2QXJA

Crystal structure of human kallikrein 7 in complex with suc-ala-ala-pro-phe-chloromethylketone and copper
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
224
structure length
224
Chain Sequence
b'IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-7
molecule tags Hydrolase
source organism Homo sapiens
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
total genus 54
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxjA02
4GVUA 2Z3EA 1K1LA 2BD7A 4IW4E 2C90B 1O2LA 1TPPA 5DPAA 3ZZCA 4CH2B 1PPGE 1MKWK 3A80A 3LC3A 5A2MH 1VITF 2FMJA 2ALVA 1EB2A 1HAIH 1LPZB 1A5IA 1MMJN 2ZU1A 2LPRA 3LJJA 3N7OA 2AS9A 2Q1JA 4IMZA 3E0NB 3QUMP 1TLDA 2G4UA 1UO6A 3H7TA 3D23A 3GDVA 1OS8A 1TNGA 1HJ8A 1GBFA 2ZQ1A 4O3TA 4CRCA 3PO1C 2FODA 3A7WA 2QV1A 2HNTE 3T62A 1EZSC 1V2WT 4NA8A 1SGRE 1O5AB 9ESTA 1O3FA 4K8YA 1C2HA 4X1PU 3VFEA 2HVXA 1MQ6A 3MU4A 3RXQA 4OS5A 3CS7A 1O33A 3EGKH 3DA9B 1WBGB 1K1OA 3IG6B 1DWBH 1NM6A 4LZ4B 2H6MA 4K69A 1G32B 3ZYDA 1QNJA 4X2WA 4HI3A 1CE5A 2FS9A 3ODFA 2PKSC 4XBCA 1P2NA 2F91A 1FPCH 1D6RA 1S6HA 1UK3A 1GBDA 1HAGE 1BTZA 3MOCA 4X8SH 1PQ8A 4CREA 2VIQA 1HIAA 5C1XA 2GCTC 1ETRH 4M7GA 2RCEA 1Y59T 3ZVAA 1RJXB 2HWLB 4CRGA 1OP2A 4Y7AA 1YPMH 2VIDA 4I33A 5EQQA 1SMFE 1KIGH 3CS0A 4X2XA 4ZKOU 4KTCA 1H9IE 1WQSA 1O3NA 1CU1A 3RLYH 3SJ8A 4UFDH 2THFB 5EXLA 2HLCA 7LPRA 1ZRBA 3O8DA 1ZOMA 4BAOB 1ELDE 3GDUA 1LO6A 4Y11E 3SJ9A 4ASHA 1GBBA 1H8IH 1HGTH 2NWNA 3BTGE 2OTVA 1XKAC 1KXBA 4UEHH 4IN2A 4K1TA 4BXWA 1P12E 1BDAA 5B6OA 2V3OH 1LHGH 3MU1A 1A4WH 1UVUH 1AE8H 1SHHB 5DP7A 4MVNA 1H9LB 4H6TA 1CGHA 1TGCA 4FUJA 1ELFA 4K60A 2A5KA 1BBRE 3MH6A 1PPFE 2VIPA 1Z71A 2VVUA 3F68H 1WV7H 2AYWA 1T4UH 4MPVA 1K28D 3GCTF 3PV4A 2ZTXA 3M7QA 2O9QA 1O2OA 1QBNA 1LVBA 1GI9B 1XUKA 4PROA 2PUQH 1ZPZA 3Q3XA 1P10A 3LGWA 3T29A 2BD8A 3FP8E 2P8OB 1TA6A 1HXFH 1FY8E 1GHZA 1UVSH 5JBBS 1GBAA 1P2OA 4ISLA 1TOMH 3VXFH 1BMNH 1MTSA 2H2ZA 3RU4T 3TIUA 3S7HB 1CA0B 1DFPA 3NPSA 1Y3YA 2PV9B 3EE0B 4TY7A 4U32A 3B23B 5ESTE 2GCHF 2PTNA 3BTDE 2WINI 2XCNA 3GCNA 1GPZA 1C1UH 1SGQE 1XXDA 1AB9C 2WPKS 2A7CA 4ZUHA 4B2AA 1AN1E 1BIOA 3QGNB 1JOUB 5DG6A 3SGQE 1GL1A 3MNXA 5GPIB 5A09A 1SOTA 3B9FH 4AFZA 5L30H 3RMLH 5HMAA 4CH8B 1ABIH 4Y0ZE 2M5TA 1V2MT 5FBIA 1A61H 3RMNH 5EQRA 2O8LA 1ESBA 3BTME 1UTLM 3P92A 1F5RA 4NIVA 3U8RH 1V2OT 4AOQA 1O3CA 2BY7X 1P3EA 5T6GA 1T7CA 7ESTE 1UK4A 1AFQB 1AKSA 5G4BA 1XUHA 2P59A 2G51A 2XTTB 3HK3B 4H4FA 4UFFH 1YF4A 1GHBG 1O36A 3GYMA 1A3EH 4I32A 2J4IA 4FUGA 2BVXH 1C5RA 2XC0A 2FTMA 2AEIH 2BQ6B 2HNTF 1TPOA 4ISHH 4YT6H 1MUEB 4X8UH 3FANA 1FDPA 5A8ZA 5GIBA 2P3TB 2DE8A 1O0DH 2F9UA 2ZFFH 3RXFA 2R9PA 3D65E 1LMWB 3ZVBA 3T25A 2OC0A 4YOIA 4MPUA 1C1TA 2PHBA 1GBJA 4ZAEA 2GT8A 2FPZA 1QA7A 3Q3YA 4X1QU 1TABE 4E05H 3TJVA 4AB9A 1EZUC 1MD8A 1AVXA 2ZGCA 1WOFA 8GCHG 5EPNA 1AQ7A 2Y5HA 4K5ZA 1GJ9B 2XYAA 8LPRA 1HUTH 4NZQA 1ELGA 1OP0A 1T8NA 3MU8A 2FIRH 1P8VC 1TNHA 2CV3A 3GY8A 4MG3A 5JYIA 4X8TH 2VINA 2OINA 3W95A 2GP9B 3RU4E 1GMCG 4KTUA 1GBIA 2IN2A 3A8BA 2ZTZA 2W7UA 1HV7A 1NT1A 1DWEH 2ZZUH 2Q6FA 2BD4A 5HM9A 1F0TA 1C2JA 1C5ZB 2A32A 3QK1A 4TYDA 3TGKE 4ZKRU 1ZRKA 1WYKA 1Z1IA 1Y5AT 4K3JA 3A7ZA 2VGCC 5L2YH 4AB8A 3RXKA 1YPKH 1WUNH 3SV6A 1W14U 1J8AA 1CO7E 4THNH 1Z7KA 1MU8B 3MH7A 1ANBA 2RDLA 3BIVH 4F49A 1PPZA 2W26A 3E0PB 1F0RA 2P3FH 2SGAA 3RXLA 4JZEH 1A1RA 3RXMA 2FDAA 1THRH 2FOMB 4UE7H 4JYVH 2BM2A 4Q7YA 2AGIX 1P2JA 2SGEE 1FIZA 4MNYA 2SGQE 1SGFA 1O2TA 1GCTB 1G3CA 1E34B 4ABHA 1SLWB 1HAXB 3SHCH 2ZPQA 6LPRA 3PLBA 1TQ7B 1A0JA 1S6FA 3SNCA 2ZU2A 1FY3A 4U01A 2SGFE 1UCYK 2Z9GA 1ZSLA 4XOJA 2WPLS 1L4DA 3F1SB 1C5TA 3LGIA 4MDSA 3WY8A 3HATH 1Z8IB 1EOLA 1BHXB 2WV5A 2AMPA 4X2YA 1FAXA 1GI1A 2ZU5A 4KGAA 4K8BA 5L2ZH 5EW1H 4J2YB 1PQ7A 1T8OA 4YLQH 3RXPA 3QX5H 3ZYEA 1BCUH 2DE9A 4ZKSU 8GCHF 1NZQH 2VWMA 4YM9A 2PTCE 2A0QB 1C5LH 2BVRH 3GCOA 1UTJA 2FOFA 2O8MA 2WV4A 3Q76A 3E3TA 2CN0H 1NO9H 4AX9H 3TK9A 5HYOA 1J9CH 1ZZZA 1MZDA 3TK5A 1QJ7B 1YYY1 5DGJA 1SI5H 2ZPRA 1ZSJA 1A3BH 1ARCA 1UTNA 1VGCB 1XXFA 1E36B 3ESTA 1ELAA 1UK2A 1O35A 1BUIA 4ZXXH 2AIPA 1AGJA 1OP8A 3BEIB 3RXDA 1YBWA 2RA3A 1UHBB 5DP3A 1EOJA 4UFEH 1KXEA 4FUBA 1F7ZA 3ODDA 4INKA 1GI6A 4AG1A 3M5NA 4NA9H 3P8FA 2BTCE 1TBZH 1KY9A 5TCAA 2ALPA 2FOBA 2GX4A 4DG4A 4D76A 1GBKA 1IHSH 2SFAA 3M7UA 1DOJA 5EPYA 1HFDA 4KTSA 1T8LA 2GVFA 3BEUA 4ZHMU 1KXFA 2FEQH 1P0SH 2EC9H 2QYIA 1O2ZA 4E7NA 4I8KA 1O3BA 3M3VA 2F83A 3PMJA 1ZSKA 1D3TB 3H7OA 1NESE 1EAXA 4SGBE 5GCHF 3V3MA 2NU1E 2BOHB 1AUJA 4FUIA 1C5OH 1AB9B 4JK5A 2GDDA 5F8ZA 1V2ST 3VB6A 4DURA 1A5HA 3R0FA 3TPIZ 2ZDAH 2HPQH 3ZZ5A 1F92A 1SBWA 1QB1A 3V12A 1P3CA 4CRDA 1O2NA 2FI5E 3L33A 1C2FA 3RXEA 1ACBE 4RKJB 1Q3XA 4WWYA 3VPKA 1W2KH 2P94A 1O38A 1BMMH 1KXCA 1QL8A 3ZVDA 1O5CB 3F9HA 3G01A 1P9SA 2UUKB 5AF9H 1DS2E 3F9GA 2VWOA 2OC8A 1SOZA 2BY9X 2ZPSA 6GCHG 2ZG0H 3SUGA 1QURH 1BOQA 1RXPA 5C20A 4BTIB 5DO4H 3A7VA 3MYWA 5FPTA 2NU0E 1Y5BT 1D3QB 4DJZB 1SQAA 1OX1A 1G3EA 1BTYA 3SU3A 2ZFRH 3AVZA 1Q2WA 2JETB 1ZMNA 1L1NA 2B0FA 1PPCE 2GCHG 1EQ9A 1AI8H 1C2DA 4Y8XA 5E0GA 2XWBI 5DP6A 4K1SA 1NRNH 1ZGVA 3RXCA 1MH0A 2D2DA 3BTQE 2ODQA 1GJ6A 1XUGA 1K1JA 1SGCA 3U1IB 1F5KU 1Y3VA 1SL3A 4Y79A 2FI4E 2FLRH 2ZP0H 2GZ9A 4WXIA 1CA8B 2G55A 1SQOA 1UTMA 2CHAB 3M3TA 3M7TA 3ZZ4A 1O3HA 3D62A 2FYRA 1E0FD 2QXJA 1S0RA 3HPTB 2H9HA 4AN7A 1GHAG 1FN8A 1DXWA 2OLGA 5EU8A 5GJ4B 2EI7A 1TNLA 3HGPA 1W7XH 1HAYB 1EPTC 3BF6H 3A85A 4O9VA 1ZLRA 1FI8A 3LIWA 4MNWA 1QR3E 1O3IA 3HKJB 1O2XA 3A87A 3RDZA 2G8TA 1V2UT 3VGCB 2D8WA 2DUCA 3MH4A 4GCHG 1C1RA 1XUJA 4Y8YA 2J2UA 1KLIH 3VXEH 4ZXYH 1BTHH 4D7FA 2WPHS 5T6DA 5LGOA 4CR5A 3OY5U 1O3AA 1W3CA 1Y3XA 1AD8H 1OWEA 3QZQA 4U30A 1NTPA 1G36A 1P06A 3EDXB 1OYTH 2AFQB 4O97A 1V2VT 2BY8X 2FOEA 4NIYA 2FWWA 1UVTH 2XRCA 1DY9A 1FY1A 4I8LA 9LPRA 2O8UA 5HM2A 1OWDA 1EPTB 2JH6D 1AY6H 4OGYA 2ZA5A 4DVAU 2Z9JA 1E37B 1LVOA 3LKWA 3A82A 1UTOA 3VEQB 3UNSA 3ZZ3A 4B2CA 5A8XA 1H9HE 1IQEA 1O2WA 1ORFA 1P01A 1SB1H 3SUFA 1B7XB 3SU2A 1C5UA 1DM4B 1ZPCA 2BXTH 1ELEE 3DHKH 2Y5GA 3Q3KA 2BB4A 6ESTA 1QIXB 2WYJA 5C5OA 4CRFA 3OU0A 3FZZA 3UQOA 2WPIS 2QXIA 1GBCA 4MNVA 1AIXH 1HPGA 4TPYA 1C5SA 1SPJA 1C1WH 1UMAH 1WSSH 1B5GH 1HJ9A 1GI5A 1ANEA 4TY6A 1YPEH 2UWOA 2TIOA 1ZTLA 2VWLA 3OTJE 1C5XB 1O5EH 2PW8H 1AO5A 1A46H 3LGYA 2B8OH 1G3DA 1S84A 1SLVB 3P6ZB 4FU7A 2P16A 4R8TB 2IOTA 1QL7A 2G00A 2ZDVH 2R0KA 1QA0A 6CHAC 1D3DB 2W7SA 1C5NH 5JB9S 3BN9A 1DLEA 1P2KA 2FS8A 3MH5A 4SGAE 4ABIA 1EB1H 1QHRB 1GHVH 4GCHF 2PGQB 1C1NA 3SGBE 1DITH 1O3EA 1DUEA 1AE5A 2Z3CA 1IQNA 1V2RT 2WPMS 1SR5C 3SJOA 1AZZA 1GHBF 1IAUA 1GCDA 1GJBB 4A5TS 1DWDH 3D49H 2BZ6H 4NFFA 4Y0YE 1F2SE 3JZ1B 3T5FH 1ELCA 3QTOH 1DUAA 1Z1JA 2CF9H 1NRSH 1EJMA 4MPXA 1EAUA 1QRZA 1BQYA 1G9IE 3PMBB 4JYUH 2ANWA 4DY7B 2CHAC 1C4U2 2VH6A 2QGRA 4ABGA 2QXHA 3U98H 3TH3H 2C4FH 1LKBA 1TNJA 4B1TA 2BYAX 1TQ0B 1AKSB 2WYGA 4DGJA 1AFQC 4E7RG 1HAHH 1GI0A 3A86A 1WAYB 3RXBA 2FO9A 3KQBA 3QTVH 1N6YA 1UJ1A 1C2KA 3V13A 3VB7A 1BTXA 1C9TA 3CP7A 2Z94A 2ZHFH 2GGVB 1LKAA 5BPEA 3VB3A 4UD9H 5L6NH 1BTWA 4I8HA 2BLVA 1VCPA 3QGJA 5CHAB 4WMEA 4HFPB 1C9PA 1XUFA 2Z3DA 3PWBA 1RTFB 2ZTYA 3PLPA 4WY3A 2OUAA 2BZAA 1O5DH 2ZU3A 3QO6A 5FCKA 2GZ8A 1VGCC 4OS4A 1YLCA 3RXGA 3ZZ6A 1GWAA 3BG4B 3ZVEA 1ESAA 1YP9A 3FP7E 2ZHDA 3AW0A 1G2MA 3RXHA 1YGCH 2WUCA 2V3HH 3UUZA 1GHXH 4BAMB 2A4OA 1IQHA 3SU5A 4ZHLU 4BOHA 2A4QA 2R2WU 2H5CA 3RXVA 4H6SB 2ZFPH 3ATLA 4CBNA 1V2QT 2CGAA 2GMTB 3BTFE 4YO9A 1D9IA 2XXLA 2BLQA 4ZROA 1GDQA 3L3TA 1FPHH 1FUJA 1UVPA 3UNQA 1GHAF 2ZGXH 3TJNA 3ZVGA 2TPIZ 1CGIE 2AMDA 1O3JA 8ESTE 3EA7A 5C5NA 1JRTA 4LXBH 1AMHA 1QB9A 4AG2A 1Y8TA 3MU0A 4NCYA 3SU6A 2F9VA 2FX4A 5JPMH 1KYNA 4NSYA 1TYNA 1MCVA 2Z7FE 3SNBA 3TNTA 1QB6A 1DANH 1O2GH 3MU5A 1ZHRA 2CF8H 2D26C 1UCYH 3F6UH 4OS1A 3KF2A 1P2IA 3SBKA 3RM0H 1N8OC 2ZI2H 1NFWA 1TGSZ 1S82A 5DP4A 5TJXA 3SOSA 1LTOA 3KHVA 4JZ1A 1LHCH 2ZDMA 3AAVA 1S5SA 1QBVH 4IGDA 4INLA 1JWTA 3UWJH 2F9PA 3A81A 1FY4A 1G3BA 5E2OA 3AASA 1V2NT 1TBRH 1CA0C 2CXVA 3A88A 1SSXA 2XNIA 3RC5A 2V0BA 1JIMA 1GVLA 1SGNE 3SU4A 1S85A 2XBXA 3SI4H 1KLTA 1ZTJA 3UWIA 1O3LA 2BD5A 2Z9IA 3ZV8A 1DSUA 1P04A 3ZVFA 1TMUH 4BTUB 4FUDA 5FX5A 1FZZA 4I8GA 3SI3H 1GJDB 1TX8A 1O2HA 4BAHB 1B0FA 1BBRH 1V2TT 5K7RA 5BRRE 4WVPE 1GCTC 1CSOE 1P9UA 2PLXA 2A45B 1HDTH 1C1QA 1ZTKA 4RSPA 1Z8GA 3MHWU 3EAJA 1CBWC 4UONA 2WUBA 4LOYH 2J9NA 2P95A 2V6NA 1BRBE 3U1JB 2ZWLH 1TPSA 4IN1A 3RXTA 1CT4E 2EEKA 1GMHF 3STJA 3LC5A 1EP6A 2O8WA 3MNCA 1CHOG 1K2I1 3P8NA 3AAUA 5GCHG 2BX4A 1ZGIA 1RIWB 1PQ5A 1XKBC 3LU9B 5C67A 4WF8A 3RXRA 1SG8B 3MNSA 1CHOF 3VGCC 3A8DA 2QA9E 4Q7XA 3SNDA 1GI4A 1DT2A 2Z9LA 3SQHE 2P93A 1AUTC 4BNRA 1GL0E 5JBTA 1Z8JB 1QL9A 3E90B 2JETC 2VIVA 3GY2A 4CR9A 1O3PB 1NRRH 1SGPE 2NU2E 2ZCKP 1UTKA 4YESB 1YC0A 3DFJA 1ABJH 1MZAA 1LVMA 5FCRA 2ZU4A 3JZ2B 2K1QA 1Z8RA 2NU4E 3QDZB 1BJUA 3LT3A 4Z6AH 2O8TA 1SGDE 2ZDKA 1QRXA 3SUDA 1KTTB 4ABDA 1NFUA 3U69H 2OQ5A 3NCLA 3ATMA 3K65B 3RC6A 4Y8ZA 1ZHMA 1FAKH 4D9RA 2TGTA 3B8JA 1IHTH 1UTPA 3R3GB 1TGBA 1SHYA 2C8YB 5E0HA 2UUFB 1CT0E 1HJAB 2ZQ2A 4Y6DA 4IS5A 4BAKB 1A0LA 5K0HA 1EPTA 3PLKA 1C1OA 1O3DA 3M3SA 1O3OA 2R3YA 1O32A 3GICB 1V3XA 1TBQH 1LVYA 5F8XA 3E91A 2Y82A 2Y7ZA 2GTBA 2ZKSA 3RU4D 1C5VA 2PWXA 2UUJB 1P02A 1NC6A 3T2NA 4X1NU 1LHDH 2QN5T 1XVOA 5LPEA 3HK6B 3NK8A 3URCA 1FQ3A 2H5DA 5ETXA 1LQEA 1O2VA 4DIIH 3EQ0H 1PJPA 2OBOA 4NG9H 2D1JA 1WTGH 2C8XB 5EOKA 4QT8C 2QF0A 4IC5A 3LOXA 3TK6A 4AFSA 4D8NA 3TGJE 4B2BA 2J34A 3LGUA 4NGAH 3PROA 3KQEA 5J4QA 2F9BH 5C2ZA 4AYYB 3MO3A 3O8CA 1BB0B 3AW1A 1XUIA 4MPWA 1MKXK 1MAYA 2A4GA 1JXPA 3BEFB 4X6PA 2FLBH 3PTBA 3FZDA 2W5EA 1C2GA 3P17H 3LGTA 4GHQA 1AVGH 1GJCB 4OGXA 1HAVA 1O2KA 2VH0A 2FYQA 5I46H 1OXGA 1C4Y2 1HB0B 1HAPH 2ZECA 4ZH8A 2SNWA 1ZMJA 1PPEE 4R0IA 3SV8A 4X1RU 1YCPK 1LCYA 3PWCA 3UR9A 1BHXF 1H4WA 4HTCH 4ZKNU 2CMYA 1GMDG 1V2PT 1ETTH 1DVAH 1C1PA 4A1XA 2SGPE 1ZYOA 2BDBA 5FXLA 2ZIQH 4A6LA 1A7SA 2SGDE 1EXFA 1GVKB 1NFXA 1VCWA 2FZZA 1HNEE 1QQ4A 3PYHA 1OWIA 1ZHPA 1LQDB 1KSNA 2ZCLP 5EQSA 4X0WU 1GI7B 2ZCHP 5A0BA 1DY8A 2ZO3H 1VITH 3BIUH 4CBOA 1K1PA 1O5FH 2BY5X 1VR1H 4GPGA 1BT7A 1QQUA 1P03A 3OSYA 3U8OH 3GCHC 5F6MA 1F0UA 5E2PA 1TIOA 2BVSH 1RIWC 3M35A 5J4SA 3EA9A 1SFQB 3KL6A 1P57B 3NZIA 1FY5A 3LONA 3TLOA 1S0QA 1MKXH 1KLJH 2BQWB 2J94A 1TA2A 3GCHB 5ESBA 4K1EA 1KXAA 2ZFTA 4DCDA 1O34A 4XBDA 3TH2H 1T4VH 4YZUA 1F5LA 1EAWA 1TX7A 5JBCS 2FOHA 3U8TH 2I6SA 1F0SA 1W0YH 2ASUB 1MTNB 3BG4C 1MTNC 5DK1A 1L4ZA 3S0NA 2BDGA 1W11U 2A4RA 2F3CE 2HRVA 2C8WB 2C8ZB 1C5QA 3EYDA 1L1GA 1Z6JH 3ZZ7A 3CENA 4CHAB 1JIRA 1TWXB 2BDAA 5EXNA 3STIA 4AGKA 1YLDA 4XBBA 3EA8A 1OPHB 1WU1A 5FAHA 5T3HA 4MTBA 2GCTB 2BD2A 1ESTA 3BTKE 1C5WB 2FOAA 1FMGA 1PFXC 2QXGA 1AZ8A 2SNVA 5F8TA 1SGIB 2BXUH 1ZMLA 2ZHQH 2BDIA 1HIAB 5HXFA 1EUFA 3SJKA 1T31A 1YPLH 3ZVCA 1XM1A 1ETSH 3P8GA 1P11E 4XFQA 5DKMA 1EASA 1TONA 1INCA 2UWPA 1O2QA 2TBSA 2PGBB 4TWWA 1C2IA 5FBEA 3KN2A 1CT2E 2FP7B 2OBQA 1AFEH 1Y3WA 2QF3A 3DFLA 1Y3UA 1P05A 4IC6A 3KCGH 4LK4A 3IITA 2PKSB 3S69A 1DE7H 3SUEA 2Z6BD 1MBQA 1NY22 2ZGBH 2BD9A 2G5VA 4INHA 4X6NA 3RXAA 1O2MA 1BRUP 4JYTA 2AERH 2VGCB 1W0ZU 1DICA 1QCPA 1YPJH 2F9OA 4O03A 3E6PH 1OKXA 1OOKB 1FNIA 1GBHA 3KQDA 2AGEX 5H4IB 4B75A 1HAVB 1SVPA 1TNIA 1ANCA 4AFUA 1TE0A 3M37A 5F03A 3MMGA 1FLEE 1QY6A 3UQVA 3Q00A 2UWLA 3NKKA 1MTVA 1VCQA 3RLWH 3GY6A 1C2LA 4I31A 4E06H 1N6XA 1O2YA 4YLUA 2GDEH 2BMGB 4YT7H 1X7AC 3UTUH 3MFJA 2R0LA 3PB1E 1C5PA 2AH4X 2B9LA 3GOVB 4DW2U 2ULLA 1BITA 2QAAA 2QIQA 2STBE 4JK6A 3BTEE 1GDUA 2Y80A 2H1UA 1VJ9U 3OYPA 1P09A 3ZZ8A 1GVZA 3ZZ9A 1AWHB 1CVWH 4FVDA 3PMAB 4A7IB 1L2EA 3F9FA 4J1YA 4K2YA 2C93B 1YPHE 1Q31A 1IQLA 3TH4H 4GHTA 2GV6A 1ZR0A 1GHWH 1YPHC 4ZMAH 5EG4A 2VVCA 4H42U 4YOJA 1O5BB 1K1NA 4YTAA 1WTHD 1PPBH 3DD2H 1K1IA 3GDSA 1RRKA 2WPJS 2BD3A 3UOPA 7KMEH 3URDA 5AFYH 5A0CA 3BG8A 4VGCB 3T26A 1SGYE 1TB6H 2HGTH 1O2RA 1HJAC 3SV9A 1HCGA 5JDUB 2ZGJA 3UIRA 4XE4A 1BMLA 1O2IA 5EW2H 1V2JT 4BXSA 2XBWA 3A89A 1TRNA 1E38B 3NUMA 1BTUA 3S9AA 2EI8A 2GT7A 4HZHA 4RN6A 2XC4A 4FXGH 3PM3A 1NROH 1IQJA 1IQKA 1DDJA 2F9NA 5AVDA 3E8LA 3H5CB 4AFQA 3A8AA 3HGNA 1TGNA 1GJ4H 1OWKA 1TOCB 2XWAA 1UTQA 3C1KA 3U9AH 3VB4A 3MNBA 1N1LA 3SJIA 2EI6A 2R3UA 1O2JA 4FU9A 2GKVE 2P3UB 5IDKA 1AU8A 1G37A 1V6DA 4UFGH 3F9EA 5EGMA 5C1UA 1GBTA 3P95A 2Y5FA 4X2VA 1H8DH 1A2CH 4DIHH 1C4V2 4GLYA 4NA7A 4XDEA 1C5MD 2VWNA 2V35A 3BTWE 2BOKA 3ATIA 4WMDA 4KP0A 4NFEA 5TCCA 4X6OA 4GSOA 4ISOA 1D4PB 4CHAC 3OX7U 3ZZDA 4KELA 2HALA 1MTWA 1VJAU 1C5YB 2PKAA 3K6YA 5DJ7A 1HAOH 1DSTA 4D7GA 1NFYA 1BZXE 1O3GA 5DP9A 1NU9A 1P2MA 5IYTA 1W12U 3BSQA 2OQUA 2VIOA 1QJ6B 1EAIA 1TRYA 2ZHWH 3KEEA 1AHTH 4YOGA 3M5OA 2TGDA 2Q6DA 2QCYA 3LPRA 2ZFSA 4ABBA 5C1YA 1GJ5H 4JMYA 3S7KB 5A8YA 2W3KA 1HRTH 1LPGB 1XMNB 3RP2A 3UPEA 1OWJA 1O39A 3T27A 2H9TH 4ABAA 1Y5UT 3PTNA 1C1MA 1ZJDA 1JMOH 2ZF0H 1E35B 3K9XB 4FUCA 1S83A 1BRAA 1RGQA 1EZQA 3ITIA 2OD3B 4NWLA 3V0XA 2FI3E 1BA8B 1T32A 2JH0D 1C1VH 1NS3A 1SLUB 1GMDF 1OYQA 1ARBA 2XW9A 4ISIH 5ABWA 2ESTE 1J16A 3M5MA 1GDNA 2PSYA 4HGCA 4Y10E 3DT0H 2Z9KA 1MAXA 4BAQB 1FONA 5AFZH 4LZ1H 4FUEA 3RM2H 5LPFA 3T28A 1QFKH 2ODYB 3UY9A 1PQAA 1KDQA 1THPB 2BQ7B 1GBMA 2A7HA 3E1XB 5HGGA 2PR3A 1IQMA 2YNBA 2H9EH 3IWMA 5I25A 1TGTA 1J14A 1VZQH 2LNCA 3PO1B 3LH1A 2J92A 4D9QA 1TMTH 1TRMA 3FFGA 1DLKB 1VITG 1YM0A 2PKAB 1GG6B 1EP5A 1ZPBA 3NWUA 1LHEH 4ABJA 1O5GH 1L1JA 3TVJB 1GI3A 1BMAA 3UR6A 2Y81A 5E0JA 1W10U 1RTLA 1EJNA 2GV7A 3SORA 1QBOA 3NXPA 5GDSH 2OC7A 4FVBA 3QZRA 3A8CA 3GCTG 4MQAA 5AHGH 4B73A 2G4TA 4Q2KA 1YPGH 2A2QH 3HKIB 2ZNKH 1GHYH 1ANDA 2IJOB 1PYTD 1FV9A 3SU0A 1GBLA 5SGAE 1MKWH 3UNRA 1HXEH 1XX9A 1OSSA 1O30A 1ELTA 3SGAE 1TALA 2GZ7A 1FJSA 2ZC9H 2EA3A 3KQCA 2TGPZ 1W8BH 2VVVA 5DP8A 1C2MA 3FVFB 2BY6X 3KGPA 3MTYA 2VNTA 2G81E 2IPHA 2ZFQH 3A83A 1IQIA 4ABEA 2A2XH 2KAIA 2UUYA 1YKTA 2ODPA 4AYVB 1D3PB 1H1BA 2BDCA 1C2EA 2PSXA 2G52A 4MNXA 4AORA 1EX3A 2TGAA 1LPKB 5DP5A 3MO6A 4MLFB 1Z6EA 4AGJA 1TX6A 3SHAH 3A7TA 1O2UA 1G2LA 2ANKH 3LJOA 3SNEA 7GCHG 2YOLA 4GAWA 2VJ1A 3P70B 3O8RA 1WCZA 1QGFA 3LGVA 1QJ1B 3W94A 1P2QA 3TITA 1UHBA 1CHGA 3SZNA 3GYLB 2NU3E 5C3NA 1O3MA 3FP6E 3SV2H 4FU8A 2A5IA 3TNSA 1EKBB 4TWYA 5T6FA 1FXYA 5GWZA 4A1VA 2STAE 3ZZAA 1BJVA 1OWHA 4KKDA 2J38A 1NPMA 3GY7A 2AMQA 1NN6A 1GJAB 1V2KT 1G30B 1SLXB 1GG6C 3TU7H 4ABFA 4I7YH 1RS0A 1NU7B 1ID5H 2PUXB 1BBRK 1O3KA 2PFEA 2RG3A 5A0AE 1CGJE 3FAOA 4NWKA 3RMMH 1ZJKA 3BTTE 5FPYA 4A1TA 3TJOA 4Z0KA 4ISNA 4Y7BA 1NRQH 3A7XA 4FUFA 4U2WA 4A92A 5JB8S 1JBUH 1QRWA 1GJ8B 1T8MA 1O31A 3C27B 4DOQA 1TFXA 2A7JA 2BLWA 1K21H 3DUXH 2A5AA 2ZDNA 4JZIA 1O2SA 4WH8A 3SO3A 3P8OA 3ATWA 3QLPH 2HNTC 3BV9B 3QN7A 1BTPA 1DPOA 1JRSA 1DXPA 2Y7XA 2ILNA 3KIDU 1EATA 2AIQA 4Y76A 1UVOA 3UREA 3BTHE 1J15A 2B7DH 2ZDLA 3GY3A 2ZGHA 5FHTA 4IMQA 1SC8U 7GCHF 2FM2A 2I6QA 1KXDA 2Y6TA 4TPIZ 1K1MA 4CRAA 5LH8A 1EJAA 1PPHE 2HPPH 1RTKA 4WH6A 3RXUA 2ANMH 2BX3A 1YCPM 1UCYE 1AWFH 1EZXC 1IQFA 3I77A 1C1SA 3K2UA 4WMFA 2QC2A 1W13U 3I78A 3LH3A 3RXSA 4B76A 5LPRA 2OC1A 3KNXA 1MCTA 4Y71A 2J95A 3S9CA 2VIWA 1GMCF 1NRPH 3ZV9A 1IQGA 1J17T 1ELBA 4B71A 1K9OE 2C3SA 3ENSB 1SGEE 2XBYA 3RXOA 2HOBA 1GGDB 4OS7A 4NIWA 5E8EH 1GGDC 1SGFG 3SQEE 4NSVA 4Q80A 1A5GH 1O37A 1HAZB 1SQTA 3MI4A 1GI2A 4WJG2 5PTPA 5CHAC 4XSKU 2YNAA 3M36A 1HBTH 3LDXH 3I29A 2OP9A 4I8JA 1GJ7B 4JZFH 1TNKA 2G5NA 3UOUA 1LHFH 3L6PA 3SW2B 5EODA 3VB5A 2RA0A 4IBLH 2R2MB 2ZHEH 1CQQA 1MU6B 4ZHAA 4BANB 3K6ZA 2JKHA 1V2LT 3A84A 2JH5D 2B5TB 1BRCE 3OY6U 4VGCC 2VU8E 4X1SU 1GMHG 2GD4B 1FIWA 4NIXA 2ANYA 2FESH 1M9UA 5GXPA 2ZEBA 1YCPH 2GMTC 5FPSA 2XC5A 4OS2A 3GY4A 3TJUA 2FOCA 2KAIB 1A0HB 1SFIA 3S9BA 1KTSB 1IOEA 1B0EA 3SU1A 1GBEA 3SN8A 3Q77A 1TAWA 4B74A 2XCFA 4GUXA 3ELAH 3A7YA 3E16B 4UDWH 5EXMA 1QTFA 2QY0B 3ZZBA 3UFAA 1RFNA 3MO9A 4DT7B 2BHGA 2VB0A 2OCVB 4NZLA 3PMHB 5JBAS 1MBMA 4F4OC 3RXIA 1W7GH 4BTTB 4CRBA 1N8OB 2P8OC 3SNAA 1K22H 5FX6A 2CJIA 1LDTT 1PYTC 2FTLE 3RUOA 1THSH 2FX6A 3O8BA 2W3IA 1U6QA 1DX5M 4FUHA 4O3UA 6GCHF 2TRMA 3ATKA 2A1DB 2FOGA 2FXRA 4JZDH 1L0ZA 1TPAE 3GISB 1TMBH 3M5LA 1KDQB 3MWIU 4Q7ZA 1AVWA 3RXJA 5CMXH 1FN6A 4X6MA 2AGGX 2XBVA 4OS6A 1XVMA 3V7TA 1SGTA 4JCNA 1RD3B 1D6WA 1MQ5A 4RKOB 4WXVA 3QWCH 2BDYA 1GI8B 1CBWB 1HYLA 2BDHA 3RC4A 6CHAB 2OXSA 4AZ2B 2A31A 1O2PA 1MTUA 4ESTE 1HLTH 2BLOA 1WQVH 1MD7A 1S81A 2Q6GA 1DWCH 8KME2 3TGIE 3SV7A 5CE1A 1ELVA 3RMOH 4X8VH 3GY5A 3M61U
chains in the Genus database with same CATH superfamily
4GVUA 2Z3EA 1K1LA 1YLNA 2BD7A 4IW4E 2C90B 1O2LA 1TPPA 5DPAA 3ZZCA 4CH2B 1PPGE 3F3BA 1MKWK 3A80A 3LC3A 5A2MH 1VITF 2FMJA 2ALVA 1EB2A 1HAIH 1LPZB 1A5IA 1MMJN 2ZU1A 2LPRA 3LJJA 3N7OA 1FX0B 2AS9A 2Q1JA 4IMZA 3E0NB 3QUMP 1TLDA 2G4UA 1UO6A 3H7TA 3D23A 3GDVA 1OS8A 1TNGA 1HJ8A 1GBFA 2ZQ1A 4O3TA 4CRCA 3PO1C 2FODA 3A7WA 4ZCNA 2QV1A 2HNTE 3T62A 1EZSC 1V2WT 4NA8A 1SGRE 1O5AB 9ESTA 1S6LA 1O3FA 4K8YA 1C2HA 4X1PU 3VFEA 2HVXA 1MQ6A 3MU4A 3RXQA 4OS5A 3CS7A 1O33A 3EGKH 3DA9B 1WBGB 1K1OA 3IG6B 1DWBH 1NM6A 4LZ4B 2H6MA 4P02A 4K69A 1G32B 3ZYDA 4RT0A 1QNJA 4X2WA 4HI3A 1CE5A 2FS9A 3ODFA 2PKSC 2EY4C 4XBCA 1P2NA 2F91A 1FPCH 1D6RA 1S6HA 1UK3A 1GBDA 1HAGE 1BTZA 3MOCA 4X8SH 1PQ8A 4CREA 2VIQA 1HIAA 5C1XA 2GCTC 1ETRH 4M7GA 2RCEA 1Y59T 3ZVAA 1RJXB 2HWLB 4CRGA 1OP2A 4Y7AA 1YPMH 2VIDA 4I33A 2M2AA 5EQQA 1SMFE 1KIGH 3CS0A 4X2XA 4ZKOU 4KTCA 2KX4A 1H9IE 1WQSA 5C94A 1O3NA 1CU1A 3RLYH 3SJ8A 4UFDH 2THFB 5EXLA 2HLCA 5C0TA 7LPRA 1ZRBA 3O8DA 1ZOMA 4BAOB 1ELDE 3GDUA 1LO6A 4Y11E 3SJ9A 4ASHA 1GBBA 1H8IH 1HGTH 2NWNA 3BTGE 2OTVA 1XKAC 1KXBA 4UEHH 4IN2A 4K1TA 4BXWA 1P12E 1BDAA 5B6OA 2V3OH 1LHGH 3MU1A 3DCLA 1A4WH 1UVUH 1AE8H 1KMHB 1SHHB 5DP7A 4MVNA 1H9LB 4H6TA 1CGHA 1TGCA 4FUJA 1ELFA 4K60A 2A5KA 1BBRE 3MH6A 4XD7D 1PPFE 2VIPA 5EJLA 1Z71A 2VVUA 3F68H 1WV7H 2AYWA 1T4UH 4MPVA 1K28D 3GCTF 3PV4A 2ZTXA 3M7QA 2O9QA 1O2OA 1QBNA 1LVBA 1GI9B 1XUKA 4PROA 2PUQH 1ZPZA 3Q3XA 1P10A 3LGWA 3T29A 2BD8A 3FP8E 2P8OB 1TA6A 1HXFH 1FY8E 1GHZA 1UVSH 5JBBS 1GBAA 1P2OA 4ISLA 1TOMH 3VXFH 1BMNH 1MTSA 2H2ZA 3RU4T 3TIUA 3S7HB 1CA0B 1DFPA 3NPSA 2WSSD 1Y3YA 2PV9B 3EE0B 4TY7A 4U32A 3B23B 5ESTE 2GCHF 3OE7D 2PTNA 3BTDE 2WINI 2XCNA 3GCNA 1GPZA 1C1UH 1SGQE 1XXDA 1AB9C 2WPKS 2A7CA 4ZUHA 4B2AA 1AN1E 1BIOA 3QGNB 1JOUB 5DG6A 3SGQE 1GL1A 3MNXA 5GPIB 5A09A 1SOTA 3B9FH 4AFZA 5L30H 3RMLH 5HMAA 4CH8B 1ABIH 4Y0ZE 2M5TA 1V2MT 5FBIA 1A61H 3RMNH 5EQRA 2O8LA 3DSGA 1ESBA 3BTME 1UTLM 3P92A 1F5RA 4NIVA 3U8RH 1V2OT 4AOQA 1O3CA 2BY7X 1P3EA 5T6GA 1T7CA 1YWUA 2KM0A 7ESTE 1UK4A 1AFQB 1AKSA 5G4BA 1XUHA 1QZ8A 2P59A 2G51A 2XTTB 3HK3B 4H4FA 4F48B 4UFFH 1YF4A 1GHBG 1O36A 3GYMA 1A3EH 4I32A 2YMSD 2J4IA 4FUGA 2BVXH 1C5RA 2AEIH 2FTMA 2BQ6B 2XC0A 2HNTF 1TPOA 4ISHH 4YT6H 1MUEB 4X8UH 3FANA 1FDPA 5A8ZA 5GIBA 2P3TB 2DE8A 1O0DH 2F9UA 2ZFFH 3RXFA 2R9PA 3D65E 1LMWB 3ZVBA 3T25A 2OC0A 4YOIA 4MPUA 2J97A 1C1TA 2JIZD 2PHBA 1GBJA 4ZAEA 2GT8A 2FPZA 1QA7A 3Q3YA 4X1QU 1TABE 4E05H 2KFWA 3TJVA 4AB9A 1EZUC 1MD8A 1AVXA 2ZGCA 1WOFA 8GCHG 5EPNA 1AQ7A 2Y5HA 4K5ZA 1GJ9B 2XYAA 8LPRA 1HUTH 4NZQA 1ELGA 1OP0A 1T8NA 3MU8A 2FIRH 1P8VC 1TNHA 2CV3A 3GY8A 4MG3A 5JYIA 4X8TH 2VINA 2OINA 3W95A 2GP9B 3RU4E 1GMCG 4FETA 4KTUA 1GBIA 2IN2A 3A8BA 2ZTZA 2W7UA 1HV7A 1NT1A 1DWEH 2ZZUH 2Q6FA 2BD4A 3N7DA 1F0TA 1C2JA 1C5ZB 2A32A 5HM9A 3QK1A 4TYDA 3TGKE 4ZKRU 1ZRKA 1WYKA 1Z1IA 1H8HD 1Y5AT 4K3JA 3A7ZA 2VGCC 5L2YH 4AB8A 3RXKA 1SQRA 1YPKH 1WUNH 3SV6A 1W14U 1J8AA 1CO7E 4THNH 1Z7KA 1MU8B 3MH7A 1ANBA 2RDLA 3BIVH 4F49A 1PPZA 2W26A 3E0PB 1F0RA 2P3FH 2SGAA 3RXLA 4JZEH 1A1RA 3RXMA 2FDAA 1THRH 2FOMB 4UE7H 4JYVH 2BM2A 4Q7YA 2AGIX 1P2JA 2SGEE 1FIZA 4MNYA 3F2FA 2SGQE 1SGFA 1O2TA 1GCTB 1G3CA 2KCYA 1E34B 4ABHA 1SLWB 1HAXB 3SHCH 2ZPQA 6LPRA 3PLBA 1TQ7B 1A0JA 1S6FA 3SNCA 2ZU2A 3PV2A 1FY3A 4U01A 2SGFE 1UCYK 2Z9GA 1ZSLA 4XOJA 2WPLS 1L4DA 3F1SB 1C5TA 3LGIA 4MDSA 3NRLA 3WY8A 3HATH 1Z8IB 1EOLA 1BHXB 2WV5A 2AMPA 4X2YA 1FAXA 3GS9A 3KYGA 1GI1A 2ZU5A 4KGAA 4K8BA 5L2ZH 5EW1H 4J2YB 1PQ7A 1T8OA 4YLQH 3RXPA 3QX5H 3ZYEA 1BCUH 2DE9A 4ZKSU 8GCHF 1NZQH 2VWMA 4YM9A 2PTCE 2A0QB 1C5LH 2BVRH 3GCOA 2VBCA 1UTJA 2FOFA 2O8MA 2WV4A 2PP6A 3Q76A 3E3TA 2CN0H 3DSOA 1NO9H 4AX9H 3TK9A 5HYOA 3FO8D 1J9CH 1ZZZA 1MZDA 3TK5A 1QJ7B 1YYY1 1MABB 5DGJA 1SI5H 2ZPRA 1ZSJA 1A3BH 1ARCA 1UTNA 1VGCB 1XXFA 1E36B 3ESTA 1ELAA 1UK2A 1O35A 1BUIA 4ZXXH 2AIPA 1AGJA 1OP8A 3BEIB 3RXDA 1YBWA 2RA3A 1UHBB 5DP3A 1EOJA 3VG8A 4UFEH 1KXEA 4FUBA 1F7ZA 3ODDA 4INKA 1GI6A 4AG1A 3M5NA 4NA9H 3P8FA 2BTCE 1TBZH 1KY9A 5TCAA 2ALPA 2FOBA 2GX4A 4DG4A 4D76A 1GBKA 1IHSH 2SFAA 3M7UA 1DOJA 5EPYA 1HFDA 4KTSA 1T8LA 2GVFA 3BEUA 4ZHMU 1KXFA 2FEQH 1P0SH 2EC9H 2QYIA 1O2ZA 4E7NA 4I8KA 1O3BA 3M3VA 2F83A 3PMJA 1ZSKA 1D3TB 3H7OA 1NESE 1EAXA 4SGBE 5GCHF 3V3MA 2NU1E 2BOHB 1AUJA 4FUIA 1C5OH 1AB9B 4JK5A 2GDDA 5F8ZA 1V2ST 3VB6A 4DURA 1A5HA 3R0FA 3TPIZ 2ZDAH 2HPQH 3ZZ5A 1F92A 1SBWA 1QB1A 2J98A 3V12A 1P3CA 4CRDA 1O2NA 2FI5E 3L33A 1C2FA 3RXEA 1ACBE 4RKJB 1Q3XA 4WWYA 3VPKA 1W2KH 2P94A 1O38A 1BMMH 1KXCA 1QL8A 3ZVDA 1O5CB 3F9HA 3G01A 1P9SA 2UUKB 5AF9H 1DS2E 3F9GA 2VWOA 2OC8A 1SOZA 2BY9X 2ZPSA 6GCHG 2JJ1D 2ZG0H 3SUGA 1QURH 1BOQA 1RXPA 5C20A 4BTIB 5DO4H 3A7VA 3MYWA 5FPTA 2NU0E 1Y5BT 1D3QB 4DJZB 1SQAA 5HKKD 1OX1A 1G3EA 1BTYA 3SU3A 2ZFRH 3AVZA 1Q2WA 2JETB 1ZMNA 1L1NA 2B0FA 1PPCE 2GCHG 1EQ9A 1AI8H 1C2DA 2IPQX 4Y8XA 5E0GA 2XWBI 5DP6A 4K1SA 1NRNH 1ZGVA 3RXCA 1MH0A 2D2DA 3BTQE 2ODQA 1GJ6A 1XUGA 1K1JA 1SGCA 3U1IB 1F5KU 1Y3VA 4Z1MD 1SL3A 4Y79A 2XOKD 2FI4E 2FLRH 2ZP0H 2GZ9A 4WXIA 1CA8B 2G55A 1SQOA 1UTMA 2CHAB 3M3TA 3M7TA 3ZZ4A 1O3HA 3D62A 2FYRA 1E1RD 1E0FD 2QXJA 2KCOA 3OEED 1S0RA 3HPTB 2H9HA 4AN7A 1GHAG 1FN8A 1DXWA 2OLGA 5EU8A 5GJ4B 2EI7A 1TNLA 3HGPA 1W7XH 3WWFA 1HAYB 3FN8A 1H8ED 1EPTC 3BF6H 3A85A 4O9VA 1ZLRA 1FI8A 3LIWA 4MNWA 1QR3E 3EE7A 1O3IA 3HKJB 1O2XA 3U28C 3A87A 3RDZA 2G8TA 1V2UT 3VGCB 2D8WA 2DUCA 3MH4A 4GCHG 1C1RA 1XUJA 4Y8YA 2J2UA 1KLIH 3VXEH 4ZXYH 1BTHH 4D7FA 2WPHS 5T6DA 5LGOA 4OM9A 4CR5A 3OY5U 2F43B 1O3AA 1W3CA 1Y3XA 1AD8H 1K0HA 1OWEA 3QZQA 4U30A 1NTPA 3WWBA 1G36A 1P06A 3EDXB 1OYTH 2AFQB 4O97A 1V2VT 2BY8X 2FOEA 4NIYA 2FWWA 1UVTH 2XRCA 1DY9A 1FY1A 4I8LA 9LPRA 2O8UA 5HM2A 1OWDA 1EPTB 2JH6D 1AY6H 4OGYA 1E1QD 2ZA5A 4DVAU 2Z9JA 1E37B 1LVOA 3LKWA 3A82A 1UTOA 3VEQB 3UNSA 3ZZ3A 4B2CA 5A8XA 1H9HE 1IQEA 1O2WA 1ORFA 1P01A 1SB1H 3SUFA 1B7XB 3SU2A 1C5UA 1DM4B 1ZPCA 2BXTH 1ELEE 3DHKH 2Y5GA 3Q3KA 2BB4A 6ESTA 1QIXB 2WYJA 4XRNA 5C5OA 2K0QA 5GNDA 3OU0A 4CRFA 3FZZA 3UQOA 2WPIS 2QXIA 1GBCA 4MNVA 1AIXH 1HPGA 4TPYA 1C5SA 1SPJA 1C1WH 1UMAH 1WSSH 1B5GH 1HJ9A 1GI5A 1ANEA 4TY6A 1YPEH 2UWOA 2TIOA 1ZTLA 2VWLA 3OTJE 1C5XB 1O5EH 2PW8H 1AO5A 1A46H 3LGYA 2B8OH 2WZQA 1G3DA 1S84A 1SLVB 3P6ZB 4FU7A 2P16A 4R8TB 2IOTA 2CK3D 1QL7A 2G00A 2ZDVH 2R0KA 1QA0A 6CHAC 1D3DB 2W7SA 1C5NH 5JB9S 3BN9A 1DLEA 1P2KA 2FS8A 3MH5A 4SGAE 4ABIA 5EIYA 1EB1H 1QHRB 1GHVH 4GCHF 2PGQB 1C1NA 3SGBE 1DITH 1O3EA 1DUEA 1AE5A 5C17A 2Z3CA 1IQNA 1V2RT 2WPMS 1SR5C 3SJOA 1AZZA 1GHBF 1SKYE 1IAUA 1GCDA 1GJBB 4A5TS 1DWDH 3D49H 2BZ6H 4NFFA 4Y0YE 1F2SE 3OTPA 3JZ1B 3T5FH 1ELCA 3QTOH 1DUAA 1Z1JA 2CF9H 1NRSH 1EJMA 4MPXA 1EAUA 1QRZA 3KQ5A 1BQYA 1G9IE 3PMBB 4JYUH 2ANWA 4DY7B 2CHAC 1C4U2 2VH6A 2QGRA 4ABGA 2QXHA 3U98H 3F0PA 3TH3H 2C4FH 1LKBA 1TNJA 4B1TA 4FOUC 2BYAX 1TQ0B 1AKSB 2WYGA 4DGJA 1AFQC 4E7RG 1HAHH 1GI0A 2KZ4A 3A86A 1WAYB 3RXBA 2FO9A 3KQBA 3QTVH 1N6YA 1UJ1A 1C2KA 3V13A 3VB7A 1BTXA 1C9TA 3CP7A 2Z94A 2QF5A 2ZHFH 2GGVB 1LKAA 5BPEA 3VB3A 4UD9H 5L6NH 1BTWA 4I8HA 2BLVA 1VCPA 3QGJA 5CHAB 4WMEA 4HFPB 1C9PA 1XUFA 2Z3DA 3PWBA 1RTFB 2ZTYA 3PLPA 4WY3A 2OUAA 2BZAA 1O5DH 2ZU3A 3QO6A 5FCKA 2GZ8A 1VGCC 4OS4A 1YLCA 3RXGA 3ZZ6A 1GWAA 3BG4B 3ZVEA 3PRDA 2QE7D 2WPDD 1ESAA 3UB0A 1YP9A 3FP7E 2J5UA 2ZHDA 3AW0A 1G2MA 3RXHA 1YGCH 2WUCA 2V3HH 3UUZA 1GHXH 4BAMB 2A4OA 1IQHA 3SU5A 4ZHLU 4BOHA 2OK5A 2A4QA 2R2WU 2H5CA 3RXVA 4H6SB 3AK5A 2ZFPH 3ATLA 4CBNA 1V2QT 2CGAA 2GMTB 3BTFE 4YO9A 1D9IA 2XXLA 2BLQA 4ZROA 1GDQA 2YMSB 1FPHH 3L3TA 1FUJA 1UVPA 3UNQA 1GHAF 2ZGXH 3TJNA 3ZVGA 2TPIZ 3F0OA 1CGIE 2AMDA 1O3JA 8ESTE 3EA7A 5C5NA 1JRTA 4LXBH 1AMHA 1QB9A 4AG2A 2WV9A 1Y8TA 3MU0A 2KR7A 4NCYA 3SU6A 2F9VA 2FX4A 5JPMH 1KYNA 4NSYA 1TYNA 1MCVA 2Z7FE 3SNBA 3TNTA 1COWD 1QB6A 1DANH 1O2GH 3MU5A 1ZHRA 2CF8H 2D26C 1UCYH 3F6UH 4OS1A 3KF2A 1P2IA 3SBKA 3RM0H 1N8OC 2ZI2H 1NFWA 1TGSZ 1S82A 5DP4A 5TJXA 3SOSA 1LTOA 3KHVA 4JZ1A 1LHCH 4F55A 2ZDMA 3AAVA 1S5SA 1QBVH 4IGDA 4INLA 2W6ID 1JWTA 2QF4A 3UWJH 2F9PA 3A81A 1FY4A 1G3BA 5E2OA 3AASA 1V2NT 1TBRH 1CA0C 2CXVA 3A88A 1SSXA 2RFKC 2XNIA 2WHXA 3RC5A 2V0BA 1JIMA 1GVLA 1SGNE 3DSPA 3SU4A 1S85A 2XBXA 3SI4H 1KLTA 1ZTJA 3UWIA 1O3LA 2BD5A 2Z9IA 3ZV8A 1DSUA 1P04A 3ZVFA 1TMUH 4BTUB 4FUDA 5FX5A 1FZZA 4I8GA 3SI3H 1GJDB 1TX8A 2W6JD 1O2HA 4BAHB 1B0FA 1BBRH 1V2TT 5K7RA 5BRRE 4WVPE 1GCTC 1CSOE 1P9UA 2PLXA 2A45B 1HDTH 1C1QA 1ZTKA 4ASUD 4RSPA 2RDEA 1Z8GA 3MHWU 3EAJA 1CBWC 4UONA 2WUBA 4LOYH 2J9NA 2P95A 2V6NA 4AC9A 1BRBE 3U1JB 2ZWLH 1TPSA 4IN1A 3RXTA 1CT4E 2EEKA 1GMHF 3STJA 3LC5A 1EP6A 2O8WA 3MNCA 1CHOG 1K2I1 3P8NA 3AAUA 5GCHG 2BX4A 1OHHD 1ZGIA 2V3MA 1RIWB 2F4LA 1PQ5A 1XKBC 3LU9B 5C67A 4WF8A 3RXRA 1SG8B 3MNSA 1CHOF 3VGCC 3A8DA 2QA9E 4Q7XA 3SNDA 1GI4A 1DT2A 2Z9LA 3SQHE 2P93A 1AUTC 4BNRA 1GL0E 5JBTA 1Z8JB 1QL9A 3E90B 2JETC 1W0JD 2VIVA 3GY2A 4CR9A 1O3PB 1NRRH 1SGPE 2NU2E 2ZCKP 1UTKA 4YESB 1YC0A 3DFJA 1ABJH 1MZAA 1LVMA 5FCRA 2ZU4A 3JZ2B 2K1QA 1Z8RA 2NU4E 3QDZB 1BJUA 3LT3A 4Z6AH 2O8TA 1SGDE 2ZDKA 1QRXA 3SUDA 1KTTB 4ABDA 5FL7D 1NFUA 3U69H 2OQ5A 3NCLA 3ATMA 3K65B 3RC6A 4Y8ZA 1ZHMA 1FAKH 3F2HA 4D9RA 2TGTA 3B8JA 1IHTH 1UTPA 3R3GB 1TGBA 1SHYA 2C8YB 5E0HA 2UUFB 1CT0E 1HJAB 2ZQ2A 4Y6DA 4IS5A 4BAKB 1A0LA 5K0HA 1EPTA 3PLKA 1C1OA 1O3DA 3M3SA 1O3OA 2R3YA 1O32A 3GICB 1V3XA 1TBQH 1LVYA 5F8XA 3E91A 2Y82A 2Y7ZA 2GTBA 2ZKSA 3RU4D 1C5VA 2PWXA 2UUJB 1P02A 1NC6A 3T2NA 5CHBA 4X1NU 1LHDH 2QN5T 2EQNA 1XVOA 5LPEA 3HK6B 3NK8A 3URCA 1FQ3A 2H5DA 5ETXA 1LQEA 1O2VA 4DIIH 3EQ0H 1PJPA 2OBOA 4NG9H 2D1JA 1WTGH 2L6OA 2C8XB 5EOKA 4QT8C 2QF0A 4IC5A 3LOXA 3TK6A 4AFSA 4D8NA 3TGJE 4B2BA 2J34A 3LGUA 4NGAH 5EJ1A 3PROA 3KQEA 5J4QA 2F9BH 5C2ZA 4AYYB 3MO3A 3O8CA 1BB0B 3AW1A 1XUIA 4MPWA 1MKXK 1MAYA 2A4GA 1JXPA 3BEFB 4X6PA 2FLBH 3PTBA 3FKSD 3FZDA 2W5EA 1C2GA 3P17H 3LGTA 3W1EA 4GHQA 1AVGH 1GJCB 4OGXA 1HAVA 1O2KA 2VH0A 2FYQA 5I46H 1OXGA 1C4Y2 1HB0B 4YXWD 1HAPH 2ZECA 4ZH8A 2SNWA 1ZMJA 1PPEE 4R0IA 3SV8A 4X1RU 1YCPK 1WXRA 1LCYA 3PWCA 3UR9A 1BHXF 1H4WA 4HTCH 4ZKNU 5C0UA 2CMYA 1GMDG 1V2PT 1ETTH 2KCPA 1DVAH 1C1PA 4A1XA 2SGPE 1ZYOA 2BDBA 5FXLA 2ZIQH 4A6LA 1A7SA 2SGDE 1EXFA 1GVKB 1NFXA 1VCWA 2FZZA 1HNEE 1QQ4A 3PYHA 1OWIA 1ZHPA 1LQDB 1KSNA 2ZCLP 5EQSA 4X0WU 1GI7B 2ZCHP 5A0BA 1DY8A 2ZO3H 1VITH 3BIUH 4CBOA 1K1PA 1O5FH 2BY5X 1VR1H 4GPGA 1BT7A 5T1VA 1QQUA 1P03A 3OSYA 3U8OH 3GCHC 5F6MA 1F0UA 5E2PA 1TIOA 2BVSH 1RIWC 2L74A 3M35A 5J4SA 3EA9A 1SFQB 3KL6A 1P57B 3NZIA 2LP6A 1FY5A 3LONA 3TLOA 1S0QA 1MKXH 1KLJH 2BQWB 2J94A 1TA2A 3GCHB 5ESBA 4K1EA 1KXAA 2ZFTA 3PV5A 4DCDA 1O34A 4XBDA 3TH2H 1T4VH 4YZUA 1F5LA 1EAWA 1TX7A 5JBCS 2FOHA 3U8TH 2I6SA 1F0SA 1W0YH 2ASUB 1MTNB 3BG4C 1MTNC 5DK1A 1L4ZA 3S0NA 2BDGA 1W11U 2A4RA 2F3CE 2HRVA 2C8WB 2C8ZB 1C5QA 3EYDA 1L1GA 1Z6JH 3ZZ7A 3CENA 4CHAB 1JIRA 1TWXB 2BDAA 5EXNA 3STIA 4AGKA 1YLDA 4XBBA 3EA8A 1OPHB 4TSFD 1WU1A 5FAHA 5T3HA 4RT1A 4MTBA 2GCTB 2BD2A 1ESTA 3BTKE 1C5WB 2FOAA 1FMGA 1PFXC 2QXGA 1AZ8A 2SNVA 5F8TA 1SGIB 2BXUH 1ZMLA 2ZHQH 2BDIA 1HIAB 5HXFA 1EUFA 3SJKA 3ZIAD 1T31A 1YPLH 3ZVCA 1XM1A 1ETSH 3P8GA 1P11E 4XFQA 5DKMA 1EASA 1TONA 1INCA 2UWPA 1O2QA 2K8IA 2TBSA 2PGBB 4TWWA 1C2IA 5FBEA 3KN2A 1CT2E 2FP7B 2OBQA 1AFEH 1Y3WA 2QF3A 3DFLA 1Y3UA 2GJGA 1P05A 3OAAD 5B6LA 4Q63A 4IC6A 3MQKC 3KCGH 4LK4A 3IITA 2PKSB 3S69A 1DE7H 3SUEA 2HLDD 2Z6BD 1MBQA 1NY22 2ZGBH 2BD9A 2G5VA 4INHA 4X6NA 3RXAA 1NBME 1O2MA 1BRUP 4JYTA 2AERH 2VGCB 1W0ZU 1DICA 1QCPA 1YPJH 2F9OA 4O03A 3E6PH 1OKXA 1OOKB 1FNIA 1GBHA 3KQDA 2AGEX 5H4IB 4B75A 1HAVB 1SVPA 1TNIA 1ANCA 4AFUA 1TE0A 3M37A 5F03A 3MMGA 1FLEE 1QY6A 3UQVA 3Q00A 2UWLA 3NKKA 1MTVA 1VCQA 3RLWH 3GY6A 1C2LA 4I31A 3OFND 4E06H 1N6XA 1O2YA 4YLUA 2GDEH 2BMGB 4YT7H 1X7AC 3UTUH 3MFJA 2R0LA 3PB1E 1C5PA 2AH4X 2B9LA 3GOVB 4DW2U 2ULLA 1BITA 2QAAA 2QIQA 2STBE 4JK6A 3BTEE 1GDUA 2Y80A 2H1UA 1VJ9U 3OYPA 4HG6A 1P09A 3ZZ8A 1GVZA 3ZZ9A 1AWHB 1CVWH 4FVDA 3PMAB 4A7IB 1L2EA 3F9FA 4J1YA 4K2YA 2C93B 1YPHE 1Q31A 2JJ2D 1IQLA 3TH4H 4GHTA 2GV6A 1ZR0A 1GHWH 1YPHC 4ZMAH 5EG4A 2VVCA 4H42U 4YOJA 1O5BB 1K1NA 4YTAA 1WTHD 1PPBH 3DD2H 1K1IA 3GDSA 1RRKA 2WPJS 2BD3A 3UOPA 7KMEH 3URDA 5KEDA 5AFYH 5A0CA 3BG8A 4VGCB 3T26A 1SGYE 1TB6H 2HGTH 1O2RA 1HJAC 1YY3A 3SV9A 1HCGA 5JDUB 2ZGJA 3UIRA 4XE4A 1BMLA 1O2IA 5EW2H 1VKYA 1V2JT 4BXSA 2XBWA 3SZEA 3A89A 1TRNA 4ACAA 1E38B 3NUMA 1BTUA 3S9AA 2EI8A 2GT7A 4HZHA 4RN6A 2XC4A 4FXGH 3PM3A 1NROH 1IQJA 1IQKA 1DDJA 2F9NA 5AVDA 3E8LA 3H5CB 4AFQA 3A8AA 3HGNA 1TGNA 1GJ4H 1OWKA 1TOCB 1UTQA 2XWAA 3C1KA 3U9AH 3VB4A 3MNBA 1N1LA 3SJIA 2EI6A 2R3UA 1O2JA 4FU9A 2GKVE 2P3UB 5IDKA 1AU8A 1G37A 1V6DA 4DT4A 4UFGH 3F9EA 5EGMA 5C1UA 1GBTA 3P95A 2Y5FA 4X2VA 1H8DH 1A2CH 4DIHH 3FOAA 1C4V2 4GLYA 4NA7A 4XDEA 1C5MD 2VWNA 2V35A 3BTWE 2BOKA 3ATIA 4WMDA 4KP0A 4NFEA 5TCCA 4X6OA 4GSOA 4ISOA 1D4PB 4CHAC 3OX7U 3ZZDA 4KELA 2HALA 1MTWA 1VJAU 1C5YB 2PKAA 3K6YA 5DJ7A 1HAOH 3WW7A 1DSTA 4D7GA 1NFYA 1BZXE 1O3GA 5DP9A 1NU9A 1P2MA 5IYTA 1W12U 3BSQA 3PRBA 2OQUA 2VIOA 1QJ6B 4TT3D 1EAIA 1TRYA 2ZHWH 3KEEA 1AHTH 4YOGA 3M5OA 2TGDA 2Q6DA 2QCYA 3LPRA 2ZFSA 4ABBA 5C1YA 3N7EA 1GJ5H 4JMYA 3S7KB 5A8YA 2W3KA 1HRTH 1LPGB 1XMNB 3RP2A 3UPEA 1OWJA 1O39A 3T27A 2H9TH 4ABAA 1Y5UT 3PTNA 1C1MA 1ZJDA 1JMOH 2ZF0H 3F2GA 1E35B 3K9XB 4FUCA 1S83A 1BRAA 1RGQA 1EZQA 3ITIA 2OD3B 4NWLA 3V0XA 2FI3E 1BA8B 1T32A 2JH0D 1C1VH 1NS3A 1SLUB 1GMDF 1OYQA 1ARBA 2XW9A 4ISIH 5ABWA 2ESTE 1J16A 3M5MA 5DSFA 1GDNA 2PSYA 4HGCA 4Y10E 3DT0H 2Z9KA 1MAXA 4BAQB 1FONA 5AFZH 4LZ1H 4FUEA 3RM2H 5LPFA 3T28A 1QFKH 2ODYB 3UY9A 1PQAA 1KDQA 1THPB 2BQ7B 1GBMA 2A7HA 3E1XB 5HGGA 2PR3A 1BMFD 1IQMA 2YNBA 2H9EH 3IWMA 5I25A 1TGTA 3KYFA 1J14A 1VZQH 2JDID 2LNCA 3PO1B 2KCAA 3LH1A 2J92A 4D9QA 1TMTH 1TRMA 3FFGA 2HVYB 1DLKB 1VITG 1YM0A 2PKAB 1GG6B 1EP5A 1ZPBA 3NWUA 1LHEH 4ABJA 4B6FA 1O5GH 1L1JA 3TVJB 1GI3A 1BMAA 3UR6A 4RI0A 2Y81A 5E0JA 1W10U 1RTLA 1EJNA 2GV7A 3SORA 3H09A 1QBOA 3SYJA 3NXPA 2AHME 5GDSH 2OC7A 4FVBA 3QZRA 3A8CA 4I86A 3GCTG 4MQAA 5AHGH 4B73A 2G4TA 4Q2KA 1YPGH 2A2QH 3HKIB 2ZNKH 5HIZA 1GHYH 1ANDA 2IJOB 1PYTD 1FV9A 3SU0A 1GBLA 5SGAE 1MKWH 3UNRA 1HXEH 1XX9A 1OSSA 1O30A 1ELTA 3SGAE 1TALA 2GZ7A 1FJSA 2ZC9H 2EA3A 3KQCA 2TGPZ 1W8BH 2VVVA 5DP8A 1C2MA 3FVFB 2BY6X 3KGPA 3MTYA 2VNTA 2G81E 2IPHA 2ZFQH 3A83A 1IQIA 4ABEA 2A2XH 2KAIA 2UUYA 1YKTA 2ODPA 3CNRA 4AYVB 1D3PB 1H1BA 2BDCA 1C2EA 2PSXA 2G52A 4MNXA 4AORA 1EX3A 2TGAA 1LPKB 5DP5A 3MO6A 4MLFB 1Z6EA 4AGJA 1TX6A 3SHAH 3A7TA 1O2UA 1G2LA 5HIYA 2ANKH 3LJOA 3SNEA 7GCHG 2YOLA 4GAWA 2V7QD 2VJ1A 3P70B 3O8RA 1WCZA 1QGFA 3LGVA 1QJ1B 3W94A 1P2QA 3TITA 1UHBA 1CHGA 3SZNA 3GYLB 2NU3E 5C3NA 1O3MA 2XNDD 3FP6E 3SV2H 4FU8A 2A5IA 3TNSA 1EKBB 4TWYA 5T6FA 1FXYA 5GWZA 4A1VA 4ACBA 2STAE 3ZZAA 1BJVA 1OWHA 4KKDA 2J38A 1NPMA 3GY7A 2AMQA 1NN6A 1GJAB 1V2KT 1G30B 1SLXB 1GG6C 3TU7H 4ABFA 5DN6D 1RS0A 4I7YH 1NU7B 1ID5H 2PUXB 1BBRK 1O3KA 2PFEA 2RG3A 5A0AE 1CGJE 3FAOA 4NWKA 3RMMH 1ZJKA 3BTTE 5FPYA 4A1TA 3TJOA 4Z0KA 4ISNA 4Y7BA 1NRQH 3A7XA 4FUFA 4U2WA 4A92A 5JB8S 1JBUH 1QRWA 1GJ8B 1T8MA 1O31A 3C27B 4DOQA 1TFXA 2A7JA 2BLWA 1K21H 3UAIC 3DUXH 2A5AA 2ZDNA 4JZIA 1O2SA 4WH8A 3SO3A 3P8OA 3ATWA 3QLPH 2HNTC 3BV9B 3QN7A 1BTPA 1DPOA 1JRSA 1DXPA 2Y7XA 2ILNA 3KIDU 1EATA 2AIQA 4Y76A 1UW7A 1NBMD 1UVOA 3UREA 3BTHE 1J15A 2B7DH 2ZDLA 3GY3A 2ZGHA 5FHTA 4IMQA 1SC8U 7GCHF 2FM2A 2I6QA 1KXDA 2Y6TA 4TPIZ 1K1MA 4CRAA 2LELA 5LH8A 1EJAA 1PPHE 2HPPH 1RTKA 4WH6A 3RXUA 2ANMH 2BX3A 1YCPM 1UCYE 1AWFH 1EZXC 2YMSC 1IQFA 3I77A 1C1SA 3K2UA 4WMFA 2QC2A 1W13U 3I78A 3LH3A 3RXSA 4B76A 1EFRD 5LPRA 2OC1A 3KNXA 1MCTA 4Y71A 2J95A 3S9CA 2VIWA 1GMCF 1NRPH 3ZV9A 1IQGA 1J17T 1ELBA 4B71A 1K9OE 2C3SA 3ENSB 1SGEE 2XBYA 3RXOA 2HOBA 1GGDB 4OS7A 4NIWA 5E8EH 1GGDC 1SGFG 3SQEE 4NSVA 4Q80A 1A5GH 1O37A 1HAZB 1SQTA 3MI4A 1GI2A 4WJG2 5PTPA 5CHAC 4XSKU 2YNAA 3M36A 1HBTH 3LDXH 3I29A 2OP9A 4I8JA 1GJ7B 4JZFH 1TNKA 2G5NA 3UOUA 1LHFH 4M9FA 3L6PA 3SW2B 5EODA 3VB5A 2RA0A 4IBLH 2R2MB 2ZHEH 1CQQA 1MU6B 4ZHAA 4BANB 3K6ZA 2JKHA 1V2LT 5KGOA 3A84A 2JH5D 2B5TB 1BRCE 3OY6U 4VGCC 2VU8E 4X1SU 4P00A 1GMHG 2GD4B 1FIWA 4NIXA 2ANYA 2FESH 1M9UA 5GXPA 2ZEBA 1YCPH 2GMTC 5FPSA 2XC5A 4OS2A 3GY4A 3TJUA 2FOCA 2KAIB 1A0HB 1SFIA 3S9BA 1KTSB 1IOEA 1B0EA 3N99A 3SU1A 1GBEA 3SN8A 3Q77A 2IJD1 1TAWA 4B74A 2XCFA 4GUXA 1E79D 3ELAH 3A7YA 3E16B 4UDWH 5EXMA 1QTFA 2QY0B 3ZZBA 5KECA 3UFAA 1RFNA 1W0KD 3MO9A 4DT7B 2BHGA 2VB0A 2OCVB 4NZLA 3PMHB 5JBAS 1MBMA 2J98B 3RXIA 4F4OC 1W7GH 4BTTB 4CRBA 1N8OB 2P8OC 3SNAA 1K22H 5FX6A 2CJIA 1LDTT 1PYTC 2FTLE 3RUOA 1THSH 2FX6A 3O8BA 2W3IA 1U6QA 1DX5M 4FUHA 4O3UA 6GCHF 3OEHD 2TRMA 3ATKA 2A1DB 2FOGA 2FXRA 4JZDH 1L0ZA 1TPAE 3GISB 1TMBH 3M5LA 1KDQB 3MWIU 4Q7ZA 1AVWA 3RXJA 5CMXH 5EJZA 1FN6A 4X6MA 2AGGX 2XBVA 5IK2D 4OS6A 1XVMA 3V7TA 1SGTA 5F53A 4JCNA 1WDIA 1RD3B 1D6WA 1MQ5A 4RKOB 4WXVA 3QWCH 2BDYA 1GI8B 1CBWB 1HYLA 2BDHA 3RC4A 6CHAB 2OXSA 4AZ2B 2A31A 1O2PA 1MTUA 4ESTE 4B6EA 1HLTH 2BLOA 1WQVH 1MD7A 1S81A 4Q4LA 2Q6GA 1DWCH 8KME2 3TGIE 3SV7A 5CDFE 5CE1A 1ELVA 3RMOH 4X8VH 3GY5A 3M61U
chains in the Genus database with same CATH topology
4GVUA 2Z3EA 1K1LA 2BD7A 4IW4E 2C90B 1O2LA 1TPPA 5DPAA 3ZZCA 4CH2B 1PPGE 1MKWK 3A80A 3LC3A 5A2MH 1VITF 2FMJA 2ALVA 1EB2A 1HAIH 1LPZB 1A5IA 1MMJN 2ZU1A 2LPRA 3LJJA 3N7OA 2AS9A 2Q1JA 4IMZA 3E0NB 3QUMP 1TLDA 2G4UA 1UO6A 3H7TA 3D23A 3GDVA 1OS8A 1TNGA 1HJ8A 1GBFA 2ZQ1A 4O3TA 4CRCA 3PO1C 2FODA 3A7WA 2QV1A 2HNTE 3T62A 1EZSC 1V2WT 4NA8A 1SGRE 1O5AB 9ESTA 1O3FA 4K8YA 1C2HA 4X1PU 3VFEA 2HVXA 1MQ6A 3MU4A 3RXQA 4OS5A 3CS7A 1O33A 3EGKH 3DA9B 1WBGB 1K1OA 3IG6B 1DWBH 1NM6A 4LZ4B 2H6MA 4K69A 1G32B 3ZYDA 1QNJA 4X2WA 4HI3A 1CE5A 2FS9A 3ODFA 2PKSC 4XBCA 1P2NA 2F91A 1FPCH 1D6RA 1S6HA 1UK3A 1GBDA 1HAGE 1BTZA 3MOCA 4X8SH 1PQ8A 4CREA 2VIQA 1HIAA 5C1XA 2GCTC 1ETRH 4M7GA 2RCEA 1Y59T 3ZVAA 1RJXB 2HWLB 4CRGA 1OP2A 4Y7AA 1YPMH 2VIDA 4I33A 5EQQA 1SMFE 1KIGH 3CS0A 4X2XA 4ZKOU 4KTCA 1H9IE 1WQSA 1O3NA 1CU1A 3RLYH 3SJ8A 4UFDH 2THFB 5EXLA 2HLCA 7LPRA 1ZRBA 3O8DA 1ZOMA 4BAOB 1ELDE 3GDUA 1LO6A 4Y11E 3SJ9A 4ASHA 1GBBA 1H8IH 1HGTH 2NWNA 3BTGE 2OTVA 1XKAC 1KXBA 4UEHH 4IN2A 4K1TA 4BXWA 1P12E 1BDAA 5B6OA 2V3OH 1LHGH 3MU1A 1A4WH 1UVUH 1AE8H 1SHHB 5DP7A 4MVNA 1H9LB 4H6TA 1CGHA 1TGCA 4FUJA 1ELFA 4K60A 2A5KA 1BBRE 3MH6A 1PPFE 2VIPA 1Z71A 2VVUA 3F68H 1WV7H 2AYWA 1T4UH 4MPVA 1K28D 3GCTF 3PV4A 2ZTXA 3M7QA 2O9QA 1O2OA 1QBNA 1LVBA 1GI9B 1XUKA 4PROA 2PUQH 1ZPZA 3Q3XA 1P10A 3LGWA 3T29A 2BD8A 3FP8E 2P8OB 1TA6A 1HXFH 1FY8E 1GHZA 1UVSH 5JBBS 1GBAA 1P2OA 4ISLA 1TOMH 3VXFH 1BMNH 1MTSA 2H2ZA 3RU4T 3TIUA 3S7HB 1CA0B 1DFPA 3NPSA 1Y3YA 2PV9B 3EE0B 4TY7A 4U32A 3B23B 5ESTE 2GCHF 2PTNA 3BTDE 2WINI 2XCNA 3GCNA 1GPZA 1C1UH 1SGQE 1XXDA 1AB9C 2WPKS 2A7CA 4ZUHA 4B2AA 1AN1E 1BIOA 3QGNB 1JOUB 5DG6A 3SGQE 1GL1A 3MNXA 5GPIB 5A09A 1SOTA 3B9FH 4AFZA 5L30H 3RMLH 5HMAA 4CH8B 1ABIH 4Y0ZE 2M5TA 1V2MT 5FBIA 1A61H 3RMNH 5EQRA 2O8LA 1ESBA 3BTME 1UTLM 3P92A 1F5RA 4NIVA 3U8RH 1V2OT 4AOQA 1O3CA 2BY7X 1P3EA 5T6GA 1T7CA 7ESTE 1UK4A 1AFQB 1AKSA 5G4BA 1XUHA 2P59A 2G51A 2XTTB 3HK3B 4H4FA 4UFFH 1YF4A 1GHBG 1O36A 3GYMA 1A3EH 4I32A 2J4IA 4FUGA 2BVXH 1C5RA 2XC0A 2FTMA 2AEIH 2BQ6B 2HNTF 1TPOA 4ISHH 4YT6H 1MUEB 4X8UH 3FANA 1FDPA 5A8ZA 5GIBA 2P3TB 2DE8A 1O0DH 2F9UA 2ZFFH 3RXFA 2R9PA 3D65E 1LMWB 3ZVBA 3T25A 2OC0A 4YOIA 4MPUA 1C1TA 2PHBA 1GBJA 4ZAEA 2GT8A 2FPZA 1QA7A 3Q3YA 4X1QU 1TABE 4E05H 3TJVA 4AB9A 1EZUC 1MD8A 1AVXA 2ZGCA 1WOFA 8GCHG 5EPNA 1AQ7A 2Y5HA 4K5ZA 1GJ9B 2XYAA 8LPRA 1HUTH 4NZQA 1ELGA 1OP0A 1T8NA 3MU8A 2FIRH 1P8VC 1TNHA 2CV3A 3GY8A 4MG3A 5JYIA 4X8TH 2VINA 2OINA 3W95A 2GP9B 3RU4E 1GMCG 4KTUA 1GBIA 2IN2A 3A8BA 2ZTZA 2W7UA 1HV7A 1NT1A 1DWEH 2ZZUH 2Q6FA 2BD4A 5HM9A 1F0TA 1C2JA 1C5ZB 2A32A 3QK1A 4TYDA 3TGKE 4ZKRU 1ZRKA 1WYKA 1Z1IA 1Y5AT 4K3JA 3A7ZA 2VGCC 5L2YH 4AB8A 3RXKA 1YPKH 1WUNH 3SV6A 1W14U 1J8AA 1CO7E 4THNH 1Z7KA 1MU8B 3MH7A 1ANBA 2RDLA 3BIVH 4F49A 1PPZA 2W26A 3E0PB 1F0RA 2P3FH 2SGAA 3RXLA 4JZEH 1A1RA 3RXMA 2FDAA 1THRH 2FOMB 4UE7H 4JYVH 2BM2A 4Q7YA 2AGIX 1P2JA 2SGEE 1FIZA 4MNYA 2SGQE 1SGFA 1O2TA 1GCTB 1G3CA 1E34B 4ABHA 1SLWB 1HAXB 3SHCH 2ZPQA 6LPRA 3PLBA 1TQ7B 1A0JA 1S6FA 3SNCA 2ZU2A 1FY3A 4U01A 2SGFE 1UCYK 2Z9GA 1ZSLA 4XOJA 2WPLS 1L4DA 3F1SB 1C5TA 3LGIA 4MDSA 3WY8A 3HATH 1Z8IB 1EOLA 1BHXB 2WV5A 2AMPA 4X2YA 1FAXA 1GI1A 2ZU5A 4KGAA 4K8BA 5L2ZH 5EW1H 4J2YB 1PQ7A 1T8OA 4YLQH 3RXPA 3QX5H 3ZYEA 1BCUH 2DE9A 4ZKSU 8GCHF 1NZQH 2VWMA 4YM9A 2PTCE 2A0QB 1C5LH 2BVRH 3GCOA 1UTJA 2FOFA 2O8MA 2WV4A 3Q76A 3E3TA 2CN0H 1NO9H 4AX9H 3TK9A 5HYOA 1J9CH 1ZZZA 1MZDA 3TK5A 1QJ7B 1YYY1 5DGJA 1SI5H 2ZPRA 1ZSJA 1A3BH 1ARCA 1UTNA 1VGCB 1XXFA 1E36B 3ESTA 1ELAA 1UK2A 1O35A 1BUIA 4ZXXH 2AIPA 1AGJA 1OP8A 3BEIB 3RXDA 1YBWA 2RA3A 1UHBB 5DP3A 1EOJA 4UFEH 1KXEA 4FUBA 1F7ZA 3ODDA 4INKA 1GI6A 4AG1A 3M5NA 4NA9H 3P8FA 2BTCE 1TBZH 1KY9A 5TCAA 2ALPA 2FOBA 2GX4A 4DG4A 4D76A 1GBKA 1IHSH 2SFAA 3M7UA 1DOJA 5EPYA 1HFDA 4KTSA 1T8LA 2GVFA 3BEUA 4ZHMU 1KXFA 2FEQH 1P0SH 2EC9H 2QYIA 1O2ZA 4E7NA 4I8KA 1O3BA 3M3VA 2F83A 3PMJA 1ZSKA 1D3TB 3H7OA 1NESE 1EAXA 4SGBE 5GCHF 3V3MA 2NU1E 2BOHB 1AUJA 4FUIA 1C5OH 1AB9B 4JK5A 2GDDA 5F8ZA 1V2ST 3VB6A 4DURA 1A5HA 3R0FA 3TPIZ 2ZDAH 2HPQH 3ZZ5A 1F92A 1SBWA 1QB1A 3V12A 1P3CA 4CRDA 1O2NA 2FI5E 3L33A 1C2FA 3RXEA 1ACBE 4RKJB 1Q3XA 4WWYA 3VPKA 1W2KH 2P94A 1O38A 1BMMH 1KXCA 1QL8A 3ZVDA 1O5CB 3F9HA 3G01A 1P9SA 2UUKB 5AF9H 1DS2E 3F9GA 2VWOA 2OC8A 1SOZA 2BY9X 2ZPSA 6GCHG 2ZG0H 3SUGA 1QURH 1BOQA 1RXPA 5C20A 4BTIB 5DO4H 3A7VA 3MYWA 5FPTA 2NU0E 1Y5BT 1D3QB 4DJZB 1SQAA 1OX1A 1G3EA 1BTYA 3SU3A 2ZFRH 3AVZA 1Q2WA 2JETB 1ZMNA 1L1NA 2B0FA 1PPCE 2GCHG 1EQ9A 1AI8H 1C2DA 4Y8XA 5E0GA 2XWBI 5DP6A 4K1SA 1NRNH 1ZGVA 3RXCA 1MH0A 2D2DA 3BTQE 2ODQA 1GJ6A 1XUGA 1K1JA 1SGCA 3U1IB 1F5KU 1Y3VA 1SL3A 4Y79A 2FI4E 2FLRH 2ZP0H 2GZ9A 4WXIA 1CA8B 2G55A 1SQOA 1UTMA 2CHAB 3M3TA 3M7TA 3ZZ4A 1O3HA 3D62A 2FYRA 1E0FD 2QXJA 1S0RA 3HPTB 2H9HA 4AN7A 1GHAG 1FN8A 1DXWA 2OLGA 5EU8A 5GJ4B 2EI7A 1TNLA 3HGPA 1W7XH 1HAYB 1EPTC 3BF6H 3A85A 4O9VA 1ZLRA 1FI8A 3LIWA 4MNWA 1QR3E 1O3IA 3HKJB 1O2XA 3A87A 3RDZA 2G8TA 1V2UT 3VGCB 2D8WA 2DUCA 3MH4A 4GCHG 1C1RA 1XUJA 4Y8YA 2J2UA 1KLIH 3VXEH 4ZXYH 1BTHH 4D7FA 2WPHS 5T6DA 5LGOA 4CR5A 3OY5U 1O3AA 1W3CA 1Y3XA 1AD8H 1OWEA 3QZQA 4U30A 1NTPA 1G36A 1P06A 3EDXB 1OYTH 2AFQB 4O97A 1V2VT 2BY8X 2FOEA 4NIYA 2FWWA 1UVTH 2XRCA 1DY9A 1FY1A 4I8LA 9LPRA 2O8UA 5HM2A 1OWDA 1EPTB 2JH6D 1AY6H 4OGYA 2ZA5A 4DVAU 2Z9JA 1E37B 1LVOA 3LKWA 3A82A 1UTOA 3VEQB 3UNSA 3ZZ3A 4B2CA 5A8XA 1H9HE 1IQEA 1O2WA 1ORFA 1P01A 1SB1H 3SUFA 1B7XB 3SU2A 1C5UA 1DM4B 1ZPCA 2BXTH 1ELEE 3DHKH 2Y5GA 3Q3KA 2BB4A 6ESTA 1QIXB 2WYJA 5C5OA 4CRFA 3OU0A 3FZZA 3UQOA 2WPIS 2QXIA 1GBCA 4MNVA 1AIXH 1HPGA 4TPYA 1C5SA 1SPJA 1C1WH 1UMAH 1WSSH 1B5GH 1HJ9A 1GI5A 1ANEA 4TY6A 1YPEH 2UWOA 2TIOA 1ZTLA 2VWLA 3OTJE 1C5XB 1O5EH 2PW8H 1AO5A 1A46H 3LGYA 2B8OH 1G3DA 1S84A 1SLVB 3P6ZB 4FU7A 2P16A 4R8TB 2IOTA 1QL7A 2G00A 2ZDVH 2R0KA 1QA0A 6CHAC 1D3DB 2W7SA 1C5NH 5JB9S 3BN9A 1DLEA 1P2KA 2FS8A 3MH5A 4SGAE 4ABIA 1EB1H 1QHRB 1GHVH 4GCHF 2PGQB 1C1NA 3SGBE 1DITH 1O3EA 1DUEA 1AE5A 2Z3CA 1IQNA 1V2RT 2WPMS 1SR5C 3SJOA 1AZZA 1GHBF 1IAUA 1GCDA 1GJBB 4A5TS 1DWDH 3D49H 2BZ6H 4NFFA 4Y0YE 1F2SE 3JZ1B 3T5FH 1ELCA 3QTOH 1DUAA 1Z1JA 2CF9H 1NRSH 1EJMA 4MPXA 1EAUA 1QRZA 1BQYA 1G9IE 3PMBB 4JYUH 2ANWA 4DY7B 2CHAC 1C4U2 2VH6A 2QGRA 4ABGA 2QXHA 3U98H 3TH3H 2C4FH 1LKBA 1TNJA 4B1TA 2BYAX 1TQ0B 1AKSB 2WYGA 4DGJA 1AFQC 4E7RG 1HAHH 1GI0A 3A86A 1WAYB 3RXBA 2FO9A 3KQBA 3QTVH 1N6YA 1UJ1A 1C2KA 3V13A 3VB7A 1BTXA 1C9TA 3CP7A 2Z94A 2ZHFH 2GGVB 1LKAA 5BPEA 3VB3A 4UD9H 5L6NH 1BTWA 4I8HA 2BLVA 1VCPA 3QGJA 5CHAB 4WMEA 4HFPB 1C9PA 1XUFA 2Z3DA 3PWBA 1RTFB 2ZTYA 3PLPA 4WY3A 2OUAA 2BZAA 1O5DH 2ZU3A 3QO6A 5FCKA 2GZ8A 1VGCC 4OS4A 1YLCA 3RXGA 3ZZ6A 1GWAA 3BG4B 3ZVEA 1ESAA 1YP9A 3FP7E 2ZHDA 3AW0A 1G2MA 3RXHA 1YGCH 2WUCA 2V3HH 3UUZA 1GHXH 4BAMB 2A4OA 1IQHA 3SU5A 4ZHLU 4BOHA 2A4QA 2R2WU 2H5CA 3RXVA 4H6SB 2ZFPH 3ATLA 4CBNA 1V2QT 2CGAA 2GMTB 3BTFE 4YO9A 1D9IA 2XXLA 2BLQA 4ZROA 1GDQA 3L3TA 1FPHH 1FUJA 1UVPA 3UNQA 1GHAF 2ZGXH 3TJNA 3ZVGA 2TPIZ 1CGIE 2AMDA 1O3JA 8ESTE 3EA7A 5C5NA 1JRTA 4LXBH 1AMHA 1QB9A 4AG2A 1Y8TA 3MU0A 4NCYA 3SU6A 2F9VA 2FX4A 5JPMH 1KYNA 4NSYA 1TYNA 1MCVA 2Z7FE 3SNBA 3TNTA 1QB6A 1DANH 1O2GH 3MU5A 1ZHRA 2CF8H 2D26C 1UCYH 3F6UH 4OS1A 3KF2A 1P2IA 3SBKA 3RM0H 1N8OC 2ZI2H 1NFWA 1TGSZ 1S82A 5DP4A 5TJXA 3SOSA 1LTOA 3KHVA 4JZ1A 1LHCH 2ZDMA 3AAVA 1S5SA 1QBVH 4IGDA 4INLA 1JWTA 3UWJH 2F9PA 3A81A 1FY4A 1G3BA 5E2OA 3AASA 1V2NT 1TBRH 1CA0C 2CXVA 3A88A 1SSXA 2XNIA 3RC5A 2V0BA 1JIMA 1GVLA 1SGNE 3SU4A 1S85A 2XBXA 3SI4H 1KLTA 1ZTJA 3UWIA 1O3LA 2BD5A 2Z9IA 3ZV8A 1DSUA 1P04A 3ZVFA 1TMUH 4BTUB 4FUDA 5FX5A 1FZZA 4I8GA 3SI3H 1GJDB 1TX8A 1O2HA 4BAHB 1B0FA 1BBRH 1V2TT 5K7RA 5BRRE 4WVPE 1GCTC 1CSOE 1P9UA 2PLXA 2A45B 1HDTH 1C1QA 1ZTKA 4RSPA 1Z8GA 3MHWU 3EAJA 1CBWC 4UONA 2WUBA 4LOYH 2J9NA 2P95A 2V6NA 1BRBE 3U1JB 2ZWLH 1TPSA 4IN1A 3RXTA 1CT4E 2EEKA 1GMHF 3STJA 3LC5A 1EP6A 2O8WA 3MNCA 1CHOG 1K2I1 3P8NA 3AAUA 5GCHG 2BX4A 1ZGIA 1RIWB 1PQ5A 1XKBC 3LU9B 5C67A 4WF8A 3RXRA 1SG8B 3MNSA 1CHOF 3VGCC 3A8DA 2QA9E 4Q7XA