1DLEA

Factor b serine protease domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
298
structure length
288
Chain Sequence
ADPDESQSLSLCGMVKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords COMPLEMENT FACTOR B
publication title New structural motifs on the chymotrypsin fold and their potential roles in complement factor B.
pubmed doi rcsb
total genus 52
structure length 288
sequence length 298
chains with identical sequence B
ec nomenclature ec 3.4.21.47: Alternative-complement-pathway C3/C5 convertase.
pdb deposition date 1999-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dleA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dleA02
3SJ8A 1Z8GA 1O0DH 1ZJDA 3OU0A 5E0GA 4AFQA 2SGEE 3DT0H 1V2VT 1E35B 1TFXA 1EJAA 1QBVH 3STIA 3SJIA 2I6SA 2P59A 3GDVA 1SFIA 2J95A 1B0FA 1BBRE 2C8WB 2B7DH 4Y7AA 5JDUB 4B71A 1YCPH 1C1VH 1PPEE 2STAE 3A8AA 4ISOA 3BN9A 4Y6DA 3RP2A 5L2YH 1J16A 1FMGA 1PQ7A 2K1QA 1Y5BT 1GDUA 3RU4E 5C5OA 1NO9H 2CMYA 2OLGA 3SV6A 4OS5A 1PYTC 2VWNA 1PPBH 4X6NA 1BRUP 1W2KH 4UDWH 5DKMA 1C2GA 2BY6X 1O2JA 3FFGA 5E0HA 1A5IA 3GCOA 1BTXA 3SORA 1HAVA 1PPHE 1FY5A 1O2ZA 3SUGA 1NU9A 1HAPH 2FO9A 4YT6H 1G3DA 3CS0A 4GSOA 5C1XA 3L3TA 4DOQA 3RC6A 2EI8A 1GMDF 5EQSA 1KLJH 3RXKA 1A0HB 1ELDE 2BQ7B 3T27A 1K22H 3KL6A 4UFFH 3SU3A 1WQSA 5EQQA 3U98H 5BPEA 5C67A 2TIOA 3E91A 3UQOA 1BMMH 3MFJA 1GHVH 2ZDLA 1RTFB 2BD3A 2BD9A 1S83A 1G2MA 2HRVA 1C4U2 3GISB 3KQDA 4O3UA 2CHAB 1FDPA 2FOGA 3ZZ4A 1K21H 1DLKB 1FNIA 4HGCA 4WMFA 1GBHA 1OP0A 1QJ6B 1HAOH 1J15A 1E36B 1GMCF 1GMHF 2QXIA 1Z7KA 2XWBI 3ZVDA 2A4QA 1QGFA 4ZKRU 2BZ6H 2Y5GA 4IN1A 1G37A 2Z3EA 2FS9A 1AUTC 1O36A 3UOUA 4TWWA 1TNKA 2FESH 1SGNE 1HCGA 3A8DA 2GDDA 1V2UT 4JZIA 1Q2WA 1WTHD 2FOHA 3SQHE 4NA9H 2Z9KA 1LQEA 1EAUA 1D4PB 3KIDU 4MPWA 3V0XA 1TLDA 3IITA 2G55A 1T32A 4NCYA 4UEHH 2O8UA 1QB1A 4JMYA 1P04A 1Y3YA 1GJ4H 1P9UA 3A7VA 1QJ1B 4VGCC 3GCHB 5A8ZA 1O2GH 1MTSA 3Q77A 1YLCA 1C5NH 2BVRH 1YLDA 2BDHA 5F03A 3DA9B 2W7SA 3SHCH 3EA8A 4K3JA 4FUJA 2ZCHP 1ID5H 1W13U 1SGQE 4JYUH 2G52A 3ZZ3A 2CJIA 2WPJS 2KAIA 3A89A 1O2MA 3I29A 1HAXB 1NN6A 2XYAA 4UFEH 6CHAC 2Y5FA 3RXOA 4ABIA 4MNXA 1OP2A 4NZQA 4O3TA 3RXEA 3G01A 1LPGB 2H1UA 3LIWA 3TH3H 1XKBC 2ZDMA 1EJMA 4NIXA 5ABWA 2GX4A 2TRMA 3VFEA 1UTMA 3GY6A 3TNSA 1OWHA 3SNEA 2Q6DA 5E0JA 1RIWB 3SJ9A 1AFQB 4TPIZ 1LHDH 1KXEA 2BD2A 1IQMA 1O5BB 1CBWB 4I8JA 5HMAA 1BQYA 4K8BA 5LPFA 1JOUB 2ODYB 3A83A 3RXUA 3ATMA 3TNTA 4JYTA 2P95A 1MQ5A 4E06H 1O34A 3LPRA 3UREA 3F9GA 3LOXA 1RS0A 1MTUA 3QTOH 3ZVGA 2WUBA 1GBDA 2VIDA 4KP0A 4ISHH 3BIVH 1A3BH 2V35A 1W0YH 4WVPE 2QAAA 3LH3A 2G81E 3RXCA 1SQAA 1O31A 1QB9A 1V2OT 3GY7A 1QHRB 1K1LA 1NROH 4CR5A 2ZHDA 1TBZH 1SQOA 2M5TA 1Z1IA 1P12E 4BNRA 2BDBA 1GHYH 1HJ9A 1P9SA 2FWWA 4IC5A 2PSXA 3LONA 4ABEA 1A46H 2PV9B 1P09A 3M7TA 1ZPBA 2ZFFH 5ESBA 3LH1A 2THFB 3NWUA 3RMMH 1UTLM 1IHTH 1O2HA 2PFEA 4Y8YA 4U2WA 2B0FA 5CHAC 1EKBB 1AIXH 2BD4A 1XVOA 1GBLA 3F9FA 4QT8C 2AIQA 1UTPA 1SHYA 2SGQE 3ZV8A 2O8WA 2BLVA 1K1IA 2FTMA 5F6MA 4YTAA 3AAUA 1AZZA 2BY8X 2BDIA 1W11U 2A2QH 2ZNKH 1Y8TA 2WUCA 5A8XA 2O8LA 2G4TA 2GZ7A 1AU8A 1UVUH 2ESTE 1N8OB 1O5DH 5AVDA 1YCPM 5T3HA 1QFKH 1WV7H 4DW2U 3BTME 5EODA 1IQHA 2H5DA 1TONA 1U6QA 2AFQB 1L0ZA 1O2QA 3DUXH 3GCTF 1IQKA 2GCHF 3BEIB 1HAVB 1BRBE 5FCKA 2XNIA 3BG4C 1P2OA 1BUIA 5GCHG 4B75A 3VPKA 4OS6A 5T6DA 2UUFB 4K1EA 2FOAA 1CHGA 1SGCA 3M35A 1P11E 2EI6A 4FU7A 4Y71A 4AZ2B 1EZXC 2YNBA 1SL3A 1O5EH 1OWEA 3TJUA 3UFAA 1TYNA 2P94A 2SGAA 1V2PT 2JETB 1TRMA 1DWBH 1TA2A 4H6SB 1KTSB 2Q6FA 3C1KA 1O3IA 2FPZA 2GVFA 4K69A 2BDGA 4FUGA 3PWBA 1BBRH 1G9IE 1SQTA 3ZZCA 2BQ6B 2WPIS 3DD2H 4A1XA 5A0BA 4CHAC 4DCDA 2ANWA 1HJ8A 1SI5H 1GCTC 2F91A 2OC1A 1C5MD 1HJAC 4INKA 3UOPA 3MH4A 4MNVA 1EATA 2P8OC 2Y81A 4ISLA 4YO9A 1OX1A 3UY9A 1O2XA 1D9IA 4DGJA 1F0SA 5JB9S 5PTPA 2RCEA 1L1GA 4NWLA 1GHZA 2QN5T 2ZI2H 3RXIA 5E8EH 2WPLS 4Y8XA 2BY5X 4I8LA 5BRRE 3NXPA 2XC4A 3AW0A 5DP6A 2F9VA 2YOLA 1TX6A 1NY22 2IPHA 3BTKE 1MD8A 3GY8A 3BTFE 1C5XB 1DOJA 1SBWA 6LPRA 4Y10E 4A5TS 3I77A 1UVSH 1C2KA 2VNTA 1C5PA 1B7XB 4GPGA 1ZTLA 2HNTC 3A7WA 2BDYA 2F3CE 2BDAA 2ZHQH 1Y3XA 1NFXA 3RLWH 3NCLA 4ZKNU 1GHAF 2TGPZ 1KXDA 5J4QA 3PTBA 1PQAA 5HGGA 1GBIA 1PPGE 2KAIB 2G8TA 2BOKA 5JBBS 1OS8A 3H5CB 5DP9A 4Z0KA 2OD3B 2NU2E 1C5ZB 2BLQA 3GYMA 1W3CA 2CV3A 1GI5A 1E37B 2XXLA 1TOMH 1DM4B 1AZ8A 1ZGVA 4I33A 1C1NA 3BTGE 4B2CA 4WJG2 5LPRA 1HNEE 5FPSA 2OTVA 4BOHA 4TYDA 5CHAB 1MCTA 8KME2 1EX3A 1O3KA 4KTUA 3MTYA 1CE5A 2D2DA 3UNQA 1GJ8B 1HXFH 2VJ1A 2Q6GA 3NKKA 1E34B 4B2BA 1RFNA 1UJ1A 1SMFE 4FUEA 3KF2A 4UD9H 2JH6D 2VH0A 5G4BA 3UPEA 1VITF 4IC6A 2C93B 2B5TB 4K60A 1OWDA 1JIMA 1YGCH 2AMQA 1V3XA 2PGBB 1LO6A 2VINA 4SGBE 1EQ9A 3RXTA 4ABHA 4CR9A 1SGDE 4BAMB 3LGUA 2GP9B 1WOFA 3HKIB 2UWOA 5DP8A 4ESTE 1OKXA 1FY3A 3VB5A 1ZSKA 1C1OA 1NRQH 1DPOA 1DY8A 1LMWB 1O5AB 2ODQA 1NC6A 2VWLA 1KDQB 1O3CA 4ABJA 1YPKH 1CVWH 2ULLA 1SR5C 1VGCC 1AE5A 2JH0D 4NFFA 4Q7ZA 4U32A 4ASHA 3SUFA 1EAIA 1O3JA 3HK3B 3PMHB 2GKVE 1QURH 1P2MA 2FLRH 5FHTA 3RLYH 3VEQB 3TVJB 2OC7A 4Q80A 4H6TA 1QQUA 1O3PB 1OXGA 1C5SA 2NU0E 1G30B 3TPIZ 4IBLH 2HGTH 4AYYB 4E7RG 4B76A 5B6OA 1HJAB 4NFEA 3A87A 4AFZA 1ZMJA 2P8OB 1DXWA 4JZFH 1S85A 1CGIE 2OC0A 1JWTA 2C4FH 2H6MA 3T5FH 1S82A 2FX6A 3Q00A 1SC8U 4YESB 3MNCA 1L1JA 2ZGJA 3NUMA 3AAVA 1TIOA 5F8XA 5C3NA 2V0BA 5T6FA 3S9BA 2FOBA 1HIAA 1AGJA 3SW2B 2R3UA 3M5NA 5HYOA 4RN6A 4AX9H 1C4V2 2Z9LA 1C1UH 2CHAC 3UQVA 1HUTH 4FUDA 4MDSA 3V13A 1A5HA 1AQ7A 1CHOG 4IN2A 5FPYA 1RD3B 2BQWB 4D9QA 1GI1A 3KQBA 1KLIH 1AKSA 1E38B 2FP7B 2V3OH 1ANCA 1ZOMA 4JK5A 1CGJE 1UK3A 1GHXH 2PGQB 1O3GA 3M3TA 3PMAB 1ELTA 2OQUA 3VGCB 4NIWA 1UO6A 1C4Y2 2CXVA 4WXIA 2O8TA 1DWEH 4GCHF 1GDNA 2P93A 1OP8A 1P57B 4AG2A 2Z9IA 5JBTA 2TPIZ 1GBMA 2ZDAH 3MH7A 2BOHB 2I6QA 5DPAA 3RXVA 1EZQA 3QO6A 2H2ZA 3GCHC 1LTOA 1RTKA 1PFXC 4GAWA 4DJZB 1O2LA 1EPTA 1T8NA 2BTCE 1LVBA 1TBRH 1F2SE 2AMPA 4AORA 1INCA 3ZZ8A 3ZYEA 2ZTYA 3GY2A 3S0NA 3VXFH 3O8CA 4GLYA 3P8FA 1O3NA 4PROA 5FCRA 1GHBG 4FUFA 3EA9A 2WPMS 1UK4A 3DFJA 4E05H 1AUJA 1AMHA 3TK9A 2A45B 3LGYA 5EPYA 1ZRBA 2BDCA 1ZJKA 2D26C 1GVZA 1RIWC 4CRAA 1AFQC 2R2WU 3QGNB 5C5NA 1CBWC 3BIUH 2XBYA 3VB6A 1AD8H 4BAKB 1EB2A 4X8VH 2QC2A 5EXLA 1PPFE 1WU1A 4K2YA 2Z3CA 1N6XA 1ANEA 3ZVEA 1ZSLA 3A88A 2R2MB 1A0JA 2UUKB 3RXAA 1DSUA 1YP9A 1D3DB 2OC8A 1EJNA 1EPTC 1TPSA 1T8MA 6GCHG 1ZPCA 1GI4A 1P03A 3PROA 4DVAU 1TPAE 2HOBA 2ZU1A 3OY5U 1VGCB 2VIPA 1YPHE 8GCHG 4K1SA 1K9OE 2FI4E 3ATKA 1PJPA 2VVVA 1O3HA 1K1OA 2VB0A 3ZZBA 2WYJA 1KY9A 3BTDE 3QZQA 1TNLA 4U30A 1F92A 3TJOA 1A1RA 1X7AC 3BG8A 1V2KT 1P0SH 2WYGA 2P3UB 2FS8A 3SHAH 1TAWA 1K1PA 1L1NA 2FDAA 4YOJA 3NK8A 1H9HE 2CF8H 3ZZAA 1K1MA 3TU7H 1DLEA 3AASA 4LK4A 4I31A 5L6NH 1DFPA 4KGAA 3MU1A 2PHBA 3F1SB 3RM2H 1GBKA 3QX5H 4NA7A 1N8OC 2OP9A 2BX3A 1ESAA 4X2XA 1LPZB 2J94A 1SLUB 1BT7A 1VR1H 3A8BA 1NTPA 3ZVCA 1FI8A 1HAZB 1C5OH 1Q31A 3E1XB 1C1RA 1DX5M 4INLA 4Z6AH 1GI2A 1AWHB 1XMNB 3RXBA 1H9LB 4FVDA 3QLPH 1C9PA 3MO9A 1O37A 1S6FA 3SZNA 4XE4A 4ABAA 1UVOA 2HWLB 2HNTE 1GI3A 3P17H 1O2KA 2ZQ1A 1GJBB 1CGHA 4Y0YE 1JMOH 1CO7E 1AWFH 3GY3A 3P92A 4WMDA 2JETC 1O5FH 3DHKH 3EYDA 1O3MA 1TMTH 4OS1A 2A32A 4FUCA 2ZHEH 4ZHMU 3QWCH 1LQDB 3SGQE 4UE7H 1D3QB 1BJVA 2PKAA 1HIAB 1FN6A 1TNHA 1K1JA 3MH6A 1QTFA 5FX5A 5HM2A 1SOTA 2Z6BD 1NS3A 2F9UA 1L4DA 3RM0H 2BYAX 3LC3A 3SO3A 1TNIA 1C2FA 2ZA5A 5A0AE 1O2VA 1XUHA 1W7GH 3HGPA 4X8TH 3P8GA 1AKSB 3ESTA 2VWOA 1O2NA 1GI6A 4X1NU 3RXHA 1SGTA 3HATH 1FQ3A 1G2LA 3FVFB 3U9AH 4AYVB 4O03A 1BMAA 2Y6TA 1ANBA 2BX4A 1ETTH 1A3EH 2B9LA 2BLWA 3SU2A 1QA7A 5DGJA 1P2KA 3SN8A 5JBAS 2FODA 1MTVA 2VIVA 3VB3A 5A2MH 2XC5A 1BTYA 2G5NA 4NIVA 1NFYA 1GL0E 2PR3A 1QL9A 3MYWA 2ZPQA 3O8RA 1C2IA 2RA0A 1EPTB 3BTHE 2ZDNA 2GV7A 4ZUHA 3RC4A 4Y76A 2A5KA 2AYWA 3A7YA 1TGSZ 2A7JA 1QB6A 1QRZA 1DSTA 1GI0A 2PTNA 4A92A 4B74A 2BD7A 2QA9E 1YF4A 5ETXA 2ZP0H 4XBBA 3TJVA 1KLTA 1RRKA 4X6OA 1SGIB 2Z94A 4AFSA 1EB1H 4CRCA 1O3FA 3SU5A 1ESTA 5L2ZH 4AG1A 3BTEE 1KDQA 3C27B 1EZUC 1FLEE 3BTTE 2XBVA 2R0KA 2ZO3H 1TGNA 2ZKSA 1EUFA 4MNYA 1O2OA 2V3HH 3SNAA 1YPGH 1V2LT 3PMJA 1LVYA 3Q3YA 5E2OA 3V7TA 1IQJA 5JYIA 3F68H 1QRXA 4Y11E 1ZMNA 1FONA 1ZGIA 4MLFB 2BZAA 2DUCA 1BBRK 2ALPA 1NFUA 2PWXA 3RC5A 3KN2A 4AGJA 1FIWA 2F9BH 3SNDA 4UFDH 1QBOA 3SV8A 5DG6A 3MMGA 4NWKA 4KTSA 5TCCA 2CF9H 3QN7A 1BZXE 7GCHG 1DANH 2BD5A 3UWIA 3Q3XA 3KQCA 5F8ZA 3U8OH 5DO4H 3FZDA 5GWZA 1FN8A 2WV5A 2F9NA 2PKSC 1GPZA 3PM3A 5IYTA 1SB1H 1YPEH 1YPHC 3L33A 3DFLA 1LPKB 1C1QA 4YLUA 4R8TB 4ISNA 1FXYA 2OINA 1YM0A 1JRSA 2P3TB 3LU9B 5DP4A 3T2NA 1N6YA 1TA6A 1TBQH 3ATWA 1NRRH 4X8UH 1OYQA 3QZRA 1O38A 1TGCA 5DP7A 2PW8H 1MUEB 1ZMLA 1NRPH 1HRTH 1Y3VA 4Y7BA 2OQ5A 4X2YA 4CREA 3TGJE 3URCA 3CS7A 1JIRA 3RXRA 4BTUB 1HDTH 1GJ7B 1XUKA 3S69A 1YPMH 7ESTE 5GJ4B 3T25A 4A1TA 1P05A 1FAKH 4FVBA 3SUDA 4ZMAH 1O32A 3FP8E 3K6ZA 6GCHF 2CGAA 3E6PH 4DT7B 2FOFA 2FLBH 1L2EA 2ZHWH 1W12U 4AB9A 2J38A 4CRDA 1ETRH 1XUFA 2B8OH 1IAUA 3ZVFA 1F5KU 5AHGH 2GCTB 1T8OA 2GGVB 1P2NA 3F9HA 1CA0B 1ELFA 3FP7E 1YYY1 1YPLH 1NRSH 1S6HA 1ZHRA 4IS5A 1GGDB 5I46H 2NU4E 1O33A 1OYTH 1A2CH 1XXDA 4F4OC 3QTVH 1SLWB 2PKAB 3GYLB 4KELA 3UR9A 1NRNH 3VGCC 1GBCA 1O3LA 4X6MA 2UWPA 4YZUA 1SSXA 3EE0B 2BMGB 8LPRA 4D7FA 3ZV9A 3ATLA 1Y5AT 2IN2A 1PPCE 2OXSA 3ZYDA 1O2WA 1DWCH 3BTQE 1BTWA 4WMEA 3VB4A 5EPNA 3HK6B 4ZAEA 2BD8A 2LNCA 1P01A 2H9TH 2Z7FE 1S0QA 2ZIQH 3A7TA 1GBBA 1GBEA 2R9PA 2XTTB 1MTNC 3QUMP 3AW1A 3TJNA 3SGAE 3MH5A 1MKXK 2GZ8A 4UONA 1WAYB 1BDAA 4H42U 1TQ7B 2H9EH 1TOCB 2EEKA 1BRAA 4TWYA 1DY9A 2ZTZA 1VJ9U 1GMHG 3T62A 5I25A 1V2WT 1QR3E 1GBTA 1YPJH 1ZHPA 1J14A 3RXSA 4K5ZA 1Z1JA 1BTZA 1SOZA 4Y79A 1LKBA 3U8RH 1WTGH 1UHBA 4NZLA 2ZCLP 2A0QB 2PSYA 4WH8A 4IW4E 1P3CA 1QY6A 2BY9X 2ZPSA 3ZZ7A 1HPGA 1GVLA 2ZU3A 3RMLH 3SJKA 3MHWU 3A7XA 1UCYH 1GBJA 5TJXA 4YLQH 2OUAA 5J4SA 2PKSB 1T7CA 1C2HA 2UUYA 2Y5HA 2STBE 1C1SA 3T26A 3GY5A 1MKXH 4LOYH 1D6WA 3UTUH 1O2SA 1B0EA 1XX9A 2SGDE 1AHTH 4GHTA 1HBTH 1C9TA 4OS7A 1HB0B 2ZFPH 3ENSB 1BMLA 2GZ9A 4X8SH 2A4RA 5JBCS 1P10A 4MG3A 4NA8A 1UTNA 3R0FA 1O3EA 3FAOA 3MO3A 4X2WA 4MNWA 1O2YA 1ARCA 3T28A 1YKTA 1BIOA 2ZPRA 1EP5A 1DVAH 3K9XB 1W8BH 2QYIA 3LJJA 4FU9A 1SFQB 2ZU5A 5LH8A 1C2MA 3SU1A 1BTUA 1W10U 3EAJA 3Q76A 1GVKB 4XSKU 2Z3DA 3URDA 3CENA 2GTBA 1BHXB 1HXEH 1ABJH 1ABIH 1LVMA 1FZZA 1IQGA 3SBKA 1TX8A 5GDSH 3SGBE 3A82A 1C5QA 7LPRA 1C2EA 5F8TA 3UUZA 3D65E 3OTJE 4OGXA 1NZQH 3HGNA 5AFYH 1LHCH 2C8ZB 4CRBA 1LHGH 2XRCA 5CMXH 4X0WU 1EASA 3MWIU 2AGEX 2G51A 1GI9B 1YBWA 2RG3A 4Y8ZA 2ALVA 4IMQA 5AF9H 1AFEH 1V2ST 1HGTH 4O9VA 5IDKA 3A86A 4TY6A 1XUGA 1IQIA 1XM1A 2HNTF 2OBOA 1XKAC 5GXPA 2FM2A 1IOEA 3E3TA 1BOQA 3RXJA 1ORFA 1G36A 4TY7A 1O2RA 3UNSA 1G32B 2ZC9H 3SV9A 1MTNB 1B5GH 2ZHFH 1GJDB 1MU6B 2SNWA 3TIUA 1ELGA 4D8NA 1P3EA 3JZ2B 3SI3H 4FXGH 5GCHF 3LDXH 2G5VA 3RUOA 3JZ1B 1PPZA 5C1YA 4FUBA 3T29A 1SHHB 3RDZA 5JB8S 1GI8B 1GJ9B 3ZVBA 4F49A 3SU0A 1TWXB 4XBCA 4JYVH 1SLVB 1P8VC 1UTOA 5GIBA 1D3TB 2A7CA 1MU8B 3A81A 1GBFA 5AFZH 2ANMH 1KTTB 1O3DA 1ZHMA 1ACBE 5GPIB 3OX7U 5EG4A 3M5LA 1O3BA 5EU8A 2ODPA 1IQLA 3VXEH 4GVUA 5EGMA 1AY6H 1CA8B 5FPTA 2ZFQH 1S81A 1LHEH 1MZAA 2OCVB 2GMTC 4B2AA 3BV9B 2ZCKP 2G00A 4MQAA 1FIZA 7KMEH 1QA0A 1FY1A 1O5CB 3U8TH 4Q7XA 4MVNA 3F9EA 3FANA 3UWJH 4ZHLU 2O9QA 2SNVA 1XUJA 2PTCE 3MNSA 1Z8IB 1A0LA 1O39A 4FU8A 3RMNH 1TABE 4BANB 1JBUH 1ARBA 4M7GA 3KCGH 3ITIA 3S7KB 2IOTA 1VZQH 3STJA 3LGVA 1NU7B 1VCPA 2TGDA 1TMUH 1K1NA 5A0CA 4MPXA 3LJOA 1DE7H 2AS9A 3P8OA 4IMZA 1UHBB 1EAXA 1SGYE 2VIOA 5C20A 1C5VA 2AERH 3A84A 1UK2A 2GDEH 3HKJB 3B8JA 5TCAA 1TB6H 3P70B 1HLTH 1UVPA 1RJXB 3IWMA 2VH6A 1ZTJA 1SGEE 4BAQB 4ZKOU 3M61U 1Z71A 1QL8A 1TPPA 4I8KA 4CBOA 2AGIX 2FIRH 3PMBB 5DP3A 1XUIA 1C2JA 1V2QT 4BTTB 1A61H 5FXLA 4X2VA 2ZDKA 2BXUH 2ZGHA 1HAHH 2NU1E 3TH2H 1G3EA 1TNJA 1GHAG 3PLKA 1S5SA 1GI7B 1ZSJA 5FBIA 1O2PA 1UMAH 3FP6E 4BAOB 4NGAH 4E7NA 3GICB 4WF8A 1Q3XA 2QIQA 3MU8A 4THNH 1O2TA 3TK6A 1THSH 1Y3UA 1PYTD 2VGCB 3P6ZB 1BTHH 4LXBH 1IQFA 3RXFA 4HI3A 1OOKB 3SV7A 3TITA 1C1MA 2VWMA 1LCYA 2ZTXA 4R0IA 1GDQA 5LGOA 1WCZA 3ZZDA 1F0UA 2TGAA 2GT8A 1M9UA 2HPQH 3MNXA 4RSPA 1W0ZU 3H7TA 3V3MA 2TGTA 5FX6A 1K28D 2W7UA 1DDJA 4BXSA 3M7QA 1HV7A 1O3OA 1ESBA 1DITH 3GY4A 3UR6A 5EW1H 3A85A 3M5MA 2FYRA 8ESTE 4ZROA 4OGYA 1JRTA 1VITG 4K1TA 1Y3WA 1O2UA 4DIHH 2GD4B 5HXFA 1OWJA 3ZVAA 4X1QU 3O8BA 4WH6A 1ELVA 3A80A 1GG6C 1RXPA 4YM9A 1T8LA 5EXNA 2XCNA 2WINI 5DJ7A 1UCYE 1C5LH 3BF6H 4I8HA 5SGAE 3TH4H 4KKDA 1S84A 3RXPA 3U1JB 1J17T 1AB9C 1BRCE 3Q3KA 3PV4A 3RXMA 4JK6A 3BEFB 1HAGE 3E0NB 3PO1B 1P02A 1MZDA 2G4UA 2GCTC 3MU4A 3ZZ6A 2C8YB 1CA0C 4CRFA 1H1BA 1WUNH 2Y80A 1AN1E 3U1IB 3V12A 5JPMH 2P3FH 1SVPA 3QK1A 2GMTB 1GGDC 2QXGA 3WY8A 1BA8B 3LT3A 1DUAA 4ZH8A 1T4VH 2A4OA 4OS4A 4B73A 1VCQA 3A8CA 3S9AA 2FX4A 1FY4A 4NIYA 1Z8RA 3W95A 4NG9H 3SI4H 1LVOA 3ODFA 2ZWLH 1FJSA 1C5WB 1OWKA 2C8XB 3U69H 2A4GA 1MKWK 2DE8A 4HTCH 3SQEE 4CBNA 2ANKH 2EC9H 1UTQA 1N1LA 4XBDA 1P2QA 4D9RA 1KXAA 4B1TA 2ZFTA 4K8YA 2JH5D 1ELEE 1CHOF 1PQ5A 2ZGBH 1XXFA 4A6LA 4AFUA 4AN7A 1GCDA 1S0RA 1ELAA 5LPEA 2Z9GA 4D76A 2A5AA 3ZZ5A 1CSOE 3E0PB 2W5EA 2C90B 1EAWA 2ZFSA 3K2UA 4DY7B 5K7RA 4ZXYH 5HM9A 1F0RA 1MAYA 1JXPA 1GBAA 2XBXA 4LZ1H 3D49H 2EI7A 2SGFE 1E0FD 2A7HA 4ZXXH 4XOJA 2FOCA 1MKWH 3F6UH 1UTJA 1J9CH 4SGAE 1CT4E 1DXPA 3KNXA 3IG6B 4XDEA 2A2XH 4RKJB 1TPOA 4GCHG 3ZZ9A 4ZKSU 1ZRKA 5CE1A 1GJ5H 1SG8B 3ATIA 3TK5A 1C5UA 1SPJA 2FMJA 5A09A 2ZEBA 1QRWA 1ZR0A 2ZECA 3LKWA 2QY0B 3AVZA 2ZZUH 4BXWA 1TGBA 2QCYA 1ZPZA 2VU8E 4YT7H 9ESTA 1QL7A 1TALA 3H7OA 1GHBF 1TRNA 4X1PU 1HYLA 1TX7A 1VITH 2NU3E 4MPVA 4MPUA 2R0LA 1WYKA 3RU4T 1CQQA 2TBSA 1SLXB 4ABBA 1QCPA 3B9FH 3BSQA 2QV1A 3R3GB 1DS2E 1MCVA 2FYQA 1AVXA 2W3KA 3PB1E 2CN0H 4ZHAA 3GCNA 2Z9JA 2DE9A 1BJUA 1CT2E 1C1PA 1GG6B 4VGCB 1GJAB 3SU4A 2RA3A 1J8AA 1G3BA 2XC0A 2FXRA 1P06A 4KTCA 4AOQA 4U01A 2F83A 4TPYA 2A31A 2QGRA 3N7OA 1BCUH 1F0TA 1RGQA 2F9PA 4LZ4B 1AB9B 3SOSA 2ZU2A 3M37A 3OSYA 1EZSC 1ZZZA 3MNBA 3QDZB 1MD7A 8GCHF 1HFDA 3RU4D 2R3YA 1C2LA 6CHAB 3M36A 3OY6U 1AVWA 1V2NT 2BXTH 1TE0A 4FUIA 4D7GA 3MU5A 3OYPA 3GDUA 2WV4A 3M3SA 1WQVH 4DURA 3CP7A 4YOIA 1KYNA 3D23A 1ZLRA 3M7UA 5FBEA 4YOGA 1Z6EA 1DICA 3P8NA 4ISIH 3BEUA 2ZGXH 4A1VA 1LDTT 4JZ1A 3E90B 1KXFA 1Y59T 1KIGH 2FOEA 3SU6A 2PLXA 2HALA 1GMDG 1O5GH 2HVXA 2QXJA 2ZQ2A 4JCNA 1MBMA 1AE8H 1TGTA 1RTLA 2PUQH 2GV6A 2QF3A 1FPCH 2J4IA 1PQ8A 2FI3E 1GJ6A 1NESE 5FAHA 1ANDA 4DG4A 2ZDVH 2A1DB 1NPMA 2XBWA 1AO5A 1UCYK 2HPPH 2IJOB 3NZIA 3KGPA 4JZDH 1ZTKA 3MU0A 1OSSA 3I78A 1NFWA 3LGTA 1GWAA 1OPHB 2WPHS 4WY3A 1C1WH 1ELBA 2BB4A 2VIWA 1MH0A 3RXLA 1WBGB 3PYHA 2H9HA 2J2UA 1CT0E 1O2IA 3E8LA 4Q7YA 2AH4X 1BTPA 1MTWA 1GMCG 1FPHH 1DWDH 2D8WA 4BAHB 1A7SA 3VB7A 4UFGH 1BMNH 3RXGA 2ZU4A 2AMDA 1VCWA 1VJAU 1GJCB 2AGGX 1FUJA 2F9OA 5T6GA 3MI4A 1MAXA 1V2TT 2XWAA 1QQ4A 2W3IA 3SNBA 1A4WH 4J1YA 1MMJN 3EGKH 5A8YA 6ESTA 3A7ZA 1SGPE 1EP6A 4A7IB 2FZZA 2H5CA 4IGDA 1A5GH 2XW9A 2BY7X 1L4ZA 1F7ZA 1THRH 3D62A 1AI8H 2ZFRH 2D1JA 4CH2B 3FZZA 1XVMA 2FTLE 1GHWH 5DK1A 4X1RU 2O8MA 2VVUA 3BG4B 3KHVA 2FI5E 5C1UA 1FY8E 1YC0A 2NWNA 1GL1A 1C2DA 2ANYA 1O3AA 1IQEA 4Q2KA 4I7YH 1WSSH 1TQ0B 1W14U 2ZGCA 1F5RA 1BITA 3GOVB 1IQNA 1KSNA 3LGIA 3ODDA 2PUXB 1EOLA 1TNGA 1MQ6A 1LHFH 4CH8B 1KXCA 1SGFG 1IHSH 3ELAH 3SNCA 1HAIH 1HAYB 3HPTB 1NT1A 1Y5UT 4BTIB 1C1TA 5H4IB 3W94A 3TGIE 5EW2H 1V2RT 2WPKS 4AB8A 1T31A 1EXFA 4O97A 4I8GA 1P2JA 2VIQA 4CHAB 3K65B 3QGJA 1QNJA 1THPB 2Y7ZA 1C5YB 1GCTB 4HZHA 4MTBA 1C5TA 3SV2H 2FOMB 2V6NA 4NSVA 2BVSH 4Y0ZE 2Q1JA 3EDXB 3EQ0H 2EA3A 1D3PB 1EOJA 1MBQA 1D6RA 1QIXB 3PTNA 1UTKA 5L30H 3UNRA 1FAXA 3PWCA 1V6DA 1V2MT 2QF0A 1BHXF 2LPRA 3TGKE 4DIIH 3S7HB 9LPRA 1FV9A 2VGCC 4FUHA 4INHA 2ZG0H 4XFQA 2ASUB 1LKAA 1W7XH 1F5LA 1AVGH 1SGRE 2SGPE 3KEEA 2C3SA 1Z8JB 4GHQA 3LGWA 2SFAA 1C5RA 5ESTE 2GT7A 1CU1A 1SGFA 4NSYA 2VVCA 4WXVA 1ELCA 1H8IH 1OWIA 1O35A 3RMOH 1DT2A 2W26A 3M3VA 1UVTH 4WWYA 5EQRA 1TRYA 2JKHA 4I32A 2BVXH 2Y82A 1T4UH 2J34A 4JZEH 4AGKA 3S9CA 5DP5A 2RDLA 5C2ZA 3EA7A 2QXHA 3M5OA 5E2PA 2XCFA 3PLPA 4X6PA 3P95A 7GCHF 3TLOA 4RKOB 3GDSA 5EXMA 3PLBA 2YNAA 4H4FA 3UIRA 4OS2A 3GCTG 2GCHG 3LC5A 1KXBA 3RXQA 1P2IA 2P16A 1H8DH 2ZF0H 3K6YA 2J92A 3E16B 3SJOA 3MOCA 2ILNA 3BTWE 1YCPK 1QJ7B 4ABGA 2BLOA 4J2YB 4ABFA 4ABDA 1G3CA 1V2JT 2AIPA 3B23B 1Z6JH 4GUXA 5K0HA 3PO1C 3O8DA 3L6PA 1H4WA 1O30A 4HFPB 1QBNA 2AEIH 2J9NA 2UUJB 1H9IE 2BM2A 3KQEA 4CRGA 3RXDA 3NPSA 4X1SU 5EOKA 1NM6A 2BHGA 1TMBH 2Y7XA 1K2I1 3SUEA 1ETSH 2FEQH 2HLCA 1DUEA 3MO6A 1BB0B 2UWLA 2OBQA 2A5IA 1ZYOA
chains in the Genus database with same CATH superfamily
3SJ8A 1Z8GA 1O0DH 1ZJDA 3OU0A 5E0GA 4AFQA 2SGEE 3DT0H 1V2VT 1E35B 1TFXA 4YXWD 1EJAA 1QBVH 3STIA 3SJIA 2I6SA 2P59A 3GDVA 1SFIA 2J95A 1B0FA 1BBRE 2C8WB 2B7DH 4Y7AA 5JDUB 4B71A 1YCPH 1C1VH 1PPEE 2STAE 3A8AA 4ISOA 3BN9A 4Y6DA 3RP2A 5L2YH 1J16A 1FMGA 1PQ7A 2K1QA 1Y5BT 1GDUA 3RU4E 5C5OA 1NO9H 2CMYA 2HVYB 2OLGA 3SV6A 4OS5A 1PYTC 2VWNA 1PPBH 4X6NA 1BRUP 1W2KH 4UDWH 5DKMA 1C2GA 2BY6X 1O2JA 3FFGA 5E0HA 1A5IA 3GCOA 1BTXA 3SORA 1HAVA 1PPHE 1FY5A 5C0TA 1O2ZA 3SUGA 1NU9A 1HAPH 2FO9A 5EIYA 4YT6H 1G3DA 3CS0A 4GSOA 5C1XA 3L3TA 4DOQA 3RC6A 2EI8A 1GMDF 5EQSA 1KLJH 3RXKA 1A0HB 1ELDE 2BQ7B 3T27A 1K22H 2KCPA 3KL6A 4UFFH 3SU3A 1WQSA 5EQQA 3U98H 5BPEA 5C67A 2TIOA 3E91A 3UQOA 1BMMH 3MFJA 1GHVH 2ZDLA 1RTFB 2BD3A 4TSFD 2BD9A 1S83A 1G2MA 2HRVA 3FN8A 1C4U2 3GISB 3KQDA 4O3UA 2CHAB 1FDPA 2FOGA 3ZZ4A 1K21H 1DLKB 1FNIA 4HGCA 4WMFA 1GBHA 1OP0A 1QJ6B 1HAOH 1J15A 1E36B 1GMCF 2KCAA 1GMHF 1Z7KA 2QXIA 2XWBI 3ZVDA 2A4QA 1QGFA 4ZKRU 2BZ6H 2Y5GA 4IN1A 1G37A 2Z3EA 1MABB 2FS9A 1AUTC 1O36A 3UOUA 2HLDD 1TNKA 2FESH 4TWWA 1SGNE 1HCGA 3A8DA 2GDDA 1EFRD 1V2UT 4JZIA 3U28C 1Q2WA 1WTHD 2FOHA 3SQHE 5HIYA 4NA9H 2Z9KA 1LQEA 1EAUA 1D4PB 3KIDU 4MPWA 3V0XA 1TLDA 3IITA 2G55A 1T32A 4NCYA 4UEHH 2O8UA 1QB1A 4JMYA 1P04A 1Y3YA 1GJ4H 1P9UA 4Q63A 3A7VA 1QJ1B 4VGCC 3GCHB 5A8ZA 1O2GH 1MTSA 3Q77A 1YLCA 1YWUA 1C5NH 2BVRH 1YLDA 2BDHA 5F03A 3DA9B 2W7SA 3SHCH 3EA8A 4K3JA 3WWFA 4FUJA 2ZCHP 1ID5H 1W13U 1SGQE 4JYUH 2G52A 3ZZ3A 2CJIA 2WPJS 2KAIA 3A89A 2K8IA 1O2MA 3I29A 1HAXB 1NN6A 2XYAA 4UFEH 6CHAC 2Y5FA 3RXOA 4ABIA 4MNXA 1OP2A 4NZQA 4O3TA 2KCOA 3RXEA 2KFWA 3G01A 1LPGB 2H1UA 3LIWA 3TH3H 1XKBC 2ZDMA 1EJMA 4NIXA 5ABWA 2GX4A 2TRMA 3VFEA 1UTMA 3GY6A 3TNSA 1OWHA 3SNEA 2Q6DA 5E0JA 1RIWB 3SJ9A 1AFQB 4TPIZ 1LHDH 1KXEA 2BD2A 1IQMA 1O5BB 1CBWB 4I8JA 5HMAA 1BQYA 4K8BA 5LPFA 1JOUB 4M9FA 2ODYB 3A83A 3RXUA 3ATMA 3TNTA 4JYTA 2P95A 1MQ5A 4E06H 1O34A 3LPRA 3UREA 2KX4A 3F9GA 3LOXA 1RS0A 1MTUA 3QTOH 3ZVGA 2WUBA 1GBDA 2VIDA 4KP0A 4ISHH 3BIVH 1A3BH 2V35A 1W0YH 4WVPE 2QAAA 3LH3A 2G81E 3RXCA 1SQAA 1O31A 1QB9A 1V2OT 3GY7A 1QHRB 1K1LA 1NROH 4CR5A 2ZHDA 4OM9A 1TBZH 1SQOA 2M5TA 1Z1IA 1COWD 2M2AA 1P12E 4BNRA 2BDBA 1GHYH 1HJ9A 1P9SA 2FWWA 4IC5A 2PSXA 3LONA 4ABEA 1A46H 2PV9B 1P09A 3M7TA 1ZPBA 2ZFFH 5ESBA 3LH1A 5IK2D 2THFB 3NWUA 3RMMH 1UTLM 1IHTH 1O2HA 2PFEA 4Y8YA 4U2WA 2B0FA 5CHAC 1EKBB 1AIXH 2BD4A 1XVOA 1GBLA 3F9FA 4QT8C 3F2HA 2AIQA 1UTPA 1SHYA 2SGQE 3ZV8A 2O8WA 2BLVA 1K1IA 2FTMA 5F6MA 4YTAA 3AAUA 1AZZA 2BY8X 2BDIA 1W11U 2A2QH 2ZNKH 1Y8TA 2WUCA 3N7DA 5A8XA 2O8LA 2G4TA 2GZ7A 1AU8A 1UVUH 2ESTE 1N8OB 1O5DH 5AVDA 1YCPM 5T3HA 1QFKH 1WV7H 4DW2U 3BTME 2J98B 5EODA 1IQHA 2H5DA 1TONA 1U6QA 5KGOA 2AFQB 1L0ZA 1O2QA 3DUXH 3GCTF 1IQKA 2GCHF 4FOUC 3BEIB 1HAVB 1BRBE 5FCKA 2XNIA 3BG4C 1P2OA 1BUIA 5GCHG 4B75A 3VPKA 4OS6A 5T6DA 2UUFB 4K1EA 2FOAA 1CHGA 3FOAA 1SGCA 3M35A 1P11E 2EI6A 4FU7A 4Y71A 4AZ2B 1EZXC 2YNBA 1SL3A 1O5EH 1OWEA 1W0JD 3TJUA 1TYNA 3UFAA 2P94A 2SGAA 1V2PT 2JETB 2JDID 1TRMA 1DWBH 1TA2A 4H6SB 1KTSB 2Q6FA 3C1KA 1O3IA 2FPZA 2GVFA 4K69A 2BDGA 4FUGA 3PWBA 1BBRH 1G9IE 1SQTA 3ZZCA 2BQ6B 2WPIS 3DD2H 4A1XA 5A0BA 4CHAC 4DCDA 2ANWA 1HJ8A 1SI5H 2K0QA 1GCTC 2F91A 2OC1A 1C5MD 1HJAC 2WHXA 3N99A 3PRDA 4INKA 3UOPA 2J5UA 3MH4A 1EATA 2P8OC 2Y81A 4ISLA 4MNVA 4YO9A 1OX1A 3F2GA 3UY9A 1O2XA 1D9IA 4DGJA 1F0SA 5JB9S 5PTPA 2RCEA 1L1GA 4NWLA 1GHZA 2QN5T 2XNDD 2ZI2H 3RXIA 5E8EH 2WPLS 4Y8XA 2BY5X 4I8LA 5BRRE 3NXPA 2XC4A 3AW0A 5DP6A 2F9VA 2YOLA 1TX6A 1NY22 2IPHA 3BTKE 1MD8A 3GY8A 3BTFE 1C5XB 1DOJA 1SBWA 6LPRA 4Y10E 4A5TS 3I77A 1UVSH 3WW7A 1C2KA 2VNTA 1C5PA 1B7XB 4GPGA 1ZTLA 2HNTC 3A7WA 2BDYA 2F3CE 2BDAA 2ZHQH 1Y3XA 1NFXA 3RLWH 3NCLA 4ZKNU 1GHAF 2TGPZ 1KXDA 5J4QA 3PTBA 3OE7D 1PQAA 5HGGA 1GBIA 1PPGE 4B6EA 2KAIB 2G8TA 2BOKA 5JBBS 1OS8A 3H5CB 3NRLA 5DP9A 4TT3D 4Z0KA 2OD3B 2NU2E 1C5ZB 2BLQA 3GYMA 1W3CA 2CV3A 1GI5A 1E37B 2XXLA 1TOMH 1DM4B 4AC9A 1AZ8A 1ZGVA 4I33A 1C1NA 3BTGE 4B2CA 4WJG2 5LPRA 1HNEE 5FPSA 2OTVA 4BOHA 4TYDA 5CHAB 5HIZA 1MCTA 8KME2 1EX3A 1O3KA 4KTUA 3MTYA 1CE5A 2D2DA 3UNQA 1GJ8B 1HXFH 2VJ1A 2Q6GA 3DSOA 3NKKA 1E34B 4B2BA 1RFNA 1UJ1A 1SMFE 4FUEA 3KF2A 4UD9H 2JH6D 2VH0A 5G4BA 3UPEA 1VITF 4IC6A 2C93B 2B5TB 4K60A 1OWDA 1JIMA 1YGCH 2AMQA 1V3XA 2PGBB 1LO6A 2VINA 4SGBE 1EQ9A 3RXTA 4ABHA 4CR9A 1SGDE 4BAMB 3LGUA 2GP9B 1WOFA 3HKIB 2UWOA 5DP8A 4ESTE 1OKXA 1FY3A 3VB5A 1ZSKA 1C1OA 1NRQH 2IPQX 1DPOA 1DY8A 3W1EA 1LMWB 1O5AB 2ODQA 1NC6A 2VWLA 1KDQB 4ACBA 2WZQA 1O3CA 4ABJA 1YPKH 1CVWH 2ULLA 1SR5C 1VGCC 1AE5A 2JH0D 4NFFA 3OFND 4Q7ZA 4U32A 4ASHA 3SUFA 1EAIA 1O3JA 3HK3B 3PMHB 2GKVE 1QURH 1P2MA 2FLRH 5FHTA 3RLYH 3VEQB 3TVJB 2OC7A 4Q80A 4H6TA 1QQUA 1O3PB 1OXGA 1C5SA 2NU0E 1G30B 3OAAD 3TPIZ 4IBLH 2HGTH 4AYYB 4E7RG 4B76A 5B6OA 1HJAB 4NFEA 3A87A 4AFZA 1ZMJA 2P8OB 1DXWA 4JZFH 1S85A 1CGIE 2OC0A 1JWTA 2C4FH 2H6MA 3T5FH 1S82A 2FX6A 3Q00A 1SC8U 4YESB 3MNCA 1L1JA 2ZGJA 3NUMA 3AAVA 1TIOA 5F8XA 5C3NA 2V0BA 5T6FA 3S9BA 2FOBA 1HIAA 1AGJA 5EJZA 3SW2B 2R3UA 3M5NA 5HYOA 4RN6A 4AX9H 1C4V2 2Z9LA 1C1UH 2CHAC 3UQVA 1HUTH 4FUDA 4MDSA 3V13A 1A5HA 1AQ7A 1CHOG 4IN2A 5FPYA 1RD3B 2BQWB 4D9QA 1GI1A 3KQBA 1KLIH 5FL7D 1AKSA 1E38B 2FP7B 2V3OH 1ANCA 1ZOMA 4JK5A 1CGJE 1UK3A 1GHXH 2PGQB 2F43B 1O3GA 3M3TA 3PMAB 1ELTA 1FX0B 2OQUA 3VGCB 4NIWA 1UO6A 1C4Y2 2JJ2D 2CXVA 4WXIA 2O8TA 1DWEH 4GCHF 1GDNA 2P93A 1OP8A 1P57B 4AG2A 2Z9IA 5JBTA 2TPIZ 1GBMA 2ZDAH 3MH7A 2BOHB 2I6QA 5DPAA 3RXVA 1EZQA 3QO6A 2H2ZA 3GCHC 1LTOA 1RTKA 1PFXC 1S6LA 4GAWA 4DJZB 1O2LA 1EPTA 1T8NA 2BTCE 4I86A 1LVBA 1TBRH 1F2SE 2AMPA 4AORA 3N7EA 1INCA 3ZZ8A 3ZYEA 2ZTYA 3GY2A 3S0NA 3VXFH 3O8CA 4GLYA 3P8FA 1O3NA 4PROA 5FCRA 1GHBG 4FUFA 3EA9A 2WPMS 1UK4A 3DFJA 4E05H 1AUJA 1AMHA 3TK9A 2A45B 3LGYA 5EPYA 1ZRBA 2BDCA 3SYJA 1ZJKA 2D26C 1GVZA 1RIWC 4CRAA 1AFQC 2R2WU 3QGNB 5C5NA 1CBWC 3BIUH 2XBYA 3VB6A 1AD8H 4BAKB 1EB2A 4X8VH 2QC2A 5EXLA 1PPFE 1WU1A 4K2YA 2Z3CA 1N6XA 1ANEA 3ZVEA 1ZSLA 3A88A 2R2MB 1A0JA 2UUKB 3RXAA 1DSUA 1YP9A 1D3DB 2OC8A 1EJNA 1EPTC 1TPSA 1T8MA 6GCHG 1ZPCA 1GI4A 1P03A 3PROA 2LP6A 4DVAU 1TPAE 2HOBA 3KQ5A 2J98A 2ZU1A 3GS9A 3OY5U 1VGCB 2VIPA 1YPHE 8GCHG 4K1SA 1K9OE 2FI4E 3ATKA 1PJPA 2VVVA 4Q4LA 1O3HA 1K1OA 2VB0A 3ZZBA 3UAIC 1E1QD 2WYJA 1KY9A 3BTDE 3QZQA 1TNLA 4U30A 1F92A 3TJOA 1A1RA 1X7AC 3BG8A 1V2KT 1P0SH 2WYGA 2P3UB 2FS8A 3SHAH 1TAWA 1K1PA 1L1NA 2FDAA 4YOJA 3NK8A 1H9HE 2CF8H 3ZZAA 1K1MA 3TU7H 1DLEA 3AASA 4LK4A 4I31A 5L6NH 1DFPA 4KGAA 3MU1A 2PHBA 3F1SB 3RM2H 1GBKA 3QX5H 4NA7A 1N8OC 2OP9A 2BX3A 1ESAA 4X2XA 1LPZB 2J94A 1SLUB 1BT7A 1VR1H 3A8BA 3VG8A 1NTPA 3ZVCA 1FI8A 1HAZB 1C5OH 1Q31A 3E1XB 1C1RA 1DX5M 4INLA 4Z6AH 1GI2A 1AWHB 1XMNB 3RXBA 1H9LB 4FVDA 3QLPH 1C9PA 3MO9A 1O37A 1S6FA 3SZNA 4XE4A 4ABAA 2QF4A 2YMSD 1UVOA 2HWLB 2HNTE 2RDEA 1GI3A 3P17H 1O2KA 2ZQ1A 1GJBB 1CGHA 4Y0YE 1JMOH 1CO7E 1AWFH 2WV9A 3GY3A 3P92A 4WMDA 2JJ1D 2JETC 1O5FH 3DHKH 3EYDA 1O3MA 1TMTH 4OS1A 2A32A 4FUCA 2ZHEH 4ZHMU 3QWCH 1LQDB 3SGQE 4UE7H 1D3QB 1BJVA 2PKAA 1HIAB 1FN6A 1TNHA 1K1JA 3MH6A 1QTFA 5FX5A 5HM2A 1SOTA 2Z6BD 1NS3A 2F9UA 1L4DA 5F53A 5KECA 3RM0H 2BYAX 3LC3A 3SO3A 1TNIA 1C2FA 2ZA5A 5A0AE 1O2VA 1XUHA 1W7GH 3HGPA 4X8TH 3P8GA 1AKSB 3ESTA 2VWOA 1O2NA 1GI6A 4X1NU 3RXHA 1SGTA 3HATH 1FQ3A 1G2LA 3FVFB 3U9AH 4AYVB 4O03A 1BMAA 2Y6TA 1ANBA 2BX4A 1ETTH 1A3EH 2B9LA 2BLWA 3SU2A 1QA7A 5DGJA 1P2KA 3SN8A 5JBAS 2FODA 1MTVA 2QE7D 2VIVA 3VB3A 5A2MH 2XC5A 1BTYA 1WDIA 2G5NA 4NIVA 1NFYA 1GL0E 2PR3A 1QL9A 3MYWA 2ZPQA 3O8RA 1C2IA 2RA0A 1EPTB 3BTHE 2ZDNA 2GV7A 4ZUHA 3RC4A 4Y76A 2A5KA 2AYWA 3A7YA 5CHBA 1TGSZ 2A7JA 1QB6A 1QRZA 1BMFD 1DSTA 1GI0A 2PTNA 4A92A 4B74A 2BD7A 4ASUD 2QA9E 1YF4A 5ETXA 3F0OA 2ZP0H 4XBBA 3TJVA 1KLTA 1RRKA 3FKSD 4X6OA 1SGIB 2Z94A 1VKYA 4AFSA 1EB1H 4CRCA 1O3FA 3SU5A 1ESTA 5L2ZH 4AG1A 3BTEE 1KDQA 3C27B 1EZUC 1FLEE 3BTTE 2XBVA 2R0KA 2YMSB 2ZO3H 1TGNA 2ZKSA 1EUFA 4MNYA 1O2OA 2V3HH 3SNAA 1YPGH 1V2LT 3PMJA 1LVYA 3Q3YA 3MQKC 5E2OA 3V7TA 4F48B 1IQJA 1H8ED 5JYIA 3F68H 1QRXA 4Y11E 1ZMNA 1FONA 1ZGIA 4MLFB 2BZAA 2DUCA 1BBRK 2ALPA 1NFUA 2PWXA 3RC5A 3KN2A 4AGJA 1FIWA 2F9BH 3SNDA 4UFDH 1QBOA 3SV8A 5DG6A 3MMGA 4NWKA 4KTSA 5TCCA 2CF9H 3QN7A 1BZXE 7GCHG 1DANH 2BD5A 3UWIA 3Q3XA 2EQNA 3KQCA 5F8ZA 3U8OH 5DO4H 3FZDA 5GWZA 1FN8A 2WV5A 2F9NA 2PKSC 1GPZA 4B6FA 3PM3A 5IYTA 1SB1H 1YPEH 1YPHC 1OHHD 3L33A 3DFLA 1LPKB 1C1QA 4YLUA 4R8TB 4ISNA 1FXYA 2OINA 1YM0A 1JRSA 2P3TB 3LU9B 5DP4A 3T2NA 1N6YA 1TA6A 1TBQH 3ATWA 1NRRH 5GNDA 4X8UH 1OYQA 3QZRA 1O38A 2RFKC 1TGCA 5C0UA 5DP7A 2PW8H 1MUEB 1ZMLA 1NRPH 1HRTH 1Y3VA 4Y7BA 2OQ5A 4X2YA 4CREA 3TGJE 3URCA 3CS7A 1JIRA 3RXRA 4BTUB 1HDTH 1GJ7B 1XUKA 3S69A 1YPMH 7ESTE 5GJ4B 3T25A 4A1TA 1P05A 1FAKH 4FVBA 3SUDA 4ZMAH 1O32A 3FP8E 3K6ZA 6GCHF 2CGAA 3E6PH 4DT7B 2FOFA 2FLBH 1L2EA 2ZHWH 1W12U 4AB9A 2J38A 2L6OA 4CRDA 1ETRH 1XUFA 2B8OH 1IAUA 3ZVFA 1F5KU 2F4LA 5AHGH 2GCTB 1T8OA 2GGVB 1P2NA 3F9HA 1CA0B 1ELFA 3FP7E 1YYY1 1YPLH 1NRSH 1S6HA 1ZHRA 4IS5A 1GGDB 5I46H 2NU4E 3PRBA 1O33A 1OYTH 1A2CH 1XXDA 4F4OC 3QTVH 1SLWB 2PKAB 3GYLB 4KELA 3UR9A 1NRNH 3VGCC 1GBCA 1O3LA 4X6MA 2UWPA 5C94A 4YZUA 1SSXA 3EE0B 2BMGB 8LPRA 4D7FA 3ZV9A 3ATLA 1Y5AT 2IN2A 1PPCE 2OXSA 3ZYDA 1O2WA 1DWCH 3BTQE 1BTWA 4WMEA 5DN6D 3F0PA 3VB4A 5EPNA 3HK6B 4ZAEA 4DT4A 2BD8A 2LNCA 1P01A 2H9TH 2Z7FE 1S0QA 2ZIQH 3A7TA 2L74A 1GBBA 1GBEA 1YLNA 2R9PA 2XTTB 1MTNC 3QUMP 3AW1A 4RT1A 3TJNA 3SGAE 3MH5A 1MKXK 2GZ8A 1E79D 1WAYB 1BDAA 4UONA 4H42U 1TQ7B 2H9EH 1TOCB 2EEKA 1BRAA 4TWYA 1DY9A 2ZTZA 1VJ9U 1GMHG 3T62A 3WWBA 5I25A 1V2WT 3EE7A 1QR3E 1GBTA 1YPJH 1ZHPA 1J14A 1KMHB 3RXSA 4K5ZA 1Z1JA 1BTZA 1SOZA 2VBCA 4Y79A 1LKBA 3U8RH 1WTGH 1UHBA 4NZLA 2ZCLP 2A0QB 2PSYA 4WH8A 4IW4E 1P3CA 4ZCNA 1QY6A 2BY9X 2ZPSA 3ZZ7A 1HPGA 1GVLA 2ZU3A 3RMLH 3SJKA 3F2FA 3MHWU 3A7XA 1UCYH 1GBJA 5TJXA 4YLQH 2OUAA 5J4SA 2PKSB 4RI0A 1T7CA 1C2HA 2UUYA 2Y5HA 4P00A 2STBE 1C1SA 3T26A 3GY5A 1MKXH 4LOYH 1D6WA 3UTUH 1O2SA 1B0EA 1XX9A 2SGDE 1AHTH 4GHTA 1HBTH 1C9TA 4OS7A 1HB0B 2ZFPH 3ENSB 1BMLA 2GZ9A 4X8SH 2A4RA 5JBCS 1P10A 4MG3A 4NA8A 1UTNA 3R0FA 1O3EA 3FAOA 3MO3A 3AK5A 4X2WA 4MNWA 1O2YA 1ARCA 3T28A 1YKTA 1BIOA 2ZPRA 1EP5A 1DVAH 3K9XB 1W8BH 2QYIA 3LJJA 4FU9A 1SFQB 2ZU5A 5LH8A 1C2MA 3SU1A 1BTUA 1W10U 3EAJA 3Q76A 1GVKB 4XSKU 2Z3DA 3URDA 3CENA 2GTBA 1BHXB 1HXEH 1ABJH 1ABIH 1LVMA 1FZZA 1IQGA 3SBKA 1TX8A 5GDSH 3SGBE 3A82A 1C5QA 7LPRA 1C2EA 5F8TA 3UUZA 3D65E 3OTJE 4OGXA 4ACAA 1NZQH 3HGNA 3F3BA 1LHCH 2C8ZB 5AFYH 1LHGH 4CRBA 2XRCA 5CMXH 4X0WU 1EASA 3MWIU 2AGEX 2G51A 1GI9B 3SZEA 1YBWA 2RG3A 4Y8ZA 2ALVA 4IMQA 5AF9H 1AFEH 1V2ST 1HGTH 4O9VA 5IDKA 3A86A 4TY6A 2W6JD 1XUGA 1IQIA 1XM1A 2HNTF 2OBOA 1XKAC 5GXPA 2FM2A 1IOEA 3E3TA 1BOQA 3RXJA 1ORFA 1G36A 4TY7A 3OEED 1O2RA 3UNSA 1G32B 2ZC9H 3SV9A 1MTNB 1B5GH 2ZHFH 1GJDB 1MU6B 2SNWA 3TIUA 1ELGA 4D8NA 1P3EA 3JZ2B 3SI3H 4FXGH 5GCHF 3LDXH 2G5VA 3RUOA 3JZ1B 1PPZA 5C1YA 4FUBA 3T29A 1SHHB 3RDZA 5JB8S 1GI8B 1GJ9B 3ZVBA 4F49A 3SU0A 1TWXB 4XBCA 4JYVH 1SLVB 1P8VC 1UTOA 5GIBA 1YY3A 1D3TB 2A7CA 1MU8B 3A81A 1GBFA 5AFZH 2ANMH 5KEDA 1KTTB 1O3DA 1ZHMA 3CNRA 1ACBE 5GPIB 3OX7U 5EG4A 3M5LA 1O3BA 5EU8A 2ODPA 1IQLA 3VXEH 4GVUA 5EGMA 1AY6H 1CA8B 2EY4C 5FPTA 2ZFQH 1S81A 1LHEH 1MZAA 2OCVB 2GMTC 4B2AA 3BV9B 2ZCKP 2G00A 4MQAA 1FIZA 7KMEH 1QA0A 1FY1A 1O5CB 3U8TH 4Q7XA 4HG6A 4MVNA 3F9EA 3FANA 3UWJH 4ZHLU 2O9QA 2SNVA 1XUJA 2PTCE 3MNSA 1Z8IB 1A0LA 1O39A 4FU8A 3RMNH 1TABE 2JIZD 4BANB 1JBUH 1ARBA 4M7GA 3KCGH 3ITIA 3PV2A 3S7KB 2IOTA 1VZQH 3STJA 3LGVA 1NU7B 1VCPA 2TGDA 1TMUH 1K1NA 2V3MA 5A0CA 4MPXA 3LJOA 1DE7H 2AS9A 3P8OA 2AHME 4IMZA 1UHBB 1EAXA 1SGYE 2VIOA 5C20A 1C5VA 2AERH 3A84A 4RT0A 2YMSC 1UK2A 2GDEH 3HKJB 3B8JA 5TCAA 1TB6H 3P70B 1HLTH 1UVPA 1RJXB 3IWMA 2VH6A 1ZTJA 1SGEE 4BAQB 4ZKOU 3M61U 1Z71A 1QL8A 1TPPA 4I8KA 4CBOA 2AGIX 2FIRH 3PMBB 5DP3A 1XUIA 1C2JA 1V2QT 4BTTB 1A61H 5FXLA 4X2VA 2ZDKA 2BXUH 2ZGHA 1HAHH 2NU1E 3TH2H 1G3EA 5HKKD 1TNJA 1GHAG 3PLKA 1S5SA 1GI7B 1ZSJA 5FBIA 1O2PA 1UMAH 3FP6E 4BAOB 4NGAH 4E7NA 3GICB 4WF8A 1Q3XA 2QIQA 3MU8A 4THNH 1O2TA 3TK6A 1THSH 1Y3UA 2KM0A 1PYTD 2VGCB 3P6ZB 1BTHH 4LXBH 1IQFA 3DSPA 3RXFA 4HI3A 1OOKB 3SV7A 3TITA 1C1MA 2VWMA 1LCYA 2ZTXA 4R0IA 1GDQA 5LGOA 1WCZA 3ZZDA 1F0UA 2TGAA 2GT8A 1M9UA 3PV5A 2HPQH 3MNXA 4RSPA 1W0ZU 3H7TA 3V3MA 2TGTA 5FX6A 1K28D 2W7UA 1DDJA 4BXSA 3M7QA 1HV7A 1O3OA 1ESBA 1DITH 3GY4A 5EJLA 3UR6A 5C17A 3A85A 5EW1H 3M5MA 2FYRA 8ESTE 4ZROA 4OGYA 1JRTA 1VITG 4K1TA 1Y3WA 1O2UA 4DIHH 2GD4B 5HXFA 1OWJA 3ZVAA 4X1QU 3O8BA 4WH6A 1ELVA 3A80A 1GG6C 1RXPA 4YM9A 1T8LA 5EXNA 2XCNA 2WINI 5DJ7A 1UCYE 1C5LH 3BF6H 4I8HA 4XRNA 5SGAE 3TH4H 4KKDA 1S84A 3RXPA 3U1JB 1J17T 2LELA 1AB9C 1BRCE 3Q3KA 3PV4A 3RXMA 4JK6A 3BEFB 1HAGE 3E0NB 3PO1B 1P02A 1MZDA 2G4UA 2GCTC 3MU4A 3ZZ6A 2C8YB 1CA0C 4CRFA 1H1BA 1WUNH 2IJD1 2Y80A 1AN1E 3U1IB 3V12A 5JPMH 2P3FH 1H8HD 1SVPA 3QK1A 2GMTB 1GGDC 2QXGA 3WY8A 1BA8B 3LT3A 3OEHD 1DUAA 4ZH8A 1T4VH 3DSGA 2A4OA 4OS4A 4B73A 1W0KD 1VCQA 3A8CA 3S9AA 2FX4A 1FY4A 1UW7A 4NIYA 1Z8RA 3W95A 4NG9H 3SI4H 1LVOA 3ODFA 2ZWLH 1FJSA 1C5WB 1OWKA 2C8XB 3U69H 2A4GA 1MKWK 2DE8A 4HTCH 3SQEE 4CBNA 2ANKH 2EC9H 2J97A 1UTQA 1N1LA 4XBDA 1P2QA 4D9RA 1KXAA 1NBMD 4B1TA 2ZFTA 4K8YA 2JH5D 1ELEE 1CHOF 1PQ5A 2ZGBH 1XXFA 4A6LA 4AFUA 4AN7A 1GCDA 1S0RA 1ELAA 5LPEA 2Z9GA 4D76A 2PP6A 2A5AA 3ZZ5A 1WXRA 1CSOE 3E0PB 2W5EA 2C90B 1EAWA 2ZFSA 3K2UA 4DY7B 5K7RA 4ZXYH 5HM9A 1F0RA 1MAYA 1JXPA 1GBAA 2XBXA 4LZ1H 3D49H 2EI7A 2SGFE 1E0FD 2A7HA 2KZ4A 4ZXXH 3H09A 4XOJA 2FOCA 1MKWH 3F6UH 1UTJA 1J9CH 4SGAE 1CT4E 1DXPA 3KNXA 3IG6B 4XDEA 2A2XH 4RKJB 1TPOA 4GCHG 3ZZ9A 2V7QD 4ZKSU 1ZRKA 5CE1A 1GJ5H 1SG8B 3ATIA 3TK5A 1C5UA 1SPJA 2FMJA 3OTPA 5A09A 2ZEBA 1QRWA 1ZR0A 2ZECA 3LKWA 2OK5A 2QY0B 3AVZA 2ZZUH 4BXWA 1TGBA 2QCYA 1ZPZA 2VU8E 4YT7H 9ESTA 1QL7A 1TALA 3H7OA 1GHBF 1TRNA 4X1PU 1HYLA 1TX7A 1VITH 2NU3E 4MPVA 4MPUA 2R0LA 1WYKA 3RU4T 1CQQA 2TBSA 1SLXB 4ABBA 1QCPA 3B9FH 3BSQA 2QV1A 3R3GB 1DS2E 1MCVA 2FYQA 1AVXA 2W3KA 3PB1E 2CN0H 4ZHAA 3GCNA 2Z9JA 2DE9A 1BJUA 1CT2E 3UB0A 1C1PA 1GG6B 4VGCB 1GJAB 3SU4A 2RA3A 1J8AA 1G3BA 2XC0A 2FXRA 1P06A 4KTCA 4AOQA 4U01A 2F83A 4TPYA 2A31A 2QGRA 3N7OA 1BCUH 1F0TA 1RGQA 2F9PA 4LZ4B 1AB9B 3SOSA 2ZU2A 3M37A 3OSYA 1EZSC 1ZZZA 3MNBA 3QDZB 1MD7A 8GCHF 4Z1MD 1HFDA 3RU4D 2R3YA 1C2LA 6CHAB 3M36A 3OY6U 1AVWA 1V2NT 2BXTH 1TE0A 4FUIA 4D7GA 3MU5A 1E1RD 3OYPA 3GDUA 2WV4A 3M3SA 1WQVH 4DURA 3CP7A 4YOIA 1KYNA 3D23A 1ZLRA 3M7UA 5FBEA 4YOGA 1Z6EA 1DICA 3P8NA 4ISIH 3BEUA 2ZGXH 4A1VA 1LDTT 4JZ1A 3E90B 1KXFA 1Y59T 1KIGH 2FOEA 3SU6A 2PLXA 2HALA 1GMDG 1O5GH 2HVXA 2QXJA 2ZQ2A 4JCNA 1MBMA 1AE8H 1TGTA 2CK3D 1RTLA 2PUQH 2GV6A 2QF5A 2QF3A 3ZIAD 1FPCH 2J4IA 1PQ8A 2FI3E 1GJ6A 1NESE 5FAHA 1ANDA 4DG4A 2ZDVH 2A1DB 1NPMA 2XBWA 3FO8D 1AO5A 1UCYK 2HPPH 2IJOB 3NZIA 3KGPA 4JZDH 1ZTKA 3MU0A 5CDFE 1OSSA 3I78A 1NFWA 3LGTA 1GWAA 1OPHB 2WPHS 4WY3A 5B6LA 1C1WH 2W6ID 1ELBA 2BB4A 2VIWA 1MH0A 3RXLA 1WBGB 3PYHA 2H9HA 2J2UA 1CT0E 1O2IA 3E8LA 4Q7YA 2AH4X 1BTPA 1MTWA 1GMCG 1FPHH 1DWDH 2D8WA 4BAHB 1A7SA 3VB7A 4UFGH 1BMNH 3RXGA 2ZU4A 2AMDA 1VCWA 1VJAU 4F55A 1GJCB 2AGGX 1FUJA 2F9OA 5T6GA 3MI4A 1MAXA 1V2TT 2XWAA 1QQ4A 2W3IA 3SNBA 1A4WH 4J1YA 1MMJN 3EGKH 5A8YA 6ESTA 3A7ZA 1SGPE 1EP6A 4A7IB 2FZZA 2H5CA 4IGDA 1A5GH 2XW9A 3KYGA 2BY7X 1L4ZA 1F7ZA 1THRH 3D62A 1AI8H 2ZFRH 2D1JA 4CH2B 3FZZA 1XVMA 2FTLE 1GHWH 5DK1A 4X1RU 2O8MA 2VVUA 3BG4B 3KHVA 2FI5E 5C1UA 1FY8E 1YC0A 2NWNA 1GL1A 1C2DA 2ANYA 1O3AA 1IQEA 4Q2KA 4I7YH 1WSSH 1SKYE 1TQ0B 1W14U 2ZGCA 1F5RA 1BITA 3GOVB 1IQNA 1KSNA 3LGIA 3ODDA 2PUXB 1EOLA 1TNGA 4XD7D 1MQ6A 1LHFH 4CH8B 1KXCA 1SGFG 1IHSH 3ELAH 3SNCA 1HAIH 1HAYB 3HPTB 1NT1A 1Y5UT 4BTIB 1C1TA 5H4IB 3W94A 3TGIE 5EW2H 1V2RT 2WPKS 4AB8A 1T31A 1EXFA 4O97A 4I8GA 1P2JA 2VIQA 4CHAB 3K65B 3QGJA 1QNJA 1THPB 2Y7ZA 5T1VA 1C5YB 1GCTB 4HZHA 4MTBA 1C5TA 3SV2H 3KYFA 2FOMB 2V6NA 4NSVA 2BVSH 4Y0ZE 2Q1JA 3EDXB 3EQ0H 2EA3A 1D3PB 1EOJA 4FETA 1MBQA 1D6RA 1QIXB 3PTNA 1UTKA 5L30H 3UNRA 1FAXA 2KCYA 3PWCA 1V6DA 1NBME 1V2MT 2QF0A 1BHXF 2LPRA 3TGKE 4DIIH 3S7HB 9LPRA 4P02A 1FV9A 2VGCC 4FUHA 4INHA 2ZG0H 4XFQA 2ASUB 1LKAA 1W7XH 1F5LA 2GJGA 1AVGH 1SGRE 2SGPE 3KEEA 2C3SA 1Z8JB 4GHQA 3LGWA 2SFAA 1C5RA 5ESTE 2GT7A 2KR7A 1CU1A 1SGFA 4NSYA 2VVCA 4WXVA 1ELCA 1H8IH 1OWIA 1O35A 3RMOH 1DT2A 2W26A 3M3VA 1UVTH 4WWYA 3DCLA 1TRYA 5EQRA 2JKHA 4I32A 1SQRA 2BVXH 2Y82A 1T4UH 2J34A 4JZEH 4AGKA 3S9CA 2XOKD 5DP5A 2RDLA 5C2ZA 3EA7A 2QXHA 3M5OA 5E2PA 2XCFA 3PLPA 4X6PA 3P95A 7GCHF 3TLOA 1QZ8A 3GDSA 4RKOB 5EXMA 3PLBA 2YNAA 4H4FA 3UIRA 4OS2A 3GCTG 2GCHG 3LC5A 1KXBA 3RXQA 5EJ1A 1P2IA 2P16A 1H8DH 2ZF0H 3K6YA 2J92A 3E16B 3SJOA 3MOCA 2ILNA 1K0HA 3BTWE 1YCPK 1QJ7B 4ABGA 2BLOA 4J2YB 4ABFA 4ABDA 1G3CA 1V2JT 2AIPA 3B23B 1Z6JH 2WPDD 4GUXA 5K0HA 3PO1C 3O8DA 3L6PA 1H4WA 1O30A 5DSFA 4HFPB 1QBNA 2AEIH 2J9NA 2UUJB 1H9IE 2BM2A 3KQEA 4CRGA 3RXDA 3NPSA 4X1SU 5EOKA 1NM6A 2BHGA 1TMBH 2Y7XA 1K2I1 3SUEA 1ETSH 2FEQH 2HLCA 1DUEA 2WSSD 3MO6A 1BB0B 2UWLA 2OBQA 2A5IA 1ZYOA
chains in the Genus database with same CATH topology
3SJ8A 1Z8GA 1O0DH 1ZJDA 3OU0A 5E0GA 4AFQA 2SGEE 3DT0H 1V2VT 1E35B 1TFXA 1EJAA 1QBVH 3STIA 3SJIA 2I6SA 2P59A 3GDVA 1SFIA 2J95A 1B0FA 1BBRE 2C8WB 2B7DH 4Y7AA 5JDUB 4B71A 1YCPH 1C1VH 1PPEE 2STAE 3A8AA 4ISOA 3BN9A 4Y6DA 3RP2A 5L2YH 1J16A 1FMGA 1PQ7A 2K1QA 1Y5BT 1GDUA 3RU4E 5C5OA 1NO9H 2CMYA 2OLGA 3SV6A 4OS5A 1PYTC 2VWNA 1PPBH 4X6NA 1BRUP 1W2KH 4UDWH 5DKMA 1C2GA 2BY6X 1O2JA 3FFGA 5E0HA 1A5IA 3GCOA 1BTXA 3SORA 1HAVA 1PPHE 1FY5A 1O2ZA 3SUGA 1NU9A 1HAPH 2FO9A 4YT6H 1G3DA 3CS0A 4GSOA 5C1XA 3L3TA 4DOQA 3RC6A 2EI8A 1GMDF 5EQSA 1KLJH 3RXKA 1A0HB 1ELDE 2BQ7B 3T27A 1K22H 3KL6A 4UFFH 3SU3A 1WQSA 5EQQA 3U98H 5BPEA 5C67A 2TIOA 3E91A 3UQOA 1BMMH 3MFJA 1GHVH 2ZDLA 1RTFB 2BD3A 2BD9A 1S83A 1G2MA 2HRVA 1C4U2 3GISB 3KQDA 4O3UA 2CHAB 1FDPA 2FOGA 3ZZ4A 1K21H 1DLKB 1FNIA 4HGCA 4WMFA 1GBHA 1OP0A 1QJ6B 1HAOH 1J15A 1E36B 1GMCF 1GMHF 2QXIA 1Z7KA 2XWBI 3ZVDA 2A4QA 1QGFA 4ZKRU 2BZ6H 2Y5GA 4IN1A 1G37A 2Z3EA 2FS9A 1AUTC 1O36A 3UOUA 4TWWA 1TNKA 2FESH 1SGNE 1HCGA 3A8DA 2GDDA 1V2UT 4JZIA 1Q2WA 1WTHD 2FOHA 3SQHE 4NA9H 2Z9KA 1LQEA 1EAUA 1D4PB 3KIDU 4MPWA 3V0XA 1TLDA 3IITA 2G55A 1T32A 4NCYA 4UEHH 2O8UA 1QB1A 4JMYA 1P04A 1Y3YA 1GJ4H 1P9UA 3A7VA 1QJ1B 4VGCC 3GCHB 5A8ZA 1O2GH 1MTSA 3Q77A 1YLCA 1C5NH 2BVRH 1YLDA 2BDHA 5F03A 3DA9B 2W7SA 3SHCH 3EA8A 4K3JA 4FUJA 2ZCHP 1ID5H 1W13U 1SGQE 4JYUH 2G52A 3ZZ3A 2CJIA 2WPJS 2KAIA 3A89A 1O2MA 3I29A 1HAXB 1NN6A 2XYAA 4UFEH 6CHAC 2Y5FA 3RXOA 4ABIA 4MNXA 1OP2A 4NZQA 4O3TA 3RXEA 3G01A 1LPGB 2H1UA 3LIWA 3TH3H 1XKBC 2ZDMA 1EJMA 4NIXA 5ABWA 2GX4A 2TRMA 3VFEA 1UTMA 3GY6A 3TNSA 1OWHA 3SNEA 2Q6DA 5E0JA 1RIWB 3SJ9A 1AFQB 4TPIZ 1LHDH 1KXEA 2BD2A 1IQMA 1O5BB 1CBWB 4I8JA 5HMAA 1BQYA 4K8BA 5LPFA 1JOUB 2ODYB 3A83A 3RXUA 3ATMA 3TNTA 4JYTA 2P95A 1MQ5A 4E06H 1O34A 3LPRA 3UREA 3F9GA 3LOXA 1RS0A 1MTUA 3QTOH 3ZVGA 2WUBA 1GBDA 2VIDA 4KP0A 4ISHH 3BIVH 1A3BH 2V35A 1W0YH 4WVPE 2QAAA 3LH3A 2G81E 3RXCA 1SQAA 1O31A 1QB9A 1V2OT 3GY7A 1QHRB 1K1LA 1NROH 4CR5A 2ZHDA 1TBZH 1SQOA 2M5TA 1Z1IA 1P12E 4BNRA 2BDBA 1GHYH 1HJ9A 1P9SA 2FWWA 4IC5A 2PSXA 3LONA 4ABEA 1A46H 2PV9B 1P09A 3M7TA 1ZPBA 2ZFFH 5ESBA 3LH1A 2THFB 3NWUA 3RMMH 1UTLM 1IHTH 1O2HA 2PFEA 4Y8YA 4U2WA 2B0FA 5CHAC 1EKBB 1AIXH 2BD4A 1XVOA 1GBLA 3F9FA 4QT8C 2AIQA 1UTPA 1SHYA 2SGQE 3ZV8A 2O8WA 2BLVA 1K1IA 2FTMA 5F6MA 4YTAA 3AAUA 1AZZA 2BY8X 2BDIA 1W11U 2A2QH 2ZNKH 1Y8TA 2WUCA 5A8XA 2O8LA 2G4TA 2GZ7A 1AU8A 1UVUH 2ESTE 1N8OB 1O5DH 5AVDA 1YCPM 5T3HA 1QFKH 1WV7H 4DW2U 3BTME 5EODA 1IQHA 2H5DA 1TONA 1U6QA 2AFQB 1L0ZA 1O2QA 3DUXH 3GCTF 1IQKA 2GCHF 3BEIB 1HAVB 1BRBE 5FCKA 2XNIA 3BG4C 1P2OA 1BUIA 5GCHG 4B75A 3VPKA 4OS6A 5T6DA 2UUFB 4K1EA 2FOAA 1CHGA 1SGCA 3M35A 1P11E 2EI6A 4FU7A 4Y71A 4AZ2B 1EZXC 2YNBA 1SL3A 1O5EH 1OWEA 3TJUA 3UFAA 1TYNA 2P94A 2SGAA 1V2PT 2JETB 1TRMA 1DWBH 1TA2A 4H6SB 1KTSB 2Q6FA 3C1KA 1O3IA 2FPZA 2GVFA 4K69A 2BDGA 4FUGA 3PWBA 1BBRH 1G9IE 1SQTA 3ZZCA 2BQ6B 2WPIS 3DD2H 4A1XA 5A0BA 4CHAC 4DCDA 2ANWA 1HJ8A 1SI5H 1GCTC 2F91A 2OC1A 1C5MD 1HJAC 4INKA 3UOPA 3MH4A 4MNVA 1EATA 2P8OC 2Y81A 4ISLA 4YO9A 1OX1A 3UY9A 1O2XA 1D9IA 4DGJA 1F0SA 5JB9S 5PTPA 2RCEA 1L1GA 4NWLA 1GHZA 2QN5T 2ZI2H 3RXIA 5E8EH 2WPLS 4Y8XA 2BY5X 4I8LA 5BRRE 3NXPA 2XC4A 3AW0A 5DP6A 2F9VA 2YOLA 1TX6A 1NY22 2IPHA 3BTKE 1MD8A 3GY8A 3BTFE 1C5XB 1DOJA 1SBWA 6LPRA 4Y10E 4A5TS 3I77A 1UVSH 1C2KA 2VNTA 1C5PA 1B7XB 4GPGA 1ZTLA 2HNTC 3A7WA 2BDYA 2F3CE 2BDAA 2ZHQH 1Y3XA 1NFXA 3RLWH 3NCLA 4ZKNU 1GHAF 2TGPZ 1KXDA 5J4QA 3PTBA 1PQAA 5HGGA 1GBIA 1PPGE 2KAIB 2G8TA 2BOKA 5JBBS 1OS8A 3H5CB 5DP9A 4Z0KA 2OD3B 2NU2E 1C5ZB 2BLQA 3GYMA 1W3CA 2CV3A 1GI5A 1E37B 2XXLA 1TOMH 1DM4B 1AZ8A 1ZGVA 4I33A 1C1NA 3BTGE 4B2CA 4WJG2 5LPRA 1HNEE 5FPSA 2OTVA 4BOHA 4TYDA 5CHAB 1MCTA 8KME2 1EX3A 1O3KA 4KTUA 3MTYA 1CE5A 2D2DA 3UNQA 1GJ8B 1HXFH 2VJ1A 2Q6GA 3NKKA 1E34B 4B2BA 1RFNA 1UJ1A 1SMFE 4FUEA 3KF2A 4UD9H 2JH6D 2VH0A 5G4BA 3UPEA 1VITF 4IC6A 2C93B 2B5TB 4K60A 1OWDA 1JIMA 1YGCH 2AMQA 1V3XA 2PGBB 1LO6A 2VINA 4SGBE 1EQ9A 3RXTA 4ABHA 4CR9A 1SGDE 4BAMB 3LGUA 2GP9B 1WOFA 3HKIB 2UWOA 5DP8A 4ESTE 1OKXA 1FY3A 3VB5A 1ZSKA 1C1OA 1NRQH 1DPOA 1DY8A 1LMWB 1O5AB 2ODQA 1NC6A 2VWLA 1KDQB 1O3CA 4ABJA 1YPKH 1CVWH 2ULLA 1SR5C 1VGCC 1AE5A 2JH0D 4NFFA 4Q7ZA 4U32A 4ASHA 3SUFA 1EAIA 1O3JA 3HK3B 3PMHB 2GKVE 1QURH 1P2MA 2FLRH 5FHTA 3RLYH 3VEQB 3TVJB 2OC7A 4Q80A 4H6TA 1QQUA 1O3PB 1OXGA 1C5SA 2NU0E 1G30B 3TPIZ 4IBLH 2HGTH 4AYYB 4E7RG 4B76A 5B6OA 1HJAB 4NFEA 3A87A 4AFZA 1ZMJA 2P8OB 1DXWA 4JZFH 1S85A 1CGIE 2OC0A 1JWTA 2C4FH 2H6MA 3T5FH 1S82A 2FX6A 3Q00A 1SC8U 4YESB 3MNCA 1L1JA 2ZGJA 3NUMA 3AAVA 1TIOA 5F8XA 5C3NA 2V0BA 5T6FA 3S9BA 2FOBA 1HIAA 1AGJA 3SW2B 2R3UA 3M5NA 5HYOA 4RN6A 4AX9H 1C4V2 2Z9LA 1C1UH 2CHAC 3UQVA 1HUTH 4FUDA 4MDSA 3V13A 1A5HA 1AQ7A 1CHOG 4IN2A 5FPYA 1RD3B 2BQWB 4D9QA 1GI1A 3KQBA 1KLIH 1AKSA 1E38B 2FP7B 2V3OH 1ANCA 1ZOMA 4JK5A 1CGJE 1UK3A 1GHXH 2PGQB 1O3GA 3M3TA 3PMAB 1ELTA 2OQUA 3VGCB 4NIWA 1UO6A 1C4Y2 2CXVA 4WXIA 2O8TA 1DWEH 4GCHF 1GDNA 2P93A 1OP8A 1P57B 4AG2A 2Z9IA 5JBTA 2TPIZ 1GBMA 2ZDAH 3MH7A 2BOHB 2I6QA 5DPAA 3RXVA 1EZQA 3QO6A 2H2ZA 3GCHC 1LTOA 1RTKA 1PFXC 4GAWA 4DJZB 1O2LA 1EPTA 1T8NA 2BTCE 1LVBA 1TBRH 1F2SE 2AMPA 4AORA 1INCA 3ZZ8A 3ZYEA 2ZTYA 3GY2A 3S0NA 3VXFH 3O8CA 4GLYA 3P8FA 1O3NA 4PROA 5FCRA 1GHBG 4FUFA 3EA9A 2WPMS 1UK4A 3DFJA 4E05H 1AUJA 1AMHA 3TK9A 2A45B 3LGYA 5EPYA 1ZRBA 2BDCA 1ZJKA 2D26C 1GVZA 1RIWC 4CRAA 1AFQC 2R2WU 3QGNB 5C5NA 1CBWC 3BIUH 2XBYA 3VB6A 1AD8H 4BAKB 1EB2A 4X8VH 2QC2A 5EXLA 1PPFE 1WU1A 4K2YA 2Z3CA 1N6XA 1ANEA 3ZVEA 1ZSLA 3A88A 2R2MB 1A0JA 2UUKB 3RXAA 1DSUA 1YP9A 1D3DB 2OC8A 1EJNA 1EPTC 1TPSA 1T8MA 6GCHG 1ZPCA 1GI4A 1P03A 3PROA 4DVAU 1TPAE 2HOBA 2ZU1A 3OY5U 1VGCB 2VIPA 1YPHE 8GCHG 4K1SA 1K9OE 2FI4E 3ATKA 1PJPA 2VVVA 1O3HA 1K1OA 2VB0A 3ZZBA 2WYJA 1KY9A 3BTDE 3QZQA 1TNLA 4U30A 1F92A 3TJOA 1A1RA 1X7AC 3BG8A 1V2KT 1P0SH 2WYGA 2P3UB 2FS8A 3SHAH 1TAWA 1K1PA 1L1NA 2FDAA 4YOJA 3NK8A 1H9HE 2CF8H 3ZZAA 1K1MA 3TU7H 1DLEA 3AASA 4LK4A 4I31A 5L6NH 1DFPA 4KGAA 3MU1A 2PHBA 3F1SB 3RM2H 1GBKA 3QX5H 4NA7A 1N8OC 2OP9A 2BX3A 1ESAA 4X2XA 1LPZB 2J94A 1SLUB 1BT7A 1VR1H 3A8BA 1NTPA 3ZVCA 1FI8A 1HAZB 1C5OH 1Q31A 3E1XB 1C1RA 1DX5M 4INLA 4Z6AH 1GI2A 1AWHB 1XMNB 3RXBA 1H9LB 4FVDA 3QLPH 1C9PA 3MO9A 1O37A 1S6FA 3SZNA 4XE4A 4ABAA 1UVOA 2HWLB 2HNTE 1GI3A 3P17H 1O2KA 2ZQ1A 1GJBB 1CGHA 4Y0YE 1JMOH 1CO7E 1AWFH 3GY3A 3P92A 4WMDA 2JETC 1O5FH 3DHKH 3EYDA 1O3MA 1TMTH 4OS1A 2A32A 4FUCA 2ZHEH 4ZHMU 3QWCH 1LQDB 3SGQE 4UE7H 1D3QB 1BJVA 2PKAA 1HIAB 1FN6A 1TNHA 1K1JA 3MH6A 1QTFA 5FX5A 5HM2A 1SOTA 2Z6BD 1NS3A 2F9UA 1L4DA 3RM0H 2BYAX 3LC3A 3SO3A 1TNIA 1C2FA 2ZA5A 5A0AE 1O2VA 1XUHA 1W7GH 3HGPA 4X8TH 3P8GA 1AKSB 3ESTA 2VWOA 1O2NA 1GI6A 4X1NU 3RXHA 1SGTA 3HATH 1FQ3A 1G2LA 3FVFB 3U9AH 4AYVB 4O03A 1BMAA 2Y6TA 1ANBA 2BX4A 1ETTH 1A3EH 2B9LA 2BLWA 3SU2A 1QA7A 5DGJA 1P2KA 3SN8A 5JBAS 2FODA 1MTVA 2VIVA 3VB3A 5A2MH 2XC5A 1BTYA 2G5NA 4NIVA 1NFYA 1GL0E 2PR3A 1QL9A 3MYWA 2ZPQA 3O8RA 1C2IA 2RA0A 1EPTB 3BTHE 2ZDNA 2GV7A 4ZUHA 3RC4A 4Y76A 2A5KA 2AYWA 3A7YA 1TGSZ 2A7JA 1QB6A 1QRZA 1DSTA 1GI0A 2PTNA 4A92A 4B74A 2BD7A 2QA9E 1YF4A 5ETXA 2ZP0H 4XBBA 3TJVA 1KLTA 1RRKA 4X6OA 1SGIB 2Z94A 4AFSA 1EB1H 4CRCA 1O3FA 3SU5A 1ESTA 5L2ZH 4AG1A 3BTEE 1KDQA 3C27B 1EZUC 1FLEE 3BTTE 2XBVA 2R0KA 2ZO3H 1TGNA 2ZKSA 1EUFA 4MNYA 1O2OA 2V3HH 3SNAA 1YPGH 1V2LT 3PMJA 1LVYA 3Q3YA 5E2OA 3V7TA 1IQJA 5JYIA 3F68H 1QRXA 4Y11E 1ZMNA 1FONA 1ZGIA 4MLFB 2BZAA 2DUCA 1BBRK 2ALPA 1NFUA 2PWXA 3RC5A 3KN2A 4AGJA 1FIWA 2F9BH 3SNDA 4UFDH 1QBOA 3SV8A 5DG6A 3MMGA 4NWKA 4KTSA 5TCCA 2CF9H 3QN7A 1BZXE 7GCHG 1DANH 2BD5A 3UWIA 3Q3XA 3KQCA 5F8ZA 3U8OH 5DO4H 3FZDA 5GWZA 1FN8A 2WV5A 2F9NA 2PKSC 1GPZA 3PM3A 5IYTA 1SB1H 1YPEH 1YPHC 3L33A 3DFLA 1LPKB 1C1QA 4YLUA 4R8TB 4ISNA 1FXYA 2OINA 1YM0A 1JRSA 2P3TB 3LU9B 5DP4A 3T2NA 1N6YA 1TA6A 1TBQH 3ATWA 1NRRH 4X8UH 1OYQA 3QZRA 1O38A 1TGCA 5DP7A 2PW8H 1MUEB 1ZMLA 1NRPH 1HRTH 1Y3VA 4Y7BA 2OQ5A 4X2YA 4CREA 3TGJE 3URCA 3CS7A 1JIRA 3RXRA 4BTUB 1HDTH 1GJ7B 1XUKA 3S69A 1YPMH 7ESTE 5GJ4B </