1B0EA

Crystal structure of porcine pancreatic elastase with mdl 101,146
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of human neutrophil elastase. 4. Design, synthesis, X-ray crystallographic analysis, and structure-activity relationships for a series of P2-modified, orally active peptidyl pentafluoroethyl ketones.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (ELASTASE)
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1998-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1b0eA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1b0eA01
3P17H 1C2MA 1O3HA 3D62A 4OS7A 2ZHDA 1LPZB 1L4ZA 3EQ0H 3I29A 1TALA 1AFEH 1MQ5A 3LPRA 4R8TB 2QXJA 1YPEH 1GVLA 3NPSA 3P92A 1NZQH 3BTQE 1ZGVA 3SGQE 4ISHH 3VB6A 1A61H 1AIXH 1UTJA 1WBGB 5EQSA 2G52A 2FMJA 3GY6A 1ZPBA 1CBWC 5F03A 2VGCC 1HAOH 1KDQA 1S5SA 4CBOA 5L6NH 1EPTA 3B8JA 1W0YH 4ABIA 5I25A 1Y3UA 3BTGE 1WYKA 3SU1A 5HXFA 3OSYA 3VXEH 1V2OT 2R2WU 1O5BB 1QCPA 1CSOE 2QY0B 1O3MA 1C1VH 1RGQA 2XBVA 3SU2A 3RXOA 3UTUH 1C5TA 3Q77A 3HPTB 3M3TA 1T7CA 2DUCA 3O8DA 4MPUA 2AGEX 3PROA 2HLCA 1K1JA 1ZJKA 7GCHF 4JK6A 3FZDA 3ZZCA 1ACBE 4LZ4B 1FPCH 4U2WA 2AGGX 2UWOA 1Y5BT 1UTMA 1UCYE 2GT8A 1THSH 2VB0A 3EAJA 3DFLA 1O2NA 3LGVA 1OWKA 5C5OA 1IHTH 2BVXH 2Q1JA 1F2SE 1LO6A 4DIHH 1IQHA 1T8NA 3U1IB 1J8AA 3GCHB 3U1JB 1FY4A 1C5OH 1AY6H 1ZHRA 1DX5M 1F7ZA 1LCYA 1GHBG 2ZCHP 3RXGA 1YPJH 2VIWA 5A8XA 4CBNA 2G4UA 3BEFB 2R3UA 4D76A 1TBZH 1O3FA 1HJAB 2Z9KA 2V35A 5DJ7A 1OKXA 2ZP0H 1ABIH 1BUIA 1C1NA 1MKWH 2GCTC 1YKTA 5DKMA 2PR3A 3FVFB 1OYTH 1WQVH 5GPIB 1GHYH 2B8OH 2CV3A 2F9BH 3UNRA 1GJ4H 3P6ZB 2SGFE 1L0ZA 2Z9GA 3Q3KA 4XDEA 4BAKB 1YM0A 3P8OA 3O8RA 4CRAA 3SN8A 2CF9H 2FI3E 4M7GA 1O37A 2VGCB 8KME2 2R0LA 1V2ST 2BVRH 4D9QA 4OS4A 3SUGA 2TBSA 1RTLA 2GV6A 5T6DA 5FPYA 1AI8H 1FDPA 2OD3B 1SOZA 4BTUB 1NPMA 1WV7H 1Q2WA 2JKHA 4GAWA 4VGCC 3ZVCA 1FAKH 1EJMA 1QR3E 5EPYA 4WF8A 5ABWA 4ZAEA 3B9FH 2BXTH 1HAPH 2P3TB 1C1WH 3UPEA 2AMQA 4UEHH 1EAIA 1GCTB 2BXUH 4Y0ZE 1ARBA 4CREA 1HAIH 1HPGA 2BM2A 1UK3A 1TOCB 5LH8A 1OX1A 2I6QA 1S0RA 2BD4A 2BB4A 4ISLA 2WPKS 2EA3A 5C1UA 3AAVA 2B9LA 1BTYA 2ZO3H 3T25A 1GI4A 5L2YH 1XUHA 2OTVA 1C5PA 1O3PB 3PWBA 3MNXA 4FUIA 2OINA 2TPIZ 2FXRA 4Y8XA 6LPRA 3BG8A 1NS3A 1O2HA 1EP5A 1NFUA 1ORFA 4LK4A 3W95A 3OYPA 2ANMH 3GY2A 3W94A 1GJ7B 1YPMH 2ZQ2A 5A09A 1XMNB 1HAHH 3SU6A 1IQIA 3A7WA 4ZXYH 2ZF0H 1C1MA 3R0FA 4LXBH 3MI4A 3DT0H 2GDEH 2V3HH 1EB2A 1F0TA 2HNTC 3F9FA 3RXEA 1BMLA 3BTFE 2STBE 4H42U 3ZYDA 1O32A 3ZVAA 4AB9A 2AS9A 1B0FA 3T27A 1BTXA 1KXDA 2ZPRA 3RXUA 2GZ9A 4NSVA 1ANEA 5C67A 1WUNH 2H9HA 3KCGH 3LGIA 3QTVH 5LPRA 6CHAB 1SGFG 2YNAA 5PTPA 1NRNH 1TNKA 4FUDA 1TNIA 2Z3DA 1BZXE 4U32A 3M7UA 2UWPA 1IQJA 4THNH 2GMTB 3ZVFA 1T31A 3M36A 1YF4A 2AFQB 4B71A 3SUEA 4MLFB 4ABEA 2C4FH 2BTCE 4ABBA 1DM4B 2AERH 4OS1A 1O38A 2XYAA 1C1QA 2QV1A 3A7TA 4K1EA 1XUGA 1VCQA 1O30A 1FI8A 3F1SB 1PPBH 2BX3A 5FXLA 3UREA 3RLYH 1SLUB 3E1XB 3GOVB 4PROA 2Y80A 1FIZA 5JB8S 1FJSA 2ODPA 4YESB 3SU0A 1ZPZA 1CT4E 1DLKB 1G30B 1Z8JB 1SGRE 1Y5UT 4BAHB 2BDHA 3PLKA 1J9CH 3V0XA 2ZTXA 1YLDA 3PV4A 3PB1E 5JPMH 1QL7A 4JZ1A 1IHSH 1N8OB 3CS7A 2FYRA 3ZV8A 2FOCA 3A7YA 5TCCA 4MPXA 1HAVB 1LVYA 1BITA 1ZPCA 4B2AA 3M5MA 3TITA 4XBCA 3URDA 4AFUA 3RXMA 2FLBH 1A5GH 2BZ6H 1JMOH 1AQ7A 3ZZ9A 5GWZA 1UHBA 4D8NA 1HV7A 4UD9H 3L3TA 4Y7BA 1T8LA 5BRRE 1JRSA 1AVXA 1EZUC 2FLRH 2H5DA 3BTTE 1MKXK 3H7TA 4NIWA 1ETRH 1P03A 2QN5T 1TGNA 2ZGHA 3KN2A 5DP4A 2AYWA 3TH4H 1V2TT 4AOQA 1GI5A 1TQ0B 1NESE 1P2IA 4KELA 5F8XA 1TA2A 2PKAA 3HK6B 3E91A 1B5GH 3K2UA 1BTWA 5JBAS 1NRSH 1ZTKA 2XW9A 1T8MA 1D9IA 1FMGA 4UDWH 1P01A 3U69H 1INCA 1HYLA 1V2MT 2ZU5A 2WPIS 4X1PU 4MNWA 2OP9A 1AFQB 2FX4A 4CHAB 1S82A 3FFGA 2ZGBH 5FBIA 5AFYH 1FUJA 1TNJA 2VJ1A 4BANB 3RXRA 1TPAE 3TK9A 1YCPH 1AKSB 4IC5A 3BF6H 3LJOA 1GBMA 1MU6B 4YTAA 1BHXF 1MD7A 2AEIH 1ZJDA 1O3JA 1SQAA 2WUCA 3P8FA 4UFEH 1BDAA 1YBWA 1MZDA 3LONA 1O3AA 3ATMA 4RSPA 1W13U 3URCA 2NU2E 9ESTA 1GBDA 3RU4D 1ELGA 1QNJA 1GGDC 3NCLA 1FIWA 4DCDA 1GVZA 5IYTA 1DWCH 3PLPA 3EYDA 5G4BA 3GCHC 2FOFA 1MCVA 5H4IB 3SNAA 1IQLA 1QBNA 9LPRA 2PFEA 1BRCE 2JETB 1C5SA 5EU8A 1EP6A 3SJKA 3S9BA 4Q2KA 1GBAA 1V2NT 3SO3A 2EEKA 2BD8A 4FUJA 4BTIB 2RA0A 4WVPE 4TY7A 2G81E 2Q6DA 2J94A 3RM0H 4FUBA 3SHAH 1SR5C 2D8WA 5DO4H 1K28D 3E90B 1XUIA 2C93B 3IG6B 1G2LA 2TGAA 1P04A 1AGJA 1ETSH 1ZR0A 1PQAA 1V2WT 1GJ9B 1O2PA 3MHWU 3UR6A 1GL0E 1WSSH 2H6MA 5EPNA 5EXMA 1ELVA 2XTTB 3F68H 2Q6GA 3A80A 1SOTA 4JK5A 1TGBA 4HI3A 2QXHA 1QIXB 1V2UT 1C1TA 1AFQC 5DPAA 4CHAC 2F9NA 4DG4A 1UCYK 2HPQH 4JZEH 3KL6A 3AW0A 1JXPA 1D6WA 1YCPK 1O5EH 1TYNA 2QA9E 3VB4A 1CA8B 4OGYA 2BY7X 1H8IH 1BOQA 4YT7H 4TWYA 1JOUB 3RP2A 4ZROA 2Z94A 1GJ6A 1IQFA 2ZHQH 3E0NB 1O2ZA 4DVAU 2UUYA 3SNDA 4X1RU 3SV6A 4OS2A 3LH1A 2OUAA 4FUGA 4R0IA 1AUTC 1HLTH 1ELCA 1IOEA 1QFKH 2QC2A 3BTKE 2BD3A 3ODDA 4DJZB 4WH8A 1DY9A 1QA7A 2ZDMA 1CU1A 1E0FD 2WV4A 2AIQA 1ANBA 2OBOA 1ZSJA 2FM2A 2WUBA 1MBQA 1A46H 2FS9A 1V6DA 4HGCA 1RFNA 1WTGH 3EA7A 4SGBE 1MTNC 2PGQB 1QB1A 2ZPSA 1BCUH 4JMYA 4BNRA 3TVJB 3PO1B 2XNIA 4NGAH 2JH5D 1ZSKA 1D3TB 2XXLA 1GBIA 1FPHH 1NU7B 1GBBA 1VGCC 3RMLH 2A7JA 1TWXB 4ZKOU 1VJAU 2KAIA 1KXEA 4NG9H 2XWBI 2Y7ZA 4K2YA 2O9QA 1RRKA 3T29A 4CH2B 1W12U 2XCFA 2ZIQH 1H9HE 3C27B 1QJ6B 4ZUHA 2GV7A 1C9PA 1DANH 1EXFA 1H9LB 2F3CE 1HIAB 2ZWLH 3Q00A 3TH2H 1BTHH 1AKSA 2CXVA 2GDDA 1OYQA 2A4GA 5T6FA 3M5NA 2CF8H 2R2MB 2C8YB 2XC0A 2ZGXH 1MTVA 2W3KA 1HAXB 3ZZBA 2GMTC 4UFGH 1NT1A 2ZU3A 4X1SU 3MO9A 1GG6C 3MH7A 1DWBH 3A7XA 1O33A 1O31A 3V3MA 5CMXH 2FESH 3S0NA 1HUTH 4YOJA 1RIWC 2VWOA 1K9OE 2FOHA 1CE5A 1SBWA 3GY7A 3ZZ8A 3A88A 1EASA 4AX9H 1O3BA 2ZHFH 2FIRH 4B1TA 3IWMA 4X8UH 1PQ5A 3SI3H 1V2LT 1FXYA 2V3OH 3A84A 3SQHE 1GI7B 2A45B 1O2JA 1TB6H 2FI5E 2H2ZA 1YYY1 1C1OA 1QJ7B 4Y10E 3E6PH 1P2MA 1DSUA 2OC8A 4AZ2B 1PQ7A 2FWWA 2VVUA 2Z3CA 3RUOA 1BB0B 4NA8A 1K1LA 2GD4B 2ZU2A 1AB9C 8LPRA 1W8BH 3A8DA 1O2SA 3K6ZA 1NRQH 4DT7B 3M37A 1MTNB 2CN0H 3RXDA 3OY5U 2TRMA 1MKWK 1GMCG 4XE4A 3A87A 1JIMA 3SGAE 1A0LA 4CRFA 5HM9A 1GHWH 3PTBA 3KQDA 4Y6DA 4WY3A 4E7RG 1BTPA 2AMDA 2IJOB 1CGIE 5E0HA 5C5NA 2W26A 1O2YA 3SHCH 4LZ1H 2BDAA 1SGDE 1BRAA 3HKIB 1DOJA 1VZQH 5JBCS 2ODYB 1C5UA 3TK5A 4JYUH 1OWDA 2FDAA 4JYTA 1W2KH 3TH3H 4BXSA 4MPWA 3MO3A 2FEQH 3RU4T 1ZRKA 3KEEA 2GVFA 2YNBA 2IPHA 3RC6A 2WV5A 4Y8YA 1ZTLA 3LGWA 3MNSA 5DP7A 2LNCA 4A1XA 2H9EH 2P95A 1C4V2 3SU5A 1HNEE 4IC6A 4AORA 2XBWA 1EOLA 1C5WB 1GBHA 4I8KA 1TNHA 1GMDG 2P3UB 4XBDA 3QWCH 3RXVA 2BD5A 1IAUA 2NU0E 1Y8TA 1ZMJA 3RXLA 1FONA 3QGNB 1KXAA 1PPCE 2VWLA 3SUDA 4H6SB 1GJBB 3ZZ5A 1A3BH 1ZLRA 1Z6JH 3SU3A 1GJCB 2ZZUH 3LDXH 1KYNA 4ZHMU 1MAYA 2ANKH 4AB8A 1TMBH 1GMCF 4X2YA 1C5VA 1ZHMA 4YM9A 4ZH8A 4B2CA 1KDQB 1O2KA 4K5ZA 1SLXB 1XVOA 3TJUA 2VIDA 1K1IA 2VWMA 2VVCA 1T4UH 2JETC 2IN2A 3C1KA 1W7XH 1O2VA 3GISB 2XRCA 1D4PB 1FY5A 1E36B 1P8VC 1TMUH 2Z9IA 1J16A 1MAXA 1LTOA 4Y8ZA 1G3CA 1K1PA 2JH0D 3RXTA 4H4FA 5EQRA 3KGPA 1T32A 4AFSA 3BTDE 1AD8H 1LHEH 1C9TA 4MTBA 1XM1A 1TGSZ 3AVZA 2A5IA 4IMQA 4WWYA 1GVKB 3QGJA 1CA0B 1BJVA 1TX8A 2BY8X 5E2OA 1O2UA 3KNXA 1P2JA 3SUFA 3UOPA 1DT2A 1GBJA 3PTNA 7KMEH 3O8CA 3UUZA 1BA8B 1MU8B 1HXFH 3H5CB 4XSKU 1EAXA 1J15A 1KTTB 3VGCC 1EZSC 3SOSA 1O3OA 1EOJA 1QRZA 3M5OA 2B0FA 3DFJA 4GUXA 5JDUB 3E3TA 3S9CA 2IOTA 2A5AA 1GI8B 1P2QA 1C4U2 2G4TA 4O03A 3U8RH 1K21H 2ANWA 1K1NA 3BIUH 2ODQA 4AGKA 1BRBE 4TWWA 1O3KA 3DUXH 3MU8A 1EPTB 1WTHD 2BDGA 1P9UA 3E16B 1PJPA 1J17T 2M5TA 2HOBA 1THPB 2A1DB 1OPHB 1PYTD 4OS6A 1GBCA 2QF3A 1TAWA 1KSNA 3ATIA 5HGGA 3RXIA 1B7XB 2ZDVH 4RN6A 4WMFA 4NZLA 1GI6A 1FN6A 1P06A 2F9UA 3RXAA 1DSTA 2Y5FA 3QUMP 3NUMA 3ZZ7A 3Q3YA 3TNTA 4CR9A 1BMMH 1QBOA 1OWEA 2HNTF 1YPHE 2LPRA 1GHXH 2BD7A 3F9GA 4X2VA 1QA0A 4X8VH 1CHOF 4OGXA 3SJ9A 2W7UA 3PO1C 1L1JA 1UTNA 5L30H 1QBVH 5DP6A 2D2DA 3UR9A 2Y7XA 1SGQE 1FAXA 3GY3A 3GYLB 4ASHA 1TRNA 1QURH 2A4OA 1SLVB 1NN6A 5F8TA 3ZVEA 1GJ5H 1NTPA 3BG4B 1KLIH 3MYWA 4XBBA 1AMHA 1BBRE 4X8SH 1SGTA 3BSQA 3SNCA 1WCZA 4E06H 3EDXB 4YZUA 5JYIA 1ELEE 1HFDA 1G2MA 3GY5A 3KQCA 3S69A 3A89A 3V13A 3P8GA 4X1NU 4MNVA 1DICA 2A7CA 4I8JA 2QYIA 4A7IB 1UTQA 1Y3XA 4I7YH 3FZZA 1P10A 1UCYH 1UTKA 3R3GB 4INLA 4Q7XA 4RKOB 3SQEE 2I6SA 4MPVA 2PV9B 1SHYA 4FVDA 3MMGA 5A0BA 3NWUA 4INHA 1Z71A 4K1TA 1C5LH 1GG6B 5FCKA 1W3CA 4Z0KA 1ELAA 3TK6A 1IQKA 1N1LA 1O3GA 1F92A 2A2QH 3TNSA 3LH3A 2FP7B 3MU0A 1EUFA 5C3NA 3MOCA 1K22H 3V7TA 2C90B 3ODFA 1DWDH 2BOHB 3VB5A 2ZU4A 3NXPA 4Y0YE 1ABJH 4IS5A 3U9AH 2PHBA 1PQ8A 1G9IE 4D9RA 2VH0A 1WQSA 1DS2E 1BRUP 1BHXB 3Q76A 1HJAC 1GHAF 2OC0A 4A5TS 3ZVBA 1PYTC 1FY1A 2SGAA 2BVSH 3Q3XA 1DDJA 1UTLM 1OP8A 1UTOA 1CT2E 1TPOA 2BLQA 3GYMA 2CHAB 1Y59T 1MUEB 3CENA 5FAHA 1OWIA 1KIGH 1AHTH 1ELFA 3PMAB 3RM2H 5JB9S 5GIBA 1HDTH 2G55A 1SI5H 1O2QA 3BIVH 5DP3A 1ZSLA 2HNTE 1Z8RA 2SGEE 2Q6FA 1TONA 2ZDKA 4HFPB 1ESAA 3WY8A 1HBTH 4VGCB 1XUKA 1F5RA 3A7VA 1RTFB 3LKWA 3OU0A 4ESTE 3SBKA 4WXIA 2AGIX 1BT7A 5IDKA 2BZAA 4NIVA 5FPSA 1DXWA 7ESTE 1AE5A 3F6UH 2Z9JA 3E0PB 5EXNA 1GCTC 1UVPA 1O5AB 3ATWA 1C5ZB 4NSYA 4B2BA 3A81A 5EOKA 3SV2H 2A32A 1GHVH 2R3YA 5GCHF 1H8DH 2NWNA 1U6QA 2EI7A 2VH6A 4IMZA 4HTCH 4IBLH 2EI8A 2GKVE 1NC6A 3T62A 4O97A 1O2OA 1UVTH 1A0HB 2ZHEH 4NFFA 1O3IA 5FX6A 1C5RA 4GLYA 3TGKE 1LVMA 1C1RA 1LQEA 2R9PA 5EW1H 1KXFA 3K6YA 1A7SA 2Y5HA 3RU4E 2WYJA 4K8BA 3OY6U 5FCRA 1UK4A 2GX4A 1F0UA 1Y3VA 4LOYH 4TPYA 3MU5A 1GI2A 5HM2A 1ELDE 4MVNA 2DE8A 3KQEA 3B23B 1OP0A 5DK1A 1UVOA 3JZ1B 1KXCA 3AW1A 4IW4E 1Q3XA 2OXSA 3NK8A 1SGEE 3RMOH 4K69A 1BJUA 3M61U 1QQ4A 1W10U 2FTMA 4NA7A 2BD2A 5GCHG 1O3CA 3SORA 2XBXA 1YGCH 1F5KU 4B75A 1QTFA 1C4Y2 1P02A 4KGAA 1GI0A 1CA0C 2P8OC 8GCHG 3MH4A 5DP5A 1SVPA 4NA9H 4K60A 3VB3A 1Z7KA 5ESTE 2SFAA 1PPGE 1QRXA 3A86A 4WXVA 5DP9A 3ELAH 2H1UA 1XKAC 4XOJA 3MNCA 1P11E 1WU1A 4IGDA 1CO7E 3SNEA 2ZTYA 3MU4A 2FOAA 2ILNA 1DITH 3SW2B 2CJIA 4NWLA 4AG2A 6ESTA 1HJ9A 1ESTA 2A2XH 2NU3E 4H6TA 1O0DH 1C1PA 1Z1IA 3ZYEA 1GBFA 2VWNA 1A4WH 1ZYOA 2BY6X 2BOKA 3RXHA 1DVAH 1TX7A 2DE9A 2ZKSA 2QXGA 1O36A 2PSXA 1T8OA 3QN7A 2Y82A 1BTUA 1C2EA 3PM3A 1O3NA 3TU7H 1O2RA 1F0RA 1TNLA 2A7HA 2ZFPH 5L2ZH 2A4RA 2A5KA 2BLOA 2V6NA 2HVXA 3D65E 4NCYA 1OWHA 3D23A 3A82A 3LU9B 1UHBB 2BY5X 3PWCA 3SU4A 2STAE 3F9EA 2FOGA 1S81A 4X1QU 4CRBA 8GCHF 5DP8A 3UNSA 1GHAG 3M35A 2TGTA 2ZQ1A 3S7KB 1ANCA 2HALA 4BXWA 1FY3A 4Y11E 3RLWH 2Y5GA 1LPGB 4ZKSU 3UOUA 2OCVB 1N6XA 4QT8C 4WJG2 1VGCB 1DPOA 1YPKH 1ZOMA 2BYAX 1ID5H 1PPHE 4KP0A 5FPTA 3VXFH 5T6GA 1MMJN 2VIQA 1GJDB 3SJIA 1MCTA 4AN7A 1OOKB 3GY8A 4X0WU 1UJ1A 4MNYA 3JZ2B 1LPKB 1C1SA 4K8YA 4OS5A 2FYQA 1AWFH 2GCHF 1GI3A 2XC5A 5C1XA 1TX6A 3RXJA 1ESBA 1EQ9A 2D1JA 4HZHA 3HK3B 2ZFSA 2TGPZ 1RS0A 4I8LA 1EJNA 4ISOA 4CRGA 4I32A 3M5LA 2W7SA 2PKAB 3UWJH 1PPZA 4NWKA 1J14A 4BAOB 3SV9A 3O8BA 1E35B 1HAZB 1LHFH 5HMAA 1HB0B 2O8WA 3D49H 4FU8A 4NZQA 4AGJA 2HWLB 2RDLA 1TPSA 5BPEA 3TIUA 5AVDA 1SC8U 4YT6H 3KIDU 2ZFQH 4IN2A 2QF0A 3MWIU 4YLUA 1C2GA 1SL3A 1LHDH 5ESBA 4YLQH 4TY6A 2H9TH 1SFIA 1T4VH 2OC1A 3RC5A 2P3FH 1VCWA 5CHAC 1VCPA 3QDZB 4YOIA 2F83A 1NFXA 3SV8A 1GGDB 2WPJS 3SV7A 3TLOA 4DOQA 3AAUA 4ZHLU 2YOLA 1HAYB 1NFWA 3LJJA 2J4IA 4ABDA 3P70B 1GJ8B 4B76A 2VIOA 1BMNH 2OC7A 3FP7E 4MG3A 1AB9B 1L2EA 2OBQA 2Y6TA 4ZKRU 4ZMAH 4O3UA 1P2NA 2PKSC 3N7OA 5C1YA 2BQ7B 3QK1A 2C8XB 2VNTA 1S6HA 2J92A 1C2DA 2RCEA 3A85A 1CT0E 2J2UA 2PTNA 3PLBA 4F4OC 2BQWB 5FX5A 1O3DA 2B7DH 1SGPE 5LPFA 2ZU1A 2BD9A 4CH8B 4A6LA 2GCHG 5EW2H 5AHGH 5A2MH 1NROH 1F5LA 1GBTA 1UVUH 4BAQB 1O2TA 1O2GH 2ZGCA 1JRTA 1TRYA 3MTYA 4E05H 3FP8E 3GCOA 2TIOA 3M3VA 1TRMA 4U01A 1S84A 2RA3A 2FOMB 6CHAC 1Q31A 1XX9A 2ULLA 3T2NA 1TMTH 2CGAA 2UUKB 5EXLA 4JCNA 1IQNA 1SHHB 4ABHA 3LT3A 5A8YA 4Q7ZA 1YCPM 1NY22 5JBTA 5I46H 3TGIE 5C20A 1MTWA 3TJNA 3F9HA 1BQYA 3DD2H 2GP9B 4AG1A 7LPRA 2P93A 1MQ6A 2ZI2H 3SZNA 1A1RA 1BBRH 2GTBA 1FZZA 1O2LA 1V2JT 3GDSA 1K1OA 5FBEA 3P8NA 2GZ7A 3P95A 1C2KA 1C2LA 5GXPA 2FS8A 2PW8H 2VIVA 1AVWA 1G3DA 3EGKH 1HXEH 1THRH 4UONA 1D6RA 1DLEA 4INKA 3I77A 2PTCE 1B0EA 1SG8B 4GCHF 4GHTA 3BTHE 1CGJE 1QRWA 2FI4E 3LC3A 1K1MA 3ENSB 3RMNH 2BDCA 4GVUA 5E0JA 5F6MA 4U30A 5SGAE 3VFEA 2G5VA 3ESTA 3S7HB 3U8OH 3L33A 1MD8A 3A8CA 3MU1A 1FV9A 1GDQA 3PMBB 2UWLA 3RXFA 5A0AE 3RC4A 2ZGJA 5HYOA 1SQOA 1DWEH 1GI1A 2OQ5A 3UIRA 1AO5A 2ZDAH 1P3EA 4KTCA 1QGFA 2GCTB 1BMAA 4A92A 1O5DH 3DHKH 1BIOA 3A8AA 1EZQA 2FTLE 4I8GA 1HAGE 1YLCA 4AFQA 4AFZA 3FANA 4NFEA 5J4SA 1TQ7B 3T26A 1TIOA 1HCGA 1IQGA 2C3SA 5A8ZA 3ATLA 1LDTT 5E2PA 1GWAA 2WYGA 3STJA 4DURA 2PWXA 4AYVB 3KQBA 2ZA5A 2ZHWH 1EKBB 4WMDA 1QHRB 3AASA 2ZECA 2F9OA 4X6PA 3S9AA 1V2KT 2P8OB 3ZZ6A 5EG4A 2Z9LA 4X6NA 2VVVA 4FUFA 4AYYB 2QGRA 1P9SA 2J9NA 5K7RA 3BN9A 1GDNA 4RKJB 4BOHA 6GCHG 1BBRK 1OXGA 2AH4X 1YPGH 1SGYE 4WMEA 3ZZAA 1MBMA 1NO9H 3PMHB 2FODA 1EPTC 1VJ9U 5TJXA 2O8MA 2HPPH 3NZIA 4ZKNU 1NRPH 1V2RT 1RIWB 1P0SH 2WPMS 5TCAA 3LGUA 2R0KA 1L4DA 4Y79A 1CVWH 4ZXXH 2BLWA 1SSXA 3L6PA 5LPEA 3BTWE 2CMYA 1QL8A 4XFQA 1SLWB 2VU8E 2ZDLA 4FVBA 1SMFE 1MTUA 1HIAA 4K3JA 4BAMB 1S0QA 2XCNA 8ESTE 4A1TA 1C5QA 1AZ8A 4IN1A 3GDVA 2A31A 4K1SA 2G51A 1O2XA 1QL9A 1E37B 1G3EA 1AE8H 1SFQB 3GCTF 1O5FH 2KAIB 3K9XB 3RXKA 1AN1E 1TPPA 3RMMH 1JBUH 3STIA 4FUEA 1YC0A 2ZFRH 1TBQH 1ZHPA 4F49A 2J95A 2SGQE 2F9PA 3QO6A 1TOMH 4GCHG 3U8TH 1W0ZU 2Z3EA 1L1NA 1IQMA 1Y3YA 2ZNKH 4Y7AA 5DGJA 3BG4C 2HGTH 1O2WA 3BTME 1H4WA 1C5NH 3QZRA 1EAWA 2ZC9H 3UQOA 1ZMLA 2O8UA 5F8ZA 1Y5AT 2UUJB 5AFZH 1M9UA 1OSSA 2BX4A 2V0BA 2FPZA 1RXPA 1KLJH 2FZZA 1Z1JA 1FLEE 3EE0B 2FX6A 4X2WA 3RXPA 3OTJE 4YO9A 2BQ6B 1C2IA 1AVGH 3ZZDA 2WPLS 3UWIA 4ABGA 1G32B 3UNQA 3M3SA 3QX5H 2PUQH 1LMWB 1QB9A 4B73A 1P05A 3RXQA 3RXSA 1FN8A 4DGJA 4UFFH 2ZCLP 4Q80A 1PFXC 3LGYA 1ZZZA 4UE7H 2NU4E 1AZZA 2ZPQA 1XVMA 1Z8IB 1V2VT 3UY9A 2ZG0H 5CHAB 1DFPA 1SB1H 1VITH 2GT7A 1JWTA 3MO6A 3PMJA 1SGIB 1ELBA 1GPZA 1TBRH 2J38A 3T5FH 1TLDA 1TNGA 2ASUB 3CP7A 4MDSA 3HGPA 2A4QA 3MH6A 3GICB 5EQQA 3GCTG 4BTTB 1KXBA 1NFYA 2B5TB 2G5NA 1O5CB 1GMHG 1N8OC 4O9VA 2RG3A 2PKSB 3FP6E 2XWAA 3DA9B 3VB7A 4I8HA 1D3QB 1GBLA 1W14U 1Y3WA 2ANYA 4YOGA 5JBBS 3QLPH 4KTSA 2SGPE 3A83A 1C5XB 1EAUA 1JIRA 3GY4A 5C2ZA 4JZIA 1CBWB 3RXBA 4CRCA 1GDUA 1O35A 1D3PB 1XUFA 2GGVB 1UMAH 3ATKA 1WOFA 3V12A 1RTKA 1GL1A 1XUJA 4JZFH 5E8EH 3KF2A 1O34A 2WPHS 2P94A 1E34B 1OP2A 2OLGA 1XKBC 1ZTJA 3HGNA 3VGCB 3M7TA 1GCDA 2EI6A 1P12E 4B74A 3UQVA 1V2PT 1W11U 4CR5A 2QIQA 1AWHB 1GI9B 2HRVA 3EA9A 4KTUA 4Y71A 1QQUA 4ZHAA 5J4QA 2Y81A 4MNXA 5AF9H 2WINI 4MQAA 2ESTE 2VIPA 4X8TH 3ZZ4A 3A7ZA 1LVBA 2G00A 3ZVDA 1GMDF 2ZEBA 4O3TA 5E0GA 1ELTA 4J2YB 1XXFA 1C5YB 2ZTZA 1AUJA 3GDUA 1DXPA 2TGDA 2W3IA 3ITIA 1TABE 3E8LA 4I31A 3UFAA 2PLXA 1MTSA 1IQEA 1P3CA 1RD3B 2JH6D 4GPGA 3MNBA 1V2QT 1LHGH 1DY8A 1VR1H 1EX3A 2BLVA 1YPLH 3RXCA 3I78A 3TJVA 5EGMA 5A0CA 2F91A 1GBKA 1SGNE 7GCHG 2GZ8A 4FUHA 4Z6AH 3VEQB 3ZVGA 2ZCKP 1GMHF 1OWJA 2P16A 1S83A 3BEUA 4CRDA 5B6OA 3QZQA 6GCHF 5ETXA 1UK2A 1A5IA 4X2XA 2ZDNA 4DIIH 1MKXH 2G8TA 1E38B 4X6MA 1O5GH 4D7FA 1CQQA 3ZZ3A 1C5MD 5CE1A 3VPKA 1EB1H 4FUCA 1NRRH 1CHGA 1GJAB 2O8TA 1GHBF 2QXIA 2P59A 4DW2U 2PGBB 1LQDB 2UUFB 1VITF 4KKDA 2SNWA 1AU8A 4NIYA 1H9IE 4GHQA 1X7AC 1XXDA 1C2HA 1EJAA 2VINA 2AIPA 3FAOA 3K65B 3EA8A 1K2I1 1LKBA 1N6YA 3LOXA 1G3BA 4ISNA 3GCNA 2BY9X 1P57B 4ABJA 1MZAA 1SGFA 3SGBE 1GHZA 1ETTH 1MH0A 3HKJB 1CGHA 2FO9A 5DG6A 2BHGA 3BEIB 1C1UH 2A0QB 3QTOH 2ZFFH 1EATA 1KY9A 4UFDH 1W7GH 2EC9H 1Z8GA 1FY8E 2ZFTA 1HGTH 3PYHA 1A2CH 1S85A 3BTEE 1V3XA 2QAAA 2BMGB 1QY6A 4GSOA 1GBEA 3MFJA 3LIWA 4Q7YA 4FXGH 3MH5A 2PUXB 5FHTA 1YPHC 2ALPA 1D3DB 1SQTA 3LC5A 1SGCA 1LKAA 3CS0A 2W5EA 3LGTA 4Y76A 2QCYA 1PPFE 1P09A 1CHOG 1HJ8A 3OX7U 3SJOA 1LVOA 2F9VA 1P2KA 2H5CA 2XC4A 1DUEA 1KTSB 1KLTA 2THFB 2CHAC 1C2FA 2PSYA 4J1YA 1EZXC 1DE7H 1NM6A 2ALVA 3M7QA 5K0HA 2BDIA 1Z6EA 1RJXB 4TPIZ 1ZRBA 1OS8A 5LGOA 3BV9B 1O2MA 1TA6A 1TE0A 4D7GA 1A5HA 2BDBA 1WAYB 3SNBA 3TPIZ 2SNVA 2AMPA 2SGDE 2Z6BD 1DUAA 1UTPA 1FQ3A 1F0SA 1L1GA 1NU9A 1QB6A 4X6OA 3ZV9A 4A1VA 2C8WB 4ABFA 3G01A 1O39A 4TYDA 2K1QA 5T3HA 4ISIH 3H7OA 1P2OA 1PPEE 1O3EA 3HATH 1TGTA 2FOEA 1G36A 3SI4H 1FNIA 2C8ZB 2NU1E 3U98H 4FU7A 4WH6A 2J34A 2BDYA 1LHCH 1UO6A 1ARCA 3IITA 1QJ1B 2Z7FE 3SJ8A 1ZGIA 1TGCA 1HRTH 4DY7B 1G37A 2XBYA 2FOBA 4I33A 2O8LA 4E7NA 4ABAA 1BTZA 5GJ4B 3TGJE 1TFXA 4JYVH 2D26C 4SGAE 1SPJA 1UVSH 3TJOA 1VITG 1ANDA 1YP9A 1A0JA 1HAVA 1ZMNA 3RDZA 1O3LA 4NIXA 3A8BA 1S6FA 1H1BA 4FU9A 5EODA 1O2IA 3KHVA 3NKKA 4JZDH 3T28A 2OQUA 5GDSH 1A3EH 1C2JA
chains in the Genus database with same CATH superfamily
3P17H 1C2MA 1O3HA 3D62A 4OS7A 2ZHDA 1LPZB 1L4ZA 3EQ0H 3I29A 1TALA 1AFEH 1MQ5A 3LPRA 4R8TB 2QXJA 1YPEH 1GVLA 3NPSA 3P92A 1NZQH 3BTQE 1ZGVA 3SGQE 4ISHH 3VB6A 1A61H 1AIXH 1UTJA 1WBGB 5EQSA 2G52A 2FMJA 3GY6A 1ZPBA 1CBWC 5EJZA 5F03A 3FKSD 2VGCC 1HAOH 1KDQA 1S5SA 4CBOA 5L6NH 1EPTA 3B8JA 1W0YH 4ABIA 5I25A 1Y3UA 3BTGE 1WYKA 3SU1A 5HXFA 3OSYA 3VXEH 1V2OT 2R2WU 1O5BB 1QCPA 1CSOE 2QY0B 1O3MA 1C1VH 1RGQA 2XBVA 3SU2A 3RXOA 3UTUH 1C5TA 3Q77A 3HPTB 3M3TA 1T7CA 2DUCA 3O8DA 3UB0A 4MPUA 2AGEX 3PROA 2HLCA 1K1JA 1ZJKA 7GCHF 4JK6A 3FZDA 3ZZCA 1ACBE 4LZ4B 1FPCH 4U2WA 2AGGX 2UWOA 2QF4A 1Y5BT 1UTMA 1UCYE 2GT8A 1THSH 2VB0A 3EAJA 3DFLA 1O2NA 3LGVA 1OWKA 5C5OA 1IHTH 2BVXH 2Q1JA 4DT4A 1F2SE 1LO6A 4DIHH 1IQHA 1T8NA 3U1IB 1J8AA 3GCHB 3U1JB 1FY4A 1C5OH 1AY6H 1ZHRA 5C94A 1DX5M 1F7ZA 1LCYA 1GHBG 2ZCHP 3RXGA 1YPJH 2VIWA 5A8XA 3F0PA 4CBNA 2G4UA 3BEFB 2R3UA 4D76A 1TBZH 1O3FA 1HJAB 2Z9KA 2V35A 5DJ7A 1OKXA 2ZP0H 3SZEA 1ABIH 1BUIA 1C1NA 1MKWH 2GCTC 1YKTA 5DKMA 2PR3A 4Q4LA 3FVFB 1OYTH 1WQVH 5GPIB 1GHYH 5B6LA 2B8OH 2CV3A 2F9BH 3UNRA 1GJ4H 3P6ZB 2SGFE 1L0ZA 2Z9GA 3Q3KA 4XDEA 4BAKB 1YM0A 3P8OA 3O8RA 4CRAA 3SN8A 2CF9H 2FI3E 4M7GA 1O37A 2VGCB 8KME2 2R0LA 1V2ST 2BVRH 4D9QA 4OS4A 3SUGA 2TBSA 1RTLA 2GV6A 5T6DA 2JDID 5FPYA 1AI8H 1FDPA 2OD3B 1SOZA 4BTUB 1NPMA 1WV7H 1Q2WA 2JKHA 4GAWA 4VGCC 3ZVCA 1FAKH 1EJMA 1QR3E 5EPYA 4WF8A 5ABWA 4ZAEA 3B9FH 2BXTH 1HAPH 2P3TB 1C1WH 3UPEA 2AMQA 4UEHH 1EAIA 1GCTB 2BXUH 4Y0ZE 1ARBA 4CREA 1HAIH 1HPGA 2BM2A 1UK3A 1TOCB 5LH8A 1OX1A 2I6QA 1S0RA 2BD4A 2KM0A 2BB4A 4ISLA 2WPKS 2EA3A 5C1UA 3KYGA 3AAVA 2B9LA 2KCPA 1BTYA 2ZO3H 3T25A 1GI4A 5L2YH 1XUHA 2OTVA 1C5PA 1O3PB 3PWBA 3MNXA 4FUIA 2OINA 2TPIZ 2FXRA 4Y8XA 6LPRA 3BG8A 1NS3A 1O2HA 1EP5A 1NFUA 1ORFA 4LK4A 3W95A 3OYPA 2ANMH 3GY2A 3W94A 1GJ7B 1YPMH 2ZQ2A 5A09A 1XMNB 1HAHH 3SU6A 1IQIA 3A7WA 4ZXYH 2ZF0H 1C1MA 3R0FA 4LXBH 3MI4A 3DT0H 2GDEH 2V3HH 1EB2A 1F0TA 2HNTC 3F9FA 3RXEA 1BMLA 3BTFE 2STBE 4H42U 3ZYDA 1O32A 3ZVAA 4AB9A 2AS9A 1B0FA 3T27A 1BTXA 1KXDA 2ZPRA 3RXUA 2GZ9A 3KYFA 3GS9A 4NSVA 1ANEA 5C67A 1WUNH 3MQKC 2H9HA 3KCGH 3LGIA 3QTVH 5KGOA 5LPRA 6CHAB 1SGFG 2YNAA 5PTPA 1NRNH 1TNKA 4FUDA 1TNIA 2Z3DA 1BZXE 4U32A 3M7UA 2UWPA 1SQRA 4ASUD 1IQJA 4THNH 2GMTB 3ZVFA 1T31A 3M36A 1YF4A 2AFQB 4B71A 3SUEA 4MLFB 4ABEA 2C4FH 2BTCE 4ABBA 1DM4B 2AERH 4OS1A 1O38A 2XYAA 1C1QA 2QV1A 3A7TA 4K1EA 1XUGA 1VCQA 1O30A 1FI8A 3F1SB 1PPBH 2BX3A 5FXLA 3UREA 3RLYH 1SLUB 3E1XB 4AC9A 3GOVB 3DSOA 4PROA 2Y80A 1FIZA 5JB8S 1FJSA 2ODPA 4YESB 3SU0A 2JIZD 1ZPZA 1CT4E 1DLKB 1G30B 1Z8JB 1SGRE 1Y5UT 4BAHB 2BDHA 3PLKA 1J9CH 3V0XA 2ZTXA 1YLDA 3PV4A 3PB1E 5JPMH 1QL7A 4JZ1A 1IHSH 1N8OB 3CS7A 2FYRA 3ZV8A 2FOCA 3A7YA 5TCCA 4MPXA 1HAVB 1LVYA 1BITA 1VKYA 1ZPCA 4B2AA 3M5MA 3TITA 4XBCA 3URDA 4AFUA 3RXMA 2FLBH 1A5GH 2BZ6H 1JMOH 1AQ7A 3ZZ9A 5GWZA 1UHBA 4D8NA 1HV7A 4UD9H 3L3TA 4Y7BA 1T8LA 5BRRE 1JRSA 1AVXA 1EZUC 2FLRH 2H5DA 3BTTE 1MKXK 3H7TA 4NIWA 1ETRH 1P03A 2QN5T 1TGNA 2ZGHA 3KN2A 5DP4A 2AYWA 3TH4H 1V2TT 4AOQA 1GI5A 1TQ0B 1NESE 1P2IA 4KELA 5F8XA 1TA2A 2PKAA 3HK6B 3E91A 1B5GH 3K2UA 1BTWA 5JBAS 1NRSH 1ZTKA 2XW9A 1T8MA 1D9IA 1FMGA 1BMFD 1P01A 4UDWH 1INCA 1HYLA 1V2MT 3U69H 2ZU5A 2WPIS 4X1PU 4MNWA 2OP9A 1E79D 1AFQB 1NBME 2FX4A 4CHAB 1S82A 3FFGA 2ZGBH 5FBIA 5AFYH 1FUJA 1TNJA 3F3BA 2VJ1A 4BANB 3F2GA 3RXRA 1TPAE 2VBCA 3TK9A 1YCPH 1AKSB 4IC5A 3BF6H 3LJOA 1GBMA 1MU6B 4YTAA 2QF5A 1BHXF 1MD7A 2AEIH 1ZJDA 1O3JA 1SQAA 2WUCA 3P8FA 4UFEH 1BDAA 1YBWA 1MZDA 3LONA 1O3AA 1SKYE 3ATMA 1W13U 4RSPA 3URCA 2NU2E 9ESTA 1GBDA 3RU4D 1ELGA 1QNJA 1GGDC 3NCLA 1FIWA 4DCDA 1GVZA 5IYTA 1DWCH 3PLPA 3EYDA 5G4BA 3GCHC 2FOFA 1MCVA 5H4IB 3SNAA 1IQLA 1QBNA 9LPRA 2PFEA 1BRCE 2JETB 1C5SA 5EU8A 1EP6A 3SJKA 4Z1MD 3S9BA 4Q2KA 1GBAA 1V2NT 3SO3A 2EEKA 2BD8A 4FUJA 5IK2D 4BTIB 2RA0A 1WXRA 4WVPE 4TY7A 2G81E 2Q6DA 2J94A 3RM0H 4FUBA 3PRBA 3SHAH 1SR5C 2D8WA 5DO4H 1K28D 2HLDD 3E90B 1XUIA 2C93B 3IG6B 1G2LA 2TGAA 1P04A 1AGJA 1ETSH 1ZR0A 1PQAA 1V2WT 3F0OA 1GJ9B 4XD7D 1O2PA 3MHWU 3UR6A 1GL0E 1WSSH 2H6MA 2J98B 5EPNA 5EXMA 1ELVA 2XTTB 3F68H 2Q6GA 3A80A 1SOTA 4JK5A 1TGBA 4HI3A 2QXHA 1QIXB 1V2UT 1C1TA 1AFQC 5DPAA 4CHAC 2F9NA 4DG4A 1UCYK 2HPQH 4JZEH 3KL6A 3AW0A 1JXPA 1D6WA 1YCPK 1O5EH 1TYNA 2QA9E 3VB4A 1CA8B 4OGYA 1YWUA 2BY7X 1H8IH 1BOQA 4YT7H 4TWYA 1JOUB 3RP2A 4ZROA 2Z94A 1GJ6A 1IQFA 2ZHQH 3E0NB 1O2ZA 4DVAU 2UUYA 3SNDA 4X1RU 3SV6A 4OS2A 3DSPA 3LH1A 2OUAA 4FUGA 4R0IA 1AUTC 1HLTH 2J5UA 1ELCA 1IOEA 1QFKH 2QC2A 3BTKE 2BD3A 3ODDA 4DJZB 4WH8A 1DY9A 1QA7A 2ZDMA 1CU1A 1E0FD 2AIQA 2WV4A 1ANBA 2OBOA 1ZSJA 2FM2A 2WUBA 1COWD 1MBQA 1A46H 2FS9A 1V6DA 4HGCA 1RFNA 1WTGH 3EA7A 4SGBE 1MTNC 2PGQB 5DSFA 1QB1A 2ZPSA 1BCUH 4JMYA 4BNRA 3TVJB 3PO1B 2XNIA 4NGAH 2JH5D 1ZSKA 1D3TB 2XXLA 1GBIA 1FPHH 1NU7B 1GBBA 1VGCC 3RMLH 2A7JA 1TWXB 3H09A 4ZKOU 1VJAU 2KAIA 1KXEA 1MABB 4NG9H 2XWBI 2Y7ZA 4K2YA 2O9QA 1RRKA 3T29A 4CH2B 1W12U 5T1VA 2XCFA 2ZIQH 1H9HE 3C27B 1QJ6B 4ZUHA 2GV7A 1C9PA 1DANH 1EXFA 1H9LB 1W0KD 1HIAB 2F3CE 2YMSD 2ZWLH 3UAIC 3Q00A 3TH2H 1BTHH 1AKSA 2CXVA 2GDDA 1OYQA 2A4GA 5T6FA 3M5NA 2CF8H 2R2MB 2C8YB 2XC0A 2ZGXH 1MTVA 2W3KA 1HAXB 3ZZBA 2GMTC 4UFGH 1NT1A 2ZU3A 4X1SU 3MO9A 1GG6C 3MH7A 1DWBH 3A7XA 1O33A 1O31A 3V3MA 5CMXH 2FESH 3S0NA 1HUTH 4YOJA 1RIWC 2VWOA 1K9OE 2FOHA 1CE5A 1SBWA 3GY7A 3ZZ8A 3A88A 1EASA 4AX9H 1O3BA 2ZHFH 2FIRH 4B1TA 3IWMA 4X8UH 1PQ5A 3SI3H 1V2LT 1FXYA 2V3OH 3A84A 3SQHE 1GI7B 2A45B 1O2JA 1TB6H 3CNRA 2FI5E 2H2ZA 1YYY1 1C1OA 1QJ7B 4Y10E 3E6PH 1P2MA 1DSUA 2OC8A 4AZ2B 3WWFA 1PQ7A 2FWWA 2VVUA 2Z3CA 3RUOA 1BB0B 4NA8A 1K1LA 2GD4B 2ZU2A 1AB9C 8LPRA 1W8BH 3A8DA 1O2SA 3K6ZA 1NRQH 4DT7B 3M37A 1MTNB 2CN0H 3RXDA 3OY5U 2TRMA 1MKWK 1GMCG 4XE4A 3A87A 1JIMA 3SGAE 1A0LA 4CRFA 5HM9A 1GHWH 3U28C 3PTBA 3KQDA 4Y6DA 4WY3A 4E7RG 1BTPA 2AMDA 2IJOB 1CGIE 5E0HA 5C5NA 2W26A 1O2YA 3SHCH 4LZ1H 2BDAA 1SGDE 1BRAA 3HKIB 1DOJA 1VZQH 5JBCS 2ODYB 1C5UA 3TK5A 4JYUH 1OWDA 2FDAA 4JYTA 1W2KH 3TH3H 1K0HA 4BXSA 4MPWA 3MO3A 2FEQH 3RU4T 3ZIAD 1ZRKA 3KEEA 2GVFA 2YNBA 2IPHA 3RC6A 2WV5A 4Y8YA 1ZTLA 3LGWA 3MNSA 5DP7A 2LNCA 4A1XA 2H9EH 2P95A 4HG6A 1C4V2 3SU5A 1HNEE 4IC6A 4AORA 2XBWA 1EOLA 1C5WB 1GBHA 4I8KA 1TNHA 1GMDG 2P3UB 4XBDA 3QWCH 3RXVA 2BD5A 1IAUA 2NU0E 1Y8TA 1ZMJA 3RXLA 1FONA 3QGNB 1KXAA 1PPCE 2VWLA 3SUDA 4H6SB 1GJBB 4ZCNA 5DN6D 3ZZ5A 2OK5A 1A3BH 1ZLRA 1Z6JH 3SU3A 1GJCB 2ZZUH 3LDXH 1KYNA 4ZHMU 1MAYA 2ANKH 4AB8A 1TMBH 1GMCF 4X2YA 1C5VA 1ZHMA 4YM9A 4ZH8A 4B2CA 1KDQB 1O2KA 4K5ZA 1SLXB 1XVOA 3TJUA 2VIDA 1K1IA 2VWMA 2VVCA 1T4UH 2JETC 2IN2A 3C1KA 1W7XH 1O2VA 3GISB 2XRCA 1D4PB 1FY5A 1E36B 1P8VC 1TMUH 2Z9IA 1J16A 1MAXA 1LTOA 4Y8ZA 1G3CA 1K1PA 2JH0D 3RXTA 4H4FA 5EQRA 3KGPA 1T32A 4AFSA 3BTDE 1AD8H 1LHEH 1C9TA 4MTBA 1XM1A 1TGSZ 3AVZA 2A5IA 4IMQA 2KCOA 4WWYA 1GVKB 3QGJA 1CA0B 1BJVA 1TX8A 2BY8X 5E2OA 1O2UA 3KNXA 1P2JA 3SUFA 3UOPA 1DT2A 1GBJA 3PTNA 7KMEH 3O8CA 1OHHD 5C17A 3UUZA 1BA8B 1MU8B 1HXFH 3H5CB 4XSKU 1EAXA 1J15A 1KTTB 3VGCC 1EZSC 3SOSA 1O3OA 1EOJA 1QRZA 3M5OA 2B0FA 3DFJA 4GUXA 5JDUB 3E3TA 3S9CA 2IOTA 2A5AA 1GI8B 2QE7D 1P2QA 1C4U2 2G4TA 4O03A 2LELA 3U8RH 5HKKD 1K21H 2ANWA 1K1NA 3BIUH 2ODQA 4AGKA 1BRBE 4TWWA 1O3KA 3DUXH 3MU8A 1EPTB 1WTHD 3OEED 2BDGA 1P9UA 3E16B 1PJPA 1J17T 2M5TA 2HOBA 1THPB 2A1DB 1OPHB 1PYTD 4OS6A 1GBCA 5C0UA 2QF3A 1TAWA 1KSNA 3ATIA 5HGGA 3RXIA 3N7EA 1B7XB 2ZDVH 4RN6A 4WMFA 4NZLA 1GI6A 1FN6A 1P06A 2F9UA 3RXAA 1DSTA 2Y5FA 3QUMP 3NUMA 2GJGA 3ZZ7A 3Q3YA 3TNTA 4CR9A 1BMMH 1QBOA 1OWEA 2HNTF 1YPHE 2LPRA 1GHXH 2BD7A 4FETA 5EJLA 3F9GA 4OM9A 4X2VA 4RT0A 1QA0A 4X8VH 1CHOF 4OGXA 3SJ9A 2W7UA 3PO1C 1L1JA 1UTNA 5L30H 1QBVH 5DP6A 2D2DA 3UR9A 2Y7XA 1SGQE 1FAXA 3GY3A 3GYLB 4ASHA 1TRNA 1QURH 2A4OA 1SLVB 1NN6A 5F8TA 3ZVEA 1GJ5H 1NTPA 3BG4B 1KLIH 3MYWA 2CK3D 4XBBA 1AMHA 1BBRE 4X8SH 1SGTA 3BSQA 3SNCA 1WCZA 4E06H 3EDXB 4YZUA 5JYIA 1ELEE 1HFDA 1G2MA 3GY5A 3KQCA 3S69A 3WWBA 3A89A 3DSGA 3P8GA 3V13A 4X1NU 1E1RD 1DICA 4MNVA 2A7CA 4I8JA 2QYIA 4A7IB 1UTQA 1Y3XA 4I7YH 3FZZA 1P10A 1UCYH 1UTKA 3R3GB 4INLA 4Q7XA 2AHME 4RKOB 3SQEE 2I6SA 4MPVA 2PV9B 1SHYA 4FVDA 3MMGA 5A0BA 3NWUA 4INHA 1Z71A 4K1TA 1C5LH 1GG6B 2WZQA 5FCKA 1W3CA 4Z0KA 1ELAA 3TK6A 1IQKA 1N1LA 1O3GA 1F92A 2A2QH 5HIZA 3TNSA 3LH3A 2FP7B 3MU0A 1EUFA 2EY4C 3MOCA 5C3NA 1K22H 3V7TA 2C90B 3ODFA 1DWDH 2BOHB 2KFWA 3VB5A 2ZU4A 3NXPA 4Y0YE 1ABJH 4IS5A 3U9AH 2PP6A 2PHBA 2V3MA 1PQ8A 1G9IE 4D9RA 2VH0A 1WQSA 1DS2E 1BRUP 1BHXB 3Q76A 1HJAC 1GHAF 2OC0A 4A5TS 3ZVBA 1PYTC 1FY1A 2SGAA 2BVSH 3Q3XA 3OTPA 1DDJA 1UTLM 1OP8A 1UTOA 1CT2E 1TPOA 2BLQA 2EQNA 3GYMA 2CHAB 1Y59T 1MUEB 3CENA 5FAHA 1OWIA 1KIGH 1AHTH 1ELFA 3PMAB 3RM2H 5JB9S 5GIBA 1HDTH 2L74A 2G55A 1SI5H 1O2QA 3BIVH 5DP3A 3FN8A 1ZSLA 2HNTE 1Z8RA 2M2AA 2SGEE 2Q6FA 3VG8A 1TONA 2ZDKA 4HFPB 1ESAA 3WY8A 1HBTH 4VGCB 1XUKA 1F5RA 3A7VA 1RTFB 3LKWA 3OU0A 4ESTE 3SBKA 4WXIA 2AGIX 1BT7A 5IDKA 2BZAA 4NIVA 5FPSA 1DXWA 1YLNA 7ESTE 1AE5A 3F6UH 2Z9JA 5EIYA 3E0PB 5EXNA 1GCTC 1UVPA 1O5AB 3ATWA 1C5ZB 4NSYA 4B2BA 3A81A 5EOKA 3SV2H 2A32A 1GHVH 2R3YA 5GCHF 1H8DH 2NWNA 1U6QA 2EI7A 2VH6A 2J98A 4IMZA 4HTCH 4IBLH 2EI8A 2GKVE 1NC6A 3T62A 4O97A 1O2OA 1UVTH 1A0HB 2ZHEH 4NFFA 1O3IA 5FX6A 1C5RA 4GLYA 3TGKE 2K0QA 1LVMA 1C1RA 1LQEA 2R9PA 5EW1H 1KXFA 3K6YA 1A7SA 2Y5HA 3RU4E 2WYJA 4K8BA 3OY6U 5FCRA 1UK4A 2GX4A 1F0UA 1Y3VA 4LOYH 4TPYA 3MU5A 1GI2A 5HM2A 1ELDE 4MVNA 2DE8A 3KQEA 3B23B 1OP0A 5DK1A 1UVOA 3JZ1B 1KXCA 3AW1A 4IW4E 1Q3XA 2OXSA 3NK8A 1SGEE 3RMOH 5CDFE 4K69A 1BJUA 3M61U 1QQ4A 1W10U 2FTMA 4NA7A 2BD2A 5GCHG 1O3CA 3SORA 2XBXA 1YGCH 1F5KU 4B75A 1QTFA 1C4Y2 1P02A 4KGAA 1GI0A 1CA0C 2P8OC 8GCHG 3MH4A 5DP5A 1SVPA 4NA9H 4K60A 2L6OA 1Z7KA 5ESTE 2SFAA 3VB3A 1PPGE 5KECA 1QRXA 3A86A 4WXVA 5DP9A 3ELAH 2H1UA 1XKAC 4XOJA 3MNCA 1P11E 1WU1A 4IGDA 1CO7E 3SYJA 3SNEA 2ZTYA 3MU4A 2FOAA 2ILNA 1DITH 3SW2B 3F2HA 2CJIA 4NWLA 4AG2A 6ESTA 1HJ9A 1ESTA 2A2XH 2NU3E 4H6TA 1O0DH 1C1PA 1Z1IA 3ZYEA 1GBFA 1ZYOA 1A4WH 2BY6X 2VWNA 2BOKA 3RXHA 1DVAH 1TX7A 2XOKD 2DE9A 2ZKSA 2QXGA 1O36A 2PSXA 1T8OA 2IJD1 3QN7A 2Y82A 1BTUA 1C2EA 3PM3A 1O3NA 3TU7H 1O2RA 1F0RA 1TNLA 2A7HA 2ZFPH 5KEDA 5L2ZH 2A4RA 2A5KA 2BLOA 2V6NA 2HVXA 3D65E 4NCYA 1OWHA 3D23A 3A82A 3LU9B 1UHBB 2BY5X 3PWCA 3SU4A 2STAE 3F9EA 2FOGA 1S81A 4X1QU 4CRBA 8GCHF 5DP8A 3UNSA 1GHAG 1NBMD 3M35A 2TGTA 2ZQ1A 3S7KB 1ANCA 2HALA 4BXWA 1FY3A 4Y11E 3RLWH 2Y5GA 1W0JD 1LPGB 4ZKSU 3UOUA 2OCVB 1N6XA 4QT8C 4WJG2 1VGCB 1DPOA 1YPKH 4XRNA 1ZOMA 2BYAX 1ID5H 1PPHE 4KP0A 5FPTA 3VXFH 5T6GA 1MMJN 2VIQA 3EE7A 1GJDB 3SJIA 3OE7D 1MCTA 4AN7A 1OOKB 3GY8A 4X0WU 1UJ1A 4MNYA 3JZ2B 1LPKB 1C1SA 4K8YA 4OS5A 2FYQA 1AWFH 2GCHF 1GI3A 2XC5A 2JJ1D 5C1XA 1TX6A 3RXJA 1ESBA 1EQ9A 2D1JA 4HZHA 3N7DA 3HK3B 2ZFSA 2TGPZ 1RS0A 4I8LA 1EJNA 4ISOA 4CRGA 4I32A 3M5LA 2W7SA 2PKAB 3UWJH 1PPZA 4NWKA 1J14A 4BAOB 3SV9A 3O8BA 1E35B 1HAZB 4ACAA 1LHFH 5HMAA 1HB0B 2O8WA 3D49H 5EJ1A 4FU8A 4NZQA 4AGJA 2HWLB 2RDLA 1TPSA 5BPEA 3TIUA 5AVDA 1SC8U 4YT6H 3KIDU 2ZFQH 4IN2A 2QF0A 3MWIU 4YLUA 1C2GA 1SL3A 1LHDH 3PV5A 4YLQH 5ESBA 4TY6A 2H9TH 1SFIA 1T4VH 2OC1A 3RC5A 2P3FH 1VCWA 5CHAC 1VCPA 3QDZB 3F2FA 4YOIA 2F83A 1NFXA 2JJ2D 3W1EA 3SV8A 1GGDB 2WPJS 3SV7A 1FX0B 1UW7A 3TLOA 4B6EA 3AAUA 4DOQA 4ZHLU 2YOLA 1HAYB 1NFWA 3LJJA 2J4IA 4ABDA 3P70B 1GJ8B 4B76A 2VIOA 1BMNH 2OC7A 3FP7E 4MG3A 1AB9B 1L2EA 2OBQA 2Y6TA 4ZKRU 4ZMAH 4O3UA 1P2NA 2PKSC 3N7OA 5C1YA 2BQ7B 3QK1A 2C8XB 2VNTA 1S6HA 2J92A 1C2DA 2J97A 2RCEA 3A85A 1CT0E 2J2UA 2PTNA 3PLBA 4F4OC 2BQWB 5FX5A 1O3DA 2B7DH 1SGPE 5LPFA 2ZU1A 2BD9A 4CH8B 4A6LA 2GCHG 5EW2H 5AHGH 5A2MH 1NROH 1F5LA 1GBTA 1UVUH 4BAQB 1O2TA 1O2GH 2ZGCA 1JRTA 1TRYA 3MTYA 4E05H 3FP8E 3GCOA 2TIOA 3M3VA 1TRMA 4U01A 1S84A 2RA3A 2FOMB 6CHAC 1Q31A 1XX9A 2ULLA 3T2NA 1TMTH 2CGAA 2UUKB 5EXLA 4JCNA 1IQNA 1SHHB 4ABHA 3LT3A 5A8YA 4Q7ZA 1YCPM 1NY22 5JBTA 5I46H 3TGIE 5C20A 1MTWA 3TJNA 3F9HA 1BQYA 3DD2H 4Q63A 4TSFD 2GP9B 4AG1A 7LPRA 2P93A 1MQ6A 2ZI2H 3SZNA 1A1RA 1BBRH 2GTBA 1FZZA 1O2LA 1V2JT 3GDSA 1K1OA 5FBEA 3P8NA 2GZ7A 3P95A 1C2KA 1C2LA 5GXPA 2FS8A 2PW8H 2VIVA 1AVWA 1G3DA 3EGKH 1HXEH 1THRH 4UONA 1D6RA 1DLEA 4INKA 3I77A 2PTCE 1B0EA 1SG8B 4GCHF 4GHTA 3BTHE 1CGJE 2KCYA 1QRWA 2FI4E 3LC3A 1K1MA 1H8HD 3ENSB 3RMNH 2BDCA 4GVUA 5E0JA 5F6MA 4U30A 5SGAE 5GNDA 3VFEA 2G5VA 3ESTA 3S7HB 3U8OH 3OFND 3L33A 1MD8A 3A8CA 3MU1A 1FV9A 1GDQA 3PMBB 2UWLA 3RXFA 5A0AE 3RC4A 2ZGJA 5HYOA 5F53A 1SQOA 1DWEH 1GI1A 2OQ5A 3UIRA 1AO5A 2ZDAH 1P3EA 4KTCA 1QGFA 2GCTB 1BMAA 4A92A 1O5DH 3DHKH 1BIOA 3A8AA 1EZQA 2FTLE 4I8GA 1HAGE 1YLCA 4AFQA 4AFZA 3FANA 4NFEA 5J4SA 1TQ7B 3T26A 1TIOA 1HCGA 1IQGA 2C3SA 5A8ZA 3ATLA 1LDTT 5E2PA 1GWAA 2WYGA 3STJA 4DURA 2PWXA 4AYVB 3KQBA 2ZA5A 2ZHWH 1EKBB 4WMDA 1QHRB 3AASA 4P02A 2ZECA 2F9OA 4X6PA 3S9AA 1V2KT 2P8OB 1WDIA 3ZZ6A 5EG4A 2Z9LA 4X6NA 5FL7D 2VVVA 4FUFA 4AYYB 2QGRA 2RDEA 1P9SA 2J9NA 4I86A 5K7RA 3BN9A 1GDNA 4RKJB 4BOHA 6GCHG 1BBRK 1OXGA 2AH4X 1YPGH 1SGYE 4WMEA 3ZZAA 1MBMA 1NO9H 3PMHB 2FODA 1EPTC 1VJ9U 5TJXA 2O8MA 2HPPH 3NZIA 4ZKNU 1NRPH 1V2RT 1RIWB 1P0SH 2WPMS 5TCAA 3LGUA 2R0KA 1L4DA 4Y79A 1CVWH 4ZXXH 2BLWA 3OAAD 1SSXA 3L6PA 5LPEA 3BTWE 2CMYA 1QL8A 4XFQA 1SLWB 2VU8E 2ZDLA 4FVBA 1SMFE 2KR7A 1MTUA 1HIAA 4K3JA 4BAMB 1S0QA 2XCNA 8ESTE 4A1TA 1C5QA 1AZ8A 4IN1A 3GDVA 2A31A 4K1SA 2G51A 1O2XA 1QL9A 4M9FA 1E1QD 1E37B 1G3EA 1AE8H 1SFQB 3GCTF 1O5FH 2KAIB 3K9XB 2KCAA 1AN1E 1TPPA 3RMMH 1JBUH 3RXKA 3STIA 4FUEA 1YC0A 2KX4A 2ZFRH 1TBQH 1ZHPA 4F49A 2J95A 2SGQE 2F9PA 3QO6A 1TOMH 2LP6A 4GCHG 3U8TH 1W0ZU 2Z3EA 1L1NA 1IQMA 1Y3YA 2ZNKH 4Y7AA 5DGJA 4F55A 3BG4C 2HGTH 1O2WA 3BTME 1H4WA 1C5NH 3QZRA 1EAWA 2ZC9H 3UQOA 1ZMLA 2O8UA 5F8ZA 1Y5AT 2UUJB 5AFZH 1M9UA 1OSSA 2BX4A 2V0BA 4RI0A 2FPZA 1RXPA 2WPDD 1KLJH 2FZZA 1Z1JA 4P00A 1FLEE 3EE0B 2FX6A 4X2WA 3RXPA 3OTJE 4YO9A 2BQ6B 1C2IA 2WHXA 1AVGH 1S6LA 3PV2A 3ZZDA 2WPLS 3UWIA 4ABGA 1G32B 3UNQA 2W6JD 3M3SA 3QX5H 2PUQH 1LMWB 1QB9A 4B73A 1P05A 3RXQA 3RXSA 1FN8A 4DGJA 4F48B 4UFFH 2ZCLP 4Q80A 1PFXC 3LGYA 1ZZZA 4UE7H 2NU4E 2HVYB 1AZZA 2ZPQA 1XVMA 1Z8IB 1V2VT 3UY9A 2ZG0H 5CHAB 1DFPA 1SB1H 1VITH 2GT7A 1JWTA 3MO6A 3PMJA 1SGIB 1ELBA 1GPZA 1TBRH 2J38A 3T5FH 1TLDA 1TNGA 2ASUB 3CP7A 4MDSA 3HGPA 2A4QA 3FO8D 3MH6A 3GICB 5HIYA 5EQQA 3GCTG 4BTTB 1KXBA 1NFYA 2B5TB 2G5NA 1O5CB 1GMHG 1N8OC 5C0TA 4O9VA 2RG3A 2PKSB 4ACBA 3FP6E 2XWAA 3DA9B 2YMSC 3VB7A 4I8HA 1D3QB 1GBLA 1W14U 1Y3WA 2ANYA 4YOGA 5JBBS 3QLPH 4KTSA 2SGPE 3A83A 1C5XB 1EAUA 1JIRA 3GY4A 2W6ID 5C2ZA 4JZIA 1CBWB 1YY3A 3RXBA 4CRCA 1GDUA 1O35A 3NRLA 1D3PB 2RFKC 1XUFA 2F4LA 2GGVB 1UMAH 3ATKA 1WOFA 3V12A 1RTKA 1GL1A 1XUJA 4JZFH 5E8EH 3KQ5A 3KF2A 1H8ED 1O34A 2WPHS 2P94A 1E34B 1OP2A 2OLGA 1XKBC 1ZTJA 3HGNA 3VGCB 3M7TA 1GCDA 2EI6A 1P12E 4B74A 3UQVA 1V2PT 1W11U 4CR5A 2QIQA 1AWHB 1GI9B 2HRVA 3EA9A 4KTUA 4Y71A 1QQUA 4ZHAA 5J4QA 2Y81A 4MNXA 5AF9H 2WINI 2WV9A 4MQAA 2ESTE 2VIPA 4X8TH 3ZZ4A 3A7ZA 1LVBA 2G00A 3ZVDA 1GMDF 2ZEBA 4O3TA 5E0GA 1ELTA 2K8IA 4J2YB 1XXFA 1C5YB 2ZTZA 1AUJA 3GDUA 1DXPA 2TGDA 2W3IA 3ITIA 1TABE 3E8LA 4I31A 3UFAA 2PLXA 1MTSA 1IQEA 1P3CA 1RD3B 2JH6D 4GPGA 4YXWD 2V7QD 3MNBA 1V2QT 2F43B 1LHGH 1DY8A 1VR1H 1EX3A 2BLVA 1YPLH 3RXCA 3I78A 3TJVA 5EGMA 5A0CA 2F91A 1GBKA 1SGNE 7GCHG 2GZ8A 4FUHA 2IPQX 4Z6AH 2YMSB 3VEQB 3ZVGA 2ZCKP 1GMHF 1OWJA 2P16A 1S83A 3BEUA 4CRDA 5B6OA 3QZQA 6GCHF 5ETXA 1UK2A 1A5IA 4X2XA 2ZDNA 4DIIH 1MKXH 2G8TA 1E38B 4X6MA 1O5GH 4D7FA 1CQQA 3ZZ3A 1QZ8A 1C5MD 5CE1A 3VPKA 1EB1H 3FOAA 4FUCA 1NRRH 1CHGA 1GJAB 2O8TA 1GHBF 2QXIA 2P59A 4DW2U 2PGBB 1LQDB 3WW7A 2UUFB 1VITF 4KKDA 2SNWA 1AU8A 4NIYA 1H9IE 4GHQA 1X7AC 1XXDA 1C2HA 1EJAA 2VINA 1EFRD 2AIPA 3FAOA 3K65B 3EA8A 1K2I1 1LKBA 1N6YA 3LOXA 1G3BA 4ISNA 3GCNA 2BY9X 1P57B 4ABJA 1MZAA 1SGFA 3SGBE 3AK5A 1GHZA 1ETTH 1MH0A 3HKJB 1CGHA 2FO9A 5DG6A 2BHGA 3BEIB 1C1UH 2A0QB 3QTOH 2ZFFH 1EATA 1KY9A 4UFDH 1W7GH 2EC9H 3DCLA 1Z8GA 1FY8E 2ZFTA 1HGTH 3PYHA 1A2CH 1S85A 3BTEE 1V3XA 2QAAA 2BMGB 1QY6A 4GSOA 1GBEA 3MFJA 3LIWA 4Q7YA 3N99A 4FXGH 3MH5A 2KZ4A 3OEHD 2PUXB 5CHBA 5FHTA 1YPHC 2ALPA 1D3DB 1SQTA 3LC5A 1SGCA 1LKAA 3CS0A 2W5EA 3LGTA 4Y76A 2QCYA 1PPFE 1P09A 1CHOG 1HJ8A 3OX7U 3SJOA 1LVOA 2F9VA 1P2KA 2H5CA 2XC4A 1DUEA 1KTSB 2WSSD 1KLTA 2THFB 2CHAC 1C2FA 2PSYA 4J1YA 1EZXC 1DE7H 1NM6A 2ALVA 3M7QA 5K0HA 2BDIA 1Z6EA 1RJXB 4TPIZ 1ZRBA 1OS8A 5LGOA 3BV9B 1O2MA 1TA6A 1TE0A 4D7GA 1A5HA 2BDBA 1WAYB 3SNBA 3TPIZ 2SNVA 2AMPA 2SGDE 2Z6BD 1DUAA 1UTPA 1FQ3A 1F0SA 1L1GA 1NU9A 1QB6A 4X6OA 3ZV9A 4A1VA 4FOUC 2C8WB 4ABFA 3G01A 1O39A 4TYDA 2K1QA 5T3HA 4ISIH 3H7OA 1P2OA 1PPEE 1O3EA 3HATH 4B6FA 1TGTA 2FOEA 1G36A 3SI4H 1FNIA 2C8ZB 2NU1E 3U98H 4FU7A 4WH6A 2J34A 2BDYA 1LHCH 1UO6A 1ARCA 3IITA 1QJ1B 2Z7FE 3PRDA 3SJ8A 1ZGIA 1TGCA 1HRTH 4DY7B 1G37A 2XBYA 2FOBA 4I33A 2O8LA 4E7NA 4ABAA 1BTZA 5GJ4B 3TGJE 1TFXA 4JYVH 2D26C 4SGAE 1SPJA 1UVSH 3TJOA 1VITG 1ANDA 1YP9A 1A0JA 1HAVA 1ZMNA 3RDZA 4TT3D 1O3LA 4NIXA 3A8BA 1S6FA 1H1BA 4FU9A 5EODA 1O2IA 3KHVA 3NKKA 4RT1A 2XNDD 4JZDH 3T28A 2OQUA 5GDSH 1A3EH 1KMHB 1C2JA
chains in the Genus database with same CATH topology
3P17H 1C2MA 1O3HA 3D62A 4OS7A 2ZHDA 1LPZB 1L4ZA 3EQ0H 3I29A 1TALA 1AFEH 1MQ5A 3LPRA 4R8TB 2QXJA 1YPEH 1GVLA 3NPSA 3P92A 1NZQH 3BTQE 1ZGVA 3SGQE 4ISHH 3VB6A 1A61H 1AIXH 1UTJA 1WBGB 5EQSA 2G52A 2FMJA 3GY6A 1ZPBA 1CBWC 5F03A 2VGCC 1HAOH 1KDQA 1S5SA 4CBOA 5L6NH 1EPTA 3B8JA 1W0YH 4ABIA 5I25A 1Y3UA 3BTGE 1WYKA 3SU1A 5HXFA 3OSYA 3VXEH 1V2OT 2R2WU 1O5BB 1QCPA 1CSOE 2QY0B 1O3MA 1C1VH 1RGQA 2XBVA 3SU2A 3RXOA 3UTUH 1C5TA 3Q77A 3HPTB 3M3TA 1T7CA 2DUCA 3O8DA 4MPUA 2AGEX 3PROA 2HLCA 1K1JA 1ZJKA 7GCHF 4JK6A 3FZDA 3ZZCA 1ACBE 4LZ4B 1FPCH 4U2WA 2AGGX 2UWOA 1Y5BT 1UTMA 1UCYE 2GT8A 1THSH 2VB0A 3EAJA 3DFLA 1O2NA 3LGVA 1OWKA 5C5OA 1IHTH 2BVXH 2Q1JA 1F2SE 1LO6A 4DIHH 1IQHA 1T8NA 3U1IB 1J8AA 3GCHB 3U1JB 1FY4A 1C5OH 1AY6H 1ZHRA 1DX5M 1F7ZA 1LCYA 1GHBG 2ZCHP 3RXGA 1YPJH 2VIWA 5A8XA 4CBNA 2G4UA 3BEFB 2R3UA 4D76A 1TBZH 1O3FA 1HJAB 2Z9KA 2V35A 5DJ7A 1OKXA 2ZP0H 1ABIH 1BUIA 1C1NA 1MKWH 2GCTC 1YKTA 5DKMA 2PR3A 3FVFB 1OYTH 1WQVH 5GPIB 1GHYH 2B8OH 2CV3A 2F9BH 3UNRA 1GJ4H 3P6ZB 2SGFE 1L0ZA 2Z9GA 3Q3KA 4XDEA 4BAKB 1YM0A 3P8OA 3O8RA 4CRAA 3SN8A 2CF9H 2FI3E 4M7GA 1O37A 2VGCB 8KME2 2R0LA 1V2ST 2BVRH 4D9QA 4OS4A 3SUGA 2TBSA 1RTLA 2GV6A 5T6DA 5FPYA 1AI8H 1FDPA 2OD3B 1SOZA 4BTUB 1NPMA 1WV7H 1Q2WA 2JKHA 4GAWA 4VGCC 3ZVCA 1FAKH 1EJMA 1QR3E 5EPYA 4WF8A 5ABWA 4ZAEA 3B9FH 2BXTH 1HAPH 2P3TB 1C1WH 3UPEA 2AMQA 4UEHH 1EAIA 1GCTB 2BXUH 4Y0ZE 1ARBA 4CREA 1HAIH 1HPGA 2BM2A 1UK3A 1TOCB 5LH8A 1OX1A 2I6QA 1S0RA 2BD4A 2BB4A 4ISLA 2WPKS 2EA3A 5C1UA 3AAVA 2B9LA 1BTYA 2ZO3H 3T25A 1GI4A 5L2YH 1XUHA 2OTVA 1C5PA 1O3PB 3PWBA 3MNXA 4FUIA 2OINA 2TPIZ 2FXRA 4Y8XA 6LPRA 3BG8A 1NS3A 1O2HA 1EP5A 1NFUA 1ORFA 4LK4A 3W95A 3OYPA 2ANMH 3GY2A 3W94A 1GJ7B 1YPMH 2ZQ2A 5A09A 1XMNB 1HAHH 3SU6A 1IQIA 3A7WA 4ZXYH 2ZF0H 1C1MA 3R0FA 4LXBH 3MI4A 3DT0H 2GDEH 2V3HH 1EB2A 1F0TA 2HNTC 3F9FA 3RXEA 1BMLA 3BTFE 2STBE 4H42U 3ZYDA 1O32A 3ZVAA 4AB9A 2AS9A 1B0FA 3T27A 1BTXA 1KXDA 2ZPRA 3RXUA 2GZ9A 4NSVA 1ANEA 5C67A 1WUNH 2H9HA 3KCGH 3LGIA 3QTVH 5LPRA 6CHAB 1SGFG 2YNAA 5PTPA 1NRNH 1TNKA 4FUDA 1TNIA 2Z3DA 1BZXE 4U32A 3M7UA 2UWPA 1IQJA 4THNH 2GMTB 3ZVFA 1T31A 3M36A 1YF4A 2AFQB 4B71A 3SUEA 4MLFB 4ABEA 2C4FH 2BTCE 4ABBA 1DM4B 2AERH 4OS1A 1O38A 2XYAA 1C1QA 2QV1A 3A7TA 4K1EA 1XUGA 1VCQA 1O30A 1FI8A 3F1SB 1PPBH 2BX3A 5FXLA 3UREA 3RLYH 1SLUB 3E1XB 3GOVB 4PROA 2Y80A 1FIZA 5JB8S 1FJSA 2ODPA 4YESB 3SU0A 1ZPZA 1CT4E 1DLKB 1G30B 1Z8JB 1SGRE 1Y5UT 4BAHB 2BDHA 3PLKA 1J9CH 3V0XA 2ZTXA 1YLDA 3PV4A 3PB1E 5JPMH 1QL7A 4JZ1A 1IHSH 1N8OB 3CS7A 2FYRA 3ZV8A 2FOCA 3A7YA 5TCCA 4MPXA 1HAVB 1LVYA 1BITA 1ZPCA 4B2AA 3M5MA 3TITA 4XBCA 3URDA 4AFUA 3RXMA 2FLBH 1A5GH 2BZ6H 1JMOH 1AQ7A 3ZZ9A 5GWZA 1UHBA 4D8NA 1HV7A 4UD9H 3L3TA 4Y7BA 1T8LA 5BRRE 1JRSA 1AVXA 1EZUC 2FLRH 2H5DA 3BTTE 1MKXK 3H7TA 4NIWA 1ETRH 1P03A 2QN5T 1TGNA 2ZGHA 3KN2A 5DP4A 2AYWA 3TH4H 1V2TT 4AOQA 1GI5A 1TQ0B 1NESE 1P2IA 4KELA 5F8XA 1TA2A 2PKAA 3HK6B 3E91A 1B5GH 3K2UA 1BTWA 5JBAS 1NRSH 1ZTKA 2XW9A 1T8MA 1D9IA 1FMGA 4UDWH 1P01A 3U69H 1INCA 1HYLA 1V2MT 2ZU5A 2WPIS 4X1PU 4MNWA 2OP9A 1AFQB 2FX4A 4CHAB 1S82A 3FFGA 2ZGBH 5FBIA 5AFYH 1FUJA 1TNJA 2VJ1A 4BANB 3RXRA 1TPAE 3TK9A 1YCPH 1AKSB 4IC5A 3BF6H 3LJOA 1GBMA 1MU6B 4YTAA 1BHXF 1MD7A 2AEIH 1ZJDA 1O3JA 1SQAA 2WUCA 3P8FA 4UFEH 1BDAA 1YBWA 1MZDA 3LONA 1O3AA 3ATMA 4RSPA 1W13U 3URCA 2NU2E 9ESTA 1GBDA 3RU4D 1ELGA 1QNJA 1GGDC 3NCLA 1FIWA 4DCDA 1GVZA 5IYTA 1DWCH 3PLPA 3EYDA 5G4BA 3GCHC 2FOFA 1MCVA 5H4IB 3SNAA 1IQLA 1QBNA 9LPRA 2PFEA 1BRCE 2JETB 1C5SA 5EU8A 1EP6A 3SJKA 3S9BA 4Q2KA 1GBAA 1V2NT 3SO3A 2EEKA 2BD8A 4FUJA 4BTIB 2RA0A 4WVPE 4TY7A 2G81E 2Q6DA 2J94A 3RM0H 4FUBA 3SHAH 1SR5C 2D8WA 5DO4H 1K28D 3E90B 1XUIA 2C93B 3IG6B 1G2LA 2TGAA 1P04A 1AGJA 1ETSH 1ZR0A 1PQAA 1V2WT 1GJ9B 1O2PA 3MHWU 3UR6A 1GL0E 1WSSH 2H6MA 5EPNA 5EXMA 1ELVA 2XTTB 3F68H 2Q6GA 3A80A 1SOTA 4JK5A 1TGBA 4HI3A 2QXHA 1QIXB 1V2UT 1C1TA 1AFQC 5DPAA 4CHAC 2F9NA 4DG4A 1UCYK 2HPQH 4JZEH 3KL6A 3AW0A 1JXPA 1D6WA 1YCPK 1O5EH 1TYNA 2QA9E 3VB4A 1CA8B 4OGYA 2BY7X 1H8IH 1BOQA 4YT7H 4TWYA 1JOUB 3RP2A 4ZROA 2Z94A 1GJ6A 1IQFA 2ZHQH 3E0NB 1O2ZA 4DVAU 2UUYA 3SNDA 4X1RU 3SV6A 4OS2A 3LH1A 2OUAA 4FUGA 4R0IA 1AUTC 1HLTH 1ELCA 1IOEA 1QFKH 2QC2A 3BTKE 2BD3A 3ODDA 4DJZB 4WH8A 1DY9A 1QA7A 2ZDMA 1CU1A 1E0FD 2WV4A 2AIQA 1ANBA 2OBOA 1ZSJA 2FM2A 2WUBA 1MBQA 1A46H 2FS9A 1V6DA 4HGCA 1RFNA 1WTGH 3EA7A 4SGBE 1MTNC 2PGQB 1QB1A 2ZPSA 1BCUH 4JMYA 4BNRA 3TVJB 3PO1B 2XNIA 4NGAH 2JH5D 1ZSKA 1D3TB 2XXLA 1GBIA 1FPHH 1NU7B 1GBBA 1VGCC 3RMLH 2A7JA 1TWXB 4ZKOU 1VJAU 2KAIA 1KXEA 4NG9H 2XWBI 2Y7ZA 4K2YA 2O9QA 1RRKA 3T29A 4CH2B 1W12U 2XCFA 2ZIQH 1H9HE 3C27B 1QJ6B 4ZUHA 2GV7A 1C9PA 1DANH 1EXFA 1H9LB 2F3CE 1HIAB 2ZWLH 3Q00A 3TH2H 1BTHH 1AKSA 2CXVA 2GDDA 1OYQA 2A4GA 5T6FA 3M5NA 2CF8H 2R2MB 2C8YB 2XC0A 2ZGXH 1MTVA 2W3KA 1HAXB 3ZZBA 2GMTC 4UFGH 1NT1A 2ZU3A 4X1SU 3MO9A 1GG6C 3MH7A 1DWBH 3A7XA 1O33A 1O31A 3V3MA 5CMXH 2FESH 3S0NA 1HUTH 4YOJA 1RIWC 2VWOA 1K9OE 2FOHA 1CE5A 1SBWA 3GY7A 3ZZ8A 3A88A 1EASA 4AX9H 1O3BA 2ZHFH 2FIRH 4B1TA 3IWMA 4X8UH 1PQ5A 3SI3H 1V2LT 1FXYA 2V3OH 3A84A 3SQHE 1GI7B 2A45B 1O2JA 1TB6H 2FI5E 2H2ZA 1YYY1 1C1OA 1QJ7B 4Y10E 3E6PH 1P2MA 1DSUA 2OC8A 4AZ2B 1PQ7A 2FWWA 2VVUA 2Z3CA 3RUOA 1BB0B 4NA8A 1K1LA 2GD4B 2ZU2A 1AB9C 8LPRA 1W8BH 3A8DA 1O2SA 3K6ZA 1NRQH 4DT7B 3M37A 1MTNB 2CN0H 3RXDA 3OY5U 2TRMA 1MKWK 1GMCG 4XE4A 3A87A 1JIMA 3SGAE 1A0LA 4CRFA 5HM9A 1GHWH 3PTBA 3KQDA 4Y6DA 4WY3A 4E7RG 1BTPA 2AMDA 2IJOB 1CGIE 5E0HA 5C5NA 2W26A 1O2YA 3SHCH 4LZ1H 2BDAA 1SGDE 1BRAA 3HKIB 1DOJA 1VZQH 5JBCS 2ODYB 1C5UA 3TK5A 4JYUH 1OWDA 2FDAA 4JYTA 1W2KH 3TH3H 4BXSA 4MPWA 3MO3A 2FEQH 3RU4T 1ZRKA 3KEEA 2GVFA 2YNBA 2IPHA 3RC6A 2WV5A 4Y8YA 1ZTLA 3LGWA 3MNSA 5DP7A 2LNCA 4A1XA 2H9EH 2P95A 1C4V2 3SU5A 1HNEE 4IC6A 4AORA 2XBWA 1EOLA 1C5WB 1GBHA 4I8KA 1TNHA 1GMDG 2P3UB 4XBDA 3QWCH 3RXVA 2BD5A 1IAUA 2NU0E 1Y8TA 1ZMJA 3RXLA 1FONA 3QGNB 1KXAA 1PPCE 2VWLA 3SUDA 4H6SB 1GJBB 3ZZ5A 1A3BH 1ZLRA 1Z6JH 3SU3A 1GJCB 2ZZUH 3LDXH 1KYNA 4ZHMU 1MAYA 2ANKH 4AB8A 1TMBH 1GMCF 4X2YA 1C5VA 1ZHMA 4YM9A 4ZH8A 4B2CA 1KDQB 1O2KA 4K5ZA 1SLXB 1XVOA 3TJUA 2VIDA 1K1IA 2VWMA 2VVCA 1T4UH 2JETC 2IN2A 3C1KA 1W7XH 1O2VA 3GISB 2XRCA 1D4PB 1FY5A 1E36B 1P8VC 1TMUH 2Z9IA 1J16A 1MAXA 1LTOA 4Y8ZA 1G3CA 1K1PA 2JH0D 3RXTA 4H4FA 5EQRA 3KGPA 1T32A 4AFSA 3BTDE 1AD8H 1LHEH 1C9TA 4MTBA 1XM1A 1TGSZ 3AVZA 2A5IA 4IMQA 4WWYA 1GVKB 3QGJA 1CA0B 1BJVA 1TX8A 2BY8X 5E2OA 1O2UA 3KNXA 1P2JA 3SUFA 3UOPA 1DT2A 1GBJA 3PTNA 7KMEH 3O8CA 3UUZA 1BA8B 1MU8B 1HXFH 3H5CB 4XSKU 1EAXA 1J15A 1KTTB 3VGCC 1EZSC 3SOSA 1O3OA 1EOJA 1QRZA 3M5OA 2B0FA 3DFJA 4GUXA 5JDUB 3E3TA 3S9CA 2IOTA 2A5AA 1GI8B 1P2QA 1C4U2 2G4TA 4O03A 3U8RH 1K21H 2ANWA 1K1NA 3BIUH 2ODQA 4AGKA 1BRBE 4TWWA 1O3KA 3DUXH 3MU8A 1EPTB 1WTHD 2BDGA 1P9UA 3E16B 1PJPA 1J17T 2M5TA 2HOBA 1THPB 2A1DB 1OPHB 1PYTD 4OS6A 1GBCA 2QF3A 1TAWA 1KSNA 3ATIA 5HGGA 3RXIA 1B7XB 2ZDVH 4RN6A 4WMFA 4NZLA 1GI6A 1FN6A 1P06A 2F9UA 3RXAA 1DSTA 2Y5FA 3QUMP 3NUMA 3ZZ7A 3Q3YA 3TNTA 4CR9A 1BMMH 1QBOA 1OWEA 2HNTF 1YPHE 2LPRA 1GHXH 2BD7A 3F9GA 4X2VA 1QA0A 4X8VH 1CHOF 4OGXA 3SJ9A 2W7UA 3PO1C 1L1JA 1UTNA 5L30H 1QBVH 5DP6A 2D2DA 3UR9A 2Y7XA 1SGQE 1FAXA 3GY3A 3GYLB 4ASHA 1TRNA 1QURH 2A4OA 1SLVB 1NN6A 5F8TA 3ZVEA 1GJ5H 1NTPA 3BG4B 1KLIH 3MYWA 4XBBA 1AMHA 1BBRE 4X8SH 1SGTA 3BSQA 3SNCA 1WCZA 4E06H 3EDXB 4YZUA 5JYIA 1ELEE 1HFDA 1G2MA 3GY5A 3KQCA 3S69A 3A89A 3V13A 3P8GA 4X1NU 4MNVA 1DICA 2A7CA 4I8JA 2QYIA 4A7IB 1UTQA 1Y3XA 4I7YH 3FZZA 1P10A 1UCYH 1UTKA 3R3GB 4INLA 4Q7XA 4RKOB 3SQEE 2I6SA 4MPVA 2PV9B 1SHYA 4FVDA 3MMGA 5A0BA 3NWUA 4INHA 1Z71A 4K1TA 1C5LH 1GG6B 5FCKA 1W3CA 4Z0KA 1ELAA 3TK6A 1IQKA 1N1LA 1O3GA 1F92A 2A2QH 3TNSA 3LH3A 2FP7B 3MU0A 1EUFA 5C3NA 3MOCA 1K22H 3V7TA 2C90B 3ODFA 1DWDH 2BOHB 3VB5A 2ZU4A 3NXPA 4Y0YE 1ABJH 4IS5A 3U9AH 2PHBA 1PQ8A 1G9IE 4D9RA 2VH0A 1WQSA 1DS2E 1BRUP 1BHXB 3Q76A 1HJAC 1GHAF 2OC0A 4A5TS 3ZVBA 1PYTC 1FY1A 2SGAA 2BVSH 3Q3XA 1DDJA 1UTLM 1OP8A 1UTOA 1CT2E 1TPOA 2BLQA 3GYMA 2CHAB 1Y59T 1MUEB 3CENA 5FAHA 1OWIA 1KIGH 1AHTH 1EL