2QXJA

Crystal structure of human kallikrein 7 in complex with suc-ala-ala-pro-phe-chloromethylketone and copper
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
224
structure length
224
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-7
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 54
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxjA02
1CT2E 1N6YA 2ZHQH 3LONA 6CHAC 1PYTD 3URDA 3FANA 4AORA 3SU0A 5F8ZA 3FFGA 1PPCE 1TLDA 3BN9A 1Y59T 2G00A 1SGEE 2FTLE 5GIBA 1AKSB 1SGFA 1KLIH 1C5QA 2AFQB 3P8NA 2ASUB 2YNAA 4ABFA 2QV1A 4D8NA 4XFQA 4D7GA 2R0LA 1OWEA 4INKA 3EAJA 1B5GH 4DVAU 2TPIZ 1G9IE 1HAYB 2HRVA 2Q1JA 4ZHMU 3PWCA 3B9FH 3SUEA 1AU8A 2ZGXH 4Z6AH 1IOEA 1DWCH 2R3UA 2ZDMA 4FUJA 5DG6A 1MTNB 2A0QB 2PHBA 1C1VH 1PQ5A 1GL0E 2XC0A 4D76A 3MWIU 4A5TS 4X8VH 1XUIA 4AFQA 3BTKE 3TNSA 2NU4E 1BZXE 2GMTB 1LPZB 4AN7A 3MU8A 2GCHG 2WPIS 4X2XA 2ODYB 2ZECA 3SW2B 2Z6BD 3UNRA 4AG2A 1P2QA 5FXLA 5JB9S 3SJIA 1BMMH 1AD8H 2V0BA 1Y5BT 2PUXB 4K69A 3ZVBA 2GDEH 4X2VA 1SGCA 1ZSJA 2VVVA 1WSSH 1FI8A 5E2PA 3F9GA 1HXEH 2BZ6H 3S69A 3BTME 2Z7FE 1SGFG 3TITA 4MLFB 1MQ6A 2NU1E 2GP9B 3KF2A 1TA2A 1S6FA 1SGPE 5DP6A 1ETRH 3RC4A 4TY7A 2B5TB 1O2HA 1XUKA 2XYAA 2A31A 2ZGHA 1WV7H 1FPHH 5LPFA 3VXEH 1GI2A 2O8LA 4RKOB 3W95A 1PQ8A 4A1TA 1T8OA 1GHWH 1Z1JA 2ANYA 1MKXH 3RDZA 1HAVB 1GBAA 1KYNA 4WJG2 4ZHLU 5FPSA 2XTTB 4DW2U 4Y76A 4GVUA 1S0RA 3V7TA 4E05H 2Y7ZA 1EJMA 3FZZA 5DP5A 1BIOA 3E3TA 3F9EA 1TABE 5DGJA 1V2ST 1DUEA 7ESTE 1GJDB 1L4DA 1W14U 3TJNA 2R9PA 1UTKA 1EP6A 1SVPA 3EA8A 2A1DB 2BMGB 1GMHG 1ACBE 1NT1A 3RXVA 3A83A 5G4BA 1W13U 2ZHWH 2BLWA 7GCHF 1O36A 1TMBH 1NTPA 1GMCF 2F91A 3DD2H 4Y79A 3GCTF 1K28D 1AVWA 4AOQA 4ISNA 1GJ9B 2SNWA 3M5NA 2NU2E 1G32B 3PMBB 4X1RU 1FQ3A 3MNCA 3F6UH 1C5SA 2C8XB 3D62A 1TRNA 3AW1A 1C2GA 4UFEH 4GUXA 1GCTC 1CHOG 3SI4H 3IG6B 3S9CA 1Y8TA 2OP9A 2Y80A 4AZ2B 1QB9A 2SGFE 3I29A 1TIOA 5A0AE 2WPHS 3U8TH 1UVOA 3BTEE 3PMAB 1ELGA 3RMMH 1CVWH 2GT8A 4F4OC 3UWJH 2G52A 4R0IA 2QY0B 5FX5A 3SU2A 1F0UA 4ISOA 1UTQA 1QJ6B 1YPKH 2FOGA 1AFQB 3RMNH 2BX3A 4H42U 4NIVA 4XBCA 2ZF0H 4DT7B 1AUJA 1O3JA 1MBQA 2OQUA 2XWAA 1GDNA 9LPRA 1V2LT 2C8YB 2UWOA 1INCA 1EJNA 4KP0A 2V3OH 2I6SA 3O8DA 2WPMS 1CA0B 2P93A 4KTSA 1P01A 2F9VA 1GDUA 1C9TA 2FWWA 1IAUA 5AVDA 3WY8A 1AO5A 2BD3A 1QB6A 1C2IA 1M9UA 1C5PA 3SNAA 3RXJA 3SV6A 2BX4A 4U01A 1F0TA 1IQHA 2AS9A 3SUDA 1NRRH 3K65B 1HGTH 1BTUA 4WH6A 3TH3H 1F92A 1GCDA 2ESTE 3RXBA 5TCCA 1O5GH 2AGGX 1VITG 4Y10E 1MQ5A 1FAKH 4AB8A 3RLYH 1QA0A 4LZ4B 5H4IB 4RKJB 2HGTH 3UOPA 2BOHB 1VR1H 3NCLA 1QURH 1TGSZ 1O2JA 3F9FA 1RTFB 2EEKA 1IQIA 2FLRH 2FXRA 1GJCB 3BIVH 3F1SB 1AHTH 2F9UA 2CXVA 4NFEA 2P16A 5BPEA 5DP7A 3QGJA 1ZRKA 1C2KA 1OOKB 1O3HA 2BD8A 3GISB 1ETSH 2Y5FA 3P95A 4A1XA 1HAOH 1UCYK 2C3SA 1PPBH 2G4UA 4YTAA 2P3FH 5JBCS 1GBMA 2QF3A 4NSVA 4A7IB 5AF9H 2G4TA 1MTUA 2O8UA 1ESTA 3RMOH 2PV9B 4H4FA 1PFXC 1SR5C 1H9LB 3IWMA 3NPSA 3RXSA 3S7HB 2ZZUH 1O3CA 1RRKA 1C1MA 1ZJDA 5EODA 3LJJA 3P8OA 3L3TA 2TRMA 3DA9B 2H2ZA 4I8LA 3A84A 3ZV8A 3LGUA 3BTTE 1KTSB 3E8LA 3OY5U 4ABAA 4FUIA 1P2JA 5FPYA 1O39A 3MHWU 1O2MA 3BTDE 1GBLA 3VB3A 1P11E 2PSXA 1O2SA 1DANH 3PTBA 1NS3A 2AYWA 1NU9A 3FP8E 2ZGJA 3UUZA 4IBLH 1NN6A 2WYJA 1GI6A 1DE7H 1WUNH 2A7CA 2C93B 3FP7E 1OPHB 3HK3B 1C5XB 2A45B 1AZZA 4JK6A 1OP0A 2DUCA 3BTWE 1IQKA 1JXPA 4IMQA 4YT7H 4BXSA 1O3AA 3UQVA 1T31A 1EAXA 1GHAG 3RXIA 1TBRH 3GDUA 1D4PB 1GDQA 3MYWA 2A5IA 1KXAA 1SL3A 2G5VA 1A4WH 1OKXA 1BRBE 1CGIE 2V3HH 5GCHG 2QN5T 3EGKH 1BHXF 2AMQA 2Y5HA 3ATWA 1GI4A 1H8IH 3BG4C 1TNLA 3KQEA 2BZAA 2BYAX 1QRWA 1O3DA 2YOLA 3K6YA 4Y0YE 3TPIZ 4AG1A 4MDSA 1ZJKA 2WUBA 4TY6A 1ELCA 2UUFB 4BTIB 1MAXA 1D3DB 1GBBA 2P95A 1TYNA 1DFPA 1RXPA 4WMEA 1A3EH 3SORA 2PUQH 3U98H 1DLEA 4MPUA 1EOJA 1C5LH 3TJUA 4MVNA 2VWNA 1SQAA 1UTOA 1SOZA 8GCHF 5F6MA 1KXCA 8LPRA 3SGBE 3MH5A 5DP9A 4Y8YA 1OSSA 1XM1A 1DICA 4B2BA 2PKAA 3A80A 3MO3A 1LVYA 1W0ZU 4X1SU 3DT0H 1PPEE 4TWWA 2FODA 1J15A 1FY8E 4HGCA 2GCTB 1HJAB 1TQ7B 4K3JA 2Y82A 1ZHPA 1SPJA 2R2MB 5C20A 2SGAA 3HGPA 3CS0A 1K1PA 3GCOA 6CHAB 1ESAA 3UFAA 4X6NA 4ZHAA 3TIUA 3E91A 4O3TA 4NGAH 1P2OA 1Z8RA 2AGIX 1BJUA 1SGIB 2ZU5A 3LGIA 4B2CA 1HYLA 2ZA5A 1ORFA 3Q3KA 5ESTE 3BIUH 1ZSLA 1E37B 5FBIA 1YPHE 4O97A 4DG4A 3ZVDA 1W12U 1ZTLA 3MU4A 1T7CA 2HLCA 3E6PH 3B8JA 5B6OA 1O2RA 2WV4A 1G3BA 1XVMA 1THSH 2WINI 3HKIB 1WYKA 2A5AA 3RXRA 3EA9A 3E1XB 3PM3A 1ETTH 1FXYA 2ZKSA 3P8FA 3UWIA 1WTHD 1EPTC 5C3NA 2FS8A 1K1MA 3M7TA 1ZLRA 1NO9H 1QQUA 3R3GB 1DITH 1UHBA 3PB1E 1T32A 1BBRK 2F9BH 3TJVA 1LMWB 1L2EA 1P09A 1UMAH 1V2WT 5F8TA 3MU0A 2G51A 4X2WA 3M7UA 3KHVA 3VFEA 4X6PA 5K0HA 2ZEBA 2FX6A 1WOFA 3CENA 4CRBA 1LHDH 3PLPA 1O2LA 2ZFSA 1T8NA 1QQ4A 2RA0A 2ALPA 2BDHA 5EXMA 3SHAH 1QHRB 1JIMA 1FN8A 1TONA 1P9SA 2BVRH 2ZGBH 4UFDH 2H6MA 2EI8A 1CHOF 1H1BA 1QGFA 2B9LA 3QTVH 3SU1A 3RU4E 4WF8A 1LPGB 5GJ4B 2TGPZ 1AE8H 1GMDG 2UWPA 4Y7BA 4NZQA 4QT8C 3S9AA 4CRGA 3A81A 3LGTA 1UVSH 1BTYA 1BHXB 5C1YA 4Y7AA 3A8AA 3SV7A 4JZDH 2ZWLH 3UPEA 5BRRE 1LHFH 1RFNA 1YLCA 1EAWA 3FP6E 4KELA 1UK3A 4ZROA 2VIPA 4I8KA 4MPVA 2W26A 2Z9GA 3GY8A 2AIQA 1GHZA 1B7XB 4FUFA 1EZSC 1MU8B 2IPHA 3ZV9A 2RA3A 3A7VA 4NCYA 1FNIA 1CBWC 3ZZ6A 4CH8B 3SV9A 3AASA 4I8HA 1UK2A 4THNH 1SLUB 4NIXA 3T28A 5T6GA 8KME2 1CSOE 1O3MA 3RM0H 3BTFE 1F5LA 5C67A 1XUGA 1HAHH 1RGQA 4IS5A 4IN1A 4K1SA 4K1EA 1P9UA 3OU0A 3MH7A 3NKKA 1EATA 2AGEX 1VJ9U 3RU4D 3M5OA 5EPYA 1C2FA 1TPSA 3MI4A 4I8GA 1O3KA 1MTSA 2OC1A 5SGAE 1TALA 4M7GA 1ZGVA 4I33A 1ARCA 2TBSA 2GKVE 2RG3A 2ZDKA 1GHYH 3VEQB 2OBQA 4Q7ZA 2J38A 3T25A 1QY6A 1W7GH 4IN2A 3ZYEA 2J4IA 1SFQB 4XSKU 3BEIB 1BB0B 2BHGA 3QO6A 1GI5A 2GT7A 3MU1A 3UREA 1QRZA 5HYOA 2ZTYA 1GCTB 3SOSA 3O8RA 4BTUB 5EU8A 2WPKS 1D6WA 1KSNA 2PFEA 2HWLB 3RXOA 2Y81A 4NWKA 1O2OA 1E38B 2VIDA 3HGNA 3STJA 1SG8B 2EI7A 2J2UA 2GVFA 1Y3VA 1GJ7B 3F9HA 4WVPE 1B0FA 1TX6A 1P2MA 2PLXA 1SSXA 1UCYE 3LJOA 1IQLA 3LDXH 1W10U 2XNIA 2XXLA 1GVLA 5FBEA 3ATIA 2BVSH 2BQWB 3ITIA 1UTPA 3KNXA 5HXFA 2Q6GA 2ZC9H 1RTKA 1THRH 4ZXXH 3MMGA 3QUMP 4ISLA 7LPRA 1QFKH 5EXLA 3MTYA 5IYTA 1ELEE 1O3PB 3SO3A 1SHHB 2BY5X 1EQ9A 3MO6A 5EW2H 3BEUA 1AKSA 2WYGA 1TPPA 3SUGA 2O9QA 3ATLA 3U8OH 2AERH 2VVUA 3GYLB 2PTNA 1OYTH 4WWYA 3TK6A 1WQVH 3TK5A 2IJOB 2QF0A 3HPTB 4NG9H 2PSYA 1PPZA 5ABWA 2JKHA 1YPHC 3NZIA 1C1RA 1YCPH 3B23B 1MKWH 3FVFB 4DGJA 1F2SE 1C2EA 1P12E 1YP9A 1GHBF 2XBVA 3DFJA 4XOJA 3P6ZB 1O37A 1BDAA 2GDDA 1ANCA 5DJ7A 2JH0D 5CMXH 2FOCA 4PROA 1QNJA 1C4U2 1J8AA 3O8BA 1IQFA 2FEQH 1OP8A 1HIAB 5LH8A 3RMLH 1ABIH 1VJAU 1YGCH 4E7NA 3SJKA 1RS0A 2VGCC 1LDTT 1O32A 4A92A 1GL1A 2FYQA 2OLGA 4HZHA 2OC7A 1ID5H 1GBFA 3PV4A 3RXDA 3I77A 4VGCB 1O3BA 2Z9LA 4ZMAH 1P06A 1XVOA 2VU8E 4OS4A 4JZIA 3KCGH 5LGOA 2J94A 1S85A 2OUAA 2OXSA 5EGMA 4OS2A 2SGEE 1HXFH 5E2OA 2G81E 1BITA 3GDVA 1Z6EA 1ZPZA 1TBQH 4WXVA 3ZVCA 1O2TA 4YOJA 1UCYH 1YYY1 4IGDA 1AQ7A 4Y11E 1BT7A 1FMGA 1KLTA 5JDUB 2VWMA 1LVMA 4SGBE 1NFUA 2ANKH 3PMHB 5TCAA 2ZDNA 1HAVA 4ZKNU 4UFGH 2H5CA 1H9IE 3RXTA 1WQSA 2XC5A 1ELVA 4LZ1H 1QA7A 4UD9H 3N7OA 4B1TA 1XMNB 3ENSB 2FP7B 1Q3XA 2FOBA 4E7RG 3SUFA 1SLWB 1O2NA 2PGBB 3Q3YA 2AEIH 1C2DA 1TRMA 1TMUH 1TPAE 2A7HA 1C5ZB 4WY3A 3DFLA 2F9PA 2F3CE 2QIQA 1HAIH 1E34B 2PW8H 2BDAA 4X8SH 1OYQA 1VITH 1DDJA 5AFYH 5DP8A 1YCPM 2ZP0H 4FXGH 1NC6A 2J34A 4ABHA 1C2JA 1LHGH 1F5KU 1KTTB 4HFPB 2QXIA 2ZQ2A 1KXBA 2V6NA 2CMYA 4TWYA 3BG4B 2KAIA 2XW9A 1DWDH 2JETC 3RXLA 3D65E 4H6TA 4JYVH 4DCDA 2GX4A 2G5NA 3SBKA 1J17T 3P70B 1SI5H 1YPJH 3CP7A 3V12A 3BF6H 3PLBA 2BD4A 1HCGA 1PPGE 3EA7A 1FIZA 1C1SA 3KEEA 3NK8A 3HK6B 1C5UA 2BY9X 4OS7A 3JZ1B 1W11U 3Q77A 1X7AC 1VCPA 3ZZ8A 4J2YB 1W2KH 1QR3E 2BQ6B 2QC2A 1GBEA 1S83A 1ABJH 1CU1A 3UOUA 2Z9KA 3Q76A 1K1IA 4X6MA 5JBTA 2BLQA 4MNXA 4JMYA 2QAAA 1K2I1 1D9IA 1J14A 1GBTA 3SU5A 2A5KA 1WU1A 3VXFH 4DJZB 3GY5A 2GZ8A 1W7XH 1O33A 2BY6X 4ABBA 3M37A 1MKXK 3ATKA 4YT6H 2FTMA 2UWLA 1TX7A 1AB9B 2FI3E 1PPFE 4ZKSU 4NA9H 4GCHG 1NPMA 1F7ZA 3C1KA 3EDXB 5I46H 2A4RA 2XCFA 3UR6A 1O3EA 1T8MA 1KY9A 1EZQA 5F8XA 2FPZA 4D9QA 1OWIA 1SLXB 4B74A 4BAOB 3SGAE 1XUFA 2CF8H 3P8GA 1EOLA 3MH4A 5AFZH 4CHAC 3UNSA 1KIGH 2BTCE 3M3TA 3AVZA 4X8TH 4YESB 1L1NA 4VGCC 2ZU4A 1AIXH 1G2MA 1SFIA 4B71A 3UNQA 1TNGA 2Y7XA 1HAZB 1BTHH 1UVUH 1KDQB 1O2XA 1C5NH 3A7TA 4MPXA 4NA7A 1O2KA 2DE9A 3A89A 5DP3A 1EPTB 1L1JA 3ZZ3A 3M3VA 2GD4B 2SGDE 3BTQE 3SNDA 2ZTZA 1G36A 1TPOA 3T29A 4B2AA 4Y0ZE 1O2PA 1C1PA 4H6SB 3GY6A 2A2QH 4FVBA 2VIOA 1HB0B 2QGRA 1O5AB 2ZHFH 1C1WH 3RP2A 1BRUP 4GHTA 3RXAA 4UEHH 2FO9A 1YLDA 3ZZ4A 1TB6H 2Z3CA 3KQCA 1S81A 3E0NB 2H9TH 1OX1A 2ZPRA 1GJ5H 4A6LA 1ZTKA 1IQMA 2UUKB 2YNBA 2FMJA 4HI3A 1VZQH 1TA6A 1FY3A 1FLEE 1SGYE 1T4UH 3O8CA 3RXUA 2M5TA 3H7TA 2BXTH 3PMJA 3MNXA 1AWFH 3RM2H 1AI8H 1TGTA 3I78A 1SLVB 2ZU2A 4OS1A 1GI9B 2C4FH 1P03A 1P57B 2GV6A 1JRTA 2H9EH 3CS7A 1C5MD 5FHTA 1G3EA 4CRCA 4JZ1A 5L6NH 2ZIQH 4ZUHA 3ZZ9A 1W3CA 3VB5A 2P3UB 2QA9E 5FCRA 2W3KA 1CT4E 3QWCH 1KXEA 3VGCC 2FM2A 4ABGA 1C2MA 2BLVA 1PQ7A 4GSOA 1S82A 4Y6DA 4UONA 1XKBC 5HGGA 4JK5A 1PPHE 2ZHDA 3MO9A 2CHAB 5T6DA 2A4GA 1CQQA 1XUHA 1Y3XA 4Y71A 1TNJA 5A09A 2FI5E 1NY22 1RTLA 4XBBA 1NRPH 1LHCH 1UVPA 2GCHF 4BANB 2Y6TA 2Z9IA 1CBWB 1QIXB 3GY7A 2ZDAH 3K2UA 1FZZA 1MCTA 4JYTA 1FV9A 2I6QA 5A2MH 3K9XB 1HAGE 2VWLA 4U30A 1A5IA 1WTGH 1C1NA 3M3SA 2FYRA 4K8BA 1OS8A 2H1UA 3M36A 4OGXA 4KTUA 1HLTH 3U8RH 2O8WA 1ZZZA 2NWNA 2TGAA 4RN6A 2ZPQA 3DUXH 2VWOA 4MNYA 1HDTH 3A7XA 3LT3A 2Q6FA 3V13A 1MZDA 4BOHA 2DE8A 1ESBA 1L0ZA 2Z3EA 4SGAE 4I31A 3EE0B 1N1LA 1EB2A 1S5SA 2BD2A 1U6QA 4TPIZ 1K21H 4X2YA 5EQSA 1P05A 4X0WU 4R8TB 3GY3A 1AB9C 1ELBA 4CH2B 3M5MA 4J1YA 2OC8A 1EJAA 3PYHA 3MFJA 5CHAC 1UO6A 3G01A 7GCHG 2SNVA 1S84A 9ESTA 1YPGH 3RC5A 1UHBB 1LKAA 4NZLA 4DIIH 3GCTG 2VH0A 1C5YB 2VIVA 2VVCA 4JZEH 2FOFA 1TAWA 1T8LA 2ZFTA 1LKBA 2EC9H 4A1VA 3RC6A 5ETXA 3GY2A 1C5TA 1ZRBA 2ZCHP 4K2YA 3U1IB 6ESTA 1MD7A 2J92A 2LNCA 3M35A 1C1OA 1XUJA 3L33A 1DXWA 3DHKH 3ZZCA 1MAYA 1QL9A 1A5HA 4CREA 1TBZH 3VB4A 3OX7U 4LK4A 3D23A 8ESTE 1GBCA 1AMHA 2BD7A 1GHVH 1C5WB 1G30B 1V6DA 1GMHF 1HAPH 1O34A 1FONA 2XBYA 1P02A 3D49H 3KN2A 2ZTXA 2ZHEH 1P3EA 1ANBA 1UK4A 1HRTH 3PO1C 4AFSA 1P2IA 1VCQA 1O35A 1P0SH 1NZQH 1V3XA 3SJ9A 3LH3A 2WV5A 1EZUC 5TJXA 2ZO3H 2BY7X 1HUTH 4D9RA 4UFFH 4Q80A 5C5NA 1DUAA 5CE1A 4FU9A 3M7QA 2NU3E 3S9BA 1LO6A 3EQ0H 1DY8A 1NROH 2OTVA 4OS5A 3EYDA 1TGBA 1HNEE 5EXNA 2D26C 1GI8B 4TYDA 3ZZAA 1C5RA 1CO7E 1CT0E 1F5RA 1L1GA 2ZFFH 3A87A 1RD3B 2R3YA 2CHAC 1FUJA 4D7FA 1QL8A 1V2OT 1ZTJA 4ABIA 2STAE 3PROA 4X1PU 3ZYDA 2VGCB 2TIOA 2QCYA 1LVOA 4B76A 1WBGB 3LIWA 1Y5UT 1BUIA 4CR5A 2PTCE 4XDEA 1O0DH 1ZOMA 3U9AH 3RXCA 1FY4A 5PTPA 1ZGIA 3VB7A 2XBXA 3SHCH 1O3FA 1SBWA 1A5GH 1GJ6A 1BRCE 2BOKA 2HVXA 3SNCA 2B7DH 1C9PA 1OXGA 4MG3A 4YZUA 5GPIB 1O5CB 2BVXH 3KQDA 2Z94A 2PR3A 1MD8A 1SQTA 1N8OC 1O5DH 4K5ZA 1GVKB 1QB1A 1UTMA 4F49A 5EQQA 1VITF 5EOKA 4ZKOU 4IMZA 3TU7H 1KLJH 3TGKE 1OWKA 1O2UA 1IHSH 1ANDA 3SQEE 1TOMH 2SGPE 3QX5H 3RXPA 4AYYB 1HAXB 4CBNA 1O30A 3A85A 4XE4A 3SU6A 1O38A 1IHTH 1GG6C 2HNTE 4INHA 1P8VC 3ZZ7A 5GXPA 4CRFA 1DLKB 3HKJB 1GGDC 3OSYA 4E06H 1C5OH 1J16A 2SGQE 2FI4E 1EKBB 1SGDE 5DK1A 2BY8X 1V2UT 4DURA 1NFYA 4BXWA 2JH6D 3P17H 2ZCKP 1NM6A 2ZQ1A 1VGCC 2PWXA 1A3BH 2A2XH 2CF9H 3ZZDA 4MNWA 1MUEB 2W7UA 2AMPA 3VPKA 1MBMA 2ZFQH 2TGTA 3BTHE 2FS9A 2QXJA 1ZMJA 4CR9A 1P3CA 1QTFA 2HOBA 1DPOA 1O5EH 4IC6A 3V0XA 5C2ZA 1MCVA 3RXEA 4NA8A 3A7ZA 3QTOH 4AX9H 1BTZA 1WCZA 4O03A 3UQOA 1AWHB 4CRDA 2JETB 2P8OC 4WH8A 5EG4A 4NIYA 1QCPA 4AGKA 5E0JA 2OCVB 2R2WU 5C5OA 2O8TA 5A8XA 2ZCLP 1DWBH 1BJVA 4I8JA 1GBKA 3H5CB 1C4Y2 1TGCA 2ZU1A 4YOGA 1QBOA 4CBOA 1UJ1A 3RU4T 4K1TA 1T4VH 2XBWA 3LOXA 4ZAEA 3LC5A 2ZI2H 3A7YA 1DXPA 1ELTA 4X8UH 1DSTA 1BRAA 4ZH8A 3KGPA 4FUDA 2CN0H 2BDYA 2OINA 3QGNB 4BTTB 3UTUH 3SZNA 4MQAA 4AB9A 1IQEA 8GCHG 4DOQA 1KXDA 4FUCA 3U1JB 1K9OE 1JIRA 4NFFA 4FUGA 1GHAF 4BAQB 1GJ8B 6GCHG 1BA8B 2CGAA 1PQAA 3Q00A 1K1NA 1HV7A 2J9NA 4Y8XA 2GV7A 1P2NA 1LPKB 2A4QA 5GCHF 2WUCA 2QXGA 4GLYA 2XCNA 1LQDB 2ZFPH 3ZVFA 2HALA 1HJ8A 3C27B 1QJ7B 3A8CA 3ODDA 1OP2A 1O3LA 1FJSA 3T2NA 1S6HA 1V2RT 1JWTA 4CHAB 2PKSC 1C1TA 5EPNA 3A7WA 2QYIA 1AVXA 3KQBA 1G2LA 1MMJN 1DT2A 3MU5A 5AHGH 4MNVA 4FVDA 2FOAA 3S7KB 1MU6B 4ZXYH 4B73A 4AFZA 1H8DH 1Y3YA 3NXPA 2Z9JA 3GCHC 1C2HA 1YPEH 1V2TT 1MTWA 3URCA 2BXUH 4U32A 1DOJA 2H9HA 1QJ1B 1Z71A 2BLOA 1TGNA 3TH4H 1P04A 2ZDLA 3SN8A 4Z0KA 2C90B 1BTWA 4YLQH 1UVTH 1ZMLA 1RIWC 1HIAA 4NSYA 2UUJB 3ZVEA 1F0SA 5J4SA 4WMFA 1O5BB 1BTPA 3JZ2B 1GJAB 1PYTC 4I32A 3A8BA 2C8ZB 2FX4A 5EW1H 3ATMA 1TFXA 2QXHA 3NUMA 1SGQE 1XXDA 5T6FA 3ELAH 2FOMB 1NRNH 3RXKA 1NU7B 1IQNA 2AH4X 1C4V2 2KAIB 1Z6JH 1GI1A 3LH1A 1DX5M 3RXMA 1HJ9A 4WXIA 1O2QA 2ODPA 1C1UH 1O3OA 2WPJS 3OYPA 1TOCB 4AYVB 3ZVGA 1O2GH 1O3GA 3SI3H 3VGCB 1G37A 1K22H 1OWHA 4FU7A 1CGJE 4RSPA 1BMLA 2G55A 3MH6A 2CV3A 3RXHA 1Y5AT 4BAHB 1LHEH 2P59A 2EI6A 4KTCA 1EXFA 5J4QA 1V2JT 3SNBA 5DPAA 3E90B 3QZQA 4NWLA 1AUTC 3AW0A 4IC5A 5LPRA 1MZAA 1E35B 1AE5A 5HM2A 1O2IA 1ZYOA 3STIA 1E36B 1QBVH 2F83A 1QBNA 1Z1IA 1G3DA 1CHGA 4B75A 4GPGA 1BBRE 1MTNC 3PWBA 1F0RA 1Q2WA 3UR9A 5L2YH 3LGWA 1YCPK 4XBDA 1MKWK 1C5VA 1QRXA 4UE7H 3IITA 1O2WA 2A7JA 1HBTH 4INLA 4ABDA 2HNTC 2GMTC 5LPEA 1ELAA 5FAHA 4Y8ZA 2O8MA 5E0GA 1OWJA 2VB0A 1HFDA 5DP4A 3T27A 2B0FA 2FLBH 3QZRA 2B8OH 5DKMA 1GJBB 1GMDF 3BG8A 3SGQE 4JZFH 1GWAA 1FPCH 3PLKA 1YM0A 4X1NU 4O3UA 2BB4A 4JCNA 3F68H 1GI7B 3U69H 3A82A 5HMAA 3TGIE 1NFXA 4YOIA 5CHAB 1ZMNA 1NFWA 1ZHRA 1ANEA 1GI3A 2A32A 1C2LA 1GJ4H 3QLPH 2ANWA 4FU8A 2ULLA 1O31A 3VB6A 3M5LA 2BD5A 1SGRE 1ZPCA 1SMFE 1V2MT 1H9HE 1GBDA 2Q6DA 2ZU3A 3NWUA 2RCEA 4HTCH 1O5FH 2FOHA 5FCKA 1MH0A 3GOVB 2HPPH 1YKTA 5A0BA 1CA8B 1FAXA 5C1UA 3LGYA 1A2CH 4KKDA 3TH2H 1V2QT 2BDIA 3RXQA 1D3PB 4UDWH 4ISHH 2FZZA 5A8ZA 3LPRA 1Z8GA 7KMEH 2D1JA 4ZKRU 2VJ1A 5IDKA 2K1QA 5HM9A 3FAOA 4GHQA 3GY4A 2WPLS 3PO1B 1K1LA 1EP5A 2CJIA 5ESBA 1BOQA 5DO4H 2F9NA 4CRAA 1D3QB 2ANMH 5JB8S 2SFAA 3FZDA 1SGNE 1LVBA 1P2KA 1YPLH 1KXFA 1EASA 1A0LA 1FIWA 4TPYA 1BBRH 1O3IA 1O2VA 3GYMA 3SJOA 3GCNA 1YPMH 1KDQA 4ASHA 5JBBS 4AGJA 2FIRH 1A0JA 4DIHH 4OGYA 1GPZA 1EPTA 2C8WB 5JYIA 1N6XA 4KGAA 1TNIA 1DSUA 3LKWA 2VIQA 3PTNA 1ZSKA 1DWEH 1E0FD 1XX9A 3LC3A 1Z7KA 1J9CH 2ZG0H 1EUFA 3QK1A 3MNSA 1GHBG 3A86A 1NRQH 1EAIA 2VIWA 3BEFB 4OS6A 3SV2H 1AFEH 2PKAB 1YC0A 4YM9A 1SB1H 4FUEA 3ZVAA 2XWBI 1ZR0A 1EAUA 2RDLA 2NU0E 1AFQC 3Q3XA 1JRSA 3ODFA 3GICB 1RJXB 2ZFRH 1QL7A 3SQHE 3T26A 1L4ZA 3A8DA 2H5DA 1JMOH 3RLWH 1XKAC 1YBWA 4LOYH 4U2WA 3UY9A 1CA0C 3K6ZA 4DY7B 2OC0A 1K1JA 1DS2E 2BM2A 3A88A 1SQOA 2PGQB 1CE5A 5L2ZH 1N8OB 1A61H 2ALVA 2OBOA 1D3TB 4O9VA 3SJ8A 3MNBA 1BQYA 2THFB 2BDCA 3TVJB 1AY6H 4X1QU 3T62A 2Z3DA 4Q7YA 4ABJA 1AN1E 6GCHF 1UTLM 4MPWA 3GDSA 2FOEA 1TX8A 1THPB 1A7SA 1DM4B 4ABEA 2AIPA 2BDGA 1GG6B 2D8WA 1CGHA 1GMCG 1BTXA 3ZZBA 1GBIA 1GGDB 1V2VT 1V2NT 1TQ0B 1AZ8A 1W0YH 1OWDA 3E0PB 4AFUA 1A1RA 3TJOA 3RXGA 2BQ7B 2P94A 1D6RA 1Q31A 1FY1A 2JH5D 1LQEA 1VGCB 4YLUA 1DVAH 2VNTA 3KIDU 3LGVA 3ESTA 1SGTA 1PJPA 1O2YA 1ARBA 1Z8JB 1SOTA 4IW4E 1IQGA 1EZXC 1VCWA 2ZPSA 3UIRA 1GHXH 4Q7XA 1AGJA 3RUOA 2ILNA 2FDAA 2OQ5A 3SU4A 4I7YH 2LPRA 1TRYA 1GI0A 2VINA 1BMNH 3TK9A 5GWZA 1W8BH 1GVZA 4Q2KA 3TGJE 1LCYA 1XXFA 1SHYA 2P8OB 2R0KA 4K60A 2ZNKH 1Y3UA 5FX6A 1ZPBA 2STBE 3BV9B 1TE0A 3AAVA 1K1OA 3AAUA 1JOUB 1FN6A 2J95A 1NESE 4FUBA 4WMDA 1TMTH 3LU9B 3BSQA 4K8YA 5F03A 1A0HB 2GGVB 2BDBA 2V35A 1TWXB 6LPRA 1P10A 5FPTA 5EQRA 3TLOA 5A0CA 2HNTF 3HATH 1EB1H 5I25A 4BAKB 2W3IA 1HPGA 2FESH 2HPQH 5E0HA 2XC4A 3TNTA 5L30H 4JYUH 2G8TA 2VH6A 1G3CA 2P3TB 1A46H 2A4OA 2XRCA 3OY6U 2ODQA 3H7OA 1FY5A 1LTOA 2W7SA 2IOTA 2IN2A 5C1XA 3ZZ5A 2EA3A 1IQJA 5K7RA 1UTNA 3SNEA 2GTBA 1FDPA 1YF4A 1BCUH 4GAWA 3RXFA 4BNRA 2GZ9A 3OTJE 1NRSH 3V3MA 1O3NA 1BMAA 3L6PA 4NIWA 5E8EH 1GBJA 3KL6A 2PKSB 3SV8A 3QN7A 3E16B 4MTBA 5A8YA 2AMDA 2ZGCA 3P92A 2GZ7A 1UTJA 2D2DA 4YO9A 2Y5GA 1TNKA 2W5EA 3GCHB 1AVGH 1WAYB 3R0FA 1JBUH 5T3HA 4ESTE 1S0QA 2UUYA 4FUHA 3S0NA 3M61U 5JBAS 1DY9A 4X6OA 1ZHMA 4ISIH 3SU3A 2ZDVH 1RIWB 3BTGE 3QDZB 1Y3WA 2BD9A 1MTVA 3T5FH 5GDSH 1SC8U 3W94A 1TNHA 3MOCA 2F9OA 1B0EA 1ELFA 1EX3A 4GCHF 1GBHA 5JPMH 1C1QA 1O2ZA 4BAMB 2GCTC 1HJAC 1Z8IB 2TGDA 1H4WA 2OD3B 4LXBH 1V2KT 1ELDE 1V2PT
chains in the Genus database with same CATH superfamily
1CT2E 1N6YA 2ZHQH 3LONA 6CHAC 1PYTD 3URDA 3FANA 4AORA 3SU0A 5F8ZA 3FFGA 1PPCE 1TLDA 3BN9A 1Y59T 2G00A 1SGEE 2FTLE 5GIBA 1AKSB 1SGFA 1KLIH 1C5QA 2AFQB 3P8NA 2ASUB 2YNAA 4ABFA 2QV1A 4D8NA 4XFQA 4D7GA 2R0LA 1OWEA 4INKA 4P00A 3EAJA 1B5GH 4DVAU 2TPIZ 1G9IE 1HAYB 2HRVA 2Q1JA 4ZHMU 3PWCA 4F48B 3B9FH 3SUEA 2KFWA 3NRLA 5C0TA 1AU8A 2ZGXH 3VG8A 4Z6AH 1IOEA 1DWCH 2R3UA 2ZDMA 4FUJA 5DG6A 1MTNB 2A0QB 2PHBA 1C1VH 1PQ5A 1GL0E 2XC0A 4D76A 3MWIU 4A5TS 4X8VH 1XUIA 4AFQA 2KCAA 3BTKE 3TNSA 2NU4E 1BZXE 2GMTB 1LPZB 4AN7A 3MU8A 2GCHG 2WPIS 4X2XA 2ODYB 2ZECA 3SW2B 2Z6BD 3UNRA 4AG2A 5DN6D 1P2QA 5FXLA 5JB9S 3DSPA 3SJIA 1BMMH 1AD8H 2V0BA 1Y5BT 2PUXB 4K69A 3ZVBA 2GDEH 4X2VA 1SGCA 1ZSJA 2VVVA 1WSSH 1FI8A 5E2PA 3F9GA 1HXEH 2BZ6H 3S69A 3BTME 2Z7FE 1SGFG 3TITA 2L6OA 4MLFB 1MQ6A 2NU1E 2GP9B 3KF2A 1TA2A 4HG6A 1S6FA 1SGPE 5DP6A 1ETRH 3RC4A 4TY7A 2B5TB 1O2HA 1XUKA 2XYAA 2A31A 2ZGHA 1WV7H 1FPHH 5LPFA 3VXEH 1GI2A 2O8LA 3FKSD 4RKOB 3W95A 1PQ8A 3KYGA 4A1TA 1T8OA 1GHWH 1Z1JA 5CDFE 2ANYA 1MKXH 2WV9A 3RDZA 1HAVB 1GBAA 1KYNA 4WJG2 4ZHLU 5FPSA 1E79D 2XTTB 4DW2U 4Y76A 4GVUA 1S0RA 3V7TA 4E05H 2Y7ZA 1EJMA 1UW7A 3FZZA 5DP5A 1BIOA 3E3TA 3F9EA 1TABE 5DGJA 1V2ST 1DUEA 7ESTE 1GJDB 1L4DA 1W14U 3TJNA 2R9PA 1UTKA 1EP6A 1SVPA 3EA8A 2A1DB 2BMGB 1GMHG 1ACBE 1NT1A 3RXVA 3A83A 5G4BA 1W13U 2ZHWH 2BLWA 7GCHF 1O36A 1TMBH 1NTPA 1GMCF 2F91A 3DD2H 4Y79A 3GCTF 1K28D 1AVWA 4AOQA 4ISNA 1NBME 1GJ9B 2SNWA 3M5NA 2NU2E 1G32B 3PMBB 4X1RU 1FQ3A 3MNCA 3F6UH 1C5SA 2C8XB 4OM9A 3D62A 1TRNA 3AW1A 1C2GA 4UFEH 4GUXA 1GCTC 1CHOG 2WZQA 3SI4H 3IG6B 2KR7A 3S9CA 1Y8TA 2OP9A 2Y80A 2V7QD 4AZ2B 1QB9A 2SGFE 3I29A 1TIOA 5A0AE 2WPHS 3U8TH 1UVOA 3BTEE 3PMAB 1ELGA 3RMMH 1CVWH 2GT8A 4F4OC 3UWJH 2G52A 4R0IA 2QY0B 5FX5A 3SU2A 1F0UA 4ISOA 1UTQA 1QJ6B 1YPKH 2FOGA 1AFQB 3RMNH 2BX3A 4H42U 4NIVA 3UB0A 4XBCA 2ZF0H 4DT7B 1AUJA 1O3JA 1MBQA 2OQUA 2XWAA 1GDNA 9LPRA 1V2LT 2C8YB 2UWOA 1INCA 1EJNA 4KP0A 2V3OH 4ASUD 2I6SA 3O8DA 2WPMS 1CA0B 2P93A 4KTSA 1P01A 2F9VA 1GDUA 1C9TA 2FWWA 1IAUA 5AVDA 3WY8A 1AO5A 2W6ID 2BD3A 1QB6A 1C2IA 1M9UA 1C5PA 3SNAA 4ACBA 3RXJA 3SV6A 2BX4A 4U01A 1F0TA 1IQHA 2AS9A 3SUDA 1NRRH 3K65B 2JIZD 1HGTH 1BTUA 4WH6A 2GJGA 3TH3H 1F92A 1GCDA 2ESTE 3RXBA 5TCCA 1O5GH 2AGGX 1VITG 4Y10E 1MQ5A 1FAKH 4AB8A 3RLYH 1QA0A 4FETA 4LZ4B 5H4IB 4RKJB 2HGTH 3UOPA 2BOHB 1VR1H 3NCLA 1QURH 1TGSZ 1O2JA 3F9FA 1RTFB 2EEKA 1IQIA 2FLRH 2FXRA 1GJCB 3BIVH 3F1SB 4B6FA 1AHTH 2F9UA 2CXVA 4NFEA 2P16A 5BPEA 5DP7A 3QGJA 1ZRKA 1C2KA 1OOKB 1O3HA 5F53A 2BD8A 3GISB 1ETSH 2Y5FA 3P95A 4A1XA 1HAOH 1UCYK 2C3SA 1PPBH 2G4UA 4YTAA 2P3FH 5JBCS 1GBMA 2QF3A 4NSVA 4A7IB 5AF9H 2G4TA 1MTUA 2O8UA 1ESTA 3RMOH 2PV9B 4H4FA 1PFXC 1SR5C 1H9LB 3IWMA 3NPSA 3RXSA 3S7HB 2ZZUH 1O3CA 1RRKA 1C1MA 1K0HA 2KX4A 1ZJDA 5EODA 3LJJA 3P8OA 3L3TA 2TRMA 3DA9B 2H2ZA 4I8LA 3A84A 3ZV8A 3FO8D 3LGUA 3BTTE 2J5UA 1KTSB 3E8LA 3OY5U 4ABAA 4FUIA 1P2JA 5C17A 5FPYA 1O39A 3MHWU 1O2MA 3BTDE 1GBLA 3VB3A 1P11E 2PSXA 3U28C 1O2SA 1DANH 3PTBA 1NS3A 2AYWA 1NU9A 3FP8E 2ZGJA 3UUZA 4IBLH 1NN6A 2WYJA 1GI6A 1DE7H 1WUNH 2A7CA 2C93B 3FP7E 1OPHB 3HK3B 5T1VA 1C5XB 2A45B 1AZZA 4JK6A 2F4LA 1OP0A 2DUCA 3BTWE 1IQKA 1JXPA 4IMQA 4YT7H 4BXSA 1O3AA 2RDEA 3UQVA 1T31A 1EAXA 1GHAG 3RXIA 1TBRH 3GDUA 1D4PB 1GDQA 3MYWA 2A5IA 1KXAA 1SL3A 2G5VA 3H09A 1A4WH 1OKXA 1BRBE 1CGIE 2V3HH 5GCHG 2QN5T 3EGKH 1BHXF 2AMQA 2Y5HA 3ATWA 3WWFA 1GI4A 1H8IH 3BG4C 1TNLA 3KQEA 2BZAA 2BYAX 1QRWA 1O3DA 2YOLA 3K6YA 4Y0YE 4RT1A 3TPIZ 4MDSA 1ZJKA 2WUBA 4TY6A 1ELCA 2HVYB 2UUFB 4BTIB 1MAXA 1D3DB 4XD7D 1GBBA 2P95A 1TYNA 1DFPA 1RXPA 4WMEA 1A3EH 3SORA 2PUQH 3DCLA 3U98H 1DLEA 2V3MA 4MPUA 1EOJA 3OEHD 1C5LH 3TJUA 5C94A 4MVNA 2VWNA 1SQAA 1UTOA 1SOZA 8GCHF 5F6MA 1KXCA 8LPRA 3SGBE 3MH5A 5DP9A 4Y8YA 1OSSA 1XM1A 1DICA 4B2BA 5EJLA 2PKAA 3A80A 3MO3A 1LVYA 1W0ZU 4X1SU 3DT0H 1PPEE 4TWWA 2FODA 1J15A 1FY8E 4HGCA 2GCTB 1HJAB 1TQ7B 4K3JA 2Y82A 1ZHPA 1SPJA 2YMSB 2R2MB 5C20A 2SGAA 3HGPA 3CS0A 1K1PA 3GCOA 6CHAB 1ESAA 3UFAA 4X6NA 4ZHAA 3TIUA 3E91A 4O3TA 4NGAH 1P2OA 1Z8RA 2AGIX 1BJUA 1SGIB 2ZU5A 3LGIA 4B2CA 1HYLA 3UAIC 2ZA5A 1ORFA 3Q3KA 5ESTE 3BIUH 1ZSLA 1E37B 5FBIA 1YPHE 4O97A 4DG4A 3ZVDA 1W12U 1ZTLA 3MU4A 1T7CA 2HLCA 3E6PH 3B8JA 2WPDD 5B6OA 1O2RA 2WV4A 1G3BA 1XVMA 1THSH 2WINI 3HKIB 1WYKA 2A5AA 3RXRA 3EA9A 3E1XB 3PM3A 1ETTH 1FXYA 2ZKSA 3P8FA 3UWIA 1WTHD 1EPTC 5C3NA 2FS8A 1K1MA 3M7TA 1ZLRA 1NO9H 1QQUA 3R3GB 1DITH 1UHBA 3PB1E 2W6JD 1T32A 1MABB 1BBRK 2F9BH 3TJVA 1LMWB 1L2EA 1P09A 1UMAH 1V2WT 5F8TA 3MU0A 2G51A 4X2WA 3M7UA 3KHVA 3VFEA 4X6PA 5K0HA 2ZEBA 2FX6A 1WOFA 3CENA 4CRBA 1LHDH 3PLPA 1O2LA 2ZFSA 1T8NA 1QQ4A 2RA0A 2ALPA 2BDHA 5EXMA 3SHAH 1QHRB 1JIMA 1FN8A 1TONA 1P9SA 2BVRH 2ZGBH 4UFDH 2H6MA 2EI8A 1CHOF 1H1BA 1QGFA 2B9LA 3QTVH 3SU1A 3RU4E 4WF8A 1LPGB 5GJ4B 2TGPZ 1AE8H 1GMDG 2UWPA 4Y7BA 4NZQA 4QT8C 3S9AA 4CRGA 3A81A 3LGTA 1UVSH 1BTYA 1BHXB 5C1YA 4Y7AA 3A8AA 3SV7A 4JZDH 2ZWLH 3UPEA 5BRRE 1LHFH 1RFNA 1YLCA 1EAWA 3FP6E 4KELA 1UK3A 4ZROA 2VIPA 4I8KA 4MPVA 2W26A 2Z9GA 3GY8A 3F2GA 2AIQA 1GHZA 1B7XB 4FUFA 1EZSC 1MU8B 2IPHA 3ZV9A 2RA3A 3A7VA 4NCYA 1FNIA 1CBWC 3ZZ6A 4CH8B 3SV9A 3AASA 4I8HA 1UK2A 4THNH 4DT4A 1SLUB 4NIXA 3T28A 5T6GA 8KME2 1CSOE 1O3MA 3RM0H 3BTFE 1F5LA 5C67A 1XUGA 1HAHH 1RGQA 4IS5A 4IN1A 4K1SA 4K1EA 1P9UA 4ZCNA 3OU0A 3MH7A 3NKKA 1EATA 2AGEX 1VJ9U 1E1QD 3RU4D 3M5OA 5EPYA 1C2FA 1TPSA 3MI4A 4I8GA 1O3KA 1MTSA 2OC1A 5SGAE 1TALA 4M7GA 1ZGVA 4I33A 1ARCA 2TBSA 2GKVE 2RG3A 2ZDKA 1GHYH 3VEQB 2OBQA 4Q7ZA 2J38A 3T25A 1QY6A 1W7GH 4IN2A 3ZYEA 2J4IA 1SFQB 4XSKU 3BEIB 1BB0B 2BHGA 3QO6A 1GI5A 2GT7A 3MU1A 2LELA 3UREA 1QRZA 5HYOA 2ZTYA 1GCTB 3SOSA 3O8RA 4BTUB 5EU8A 2WPKS 1D6WA 1KSNA 2PFEA 2HWLB 3RXOA 2Y81A 4NWKA 1O2OA 1E38B 2VIDA 3HGNA 3STJA 1SG8B 2EI7A 2J2UA 5C0UA 2QE7D 2GVFA 5EJ1A 1Y3VA 1GJ7B 3F9HA 4WVPE 1B0FA 1TX6A 1P2MA 3F3BA 2PLXA 1SSXA 1UCYE 3LJOA 1IQLA 3LDXH 1W10U 2XNIA 2XXLA 1GVLA 5FBEA 3ATIA 2BVSH 2BQWB 3ITIA 1UTPA 3KNXA 5HXFA 4TT3D 2Q6GA 2ZC9H 1RTKA 1THRH 4ZXXH 3MMGA 3QUMP 4ISLA 7LPRA 3KYFA 1QFKH 5EXLA 3MTYA 5IYTA 1ELEE 1O3PB 3SO3A 1SHHB 2BY5X 1EQ9A 3MO6A 5EW2H 3BEUA 1AKSA 2WYGA 1TPPA 3SUGA 2O9QA 3ATLA 3U8OH 2AERH 2VVUA 3GYLB 2PTNA 1OYTH 4WWYA 3TK6A 1WQVH 5HIYA 3TK5A 2IJOB 2QF0A 3HPTB 4NG9H 3AK5A 2PSYA 1PPZA 5ABWA 2JKHA 1YPHC 3NZIA 1C1RA 1YCPH 3B23B 1MKWH 3FVFB 4DGJA 1F2SE 1C2EA 3DSOA 1P12E 1YP9A 3F0PA 1GHBF 2XBVA 3DFJA 4XOJA 3P6ZB 1O37A 1BDAA 2GDDA 1ANCA 5DJ7A 2JH0D 5CMXH 2FOCA 4PROA 1QNJA 1C4U2 1J8AA 3O8BA 1IQFA 2XOKD 5KGOA 2FEQH 1OP8A 1HIAB 5LH8A 2K8IA 4AC9A 1SKYE 3RMLH 1ABIH 1VJAU 1YGCH 4E7NA 3SJKA 1RS0A 2VGCC 1LDTT 2KCYA 1O32A 3PV5A 4A92A 3MQKC 1GL1A 2FYQA 2OLGA 4HZHA 2OC7A 1ID5H 1GBFA 3PV4A 3RXDA 3I77A 4VGCB 1O3BA 2Z9LA 4ZMAH 1P06A 1XVOA 2VU8E 4OS4A 4JZIA 1QZ8A 3KCGH 5LGOA 2J94A 1S85A 2OUAA 2OXSA 5EGMA 2LP6A 3F2FA 4OS2A 2SGEE 1HXFH 5E2OA 2G81E 1BITA 3GDVA 1Z6EA 1ZPZA 1S6LA 1TBQH 4WXVA 3ZVCA 1O2TA 4YOJA 1UCYH 1YYY1 4IGDA 1AQ7A 4Y11E 1BT7A 1FMGA 1KLTA 5JDUB 2VWMA 1LVMA 4SGBE 4Z1MD 1NFUA 2ANKH 3PMHB 5TCAA 2ZDNA 1HAVA 4ZKNU 4UFGH 2H5CA 1H9IE 3RXTA 1WQSA 2XC5A 1ELVA 4LZ1H 1QA7A 4UD9H 3N7OA 4B1TA 1XMNB 3ENSB 2FP7B 1Q3XA 2FOBA 4E7RG 3SUFA 1SLWB 1O2NA 2PGBB 3Q3YA 2AEIH 1C2DA 1TRMA 1TMUH 1TPAE 2A7HA 1C5ZB 4WY3A 2HLDD 3DFLA 2F9PA 2F3CE 2QIQA 1HAIH 1E34B 2PW8H 2BDAA 4X8SH 1OYQA 1VITH 1DDJA 5AFYH 5DP8A 1YCPM 2ZP0H 4FXGH 1NC6A 3SZEA 2J34A 4ABHA 1C2JA 1LHGH 1F5KU 1KTTB 4HFPB 3WWBA 2QXIA 2ZQ2A 1KXBA 2V6NA 2CMYA 4TWYA 3BG4B 2KAIA 2XW9A 1DWDH 2JETC 3RXLA 3D65E 4H6TA 4JYVH 4DCDA 2GX4A 2G5NA 3SBKA 1J17T 3P70B 1SI5H 1YPJH 3CP7A 3V12A 3BF6H 3FN8A 3PLBA 2BD4A 1HCGA 2J97A 1PPGE 3EA7A 1FIZA 1C1SA 3KEEA 3NK8A 3HK6B 1C5UA 2BY9X 4OS7A 3JZ1B 1W11U 3Q77A 1X7AC 1VCPA 3ZZ8A 4J2YB 1W2KH 1QR3E 2BQ6B 2QC2A 1GBEA 1S83A 1ABJH 1CU1A 3UOUA 2Z9KA 3Q76A 1K1IA 4X6MA 5JBTA 2BLQA 4MNXA 4JMYA 2QAAA 1K2I1 1D9IA 1J14A 1GBTA 3SU5A 2A5KA 1WU1A 4B6EA 3VXFH 4DJZB 3GY5A 2GZ8A 1W7XH 1O33A 2BY6X 4ABBA 3M37A 4YXWD 1MKXK 3ATKA 4YT6H 2FTMA 2UWLA 1TX7A 1AB9B 2FI3E 1PPFE 4ZKSU 4NA9H 4GCHG 1NPMA 1F7ZA 3C1KA 3EDXB 5I46H 2A4RA 2XCFA 3UR6A 1O3EA 1T8MA 1KY9A 1EZQA 5F8XA 2FPZA 4D9QA 1OWIA 1SLXB 4B74A 4BAOB 3SGAE 1XUFA 2CF8H 3P8GA 1EOLA 3MH4A 5AFZH 4CHAC 3UNSA 1KIGH 2BTCE 3M3TA 3AVZA 4X8TH 4YESB 1L1NA 4VGCC 2ZU4A 1AIXH 1G2MA 1SFIA 4B71A 3UNQA 1TNGA 2Y7XA 1HAZB 1BTHH 1UVUH 1KDQB 1O2XA 1C5NH 3A7TA 4MPXA 4NA7A 1O2KA 2DE9A 3A89A 5DP3A 1EPTB 1L1JA 2WSSD 3ZZ3A 3M3VA 2GD4B 2SGDE 3BTQE 3SNDA 2ZTZA 1G36A 1TPOA 3T29A 4B2AA 4Y0ZE 1O2PA 1C1PA 4H6SB 3GY6A 2A2QH 4FVBA 2VIOA 1HB0B 2QGRA 1O5AB 2CK3D 2ZHFH 1C1WH 3RP2A 1BRUP 4GHTA 3RXAA 4UEHH 2FO9A 1YLDA 3ZZ4A 1TB6H 2Z3CA 3KQCA 1S81A 3E0NB 2H9TH 3F2HA 1OX1A 2ZPRA 1GJ5H 4A6LA 1ZTKA 1IQMA 2UUKB 2YNBA 2FMJA 4HI3A 1VZQH 1TA6A 1FY3A 1FLEE 1SGYE 1T4UH 3O8CA 3RXUA 2M5TA 3H7TA 2BXTH 3PMJA 3MNXA 1AWFH 3RM2H 1AI8H 1TGTA 3I78A 1SLVB 2WHXA 2ZU2A 4OS1A 1GI9B 2C4FH 1P03A 1P57B 2GV6A 1JRTA 2H9EH 3CS7A 1C5MD 5FHTA 1G3EA 4CRCA 4JZ1A 5L6NH 1WDIA 2ZIQH 4ZUHA 3ZZ9A 1W3CA 3VB5A 2P3UB 2QA9E 5FCRA 2W3KA 1CT4E 3QWCH 1KXEA 3VGCC 4FOUC 3PV2A 2FM2A 4ABGA 4RT0A 5EIYA 1C2MA 2BLVA 1PQ7A 4GSOA 1S82A 4Y6DA 4UONA 1XKBC 5HGGA 4JK5A 1PPHE 2ZHDA 3MO9A 2CHAB 2JJ2D 5T6DA 2A4GA 1CQQA 1XUHA 1Y3XA 4Y71A 1TNJA 5A09A 2FI5E 1NY22 1RTLA 4XBBA 1NRPH 1LHCH 1UVPA 2GCHF 4BANB 2Y6TA 2Z9IA 1CBWB 1QIXB 3GY7A 2ZDAH 3K2UA 1FZZA 1MCTA 4JYTA 1FV9A 2I6QA 5A2MH 3K9XB 1HAGE 2VWLA 3OAAD 4U30A 1A5IA 1WTGH 1C1NA 3M3SA 2FYRA 4K8BA 1OS8A 2H1UA 3M36A 4OGXA 4KTUA 1HLTH 3U8RH 2O8WA 1ZZZA 2NWNA 2TGAA 4RN6A 2ZPQA 3DUXH 2VWOA 4MNYA 1HDTH 3A7XA 3LT3A 3PRBA 2Q6FA 3V13A 1MZDA 4BOHA 2DE8A 1ESBA 1L0ZA 2Z3EA 4SGAE 2VBCA 4I31A 3EE0B 1N1LA 4Q4LA 1EB2A 1S5SA 2BD2A 1U6QA 4TPIZ 1K21H 4X2YA 5EQSA 1P05A 4X0WU 4R8TB 3GY3A 1AB9C 1ELBA 4CH2B 3M5MA 4J1YA 2OC8A 1EJAA 3PYHA 3MFJA 5CHAC 1UO6A 3G01A 7GCHG 2SNVA 1S84A 9ESTA 1YPGH 3RC5A 1UHBB 1LKAA 4NZLA 4DIIH 2YMSD 3GCTG 2VH0A 1C5YB 2VIVA 3CNRA 2VVCA 4JZEH 2FOFA 1TAWA 1T8LA 2ZFTA 1LKBA 2EC9H 3GS9A 3RC6A 4A1VA 5ETXA 3GY2A 1C5TA 1ZRBA 2ZCHP 4K2YA 3U1IB 6ESTA 1MD7A 2J92A 2LNCA 3M35A 1C1OA 1XUJA 3L33A 1DXWA 3DHKH 3ZZCA 1MAYA 1QL9A 2J98B 1A5HA 4CREA 1TBZH 3VB4A 3OX7U 4LK4A 3D23A 8ESTE 1GBCA 1COWD 1AMHA 2BD7A 1GHVH 1C5WB 1G30B 4RI0A 1V6DA 1GMHF 1HAPH 1O34A 1FONA 2XBYA 4ACAA 5EJZA 1P02A 3D49H 3KN2A 2ZTXA 2ZHEH 1P3EA 1ANBA 1UK4A 1HRTH 3PO1C 4AFSA 1P2IA 1VCQA 1O35A 1P0SH 1NZQH 1V3XA 3SJ9A 3LH3A 2WV5A 1EZUC 5TJXA 2ZO3H 2BY7X 1WXRA 1HUTH 4D9RA 4UFFH 4Q80A 1VKYA 5C5NA 2QF5A 1DUAA 5CE1A 4FU9A 3M7QA 2NU3E 3S9BA 1LO6A 3EQ0H 1DY8A 1NROH 2OTVA 4OS5A 3EYDA 1TGBA 1HNEE 5EXNA 2D26C 1GI8B 4TYDA 3ZZAA 1C5RA 1CO7E 1CT0E 1F5RA 1L1GA 2ZFFH 2IJD1 1RD3B 2R3YA 3A87A 2CHAC 1FUJA 3KQ5A 4D7FA 1QL8A 1V2OT 1ZTJA 4ABIA 2STAE 3PROA 4X1PU 3ZYDA 2VGCB 2TIOA 2QCYA 1LVOA 4B76A 1WBGB 1SQRA 3LIWA 1Y5UT 1BUIA 2KCOA 4CR5A 2PTCE 4XDEA 5KECA 1O0DH 1ZOMA 3U9AH 3RXCA 1FY4A 5PTPA 1ZGIA 3VB7A 2XBXA 3SHCH 1O3FA 1SBWA 1A5GH 1GJ6A 1BRCE 2BOKA 2HVXA 3SNCA 2B7DH 1C9PA 1OXGA 4MG3A 4YZUA 5GPIB 1W0KD 1O5CB 2BVXH 3KQDA 2Z94A 2PR3A 1MD8A 1SQTA 1N8OC 1O5DH 4K5ZA 1GVKB 1QB1A 1UTMA 4F49A 5EQQA 1VITF 5EOKA 4ZKOU 4IMZA 3TU7H 1KLJH 3EE7A 3TGKE 1OWKA 1O2UA 1IHSH 2JJ1D 1ANDA 2KZ4A 3SQEE 1TOMH 2SGPE 3QX5H 3RXPA 4AYYB 1HAXB 4CBNA 1O30A 3A85A 4XE4A 3SU6A 1O38A 1IHTH 1GG6C 2HNTE 2KM0A 4INHA 1P8VC 3ZZ7A 5GXPA 4CRFA 1DLKB 3HKJB 1GGDC 3OSYA 4E06H 1C5OH 1J16A 2SGQE 2FI4E 1EKBB 1SGDE 5DK1A 2BY8X 1V2UT 4DURA 1NFYA 4BXWA 2JH6D 3P17H 2ZCKP 1NM6A 2ZQ1A 1VGCC 2PWXA 1A3BH 1YWUA 2A2XH 2CF9H 3ZZDA 4MNWA 1MUEB 2W7UA 2AMPA 3VPKA 1MBMA 2ZFQH 2TGTA 3BTHE 2FS9A 2QXJA 1ZMJA 4CR9A 1P3CA 1QTFA 2HOBA 1DPOA 2F43B 1O5EH 4IC6A 3V0XA 5C2ZA 1MCVA 3RXEA 4NA8A 3A7ZA 3QTOH 4AX9H 1BTZA 1WCZA 4O03A 3UQOA 1AWHB 4CRDA 2JETB 2P8OC 4WH8A 5EG4A 4NIYA 1QCPA 4AGKA 5E0JA 2OCVB 2R2WU 5C5OA 2O8TA 5A8XA 2ZCLP 1DWBH 1BMFD 1BJVA 4I8JA 1GBKA 3H5CB 1C4Y2 1TGCA 2ZU1A 4YOGA 1QBOA 4CBOA 1UJ1A 3RU4T 4K1TA 3PRDA 1T4VH 2XBWA 3LOXA 4ZAEA 3LC5A 2ZI2H 3A7YA 1DXPA 1ELTA 4X8UH 1DSTA 1BRAA 4ZH8A 3KGPA 4FUDA 2CN0H 2BDYA 2OINA 3QGNB 4BTTB 3UTUH 3SZNA 4Q63A 4MQAA 4AB9A 2XNDD 1IQEA 8GCHG 4DOQA 1KXDA 3FOAA 4FUCA 5DSFA 3U1JB 1K9OE 5B6LA 1JIRA 4NFFA 4FUGA 1GHAF 4BAQB 1GJ8B 6GCHG 1BA8B 2CGAA 1PQAA 3Q00A 1K1NA 1HV7A 2J9NA 4Y8XA 2GV7A 1P2NA 1LPKB 2A4QA 5GCHF 2WUCA 2QXGA 4GLYA 2XCNA 1LQDB 2ZFPH 3ZVFA 2HALA 1HJ8A 3C27B 1QJ7B 3A8CA 3ODDA 1OP2A 1O3LA 1FJSA 3T2NA 1S6HA 1V2RT 1JWTA 4CHAB 2PKSC 1C1TA 5EPNA 3A7WA 2QYIA 1AVXA 3KQBA 1G2LA 1MMJN 1DT2A 3MU5A 5AHGH 4MNVA 4FVDA 2FOAA 3S7KB 1MU6B 4ZXYH 4B73A 4AFZA 1H8DH 4TSFD 1Y3YA 3NXPA 2Z9JA 3GCHC 1C2HA 1YPEH 1V2TT 1MTWA 3URCA 2BXUH 4U32A 1DOJA 2H9HA 1QJ1B 1Z71A 2BLOA 1TGNA 2QF4A 3TH4H 1P04A 2ZDLA 3SN8A 4Z0KA 2C90B 1BTWA 4YLQH 1UVTH 1ZMLA 1RIWC 1HIAA 4NSYA 2UUJB 3ZVEA 1F0SA 5J4SA 4WMFA 1O5BB 5IK2D 1BTPA 3JZ2B 1GJAB 1PYTC 4I32A 3A8BA 2C8ZB 2FX4A 5EW1H 3ATMA 1TFXA 2QXHA 3NUMA 2KCPA 1SGQE 1XXDA 1YY3A 5T6FA 3ELAH 2FOMB 1NRNH 3RXKA 1NU7B 1IQNA 2AH4X 1C4V2 2JDID 2KAIB 1YLNA 1Z6JH 1GI1A 3LH1A 1DX5M 3RXMA 1HJ9A 4WXIA 1O2QA 2ODPA 1C1UH 1O3OA 2WPJS 3OYPA 1TOCB 4AYVB 5GNDA 3ZVGA 1O2GH 1O3GA 3SI3H 3VGCB 1G37A 1K22H 1OWHA 4FU7A 3ZIAD 1CGJE 4RSPA 1BMLA 2G55A 3MH6A 2CV3A 3RXHA 1Y5AT 4BAHB 1LHEH 2P59A 2EI6A 4KTCA 1EXFA 5J4QA 1V2JT 3SNBA 5DPAA 3E90B 3QZQA 4NWLA 1AUTC 3AW0A 4IC5A 5LPRA 1MZAA 1E35B 1AE5A 3N7DA 5HM2A 3DSGA 1O2IA 1ZYOA 3STIA 1E36B 1QBVH 2F83A 1QBNA 1Z1IA 1G3DA 1CHGA 4B75A 4GPGA 1BBRE 1MTNC 3PWBA 1F0RA 1Q2WA 3UR9A 5L2YH 3LGWA 1YCPK 4XBDA 1MKWK 1C5VA 1QRXA 4UE7H 3IITA 1O2WA 2A7JA 3N99A 1HBTH 4INLA 3SYJA 3OTPA 4ABDA 2HNTC 2GMTC 5LPEA 1ELAA 5FAHA 4Y8ZA 2O8MA 5E0GA 1OWJA 1NBMD 2VB0A 1HFDA 5DP4A 3T27A 2B0FA 2FLBH 3QZRA 2B8OH 1W0JD 5DKMA 1GJBB 1GMDF 3BG8A 3SGQE 4JZFH 1GWAA 1FPCH 3PLKA 1YM0A 4X1NU 4O3UA 2BB4A 4JCNA 3F68H 1GI7B 2PP6A 3U69H 3A82A 5HMAA 3TGIE 1NFXA 4YOIA 5CHAB 1OHHD 1ZMNA 1NFWA 1ZHRA 1ANEA 1GI3A 2A32A 1C2LA 1GJ4H 4F55A 3QLPH 1EFRD 2ANWA 4FU8A 2ULLA 5KEDA 1O31A 3VB6A 5FL7D 3M5LA 2BD5A 1SGRE 1ZPCA 1SMFE 1V2MT 3N7EA 1H9HE 1GBDA 2Q6DA 2ZU3A 3NWUA 2RCEA 2OK5A 3WW7A 4HTCH 1O5FH 2FOHA 5FCKA 1MH0A 3GOVB 2HPPH 1YKTA 5A0BA 1CA8B 1FAXA 5C1UA 3LGYA 1A2CH 4KKDA 3TH2H 1V2QT 2BDIA 5HIZA 3RXQA 1D3PB 4UDWH 4ISHH 2FZZA 5A8ZA 3LPRA 1Z8GA 7KMEH 2D1JA 4ZKRU 2VJ1A 5IDKA 2K1QA 5HM9A 3FAOA 4GHQA 3GY4A 2EY4C 2WPLS 3PO1B 1K1LA 1EP5A 2CJIA 5ESBA 1BOQA 5DO4H 2F9NA 4CRAA 1D3QB 2ANMH 5JB8S 2SFAA 3FZDA 1SGNE 1LVBA 1P2KA 1YPLH 1KXFA 1EASA 1A0LA 4I86A 1FIWA 4TPYA 1BBRH 1O3IA 1O2VA 3GYMA 3SJOA 3GCNA 1YPMH 1KDQA 4ASHA 5JBBS 4XRNA 4AGJA 2FIRH 1A0JA 4DIHH 3OEED 4OGYA 1GPZA 1EPTA 2C8WB 5JYIA 1N6XA 4KGAA 1TNIA 1DSUA 3LKWA 2VIQA 3PTNA 1ZSKA 1DWEH 1E0FD 1XX9A 3LC3A 1Z7KA 1J9CH 2ZG0H 1EUFA 3QK1A 3OE7D 3MNSA 1GHBG 3A86A 2K0QA 1NRQH 1EAIA 2VIWA 3BEFB 2IPQX 4OS6A 3SV2H 1AFEH 2PKAB 1YC0A 4YM9A 1SB1H 4FUEA 3ZVAA 2XWBI 1ZR0A 1EAUA 2RDLA 2NU0E 1AFQC 3Q3XA 1JRSA 3ODFA 3GICB 1RJXB 2ZFRH 1QL7A 3SQHE 4P02A 3T26A 1L4ZA 3A8DA 2H5DA 1JMOH 3RLWH 1XKAC 1YBWA 4LOYH 4U2WA 3UY9A 1CA0C 3K6ZA 4DY7B 2OC0A 1K1JA 1DS2E 2BM2A 3A88A 1SQOA 2PGQB 1CE5A 5L2ZH 1N8OB 1A61H 2ALVA 2OBOA 1D3TB 4O9VA 3SJ8A 3MNBA 1BQYA 2THFB 2BDCA 3TVJB 1AY6H 4X1QU 3T62A 2Z3DA 4Q7YA 4ABJA 1AN1E 6GCHF 1UTLM 4MPWA 3GDSA 2FOEA 1TX8A 1THPB 1A7SA 1DM4B 4ABEA 2AIPA 2BDGA 1GG6B 2D8WA 1CGHA 1GMCG 1BTXA 3ZZBA 1GBIA 1GGDB 1V2VT 1V2NT 1TQ0B 1AZ8A 1W0YH 1OWDA 3E0PB 4AFUA 1A1RA 3TJOA 3RXGA 2BQ7B 2P94A 4M9FA 1D6RA 1Q31A 1FY1A 2JH5D 1LQEA 1VGCB 4YLUA 1DVAH 2VNTA 3KIDU 3LGVA 3ESTA 1SGTA 1PJPA 1O2YA 1ARBA 1Z8JB 1SOTA 4IW4E 1IQGA 1EZXC 1VCWA 2ZPSA 3UIRA 1GHXH 4Q7XA 1AGJA 3RUOA 2ILNA 2FDAA 2OQ5A 3SU4A 4I7YH 2LPRA 1TRYA 1GI0A 2VINA 3W1EA 1BMNH 3TK9A 5GWZA 1W8BH 1GVZA 3OFND 4Q2KA 3TGJE 2M2AA 1LCYA 1XXFA 1SHYA 2P8OB 2R0KA 4K60A 2ZNKH 1Y3UA 5FX6A 1ZPBA 2STBE 3BV9B 1TE0A 3AAVA 1K1OA 3AAUA 1JOUB 1FN6A 2J95A 1NESE 4FUBA 4WMDA 1TMTH 3LU9B 3BSQA 4K8YA 1H8HD 5F03A 1A0HB 2GGVB 2BDBA 2V35A 1TWXB 6LPRA 1P10A 5FPTA 5EQRA 3TLOA 4AG1A 5A0CA 2HNTF 3HATH 1EB1H 5I25A 4BAKB 2W3IA 1HPGA 2J98A 2FESH 2HPQH 5E0HA 2XC4A 3TNTA 5L30H 4JYUH 2G8TA 2VH6A 1G3CA 2P3TB 1A46H 2A4OA 2XRCA 3OY6U 2ODQA 3H7OA 1FY5A 1LTOA 2W7SA 2IOTA 2IN2A 5C1XA 3ZZ5A 2EA3A 1IQJA 5K7RA 1UTNA 3SNEA 1H8ED 2GTBA 1FDPA 1YF4A 1BCUH 4GAWA 3RXFA 2L74A 4BNRA 2GZ9A 3OTJE 1NRSH 3V3MA 1O3NA 1BMAA 3L6PA 4NIWA 5E8EH 1GBJA 3KL6A 2PKSB 5CHBA 3SV8A 3QN7A 3E16B 4MTBA 3F0OA 5A8YA 2AMDA 2ZGCA 1FX0B 3P92A 2GZ7A 1UTJA 2D2DA 4YO9A 2Y5GA 1TNKA 2W5EA 5HKKD 3GCHB 1AVGH 1WAYB 3R0FA 1JBUH 5T3HA 4ESTE 1S0QA 2UUYA 4FUHA 3S0NA 3M61U 1KMHB 2AHME 5JBAS 1DY9A 4X6OA 1ZHMA 4ISIH 3SU3A 2ZDVH 2RFKC 1RIWB 3BTGE 3QDZB 1Y3WA 2BD9A 1MTVA 3T5FH 5GDSH 1SC8U 3W94A 1TNHA 3MOCA 2F9OA 1B0EA 1ELFA 1EX3A 4GCHF 1GBHA 5JPMH 1C1QA 1O2ZA 1E1RD 4BAMB 2GCTC 1HJAC 1Z8IB 2TGDA 1H4WA 2OD3B 4LXBH 1V2KT 2EQNA 1ELDE 1V2PT 2YMSC
chains in the Genus database with same CATH topology
1CT2E 1N6YA 2ZHQH 3LONA 6CHAC 1PYTD 3URDA 3FANA 4AORA 3SU0A 5F8ZA 3FFGA 1PPCE 1TLDA 3BN9A 1Y59T 2G00A 1SGEE 2FTLE 5GIBA 1AKSB 1SGFA 1KLIH 1C5QA 2AFQB 3P8NA 2ASUB 2YNAA 4ABFA 2QV1A 4D8NA 4XFQA 4D7GA 2R0LA 1OWEA 4INKA 3EAJA 1B5GH 4DVAU 2TPIZ 1G9IE 1HAYB 2HRVA 2Q1JA 4ZHMU 3PWCA 3B9FH 3SUEA 1AU8A 2ZGXH 4Z6AH 1IOEA 1DWCH 2R3UA 2ZDMA 4FUJA 5DG6A 1MTNB 2A0QB 2PHBA 1C1VH 1PQ5A 1GL0E 2XC0A 4D76A 3MWIU 4A5TS 4X8VH 1XUIA 4AFQA 3BTKE 3TNSA 2NU4E 1BZXE 2GMTB 1LPZB 4AN7A 3MU8A 2GCHG 2WPIS 4X2XA 2ODYB 2ZECA 3SW2B 2Z6BD 3UNRA 4AG2A 1P2QA 5FXLA 5JB9S 3SJIA 1BMMH 1AD8H 2V0BA 1Y5BT 2PUXB 4K69A 3ZVBA 2GDEH 4X2VA 1SGCA 1ZSJA 2VVVA 1WSSH 1FI8A 5E2PA 3F9GA 1HXEH 2BZ6H 3S69A 3BTME 2Z7FE 1SGFG 3TITA 4MLFB 1MQ6A 2NU1E 2GP9B 3KF2A 1TA2A 1S6FA 1SGPE 5DP6A 1ETRH 3RC4A 4TY7A 2B5TB 1O2HA 1XUKA 2XYAA 2A31A 2ZGHA 1WV7H 1FPHH 5LPFA 3VXEH 1GI2A 2O8LA 4RKOB 3W95A 1PQ8A 4A1TA 1T8OA 1GHWH 1Z1JA 2ANYA 1MKXH 3RDZA 1HAVB 1GBAA 1KYNA 4WJG2 4ZHLU 5FPSA 2XTTB 4DW2U 4Y76A 4GVUA 1S0RA 3V7TA 4E05H 2Y7ZA 1EJMA 3FZZA 5DP5A 1BIOA 3E3TA 3F9EA 1TABE 5DGJA 1V2ST 1DUEA 7ESTE 1GJDB 1L4DA 1W14U 3TJNA 2R9PA 1UTKA 1EP6A 1SVPA 3EA8A 2A1DB 2BMGB 1GMHG 1ACBE 1NT1A 3RXVA 3A83A 5G4BA 1W13U 2ZHWH 2BLWA 7GCHF 1O36A 1TMBH 1NTPA 1GMCF 2F91A 3DD2H 4Y79A 3GCTF 1K28D 1AVWA 4AOQA 4ISNA 1GJ9B 2SNWA 3M5NA 2NU2E 1G32B 3PMBB 4X1RU 1FQ3A 3MNCA 3F6UH 1C5SA 2C8XB 3D62A 1TRNA 3AW1A 1C2GA 4UFEH 4GUXA 1GCTC 1CHOG 3SI4H 3IG6B 3S9CA 1Y8TA 2OP9A 2Y80A 4AZ2B 1QB9A 2SGFE 3I29A 1TIOA 5A0AE 2WPHS 3U8TH 1UVOA 3BTEE 3PMAB 1ELGA 3RMMH 1CVWH 2GT8A 4F4OC 3UWJH 2G52A 4R0IA 2QY0B 5FX5A 3SU2A 1F0UA 4ISOA 1UTQA 1QJ6B 1YPKH 2FOGA 1AFQB 3RMNH 2BX3A 4H42U 4NIVA 4XBCA 2ZF0H 4DT7B 1AUJA 1O3JA 1MBQA 2OQUA 2XWAA 1GDNA 9LPRA 1V2LT 2C8YB 2UWOA 1INCA 1EJNA 4KP0A 2V3OH 2I6SA 3O8DA 2WPMS 1CA0B 2P93A 4KTSA 1P01A 2F9VA 1GDUA 1C9TA 2FWWA 1IAUA 5AVDA 3WY8A 1AO5A 2BD3A 1QB6A 1C2IA 1M9UA 1C5PA 3SNAA 3RXJA 3SV6A 2BX4A 4U01A 1F0TA 1IQHA 2AS9A 3SUDA 1NRRH 3K65B 1HGTH 1BTUA 4WH6A 3TH3H 1F92A 1GCDA 2ESTE 3RXBA 5TCCA 1O5GH 2AGGX 1VITG 4Y10E 1MQ5A 1FAKH 4AB8A 3RLYH 1QA0A 4LZ4B 5H4IB 4RKJB 2HGTH 3UOPA 2BOHB 1VR1H 3NCLA 1QURH 1TGSZ 1O2JA 3F9FA 1RTFB 2EEKA 1IQIA 2FLRH 2FXRA 1GJCB 3BIVH 3F1SB 1AHTH 2F9UA 2CXVA 4NFEA 2P16A 5BPEA 5DP7A 3QGJA 1ZRKA 1C2KA 1OOKB 1O3HA 2BD8A 3GISB 1ETSH 2Y5FA 3P95A 4A1XA 1HAOH 1UCYK 2C3SA 1PPBH 2G4UA 4YTAA 2P3FH 5JBCS 1GBMA 2QF3A 4NSVA 4A7IB 5AF9H 2G4TA 1MTUA 2O8UA 1ESTA 3RMOH 2PV9B 4H4FA 1PFXC 1SR5C 1H9LB 3IWMA 3NPSA 3RXSA 3S7HB 2ZZUH 1O3CA 1RRKA 1C1MA 1ZJDA 5EODA 3LJJA 3P8OA 3L3TA 2TRMA 3DA9B 2H2ZA 4I8LA 3A84A 3ZV8A 3LGUA 3BTTE 1KTSB 3E8LA 3OY5U 4ABAA 4FUIA 1P2JA 5FPYA 1O39A 3MHWU 1O2MA 3BTDE 1GBLA 3VB3A 1P11E 2PSXA 1O2SA 1DANH 3PTBA 1NS3A 2AYWA 1NU9A 3FP8E 2ZGJA 3UUZA 4IBLH 1NN6A 2WYJA 1GI6A 1DE7H 1WUNH 2A7CA 2C93B 3FP7E 1OPHB 3HK3B 1C5XB 2A45B 1AZZA 4JK6A 1OP0A 2DUCA 3BTWE 1IQKA 1JXPA 4IMQA 4YT7H 4BXSA 1O3AA 3UQVA 1T31A 1EAXA 1GHAG 3RXIA 1TBRH 3GDUA 1D4PB 1GDQA 3MYWA 2A5IA 1KXAA 1SL3A 2G5VA 1A4WH 1OKXA 1BRBE 1CGIE 2V3HH 5GCHG 2QN5T 3EGKH 1BHXF 2AMQA 2Y5HA 3ATWA 1GI4A 1H8IH 3BG4C 1TNLA 3KQEA 2BZAA 2BYAX 1QRWA 1O3DA 2YOLA 3K6YA 4Y0YE 3TPIZ 4AG1A 4MDSA 1ZJKA 2WUBA 4TY6A 1ELCA 2UUFB 4BTIB 1MAXA 1D3DB 1GBBA 2P95A 1TYNA 1DFPA 1RXPA 4WMEA 1A3EH 3SORA 2PUQH 3U98H 1DLEA 4MPUA 1EOJA 1C5LH 3TJUA 4MVNA 2VWNA 1SQAA 1UTOA 1SOZA 8GCHF 5F6MA 1KXCA 8LPRA 3SGBE 3MH5A 5DP9A 4Y8YA 1OSSA 1XM1A 1DICA 4B2BA 2PKAA 3A80A 3MO3A 1LVYA 1W0ZU 4X1SU 3DT0H 1PPEE 4TWWA 2FODA 1J15A 1FY8E 4HGCA 2GCTB 1HJAB 1TQ7B 4K3JA 2Y82A 1ZHPA 1SPJA 2R2MB 5C20A 2SGAA 3HGPA 3CS0A 1K1PA 3GCOA 6CHAB 1ESAA 3UFAA 4X6NA 4ZHAA 3TIUA 3E91A 4O3TA 4NGAH 1P2OA 1Z8RA 2AGIX 1BJUA 1SGIB 2ZU5A 3LGIA 4B2CA 1HYLA 2ZA5A 1ORFA 3Q3KA 5ESTE 3BIUH 1ZSLA 1E37B 5FBIA 1YPHE 4O97A 4DG4A 3ZVDA 1W12U 1ZTLA 3MU4A 1T7CA 2HLCA 3E6PH 3B8JA 5B6OA 1O2RA 2WV4A 1G3BA 1XVMA 1THSH 2WINI 3HKIB 1WYKA 2A5AA 3RXRA 3EA9A 3E1XB 3PM3A 1ETTH 1FXYA 2ZKSA 3P8FA 3UWIA 1WTHD 1EPTC 5C3NA 2FS8A 1K1MA 3M7TA 1ZLRA 1NO9H 1QQUA 3R3GB 1DITH 1UHBA 3PB1E 1T32A 1BBRK 2F9BH 3TJVA 1LMWB 1L2EA 1P09A 1UMAH 1V2WT 5F8TA 3MU0A 2G51A 4X2WA 3M7UA 3KHVA 3VFEA 4X6PA 5K0HA 2ZEBA 2FX6A 1WOFA 3CENA 4CRBA 1LHDH 3PLPA 1O2LA 2ZFSA 1T8NA 1QQ4A 2RA0A 2ALPA 2BDHA 5EXMA 3SHAH 1QHRB 1JIMA 1FN8A 1TONA 1P9SA 2BVRH 2ZGBH 4UFDH 2H6MA 2EI8A 1CHOF 1H1BA 1QGFA 2B9LA 3QTVH 3SU1A 3RU4E 4WF8A 1LPGB 5GJ4B 2TGPZ 1AE8H 1GMDG 2UWPA 4Y7BA 4NZQA 4QT8C 3S9AA 4CRGA 3A81A 3LGTA 1UVSH 1BTYA 1BHXB 5C1YA 4Y7AA 3A8AA 3SV7A 4JZDH 2ZWLH 3UPEA 5BRRE 1LHFH 1RFNA 1YLCA 1EAWA 3FP6E 4KELA 1UK3A 4ZROA 2VIPA 4I8KA 4MPVA 2W26A 2Z9GA 3GY8A 2AIQA 1GHZA 1B7XB 4FUFA 1EZSC 1MU8B 2IPHA 3ZV9A 2RA3A 3A7VA 4NCYA 1FNIA 1CBWC 3ZZ6A 4CH8B 3SV9A 3AASA 4I8HA 1UK2A 4THNH 1SLUB 4NIXA 3T28A 5T6GA 8KME2 1CSOE 1O3MA 3RM0H 3BTFE 1F5LA 5C67A 1XUGA 1HAHH 1RGQA 4IS5A 4IN1A 4K1SA 4K1EA 1P9UA 3OU0A 3MH7A 3NKKA 1EATA 2AGEX 1VJ9U 3RU4D 3M5OA 5EPYA 1C2FA 1TPSA 3MI4A 4I8GA 1O3KA 1MTSA 2OC1A 5SGAE 1TALA 4M7GA 1ZGVA 4I33A 1ARCA 2TBSA 2GKVE 2RG3A 2ZDKA 1GHYH 3VEQB 2OBQA 4Q7ZA 2J38A 3T25A 1QY6A 1W7GH 4IN2A 3ZYEA 2J4IA 1SFQB 4XSKU 3BEIB 1BB0B 2BHGA 3QO6A 1GI5A 2GT7A 3MU1A 3UREA 1QRZA 5HYOA 2ZTYA 1GCTB 3SOSA 3O8RA 4BTUB 5EU8A 2WPKS 1D6WA 1KSNA 2PFEA 2HWLB 3RXOA 2Y81A 4NWKA 1O2OA 1E38B 2VIDA 3HGNA 3STJA 1SG8B 2EI7A 2J2UA 2GVFA 1Y3VA 1GJ7B 3F9HA 4WVPE 1B0FA 1TX6A 1P2MA 2PLXA 1SSXA 1UCYE 3LJOA 1IQLA 3LDXH 1W10U 2XNIA 2XXLA 1GVLA 5FBEA 3ATIA 2BVSH 2BQWB 3ITIA 1UTPA 3KNXA 5HXFA 2Q6GA 2ZC9H 1RTKA 1THRH 4ZXXH 3MMGA 3QUMP 4ISLA 7LPRA 1QFKH 5EXLA 3MTYA 5IYTA 1ELEE 1O3PB 3SO3A 1SHHB 2BY5X 1EQ9A 3MO6A 5EW2H 3BEUA 1AKSA 2WYGA 1TPPA 3SUGA 2O9QA 3ATLA 3U8OH 2AERH 2VVUA 3GYLB 2PTNA 1OYTH 4WWYA 3TK6A 1WQVH 3TK5A 2IJOB 2QF0A 3HPTB 4NG9H 2PSYA 1PPZA 5ABWA 2JKHA 1YPHC 3NZIA 1C1RA 1YCPH 3B23B 1MKWH 3FVFB 4DGJA 1F2SE 1C2EA 1P12E 1YP9A 1GHBF 2XBVA 3DFJA 4XOJA 3P6ZB 1O37A 1BDAA 2GDDA 1ANCA 5DJ7A 2JH0D 5CMXH 2FOCA 4PROA 1QNJA 1C4U2 1J8AA 3O8BA 1IQFA 2FEQH 1OP8A 1HIAB 5LH8A 3RMLH 1ABIH 1VJAU 1YGCH 4E7NA 3SJKA 1RS0A 2VGCC 1LDTT 1O32A 4A92A 1GL1A 2FYQA 2OLGA 4HZHA 2OC7A 1ID5H 1GBFA 3PV4A 3RXDA 3I77A 4VGCB 1O3BA 2Z9LA 4ZMAH 1P06A 1XVOA 2VU8E 4OS4A 4JZIA 3KCGH 5LGOA 2J94A 1S85A 2OUAA 2OXSA 5EGMA 4OS2A 2SGEE 1HXFH 5E2OA 2G81E 1BITA 3GDVA 1Z6EA 1ZPZA 1TBQH 4WXVA 3ZVCA 1O2TA 4YOJA 1UCYH 1YYY1 4IGDA 1AQ7A 4Y11E 1BT7A 1FMGA 1KLTA 5JDUB 2VWMA 1LVMA 4SGBE 1NFUA 2ANKH 3PMHB 5TCAA 2ZDNA 1HAVA 4ZKNU 4UFGH 2H5CA 1H9IE 3RXTA 1WQSA 2XC5A 1ELVA 4LZ1H 1QA7A 4UD9H 3N7OA 4B1TA 1XMNB 3ENSB 2FP7B 1Q3XA 2FOBA 4E7RG 3SUFA 1SLWB 1O2NA 2PGBB 3Q3YA 2AEIH 1C2DA 1TRMA 1TMUH 1TPAE 2A7HA 1C5ZB 4WY3A 3DFLA 2F9PA 2F3CE 2QIQA 1HAIH 1E34B 2PW8H 2BDAA 4X8SH 1OYQA 1VITH 1DDJA 5AFYH 5DP8A 1YCPM 2ZP0H 4FXGH 1NC6A 2J34A 4ABHA 1C2JA 1LHGH 1F5KU 1KTTB 4HFPB 2QXIA 2ZQ2A 1KXBA 2V6NA 2CMYA 4TWYA 3BG4B 2KAIA 2XW9A 1DWDH 2JETC 3RXLA 3D65E 4H6TA 4JYVH 4DCDA 2GX4A 2G5NA 3SBKA 1J17T 3P70B 1SI5H 1YPJH 3CP7A 3V12A 3BF6H 3PLBA 2BD4A 1HCGA 1PPGE 3EA7A 1FIZA 1C1SA 3KEEA 3NK8A 3HK6B 1C5UA 2BY9X 4OS7A 3JZ1B 1W11U 3Q77A 1X7AC 1VCPA 3ZZ8A 4J2YB 1W2KH 1QR3E 2BQ6B 2QC2A 1GBEA 1S83A 1ABJH 1CU1A 3UOUA 2Z9KA 3Q76A 1K1IA 4X6MA 5JBTA 2BLQA 4MNXA 4JMYA 2QAAA 1K2I1 1D9IA 1J14A 1GBTA 3SU5A 2A5KA 1WU1A 3VXFH 4DJZB 3GY5A 2GZ8A 1W7XH 1O33A 2BY6X 4ABBA 3M37A 1MKXK 3ATKA 4YT6H 2FTMA 2UWLA 1TX7A 1AB9B 2FI3E 1PPFE 4ZKSU 4NA9H 4GCHG 1NPMA 1F7ZA 3C1KA 3EDXB 5I46H 2A4RA 2XCFA 3UR6A 1O3EA 1T8MA 1KY9A 1EZQA 5F8XA 2FPZA 4D9QA 1OWIA 1SLXB 4B74A 4BAOB 3SGAE 1XUFA 2CF8H 3P8GA 1EOLA 3MH4A 5AFZH 4CHAC 3UNSA 1KIGH 2BTCE 3M3TA 3AVZA 4X8TH 4YESB 1L1NA 4VGCC 2ZU4A 1AIXH 1G2MA 1SFIA 4B71A 3UNQA 1TNGA 2Y7XA 1HAZB 1BTHH 1UVUH 1KDQB 1O2XA 1C5NH 3A7TA 4MPXA 4NA7A 1O2KA 2DE9A 3A89A 5DP3A 1EPTB 1L1JA 3ZZ3A 3M3VA 2GD4B 2SGDE 3BTQE 3SNDA 2ZTZA 1G36A 1TPOA 3T29A 4B2AA 4Y0ZE 1O2PA 1C1PA 4H6SB 3GY6A 2A2QH 4FVBA 2VIOA 1HB0B 2QGRA 1O5AB 2ZHFH 1C1WH 3RP2A 1BRUP