQB 2WPLS 1S6FA 3CENA 3TH4H 2TRMA 1QRXA 1CT0E 1PQ5A 5FBIA 4CRFA 1O2RA 1H8IH 5DP9A 4BXWA 3DT0H 1JRSA 1GJDB 4ABAA 2PR3A 2ZFQH 2VGCC 4TSFD 1TLDA 3I78A 3M5LA 1VKYA 3MO9A 1J9CH 3JZ1B 2WV5A 4NA8A 1CBWB 3CNRA 3ZV8A 1SFIA 1IAUA 2A2QH 4MPVA 4AFQA 1O0DH 1H9LB 1F92A 1O2TA 2ASUB 4YXWD 3I29A 3F9EA 1IQLA 1GI8B 2Z9JA 4WY3A 3T2NA 5HXFA 1GBHA 8ESTE 2OTVA 1CT4E 3PMJA 3ESTA 2WV4A 1S85A 1MKXH 1Q2WA 1V2KT 1AZ8A 1IQGA 1GHVH 5DN6D 1HLTH 1GJ5H 2J34A 5I25A 1HAHH 1NFYA 1XM1A 4B6FA 3OYPA 1QCPA 2GGVB 2F9BH 3VB3A 1V2VT 1TAWA 2H1UA 2YOLA 4CRGA 4X2WA 2PV9B 2OBQA 3RDZA 1QB1A 2VWMA 4A7IB 4INKA 2SGFE 3RXFA 1C5LH 1QB6A 1ANBA 3UOUA 3SYJA 4H4FA 5E0GA 2WPJS 1A5IA 2BTCE 3VB6A 1NRSH 3A7XA 1AFEH 1J16A 4JK5A 4DCDA 1KLIH 3V3MA 1O31A 1AE8H 1AUTC 1Y8TA 2F4LA 3UQVA 4KTSA 2SGDE 5FPYA 1YPLH 1VJAU 1HIAB 1WQVH 2ZNKH 4BAOB 1A5GH 1SG8B 1FI8A 2BDGA 1O5AB 3M7QA 1DWBH 3PLKA 1V2JT 1ANCA 4JK6A 1LPKB 1MKXK 1F5LA 2F83A 3P8OA 1AKSA 1O2OA 1ZYOA 1PPFE 4YOJA 1OX1A 2JIZD 2WPDD 1TPPA 1ZGIA 1P8VC 4TPYA 1HJ8A 4K1SA 5T1VA 2I6QA 3A8BA 1LQDB 1CO7E 2GCHF 4X8VH 2ZDKA 1TBRH 2PW8H 4AYVB 4A1TA 1GHYH 2UUJB 3A7TA 3P8GA 1G36A 1NRQH 2NU1E 4FU7A 3E16B 2WPKS 2ZDNA 1SGDE 3LC5A 1N6XA 1PPHE 2BZ6H 3PWBA 2H9EH 1BRAA 4JZFH 2BDHA 1C4U2 1JIMA 5EPYA 5EIYA 1XUHA 1O3PB 2AMDA 2ZQ1A 2Q6FA 4D9QA 2A32A 3SV2H 1KXEA 1FNIA 4INHA 5EJLA 4Q7XA 1EZQA 1YWUA 4D9RA 3MU1A 1C2DA 1HAGE 1W0KD 1TNKA 1L4ZA 5KGOA 4CR5A 5JYIA 3VGCC 2BB4A 1GI5A 1L2EA 2HRVA 5JDUB 3M36A 1Y3UA 1OOKB 3SNBA 3SV7A 3ZZ5A 5ETXA 2Z3CA 3OTJE 4OGYA 3LJJA 3EA8A 1D3QB 3MH5A 2XYAA 4FUHA 2VIWA 4DY7B 1P10A 1C2EA 1KY9A 4ESTE 1GI7B 4FUEA 1XXFA 3MWIU 3OSYA 3WWBA 4ACBA 1D3DB 1DS2E 4YLUA 1O36A 2Y82A 4FVDA 2FXRA 1SBWA 5F6MA 4ABGA 1QY6A 3S69A 3LGWA 1DVAH 3RXQA 4XE4A 1EQ9A 1P05A 2BY9X 4GCHF 2VNTA 3UFAA 4ABJA 3ENSB 2DE8A 3RXBA 1DOJA 1VCQA 2QF0A 5J4SA 4FUFA 1FX0B 5FBEA 2C8YB 1BHXB 1TMUH 3BTWE 2QXGA 3P8NA 5A2MH 4H6SB 2GMTB 2VB0A 4DW2U 3RXSA 3AW0A 2J94A 3KQDA 5HM2A 3BEFB 3A8AA 1L1GA 4WVPE 2FMJA 1FY8E 1SSXA 2BD5A 5JBTA 2GT7A 1THPB 1GI9B 3LDXH 1DFPA 4U2WA 4ZKOU 4ZKSU 2A1DB 1SMFE 3PV4A 1XUJA 2FOHA 1RTFB 4GVUA 1BJUA 3O8DA 1U6QA 2ZG0H 4ZCNA 3TNTA 5LH8A 1SGPE 1F0RA 1EX3A 4M7GA 4M9FA 3TJNA 1P02A 2ZA5A 3OEHD 3SBKA 1BRUP 3A89A 1AQ7A 1CU1A 5F8TA 2P3TB 4FUBA 4UFFH 1UTPA 5HYOA 1Z6EA 3Q00A 2VWNA 1YGCH 1F0UA 4MG3A 1QBNA 1S0RA 1C5XB 3PROA 1HB0B 2J9NA 2CN0H 2FYQA 1BTZA 1GHAF 4TY7A 1GJ4H 4SGBE 2BLVA 1NFUA 1DLKB 1IHTH 2AERH 3HK3B 1N6YA 2XWAA 5CHAB 1XXDA 1GDUA 1G9IE 3W1EA 3ZZ6A 2J5UA 2GTBA 1GBEA 5DP6A 1YYY1 3DD2H 1PPGE 2JKHA 2Z9IA 1DSUA 3LGUA 1GJBB 1O3BA 2JETB 1SGFG 2P93A 1QA7A 3MO3A 1ORFA 4DVAU 2XCFA 1TNHA 1VGCB 2WV9A 4XRNA 1KXDA 2XOKD 4YO9A 5A8XA 1SGFA 2G4UA 3RXRA 2ZPRA 1QRZA 1A0JA 3LGIA 1ZMNA 5PTPA 1NZQH 3RXTA 1BJVA 1TA2A 3KCGH 3KYGA 4Y11E 3IG6B 4INLA 4ZKRU 3RXLA 3ZV9A 3R3GB 4IN1A 2KCPA 2A7CA 4F48B 2GV6A 2BQ6B 5T6DA 5KEDA 2ZCHP 4O3UA 1EATA 2QYIA 2A4RA 3ZZDA 3VFEA 1CGJE 2GCHG 3AASA 1AHTH 2W3KA 3KQ5A 1EPTB 1RTLA 3E90B 1DANH 4IMQA 1BT7A 4OGXA 1GBCA 3GCNA 4RKJB 4DIHH 4XBBA 5DKMA 3ZVGA 1SHHB 1UVTH 8LPRA 2PKSB 4A92A 1SR5C 2ZGJA 1ZJKA 4DJZB 1O3OA 1QL7A 1C5YB 2BZAA 4JYTA 2QV1A 1UTOA 1WDIA 1W3CA 1Y5UT 3FP7E 1MD7A 1OYQA 4NG9H 2ZZUH 1XUFA 1THSH 1SB1H 3OEED 2GZ7A 3GCHC 2ZKSA 1GG6B 4Y10E 1NFWA 2R0LA 2AMQA 2WPHS 3M35A 1WV7H 3NKKA 2ZF0H 2C3SA 1C5SA 3T29A 1AZZA 3KNXA 3NPSA 1KXBA 1AY6H 3A80A 1TALA 3U9AH 3BTTE 1KSNA 1MUEB 4Y6DA 4B76A 1TPAE 4X0WU 2RDEA 1C5VA 1F5RA 1E35B 2ODQA 3A82A 1TB6H 1B7XB 1NY22 2CXVA 3A83A 5F8XA 4PROA 1EXFA 4O97A 1B0EA 3GCOA 4K3JA 4MPXA 5EQRA 2FZZA 2ZDAH 1KXAA 2VIVA 2BYAX 3FZZA 1UVSH 3M7TA 1OWIA 4NA7A 2BD9A 2UWPA 4GCHG 4I8GA 2QC2A 3SJ8A 4A1VA 2IJOB 1ZMLA 2CK3D 7KMEH 1DWCH 1K1IA 2Y5FA 1EZXC 4FUIA 4BXSA 4B2AA 2CF9H 3U1IB 5C1XA 1TOMH 1LHDH 5EU8A 5EXMA 1SQRA 3BN9A 1C5QA 3F68H 4HZHA 2VIQA 1XKAC 2VWOA 2PWXA 4NWLA 1GCTB 5EW1H 1GI3A 3R0FA 5GIBA 3PYHA 3P8FA 2BMGB 2ZTXA 2IJD1 1MD8A 5EXLA 2A31A 3K65B 2VIDA 2XNDD 5HIYA 3SU4A 2C93B 2BOHB 4ZH8A 1CE5A 1HAYB 3UB0A 3FKSD 1LHCH 4Y71A 2JH5D 1ZTJA 1TNLA 4DT4A 3PO1B 4ACAA 2BD3A 2V35A 3Q3KA 3RXGA 1K21H 5GXPA 1C1SA 3GOVB 1Y3VA 2ANWA 1MTNC 4AOQA 1G3DA 2RCEA 3RUOA 2JJ1D 2K1QA 2BHGA 3E0NB 4KTUA 3SZNA 2Y5HA 1ZLRA 4FUJA 1ESBA 6CHAC 1TRNA 3MNBA 1KLTA 1ZPZA 3GY5A 5GJ4B 2FIRH 1GI4A 4Y8XA 3DUXH 2ZHWH 3SNAA 1GHAG 1GI1A 4F4OC 4I31A 3SZEA 1DUAA 1UK3A 2VBCA 3QWCH 2HLDD 2A7HA 1O3LA 4TT3D 1ZZZA 1P2OA 1SGRE 5DG6A 4ABEA 4B71A 2J98B 1ELCA 3GY3A 3RC6A 2BVSH 1EP5A 5C5OA 5GDSH 2ULLA 4BTUB 3U1JB 4CRCA 1RIWC 2FDAA 2VIPA 4NIXA 1BCUH 1PYTC 5EG4A 3UTUH 5FCKA 1Z1JA 3P17H 3UOPA 1CA0B 1P09A 1UTNA 2XBWA 3SV8A 1YPJH 1SC8U 1E34B 1ZMJA 1MKWH 2GCTB 4Q7ZA 3QLPH 1O2UA 1UTLM 5C67A 1C5PA 1XUGA 4ZXYH 1SLUB 5A8ZA 7GCHF 1FONA 2JJ2D 3P6ZB 2D1JA 1ZHMA 4X1SU 3ZZAA 3HKJB 3ZZ4A 1MU6B 4NGAH 4NA9H 1ELDE 4X8TH 5ESTE 1GVKB 3U28C 5CE1A 1QQUA 2EY4C 2W6JD 2WHXA 2QF5A 3RP2A 3CP7A 2A7JA 3QZRA 4K8BA 1SGQE
chains in the Genus database with same CATH topology
1ID5H 2KAIB 3SNEA 4X6PA 4GPGA 2OC7A 4RSPA 1UTMA 2P95A 1J15A 1C5NH 2VVUA 3ZVAA 1C5ZB 4MPWA 4DURA 3LGTA 4CHAC 5DK1A 1SGIB 1O3MA 3KGPA 1ELEE 2PHBA 1NRPH 1Q31A 3TK5A 1WTGH 1BTXA 4AORA 1MKWK 1W11U 3M3SA 4UEHH 2UWOA 1ZTLA 1GGDC 2OP9A 4X6OA 1AFQC 4WWYA 3AAVA 2Y80A 1MZDA 1GHZA 1NS3A 4I32A 2PTCE 3RMLH 1FY1A 1UVUH 1AWHB 1LVBA 1EAIA 1P12E 2PTNA 2HWLB 3OY5U 4ASHA 1HAZB 1HNEE 1O3DA 5C20A 2OQUA 2D8WA 1AUJA 2PUXB 1W0ZU 1LVMA 3VB7A 4YTAA 2WYGA 3ZZBA 2FYRA 3URCA 3KQEA 1FQ3A 1TPSA 1A4WH 2AEIH 3UNSA 3TJVA 2ZU1A 5DP4A 2ZC9H 2NU4E 3GYMA 2CV3A 3RM0H 1LDTT 4CRDA 1ABIH 1H8DH 3SU5A 4YT6H 1A0LA 1XUIA 1SQAA 2AGEX 3QDZB 1E0FD 1CA8B 4MLFB 3LONA 1CGHA 4BANB 1DUEA 1C5WB 2FOAA 3SU1A 1EOJA 2IPHA 1RRKA 3UUZA 1BTPA 3C1KA 2HLCA 2GD4B 2NU0E 3ZZ7A 2AYWA 2BY6X 2PFEA 1FIZA 1OP8A 1T8MA 3HK6B 4ISLA 2BXUH 1TBQH 1WBGB 2QAAA 1FY3A 1A0HB 3ELAH 1RJXB 1UMAH 1ELFA 1GBMA 4NFFA 4DG4A 4E7RG 1MMJN 2VGCB 1VZQH 4F49A 4ABDA 4NCYA 1V2PT 1O34A 2GT8A 2HNTC 1SGTA 2CHAC 4XBCA 1WYKA 3TGKE 5L2YH 4CREA 3LGYA 2J4IA 1TMBH 2G5VA 2IN2A 3ZZ9A 1ETTH 1ZHRA 1C5TA 1KDQA 2Z9GA 1O35A 3KN2A 1AD8H 3BTDE 2V6NA 2G51A 1GL1A 1KIGH 1EZSC 5I46H 1NC6A 3S7HB 3E0PB 5EXNA 4GSOA 5E8EH 3SJIA 3RXEA 1UO6A 1TOCB 1TYNA 4KP0A 5ABWA 1MTVA 4AFUA 4TWWA 2QXHA 5FCRA 1ETSH 2ZFSA 2O8MA 1P3CA 1WTHD 1G32B 1T8LA 4Q7YA 1ZHPA 1SQOA 7GCHG 1O3KA 4U01A 1AE5A 2F9PA 2M5TA 4FU9A 2W7SA 3P95A 3RXIA 1IQEA 1MH0A 3A84A 4AYYB 3MYWA 3CS0A 1YBWA 1B0FA 3ZVCA 3Q3YA 2F9UA 3ZVEA 5DP7A 4XBDA 6LPRA 5CMXH 1DX5M 2G5NA 2RG3A 3F9FA 1MTWA 2BX4A 1OXGA 4X8SH 3QUMP 4BNRA 3EA9A 3GCTF 1BTYA 2EEKA 4IN2A 3JZ2B 1FXYA 1THRH 2FOEA 4XOJA 3RXPA 1IQMA 1HYLA 2RA0A 4HI3A 4IGDA 1O5EH 1WU1A 1YM0A 1EJNA 2FPZA 3V7TA 1SLWB 1XVOA 2Z3DA 4YZUA 3BTME 1GJCB 1Z71A 1EASA 2ZFFH 2A5KA 3VB5A 1EAUA 3RMMH 2A4GA 2TGTA 1KLJH 4OS4A 1TGBA 4D7GA 3EGKH 2AGGX 1INCA 5EOKA 4CH2B 1W14U 1A5HA 1AKSB 1BBRE 1TGCA 2B9LA 3LH1A 1XVMA 1D6RA 2LNCA 4YOIA 2FI5E 2C90B 4XFQA 4GHQA 4MNVA 4AB9A 3QX5H 1C2LA 4AGKA 1GBFA 5C1YA 2RDLA 3A87A 2C8ZB 3HGPA 1DXPA 1O33A 2QIQA 3MH7A 2GX4A 4OS6A 3LIWA 3A85A 4JYUH 3SJ9A 2ZEBA 2FI3E 1ARCA 2BDYA 1O2YA 1W12U 2XCNA 3VGCB 2Q1JA 2FS9A 1DM4B 4JYVH 5C3NA 4TYDA 1TX6A 4UE7H 1RFNA 1O32A 3I77A 1GI0A 1KXFA 3L6PA 5EGMA 5TCAA 4WMEA 3SUDA 2J38A 3RXUA 1GMHF 2W5EA 3QGNB 4X8UH 2LPRA 1JMOH 4QT8C 1UCYE 2QXIA 3BG4C 1ZSKA 4Y7BA 3LJOA 4LOYH 1DY9A 4X1NU 1BA8B 1E38B 1E37B 3STJA 2J92A 1A3BH 1QIXB 5AHGH 2FOGA 1NFXA 2VVVA 1TQ0B 5E0HA 2D2DA 4IS5A 2ESTE 2BLWA 1JBUH 1A61H 3BEIB 1AVGH 3O8RA 1PJPA 1P03A 1Y3XA 1BRBE 4K60A 2R2MB 5JBCS 1H1BA 2J2UA 6ESTA 5GWZA 1FIWA 3QTVH 3RU4E 3TK6A 3UREA 1TABE 1TBZH 4NWKA 3OU0A 1MZAA 1W2KH 1SL3A 1BQYA 3TGIE 3MI4A 3RXJA 5H4IB 3TLOA 1LO6A 5EW2H 2CMYA 3Q77A 1O38A 1FJSA 1LKBA 2P8OC 1BTHH 3S9CA 1MQ6A 2FEQH 1O5CB 4WXIA 1UTJA 3SOSA 4ZROA 2UUFB 1TNJA 1C2IA 3Q3XA 3RXDA 4CBNA 3A88A 1C2GA 2ZGHA 3SU0A 1ABJH 1YLCA 2PLXA 3PTBA 3LC3A 3M7UA 2UUYA 1C4Y2 1GBIA 1O3FA 3UR9A 3UWIA 1MQ5A 1XUKA 3SV9A 3M5OA 3CS7A 1S81A 5DP8A 3RXKA 5ESBA 4K1EA 3WY8A 1V2ST 1UVOA 3ATIA 3BSQA 3T26A 1FY4A 1ZTKA 4BAKB 3TJUA 4O3TA 1CGIE 2CGAA 2O8WA 1UK4A 1Z8RA 1O2MA 3U8OH 1O3JA 2P59A 3DA9B 2SFAA 2OINA 3QZQA 3N7OA 4BOHA 1JOUB 1AVXA 2XWBI 3SHAH 4DIIH 1DT2A 3UNRA 3BIVH 1GI6A 3ODDA 3SGBE 3S9AA 1G37A 3SJKA 4WMDA 1ANDA 3NK8A 4X2YA 1SQTA 5FPTA 1O5BB 2IOTA 1HAOH 1OWHA 3GY2A 3W95A 3GCTG 1NU9A 1K1OA 1ELTA 4ZMAH 1G2LA 4U32A 1EZUC 5FX6A 2VH0A 3FAOA 1A46H 1VITF 1FLEE 4ABHA 1O3NA 2GP9B 1JIRA 3QGJA 1QQ4A 4FXGH 4Y8ZA 1FPHH 2TGDA 1YPKH 3U8TH 5DP3A 1A2CH 2SGPE 3KQBA 4ZHAA 2BDAA 1AI8H 2F3CE 1F5KU 2OCVB 1V6DA 5A0BA 1YLDA 5FPSA 1CSOE 2BD8A 3UPEA 4XDEA 3ATWA 2VJ1A 3GY8A 2ZO3H 4D7FA 3H5CB 1E36B 3SNDA 4TPIZ 2UUKB 3SU6A 1CVWH 2Y81A 1Z7KA 3E91A 3ZYDA 4TY6A 1N8OC 4B1TA 2ZTYA 1YP9A 5DJ7A 3ZYEA 4X1PU 1P2JA 1O2ZA 2AMPA 2AIPA 1P2MA 1JWTA 1CHOF 1V2TT 1GJ9B 2ZHFH 3RMOH 1HPGA 1Y5BT 2XBVA 3GCHB 1ZJDA 4B75A 1V2RT 4TWYA 3URDA 1TX8A 1HJAC 1ARBA 2EI8A 2SGAA 1QJ7B 5LPRA 2R3YA 2OXSA 1D6WA 1GWAA 4CRBA 5G4BA 3ZVDA 5L2ZH 1GMCF 1TNGA 3TNSA 3A7ZA 1GMHG 1P2NA 1TNIA 4IC6A 4ISNA 1VCWA 2R3UA 2F9NA 3BTQE 4IW4E 4H6TA 4JZ1A 3FVFB 3M3VA 2F9OA 4GUXA 1YKTA 2ZGBH 3STIA 3O8CA 3OX7U 4JZIA 4O03A 1IQFA 2HNTF 2W26A 4MVNA 1C2MA 1GBJA 1G30B 5GPIB 3A8DA 2STAE 1NTPA 1TONA 2FO9A 2ZU3A 1DICA 3VXEH 2SGEE 4WMFA 3PWCA 1PQAA 1HJAB 4I7YH 4YLQH 3T5FH 1NN6A 5FAHA 4Y79A 1VJ9U 3K6ZA 1H9IE 1Q3XA 1CT2E 1W8BH 4X1QU 2ZDMA 3RC5A 3ZZCA 3SORA 5T3HA 2BY8X 1MAYA 1P11E 1TE0A 2G81E 2ZCKP 2TGPZ 2C8WB 3ZZ3A 1BB0B 3TIUA 1W0YH 1XMNB 2FOBA 1HAVA 4MQAA 4FUCA 4E7NA 1EJAA 3TITA 5AF9H 1FMGA 5BPEA 1S84A 2ANKH 2AGIX 1LKAA 1GVZA 3ATKA 1C2HA 2JH0D 1C1MA 1O3CA 1Y59T 1CQQA 1K1JA 1MTNB 2G00A 4NSYA 2ZDVH 3MU4A 3U69H 1ZOMA 2FLRH 1SGNE 3MO6A 1V3XA 5E2PA 1C2JA 2BD4A 3BF6H 2BDIA 4BTTB 6CHAB 2A4QA 1T8OA 2DE9A 2PSYA 1F0SA 1FN6A 1M9UA 3SI4H 3BTFE 1O2SA 3UIRA 3UR6A 4ISOA 2ZECA 1FY5A 3SJOA 1W7GH 3RXAA 1GCDA 4BTIB 1YPHE 2VH6A 4IC5A 3SGQE 2QF3A 3FZDA 1BRCE 1EJMA 1TWXB 1BTWA 2SNVA 2ZP0H 2HNTE 1UK2A 2YNAA 1TA6A 5LGOA 2UWLA 1RIWB 2ZI2H 4LK4A 5IYTA 2PKAA 1O3HA 1OP2A 2QCYA 1HGTH 1P2QA 2OC0A 3GY4A 1JRTA 5L6NH 3NZIA 1VITG 1KXCA 1GJ8B 4OS2A 2A2XH 1TPOA 2ALPA 5AFYH 1K1LA 1LCYA 2P3UB 1GDQA 1BHXF 7LPRA 3SN8A 3BEUA 3D65E 3DFLA 1AWFH 1TIOA 5IDKA 3BTGE 4ABFA 1O30A 2RA3A 1BIOA 1W13U 2O9QA 1QB9A 2H2ZA 3ATMA 5K0HA 4AFZA 2BLOA 1C1WH 1D4PB 1NO9H 5FXLA 2Z3EA 3H7OA 1C2FA 1PYTD 4BAMB 2G8TA 3D23A 2ZQ2A 3PB1E 4UFDH 3MU5A 1BTUA 4GAWA 2DUCA 3F6UH 4Q80A 4NIYA 4HTCH 1HJ9A 3A81A 2H6MA 1CBWC 4THNH 3PMBB 3T27A 2FODA 3RXOA 3OY6U 1UCYH 1O3EA 3EDXB 3TH3H 2VWLA 1CHOG 1BITA 2Z94A 1O3GA 1UTKA 2ZFRH 1BBRK 3QN7A 3UQOA 5B6OA 3SU2A 2BY5X 4D76A 4CHAB 4ZHLU 3K6YA 4DOQA 1V2QT 4BAQB 3PMAB 1O2NA 2B0FA 3C27B 1DWEH 1HXFH 2AFQB 1G2MA 1C1UH 1C5OH 1FAXA 3KEEA 3KF2A 4XSKU 3QTOH 4MNYA 1GGDB 1GMCG 2PGBB 1AFQB 1D9IA 1C1OA 1P0SH 2FWWA 1AIXH 3SHCH 2VU8E 3NWUA 1GJ6A 1K9OE 1LQEA 1O2LA 4UFGH 1PPBH 2BOKA 1O2HA 2HOBA 8GCHF 2TGAA 1SVPA 1P9UA 1QBVH 5J4QA 1P2IA 1ZRBA 1QRWA 2ANYA 3PLPA 3LU9B 3Q76A 1GL0E 2FOFA 3GDUA 3HATH 3VPKA 1UJ1A 1LHEH 4X6NA 1GMDF 1H4WA 2R2WU 3DHKH 1YPHC 1NT1A 4ISIH 1C4V2 1UCYK 2OLGA 2ZHEH 1LHGH 1DPOA 1HIAA 4B74A 5F03A 3B8JA 3M5NA 3S9BA 2VIOA 3KQCA 2A4OA 1IOEA 1CHGA 1HFDA 1L0ZA 1O2JA 2FX6A 2A0QB 2D26C 1O3AA 3L3TA 4RN6A 1GDNA 2OBOA 2B5TB 2GZ9A 3S0NA 2ZU4A 1YPMH 4X1RU 4H42U 1UVPA 2CF8H 1ELVA 1ZPBA 1C9TA 2SNWA 4ZAEA 2Z9KA 1QJ6B 1V2WT 4ZUHA 2W7UA 1LPGB 1ELGA 1PPCE 5TJXA 5JB9S 1NRNH 1PPZA 3F9GA 1P01A 3MNXA 4OS7A 1HUTH 3MMGA 4J1YA 1GPZA 1J14A 2F9VA 1WCZA 4AZ2B 3RXCA 3TU7H 2QGRA 2BDCA 2ZDLA 4E06H 1W7XH 2EC9H 1QFKH 4JZEH 1KYNA 1V2OT 1P04A 1OWKA 2CHAB 2TBSA 3E8LA 2C8XB 4AG2A 1QJ1B 2A45B 1C2KA 1RS0A 2VINA 1FPCH 3T28A 4NFEA 1SLXB 4B73A 4VGCC 1ESAA 1K1MA 4MDSA 4NSVA 1GHBF 1W10U 3MH6A 6GCHG 2ZU5A 4WXVA 2B7DH 3ODFA 1O2VA 1TMTH 4UDWH 3GYLB 3TVJB 1OS8A 1GBAA 2ZHDA 1EUFA 4LZ4B 3S7KB 2OUAA 4KKDA 2ANMH 3SW2B 1KDQB 3V12A 1PQ8A 3IWMA 1V2MT 1HAPH 1Z6JH 4MPUA 1AB9C 2R9PA 1LMWB 5F8ZA 1MBQA 1DY8A 1DWDH 2H9TH 1C1RA 5HMAA 1BMNH 2ALVA 1NM6A 3RLWH 2BD2A 3PLBA 1Z8JB 1ZPCA 4UFEH 1GBLA 4CRAA 2P3FH 1LHFH 2HPQH 3LGVA 5SGAE 3SUEA 4FVBA 2ZPQA 1MBMA 4UD9H 1GI2A 1QGFA 4I8HA 3HKIB 4VGCB 3PTNA 4K8YA 4AB8A 1OYTH 4Y0ZE 2AIQA 2BM2A 2Y6TA 1AU8A 4LXBH 4U30A 5L30H 2GMTC 4ABIA 1S82A 2WUBA 3AAUA 2XXLA 1ETRH 2EI7A 4J2YB 3GISB 1P2KA 1V2UT 1FAKH 1PFXC 1IHSH 1V2LT 1C1NA 1MCVA 3B23B 2ODPA 1RD3B 3GY6A 3F9HA 4WH6A 4YT7H 1L4DA 1AB9B 1Y3WA 3TGJE 2HGTH 3T25A 1VITH 1F2SE 4LZ1H 1YCPH 2QA9E 2ZFPH 3A7YA 3BIUH 1O2IA 1TGTA 1AN1E 4ZXXH 1H9HE 1GBTA 3SUGA 1D3TB 3PMHB 1MAXA 1QR3E 4KELA 2PGQB 1HV7A 2NU3E 1ZSLA 2ZWLH 3RM2H 1GVLA 3PM3A 5C2ZA 1OWDA 1BUIA 3FFGA 5GCHF 1GBBA 3E1XB 3A8CA 1FN8A 5AFZH 3LKWA 1Y3YA 3FP8E 3SV6A 1A3EH 1P06A 3IITA 3MFJA 2W3IA 2B8OH 8GCHG 2XC5A 1T4VH 2YNBA 1BMMH 5T6GA 3B9FH 3M37A 2F91A 1HCGA 2XC4A 3TK9A 5CHAC 4JMYA 1T7CA 5TCCA 4FUGA 3UNQA 1GMDG 2ZHQH 1C9PA 4R0IA 3RXMA 3A86A 2V0BA 1T4UH 3QO6A 1EP6A 2GZ8A 2GVFA 4CH8B 5DPAA 1WUNH 1O3IA 1YC0A 1YCPK 2JETC