2QXJA

Crystal structure of human kallikrein 7 in complex with suc-ala-ala-pro-phe-chloromethylketone and copper
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
224
structure length
224
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Kallikrein-7
publication title Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qxjA02
4NWLA 3NKKA 6GCHG 2BDYA 2TGTA 4RKOB 5DK1A 1FY3A 1O3AA 1BRBE 3M7QA 2BMGB 1C5VA 1BJUA 3A81A 5JBCS 1XVOA 4FUEA 1ARBA 1PJPA 1SLUB 4K1EA 1GJAB 3OY5U 4FUDA 4B2BA 1OXGA 3F9GA 3TH3H 1UTKA 1G32B 2Y5FA 3RU4D 3EQ0H 5DP5A 1EJAA 4OS5A 2FMJA 1MTUA 2GCHG 1O2MA 1ANBA 2ZU2A 3HKJB 2XW9A 3Q3YA 1OP0A 3RC4A 1A2CH 3ZVEA 1GI6A 3V12A 4BOHA 1V2WT 2BXTH 5E0GA 1YBWA 3ZVAA 1FN8A 1TBQH 1DWEH 1HAPH 1SGCA 1OSSA 4INHA 1BBRK 1J14A 3BIUH 1V2RT 1UK4A 2A7JA 1P8VC 1XUFA 5GDSH 1IQNA 3LT3A 1FY4A 2YNBA 2BDIA 2D2DA 3BTDE 3ATLA 1V2KT 1ZGVA 2PKAA 1TWXB 2ZU5A 2ZPSA 4DJZB 3HGPA 1ZHPA 5T6DA 5E2OA 3T28A 1H8DH 5EQSA 3P92A 2EEKA 1P09A 1MU8B 5E8EH 1BDAA 4GLYA 4K8BA 3K2UA 1P2IA 1RS0A 1AMHA 3SQEE 2ZDAH 1F0RA 1N8OC 1K1NA 1TGNA 3AW0A 3VPKA 3RXEA 4CRBA 2ZFRH 2VIVA 2ZKSA 3KHVA 4DG4A 4NWKA 3D62A 1ANCA 4D7GA 2STAE 1BTYA 1NRSH 2BDHA 3AW1A 1D3QB 3KQDA 3MMGA 4GHTA 2XBXA 2AS9A 1GBFA 1U6QA 3LOXA 1E35B 1HV7A 2YOLA 3A80A 5ABWA 5ESTE 1Q2WA 6ESTA 1DM4B 2ZP0H 1C5LH 4I32A 4QT8C 1JMOH 3E91A 2FOHA 2GVFA 1Z6EA 3MO9A 5C3NA 4DIHH 2F83A 3ELAH 3MH7A 3HGNA 3A8CA 4F49A 4D9RA 2ZF0H 3VGCC 3O8BA 1TX7A 2PR3A 1MD8A 1MKXK 2AYWA 3KNXA 1XVMA 5JB8S 1YPJH 1SMFE 1NESE 3BG8A 4MPUA 4AN7A 1O2WA 1NFWA 4A1XA 4K60A 1QL7A 1Z7KA 3BTEE 2H1UA 2FESH 1TOMH 2I6SA 1J16A 3HKIB 1FIWA 3M36A 2RA0A 4RN6A 2OD3B 1KXAA 2O8MA 2WPKS 2Z3DA 5FX5A 4LZ1H 2FTLE 1Y3WA 1GHZA 1K1IA 1EZQA 1BMAA 1TE0A 3P95A 3RC5A 3SO3A 4I8LA 1OP8A 1TPAE 1KTTB 5L30H 1O3FA 3ZVBA 4TWYA 1QIXB 3RXKA 1HAZB 3KL6A 1Y5BT 1G3EA 1GJ5H 1SGNE 2VVCA 4XDEA 1K1LA 1PYTC 4AFSA 5HXFA 1K9OE 2PSYA 1TFXA 1ZTLA 1EB1H 1MCTA 3P8FA 1UVTH 3LDXH 2ESTE 2ZGXH 3O8CA 1MKWK 4FUJA 3SUFA 3LJOA 2GV7A 2ILNA 4X8TH 2H2ZA 3U8RH 1GBCA 2RG3A 3TK5A 1N6XA 1UVUH 2FEQH 1SLVB 2W26A 1E0FD 4MPXA 1CT4E 3GCHC 2Z94A 1CGHA 3M7UA 1P2MA 4J2YB 2AIPA 1C2MA 1EZUC 1Q3XA 2WINI 1W11U 2C8XB 6CHAC 4IN2A 3QZRA 2BZAA 2GP9B 3PLBA 3V0XA 1RTLA 5BRRE 2FX4A 3RXIA 1WTGH 2P59A 3DA9B 5F6MA 1O31A 3T62A 3H7OA 3SU5A 2CGAA 1C1TA 2VNTA 3S9AA 2G5VA 4WH8A 2FOMB 3RXPA 1O34A 1C1NA 1NN6A 3TITA 4AOQA 1S0QA 3ZYDA 1AHTH 5HM9A 3FAOA 4WXIA 5GWZA 1CT2E 1DWBH 2OC0A 1RIWB 2OLGA 3OX7U 4ISNA 3PO1B 1TMTH 2CMYA 1PPGE 1ELTA 1UHBA 1ELEE 1CT0E 5L2ZH 1GJCB 1F0SA 3RXUA 1SGFA 2Z6BD 5DJ7A 2NU3E 4XBDA 1SGRE 3K6ZA 5ETXA 1O3PB 1EXFA 3UTUH 1UTQA 1KY9A 3BN9A 2JH6D 2EA3A 2H9EH 5DGJA 2ANKH 1DY8A 5FX6A 2K1QA 1V2ST 3KQEA 3Q77A 5DP6A 1LHFH 4AG1A 1HNEE 2G8TA 2VB0A 2GMTC 2FOEA 5DG6A 1GJ4H 1SPJA 3U8TH 5C1UA 3SU6A 1Q31A 4D9QA 4Y7BA 4R0IA 1DVAH 1UK3A 1GMHG 1KDQA 3MU4A 2OTVA 1T8LA 1EAWA 1BHXF 4JYUH 2HWLB 1EPTB 1ZHMA 3ZZDA 2TGPZ 4X6PA 2V6NA 1IAUA 1HAXB 1VGCC 2Z7FE 1AIXH 4BNRA 1ABJH 1GJBB 3VFEA 1FZZA 3SV7A 2F91A 4CRAA 4NFEA 1RFNA 1F5KU 1GBMA 4KP0A 2Z3CA 3UR6A 4WWYA 4JZEH 5TCAA 2VVVA 1O2QA 1HRTH 1SLXB 2ZFPH 1YGCH 3CENA 1C1WH 1TB6H 4FVDA 4Y11E 2R0LA 1QQUA 1C1MA 3GICB 2QC2A 1SGYE 3LGYA 2HGTH 2FM2A 3LGWA 4NFFA 4NZQA 4A7IB 1HIAB 1YLDA 2AGGX 1ZPZA 5C5NA 2D26C 2BXUH 3OYPA 4X2WA 1NY22 4I31A 2V3HH 3STIA 4UONA 4DY7B 2CHAB 3UNRA 3LKWA 2WPLS 3I78A 2O8UA 4Y0YE 4ZROA 3RMLH 1O2LA 2JETC 1SGFG 1P02A 1GBBA 1J15A 3QGJA 1BTHH 3NZIA 1GDUA 2ANMH 3KQBA 2HNTC 1O2RA 2R2WU 1ARCA 1YYY1 4WXVA 2QF0A 1SOTA 3C27B 3EAJA 4UFEH 4AZ2B 1GBTA 2FYRA 4MPWA 2IPHA 1AFEH 3VXEH 1QCPA 1SHHB 1IQKA 1C5PA 1T8MA 2FI3E 1DXPA 3E0PB 4TY7A 1GBAA 1O38A 2ZHQH 4NIXA 3Q76A 1P01A 2ZDMA 1C4U2 1DXWA 4MG3A 3SUDA 1ZLRA 1AKSA 2VIQA 4Z0KA 4O3UA 4X6MA 1BTWA 2PSXA 2BLQA 2W7SA 4IC5A 1FY5A 7LPRA 1KYNA 2ZPQA 2PTCE 1DITH 5DKMA 3SGQE 7ESTE 2WPIS 1AWHB 3BTWE 2KAIB 4LXBH 1EAXA 1C1UH 4WJG2 1ZTKA 1TPOA 3GYMA 4A1TA 3GISB 4AFZA 4NSYA 2ZWLH 1XKAC 1WV7H 1ELDE 2BD8A 4ASHA 2Q6GA 2BD9A 4ISOA 3TU7H 2FODA 3ZZ9A 2ALVA 1P9UA 4F4OC 3SV9A 4AGJA 1XM1A 4OS6A 1DWDH 2PKSC 2OC7A 4I7YH 4NIVA 1ZHRA 3SW2B 1KTSB 4YESB 1MTVA 3EA7A 2Y5GA 1YCPH 3B8JA 1O2VA 1XKBC 3UQVA 4MPVA 1HJAB 1V2NT 4YZUA 1MAYA 9ESTA 4BAOB 4UFGH 3A89A 3UOPA 1C5NH 2ZFTA 1GBHA 3ITIA 5AHGH 4TPYA 1TNKA 2PFEA 1FIZA 4XSKU 3BEUA 1WYKA 2RDLA 3HPTB 3ZZAA 5JBTA 2AEIH 3Q3KA 1O39A 3K6YA 2HPQH 2BD4A 3TLOA 1NFUA 2WV4A 4VGCB 2OP9A 3GCOA 5EXLA 1LVYA 1O2GH 4H6SB 3A7XA 3FVFB 4BTUB 3KF2A 3SI3H 3SJKA 4HFPB 3GY6A 1WCZA 1MH0A 2PLXA 1GMCG 2WPMS 4Y79A 1TGSZ 3D23A 3QUMP 4XFQA 1GVZA 1BZXE 2RCEA 4WVPE 1HPGA 1UCYH 1TIOA 1UVPA 3E6PH 1K21H 5EGMA 1LPZB 5EU8A 2ZG0H 3ZVFA 1A1RA 1SGPE 1K1MA 2F9UA 1GDQA 1NROH 2CF9H 2C3SA 3PB1E 2BX4A 2VH6A 1TNLA 1QL9A 1ELCA 2ZFFH 4NA9H 1TNIA 3LGIA 1FI8A 1LO6A 4R8TB 4BAKB 4AYYB 3EDXB 2DUCA 1GI8B 1B7XB 1O5BB 1QRWA 2P8OC 3A85A 1BTPA 3TIUA 3S9BA 4CRFA 3P17H 3T5FH 2BTCE 1PPCE 1V6DA 4B1TA 5AVDA 1L1GA 1H4WA 4Y10E 1K1OA 3U8OH 1QFKH 5A2MH 2SGPE 5DP4A 3RLWH 3RXCA 2P94A 1TLDA 1O3HA 5F8TA 2VWNA 3SHAH 3AASA 1C2LA 1S82A 4THNH 3ATMA 2C8YB 5FPYA 3M5OA 2UWOA 3CS7A 1O0DH 2FOCA 1O3JA 1L2EA 1T7CA 1V2PT 8LPRA 4KELA 1C5YB 2FOAA 1O3LA 3UOUA 1NU9A 3E16B 8KME2 5K0HA 4MNXA 4JZ1A 1JRSA 3OTJE 4HTCH 1MD7A 5C1YA 1ZYOA 4Y0ZE 1FPCH 3TH2H 4JMYA 4ZUHA 3SV2H 1S83A 2PKAB 1GPZA 1D3DB 1ELBA 2OINA 2ALPA 4GCHF 3V3MA 3NK8A 3AAUA 1CGIE 2ANWA 3A86A 4NZLA 4OGXA 1ESAA 5A8ZA 1TYNA 1DPOA 2XCFA 6LPRA 1V2UT 2A5IA 2GZ9A 4UDWH 1P2QA 3BTKE 2PGBB 4JK6A 4XE4A 3LPRA 1Y8TA 3F9EA 1YLCA 3M37A 1D3PB 4X2VA 4JK5A 1TGTA 3W95A 2QXIA 1WAYB 1PQ8A 2B7DH 1UMAH 1ZMJA 3GY5A 4FUFA 3ATIA 4X8UH 1BJVA 2J92A 5JB9S 4WMDA 3EYDA 1O5AB 1AWFH 2GTBA 1K28D 1NT1A 1O2PA 1GDNA 1OOKB 1NTPA 3BV9B 3VB7A 1TAWA 1MMJN 4BXSA 6GCHF 1PPFE 1T8OA 1TMBH 4M7GA 4B71A 3IITA 4I8HA 1CBWB 1AFQC 3Q3XA 2XC5A 2AMDA 2QY0B 2BY9X 2GGVB 4IBLH 1ZTJA 1T32A 2GCTC 1E36B 1PYTD 2FS8A 2ZGHA 2BY8X 1ID5H 1CGJE 2UUJB 3LH3A 1TX6A 1VCQA 2VIPA 2VINA 4ZAEA 1TMUH 4YO9A 2GCHF 1DT2A 1UTMA 1ACBE 2A4RA 5CHAC 1KXCA 3RXHA 1W2KH 2SNWA 3MFJA 1C5WB 1O3EA 1SBWA 4K2YA 1HJ9A 3KCGH 1CSOE 4ZKSU 5TJXA 2F9OA 5HM2A 2ZHDA 1FAXA 3W94A 1GBDA 1JBUH 2BLOA 4DW2U 1HLTH 1HBTH 1RD3B 1ETSH 3RXQA 4IMQA 1ZR0A 1DANH 3BEFB 1XXFA 1NRNH 5C1XA 2G5NA 2HLCA 1OWHA 3P8OA 4DOQA 1JIMA 4BXWA 2SGQE 5A0AE 1BB0B 1L0ZA 1MTWA 2PGQB 3RMOH 1WOFA 2AIQA 1AVGH 1P3CA 3S0NA 3KIDU 1BHXB 1AE5A 1GBEA 2ZTYA 4OS1A 1RGQA 2A4QA 1KIGH 2ODYB 3PTNA 2HOBA 1C1VH 1MCVA 1SC8U 4OS2A 4X6NA 3UNSA 5GCHG 2Y7ZA 1AQ7A 7GCHG 3SNAA 4Y8ZA 4YTAA 5F8XA 1S6FA 1GCTC 5JBBS 1LTOA 1OP2A 1KXBA 1FUJA 1DX5M 3PMBB 3PV4A 7GCHF 2FP7B 2C4FH 2ZDNA 1G2MA 4I33A 1HXEH 1TNHA 4A1VA 1ELFA 2ODPA 3P8GA 2AMQA 3AAVA 1INCA 2ZU3A 1CQQA 4KGAA 3ODFA 5A0BA 1L1JA 1V2JT 3ENSB 2ZHEH 2PUQH 1HAGE 3GY2A 2F9BH 1ELVA 4AYVB 2H9HA 2ZDKA 1OWDA 1TOCB 1MBMA 3PMJA 5T6GA 4BAQB 1O2SA 1TPSA 3M5LA 2J34A 1J8AA 3RXOA 3M3SA 1ZMNA 5FPTA 5BPEA 3K65B 1C1OA 1UHBB 2SGFE 4CRGA 2G4UA 1HAVB 1S81A 5A8XA 3MNBA 1O36A 2QN5T 1SGTA 1AUJA 5J4QA 1EZSC 1GI9B 2J9NA 1LKAA 2V3OH 3S69A 3FP6E 1O2OA 2ZHFH 3U1IB 3ZZ8A 1LPKB 1CVWH 1O2NA 1UCYE 4Y8YA 4A6LA 1GHXH 3OY6U 2LPRA 1V2VT 3KQCA 1GI3A 1WQSA 5GXPA 5K7RA 4FU7A 5DP9A 2M5TA 1T4UH 4WMFA 4AB8A 3GOVB 2A45B 1C9PA 1BRAA 3IWMA 1THSH 1ZJDA 5LPFA 2FOBA 1RIWC 3GDUA 2R2MB 4IW4E 3PO1C 5J4SA 2TPIZ 2G81E 2A31A 1OWEA 1KDQB 3TK6A 1KSNA 1NFYA 2ZZUH 2CN0H 3U1JB 1B5GH 2BQ7B 4JYTA 5EXNA 3VB4A 2ASUB 4B2AA 2FIRH 1E34B 1DS2E 1HJ8A 3URCA 2GV6A 2AH4X 4HGCA 4WMEA 2XRCA 4U32A 2F9PA 1DOJA 2ZDVH 3S7HB 1OYTH 4X8SH 1GI7B 3TJOA 4ZHLU 5FCRA 1C2DA 1O2HA 4ABIA 4AFQA 2VGCB 3QDZB 2B9LA 2VVUA 1GI2A 2O9QA 3JZ1B 4DIIH 2JH5D 1VITH 3QWCH 2H5DA 1H9HE 3MO3A 4GVUA 2Z3EA 4K1SA 1WUNH 1O32A 4MNVA 1P57B 4Q7YA 2C93B 3H5CB 1GBLA 2QIQA 1G3CA 1PPZA 3K9XB 1FNIA 4NA8A 3TGJE 2OC8A 2NU2E 1VZQH 3NPSA 2ZHWH 3SJIA 1O3CA 2A5KA 5HMAA 3GYLB 1QRXA 2ZCHP 3LGVA 2EI8A 1W0ZU 3GCHB 1P12E 4NCYA 2VH0A 3U69H 1P3EA 3B9FH 1E37B 3WY8A 3SQHE 1FJSA 1ZRBA 1TNJA 4ISLA 3PLPA 1QQ4A 6CHAB 3ATWA 3FANA 2C90B 1W7GH 1ZZZA 3BTQE 3QTVH 2HRVA 1C2FA 1BTUA 2A7CA 1GJ6A 4GSOA 1ZPBA 1KXDA 1UTPA 3M35A 2ZIQH 1IQJA 4U30A 1AKSB 1ZGIA 1GMHF 3MH4A 4SGBE 1SL3A 1C2HA 2XCNA 3ZVDA 4I8GA 4CR9A 3R3GB 1B0EA 2Y82A 3T29A 1TQ0B 2H9TH 2FYQA 1SOZA 3BTME 4CHAB 3MHWU 4O9VA 4X2YA 5H4IB 3TJUA 2FOFA 2BY6X 2ZEBA 3VB3A 3VXFH 2OUAA 2NU0E 1ZSLA 2ZNKH 5JBAS 1ORFA 5LPRA 2QXJA 1YC0A 3QLPH 2Y7XA 1AVWA 2J4IA 2O8WA 1MQ6A 4I8JA 2QCYA 3SJ9A 2FZZA 2FO9A 1FV9A 3OU0A 3ZZ6A 4YLQH 1PPBH 1YPEH 1BOQA 1V2QT 1D9IA 3AVZA 2H5CA 1IQEA 1DWCH 1JOUB 1C5ZB 2BVXH 3SI4H 3PWBA 1ANEA 1CHOG 1GI0A 1C1SA 1GHAG 2FTMA 2P93A 3TNTA 3A8AA 1CHOF 1C5TA 4ABHA 1GHAF 4AGKA 2FLBH 4CRCA 4YOJA 2Q6FA 5C2ZA 3BIVH 4AORA 3P70B 3UUZA 4JCNA 1Y5AT 1VGCB 3I29A 1O2TA 4U01A 3RDZA 5ESBA 1QTFA 3F9HA 3STJA 5C20A 1VITG 4ABAA 1DUEA 1GMDG 2UWPA 1YPHC 1W10U 3G01A 5GPIB 4ABFA 3SJ8A 3ZZBA 3RC6A 1VITF 4TY6A 5E2PA 1EAUA 2NWNA 1ANDA 3NWUA 3SORA 1LHGH 3TGKE 2F9NA 1EB2A 1IQLA 1BMLA 3ZV8A 4WY3A 1ETRH 2W7UA 4RSPA 2TBSA 1O5EH 3MNXA 1W14U 2A32A 3MWIU 1C2EA 2FWWA 3M7TA 1V3XA 1YCPK 4ZHMU 1ZSKA 2ZGCA 1AUTC 2FXRA 1O3IA 4Q2KA 3MU8A 1C2JA 4AX9H 3VEQB 4VGCC 1VCWA 1UTOA 2R3UA 1HUTH 1MZDA 5I46H 1P11E 1G37A 1KXFA 2JETB 1GJ7B 4IMZA 4MQAA 1HYLA 3RMNH 3PWCA 3SHCH 5EODA 3T25A 3UR9A 1J9CH 4BAMB 4JYVH 1HCGA 1EX3A 1QA7A 4NGAH 4GPGA 2OQUA 2IN2A 2NU1E 3MU1A 3BG4B 4X0WU 1MTSA 2VWMA 2GD4B 1TQ7B 1BIOA 1OKXA 3A7YA 2F3CE 3A88A 1O3GA 5PTPA 1O3MA 2FDAA 3A7VA 3TH4H 1HAOH 4RKJB 4Z6AH 1MAXA 1G3BA 1NS3A 3RXGA 1SGDE 1GI5A 1UCYK 1OWIA 2BLWA 3U9AH 3A83A 1QJ7B 2CXVA 1DY9A 1Z1IA 2VWOA 2FX6A 4K1TA 3M3TA 3TK9A 3PLKA 1GGDC 2DE8A 3HK3B 4FU9A 5FPSA 2SFAA 1T31A 1IQMA 3M5NA 5FAHA 3T26A 4JZIA 3D65E 3FP7E 2Y80A 3U98H 2A1DB 1GMCF 5EOKA 1P2OA 2P95A 2SNVA 1AB9B 3DT0H 2G55A 3MI4A 3VB6A 1WTHD 3GDVA 2BZ6H 4H42U 3CS0A 2CJIA 4ZKOU 5G4BA 2VWLA 2BDCA 2FI5E 3E1XB 1IQFA 5GIBA 1HB0B 3ESTA 1BMNH 2IOTA 2ZGBH 2IJOB 2GT8A 4Y8XA 2TGDA 4UE7H 2XYAA 2ZCKP 2OCVB 1BT7A 3ZZCA 3URDA 2THFB 1L4ZA 1Z8IB 4BANB 1TRNA 4NIYA 2V0BA 3UQOA 5EW2H 1ABIH 3GDSA 4ABJA 1D6WA 3LONA 4OS4A 1QNJA 3DUXH 5IYTA 4H4FA 1AU8A 3PMHB 3VB5A 3A8BA 1FMGA 5C67A 1IQGA 1C1RA 1LHDH 3RMMH 3EGKH 1ZRKA 4FUGA 5FBIA 2JKHA 2ZFQH 1NPMA 1AZZA 1J17T 4ABBA 2GDEH 1XXDA 4LZ4B 1G2LA 1PQ7A 3F1SB 1ZSJA 1GVKB 1O5DH 1DLKB 1DUAA 1SFQB 1SR5C 3P6ZB 2TIOA 3SU4A 1TNGA 3ZZ5A 5FCKA 4B73A 1EZXC 1YPMH 2HPPH 4DCDA 4ESTE 1S85A 1LQEA 1O3KA 2PWXA 2GKVE 3QTOH 1TGCA 2O8LA 2Z9GA 7KMEH 3P8NA 1A46H 1ZPCA 1KXEA 4KTSA 1O3DA 4O97A 3QK1A 1D3TB 1P04A 1W3CA 1VJ9U 1QL8A 2XXLA 3UWIA 2P8OB 5DP3A 1W7XH 3CP7A 1CA0B 3MNCA 1PQAA 1NRQH 4FUHA 3MO6A 4BTTB 2BY5X 1O5CB 4NSVA 3TJVA 3SOSA 3NUMA 4UFDH 1SI5H 1QY6A 4Y7AA 1Y5UT 4SGAE 1C5OH 1C5XB 2BY7X 4GHQA 1H1BA 2A4OA 3OSYA 1EJNA 1BITA 1TA6A 3EA9A 4O3TA 2OBQA 1K1JA 2PTNA 2G4TA 2FS9A 3N7OA 3SU3A 2VU8E 2OQ5A 5F8ZA 1UO6A 1P2NA 1C2GA 2HNTF 4UD9H 1NO9H 5LPEA 1TONA 3MNSA 3ATKA 2SGEE 1QBVH 3L3TA 1FXYA 2DE9A 3B23B 3UREA 3BF6H 1TRYA 1OWKA 1BQYA 3RXJA 8ESTE 4BAHB 3D49H 4TPIZ 1CU1A 1C4V2 5E0HA 1LPGB 1N1LA 2WUBA 3SNCA 5B6OA 5GJ4B 1O2KA 5CE1A 5IDKA 3RUOA 1RJXB 1GL1A 3DFLA 3MTYA 3SNBA 3O8DA 4PROA 2A2QH 3A7ZA 1TABE 2BYAX 1EOLA 1EKBB 1CE5A 1C5SA 3QN7A 3RXDA 5AFYH 4MDSA 1WBGB 3ZVGA 2UWLA 2W3KA 1MTNB 1GG6B 1V2MT 3A7TA 2ZTZA 2QF3A 4U2WA 5HGGA 1QB9A 4HI3A 3BTHE 3A87A 1ZJKA 3FZZA 1O2ZA 4X8VH 4CBOA 2P3TB 2Y5HA 4LK4A 2BD3A 1Z6JH 2ULLA 4B2CA 3E8LA 1AFQB 1FQ3A 3IG6B 1S84A 2WYJA 2OXSA 1GBIA 4FVBA 1E38B 1XUIA 1QJ6B 2GCTB 5F03A 2QXGA 1EATA 1F0TA 3M5MA 3SU1A 2WUCA 2AMPA 2Z9KA 3HK6B 4BTIB 1BBRH 4Y76A 1TX8A 3PM3A 3R0FA 3RM2H 4JZFH 5GCHF 1NM6A 1C5RA 1LQDB 3FFGA 2STBE 4INKA 4YT7H 2XBYA 3ZVCA 5CHAB 3SNEA 3SUGA 4CH8B 1AD8H 1A0JA 5DO4H 3MU5A 3SV8A 1OWJA 1MU6B 1XUJA 4CRDA 2XWAA 2QGRA 2J38A 4LOYH 3BTFE 1DDJA 2Q6DA 2GZ8A 1JRTA 1O33A 2ZCLP 1TBRH 1AO5A 2B5TB 1EQ9A 2ZDLA 3E90B 5E0JA 4YOIA 4ABEA 3S7KB 4IS5A 3SBKA 3SU2A 2BQ6B 4K69A 1N8OB 1HAHH 1K2I1 1EUFA 3LGTA 1THPB 1Z8RA 1GWAA 2BDAA 1SG8B 4X2XA 2ANYA 4O03A 1O35A 4YLUA 2FPZA 4YT6H 1C1PA 1QB1A 2UUYA 5CMXH 5T6FA 1QHRB 2HNTE 4E05H 5DP8A 3RXVA 1ZMLA 1BRCE 1PPEE 4FU8A 4X1RU 1G30B 1A61H 2BB4A 4NA7A 1MKXH 1OX1A 1O5FH 1YP9A 3FP8E 1DFPA 1G36A 3SGBE 2H6MA 3HATH 4KTCA 3RXRA 1GBJA 1GCTB 4D8NA 1NU7B 1JWTA 3VGCB 1H9LB 1UK2A 3GCTG 1S0RA 1YPHE 2VGCC 1OYQA 3RXSA 1GJDB 4YM9A 5AF9H 3GCTF 1UTJA 5EQRA 3TNSA 2HALA 2XBVA 1D4PB 1EJMA 1SSXA 4MNYA 1MBQA 1C1QA 5A09A 3LJJA 1F2SE 3QX5H 1TA2A 4D7FA 1SQTA 4ZXYH 2V35A 3DD2H 1UVSH 3LU9B 4ZKNU 4E7RG 1UTNA 1AN1E 8GCHG 2UUFB 5TCCA 1AZ8A 2VIDA 3MH6A 2OBOA 2HVXA 2BOKA 8GCHF 1QR3E 1O2YA 2BHGA 3F9FA 4E06H 4MNWA 2JH0D 1MKWH 1O3BA 3ZYEA 2ZC9H 1EASA 1A7SA 2WV5A 3ZZ7A 2ZI2H 3S9CA 2BVRH 1O37A 2WYGA 4H6TA 3RP2A 2LNCA 5DP7A 1O2UA 1PPHE 2ZU1A 4XBBA 3V13A 1IQHA 2BD7A 2ZECA 1IOEA 1A5IA 1AE8H 1RXPA 3T2NA 2SGAA 1EPTC 2W3IA 2BD2A 3KN2A 1HFDA 1HAIH 1FY1A 2Y6TA 5FXLA 5L2YH 3RXBA 1O30A 4K8YA 2VIWA 1P2KA 2EI6A 3GY8A 1RTKA 4CHAC 4ISHH 3SJOA 3PTBA 3MOCA 3RM0H 1HAVA 1GJ8B 1GBKA 4ZHAA 1DE7H 1HAYB 2P3UB 5EPYA 1O5GH 2FOGA 1QGFA 5A8YA 3BTTE 4UFFH 3M61U 2ZA5A 1SFIA 2UUKB 3O8RA 2BX3A 1GI4A 3UY9A 4OS7A 3I77A 1KLTA 2D8WA 3FZDA 4ZH8A 3SNDA 2A4GA 1GCDA 4Q7XA 1LVBA 1NRPH 1DSTA 1HXFH 2XC0A 4WF8A 1LVOA 2J94A 4Q7ZA 3EA8A 3SUEA 2CHAC 2QYIA 1YM0A 1MUEB 3RXAA 2NU4E 3ZZ4A 1Z8GA 3UPEA 1CO7E 1YCPM 3A82A 1IHSH 1K22H 1Z8JB 4J1YA 1V2LT 2AGEX 3RXFA 1FY8E 5SGAE 3MYWA 1S5SA 4Q80A 1W12U 2D1JA 2A7HA 4IC6A 2ZGJA 5LH8A 1IHTH 1OS8A 3LGUA 2ODQA 1NC6A 1P2JA 4AFUA 3SU0A 4FXGH 2ZQ1A 3LIWA 1VR1H 4FUCA 2R9PA 1TALA 4KKDA 4CBNA 4DGJA 2GX4A 2WPHS 2G00A 1A0LA 4MTBA 1B0FA 1Y59T 1TPPA 2WPJS 1MZAA 3BTGE 3ODDA 2CV3A 1SHYA 2GMTB 4CREA 1KLIH 1SGEE 1Z71A 1F5RA 2EI7A 1GVLA 1TGBA 1FLEE 1G3DA 1IQIA 1P10A 3L33A 1K1PA 4A5TS 3UIRA 4X1NU 4X1PU 3UWJH 2BM2A 2Z9IA 1C2IA 2PW8H 2W5EA 3A8DA 4NG9H 1EP6A 5C5OA 1FN6A 1PFXC 1W13U 1A4WH 2ZFSA 3QZQA 1BA8B 2VIOA 2C8WB 1GL0E 1XX9A 1T8NA 4E7NA 4OGYA 2PUXB 1F7ZA 4IGDA 1YPLH 1BBRE 3PMAB 1O3OA 1P9SA 4KTUA 1GMDF 1A3BH 1HJAC 2QXHA 1S6HA 4ZXXH 4ABGA 2BLVA 2I6QA 1P0SH 3BG4C 4INLA 2GDDA 2FLRH 4NIWA 3QO6A 2OC1A 3GCNA 3UFAA 3BEIB 4X1SU 3V7TA 2SGDE 1D6RA 5LGOA 1YPGH 2Z9LA 1L4DA 3RXMA 1F5LA 1FONA 1NRRH 1THRH 5I25A 1W0YH 3LC3A 1EPTA 1CHGA 1O2JA 2TGAA 1LKBA 3EE0B 1HGTH 4B75A 1NFXA 3Q00A 2J2UA 1ELAA 5DPAA 1ZOMA 4HZHA 2A0QB 3ZV9A 1GI1A 4WH6A 2CF8H 1H8IH 1LHCH 2G52A 3QGNB 2BDBA 1BUIA 4XBCA 5JDUB 1CA8B 3SGAE 4TWWA 1QA0A 1UTLM 2ZQ2A 4UEHH 1YKTA 1KLJH 3GY7A 1DLEA 1QRZA 2Q1JA 1L1NA 4DT7B 3BSQA 9LPRA 1O2IA 3L6PA 2Z9JA 1G9IE 1HIAA 2P3FH 1AB9C 2BD5A 3C1KA 1PQ5A 2VJ1A 2BOHB 1C5MD 1DSUA 1GHYH 2C8ZB 2XC4A 3SZNA 1YPKH 2G51A 1DICA 1FDPA 5EW1H 1A3EH 4Y71A 2EC9H 1O3NA 2BQWB 1V2OT 4K5ZA 1Y3VA 1C5UA 3NCLA 5AFZH 2J95A 2R3YA 3MH5A 4B74A 1AGJA 2ZTXA 2BDGA 5EPNA 1XUKA 1P05A 4ABDA 2O8TA 2PHBA 1FAKH 3GY4A 1XUGA 1UVOA 4B76A 1F0UA 2R0KA 1UJ1A 4JZDH 5EXMA 2ZPRA 2A5AA 3H7TA 1BMMH 2PKSB 3RXTA 1ESBA 1JXPA 1SB1H 4ZMAH 1MQ5A 3M3VA 1BTZA 2ZO3H 1ETTH 1AVXA 1GHBG 1X7AC 3RXLA 4TYDA 3LH1A 1WSSH 4XOJA 4AG2A 4A92A 5EG4A 2KAIA 4GUXA 1GHBF 1SQAA 3DHKH 4FUIA 1Y3XA 2GZ7A 2F9VA 3GY3A 5A0CA 2TRMA 1OPHB 1C9TA 2Y81A 3TGIE 3NXPA 2QV1A 2AFQB 1XUHA 1BCUH 3PYHA 1AY6H 3E0NB 3F68H 1QURH 3MU0A 4X6OA 3ZZ3A 4K3JA 4ZKRU 1W8BH 4IN1A 1C2KA 5EQQA 1QJ1B 4DVAU 2P16A 1N6YA 1GHVH 3UNQA 1WU1A 1CA0C 1A5GH 1GGDB 1C4Y2 1FPHH 1EAIA 3JZ2B 4X1QU 2PV9B 3A84A 4GAWA 3SN8A 1XMNB 3DFJA 1BRUP 1WQVH 2GT7A 4I8KA 5FBEA 1TBZH 3KGPA 4AB9A 1RTFB 4MVNA 4CR5A 4D76A 2A2XH 3KEEA 4FUBA 5T3HA 3LC5A 3TJNA 1LVMA 1JIRA 1O2XA 3SV6A 1SQOA 5JPMH 1RRKA 1GJ9B 5JYIA 1CBWC 2XBWA 1P06A 1P03A 3RLYH 1C5QA 1LDTT 1A0HB 1LCYA 1ESTA 2FI4E 1QBNA 2QAAA 3F6UH 1SLWB 1YF4A 2XTTB 1LHEH 1F92A 1VJAU 3TPIZ 4GCHG 4MLFB 5L6NH 4CH2B 1EOJA 2BVSH 2XNIA 3RU4E 1VCPA 4DURA 1AI8H 4Y6DA 1NZQH 1TRMA 2ZU4A 2RA3A 4ISIH 1SVPA 4YOGA 1Z1JA 1M9UA 2AERH 1A5HA 1HDTH 1QB6A 3RU4T 1BTXA 1SGIB 1H9IE 1SGQE 5FHTA 2XWBI 3E3TA 1QBOA 1Y3YA 1EP5A 2YNAA 2B0FA 3A7WA 3PROA 1MTNC 3TVJB 1ELGA 1GG6C 1T4VH 2B8OH 1GHWH 2AGIX 1LMWB 1V2TT 5HYOA 2QA9E 3T27A 1Y3UA
chains in the Genus database with same CATH superfamily
4NWLA 3NKKA 6GCHG 4Z1MD 2BDYA 2TGTA 4RKOB 5DK1A 1FY3A 1O3AA 1BRBE 3M7QA 2BMGB 1C5VA 1COWD 1BJUA 2LELA 4ZCNA 3A81A 5JBCS 1XVOA 4FUEA 1ARBA 1PJPA 1SLUB 4K1EA 1GJAB 3OY5U 4FUDA 2YMSC 4B2BA 1OXGA 3F9GA 3TH3H 1UTKA 1G32B 2Y5FA 3RU4D 3EQ0H 5DP5A 1EJAA 4OS5A 2FMJA 1MTUA 2GCHG 1O2MA 1ANBA 2EY4C 2ZU2A 3HKJB 2XW9A 3Q3YA 1OP0A 3RC4A 1A2CH 3ZVEA 1GI6A 3V12A 3OFND 4BOHA 1V2WT 2BXTH 5E0GA 1YBWA 3ZVAA 1FN8A 1TBQH 1DWEH 1HAPH 1SGCA 1OSSA 4INHA 1BBRK 1J14A 3BIUH 1V2RT 1UK4A 2A7JA 1P8VC 1XUFA 5GDSH 1IQNA 3LT3A 1FY4A 2YNBA 2BDIA 2D2DA 3BTDE 3ATLA 1V2KT 1ZGVA 2PKAA 1TWXB 2ZU5A 2ZPSA 4DJZB 4P02A 3HGPA 1ZHPA 5T6DA 5E2OA 3T28A 2RFKC 1H8DH 5EQSA 3P92A 1E1RD 2EEKA 1P09A 1MU8B 5E8EH 1BDAA 4GLYA 4K8BA 2KCAA 3K2UA 1P2IA 1RS0A 1AMHA 3SQEE 2ZDAH 1F0RA 1N8OC 1K1NA 1TGNA 3AW0A 2K0QA 3VPKA 3RXEA 4CRBA 2ZFRH 2VIVA 2ZKSA 3KHVA 4DG4A 4NWKA 3D62A 1ANCA 4D7GA 2STAE 1BTYA 1NRSH 2BDHA 3AW1A 1D3QB 3KQDA 3MMGA 4GHTA 2XBXA 2AS9A 1GBFA 1U6QA 3LOXA 1E35B 1HV7A 2JJ2D 2YOLA 3A80A 5ABWA 5ESTE 1Q2WA 6ESTA 1DM4B 2ZP0H 1C5LH 4I32A 4QT8C 1JMOH 3E91A 2FOHA 2GVFA 1Z6EA 3MO9A 5C3NA 4DIHH 2F83A 3ELAH 3MH7A 3HGNA 3A8CA 4F49A 4D9RA 2ZF0H 3VGCC 3O8BA 1TX7A 2PR3A 5HKKD 2J98A 1MD8A 1MKXK 2AYWA 3KNXA 1XVMA 5JB8S 1YPJH 1SMFE 1NESE 3BG8A 4MPUA 4AN7A 1O2WA 2WZQA 1NFWA 3GS9A 4A1XA 4K60A 1QL7A 1Z7KA 3BTEE 2H1UA 2FESH 1TOMH 2I6SA 1J16A 3HKIB 1FIWA 3M36A 2RA0A 4RN6A 2OD3B 1KXAA 2O8MA 2WPKS 2Z3DA 5FX5A 4LZ1H 2FTLE 1Y3WA 1GHZA 1K1IA 1EZQA 1BMAA 2JIZD 1TE0A 3P95A 3RC5A 3SO3A 4I8LA 1OP8A 1TPAE 1KTTB 5L30H 1O3FA 4YXWD 3ZVBA 4TWYA 1QIXB 3RXKA 1HAZB 3KL6A 1Y5BT 1G3EA 1GJ5H 3PV2A 1SGNE 2VVCA 4XDEA 1K1LA 1PYTC 4AFSA 5HXFA 1K9OE 2PSYA 1TFXA 1ZTLA 1EB1H 1MCTA 3P8FA 1UVTH 3LDXH 2ESTE 2ZGXH 3O8CA 1MKWK 4FUJA 3SUFA 3LJOA 2GV7A 2ILNA 4X8TH 2H2ZA 3U8RH 1GBCA 4B6FA 2RG3A 3TK5A 1N6XA 1UVUH 2FEQH 1SLVB 2W26A 1E0FD 4MPXA 1CT4E 1SKYE 3GCHC 2Z94A 1CGHA 3M7UA 1P2MA 4J2YB 2AIPA 1C2MA 1EZUC 1Q3XA 2WINI 1W11U 2C8XB 6CHAC 4IN2A 3QZRA 2BZAA 2GP9B 3PLBA 3V0XA 1RTLA 5BRRE 2FX4A 2KCOA 3RXIA 2WSSD 1WTGH 2P59A 3DA9B 5F6MA 1O31A 3T62A 3H7OA 3SU5A 2CGAA 1C1TA 2VNTA 3S9AA 2G5VA 4WH8A 2FOMB 3RXPA 1O34A 1C1NA 1NN6A 3TITA 4AOQA 1S0QA 3ZYDA 1AHTH 5HM9A 3FAOA 4WXIA 5GWZA 1CT2E 1DWBH 2OC0A 1RIWB 2OLGA 3OX7U 4ISNA 3PO1B 1TMTH 2CMYA 1PPGE 1ELTA 1UHBA 1ELEE 1CT0E 5L2ZH 1GJCB 1F0SA 3RXUA 1SGFA 2Z6BD 5DJ7A 2NU3E 4XBDA 1SGRE 3K6ZA 5ETXA 1O3PB 1EXFA 3UTUH 1UTQA 1KY9A 3BN9A 2JH6D 2EA3A 2H9EH 5DGJA 2ANKH 1DY8A 1EFRD 3ZIAD 2V3MA 5FX6A 2K1QA 1V2ST 3KQEA 3Q77A 5DP6A 4OM9A 1LHFH 4AG1A 1HNEE 2G8TA 2VB0A 2GMTC 2FOEA 5DG6A 1GJ4H 1SPJA 3U8TH 5C1UA 3SU6A 1Q31A 4D9QA 4Y7BA 4R0IA 5KECA 1DVAH 1UK3A 1GMHG 1KDQA 3MU4A 2OTVA 1T8LA 1EAWA 1YLNA 1BHXF 4JYUH 2HWLB 1EPTB 1ZHMA 3ZZDA 2TGPZ 4X6PA 1K0HA 2V6NA 1IAUA 1HAXB 1VGCC 2Z7FE 1AIXH 4BNRA 1ABJH 1GJBB 3VFEA 1FZZA 3SV7A 2F91A 4CRAA 4NFEA 1RFNA 1F5KU 2M2AA 1GBMA 4KP0A 2Z3CA 3UR6A 4WWYA 2XNDD 4JZEH 2VVVA 1O2QA 1HRTH 1SLXB 5TCAA 2ZFPH 1YGCH 3CENA 1C1WH 1TB6H 4FVDA 4Y11E 2R0LA 1QQUA 1C1MA 3GICB 2QC2A 1SGYE 3LGYA 2HGTH 2FM2A 3LGWA 4NFFA 4NZQA 4A7IB 1HIAB 1YLDA 2AGGX 1ZPZA 2F4LA 5C5NA 2D26C 2BXUH 3OYPA 4X2WA 1NY22 4I31A 2V3HH 3STIA 4UONA 4DY7B 2CHAB 3UNRA 3LKWA 2WPLS 3I78A 2O8UA 4Y0YE 4ZROA 3RMLH 1O2LA 1H8HD 2JETC 1SGFG 1P02A 1GBBA 1J15A 3QGJA 1BTHH 3NZIA 1GDUA 2ANMH 3KQBA 2HNTC 1O2RA 2R2WU 1ARCA 1YYY1 4WXVA 2QF0A 1SOTA 3C27B 3EAJA 4UFEH 4AZ2B 1GBTA 2FYRA 4MPWA 2IPHA 3DSOA 1AFEH 3VXEH 1QCPA 1SHHB 1IQKA 1C5PA 1T8MA 2FI3E 1DXPA 3E0PB 4TY7A 1GBAA 1O38A 2ZHQH 4NIXA 3Q76A 1P01A 2ZDMA 1C4U2 1DXWA 4MG3A 3SUDA 1ZLRA 1AKSA 2VIQA 4Z0KA 4O3UA 4X6MA 1BTWA 2PSXA 2BLQA 2W7SA 4IC5A 1FY5A 3KYFA 7LPRA 1KYNA 2ZPQA 2PTCE 1DITH 5DKMA 3SGQE 7ESTE 2WPIS 1AWHB 3BTWE 2KAIB 4LXBH 1EAXA 1C1UH 4WJG2 1ZTKA 1TPOA 3GYMA 4A1TA 3GISB 4AFZA 4NSYA 1VKYA 2ZWLH 1XKAC 1WV7H 1ELDE 2BD8A 4ASHA 2Q6GA 4AC9A 2BD9A 4ISOA 3TU7H 2FODA 3ZZ9A 2ALVA 1P9UA 4F4OC 3SV9A 4AGJA 1XM1A 4OS6A 1DWDH 2PKSC 2OC7A 4I7YH 4NIVA 1ZHRA 2PP6A 3SW2B 5CDFE 1KTSB 4YESB 1MTVA 3EA7A 2Y5GA 1YCPH 3B8JA 1O2VA 1XKBC 3UQVA 4MPVA 1HJAB 1V2NT 4YZUA 1MAYA 9ESTA 4BAOB 4UFGH 3A89A 3UOPA 1C5NH 2ZFTA 1GBHA 3ITIA 5AHGH 4TPYA 1TNKA 2PFEA 1FIZA 4XSKU 3BEUA 1WYKA 2RDLA 3HPTB 3ZZAA 5JBTA 2AEIH 3Q3KA 1O39A 3K6YA 2HPQH 1QZ8A 4DT4A 2BD4A 3TLOA 1NFUA 3FO8D 2WV4A 4VGCB 2OP9A 3GCOA 5EXLA 1LVYA 1O2GH 4H6SB 3A7XA 3FVFB 4BTUB 3KF2A 3SI3H 3SJKA 4HFPB 3GY6A 1WCZA 1MH0A 2PLXA 1GMCG 2WPMS 2YMSD 4Y79A 1TGSZ 3D23A 3QUMP 4XFQA 1GVZA 1BZXE 2RCEA 4WVPE 3H09A 4P00A 1HPGA 5C94A 1UCYH 1TIOA 1UVPA 3E6PH 1K21H 5EGMA 1LPZB 5EU8A 2ZG0H 3ZVFA 1A1RA 1SGPE 1K1MA 2F9UA 1GDQA 1NROH 2CF9H 3WW7A 2C3SA 3PB1E 2BX4A 2VH6A 1TNLA 1QL9A 1ELCA 2ZFFH 4NA9H 1TNIA 3LGIA 1FI8A 1LO6A 4XRNA 4R8TB 4BAKB 4AYYB 3EDXB 2DUCA 1GI8B 1B7XB 1O5BB 1QRWA 2P8OC 3A85A 1BTPA 3TIUA 3S9BA 4CRFA 3P17H 3T5FH 2BTCE 1PPCE 1V6DA 4B1TA 5AVDA 1L1GA 1H4WA 4Y10E 1K1OA 3U8OH 1QFKH 2L6OA 5A2MH 2SGPE 5DP4A 3RLWH 3RXCA 2P94A 1TLDA 1O3HA 5F8TA 2VWNA 3SHAH 3AASA 1C2LA 1S82A 4THNH 3ATMA 4B6EA 2C8YB 5FPYA 3M5OA 2UWOA 3CS7A 1O0DH 2FOCA 1O3JA 1L2EA 1T7CA 1V2PT 8LPRA 4KELA 1C5YB 2FOAA 1O3LA 3UOUA 1NU9A 3E16B 8KME2 5K0HA 4MNXA 4JZ1A 1JRSA 3OTJE 4HTCH 1MD7A 5C1YA 1ZYOA 3SZEA 4Y0ZE 1FPCH 3TH2H 5IK2D 4JMYA 4ZUHA 3SV2H 1S83A 2PKAB 1GPZA 1D3DB 1ELBA 2OINA 5HIZA 2ALPA 4GCHF 3V3MA 3NK8A 3AAUA 1CGIE 2ANWA 3A86A 4NZLA 4OGXA 5C0UA 1ESAA 5A8ZA 1TYNA 1DPOA 2XCFA 6LPRA 1V2UT 2A5IA 2GZ9A 4UDWH 1P2QA 3BTKE 2PGBB 4JK6A 4XE4A 3LPRA 1Y8TA 3F9EA 1YLCA 3M37A 1D3PB 4X2VA 4JK5A 1TGTA 3W95A 2QXIA 1WAYB 1PQ8A 2B7DH 3SYJA 1UMAH 1ZMJA 3OAAD 3GY5A 4FUFA 3ATIA 4X8UH 1BJVA 2J92A 5JB9S 4WMDA 3EYDA 1O5AB 1AWFH 2GTBA 1K28D 1NT1A 1O2PA 1GDNA 1OOKB 1NTPA 3BV9B 3VB7A 1TAWA 1MMJN 4BXSA 6GCHF 1PPFE 1T8OA 1TMBH 4M7GA 4B71A 3IITA 4I8HA 1CBWB 1AFQC 3Q3XA 2XC5A 2AMDA 2QY0B 2BY9X 2GGVB 4IBLH 1ZTJA 1T32A 2GCTC 1E36B 1PYTD 2FS8A 2ZGHA 2BY8X 2J98B 1ID5H 1OHHD 1CGJE 2UUJB 3LH3A 1TX6A 1VCQA 2VIPA 2VINA 4ZAEA 1TMUH 4YO9A 2GCHF 1DT2A 1UTMA 1ACBE 2A4RA 5CHAC 1KXCA 3RXHA 1W2KH 2SNWA 3MFJA 1C5WB 1O3EA 1SBWA 4K2YA 5EJZA 1HJ9A 3KCGH 1CSOE 4ZKSU 3CNRA 5TJXA 2F9OA 5HM2A 2ZHDA 1FAXA 3W94A 1GBDA 1JBUH 2BLOA 4DW2U 1HLTH 1HBTH 1RD3B 1ETSH 3RXQA 4IMQA 1ZR0A 1DANH 2KM0A 3BEFB 5FL7D 1XXFA 1NRNH 5C1XA 2G5NA 2HLCA 1OWHA 3P8OA 4DOQA 1JIMA 4BXWA 2SGQE 5C17A 5A0AE 1BB0B 1L0ZA 1MTWA 2PGQB 3RMOH 1WOFA 2AIQA 1AVGH 1P3CA 3S0NA 3KIDU 1BHXB 1AE5A 1H8ED 2YMSB 1GBEA 2ZTYA 4OS1A 1RGQA 2A4QA 1KIGH 2ODYB 3PTNA 2HOBA 1C1VH 1MCVA 1SC8U 4OS2A 4X6NA 3UNSA 5GCHG 2Y7ZA 1AQ7A 7GCHG 3SNAA 4Y8ZA 4YTAA 5F8XA 1S6FA 1GCTC 5JBBS 3VG8A 1LTOA 1OP2A 1KXBA 1FUJA 1DX5M 3PMBB 3PV4A 7GCHF 2FP7B 2C4FH 2ZDNA 1G2MA 4I33A 1HXEH 1TNHA 4A1VA 1ELFA 2ODPA 3P8GA 2AMQA 3AAVA 1INCA 2ZU3A 2L74A 1CQQA 4Q63A 4KGAA 3ODFA 5A0BA 1L1JA 1V2JT 3ENSB 2ZHEH 2PUQH 1HAGE 3GY2A 2F9BH 1ELVA 4AYVB 2H9HA 2ZDKA 1OWDA 1TOCB 4ASUD 1MBMA 3PMJA 2KX4A 2KZ4A 3PRBA 5T6GA 4BAQB 1O2SA 1TPSA 3M5LA 2J34A 1J8AA 3RXOA 3M3SA 1ZMNA 5FPTA 4RT1A 5BPEA 3K65B 1C1OA 1UHBB 2SGFE 4CRGA 2G4UA 1HAVB 1S81A 5A8XA 3MNBA 1O36A 2QN5T 1SGTA 1AUJA 4TSFD 5J4QA 1EZSC 1GI9B 2J9NA 1LKAA 2V3OH 3S69A 3FP6E 1O2OA 2ZHFH 3U1IB 3ZZ8A 1LPKB 1CVWH 1O2NA 1UCYE 4Y8YA 4A6LA 1GHXH 3OY6U 2LPRA 1V2VT 3KQCA 1GI3A 1WQSA 5GXPA 5K7RA 4FU7A 5DP9A 2M5TA 1T4UH 3OEED 4WMFA 4AB8A 3GOVB 2A45B 1C9PA 1BRAA 3IWMA 1THSH 5KGOA 1ZJDA 5LPFA 2FOBA 1RIWC 3GDUA 2R2MB 4IW4E 3PO1C 5J4SA 2TPIZ 2G81E 2A31A 1OWEA 1KDQB 3TK6A 1KSNA 1NFYA 2ZZUH 2CN0H 3U1JB 1B5GH 2BQ7B 4JYTA 5EXNA 3VB4A 2ASUB 4B2AA 2FIRH 1E34B 1DS2E 1HJ8A 3URCA 2AHME 2GV6A 2AH4X 4HGCA 4WMEA 2XRCA 4U32A 2F9PA 1DOJA 2ZDVH 3S7HB 1OYTH 4X8SH 1GI7B 3TJOA 4ZHLU 5FCRA 1C2DA 1O2HA 4ABIA 4AFQA 2VGCB 3QDZB 2B9LA 2VVUA 1GI2A 2O9QA 3JZ1B 4DIIH 2JH5D 1VITH 3QWCH 2H5DA 1H9HE 3MO3A 4GVUA 2Z3EA 4K1SA 1WUNH 1O32A 4MNVA 1P57B 4Q7YA 2C93B 3H5CB 5DSFA 1GBLA 2QIQA 1G3CA 2KR7A 1PPZA 3K9XB 1FNIA 4NA8A 4I86A 3TGJE 2OC8A 2NU2E 1VZQH 3DSGA 3NPSA 2ZHWH 3SJIA 1O3CA 2A5KA 5HMAA 3GYLB 1QRXA 2ZCHP 3LGVA 2EI8A 1W0ZU 3GCHB 1P12E 4NCYA 2VH0A 3U69H 1P3EA 3B9FH 1E37B 3WY8A 3SQHE 1FJSA 1ZRBA 1TNJA 3NRLA 4ISLA 3PLPA 1QQ4A 6CHAB 5EIYA 3ATWA 3FANA 2KCYA 2C90B 1W7GH 1ZZZA 3BTQE 3QTVH 2HRVA 1C2FA 1BTUA 2A7CA 1GJ6A 4GSOA 5GNDA 1ZPBA 1KXDA 1UTPA 3M35A 2ZIQH 1IQJA 4U30A 1AKSB 1ZGIA 1GMHF 3MH4A 4SGBE 1SL3A 1C2HA 2XCNA 3ZVDA 4I8GA 4CR9A 3R3GB 1B0EA 2Y82A 3T29A 1TQ0B 2H9TH 2FYQA 1SOZA 3BTME 3DCLA 1KMHB 4CHAB 3MHWU 4O9VA 4X2YA 5H4IB 3TJUA 2FOFA 4Q4LA 2BY6X 2ZEBA 3VB3A 3VXFH 2OUAA 2NU0E 1ZSLA 2ZNKH 5JBAS 1ORFA 5LPRA 2QXJA 1YC0A 3QLPH 2Y7XA 1AVWA 2J4IA 2O8WA 1MQ6A 4I8JA 2QCYA 3SJ9A 2FZZA 2FO9A 1FV9A 3OU0A 3ZZ6A 4YLQH 1PPBH 1YPEH 1BOQA 1V2QT 1D9IA 3AVZA 2H5CA 1IQEA 5EJLA 1DWCH 1JOUB 4XD7D 1C5ZB 2BVXH 3SI4H 3PWBA 1ANEA 1CHOG 1GI0A 2W6ID 1C1SA 1GHAG 2FTMA 2P93A 3TNTA 3A8AA 1CHOF 1C5TA 4ABHA 1GHAF 4AGKA 1W0JD 2FLBH 4CRCA 4YOJA 2Q6FA 5C2ZA 3BIVH 4AORA 3P70B 3UUZA 4JCNA 1Y5AT 1VGCB 3I29A 1O2TA 4U01A 3RDZA 5ESBA 1QTFA 3F9HA 3STJA 5C20A 1VITG 4ABAA 1DUEA 1GMDG 2UWPA 3UAIC 1YPHC 1W10U 3G01A 5GPIB 4ABFA 3SJ8A 3ZZBA 3RC6A 1VITF 4TY6A 5E2PA 1EAUA 2NWNA 1ANDA 3NWUA 3SORA 1LHGH 3TGKE 2F9NA 1EB2A 1IQLA 1BMLA 3ZV8A 4WY3A 1ETRH 2W7UA 4RSPA 2TBSA 1O5EH 3MNXA 1W14U 2A32A 3MWIU 1C2EA 2FWWA 3M7TA 1V3XA 2QF4A 1YCPK 4ZHMU 1ZSKA 2ZGCA 1AUTC 2FXRA 1O3IA 4Q2KA 3MU8A 1C2JA 4AX9H 3VEQB 4VGCC 1VCWA 1UTOA 2R3UA 1HUTH 1MZDA 5I46H 1P11E 1G37A 1KXFA 2JETB 1GJ7B 4IMZA 4MQAA 1HYLA 3RMNH 3PWCA 3F2HA 3SHCH 5EODA 3T25A 3UR9A 1J9CH 4BAMB 4JYVH 1HCGA 1EX3A 1QA7A 4NGAH 4GPGA 2OQUA 2IN2A 2NU1E 3MU1A 3BG4B 4X0WU 1MTSA 2VWMA 2GD4B 5C0TA 1TQ7B 1BIOA 1OKXA 3A7YA 2F3CE 3A88A 1O3GA 5PTPA 2WHXA 1O3MA 2FDAA 3A7VA 3TH4H 1HAOH 4RKJB 4Z6AH 1MAXA 1G3BA 1NS3A 3RXGA 1SGDE 1GI5A 1UCYK 1OWIA 2BLWA 2QF5A 3U9AH 3A83A 1QJ7B 3WWFA 2CXVA 1DY9A 1Z1IA 2VWOA 2FX6A 4K1TA 3M3TA 3TK9A 3PLKA 1GGDC 2DE8A 3HK3B 4FU9A 5FPSA 2SFAA 1T31A 1IQMA 3M5NA 5FAHA 3T26A 4JZIA 2JJ1D 3D65E 3FP7E 2Y80A 3U98H 2A1DB 1GMCF 5EOKA 1P2OA 2P95A 2SNVA 1AB9B 3DT0H 2G55A 3MI4A 3VB6A 1WTHD 3GDVA 2BZ6H 4H42U 3CS0A 2CJIA 4ZKOU 5G4BA 2VWLA 2BDCA 2FI5E 3E1XB 1IQFA 5GIBA 1HB0B 3ESTA 1BMNH 2IOTA 2ZGBH 2IJOB 2GT8A 4Y8XA 2TGDA 4UE7H 2XYAA 2ZCKP 2OCVB 1BT7A 3ZZCA 1FX0B 3URDA 2THFB 1L4ZA 1Z8IB 4BANB 1TRNA 4NIYA 2V0BA 3UQOA 5EW2H 1ABIH 3GDSA 4ABJA 1D6WA 3LONA 4OS4A 1QNJA 4HG6A 3DUXH 5IYTA 4H4FA 1AU8A 3PMHB 3VB5A 3A8BA 1FMGA 5C67A 1IQGA 1C1RA 1LHDH 3RMMH 3EGKH 1ZRKA 4FUGA 5FBIA 2JKHA 2ZFQH 1NPMA 1AZZA 1J17T 4ABBA 2GDEH 1XXDA 4LZ4B 1G2LA 1PQ7A 2F43B 3F1SB 3OEHD 1ZSJA 1GVKB 1O5DH 1DLKB 1DUAA 1SFQB 1SR5C 3FOAA 3P6ZB 2TIOA 3SU4A 1TNGA 3ZZ5A 5FCKA 4B73A 1EZXC 2IPQX 1YPMH 2HPPH 4DCDA 4ESTE 1S85A 1LQEA 1O3KA 2PWXA 2GKVE 3QTOH 1TGCA 2O8LA 2Z9GA 7KMEH 3P8NA 1A46H 1ZPCA 3F2GA 1KXEA 4KTSA 1O3DA 4O97A 3QK1A 1D3TB 1P04A 1W3CA 1VJ9U 1QL8A 2JDID 2XXLA 3UWIA 2P8OB 5DP3A 2QE7D 2J5UA 1W7XH 2J97A 3CP7A 1CA0B 3MNCA 1PQAA 2KCPA 1NRQH 2HLDD 3MO6A 4FUHA 4BTTB 2BY5X 1O5CB 4NSVA 3TJVA 3SOSA 3NUMA 4UFDH 1SI5H 1QY6A 4Y7AA 1Y5UT 4SGAE 1C5OH 1C5XB 1MABB 2BY7X 4GHQA 1H1BA 2A4OA 3OSYA 1EJNA 1BITA 1TA6A 3OE7D 3EA9A 4O3TA 2OBQA 1K1JA 2PTNA 2HVYB 2G4TA 2FS9A 3N7OA 3SU3A 2VU8E 2OQ5A 5F8ZA 3DSPA 1UO6A 1P2NA 1C2GA 2HNTF 4UD9H 1NO9H 5LPEA 1TONA 3MNSA 3ATKA 2SGEE 1QBVH 3L3TA 1FXYA 2DE9A 3B23B 3UREA 3BF6H 1TRYA 5HIYA 1OWKA 1BQYA 3RXJA 8ESTE 4F55A 4BAHB 3D49H 4TPIZ 1CU1A 1C4V2 5E0HA 1LPGB 1N1LA 2WUBA 3SNCA 5B6OA 5GJ4B 1O2KA 5CE1A 2OK5A 5IDKA 3RUOA 1RJXB 1GL1A 3DFLA 3MTYA 3SNBA 3O8DA 4PROA 2A2QH 3A7ZA 1TABE 2BYAX 1EOLA 1EKBB 1CE5A 1C5SA 3QN7A 5EJ1A 3RXDA 3F0PA 5AFYH 4MDSA 1WBGB 3ZVGA 2UWLA 3F3BA 2W3KA 1MTNB 1GG6B 1V2MT 3A7TA 2ZTZA 2QF3A 4U2WA 5HGGA 1QB9A 4HI3A 3BTHE 3A87A 3MQKC 1ZJKA 3FZZA 1O2ZA 4X8VH 4CBOA 2P3TB 2Y5HA 4LK4A 2BD3A 1E79D 1Z6JH 2ULLA 4B2CA 3E8LA 1AFQB 1FQ3A 3IG6B 1S84A 2WYJA 2OXSA 1GBIA 4FVBA 1E38B 1XUIA 1QJ6B 2GCTB 1W0KD 5F03A 2QXGA 1EATA 1F0TA 3M5MA 3SU1A 2WUCA 2AMPA 2Z9KA 3HK6B 4BTIB 1BBRH 4Y76A 1TX8A 3PM3A 3R0FA 3RM2H 4FOUC 5F53A 4JZFH 5GCHF 1NM6A 1C5RA 1LQDB 3AK5A 3FFGA 2STBE 4INKA 4YT7H 2XBYA 5KEDA 3ZVCA 5CHAB 3SNEA 3SUGA 4CH8B 1AD8H 1A0JA 5DO4H 3MU5A 3SV8A 1OWJA 1MU6B 1XUJA 4CRDA 2XWAA 2QGRA 2J38A 4LOYH 3BTFE 1DDJA 2Q6DA 1YWUA 2GZ8A 1JRTA 1O33A 2ZCLP 1TBRH 1AO5A 2B5TB 1EQ9A 2ZDLA 3E90B 5E0JA 4YOIA 4ABEA 3S7KB 4IS5A 3SBKA 3SU2A 2BQ6B 4K69A 1N8OB 1HAHH 1K2I1 1EUFA 3LGTA 1THPB 1Z8RA 1GWAA 4F48B 2BDAA 1SG8B 4X2XA 2ANYA 4O03A 1O35A 2V7QD 4YLUA 2FPZA 4YT6H 1C1PA 1QB1A 2UUYA 5CMXH 5T6FA 1QHRB 2HNTE 4E05H 5DP8A 3RXVA 3F2FA 1ZMLA 1BRCE 1PPEE 4FU8A 4X1RU 1G30B 1A61H 2BB4A 4NA7A 1MKXH 1OX1A 1O5FH 1YP9A 3FP8E 2CK3D 1DFPA 1G36A 4ACBA 3SGBE 2H6MA 3HATH 4KTCA 4FETA 1GBJA 1GCTB 3RXRA 4D8NA 1NU7B 1JWTA 3VGCB 1H9LB 1UK2A 3GCTG 1S0RA 1YPHE 1NBME 2VGCC 1OYQA 3RXSA 1GJDB 3W1EA 4YM9A 5AF9H 3GCTF 1UTJA 5EQRA 3TNSA 2K8IA 1UW7A 2HALA 2XBVA 1D4PB 1EJMA 1SSXA 4MNYA 1MBQA 1C1QA 5A09A 3LJJA 1F2SE 3QX5H 1TA2A 4D7FA 1SQTA 4ZXYH 2V35A 3N7EA 3DD2H 4RT0A 1UVSH 3LU9B 4ZKNU 4E7RG 1UTNA 1AN1E 8GCHG 2UUFB 5TCCA 1AZ8A 3KQ5A 2VIDA 3MH6A 2OBOA 2W6JD 2HVXA 2BOKA 8GCHF 1QR3E 1O2YA 2BHGA 3F9FA 4E06H 4MNWA 2JH0D 3U28C 1MKWH 1O3BA 3ZYEA 2ZC9H 1EASA 1NBMD 1A7SA 2WV5A 3ZZ7A 2ZI2H 3S9CA 2BVRH 1O37A 2WYGA 4H6TA 3RP2A 2LNCA 5DP7A 1O2UA 1PPHE 2ZU1A 4XBBA 3V13A 1IQHA 2BD7A 2ZECA 1IOEA 1A5IA 1AE8H 1RXPA 3T2NA 2LP6A 2SGAA 1EPTC 2W3IA 2BD2A 2GJGA 3KN2A 1HFDA 1HAIH 1FY1A 5B6LA 2Y6TA 1WDIA 5FXLA 5L2YH 3RXBA 3KYGA 1O30A 4K8YA 2VIWA 1P2KA 1S6LA 2EI6A 3GY8A 1RTKA 4CHAC 4ISHH 3SJOA 2VBCA 3PTBA 3MOCA 3RM0H 1HAVA 1GJ8B 1GBKA 4ZHAA 1DE7H 1HAYB 2P3UB 5EPYA 1O5GH 2FOGA 1QGFA 5A8YA 3BTTE 2WV9A 4UFFH 3M61U 2ZA5A 1SFIA 2UUKB 3O8RA 2BX3A 1GI4A 3UY9A 4OS7A 3I77A 1KLTA 2D8WA 3FZDA 4ZH8A 3SNDA 2A4GA 1GCDA 4Q7XA 1LVBA 1NRPH 1DSTA 1HXFH 2XC0A 4WF8A 1LVOA 2J94A 3N7DA 4Q7ZA 3EA8A 3SUEA 3PV5A 2CHAC 2QYIA 1YM0A 1MUEB 2RDEA 4ACAA 3RXAA 2NU4E 3ZZ4A 1Z8GA 3UPEA 1CO7E 1YCPM 3A82A 1IHSH 1K22H 1Z8JB 4J1YA 1V2LT 2AGEX 3RXFA 1FY8E 5SGAE 3MYWA 1S5SA 4Q80A 1W12U 2D1JA 2A7HA 1E1QD 4IC6A 2ZGJA 5LH8A 1IHTH 4TT3D 1OS8A 3LGUA 2ODQA 2XOKD 1NC6A 1P2JA 4AFUA 3SU0A 4FXGH 2ZQ1A 3LIWA 1VR1H 4FUCA 4M9FA 2R9PA 1TALA 4KKDA 4CBNA 4DGJA 2GX4A 2WPHS 2G00A 1A0LA 4MTBA 1B0FA 1Y59T 1TPPA 2WPJS 1MZAA 3BTGE 3ODDA 2CV3A 1SHYA 2GMTB 4CREA 1KLIH 1SGEE 1Z71A 1F5RA 2EI7A 1GVLA 1TGBA 1FLEE 1G3DA 1IQIA 1P10A 3L33A 1K1PA 4A5TS 3UIRA 4X1NU 1SQRA 4X1PU 3UWJH 2BM2A 2Z9IA 1C2IA 2PW8H 1BMFD 2W5EA 3A8DA 4NG9H 1EP6A 5C5OA 1FN6A 1PFXC 1W13U 2KFWA 1A4WH 2ZFSA 3QZQA 1BA8B 2VIOA 2C8WB 1GL0E 1XX9A 1T8NA 4E7NA 4OGYA 2PUXB 1F7ZA 4IGDA 1YPLH 1BBRE 3PMAB 1O3OA 1P9SA 4KTUA 1GMDF 1A3BH 1HJAC 2QXHA 1S6HA 4ZXXH 4ABGA 2BLVA 2I6QA 1P0SH 3BG4C 4INLA 2GDDA 5T1VA 2FLRH 3FKSD 4NIWA 3QO6A 5CHBA 2OC1A 3GCNA 3UFAA 3BEIB 4X1SU 3V7TA 2SGDE 1D6RA 5LGOA 1YPGH 2Z9LA 1L4DA 3RXMA 1F5LA 1FONA 1NRRH 1THRH 5I25A 1W0YH 3LC3A 1EPTA 1CHGA 3WWBA 1O2JA 2TGAA 1LKBA 3EE0B 1HGTH 4B75A 1NFXA 3Q00A 2IJD1 2J2UA 1ELAA 5DPAA 1ZOMA 4HZHA 2A0QB 3ZV9A 1GI1A 4WH6A 2CF8H 1H8IH 1LHCH 2G52A 3QGNB 2BDBA 1BUIA 4XBCA 5JDUB 1CA8B 3SGAE 4TWWA 1QA0A 1UTLM 2ZQ2A 4UEHH 1YKTA 1KLJH 3GY7A 1DLEA 1QRZA 2Q1JA 1L1NA 4DT7B 3BSQA 9LPRA 1O2IA 3L6PA 2Z9JA 1G9IE 1HIAA 2P3FH 1AB9C 2BD5A 3C1KA 1PQ5A 2VJ1A 2BOHB 1C5MD 1DSUA 1GHYH 2C8ZB 2XC4A 3SZNA 1YPKH 2G51A 1DICA 1FDPA 5EW1H 1A3EH 4Y71A 2EC9H 1O3NA 2BQWB 1V2OT 4K5ZA 1Y3VA 1C5UA 3NCLA 5AFZH 2J95A 2R3YA 3MH5A 4B74A 1AGJA 2ZTXA 1WXRA 5DN6D 2BDGA 5EPNA 1XUKA 1P05A 4ABDA 2O8TA 2PHBA 1FAKH 3GY4A 2WPDD 1XUGA 1UVOA 4B76A 1F0UA 2R0KA 1UJ1A 4JZDH 5EXMA 2ZPRA 2A5AA 3H7TA 1BMMH 2PKSB 3FN8A 4RI0A 3RXTA 1ESBA 1JXPA 1SB1H 4ZMAH 1MQ5A 3OTPA 3M3VA 1BTZA 2ZO3H 1ETTH 1AVXA 1GHBG 1X7AC 3RXLA 4TYDA 3LH1A 1WSSH 4XOJA 4AG2A 4A92A 5EG4A 2KAIA 4GUXA 1GHBF 1SQAA 3DHKH 4FUIA 1Y3XA 2GZ7A 2F9VA 3GY3A 5A0CA 2TRMA 1OPHB 1C9TA 2Y81A 3TGIE 3PRDA 3NXPA 3F0OA 2QV1A 2AFQB 1XUHA 1BCUH 3PYHA 1AY6H 3E0NB 3F68H 1QURH 3MU0A 4X6OA 3ZZ3A 4K3JA 4ZKRU 1W8BH 4IN1A 1C2KA 5EQQA 1QJ1B 4DVAU 2P16A 1N6YA 1GHVH 3UNQA 1WU1A 1CA0C 1A5GH 1GGDB 1C4Y2 1FPHH 1EAIA 3JZ2B 4X1QU 2PV9B 3A84A 4GAWA 3SN8A 1XMNB 3DFJA 3EE7A 1BRUP 1WQVH 2GT7A 4I8KA 5FBEA 1TBZH 3KGPA 4AB9A 1RTFB 4MVNA 4CR5A 4D76A 2A2XH 3KEEA 4FUBA 5T3HA 3LC5A 3TJNA 1LVMA 1JIRA 1O2XA 3N99A 3SV6A 1SQOA 5JPMH 1RRKA 1GJ9B 5JYIA 1CBWC 2XBWA 1P06A 1P03A 3RLYH 1C5QA 1LDTT 1A0HB 1LCYA 1ESTA 2FI4E 1QBNA 2QAAA 3F6UH 1SLWB 1YF4A 2XTTB 1LHEH 1F92A 1VJAU 3TPIZ 4GCHG 4MLFB 5L6NH 4CH2B 1EOJA 2BVSH 2XNIA 1YY3A 3RU4E 1VCPA 4DURA 1AI8H 4Y6DA 1NZQH 1TRMA 2ZU4A 2EQNA 2RA3A 4ISIH 1SVPA 4YOGA 1Z1JA 1M9UA 2AERH 1A5HA 1HDTH 1QB6A 3RU4T 1BTXA 1SGIB 1H9IE 1SGQE 5FHTA 2XWBI 3E3TA 1QBOA 1Y3YA 1EP5A 2YNAA 2B0FA 3A7WA 3PROA 1MTNC 3TVJB 1ELGA 1GG6C 1T4VH 2B8OH 3UB0A 1GHWH 2AGIX 1LMWB 1V2TT 5HYOA 2QA9E 3T27A 1Y3UA
chains in the Genus database with same CATH topology
4NWLA 3NKKA 6GCHG 2BDYA 2TGTA 4RKOB 5DK1A 1FY3A 1O3AA 1BRBE 3M7QA 2BMGB 1C5VA 1BJUA 3A81A 5JBCS 1XVOA 4FUEA 1ARBA 1PJPA 1SLUB 4K1EA 1GJAB 3OY5U 4FUDA 4B2BA 1OXGA 3F9GA 3TH3H 1UTKA 1G32B 2Y5FA 3RU4D 3EQ0H 5DP5A 1EJAA 4OS5A 2FMJA 1MTUA 2GCHG 1O2MA 1ANBA 2ZU2A 3HKJB 2XW9A 3Q3YA 1OP0A 3RC4A 1A2CH 3ZVEA 1GI6A 3V12A 4BOHA 1V2WT 2BXTH 5E0GA 1YBWA 3ZVAA 1FN8A 1TBQH 1DWEH 1HAPH 1SGCA 1OSSA 4INHA 1BBRK 1J14A 3BIUH 1V2RT 1UK4A 2A7JA 1P8VC 1XUFA 5GDSH 1IQNA 3LT3A 1FY4A 2YNBA 2BDIA 2D2DA 3BTDE 3ATLA 1V2KT 1ZGVA 2PKAA 1TWXB 2ZU5A 2ZPSA 4DJZB 3HGPA 1ZHPA 5T6DA 5E2OA 3T28A 1H8DH 5EQSA 3P92A 2EEKA 1P09A 1MU8B 5E8EH 1BDAA 4GLYA 4K8BA 3K2UA 1P2IA 1RS0A 1AMHA 3SQEE 2ZDAH 1F0RA 1N8OC 1K1NA 1TGNA 3AW0A 3VPKA 3RXEA 4CRBA 2ZFRH 2VIVA 2ZKSA 3KHVA 4DG4A 4NWKA 3D62A 1ANCA 4D7GA 2STAE 1BTYA 1NRSH 2BDHA 3AW1A 1D3QB 3KQDA 3MMGA 4GHTA 2XBXA 2AS9A 1GBFA 1U6QA 3LOXA 1E35B 1HV7A 2YOLA 3A80A 5ABWA 5ESTE 1Q2WA 6ESTA 1DM4B 2ZP0H 1C5LH 4I32A 4QT8C 1JMOH 3E91A 2FOHA 2GVFA 1Z6EA 3MO9A 5C3NA 4DIHH 2F83A 3ELAH 3MH7A 3HGNA 3A8CA 4F49A 4D9RA 2ZF0H 3VGCC 3O8BA 1TX7A 2PR3A 1MD8A 1MKXK 2AYWA 3KNXA 1XVMA 5JB8S 1YPJH 1SMFE 1NESE 3BG8A 4MPUA 4AN7A 1O2WA 1NFWA 4A1XA 4K60A 1QL7A 1Z7KA 3BTEE 2H1UA 2FESH 1TOMH 2I6SA 1J16A 3HKIB 1FIWA 3M36A 2RA0A 4RN6A 2OD3B 1KXAA 2O8MA 2WPKS 2Z3DA 5FX5A 4LZ1H 2FTLE 1Y3WA 1GHZA 1K1IA 1EZQA 1BMAA 1TE0A 3P95A 3RC5A 3SO3A 4I8LA 1OP8A 1TPAE 1KTTB 5L30H 1O3FA 3ZVBA 4TWYA 1QIXB 3RXKA 1HAZB 3KL6A 1Y5BT 1G3EA 1GJ5H 1SGNE 2VVCA 4XDEA 1K1LA 1PYTC 4AFSA 5HXFA 1K9OE 2PSYA 1TFXA 1ZTLA 1EB1H 1MCTA 3P8FA 1UVTH 3LDXH 2ESTE 2ZGXH 3O8CA 1MKWK 4FUJA 3SUFA 3LJOA 2GV7A 2ILNA 4X8TH 2H2ZA 3U8RH 1GBCA 2RG3A 3TK5A 1N6XA 1UVUH 2FEQH 1SLVB 2W26A 1E0FD 4MPXA 1CT4E 3GCHC 2Z94A 1CGHA 3M7UA 1P2MA 4J2YB 2AIPA 1C2MA 1EZUC 1Q3XA 2WINI 1W11U 2C8XB 6CHAC 4IN2A 3QZRA 2BZAA 2GP9B 3PLBA 3V0XA 1RTLA 5BRRE 2FX4A 3RXIA 1WTGH 2P59A 3DA9B 5F6MA 1O31A 3T62A 3H7OA 3SU5A 2CGAA 1C1TA 2VNTA 3S9AA 2G5VA 4WH8A 2FOMB 3RXPA 1O34A 1C1NA 1NN6A 3TITA 4AOQA 1S0QA 3ZYDA 1AHTH 5HM9A 3FAOA 4WXIA 5GWZA 1CT2E 1DWBH 2OC0A 1RIWB 2OLGA 3OX7U 4ISNA 3PO1B 1TMTH 2CMYA 1PPGE 1ELTA 1UHBA 1ELEE 1CT0E 5L2ZH 1GJCB 1F0SA 3RXUA 1SGFA 2Z6BD 5DJ7A 2NU3E 4XBDA 1SGRE 3K6ZA 5ETXA 1O3PB 1EXFA 3UTUH 1UTQA 1KY9A 3BN9A 2JH6D 2EA3A 2H9EH 5DGJA 2ANKH 1DY8A 5FX6A 2K1QA 1V2ST 3KQEA 3Q77A 5DP6A 1LHFH 4AG1A 1HNEE 2G8TA 2VB0A 2GMTC 2FOEA 5DG6A 1GJ4H 1SPJA 3U8TH 5C1UA 3SU6A 1Q31A 4D9QA 4Y7BA 4R0IA 1DVAH 1UK3A 1GMHG 1KDQA 3MU4A 2OTVA 1T8LA 1EAWA 1BHXF 4JYUH 2HWLB 1EPTB 1ZHMA 3ZZDA 2TGPZ 4X6PA 2V6NA 1IAUA 1HAXB 1VGCC 2Z7FE 1AIXH 4BNRA 1ABJH 1GJBB 3VFEA 1FZZA 3SV7A 2F91A 4CRAA 4NFEA 1RFNA 1F5KU 1GBMA 4KP0A 2Z3CA 3UR6A 4WWYA 4JZEH 5TCAA 2VVVA 1O2QA 1HRTH 1SLXB 2ZFPH 1YGCH 3CENA 1C1WH 1TB6H 4FVDA 4Y11E 2R0LA 1QQUA 1C1MA 3GICB 2QC2A 1SGYE 3LGYA 2HGTH 2FM2A 3LGWA 4NFFA 4NZQA 4A7IB 1HIAB 1YLDA 2AGGX 1ZPZA 5C5NA 2D26C 2BXUH 3OYPA 4X2WA 1NY22 4I31A 2V3HH 3STIA 4UONA 4DY7B 2CHAB 3UNRA 3LKWA 2WPLS 3I78A 2O8UA 4Y0YE 4ZROA 3RMLH 1O2LA 2JETC 1SGFG 1P02A 1GBBA 1J15A 3QGJA 1BTHH 3NZIA 1GDUA 2ANMH 3KQBA 2HNTC 1O2RA 2R2WU 1ARCA 1YYY1 4WXVA 2QF0A 1SOTA 3C27B 3EAJA 4UFEH 4AZ2B 1GBTA 2FYRA 4MPWA 2IPHA 1AFEH 3VXEH 1QCPA 1SHHB 1IQKA 1C5PA 1T8MA 2FI3E 1DXPA 3E0PB 4TY7A 1GBAA 1O38A 2ZHQH 4NIXA 3Q76A 1P01A 2ZDMA 1C4U2 1DXWA 4MG3A 3SUDA 1ZLRA 1AKSA 2VIQA 4Z0KA 4O3UA 4X6MA 1BTWA 2PSXA 2BLQA 2W7SA 4IC5A 1FY5A 7LPRA 1KYNA 2ZPQA 2PTCE 1DITH 5DKMA 3SGQE 7ESTE 2WPIS 1AWHB 3BTWE 2KAIB 4LXBH 1EAXA 1C1UH 4WJG2 1ZTKA 1TPOA 3GYMA 4A1TA 3GISB 4AFZA 4NSYA 2ZWLH 1XKAC 1WV7H 1ELDE 2BD8A 4ASHA 2Q6GA 2BD9A 4ISOA 3TU7H 2FODA 3ZZ9A 2ALVA 1P9UA 4F4OC 3SV9A 4AGJA 1XM1A 4OS6A 1DWDH 2PKSC 2OC7A 4I7YH 4NIVA 1ZHRA 3SW2B 1KTSB 4YESB 1MTVA 3EA7A 2Y5GA 1YCPH 3B8JA 1O2VA 1XKBC 3UQVA 4MPVA 1HJAB 1V2NT 4YZUA 1MAYA 9ESTA 4BAOB 4UFGH 3A89A 3UOPA 1C5NH 2ZFTA 1GBHA 3ITIA 5AHGH 4TPYA 1TNKA 2PFEA 1FIZA 4XSKU 3BEUA 1WYKA 2RDLA 3HPTB 3ZZAA 5JBTA 2AEIH 3Q3KA 1O39A 3K6YA 2HPQH 2BD4A 3TLOA 1NFUA 2WV4A 4VGCB 2OP9A 3GCOA 5EXLA 1LVYA 1O2GH 4H6SB 3A7XA 3FVFB 4BTUB 3KF2A 3SI3H 3SJKA 4HFPB 3GY6A 1WCZA 1MH0A 2PLXA 1GMCG 2WPMS 4Y79A 1TGSZ 3D23A 3QUMP 4XFQA 1GVZA 1BZXE 2RCEA 4WVPE 1HPGA 1UCYH 1TIOA 1UVPA 3E6PH 1K21H 5EGMA 1LPZB 5EU8A 2ZG0H 3ZVFA 1A1RA 1SGPE 1K1MA 2F9UA 1GDQA 1NROH 2CF9H 2C3SA 3PB1E 2BX4A 2VH6A 1TNLA 1QL9A 1ELCA 2ZFFH 4NA9H 1TNIA 3LGIA 1FI8A 1LO6A 4R8TB 4BAKB 4AYYB 3EDXB 2DUCA 1GI8B 1B7XB 1O5BB 1QRWA 2P8OC 3A85A 1BTPA 3TIUA 3S9BA 4CRFA 3P17H 3T5FH 2BTCE 1PPCE 1V6DA 4B1TA 5AVDA 1L1GA 1H4WA 4Y10E 1K1OA 3U8OH 1QFKH 5A2MH 2SGPE 5DP4A 3RLWH 3RXCA 2P94A 1TLDA 1O3HA 5F8TA 2VWNA 3SHAH 3AASA 1C2LA 1S82A 4THNH 3ATMA 2C8YB 5FPYA 3M5OA 2UWOA 3CS7A 1O0DH 2FOCA 1O3JA 1L2EA 1T7CA 1V2PT 8LPRA 4KELA 1C5YB 2FOAA 1O3LA 3UOUA 1NU9A 3E16B 8KME2 5K0HA 4MNXA 4JZ1A 1JRSA 3OTJE 4HTCH 1MD7A 5C1YA 1ZYOA 4Y0ZE 1FPCH 3TH2H 4JMYA 4ZUHA 3SV2H 1S83A 2PKAB 1GPZA 1D3DB 1ELBA 2OINA 2ALPA 4GCHF 3V3MA 3NK8A 3AAUA 1CGIE 2ANWA 3A86A 4NZLA 4OGXA 1ESAA 5A8ZA 1TYNA 1DPOA 2XCFA 6LPRA 1V2UT 2A5IA 2GZ9A 4UDWH 1P2QA 3BTKE 2PGBB 4JK6A 4XE4A 3LPRA 1Y8TA 3F9EA 1YLCA 3M37A 1D3PB 4X2VA 4JK5A 1TGTA 3W95A 2QXIA 1WAYB 1PQ8A 2B7DH 1UMAH 1ZMJA 3GY5A 4FUFA 3ATIA 4X8UH 1BJVA 2J92A 5JB9S 4WMDA 3EYDA 1O5AB 1AWFH 2GTBA 1K28D 1NT1A 1O2PA 1GDNA 1OOKB 1NTPA 3BV9B 3VB7A 1TAWA 1MMJN 4BXSA 6GCHF 1PPFE 1T8OA 1TMBH 4M7GA 4B71A 3IITA 4I8HA 1CBWB 1AFQC 3Q3XA 2XC5A 2AMDA 2QY0B 2BY9X 2GGVB 4IBLH 1ZTJA 1T32A 2GCTC 1E36B 1PYTD 2FS8A 2ZGHA 2BY8X 1ID5H 1CGJE 2UUJB 3LH3A 1TX6A 1VCQA 2VIPA 2VINA 4ZAEA 1TMUH 4YO9A 2GCHF 1DT2A 1UTMA 1ACBE 2A4RA 5CHAC 1KXCA 3RXHA 1W2KH 2SNWA 3MFJA 1C5WB 1O3EA 1SBWA 4K2YA 1HJ9A 3KCGH 1CSOE 4ZKSU 5TJXA 2F9OA 5HM2A 2ZHDA 1FAXA 3W94A 1GBDA 1JBUH 2BLOA 4DW2U 1HLTH 1HBTH 1RD3B 1ETSH 3RXQA 4IMQA 1ZR0A 1DANH 3BEFB 1XXFA 1NRNH 5C1XA 2G5NA 2HLCA 1OWHA 3P8OA 4DOQA 1JIMA 4BXWA 2SGQE 5A0AE 1BB0B 1L0ZA 1MTWA 2PGQB 3RMOH 1WOFA 2AIQA 1AVGH 1P3CA 3S0NA 3KIDU 1BHXB 1AE5A 1GBEA 2ZTYA 4OS1A 1RGQA 2A4QA 1KIGH 2ODYB 3PTNA 2HOBA 1C1VH 1MCVA 1SC8U 4OS2A 4X6NA 3UNSA 5GCHG 2Y7ZA 1AQ7A 7GCHG 3SNAA 4Y8ZA 4YTAA 5F8XA 1S6FA 1GCTC 5JBBS 1LTOA 1OP2A 1KXBA 1FUJA 1DX5M 3PMBB 3PV4A 7GCHF 2FP7B 2C4FH 2ZDNA 1G2MA 4I33A 1HXEH 1TNHA 4A1VA 1ELFA 2ODPA 3P8GA 2AMQA 3AAVA 1INCA 2ZU3A 1CQQA 4KGAA 3ODFA 5A0BA 1L1JA 1V2JT 3ENSB 2ZHEH 2PUQH 1HAGE 3GY2A 2F9BH 1ELVA 4AYVB 2H9HA 2ZDKA 1OWDA 1TOCB 1MBMA 3PMJA 5T6GA 4BAQB 1O2SA 1TPSA 3M5LA 2J34A 1J8AA 3RXOA 3M3SA 1ZMNA 5FPTA 5BPEA 3K65B 1C1OA 1UHBB 2SGFE 4CRGA 2G4UA 1HAVB 1S81A 5A8XA 3MNBA 1O36A 2QN5T 1SGTA 1AUJA 5J4QA 1EZSC 1GI9B 2J9NA 1LKAA 2V3OH 3S69A 3FP6E 1O2OA 2ZHFH 3U1IB 3ZZ8A 1LPKB 1CVWH 1O2NA 1UCYE 4Y8YA 4A6LA 1GHXH 3OY6U 2LPRA 1V2VT 3KQCA 1GI3A 1WQSA 5GXPA 5K7RA 4FU7A 5DP9A 2M5TA 1T4UH 4WMFA 4AB8A 3GOVB 2A45B 1C9PA 1BRAA 3IWMA 1THSH 1ZJDA 5LPFA 2FOBA 1RIWC 3GDUA 2R2MB 4IW4E 3PO1C 5J4SA 2TPIZ 2G81E 2A31A 1OWEA 1KDQB 3TK6A 1KSNA 1NFYA 2ZZUH 2CN0H 3U1JB 1B5GH 2BQ7B 4JYTA 5EXNA 3VB4A 2ASUB 4B2AA 2FIRH 1E34B 1DS2E 1HJ8A 3URCA 2GV6A 2AH4X 4HGCA 4WMEA 2XRCA 4U32A 2F9PA 1DOJA 2ZDVH 3S7HB 1OYTH 4X8SH 1GI7B 3TJOA 4ZHLU 5FCRA 1C2DA 1O2HA 4ABIA 4AFQA 2VGCB 3QDZB 2B9LA 2VVUA 1GI2A 2O9QA 3JZ1B 4DIIH 2JH5D 1VITH 3QWCH 2H5DA 1H9HE 3MO3A 4GVUA 2Z3EA 4K1SA 1WUNH 1O32A 4MNVA 1P57B 4Q7YA 2C93B 3H5CB 1GBLA 2QIQA 1G3CA 1PPZA 3K9XB 1FNIA 4NA8A 3TGJE 2OC8A 2NU2E 1VZQH 3NPSA 2ZHWH 3SJIA 1O3CA 2A5KA 5HMAA 3GYLB 1QRXA 2ZCHP 3LGVA 2EI8A 1W0ZU 3GCHB 1P12E 4NCYA 2VH0A 3U69H 1P3EA 3B9FH 1E37B 3WY8A 3SQHE 1FJSA 1ZRBA 1TNJA 4ISLA 3PLPA 1QQ4A 6CHAB 3ATWA 3FANA 2C90B 1W7GH 1ZZZA 3BTQE 3QTVH 2HRVA 1C2FA 1BTUA 2A7CA 1GJ6A 4GSOA 1ZPBA 1KXDA 1UTPA 3M35A 2ZIQH 1IQJA 4U30A 1AKSB 1ZGIA 1GMHF 3MH4A 4SGBE 1SL3A 1C2HA 2XCNA 3ZVDA 4I8GA 4CR9A 3R3GB 1B0EA 2Y82A 3T29A 1TQ0B 2H9TH 2FYQA 1SOZA 3BTME 4CHAB 3MHWU 4O9VA 4X2YA 5H4IB 3TJUA 2FOFA 2BY6X 2ZEBA 3VB3A 3VXFH 2OUAA 2NU0E 1ZSLA 2ZNKH 5JBAS 1ORFA 5LPRA