1B0EA

Crystal structure of porcine pancreatic elastase with mdl 101,146
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (ELASTASE)
publication title Inhibition of human neutrophil elastase. 4. Design, synthesis, X-ray crystallographic analysis, and structure-activity relationships for a series of P2-modified, orally active peptidyl pentafluoroethyl ketones.
pubmed doi rcsb
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1998-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1b0eA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1b0eA01
3MFJA 1C2FA 1TGBA 1D9IA 1ZRKA 2H9EH 1GHAG 1TA2A 3Q76A 1DXPA 2ZU2A 2BY8X 5GCHG 1O0DH 4YESB 4I8LA 1LPGB 1Y5BT 1TGTA 1O2ZA 2SGQE 2ZDKA 1BMNH 1ZJKA 2GZ7A 3VGCC 1YPLH 1C2JA 2VINA 4BAQB 1C5XB 3PV4A 4YOGA 4D9QA 1FIWA 1QTFA 3PM3A 5EG4A 3M5MA 3LGUA 1FUJA 4B1TA 2VGCC 5FX5A 1FY8E 1TGCA 1FV9A 7KMEH 4JZFH 1EAWA 3FZDA 3ZYEA 1HNEE 2RG3A 5IDKA 1M9UA 4JYUH 1SLVB 5DK1A 1JRTA 1IHTH 1TRNA 2RCEA 1AE5A 2SGAA 1GI9B 1A5IA 1O30A 2JH5D 1YCPH 1DY9A 1YGCH 4MG3A 3LIWA 1OYTH 5E8EH 1G9IE 1GI0A 3AVZA 3GCHB 1BTYA 1C5PA 1YM0A 1TPOA 1H9HE 1RTFB 2B8OH 3A83A 5JBCS 1EKBB 1C5YB 4Y10E 4KGAA 1MKXK 1TX7A 2XC0A 4H4FA 1A1RA 1HB0B 1O2KA 3ESTA 1X7AC 1UTNA 4Q7ZA 1SGRE 1HAGE 3KEEA 1C4U2 2BQ6B 3RXRA 1QL8A 4IC6A 5K0HA 4Q7YA 9LPRA 3QWCH 4ASHA 1A3EH 1DT2A 2AFQB 1HJ8A 1V2VT 1MQ6A 3RXTA 3LKWA 3U8TH 2LPRA 1MCVA 2Y5GA 4XDEA 1QQUA 3RXFA 1A7SA 3E16B 4CRGA 2QY0B 1WQVH 1MD8A 4ZXXH 3TJUA 2BQ7B 4MPXA 1DOJA 1V2LT 1DX5M 1EUFA 5JBBS 3CS0A 5T3HA 3UR6A 1O3CA 4Y7AA 1P12E 1ANDA 2BZAA 4ZKOU 1AI8H 3VFEA 1AKSA 2PUXB 3U69H 4ISHH 1O31A 3ZV9A 4B75A 3ZVAA 3SI4H 4WXVA 3UWJH 2ANYA 5E0HA 4R8TB 2ZDVH 4FU7A 2ZP0H 5ETXA 4GCHF 5CHAB 1NROH 2EI6A 1C4V2 5C1YA 2ZC9H 2QXGA 3TITA 4UFDH 3GY2A 1YPGH 1QBNA 1W7GH 1GL1A 1GJBB 3ZYDA 3M3TA 5A8YA 1QBVH 1EAIA 4K5ZA 2Z7FE 4HGCA 8ESTE 1HUTH 3SNAA 1DSTA 2YNAA 5HMAA 3RXPA 4DIHH 1O2UA 2J34A 1LPKB 1BJUA 3P8FA 1DUAA 2QGRA 1K1MA 3P8NA 1W13U 1O3HA 1ABJH 1D3DB 4K1SA 1GG6B 2OC8A 2SGEE 4VGCB 3EDXB 1EB2A 2JETC 2Z94A 4AOQA 1HJ9A 5SGAE 1S0QA 4JMYA 5LPRA 1K22H 2QF0A 2P8OC 5HYOA 2D2DA 1O35A 3OU0A 2ZHQH 3GY5A 4NZQA 2J4IA 4F4OC 1GMHG 3UREA 4MNYA 1GCTC 1H9IE 2GVFA 1K1IA 1EJMA 3F9HA 5EOKA 1DY8A 1N8OC 1QJ1B 3A87A 1OOKB 4IS5A 3UUZA 1GI6A 2B7DH 1O3NA 3KHVA 4Y8YA 1O38A 2BMGB 3E3TA 1UVPA 1O3OA 2BLQA 1O3KA 2Q6FA 1Q31A 1ZMJA 2PKAA 3RXMA 2ODYB 3BTEE 1CU1A 2OP9A 3LJJA 1TNKA 1SGCA 2FS9A 1HBTH 4JZIA 3E90B 2XCNA 1TPAE 2F9PA 1Z6EA 1MU6B 1Z8GA 1KLJH 5F6MA 1O2VA 3EGKH 3E0PB 3UIRA 1YC0A 3TGKE 4TYDA 5A09A 1VZQH 1TX6A 3ZVFA 1VCPA 3MTYA 1MBQA 2OUAA 1C5RA 3VB5A 1IQNA 4CH8B 3A8BA 1AUJA 2BD8A 2F9NA 2ZPRA 1ZGIA 5GXPA 4GCHG 4OS4A 2VGCB 3A84A 1AFQC 4CRAA 1FAKH 5TCCA 1CBWC 2AMQA 4X0WU 1AE8H 1OX1A 2ZHEH 5DG6A 4Y0YE 3KQBA 1V2NT 2Q1JA 2CF9H 2SGPE 1GBTA 2HOBA 2ZZUH 2WPMS 1EJAA 4A1TA 1ELTA 4O03A 1O36A 4Y11E 2G8TA 3SBKA 3ODDA 1AZ8A 4NIXA 3RXHA 2BHGA 5J4SA 1BRUP 1GBIA 1W2KH 1OS8A 1XKBC 2ZPSA 1C5LH 1A0JA 2BY6X 2KAIA 3SJ8A 4ABAA 3TGJE 4UEHH 1C5SA 1TOCB 1CA8B 4E06H 4UONA 3FFGA 2GDEH 3VXFH 1XM1A 3B8JA 1SB1H 3LH3A 3U98H 4ZMAH 1NFYA 4M7GA 1FY3A 1ESAA 4NG9H 2EC9H 1OWIA 4I7YH 1LHDH 4INKA 3MO3A 2OC7A 1WCZA 1C5MD 3JZ2B 3MI4A 1GI2A 1YPEH 3D62A 2TIOA 3RU4T 3ZVCA 1EOLA 2ZHFH 1C5NH 5EU8A 1UMAH 1D6WA 4GHTA 4HI3A 1ANBA 1T8NA 3RMMH 4AN7A 3RMOH 4RSPA 2ZDAH 5F8XA 4BAOB 3DHKH 2BY5X 1ZSKA 2J38A 1MZAA 1XUKA 3ODFA 1HRTH 1ETSH 1JMOH 1BMLA 1ZPCA 4CREA 4XBBA 1PPEE 3QO6A 2ZU5A 3SU4A 1S84A 3AAVA 3GYMA 4X8VH 1ABIH 2BM2A 1TPSA 1T31A 5C5OA 4IN2A 1Z1IA 1TMUH 2SFAA 1SGNE 3MU8A 5C20A 6LPRA 3NWUA 4YM9A 1V2PT 2ZECA 1T7CA 1IQMA 1A4WH 3EA7A 1O5DH 3A85A 2OBQA 2FTMA 1GBKA 1Y3XA 3ZZ3A 1EZQA 1LVYA 1TIOA 1T4UH 3SV7A 1G3EA 4LZ4B 3CS7A 1BTPA 5AHGH 5GDSH 2ZDMA 1EPTC 1O5FH 2VNTA 1O3BA 2V35A 4IN1A 4OS5A 5JB8S 3ZVDA 4X1NU 1MAYA 2ZHWH 1P2MA 3K65B 4J2YB 4UFFH 2C8ZB 5K7RA 2P8OB 1BITA 2XYAA 1O2HA 4DURA 3Q3XA 3P70B 3KQEA 4ZHAA 1BTZA 1QGFA 2XBYA 1OKXA 2FXRA 4U2WA 3A7YA 2SGDE 2TPIZ 1S85A 2A5AA 1N8OB 1W8BH 1TA6A 4NIVA 4WMEA 1KTSB 1DUEA 1GHZA 2BD4A 3IG6B 2A7CA 2GCTC 2H9TH 1Y5AT 3UOUA 4UE7H 2Y5HA 1NFWA 3A8AA 4FUBA 2ALVA 2FO9A 3FP6E 1AGJA 4NWLA 1SBWA 1AN1E 4ZHMU 1O2YA 1P11E 3H5CB 3FP8E 4H6SB 1AZZA 3STIA 2Z6BD 1V6DA 4FU8A 3LGYA 1GBDA 1NRRH 1UK2A 3RXUA 1CA0C 3HK3B 3BG4B 1YF4A 1OXGA 3QGNB 1K2I1 1DM4B 3M3SA 1CQQA 3LT3A 1ELFA 2UUJB 1QRXA 1PPCE 1A3BH 5FPYA 2G5VA 1Y5UT 3UR9A 5IYTA 1GHVH 5L2ZH 1ZHRA 2Q6GA 3VEQB 1F5RA 2GZ8A 2ULLA 1PPZA 3BSQA 1AFQB 3TU7H 3SUGA 2AIPA 1FNIA 2CF8H 1L0ZA 1BRCE 2NU2E 4JK6A 1AB9B 1MQ5A 4WMDA 5E0JA 4ABHA 4A1XA 1ELEE 3K6YA 2WPHS 1C2IA 2ZCLP 4CR5A 2WINI 4O3UA 2ZF0H 5DP3A 5GCHF 1BMAA 3D49H 3EA9A 1ANEA 3GY7A 3MNSA 3QDZB 1F0TA 1QBOA 1EZUC 1NN6A 2IJOB 2GMTC 1L4ZA 1NPMA 4H42U 3FANA 2W7SA 1NZQH 3QN7A 2A5IA 1BCUH 1O34A 1SGTA 2ZI2H 1CGJE 2IOTA 4LOYH 3BTME 1TNIA 1YCPM 2BDGA 2A5KA 1QQ4A 1S83A 2G00A 4GLYA 4GSOA 1WSSH 4JCNA 2ZU1A 1O3GA 2OD3B 4KP0A 1Z1JA 4BAKB 3Q77A 1SC8U 2P3FH 3QGJA 2VU8E 4JYTA 1UJ1A 2QV1A 2CHAB 2OBOA 2FX6A 2Z3EA 5JDUB 3P8OA 1HLTH 4NFEA 1MKXH 2A4OA 3SU0A 4ISLA 2ZG0H 4ISOA 1C5VA 1WYKA 2GZ9A 3NCLA 2Y6TA 1ANCA 4E05H 3RXJA 1LHFH 1TGNA 3I77A 3ITIA 1SHYA 5JBTA 2HPQH 1UTPA 3OY6U 1QL9A 5C3NA 1O5GH 3PO1B 1RRKA 2VVVA 2FOAA 1BRAA 2ZTZA 3BN9A 1TNHA 4MNXA 1GHYH 2A45B 5C5NA 1TB6H 2ZHDA 3NKKA 2FOBA 3ZZ8A 1HGTH 1EASA 4GVUA 3EA8A 4FUDA 4I33A 1HAOH 3HATH 1HAYB 1ZSJA 1PJPA 5C2ZA 2BOHB 3LGTA 2FIRH 4GHQA 4DCDA 6CHAB 3S7HB 1SGIB 2ANKH 3BTHE 4ABEA 1HIAA 4NIYA 1GBLA 1BA8B 5E0GA 1W0YH 1GPZA 1WUNH 3UNSA 3UFAA 2DE9A 3TH4H 2H6MA 4LK4A 1S6HA 2BXTH 1O2JA 1P2JA 3BTKE 1ELCA 1HAPH 1CT4E 5EXMA 1RD3B 2Y7ZA 1BQYA 3RXIA 2PKSB 4FUIA 1O2IA 1WOFA 3M5OA 2V0BA 4FXGH 5A2MH 5DP4A 1GJDB 2VB0A 2ZDLA 1AU8A 4X8TH 3AAUA 1Q3XA 1ZGVA 5AFZH 1IQGA 1LPZB 1YLCA 4TPYA 1V2ST 4AGKA 4FUGA 3E0NB 3G01A 2VJ1A 4Y8ZA 3ZZ7A 2ZGCA 2XCFA 2ZQ2A 4ZKNU 5ABWA 2GCTB 1C1NA 3SU2A 1DLEA 1AKSB 3V3MA 4XBDA 1KXFA 1THSH 1DFPA 3SN8A 1P57B 4K1TA 2A2XH 2Y80A 1E36B 1UVOA 2F3CE 2VH6A 5F8TA 1EAXA 1YBWA 2Y81A 1FJSA 3Q3YA 5FPSA 1KXAA 1CA0B 2PR3A 1V2TT 2QCYA 1QA0A 1BRBE 5E2OA 2G4UA 2C4FH 1GMHF 2Q6DA 3RXQA 2F83A 3KCGH 2HRVA 4DJZB 1J9CH 3HGPA 4X1SU 5JYIA 1GL0E 4ABBA 1BHXB 1P2OA 1Y59T 1QCPA 1EXFA 5F03A 1G37A 3PLBA 1F0SA 2FTLE 2XRCA 1SG8B 3S7KB 1BUIA 1C2HA 3OYPA 5FCKA 1NU9A 1HAVA 5EW1H 5I46H 1EPTA 2IN2A 3QK1A 1UTKA 2R2WU 3C1KA 3SNDA 1OYQA 1IQLA 4I8GA 2BDYA 5L30H 1KSNA 1LMWB 3MWIU 3OTJE 2FI3E 1QRWA 2BD3A 1GDQA 2BD9A 1GBJA 4JYVH 1UHBA 1DPOA 2ZFTA 1AIXH 1BB0B 2GKVE 3TIUA 1IOEA 3LJOA 3S9BA 4TY6A 3LOXA 1GBBA 1V2KT 1RFNA 3RUOA 4HFPB 4O97A 2FOFA 1KYNA 1O3EA 4WF8A 3BTFE 3RXBA 2ZFFH 2G51A 2BX3A 5HM9A 2PGBB 1H8IH 6ESTA 1SQAA 1O2XA 3C27B 1K21H 1WAYB 4AB9A 4D76A 3DFJA 3FVFB 4ISNA 4X6OA 2PKAB 3W95A 1GMCF 1P3CA 1RTLA 1FY5A 2EEKA 2D1JA 3F9GA 1CGHA 3P6ZB 1FZZA 2V6NA 1THPB 1GI5A 3QZQA 2CGAA 4NZLA 5CE1A 1T32A 2PTNA 5FXLA 3TH2H 1MBMA 3PMHB 1GBCA 2DE8A 2BD5A 1GMDG 2BQWB 1VJ9U 3M3VA 1K1LA 1O2QA 1UCYK 2B0FA 4BNRA 2WPLS 3BF6H 1C5WB 3Q00A 4BAHB 1MTNB 1OWHA 1LDTT 2BZ6H 3AW0A 5C67A 3O8CA 2PTCE 3HGNA 4B2CA 2JH0D 1LTOA 3SO3A 4AFZA 3CP7A 2CXVA 1GHXH 5BPEA 2PV9B 1GJCB 1O33A 3SQEE 2VVUA 3RU4D 2G55A 1C9TA 4F49A 2Z9IA 1J17T 2AGGX 1E0FD 1VITH 1C2EA 4K3JA 3E91A 2ZGJA 7GCHF 2WV5A 1BT7A 1FN8A 2P3TB 2R0KA 1IQHA 1W0ZU 3RXSA 1FPHH 2KAIB 1DWEH 3TK9A 2P93A 3LH1A 1DVAH 4AGJA 4YOJA 5DP6A 3T26A 1BZXE 1SSXA 1EOJA 1O2NA 4SGBE 1OWDA 3RLYH 1MCTA 3RXOA 4OS6A 1H9LB 3ATKA 3RXCA 4AG1A 1FN6A 2GT8A 2BYAX 3N7OA 1S5SA 1C5UA 1ZJDA 4MTBA 3I78A 4NA9H 2FPZA 3MYWA 3R3GB 4ZAEA 1CHOF 1O2PA 1P03A 1BTWA 3RU4E 2CN0H 4J1YA 1K9OE 4UDWH 4E7NA 1SQTA 3VGCB 2AERH 1EJNA 1Y8TA 4DGJA 2R3YA 4FUFA 1FY4A 1V2QT 1L1NA 2WPKS 2BDHA 2FS8A 5LH8A 5JBAS 1NFXA 2XC4A 1ZOMA 4MPWA 3M7QA 2OQ5A 2UWPA 3F6UH 1ZZZA 1S6FA 1GMCG 2GP9B 3GDVA 2STBE 1JBUH 2A4QA 3PLPA 1GDNA 1G2LA 1BMMH 2FI4E 3MH7A 1W14U 2F9VA 4X8SH 2BOKA 5TJXA 3A8CA 1BBRE 1E35B 3E6PH 1LVBA 4WXIA 4X2XA 3SU1A 3ELAH 1OPHB 1D6RA 1DLKB 1SMFE 1LO6A 3OSYA 3BTTE 1K1JA 2FOHA 4BTTB 4I8HA 1O3FA 3DUXH 1KXEA 7ESTE 1L2EA 3SU3A 3ZZ5A 1JIRA 4RN6A 4BXSA 5JPMH 3SGQE 2W7UA 1XX9A 3ZZAA 3SNBA 3TJOA 1S0RA 3ATMA 1TE0A 5A8XA 1B5GH 1G3CA 2VWMA 1T8OA 3GDUA 1W10U 1O3MA 1TPPA 2BX4A 4UFGH 2ZEBA 5C1XA 3LPRA 1ARCA 4B73A 1UO6A 2OQUA 3M5LA 3ZZCA 2BLWA 2UWLA 4QT8C 1XXDA 2NU3E 2ZU3A 1G3BA 2BDBA 2HLCA 1P06A 7GCHG 1V2MT 4Y76A 1VGCC 1THRH 2TRMA 3PROA 1RXPA 1ELAA 2ASUB 3PWBA 1ELBA 3SHAH 2TBSA 1LQDB 1QNJA 2HNTF 1XXFA 1Z8IB 1BOQA 1HCGA 2FDAA 2CV3A 1F2SE 2R0LA 3P92A 2AGIX 4CRFA 3VXEH 2OC1A 1RS0A 5C1UA 5EW2H 3A82A 5EPNA 1G32B 2VWOA 5HXFA 1GJ5H 2OC0A 4X8UH 1C1OA 3IWMA 5E2PA 2GCHF 1C1MA 3SV2H 4SGAE 1CHOG 1KXCA 2FMJA 4YZUA 1BTXA 1EP6A 2BB4A 2GV7A 4OS7A 1NRQH 5DO4H 5DP7A 4MNVA 3SI3H 2H5CA 1O2WA 1LKBA 5GIBA 3A80A 1BTHH 4YLQH 4BTIB 1TX8A 4CHAC 2ZDNA 1AVXA 1SFIA 2VH0A 5DPAA 1W11U 3SU6A 4CR9A 1P0SH 1PPBH 3T29A 2O8UA 2RDLA 1UVUH 1GGDC 2QIQA 2SGFE 3LC5A 1RIWC 2XBVA 1A2CH 1WU1A 4MQAA 3SUDA 3SV9A 3S0NA 3MO6A 2BY9X 3FP7E 2FEQH 1V2OT 3NZIA 4IBLH 2Y82A 2ZTYA 4YO9A 2JETB 1TQ0B 1BDAA 1DWBH 2J95A 5DGJA 1TAWA 4X1PU 1NU7B 5F8ZA 4IW4E 2ZGHA 1DSUA 1KDQA 4NA8A 2FESH 4B71A 2P16A 1L4DA 4CBNA 1GCTB 2WYJA 1SR5C 1UTQA 2WUCA 1KXDA 1VITF 2GT7A 2I6SA 4Y6DA 3TJVA 1DANH 3LONA 1SGDE 3PTBA 3MU5A 1O2MA 1ZMNA 1Z7KA 1UVSH 3MNXA 3RC6A 1SOTA 4OGXA 1YPHC 3BIVH 2LNCA 1W3CA 3AASA 3RP2A 1SGFG 1Y3VA 2AYWA 4AFUA 2JH6D 2PHBA 2VIVA 1ZTLA 3UTUH 1ETRH 4HZHA 1SVPA 3QX5H 4OS1A 4K2YA 4D8NA 1DWDH 5A8ZA 2A7JA 2ZWLH 3PMJA 4XBCA 3PWCA 1GJ8B 2UWOA 1HV7A 5AVDA 2QAAA 4ZKSU 3LC3A 1MAXA 1MKWK 2PLXA 4ZHLU 2BDIA 1J14A 2ZGXH 1PYTC 4ISIH 1CE5A 3D23A 4NFFA 1MTWA 2BY7X 5EXLA 2VIDA 4KTUA 1IQEA 4FUHA 3MO9A 1C1UH 4YOIA 3K9XB 4A92A 1TBZH 1O39A 3T28A 5ESBA 2GCHG 2B9LA 2BVRH 6GCHF 1QR3E 3O8RA 2VWLA 1SL3A 1QA7A 1CBWB 2V3HH 1GJ7B 1VCQA 3UOPA 4Q2KA 1CT0E 3RXVA 1P2NA 2QN5T 2Z3DA 1HAXB 1O2TA 5H4IB 1YPJH 2RA3A 3DA9B 1TRMA 3ZZ4A 2CMYA 2TGPZ 5BRRE 1YP9A 2FODA 1XMNB 1JIMA 4MPUA 2IPHA 1NM6A 3PTNA 2B5TB 2YOLA 1FONA 1SLXB 3SV8A 3KIDU 1V2WT 2RA0A 4U32A 3LU9B 1C1TA 1F7ZA 2C93B 5EPYA 4ABIA 1NRPH 3ZVEA 1PFXC 1HIAB 2XWBI 3K2UA 3ZVBA 1DS2E 3ZZ6A 1KTTB 1DXWA 2ZGBH 3A7VA 1ZRBA 3M36A 4NCYA 3SW2B 1B7XB 3O8BA 3B23B 1DICA 3TK5A 1TNJA 1KLIH 2FOEA 3KN2A 1XUJA 2OCVB 4X6PA 2GTBA 4XE4A 1AO5A 1NRSH 2R9PA 2ZA5A 3NPSA 1XVOA 1O3PB 3A86A 1GI1A 1VGCB 1C1PA 1VITG 5GPIB 1DWCH 9ESTA 2VIPA 1SFQB 3R0FA 5CHAC 1K28D 1GBAA 3SZNA 2F91A 3BTWE 3TNSA 2XC5A 4XOJA 2J92A 1TYNA 4K69A 4NWKA 4DW2U 3DD2H 1ZTJA 1C2KA 1A5GH 4KKDA 2ANMH 4U30A 3T5FH 4GPGA 3GY4A 2O8MA 2J2UA 3MHWU 4A5TS 2GDDA 3UQVA 4FU9A 1OP8A 3TVJB 3HKJB 3SUFA 4B2AA 1J8AA 5DP5A 1XUGA 3L33A 3U8OH 1DE7H 1LQEA 1SLUB 1GG6C 4VGCC 1GI4A 1IHSH 1C2LA 1TNGA 3M5NA 1DDJA 2P94A 2ZFPH 3UQOA 4CHAB 3OY5U 1E37B 3FAOA 1JOUB 3UPEA 1BJVA 6GCHG 1O2LA 2G52A 1AY6H 2VIWA 4I8KA 1MTVA 3U9AH 1GHBF 2ZFSA 1C1WH 1O5CB 1EQ9A 3LGIA 1QB9A 1A0HB 2PW8H 3L6PA 1J15A 2VWNA 3RXLA 4A7IB 3MMGA 4BTUB 4JZ1A 1QL7A 1MMJN 3SNEA 1HAVB 1HAHH 2ZKSA 1EPTB 1ZTKA 1T8MA 8GCHF 3GICB 4ABFA 3SOSA 3U1IB 2FLRH 4Q7XA 2YNBA 1XUIA 4DVAU 4U01A 2SNWA 1GVZA 1OSSA 1Q2WA 2GX4A 1A61H 3GCNA 3TLOA 2HVXA 1WV7H 1GBHA 1RGQA 4YTAA 4LZ1H 1UHBB 1LHCH 4YT6H 1L1JA 4MLFB 1YPKH 4IC5A 2K1QA 4I31A 2UUFB 4I32A 3V13A 1Z8RA 1HJAC 1F5KU 3FZZA 4ZUHA 1UTJA 1PQAA 3B9FH 1TQ7B 1UCYH 5HM2A 4IGDA 1GMDF 1SLWB 2P95A 1GI7B 3GDSA 1LHGH 2BVXH 5L6NH 1INCA 2BDAA 2GGVB 5DP9A 5FPTA 3F9FA 4UD9H 1EB1H 1QHRB 1YPMH 4AB8A 3MU0A 1UVTH 4Y71A 1S81A 2BDCA 2XWAA 3PYHA 4NGAH 2SNVA 3ZVGA 3MH6A 1TRYA 4TPIZ 4Y7BA 4CRDA 1Z8JB 1C2GA 2WPJS 5EGMA 3TJNA 2ANWA 1K1OA 1AD8H 1P3EA 1T4VH 3PMAB 3SGAE 2HNTC 2VVCA 3LDXH 3K6ZA 1YKTA 1FY1A 1TOMH 2H1UA 3V0XA 4O3TA 4UFEH 1OP2A 1NO9H 3Q3KA 1OWJA 1TABE 1MUEB 3DFLA 3MH5A 2BXUH 3A8DA 2ZCKP 4OGYA 5AFYH 3TPIZ 1HXEH 4YLUA 1W12U 4KTSA 1ORFA 3KL6A 3RLWH 4D7GA 4H6TA 4NSVA 2WV4A 4TWWA 3NXPA 2HWLB 3DT0H 2ODPA 2ZTXA 1O5EH 1GHBG 2O9QA 3TK6A 1O3AA 4INLA 1U6QA 1GI3A 1EAUA 1LVOA 2AMPA 4FUEA 4RKJB 3QUMP 4K1EA 2GMTB 3ATLA 2XBXA 4X2VA 4GUXA 1FI8A 4HTCH 8GCHG 1P09A 1TWXB 3BTDE 2J94A 1MH0A 3RC5A 1BHXF 1ESTA 4PROA 2FLBH 3URDA 3BEUA 1FLEE 1GWAA 2FP7B 1AHTH 4X2WA 4BOHA 1O32A 3V7TA 1XKAC 1C1QA 1CSOE 3QTOH 3T27A 2PSXA 2NU1E 1OP0A 1MZDA 2FM2A 2TGDA 3BEFB 1NT1A 2BD2A 2A31A 1OWEA 1C1VH 1D3QB 5A0BA 1O2GH 3S69A 1ZHPA 2F9UA 1TALA 3SJOA 3S9CA 4X6NA 1V3XA 1EZSC 5G4BA 1GDUA 4MVNA 1AWFH 4DOQA 3MU1A 4NSYA 4ESTE 4Z6AH 1D3TB 2UUYA 3JZ1B 1ACBE 2BLOA 3EAJA 2XTTB 4FVDA 1ARBA 2F9OA 2UUKB 2C8YB 1JXPA 1D4PB 5T6DA 1TMTH 4RKOB 3E8LA 1QFKH 2A2QH 4Y79A 4X1RU 1QURH 3QTVH 1JRSA 2OXSA 1ID5H 4JK5A 4YT7H 1WTGH 4WWYA 1RJXB 2DUCA 3NUMA 2WPIS 1O5BB 5DP8A 2D8WA 1GBMA 4BANB 4IMZA 3U8RH 1P02A 1Z71A 2W3KA 1PQ7A 2G81E 1BTUA 7LPRA 1QB1A 1YCPK 1C1RA 4LXBH 1HDTH 2PSYA 1C5TA 2Z9KA 3MNBA 4WJG2 3GY8A 1GCDA 3PLKA 4OS2A 5J4QA 3A7WA 2H5DA 3RC4A 1RTKA 2PWXA 4A1VA 2QYIA 1F5LA 1C1SA 1SGPE 2O8WA 3RDZA 1CT2E 4B74A 1KLTA 2P59A 5EXNA 1SI5H 2A32A 3RXKA 4KTCA 2AIQA 4ABGA 1ELDE 2ILNA 1IQJA 1J16A 3LGVA 3A7ZA 1AWHB 3M35A 3QZRA 2XNIA 1FQ3A 1HXFH 1DITH 1TFXA 2H9HA 1HJAB 4GAWA 2STAE 1QJ6B 3BG4C 2HPPH 2QA9E 4NIWA 4AZ2B 3P8GA 2Z3CA 1QY6A 3VB7A 2BTCE 1TLDA 4CRCA 2OTVA 1A46H 1NY22 3KGPA 1TGSZ 1Y3WA 1H4WA 4WH6A 1AVGH 2FX4A 3BTGE 3EYDA 1UTMA 1C9PA 1G30B 3V12A 2I6QA 2C3SA 4BAMB 3HKIB 3UNRA 2XW9A 3GYLB 1P2IA 3SV6A 1Z6JH 2THFB 1HYLA 1B0EA 1CGIE 1CHGA 3ATWA 2ZPQA 1AB9C 2R2MB 1XUFA 1MTUA 2PUQH 3ZZDA 5A0AE 5LGOA 4CRBA 1ELGA 3VPKA 1SOZA 5GWZA 3GCTF 4WVPE 3QLPH 1PPGE 1GJ4H 1AVWA 1KY9A 2XXLA 3PMBB 1KIGH 4Y8XA 5T6GA 3O8DA 2ESTE 5JB9S 2A0QB 3VB6A 4WH8A 1D3PB 5FBIA 2HALA 4ZXYH 1TONA 1V2RT 1P10A 4DY7B 2WYGA 1MTSA 3T25A 1FPCH 1KDQB 1NESE 5LPEA 1GJ6A 2C8XB 1EATA 2M5TA 1EX3A 1ZSLA 4A6LA 1MKWH 3F1SB 4BXWA 1W7XH 3A7XA 3U1JB 4DT7B 4DIIH 1ZMLA 5GJ4B 5FBEA 3OX7U 3KNXA 1IAUA 3RXEA 1O2RA 2D26C 1PQ5A 3F9EA 4ABDA 1PYTD 3M7UA 3VB4A 1P04A 3GY6A 2CHAC 5FAHA 2ZIQH 2WUBA 1GJAB 3BEIB 3NK8A 3UY9A 2ALPA 4TWYA 5I25A 1K1NA 1O3JA 3WY8A 4B76A 3SJKA 4TY7A 4K60A 3ZV8A 4D9RA 4R0IA 1C5QA 1GBFA 1YPHE 1SGFA 1FDPA 1FXYA 2OINA 1O2OA 1N6XA 1AFEH 1GBEA 1O3IA 3PO1C 5FHTA 1KXBA 1NC6A 1HFDA 1Y3YA 1YLDA 1P9UA 3GCOA 1P05A 3VB3A 4FVBA 2QXJA 4INHA 2ZO3H 1O37A 1NTPA 3EE0B 3HK6B 2O8TA 1WBGB 1UTLM 4AORA 2QC2A 1BBRH 1XVMA 3UWIA 3A89A 2ZU4A 3RM2H 1HAZB 4AFQA 8LPRA 3KQCA 2BD7A 2Z9JA 6CHAC 2ZNKH 4WMFA 2A1DB 1ZYOA 2FYQA 3URCA 1B0FA 1ESBA 1S82A 1ZHMA 3P17H 1FIZA 3GISB 4B2BA 4WY3A 3SJIA 5FCRA 2W5EA 3MU4A 2AS9A 1ETTH 1TMBH 2V3OH 4MPVA 2ZQ1A 2A4RA 1GI8B 2R3UA 2Z9LA 1K1PA 2FYRA 1EZXC 2VIQA 3GCTG 2PKSC 2A4GA 2A7HA 1EP5A 2VIOA 2FI5E 1AQ7A 1IQKA 1SQOA 1E34B 2FOCA 2ODQA 3MNCA 2P3UB 3CENA 5DJ7A 3RXAA 3T62A 2ZCHP 1ELVA 1TBRH 1A0LA 3ATIA 3D65E 4E7RG 2NWNA 3MOCA 5TCAA 1BIOA 3PB1E 5EODA 2H2ZA 2C90B 4NA7A 5PTPA 1AMHA 5FX6A 3SGBE 4XFQA 3SORA 3RMLH 4ZKRU 8KME2 1O2SA 2HGTH 4ABJA 4AYVB 4FUJA 1LHEH 1PPHE 3BTQE 3ZZBA 3TGIE 2NU4E 1P2QA 1C5ZB 3GCHC 3H7TA 2ZFQH 1MD7A 2BLVA 4I8JA 2O8LA 3EQ0H 2JKHA 3KF2A 2FOMB 5AF9H 4Q80A 2FOGA 2PGQB 4MDSA 3ZZ9A 4Z0KA 2EI8A 2C8WB 1SPJA 1C2DA 2EA3A 2CJIA 1FMGA 2GD4B 3M7TA 1G2MA 1GHWH 4K8BA 5B6OA 3H7OA 1IQFA 1F0RA 1UK4A 1FAXA 1SGYE 5A0CA 1AUTC 5EQSA 1PPFE 1QB6A 1NRNH 1G36A 2AH4X 1TBQH 1WTHD 3BV9B 2EI7A 2BVSH 1ZPZA 4JZDH 1SHHB 4X6MA 1O3DA 3SU5A 1P8VC 3A7TA 1CO7E 2G4TA 1BBRK 2QF3A 1WQSA 4Y0ZE 1GHAF 3SHCH 1GJ9B 1QIXB 3SQHE 3BIUH 1VR1H 3SJ9A 2TGAA 4FUCA 4JZEH 1F0UA 2NU0E 4ZROA 4XSKU 3A81A 4AG2A 3TH3H 5EQRA 1VJAU 3SNCA 2F9BH 1O3LA 2GV6A 2J9NA 4CBOA 5HGGA 3KQDA 4X1QU 1O5AB 1QRZA 4D7FA 3ENSB 1UTOA 3L3TA 2OLGA 2Y7XA 3GOVB 1ZLRA 1C4Y2 1V2UT 1C5OH 2XBWA 4AFSA 3S9AA 1CVWH 1ZPBA 3AW1A 4K8YA 2Y5FA 4X2YA 4CH2B 1P01A 2G5NA 1YYY1 4AX9H 4MNWA 1T8LA 3I29A 3HPTB 1UCYE 1PQ8A 5CMXH 1GVKB 1C2MA 3W94A 1TNLA 1P9SA 1ZR0A 3RM0H 1H1BA 2AMDA 5ESTE 3RMNH 3TNTA 1LCYA 3LGWA 3SUEA 2W3IA 5LPFA 1QJ7B 1SGEE 3M61U 3MH4A 1MTNC 2ZFRH 1E38B 1UK3A 1HPGA 2FZZA 2AGEX 4AYYB 5L2YH 1MU8B 4ZH8A 1VCWA 3BG8A 5EQQA 2PFEA 1H8DH 1HAIH 3RXGA 1GGDB 1NS3A 3RXDA 1SGQE 2AEIH 1NFUA 1RIWB 1Y3UA 1G3DA 2TGTA 3M37A 1OWKA 1L1GA 5DKMA 3T2NA 1IQIA 2QXIA 2Z9GA 3IITA 2W26A 2FWWA 3P95A 1GVLA 1N6YA 1LVMA 3STJA 5T6FA 4KELA 3E1XB 1N1LA 2HNTE 4O9VA 1JWTA 4DG4A 1LKAA 1XUHA 1V2JT 3F68H 3GY3A 1A5HA 1P2KA 2QXHA 3A88A 3UNQA 4IMQA 1F92A 4THNH
chains in the Genus database with same CATH superfamily
3MFJA 1C2FA 1TGBA 1D9IA 1ZRKA 2H9EH 2EY4C 1GHAG 1TA2A 3Q76A 1DXPA 2ZU2A 2BY8X 5GCHG 1O0DH 4YESB 4I8LA 1LPGB 1Y5BT 1TGTA 1O2ZA 2SGQE 2ZDKA 1BMNH 1ZJKA 2GZ7A 3VGCC 1YPLH 1C2JA 2VINA 4BAQB 1C5XB 3PV4A 4YOGA 4D9QA 3DCLA 1FIWA 1QTFA 3PM3A 5EG4A 3M5MA 3LGUA 1FUJA 4TT3D 4F48B 4B1TA 2VGCC 5FX5A 1FY8E 1TGCA 1FV9A 7KMEH 4JZFH 1EAWA 3FZDA 3ZYEA 1HNEE 2RG3A 5IDKA 1M9UA 4JYUH 1SLVB 5DK1A 1JRTA 1IHTH 1TRNA 2RCEA 1AE5A 2SGAA 1GI9B 1A5IA 2XNDD 1O30A 2JH5D 1YCPH 2K0QA 1DY9A 1YGCH 4MG3A 3LIWA 1OYTH 5E8EH 1G9IE 1GI0A 3AVZA 3GCHB 1BTYA 1C5PA 1YM0A 1TPOA 1H9HE 1RTFB 3FOAA 2B8OH 2XOKD 3A83A 5JBCS 1EKBB 1C5YB 4Y10E 4KGAA 1MKXK 1TX7A 2XC0A 4H4FA 1A1RA 1HB0B 1O2KA 3ESTA 1X7AC 1UTNA 4Q7ZA 1SGRE 1HAGE 3KEEA 1C4U2 2BQ6B 3RXRA 1QL8A 1W0KD 4IC6A 1QZ8A 5K0HA 4Q7YA 9LPRA 3QWCH 4ASHA 1A3EH 1DT2A 2AFQB 1HJ8A 1V2VT 1MQ6A 3RXTA 3LKWA 3U8TH 2LPRA 1MCVA 2Y5GA 4XDEA 1QQUA 3RXFA 1A7SA 3E16B 4CRGA 2QY0B 1WQVH 1MD8A 4ZXXH 3TJUA 2BQ7B 4MPXA 1DOJA 1V2LT 1DX5M 3PV2A 1EUFA 5JBBS 3CS0A 5T3HA 3UR6A 1O3CA 4Y7AA 1P12E 1ANDA 2BZAA 4ZKOU 1AI8H 3VFEA 1AKSA 2PUXB 3U69H 4ISHH 1O31A 3ZV9A 4B75A 3ZVAA 3SI4H 4WXVA 3UWJH 2ANYA 5E0HA 4R8TB 2ZDVH 4FU7A 2ZP0H 2J97A 5ETXA 4GCHF 5CHAB 1NROH 5EJZA 2EI6A 1C4V2 5C1YA 2ZC9H 2QXGA 3TITA 4UFDH 3GY2A 3F0PA 1YPGH 1QBNA 1W7GH 1GL1A 1GJBB 3ZYDA 3M3TA 5A8YA 1QBVH 1EAIA 4K5ZA 2Z7FE 4HGCA 8ESTE 1HUTH 3SNAA 1DSTA 2YNAA 3N7EA 5HMAA 3RXPA 4DIHH 1O2UA 2J34A 1LPKB 1BJUA 3P8FA 1DUAA 2QGRA 1K1MA 3P8NA 1W13U 1O3HA 1ABJH 1D3DB 4K1SA 1GG6B 2OC8A 2SGEE 4VGCB 3EDXB 1EB2A 2JETC 2Z94A 4AOQA 1HJ9A 5SGAE 1S0QA 4JMYA 5LPRA 1K22H 2QF0A 2P8OC 5HYOA 2D2DA 1O35A 3OU0A 3SYJA 2ZHQH 3GY5A 4NZQA 2J4IA 4F4OC 1GMHG 3UREA 4MNYA 1GCTC 1H9IE 2GVFA 1K1IA 1EJMA 3F9HA 5EOKA 1DY8A 1N8OC 5C0UA 1QJ1B 3A87A 1OOKB 4IS5A 3UUZA 1GI6A 2B7DH 1O3NA 3KHVA 4Y8YA 5KGOA 1O38A 2BMGB 3E3TA 1UVPA 1O3OA 2BLQA 1O3KA 2Q6FA 1Q31A 4FOUC 1ZMJA 2PKAA 3RXMA 2ODYB 2YMSB 3BTEE 1CU1A 2OP9A 3LJJA 1TNKA 1SGCA 2FS9A 1HBTH 4JZIA 3E90B 2XCNA 1TPAE 2F9PA 1Z6EA 1MU6B 3N99A 1Z8GA 1KLJH 5F6MA 1O2VA 3EGKH 3E0PB 3UIRA 1YC0A 3TGKE 4TYDA 5A09A 1VZQH 1TX6A 3ZVFA 1VCPA 3MTYA 1MBQA 1SQRA 2OUAA 1C5RA 4OM9A 3VB5A 1IQNA 4CH8B 3A8BA 1AUJA 2BD8A 2F9NA 2ZPRA 5GNDA 1ZGIA 5GXPA 4GCHG 4OS4A 2VGCB 3A84A 1AFQC 3F2GA 1FAKH 4CRAA 5TCCA 1CBWC 2AMQA 4X0WU 1AE8H 1OX1A 2ZHEH 5DG6A 3GS9A 2K8IA 4Y0YE 3KQBA 1V2NT 2Q1JA 2CF9H 2SGPE 1GBTA 2HOBA 2J5UA 2WPMS 1EJAA 2ZZUH 4A1TA 1ELTA 4O03A 1O36A 2KZ4A 4Y11E 2G8TA 3SBKA 3ODDA 1AZ8A 4NIXA 3RXHA 2BHGA 5J4SA 1BRUP 1GBIA 1W2KH 1OS8A 1XKBC 2ZPSA 1C5LH 1A0JA 2BY6X 2KAIA 3SJ8A 4ABAA 3WW7A 3TGJE 4UEHH 5HKKD 1C5SA 1TOCB 1CA8B 4E06H 4UONA 5HIYA 3FFGA 2GDEH 3KQ5A 3VXFH 1XM1A 3B8JA 1SB1H 3UB0A 1WDIA 3LH3A 3U98H 4ZMAH 1NFYA 4M7GA 1FY3A 1ESAA 4NG9H 2EC9H 1OWIA 4I7YH 1LHDH 4INKA 3MO3A 2OC7A 1WCZA 1C5MD 3JZ2B 3MI4A 1GI2A 1YPEH 3D62A 2TIOA 3RU4T 3ZVCA 1EOLA 2ZHFH 1C5NH 5EU8A 1UMAH 1D6WA 4GHTA 4HI3A 1ANBA 1T8NA 2QE7D 3RMMH 4AN7A 3RMOH 5CDFE 4RSPA 2ZDAH 5F8XA 4BAOB 3DHKH 2BY5X 1ZSKA 2J38A 1MZAA 1XUKA 4Q63A 3ODFA 1HRTH 1ETSH 1JMOH 1BMLA 1ZPCA 4CREA 4XBBA 1PPEE 3QO6A 2ZU5A 3SU4A 1S84A 3AAVA 3GYMA 4X8VH 1ABIH 2BM2A 2IPQX 1OHHD 1TPSA 1T31A 5C5OA 2KCYA 4IN2A 1Z1IA 1TMUH 2SFAA 1SGNE 3MU8A 5C20A 6LPRA 3NWUA 4YM9A 1V2PT 2ZECA 1T7CA 1IQMA 1A4WH 3EA7A 1O5DH 3A85A 2OBQA 2FTMA 3WWFA 1GBKA 1Y3XA 3ZZ3A 1EZQA 1LVYA 1TIOA 1T4UH 3SV7A 1G3EA 4LZ4B 3CS7A 1BTPA 5AHGH 5GDSH 2ZDMA 2CK3D 1EPTC 1O5FH 2VNTA 1O3BA 2V35A 4IN1A 4OS5A 5JB8S 3ZVDA 4X1NU 1MAYA 2ZHWH 1P2MA 3K65B 4J2YB 4UFFH 2C8ZB 5K7RA 2P8OB 1BITA 2XYAA 1O2HA 4DURA 3Q3XA 3P70B 4XRNA 3KQEA 4ZHAA 1BTZA 1QGFA 2XBYA 1OKXA 2FXRA 4U2WA 3A7YA 2SGDE 2TPIZ 1S85A 2A5AA 1N8OB 1W8BH 2PP6A 1TA6A 4NIVA 4WMEA 1KTSB 1DUEA 1GHZA 2BD4A 3IG6B 2A7CA 2GCTC 2H9TH 1Y5AT 3UOUA 4UE7H 2Y5HA 1NFWA 3A8AA 4FUBA 2ALVA 2FO9A 3FP6E 1AGJA 4NWLA 1SBWA 1AN1E 4ZHMU 1O2YA 1P11E 3H5CB 3FP8E 4H6SB 1AZZA 3STIA 4ACBA 2Z6BD 1V6DA 3PRDA 4FU8A 2L74A 3LGYA 1GBDA 1NRRH 1UK2A 3RXUA 1CA0C 3HK3B 3BG4B 1YF4A 1OXGA 3QGNB 1K2I1 1DM4B 3M3SA 1CQQA 3LT3A 1ELFA 2UUJB 1QRXA 1PPCE 1A3BH 5FPYA 2G5VA 1Y5UT 3UR9A 5IYTA 1GHVH 5L2ZH 1ZHRA 2Q6GA 3VEQB 1F5RA 2GZ8A 2ULLA 1PPZA 3BSQA 3NRLA 1AFQB 3TU7H 4Z1MD 1NBMD 3SUGA 2AIPA 1FNIA 2CF8H 1L0ZA 2V3MA 1BRCE 2NU2E 4JK6A 1AB9B 1MQ5A 4WMDA 5E0JA 4ABHA 4A1XA 1ELEE 3K6YA 2WPHS 1C2IA 2ZCLP 4CR5A 2YMSD 2WINI 4O3UA 2ZF0H 5DP3A 5GCHF 1BMAA 3D49H 3EA9A 1ANEA 3GY7A 3MNSA 3QDZB 1F0TA 2W6JD 3AK5A 1QBOA 1EZUC 1NN6A 2IJOB 2GMTC 1L4ZA 1NPMA 3WWBA 4H42U 3FANA 2QF4A 2W7SA 3OEED 1NZQH 3QN7A 2A5IA 1BCUH 1O34A 1SGTA 2ZI2H 3PV5A 1CGJE 2IOTA 4LOYH 5CHBA 3BTME 1TNIA 1YCPM 2BDGA 2A5KA 1QQ4A 1S83A 2G00A 4GLYA 1NBME 4GSOA 1WSSH 4JCNA 2ZU1A 1O3GA 2OD3B 4KP0A 1Z1JA 4BAKB 3Q77A 1SC8U 2P3FH 3QGJA 2VU8E 4JYTA 1UJ1A 2QV1A 2CHAB 2OBOA 2FX6A 2Z3EA 5JDUB 3P8OA 1HLTH 4NFEA 1MKXH 2A4OA 3SU0A 4ISLA 2ZG0H 4ISOA 1C5VA 1WYKA 2GZ9A 3NCLA 2Y6TA 1ANCA 4E05H 3RXJA 1LHFH 1TGNA 3I77A 3ITIA 1SHYA 5JBTA 2HPQH 1UTPA 3OY6U 1QL9A 5C3NA 1O5GH 3PO1B 1RRKA 2VVVA 2J98A 2FOAA 1BRAA 2ZTZA 3BN9A 1TNHA 4MNXA 1GHYH 4XD7D 2A45B 5C5NA 1TB6H 2ZHDA 3NKKA 1FX0B 2FOBA 3ZZ8A 1HGTH 1EASA 2M2AA 4GVUA 3EA8A 2QF5A 4FUDA 4I33A 1HAOH 3HATH 1HAYB 1ZSJA 1PJPA 5C2ZA 2BOHB 3LGTA 2FIRH 4GHQA 4DCDA 6CHAB 3S7HB 1SGIB 2ANKH 3BTHE 4ABEA 1HIAA 4NIYA 1GBLA 1BA8B 5E0GA 1W0YH 1GPZA 1WUNH 3UNSA 3UFAA 2DE9A 3TH4H 2H6MA 3OFND 4LK4A 1S6HA 2BXTH 1O2JA 1P2JA 3BTKE 1ELCA 1HAPH 1CT4E 4B6FA 5EXMA 1RD3B 2Y7ZA 1BQYA 3RXIA 3U28C 2PKSB 4FUIA 1O2IA 2WPDD 1WOFA 3M5OA 2L6OA 5EJLA 2V0BA 4FXGH 5A2MH 5DP4A 1GJDB 2VB0A 2ZDLA 5DSFA 1AU8A 4X8TH 3AAUA 1Q3XA 1ZGVA 5AFZH 1IQGA 1LPZB 1YLCA 4TPYA 1V2ST 4AGKA 4FUGA 3E0NB 3G01A 2VJ1A 4Y8ZA 3ZZ7A 2ZGCA 2XCFA 2ZQ2A 4ZKNU 5ABWA 2GCTB 1C1NA 3SU2A 1DLEA 1AKSB 3V3MA 4XBDA 1KXFA 1THSH 1DFPA 3SN8A 1P57B 4K1TA 2A2XH 2Y80A 1E36B 1UVOA 2F3CE 2VH6A 5F8TA 1EAXA 1YBWA 2Y81A 1FJSA 3Q3YA 5FPSA 1KXAA 1CA0B 2PR3A 1V2TT 2QCYA 1QA0A 1BRBE 5E2OA 2G4UA 2C4FH 1GMHF 2Q6DA 3RXQA 2AHME 2EQNA 2F83A 3KCGH 2HRVA 2VBCA 4DJZB 1J9CH 3HGPA 4X1SU 5JYIA 1GL0E 4ABBA 1BHXB 1P2OA 1Y59T 1QCPA 1EXFA 5F03A 1G37A 3PLBA 1F0SA 2FTLE 2XRCA 1SG8B 3S7KB 1BUIA 1C2HA 3OYPA 5FCKA 1NU9A 1HAVA 5EW1H 5I46H 1EPTA 2IN2A 3QK1A 1UTKA 2R2WU 3C1KA 3SNDA 1OYQA 1IQLA 4I8GA 2BDYA 5L30H 1KSNA 1LMWB 3MWIU 3OTJE 2FI3E 1QRWA 2BD3A 1GDQA 2BD9A 1GBJA 4JYVH 1UHBA 1DPOA 2ZFTA 1AIXH 1BB0B 2GKVE 3TIUA 1IOEA 3LJOA 3S9BA 4TY6A 3LOXA 3MQKC 1GBBA 1V2KT 1RFNA 3RUOA 4HFPB 4O97A 2FOFA 1KYNA 1O3EA 4WF8A 3BTFE 3RXBA 2ZFFH 2G51A 2BX3A 5HM9A 2PGBB 1H8IH 2RDEA 6ESTA 1SQAA 1O2XA 2F4LA 3C27B 1K21H 1WAYB 4AB9A 4D76A 3DFJA 3FVFB 4ISNA 4X6OA 2PKAB 3W95A 1GMCF 1P3CA 1RTLA 1FY5A 2EEKA 2D1JA 3F9GA 1CGHA 3P6ZB 1FZZA 2V6NA 1THPB 1GI5A 3QZQA 2CGAA 4NZLA 5CE1A 1T32A 2PTNA 5FXLA 3TH2H 1MBMA 3PMHB 1GBCA 2DE8A 2BD5A 1GMDG 2BQWB 1VJ9U 3M3VA 1K1LA 1O2QA 1UCYK 2B0FA 4BNRA 2WPLS 3BF6H 1C5WB 3Q00A 4BAHB 1MTNB 1OWHA 1LDTT 2BZ6H 3AW0A 5C67A 3O8CA 2PTCE 3HGNA 4B2CA 2JH0D 1LTOA 3SO3A 4AFZA 3CP7A 2CXVA 1GHXH 1YLNA 4YXWD 5BPEA 2PV9B 2IJD1 1GJCB 1O33A 3SQEE 5FL7D 2VVUA 3RU4D 2G55A 1C9TA 4F49A 2Z9IA 1J17T 2LELA 4P02A 2AGGX 1E0FD 1VITH 1C2EA 4K3JA 3E91A 2ZGJA 7GCHF 2WV5A 1BT7A 1FN8A 2P3TB 2R0KA 1IQHA 1W0ZU 3RXSA 1FPHH 2KAIB 1DWEH 3TK9A 2P93A 3LH1A 1DVAH 1KMHB 4AGJA 4YOJA 5DP6A 3T26A 1BZXE 1SSXA 1EOJA 1O2NA 4SGBE 1OWDA 3RLYH 1MCTA 3RXOA 4OS6A 1H9LB 3W1EA 3ATKA 3RXCA 4AG1A 1FN6A 2GT8A 2BYAX 3N7OA 1S5SA 1C5UA 1ZJDA 4MTBA 3I78A 4NA9H 2FPZA 3MYWA 3R3GB 4ZAEA 1CHOF 1O2PA 1P03A 1BTWA 1MABB 3RU4E 2CN0H 3F2HA 4J1YA 5C17A 1K9OE 4UDWH 4E7NA 1SQTA 3VGCB 2AERH 1EJNA 1Y8TA 4DGJA 2R3YA 4FUFA 1FY4A 1S6LA 1V2QT 1L1NA 2WPKS 2BDHA 2FS8A 5LH8A 1YWUA 5JBAS 1NFXA 2XC4A 1ZOMA 4MPWA 3M7QA 2OQ5A 2UWPA 3F6UH 1ZZZA 1S6FA 1GMCG 2GP9B 3GDVA 2STBE 2JJ2D 1JBUH 2A4QA 3PLPA 1GDNA 1G2LA 1BMMH 3PRBA 2FI4E 3MH7A 1W14U 2F9VA 3KYGA 4X8SH 2BOKA 5TJXA 3A8CA 1BBRE 1E35B 3E6PH 1LVBA 2F43B 4WXIA 4X2XA 3SU1A 3ELAH 1OPHB 1D6RA 1DLKB 1SMFE 1LO6A 4ACAA 3OSYA 3BTTE 1K1JA 2FOHA 4BTTB 4I8HA 1O3FA 3DUXH 1KXEA 7ESTE 1L2EA 3SU3A 3ZZ5A 1JIRA 4RN6A 4BXSA 5JPMH 3SGQE 2W7UA 1XX9A 3ZZAA 3SNBA 3TJOA 1S0RA 3ATMA 1TE0A 5A8XA 1B5GH 1G3CA 2VWMA 1T8OA 3GDUA 1W10U 1O3MA 1TPPA 2BX4A 4UFGH 2ZEBA 3KYFA 5C1XA 3LPRA 1ARCA 4B73A 1UO6A 2OQUA 3M5LA 3ZZCA 2BLWA 1H8ED 2UWLA 4QT8C 1XXDA 2NU3E 2ZU3A 1G3BA 2BDBA 2HLCA 1P06A 3UAIC 7GCHG 1V2MT 4Y76A 1VGCC 1THRH 2TRMA 3PROA 1RXPA 1ELAA 2ASUB 3PWBA 1ELBA 3SHAH 2TBSA 1LQDB 1QNJA 2HNTF 1XXFA 1Z8IB 1BOQA 1HCGA 2JJ1D 2FDAA 2CV3A 1F2SE 2R0LA 3P92A 2AGIX 4CRFA 3VXEH 2OC1A 1RS0A 5C1UA 5EW2H 3A82A 5EPNA 1G32B 2VWOA 5HXFA 1GJ5H 2OC0A 4X8UH 1C1OA 3IWMA 5E2PA 2GCHF 1C1MA 3SV2H 4SGAE 1CHOG 1KXCA 2FMJA 4YZUA 1BTXA 1EP6A 2BB4A 2GV7A 4OS7A 1NRQH 5DO4H 5DP7A 4MNVA 3SI3H 2H5CA 1O2WA 1LKBA 5GIBA 3A80A 1BTHH 4YLQH 1K0HA 4BTIB 1TX8A 4CHAC 2ZDNA 1AVXA 1SFIA 2VH0A 5DPAA 1W11U 3SU6A 4CR9A 1P0SH 1PPBH 3T29A 2O8UA 2RDLA 1UVUH 1GGDC 2QIQA 2SGFE 3LC5A 1RIWC 2XBVA 1A2CH 1WU1A 4MQAA 3SUDA 3SV9A 3S0NA 3MO6A 2BY9X 3FP7E 2FEQH 1V2OT 3NZIA 4IBLH 2Y82A 2ZTYA 4YO9A 2JETB 1TQ0B 1BDAA 1DWBH 2J95A 5DGJA 4P00A 1TAWA 4ASUD 4X1PU 1NU7B 5F8ZA 4IW4E 2ZGHA 1DSUA 1KDQA 4NA8A 2FESH 4AC9A 4B71A 2P16A 1L4DA 4CBNA 1GCTB 2WYJA 1SR5C 1UTQA 2WUCA 1KXDA 2WSSD 1VITF 2GT7A 2I6SA 4Y6DA 3TJVA 1DANH 3LONA 1SGDE 3PTBA 3MU5A 1O2MA 1ZMNA 1Z7KA 1UVSH 3MNXA 3RC6A 1SOTA 4OGXA 1YPHC 3BIVH 2LNCA 1W3CA 3AASA 4B6EA 3RP2A 1SGFG 1Y3VA 2AYWA 4AFUA 2JH6D 2PHBA 2VIVA 1ZTLA 3OE7D 3UTUH 1ETRH 4HZHA 1SVPA 3QX5H 4OS1A 4K2YA 4D8NA 1DWDH 5A8ZA 2A7JA 2ZWLH 3PMJA 4XBCA 3PWCA 1GJ8B 2UWOA 1HV7A 5AVDA 2QAAA 4ZKSU 3LC3A 1MAXA 1MKWK 2PLXA 4ZHLU 2BDIA 2V7QD 1J14A 2ZGXH 1PYTC 4ISIH 1CE5A 3D23A 2KR7A 4NFFA 1MTWA 2BY7X 5EXLA 2VIDA 4KTUA 1IQEA 4FUHA 3MO9A 1C1UH 4YOIA 3K9XB 4A92A 1TBZH 1O39A 3T28A 5ESBA 5EIYA 2GCHG 2JIZD 2B9LA 2BVRH 6GCHF 1QR3E 3O8RA 2VWLA 1SL3A 1QA7A 1CBWB 2V3HH 1GJ7B 4IMQA 3SZEA 1VCQA 3OEHD 3UOPA 4Q2KA 1CT0E 3RXVA 1P2NA 2QN5T 2Z3DA 1HAXB 1O2TA 2J98B 5H4IB 1YPJH 3VG8A 2RA3A 3DA9B 1TRMA 3ZZ4A 2CMYA 2TGPZ 5BRRE 3CNRA 1YP9A 2FODA 1XMNB 1JIMA 4MPUA 2IPHA 1NM6A 3PTNA 2B5TB 2YOLA 1FONA 1SLXB 3SV8A 3KIDU 1V2WT 2GJGA 2RA0A 4U32A 3LU9B 1C1TA 1F7ZA 2C93B 3F0OA 5EPYA 1NRPH 4ABIA 3ZVEA 1PFXC 1HIAB 2XWBI 3K2UA 3ZVBA 1DS2E 3ZZ6A 1KTTB 1DXWA 2ZGBH 3A7VA 1ZRBA 3M36A 4NCYA 3SW2B 1B7XB 3O8BA 3B23B 1DICA 3TK5A 1TNJA 1KLIH 2FOEA 3KN2A 1XUJA 2OCVB 4X6PA 2GTBA 4XE4A 1AO5A 1NRSH 2R9PA 2ZA5A 3NPSA 1XVOA 1O3PB 3A86A 1GI1A 1VGCB 1C1PA 1VITG 5GPIB 1DWCH 9ESTA 2VIPA 1SFQB 3R0FA 5CHAC 1K28D 1GBAA 3SZNA 2F91A 3BTWE 3TNSA 2XC5A 4XOJA 1VKYA 2J92A 1TYNA 4K69A 4NWKA 4DW2U 3DD2H 1ZTJA 1C2KA 1A5GH 4KKDA 2ANMH 4U30A 3T5FH 4GPGA 3GY4A 2O8MA 2J2UA 3MHWU 4A5TS 2GDDA 3UQVA 4FU9A 1OP8A 3TVJB 3HKJB 3DSGA 3SUFA 4B2AA 1J8AA 5DP5A 1XUGA 3L33A 3U8OH 1DE7H 1LQEA 1SLUB 1GG6C 4VGCC 1GI4A 1IHSH 1C2LA 1TNGA 3M5NA 1DDJA 2P94A 2ZFPH 3UQOA 4CHAB 3OY5U 1E37B 3FAOA 1JOUB 4RT1A 3UPEA 1BJVA 6GCHG 1O2LA 2G52A 1AY6H 2VIWA 4I8KA 1MTVA 3U9AH 1GHBF 2ZFSA 1C1WH 1O5CB 1EQ9A 3LGIA 2KCAA 1QB9A 1A0HB 2PW8H 3L6PA 1J15A 2VWNA 3RXLA 4A7IB 3MMGA 4BTUB 4JZ1A 1QL7A 1MMJN 3SNEA 1HAVB 1HAHH 2ZKSA 1EPTB 1ZTKA 1T8MA 8GCHF 3GICB 4ABFA 3SOSA 3U1IB 2FLRH 4Q7XA 2YNBA 1XUIA 4DVAU 4U01A 2SNWA 1GVZA 1OSSA 1Q2WA 2GX4A 1A61H 3GCNA 3TLOA 2HVXA 1WV7H 1GBHA 1RGQA 4YTAA 4LZ1H 2HVYB 1UHBB 1LHCH 4YT6H 1L1JA 4MLFB 1YPKH 4IC5A 2K1QA 4I31A 2UUFB 4I32A 3V13A 1Z8RA 1HJAC 1F5KU 3FZZA 4ZUHA 1UTJA 1PQAA 3B9FH 1TQ7B 1UCYH 5HM2A 4IGDA 1GMDF 1SLWB 2KFWA 1GI7B 2P95A 3GDSA 1LHGH 2BVXH 5L6NH 1INCA 2BDAA 2GGVB 5DP9A 4RI0A 5FPTA 3F9FA 4UD9H 1EB1H 1QHRB 1YPMH 4AB8A 3MU0A 1UVTH 4Y71A 5C94A 1S81A 2BDCA 2XWAA 3PYHA 4NGAH 2SNVA 3ZVGA 3MH6A 1TRYA 4TPIZ 4Y7BA 4CRDA 5DN6D 1Z8JB 1C2GA 2WPJS 5EGMA 3TJNA 2ANWA 1K1OA 1AD8H 1P3EA 1T4VH 3PMAB 3SGAE 2HNTC 2VVCA 3LDXH 3K6ZA 1YKTA 1FY1A 1TOMH 2H1UA 4RT0A 3V0XA 4O3TA 4UFEH 1OP2A 1NO9H 4HG6A 3Q3KA 1OWJA 1TABE 1MUEB 3DFLA 3MH5A 2BXUH 3A8DA 4M9FA 2ZCKP 4OGYA 5AFYH 3TPIZ 1HXEH 4YLUA 5C0TA 1W12U 4KTSA 1ORFA 3KL6A 3RLWH 4D7GA 4H6TA 4NSVA 2WV4A 3FN8A 4TWWA 2KCPA 3NXPA 2HWLB 3DT0H 2ODPA 2ZTXA 1O5EH 1GHBG 2O9QA 3TK6A 1O3AA 4INLA 1U6QA 1GI3A 1EAUA 1LVOA 1UW7A 2AMPA 4FUEA 4RKJB 3QUMP 4K1EA 2GMTB 3ATLA 2XBXA 4X2VA 4GUXA 1FI8A 1SKYE 4HTCH 8GCHG 2W6ID 1P09A 1TWXB 3BTDE 2J94A 1MH0A 3RC5A 1BHXF 1ESTA 4PROA 2FLBH 3URDA 3BEUA 1FLEE 1GWAA 2FP7B 1AHTH 4X2WA 4BOHA 1O32A 3V7TA 1XKAC 1C1QA 1CSOE 3QTOH 3T27A 2PSXA 2NU1E 1OP0A 1MZDA 2FM2A 2TGDA 2HLDD 3BEFB 1NT1A 2BD2A 3OTPA 2A31A 1OWEA 2LP6A 1C1VH 1D3QB 5A0BA 1O2GH 2OK5A 3S69A 1ZHPA 2F9UA 1TALA 3SJOA 3S9CA 4X6NA 4I86A 1V3XA 1EZSC 5G4BA 1GDUA 4MVNA 1AWFH 4DOQA 3MU1A 4NSYA 2RFKC 4ESTE 4Z6AH 1D3TB 2UUYA 3JZ1B 1ACBE 2BLOA 3EAJA 2XTTB 4FVDA 1ARBA 1E1RD 2F9OA 2UUKB 2C8YB 1JXPA 1D4PB 5T6DA 1TMTH 4RKOB 3E8LA 1QFKH 2A2QH 4Y79A 4X1RU 1QURH 3QTVH 1JRSA 2OXSA 1ID5H 4JK5A 4YT7H 1WTGH 4WWYA 1RJXB 5IK2D 2DUCA 3NUMA 2WPIS 1O5BB 5DP8A 2D8WA 1GBMA 4BANB 4IMZA 3U8RH 1P02A 1Z71A 2W3KA 1PQ7A 2G81E 1BTUA 7LPRA 1QB1A 1YCPK 1C1RA 4LXBH 1HDTH 2PSYA 1C5TA 2Z9KA 3MNBA 4WJG2 3GY8A 1GCDA 3PLKA 4OS2A 5T1VA 5J4QA 3A7WA 1W0JD 2H5DA 3RC4A 1RTKA 2PWXA 4A1VA 2QYIA 1F5LA 1C1SA 1SGPE 2O8WA 3RDZA 1CT2E 4B74A 1KLTA 2P59A 5EXNA 1SI5H 2KCOA 2A32A 3RXKA 4KTCA 2JDID 2AIQA 4ABGA 1ELDE 2ILNA 1IQJA 1J16A 3LGVA 3A7ZA 1AWHB 3M35A 3QZRA 2XNIA 1FQ3A 1HXFH 1DITH 1TFXA 2H9HA 1HJAB 4GAWA 2STAE 1QJ6B 3BG4C 2HPPH 2QA9E 4NIWA 4AZ2B 3P8GA 2Z3CA 1QY6A 3VB7A 2BTCE 1EFRD 1TLDA 4CRCA 2OTVA 1A46H 1NY22 3KGPA 1TGSZ 1Y3WA 1H4WA 4WH6A 1AVGH 2FX4A 3BTGE 3EYDA 1UTMA 1C9PA 1G30B 3V12A 2I6QA 2C3SA 4BAMB 3HKIB 3UNRA 2XW9A 3GYLB 1P2IA 3SV6A 1Z6JH 2THFB 1HYLA 1B0EA 1CGIE 1CHGA 3ATWA 2ZPQA 1AB9C 2WZQA 3FKSD 2R2MB 1XUFA 1MTUA 2PUQH 3ZZDA 5A0AE 5LGOA 4CRBA 1ELGA 3VPKA 1SOZA 5GWZA 3GCTF 4WVPE 3QLPH 1PPGE 1GJ4H 1AVWA 1KY9A 2XXLA 3PMBB 3F2FA 1E79D 1KIGH 4Y8XA 5T6GA 3O8DA 3OAAD 2ESTE 5JB9S 2A0QB 5KECA 3VB6A 4WH8A 1D3PB 5FBIA 2HALA 4ZXYH 1TONA 1V2RT 1P10A 4DY7B 2WYGA 1MTSA 3T25A 1FPCH 1KDQB 1NESE 5LPEA 1GJ6A 2C8XB 1EATA 2M5TA 1EX3A 1ZSLA 4A6LA 4Q4LA 1MKWH 3F1SB 4BXWA 1W7XH 3A7XA 3U1JB 4DT7B 4DIIH 1ZMLA 5GJ4B 5FBEA 3OX7U 3KNXA 1IAUA 3RXEA 1O2RA 2D26C 1PQ5A 3F9EA 4ABDA 3F3BA 1COWD 1PYTD 3M7UA 3VB4A 1P04A 3GY6A 2CHAC 5FAHA 2ZIQH 2WUBA 1WXRA 5B6LA 1GJAB 3BEIB 3DSOA 3NK8A 3UY9A 2ALPA 4TWYA 5I25A 1K1NA 1O3JA 3WY8A 4B76A 3SJKA 4TY7A 4K60A 3ZV8A 4D9RA 4R0IA 1C5QA 1GBFA 1YPHE 1SGFA 1FDPA 1FXYA 2OINA 1O2OA 1N6XA 1AFEH 1GBEA 1O3IA 1YY3A 3N7DA 3PO1C 5FHTA 1KXBA 1NC6A 1HFDA 1Y3YA 1YLDA 1P9UA 3GCOA 1P05A 3VB3A 4FVBA 2QXJA 4INHA 2ZO3H 1O37A 1NTPA 3EE0B 3HK6B 2O8TA 1WBGB 1UTLM 4AORA 2QC2A 1BBRH 1XVMA 3UWIA 3A89A 2ZU4A 3RM2H 1HAZB 5F53A 4AFQA 8LPRA 3KQCA 2BD7A 2Z9JA 6CHAC 2ZNKH 4WMFA 2A1DB 1ZYOA 2FYQA 3URCA 3ZIAD 1B0FA 1ESBA 1S82A 1ZHMA 3P17H 1FIZA 3GISB 4B2BA 4WY3A 1E1QD 3SJIA 5FCRA 2W5EA 3MU4A 2AS9A 1ETTH 1TMBH 2V3OH 4MPVA 2ZQ1A 2A4RA 1GI8B 2R3UA 2Z9LA 1K1PA 2FYRA 1EZXC 2VIQA 3GCTG 2PKSC 2A4GA 2A7HA 1EP5A 2VIOA 2FI5E 1AQ7A 1IQKA 1SQOA 1E34B 2FOCA 2ODQA 3MNCA 2P3UB 3CENA 4FETA 5DJ7A 3RXAA 3T62A 2ZCHP 1ELVA 1TBRH 1A0LA 3ATIA 3D65E 4E7RG 2NWNA 3MOCA 5TCAA 3H09A 1BIOA 3PB1E 5EODA 2H2ZA 2C90B 4NA7A 5PTPA 1AMHA 5FX6A 3SGBE 4XFQA 3SORA 3RMLH 4ZKRU 8KME2 1O2SA 2HGTH 4ABJA 4AYVB 4FUJA 1LHEH 1PPHE 3BTQE 3ZZBA 3TGIE 2NU4E 1P2QA 1C5ZB 3GCHC 3H7TA 2ZFQH 1MD7A 2BLVA 4I8JA 2O8LA 3EQ0H 2JKHA 3KF2A 2FOMB 5AF9H 4Q80A 2FOGA 2PGQB 4MDSA 3EE7A 3ZZ9A 4ZCNA 4Z0KA 2EI8A 2C8WB 1SPJA 1C2DA 2EA3A 2CJIA 1FMGA 2GD4B 3M7TA 1G2MA 1GHWH 3FO8D 4K8BA 5B6OA 3H7OA 1IQFA 1F0RA 1UK4A 1FAXA 1SGYE 5A0CA 1AUTC 5EQSA 1PPFE 1QB6A 1NRNH 1G36A 2AH4X 1TBQH 1WTHD 3BV9B 2EI7A 2BVSH 1ZPZA 4JZDH 1SHHB 4X6MA 1O3DA 3SU5A 1P8VC 3A7TA 1CO7E 2G4TA 1BBRK 2QF3A 5EJ1A 1WQSA 4Y0ZE 1GHAF 3SHCH 1GJ9B 4F55A 1QIXB 3SQHE 3BIUH 1VR1H 3SJ9A 2TGAA 4FUCA 4JZEH 1F0UA 2KM0A 2NU0E 4ZROA 4XSKU 3A81A 4AG2A 3TH3H 5EQRA 1VJAU 3SNCA 2F9BH 1O3LA 2GV6A 2J9NA 4CBOA 5HGGA 3KQDA 4X1QU 1O5AB 1QRZA 4D7FA 3ENSB 1UTOA 3L3TA 5HIZA 2OLGA 1BMFD 2Y7XA 3GOVB 1ZLRA 1C4Y2 1V2UT 1C5OH 2XBWA 4AFSA 3S9AA 1CVWH 1ZPBA 3AW1A 4K8YA 2Y5FA 4X2YA 4CH2B 1P01A 2G5NA 1YYY1 4TSFD 4AX9H 4MNWA 1T8LA 3I29A 3HPTB 1UCYE 1PQ8A 5CMXH 1GVKB 1C2MA 3W94A 1TNLA 1P9SA 1ZR0A 3RM0H 1H1BA 2AMDA 5ESTE 3RMNH 3TNTA 1LCYA 3LGWA 3SUEA 2W3IA 5LPFA 1QJ7B 3DSPA 2WV9A 1SGEE 3M61U 3MH4A 1MTNC 2ZFRH 4DT4A 1E38B 1UK3A 1HPGA 2FZZA 1H8HD 2AGEX 2WHXA 4AYYB 5L2YH 1MU8B 4ZH8A 2KX4A 1VCWA 3BG8A 5EQQA 2PFEA 1H8DH 1HAIH 3RXGA 1GGDB 1NS3A 3RXDA 1SGQE 2AEIH 1NFUA 1RIWB 1Y3UA 1G3DA 2TGTA 3M37A 1OWKA 1L1GA 5DKMA 3T2NA 1IQIA 2QXIA 2Z9GA 3IITA 2W26A 2FWWA 3P95A 1GVLA 1N6YA 1LVMA 3STJA 5T6FA 4KELA 3E1XB 1N1LA 2HNTE 4O9VA 1JWTA 5KEDA 4DG4A 1LKAA 1XUHA 1V2JT 3F68H 3GY3A 1A5HA 1P2KA 2QXHA 3A88A 3UNQA 2YMSC 1F92A 4THNH
chains in the Genus database with same CATH topology
3MFJA 1C2FA 1TGBA 1D9IA 1ZRKA 2H9EH 1GHAG 1TA2A 3Q76A 1DXPA 2ZU2A 2BY8X 5GCHG 1O0DH 4YESB 4I8LA 1LPGB 1Y5BT 1TGTA 1O2ZA 2SGQE 2ZDKA 1BMNH 1ZJKA 2GZ7A 3VGCC 1YPLH 1C2JA 2VINA 4BAQB 1C5XB 3PV4A 4YOGA 4D9QA 1FIWA 1QTFA 3PM3A 5EG4A 3M5MA 3LGUA 1FUJA 4B1TA 2VGCC 5FX5A 1FY8E 1TGCA 1FV9A 7KMEH 4JZFH 1EAWA 3FZDA 3ZYEA 1HNEE 2RG3A 5IDKA 1M9UA 4JYUH 1SLVB 5DK1A 1JRTA 1IHTH 1TRNA 2RCEA 1AE5A 2SGAA 1GI9B 1A5IA 1O30A 2JH5D 1YCPH 1DY9A 1YGCH 4MG3A 3LIWA 1OYTH 5E8EH 1G9IE 1GI0A 3AVZA 3GCHB 1BTYA 1C5PA 1YM0A 1TPOA 1H9HE 1RTFB 2B8OH 3A83A 5JBCS 1EKBB 1C5YB 4Y10E 4KGAA 1MKXK 1TX7A 2XC0A 4H4FA 1A1RA 1HB0B 1O2KA 3ESTA 1X7AC 1UTNA 4Q7ZA 1SGRE 1HAGE 3KEEA 1C4U2 2BQ6B 3RXRA 1QL8A 4IC6A 5K0HA 4Q7YA 9LPRA 3QWCH 4ASHA 1A3EH 1DT2A 2AFQB 1HJ8A 1V2VT 1MQ6A 3RXTA 3LKWA 3U8TH 2LPRA 1MCVA 2Y5GA 4XDEA 1QQUA 3RXFA 1A7SA 3E16B 4CRGA 2QY0B 1WQVH 1MD8A 4ZXXH 3TJUA 2BQ7B 4MPXA 1DOJA 1V2LT 1DX5M 1EUFA 5JBBS 3CS0A 5T3HA 3UR6A 1O3CA 4Y7AA 1P12E 1ANDA 2BZAA 4ZKOU 1AI8H 3VFEA 1AKSA 2PUXB 3U69H 4ISHH 1O31A 3ZV9A 4B75A 3ZVAA 3SI4H 4WXVA 3UWJH 2ANYA 5E0HA 4R8TB 2ZDVH 4FU7A 2ZP0H 5ETXA 4GCHF 5CHAB 1NROH 2EI6A 1C4V2 5C1YA 2ZC9H 2QXGA 3TITA 4UFDH 3GY2A 1YPGH 1QBNA 1W7GH 1GL1A 1GJBB 3ZYDA 3M3TA 5A8YA 1QBVH 1EAIA 4K5ZA 2Z7FE 4HGCA 8ESTE 1HUTH 3SNAA 1DSTA 2YNAA 5HMAA 3RXPA 4DIHH 1O2UA 2J34A 1LPKB 1BJUA 3P8FA 1DUAA 2QGRA 1K1MA 3P8NA 1W13U 1O3HA 1ABJH 1D3DB 4K1SA 1GG6B 2OC8A 2SGEE 4VGCB 3EDXB 1EB2A 2JETC 2Z94A 4AOQA 1HJ9A 5SGAE 1S0QA 4JMYA 5LPRA 1K22H 2QF0A 2P8OC 5HYOA 2D2DA 1O35A 3OU0A 2ZHQH 3GY5A 4NZQA 2J4IA 4F4OC 1GMHG 3UREA 4MNYA 1GCTC 1H9IE 2GVFA 1K1IA 1EJMA 3F9HA 5EOKA 1DY8A 1N8OC 1QJ1B 3A87A 1OOKB 4IS5A 3UUZA 1GI6A 2B7DH 1O3NA 3KHVA 4Y8YA 1O38A 2BMGB 3E3TA 1UVPA 1O3OA 2BLQA 1O3KA 2Q6FA 1Q31A 1ZMJA 2PKAA 3RXMA 2ODYB 3BTEE 1CU1A 2OP9A 3LJJA 1TNKA 1SGCA 2FS9A 1HBTH 4JZIA 3E90B 2XCNA 1TPAE 2F9PA 1Z6EA 1MU6B 1Z8GA 1KLJH 5F6MA 1O2VA 3EGKH 3E0PB 3UIRA 1YC0A 3TGKE 4TYDA 5A09A 1VZQH 1TX6A 3ZVFA 1VCPA 3MTYA 1MBQA 2OUAA 1C5RA 3VB5A 1IQNA 4CH8B 3A8BA 1AUJA 2BD8A 2F9NA 2ZPRA 1ZGIA 5GXPA 4GCHG 4OS4A 2VGCB 3A84A 1AFQC 4CRAA 1FAKH 5TCCA 1CBWC 2AMQA 4X0WU 1AE8H 1OX1A 2ZHEH 5DG6A 4Y0YE 3KQBA 1V2NT 2Q1JA 2CF9H 2SGPE 1GBTA 2HOBA 2ZZUH 2WPMS 1EJAA 4A1TA 1ELTA 4O03A 1O36A 4Y11E 2G8TA 3SBKA 3ODDA 1AZ8A 4NIXA 3RXHA 2BHGA 5J4SA 1BRUP 1GBIA 1W2KH 1OS8A 1XKBC 2ZPSA 1C5LH 1A0JA 2BY6X 2KAIA 3SJ8A 4ABAA 3TGJE 4UEHH 1C5SA 1TOCB 1CA8B 4E06H 4UONA 3FFGA 2GDEH 3VXFH 1XM1A 3B8JA 1SB1H 3LH3A 3U98H 4ZMAH 1NFYA 4M7GA 1FY3A 1ESAA 4NG9H 2EC9H 1OWIA 4I7YH 1LHDH 4INKA 3MO3A 2OC7A 1WCZA 1C5MD 3JZ2B 3MI4A 1GI2A 1YPEH 3D62A 2TIOA 3RU4T 3ZVCA 1EOLA 2ZHFH 1C5NH 5EU8A 1UMAH 1D6WA 4GHTA 4HI3A 1ANBA 1T8NA 3RMMH 4AN7A 3RMOH 4RSPA 2ZDAH 5F8XA 4BAOB 3DHKH 2BY5X 1ZSKA 2J38A 1MZAA 1XUKA 3ODFA 1HRTH 1ETSH 1JMOH 1BMLA 1ZPCA 4CREA 4XBBA 1PPEE 3QO6A 2ZU5A 3SU4A 1S84A 3AAVA 3GYMA 4X8VH 1ABIH 2BM2A 1TPSA 1T31A 5C5OA 4IN2A 1Z1IA 1TMUH 2SFAA 1SGNE 3MU8A 5C20A 6LPRA 3NWUA 4YM9A 1V2PT 2ZECA 1T7CA 1IQMA 1A4WH 3EA7A 1O5DH 3A85A 2OBQA 2FTMA 1GBKA 1Y3XA 3ZZ3A 1EZQA 1LVYA 1TIOA 1T4UH 3SV7A 1G3EA 4LZ4B 3CS7A 1BTPA 5AHGH 5GDSH 2ZDMA 1EPTC 1O5FH 2VNTA 1O3BA 2V35A 4IN1A 4OS5A 5JB8S 3ZVDA 4X1NU 1MAYA 2ZHWH 1P2MA 3K65B 4J2YB 4UFFH 2C8ZB 5K7RA 2P8OB 1BITA 2XYAA 1O2HA 4DURA 3Q3XA 3P70B 3KQEA 4ZHAA 1BTZA 1QGFA 2XBYA 1OKXA 2FXRA 4U2WA 3A7YA 2SGDE 2TPIZ 1S85A 2A5AA 1N8OB 1W8BH 1TA6A 4NIVA 4WMEA 1KTSB 1DUEA 1GHZA 2BD4A 3IG6B 2A7CA 2GCTC 2H9TH 1Y5AT 3UOUA 4UE7H 2Y5HA 1NFWA 3A8AA 4FUBA 2ALVA 2FO9A 3FP6E 1AGJA 4NWLA 1SBWA 1AN1E 4ZHMU 1O2YA 1P11E 3H5CB 3FP8E 4H6SB 1AZZA 3STIA 2Z6BD 1V6DA 4FU8A 3LGYA 1GBDA 1NRRH 1UK2A 3RXUA 1CA0C 3HK3B 3BG4B 1YF4A 1OXGA 3QGNB 1K2I1 1DM4B 3M3SA 1CQQA 3LT3A 1ELFA 2UUJB 1QRXA 1PPCE 1A3BH 5FPYA 2G5VA 1Y5UT 3UR9A 5IYTA 1GHVH 5L2ZH 1ZHRA 2Q6GA 3VEQB 1F5RA 2GZ8A 2ULLA 1PPZA 3BSQA 1AFQB 3TU7H 3SUGA 2AIPA 1FNIA 2CF8H 1L0ZA 1BRCE 2NU2E 4JK6A 1AB9B 1MQ5A 4WMDA 5E0JA 4ABHA 4A1XA 1ELEE 3K6YA 2WPHS 1C2IA 2ZCLP 4CR5A 2WINI 4O3UA 2ZF0H 5DP3A 5GCHF 1BMAA 3D49H 3EA9A 1ANEA 3GY7A 3MNSA 3QDZB 1F0TA 1QBOA 1EZUC 1NN6A 2IJOB 2GMTC 1L4ZA 1NPMA 4H42U 3FANA 2W7SA 1NZQH 3QN7A 2A5IA 1BCUH 1O34A 1SGTA 2ZI2H 1CGJE 2IOTA 4LOYH 3BTME 1TNIA 1YCPM 2BDGA 2A5KA 1QQ4A 1S83A 2G00A 4GLYA 4GSOA 1WSSH 4JCNA 2ZU1A 1O3GA 2OD3B 4KP0A 1Z1JA 4BAKB 3Q77A 1SC8U 2P3FH 3QGJA 2VU8E 4JYTA 1UJ1A 2QV1A 2CHAB 2OBOA 2FX6A 2Z3EA 5JDUB 3P8OA 1HLTH 4NFEA 1MKXH 2A4OA 3SU0A 4ISLA 2ZG0H 4ISOA 1C5VA 1WYKA 2GZ9A 3NCLA 2Y6TA 1ANCA 4E05H 3RXJA 1LHFH 1TGNA 3I77A 3ITIA 1SHYA 5JBTA 2HPQH 1UTPA 3OY6U 1QL9A 5C3NA 1O5GH 3PO1B 1RRKA 2VVVA 2FOAA 1BRAA 2ZTZA 3BN9A 1TNHA 4MNXA 1GHYH 2A45B 5C5NA 1TB6H 2ZHDA 3NKKA 2FOBA 3ZZ8A 1HGTH 1EASA 4GVUA 3EA8A 4FUDA 4I33A 1HAOH 3HATH 1HAYB 1ZSJA 1PJPA 5C2ZA 2BOHB 3LGTA 2FIRH 4GHQA 4DCDA 6CHAB 3S7HB 1SGIB 2ANKH 3BTHE 4ABEA 1HIAA 4NIYA 1GBLA 1BA8B 5E0GA 1W0YH 1GPZA 1WUNH 3UNSA 3UFAA 2DE9A 3TH4H 2H6MA 4LK4A 1S6HA 2BXTH 1O2JA 1P2JA 3BTKE 1ELCA 1HAPH 1CT4E 5EXMA 1RD3B 2Y7ZA 1BQYA 3RXIA 2PKSB 4FUIA 1O2IA 1WOFA 3M5OA 2V0BA 4FXGH 5A2MH 5DP4A 1GJDB 2VB0A 2ZDLA 1AU8A 4X8TH 3AAUA 1Q3XA 1ZGVA 5AFZH 1IQGA 1LPZB 1YLCA 4TPYA 1V2ST 4AGKA 4FUGA 3E0NB 3G01A 2VJ1A 4Y8ZA 3ZZ7A 2ZGCA 2XCFA 2ZQ2A 4ZKNU 5ABWA 2GCTB 1C1NA 3SU2A 1DLEA 1AKSB 3V3MA 4XBDA 1KXFA 1THSH 1DFPA 3SN8A 1P57B 4K1TA 2A2XH 2Y80A 1E36B 1UVOA 2F3CE 2VH6A 5F8TA 1EAXA 1YBWA 2Y81A 1FJSA 3Q3YA 5FPSA 1KXAA 1CA0B 2PR3A 1V2TT 2QCYA 1QA0A 1BRBE 5E2OA 2G4UA 2C4FH 1GMHF 2Q6DA 3RXQA 2F83A 3KCGH 2HRVA 4DJZB 1J9CH 3HGPA 4X1SU 5JYIA 1GL0E 4ABBA 1BHXB 1P2OA 1Y59T 1QCPA 1EXFA 5F03A 1G37A 3PLBA 1F0SA 2FTLE 2XRCA 1SG8B 3S7KB 1BUIA 1C2HA 3OYPA 5FCKA 1NU9A 1HAVA 5EW1H 5I46H 1EPTA 2IN2A 3QK1A 1UTKA 2R2WU 3C1KA 3SNDA 1OYQA 1IQLA 4I8GA 2BDYA 5L30H 1KSNA 1LMWB 3MWIU 3OTJE 2FI3E 1QRWA 2BD3A 1GDQA 2BD9A 1GBJA 4JYVH 1UHBA 1DPOA 2ZFTA 1AIXH 1BB0B 2GKVE 3TIUA 1IOEA 3LJOA 3S9BA 4TY6A 3LOXA 1GBBA 1V2KT 1RFNA 3RUOA 4HFPB 4O97A 2FOFA 1KYNA 1O3EA 4WF8A 3BTFE 3RXBA 2ZFFH 2G51A 2BX3A 5HM9A 2PGBB 1H8IH 6ESTA 1SQAA 1O2XA 3C27B 1K21H 1WAYB 4AB9A 4D76A 3DFJA 3FVFB 4ISNA 4X6OA 2PKAB 3W95A 1GMCF 1P3CA 1RTLA 1FY5A 2EEKA 2D1JA 3F9GA 1CGHA 3P6ZB 1FZZA 2V6NA 1THPB 1GI5A 3QZQA 2CGAA 4NZLA 5CE1A 1T32A 2PTNA 5FXLA 3TH2H 1MBMA 3PMHB 1GBCA 2DE8A 2BD5A 1GMDG 2BQWB 1VJ9U 3M3VA 1K1LA 1O2QA 1UCYK 2B0FA 4BNRA 2WPLS 3BF6H 1C5WB 3Q00A 4BAHB 1MTNB 1OWHA 1LDTT 2BZ6H 3AW0A 5C67A 3O8CA 2PTCE 3HGNA 4B2CA 2JH0D 1LTOA 3SO3A 4AFZA 3CP7A 2CXVA 1GHXH 5BPEA 2PV9B 1GJCB 1O33A 3SQEE 2VVUA 3RU4D 2G55A 1C9TA 4F49A 2Z9IA 1J17T 2AGGX 1E0FD 1VITH 1C2EA 4K3JA 3E91A 2ZGJA 7GCHF 2WV5A 1BT7A 1FN8A 2P3TB 2R0KA 1IQHA 1W0ZU 3RXSA 1FPHH 2KAIB 1DWEH 3TK9A 2P93A 3LH1A 1DVAH 4AGJA 4YOJA 5DP6A 3T26A 1BZXE 1SSXA 1EOJA 1O2NA 4SGBE 1OWDA 3RLYH 1MCTA 3RXOA 4OS6A 1H9LB 3ATKA 3RXCA 4AG1A 1FN6A 2GT8A 2BYAX 3N7OA 1S5SA 1C5UA 1ZJDA 4MTBA 3I78A 4NA9H 2FPZA 3MYWA 3R3GB 4ZAEA 1CHOF 1O2PA 1P03A 1BTWA 3RU4E 2CN0H 4J1YA 1K9OE 4UDWH 4E7NA 1SQTA 3VGCB 2AERH 1EJNA 1Y8TA 4DGJA 2R3YA 4FUFA 1FY4A 1V2QT 1L1NA 2WPKS 2BDHA 2FS8A 5LH8A 5JBAS 1NFXA 2XC4A 1ZOMA 4MPWA 3M7QA 2OQ5A 2UWPA 3F6UH 1ZZZA 1S6FA 1GMCG 2GP9B 3GDVA 2STBE 1JBUH 2A4QA 3PLPA 1GDNA 1G2LA 1BMMH 2FI4E 3MH7A 1W14U 2F9VA 4X8SH 2BOKA 5TJXA 3A8CA 1BBRE 1E35B 3E6PH 1LVBA 4WXIA 4X2XA 3SU1A 3ELAH 1OPHB 1D6RA 1DLKB 1SMFE 1LO6A 3OSYA 3BTTE 1K1JA 2FOHA 4BTTB 4I8HA 1O3FA 3DUXH 1KXEA 7ESTE 1L2EA 3SU3A 3ZZ5A 1JIRA 4RN6A 4BXSA 5JPMH 3SGQE 2W7UA 1XX9A 3ZZAA 3SNBA 3TJOA 1S0RA 3ATMA 1TE0A 5A8XA 1B5GH 1G3CA 2VWMA 1T8OA 3GDUA 1W10U 1O3MA 1TPPA 2BX4A 4UFGH 2ZEBA 5C1XA 3LPRA 1ARCA 4B73A 1UO6A 2OQUA 3M5LA 3ZZCA 2BLWA 2UWLA 4QT8C 1XXDA 2NU3E 2ZU3A 1G3BA 2BDBA 2HLCA 1P06A 7GCHG 1V2MT 4Y76A 1VGCC 1THRH 2TRMA 3PROA 1RXPA 1ELAA 2ASUB 3PWBA 1ELBA 3SHAH 2TBSA 1LQDB 1QNJA 2HNTF 1XXFA 1Z8IB 1BOQA 1HCGA 2FDAA 2CV3A 1F2SE 2R0LA 3P92A 2AGIX 4CRFA 3VXEH 2OC1A 1RS0A 5C1UA 5EW2H 3A82A 5EPNA 1G32B 2VWOA 5HXFA 1GJ5H 2OC0A 4X8UH 1C1OA