1DLEA

Factor b serine protease domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
298
structure length
288
Chain Sequence
ADPDESQSLSLCGMVKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR B
publication title New structural motifs on the chymotrypsin fold and their potential roles in complement factor B.
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 288
sequence length 298
chains with identical sequence B
ec nomenclature ec 3.4.21.47: Alternative-complement-pathway C3/C5 convertase.
pdb deposition date 1999-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dleA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dleA02
3TJOA 4NIYA 3FANA 2WPMS 1BTUA 2R2MB 1SGEE 1DT2A 2P8OC 1ABJH 4ABFA 2A5KA 3LH3A 3NPSA 3QDZB 3SJOA 2AEIH 3URDA 1FI8A 4E7RG 4RKJB 5B6OA 1ZYOA 2ZU1A 1HB0B 1MKXK 2JETC 4BAOB 3R3GB 4CRBA 1C2IA 1T4UH 4F4OC 2D26C 1GBLA 1P01A 4AFQA 6GCHG 3PWCA 2ZFRH 2ODPA 5JBAS 2ZNKH 1HCGA 2H9TH 3E1XB 2A32A 4Q2KA 3RM2H 3BG4B 1QURH 1MUEB 1CVWH 3KQCA 1AFQC 1O3MA 3KGPA 8ESTE 1TWXB 3SNDA 4I8LA 6GCHF 1O3LA 1GI7B 1C2FA 2Z9KA 3UREA 4MPVA 3EE0B 1TA6A 8GCHG 2AMPA 1FAXA 4JMYA 1BIOA 3T62A 3KEEA 1JIMA 1GBKA 2BQWB 3B9FH 1XUGA 5JBTA 1C1SA 5C1UA 1JRTA 2D1JA 3SV7A 2G8TA 1YCPK 2P93A 4NWKA 3SHCH 4FUDA 1C2GA 3TPIZ 2ZPRA 4GHQA 2WUBA 2ZCHP 3S9BA 3M37A 1NRRH 3CS7A 3PLPA 4UFEH 3DFJA 3H7TA 3RU4T 2SGQE 2ZO3H 2Z9IA 1S6FA 1AGJA 2AERH 2VVCA 1TPAE 1HAGE 4WMFA 1B0EA 5BPEA 3RXOA 3NKKA 1OYQA 1VJ9U 4X8VH 1QHRB 1WOFA 1IQIA 4DJZB 3RC4A 1GJ9B 2WPKS 4MPWA 2QV1A 4ZKOU 4DOQA 2WINI 2A2XH 2J2UA 2WPJS 2Z7FE 1FY1A 2VIOA 2ODQA 3ATLA 1XKBC 3VB7A 1NFUA 1K28D 3ZVEA 1VCWA 5EGMA 1ZOMA 2PUXB 1SGRE 5T6DA 3KL6A 4OS1A 5SGAE 2ZDKA 1A61H 2BLVA 2HPQH 1XVMA 1O38A 2ZCLP 3SI4H 1Y3VA 1O2NA 2XBWA 1HAHH 2FLRH 1A46H 1SR5C 3OTJE 2F9PA 1ZRKA 3VXEH 1OYTH 3RMMH 1YPHC 3SGBE 3A88A 1FZZA 3E3TA 4FVBA 1CHGA 1A0LA 3RC5A 5JB8S 1W12U 1JXPA 3TJNA 4NCYA 2ZQ1A 4SGBE 2GDDA 1LHCH 3QTOH 4GLYA 2JH5D 1NY22 2CMYA 1P3CA 1TYNA 1DWEH 4K1EA 5TJXA 3L3TA 3HPTB 2F91A 4JYVH 2VH0A 2ZU3A 3ZVAA 2ZKSA 3F9FA 2P8OB 4X1NU 3TIUA 3URCA 2C8WB 1FPCH 1GBCA 2VVVA 5LPEA 1QNJA 4MNYA 4X1PU 1HV7A 3SV8A 2JETB 1GJ7B 1P03A 4YOIA 3SU3A 1ANCA 5JBCS 3A81A 1EAXA 2J92A 1ZJDA 1G3BA 1TABE 2TGDA 3VXFH 1EZXC 1U6QA 1OP2A 1BMNH 1O5FH 2TBSA 1JOUB 1P12E 3ZYDA 1G2LA 1XM1A 3D62A 2R2WU 2SGPE 1P10A 2C8XB 2F9NA 2BLQA 2VIDA 1C5UA 2R3UA 4NIXA 1D3TB 4UEHH 3LDXH 5G4BA 4IS5A 3PTNA 1YPGH 1AFQB 2A0QB 1TE0A 3I77A 3QN7A 4JZFH 1BRBE 2AGGX 2QF0A 3BV9B 9ESTA 1KTSB 5H4IB 4ISHH 2AS9A 1J16A 4A1VA 5HXFA 1BTHH 1LVBA 4MPXA 1UMAH 3M35A 3IITA 1LCYA 1GJ5H 1FQ3A 1TBRH 3BIUH 1O3EA 3LGYA 3ZVCA 3ZV9A 1AB9C 2FOEA 1T8NA 2JKHA 3OSYA 5ESTE 1K1PA 1BMMH 1SHHB 1SG8B 1K9OE 4ABEA 5T3HA 1XUFA 1KXCA 5DP4A 4O97A 3PLKA 5C5OA 1WQSA 2EC9H 2GP9B 3MU4A 3UQVA 1QJ7B 1ETSH 4D76A 4Q7ZA 3ATWA 1HXEH 3SV6A 5AFZH 2B0FA 3OYPA 5A0BA 1C2DA 4Y6DA 1GDUA 3FZDA 3OU0A 2PFEA 2ZC9H 3ZZ9A 2A4OA 3Q76A 4ZKRU 4D7FA 1BRAA 2W7SA 2IOTA 3GY5A 2BLOA 4B2AA 2Z3DA 2ILNA 3FAOA 2GZ9A 1MQ6A 1LDTT 3BTFE 1ZLRA 4Y7BA 1DSUA 1V2NT 3MU8A 2ALVA 1QCPA 2VIQA 4E05H 2ZWLH 1D6RA 1KDQA 4DG4A 2OQUA 1C2MA 4GVUA 2XW9A 3G01A 4B76A 4R0IA 1ABIH 1KTTB 2TGPZ 1TMUH 1SGIB 4HI3A 3GCNA 4CBOA 1QY6A 1CA0C 1MTSA 2SNWA 1MMJN 3MWIU 1UHBA 3UNSA 5EW2H 3TH2H 1LHEH 1W7XH 3GY2A 1EZQA 3TK5A 3M7UA 2BDHA 5CMXH 2Y82A 2P94A 1XUJA 1OWKA 1UTJA 1ZJKA 4FUHA 2ZDVH 4CRGA 1TNKA 2ESTE 3GY8A 5I46H 1FUJA 1V2OT 1DY9A 1FPHH 4U32A 1GHWH 1HUTH 2CF9H 1SOZA 1Z7KA 3U1JB 2UWLA 1C4U2 1HYLA 3P17H 2G81E 3K65B 4IN2A 2ZCKP 1O2SA 1BZXE 2GZ7A 3P8FA 2BX3A 1IQHA 2VGCB 3D65E 2V6NA 5E2OA 1GMCG 3EA9A 3E0NB 1FY4A 4B2BA 2HWLB 4FU7A 2BDIA 5PTPA 2OC1A 4BAQB 1QQ4A 2V3HH 1IQJA 1HGTH 1VGCB 3MH6A 2GCHG 4YOJA 5EPNA 2V3OH 2QCYA 1V2VT 1ETTH 1SGCA 2HRVA 5A8XA 1YGCH 1H9IE 3MO3A 1MBQA 1GMCF 1KDQB 1W10U 3ZVBA 1IHSH 2XNIA 1RTKA 3SU4A 3V12A 1ZSKA 2VWNA 1MD7A 1C5PA 4UDWH 1O37A 1TRYA 1NFXA 2GCHF 1VITG 1D3PB 1J14A 3S69A 4E7NA 2G55A 1VZQH 1Z8JB 3I78A 1IQLA 1V2ST 4X1QU 3FP8E 4ZAEA 4JYUH 5C2ZA 2YNAA 1UHBB 1HPGA 1PFXC 1C1UH 2W3KA 1PPHE 1QQUA 1G30B 1UCYH 1AB9B 3JZ1B 4AB9A 2Z3EA 5JDUB 1O3IA 1G32B 1L1GA 1GJ6A 2YOLA 4WF8A 1EXFA 4OS6A 3SUDA 1YBWA 1GBBA 2J4IA 1O2QA 1DXPA 2QGRA 2VJ1A 1TGCA 1VITF 1CT4E 1MAYA 1CGHA 2QC2A 1N6YA 4ABAA 3JZ2B 3NZIA 4B75A 1WTGH 3A7TA 1HDTH 4KTUA 4MTBA 1NTPA 1TPOA 3NUMA 1WAYB 2STAE 3KQDA 3A8AA 3T26A 3EQ0H 5ABWA 1TIOA 1JRSA 1T31A 2Z94A 4ISNA 4WH8A 1WSSH 2BD8A 2STBE 3LGUA 1DPOA 1C1PA 2D8WA 3QZQA 1C5XB 4X8SH 4CBNA 1FXYA 1G37A 1GJCB 4Y79A 1DY8A 3A8BA 4I7YH 1DFPA 2O8UA 4FVDA 3MMGA 4ZKNU 1EB2A 4DIIH 2ZHDA 3PROA 1SLXB 3UR6A 3RXCA 2NU2E 3P8GA 2ZA5A 5F8ZA 4BANB 4QT8C 1CA0B 1A3EH 3E8LA 1O5GH 3RXPA 1TNGA 1Y59T 1SQOA 1UTNA 4UONA 1IHTH 1BB0B 1IQKA 4A1TA 1L2EA 3QLPH 2H9HA 3E6PH 1Z71A 3MNXA 4MDSA 1O36A 3HK3B 3ZZ3A 2BB4A 4Y71A 1FMGA 4B71A 1KLIH 1BTXA 2VWOA 3SQHE 2OC0A 5JPMH 3O8DA 3HKJB 2ZTYA 1TNLA 4ISOA 5EODA 1O3BA 1C5ZB 1OPHB 1HAVA 5ETXA 2GTBA 1UO6A 1GPZA 3S7HB 2W5EA 1C4Y2 1GBTA 4D8NA 1AO5A 3OY6U 4A6LA 2G4TA 3BN9A 2PR3A 4MNWA 4FUIA 2AGEX 4MNVA 1O3JA 5DP6A 2ZZUH 2ZU4A 1S6HA 2RDLA 3GOVB 2VWMA 1DWBH 5DP3A 1N8OC 2A45B 2HNTE 3IG6B 3SNBA 3VEQB 5F03A 4BAMB 4AG2A 1C5VA 4K1SA 2FEQH 5FBIA 1B0FA 1ZSLA 1YPMH 2F83A 2FOCA 3LPRA 6LPRA 2GX4A 1BA8B 1NFYA 1L4DA 2H2ZA 2JH6D 1BJUA 4NWLA 3ITIA 2PHBA 1NU7B 4UFGH 1C2KA 1GL1A 1SGYE 2SGFE 1EB1H 4DGJA 5A8ZA 1K2I1 2P3FH 4Y7AA 4K1TA 2QA9E 4ZROA 5JB9S 1W7GH 3UIRA 4YM9A 3A7YA 4WJG2 3K6YA 2THFB 4YLQH 3SBKA 5TCAA 2LPRA 3A86A 2ZDMA 2OBOA 3PWBA 4ISLA 5EU8A 1B5GH 2WPHS 3O8CA 1HAVB 1S0RA 1SGDE 2BY6X 1GHZA 2VIWA 5GXPA 1KXAA 5FXLA 3ATMA 2BY7X 3PMJA 2QF3A 2J9NA 1H8IH 2Y81A 1C5YB 1C9PA 1QJ6B 1ZSJA 1DLEA 4ABBA 4CRAA 4AYYB 3EDXB 3RXKA 2BDBA 2EEKA 2P3TB 1ZTJA 5E8EH 3QWCH 3TU7H 1O2VA 1GJDB 3LGWA 1QR3E 4X2VA 3KQBA 3QO6A 4OGXA 4FUGA 1QRXA 4GSOA 3SU1A 3SJ8A 5C20A 5JBBS 2IPHA 1HAPH 1O2OA 1A4WH 1EAUA 4MLFB 1QL7A 2BZ6H 4PROA 3SI3H 1O5DH 1YPKH 5EG4A 1UVUH 1GDNA 2OC8A 1GBFA 1O3KA 4NG9H 4BTTB 3S7KB 5F8TA 4ZMAH 4FU9A 2VU8E 2W26A 4CHAC 3DD2H 1GJ8B 4YT7H 4I8JA 1EJNA 4TY7A 1H8DH 3STJA 1IQNA 2C93B 1THSH 4ZXXH 3DFLA 2XWBI 1QRWA 4IMQA 3SU0A 1INCA 1P2MA 1G9IE 1O35A 1UTKA 1DITH 4AGJA 3LU9B 1FIWA 1MAXA 1V6DA 3U1IB 1ZHMA 4B2CA 2PKSC 1JBUH 1O2XA 4JZDH 1G3CA 1XUIA 1YP9A 4GHTA 3SOSA 3AAUA 3ZVFA 5E0JA 4FUEA 2O9QA 4NGAH 1TBQH 3TK9A 4ABIA 1O5BB 8GCHF 4SGAE 2FOMB 4OS4A 1GL0E 1NC6A 3UY9A 2A4GA 2BLWA 2I6QA 2G4UA 3V0XA 3QUMP 1QFKH 1S5SA 5HM2A 1XXDA 1ZGVA 1UTPA 3W94A 1JWTA 1TBZH 1HJAC 5DP9A 1UCYK 4ABDA 2DE9A 3SZNA 2ZI2H 2GT7A 2WUCA 4AFZA 1MTVA 4WMDA 1TX6A 2LNCA 2PSYA 1LVOA 4HGCA 1IQMA 1RS0A 3ZZ7A 4IGDA 1F0TA 5FX5A 1NRNH 3SORA 3ZV8A 4X2YA 4K3JA 3RP2A 1KY9A 4Y8YA 2ZTZA 1GWAA 3T28A 3CENA 3TNSA 4M7GA 2YNBA 1TMTH 3K2UA 2HOBA 3TITA 3KNXA 1TPSA 2HLCA 3GCHC 1AUJA 1DM4B 4XOJA 4HTCH 1C1QA 3SU6A 2BOKA 3RXVA 3TH4H 1JIRA 1GVKB 3A80A 4K8BA 1WBGB 1PPFE 1HBTH 6CHAC 1P0SH 1LKBA 3TLOA 1BBRK 1NO9H 2ZHEH 2UUFB 1F2SE 3MU0A 1SHYA 7LPRA 3UNRA 1W2KH 5FPTA 4OS2A 3F68H 2Y7XA 9LPRA 2A2QH 1LMWB 3FFGA 2FS8A 1L0ZA 3A87A 4U2WA 4X6MA 4ZHLU 3QZRA 4K5ZA 1SB1H 2ZU2A 1O31A 4I8HA 1UJ1A 4X1RU 1HRTH 2FZZA 2ZGXH 4DIHH 1NN6A 1O3HA 2DE8A 2FOAA 1UVOA 1YPHE 5FCRA 4FXGH 2RCEA 5A09A 2XCFA 3A7ZA 2ANYA 2CF8H 4CRDA 1ELTA 4Y0YE 3ZVDA 2G5VA 3HGPA 5F6MA 1GMHG 1Q2WA 1UVPA 1D3QB 3MH5A 4A92A 2Y80A 1UK2A 3VB3A 1D9IA 4D7GA 1ANDA 1OWDA 2VH6A 1Y5BT 1BUIA 1AMHA 2FPZA 4INHA 4CHAB 1A1RA 1OWJA 4GAWA 1OWIA 2SGEE 1MTWA 1GMHF 2FOFA 3E91A 2G00A 2BDCA 2O8MA 2V0BA 3PMBB 4KTCA 2PV9B 2HVXA 1O34A 2H6MA 5A0AE 2FESH 2QXHA 5FHTA 2GKVE 5C3NA 2FOBA 3M7TA 1C9TA 1WQVH 4Z0KA 4X6PA 4IN1A 4WMEA 3GDUA 1ZR0A 2PKSB 2ZHQH 3UUZA 1K22H 4ZUHA 3ZZAA 4TYDA 1CT0E 1PQ8A 1UVTH 3FZZA 1QL9A 3L6PA 1XUKA 2XYAA 1BOQA 2FYRA 2GV6A 1EPTC 5L2YH 1A5HA 1EZSC 4IMZA 3TJVA 1C4V2 3I29A 2EA3A 1DICA 2HALA 5J4SA 1ZPZA 1TGTA 2C3SA 2BVXH 2FO9A 5CHAC 5GDSH 1HAOH 4O3TA 4Y76A 4AGKA 1HJAB 1C5OH 1C1MA 1ZPCA 3BEIB 3KQEA 2ODYB 2ZGBH 2WPIS 1LO6A 4CRFA 1Q31A 2WYGA 2OD3B 3S0NA 1P2NA 1W13U 2SGDE 5J4QA 2ULLA 3BTGE 4Y0ZE 5C5NA 3ENSB 1O3FA 1SLWB 3RU4D 1O3PB 4TPIZ 4VGCC 1ZMNA 3TVJB 4XDEA 4WH6A 2B8OH 2H5CA 5JYIA 1DDJA 1G36A 2ZPSA 5EPYA 3GCHB 1O2IA 2GZ8A 3A83A 1PPBH 3A7VA 1QBVH 1A5GH 1MKWH 1J17T 2ZHWH 5TCCA 1BCUH 2QXJA 4XE4A 4IC6A 1C2JA 4AORA 6CHAB 1D4PB 2ZPQA 4J2YB 3RDZA 3SUEA 1O2JA 2WV4A 3BTHE 1VCQA 1PYTD 2A5IA 1V2TT 1TOCB 4O3UA 1EPTA 2I6SA 2GCTC 4YOGA 2XTTB 2BD9A 1CA8B 3UOPA 1WTHD 3MOCA 1XXFA 4OGYA 3LIWA 3T29A 5C67A 1F0SA 1MKXH 1UK3A 4YT6H 4XFQA 1RD3B 3M61U 3HATH 1PJPA 1YYY1 1T4VH 1C1NA 2BD3A 3RC6A 1BT7A 1AZZA 1TGBA 4AFSA 1ZTLA 2NU4E 1NT1A 2A4QA 2BQ6B 1LVYA 2BVRH 3GCOA 5DPAA 1AWHB 1UK4A 1Z1IA 4J1YA 1OXGA 1UTOA 1W14U 1S0QA 1HIAA 1P02A 3LJOA 1O3DA 1QA7A 3W95A 1Z6JH 1ANBA 4MPUA 5T6FA 3GCTG 1P9SA 1MZDA 2FYQA 4JK6A 1LQEA 1N6XA 3DA9B 2EI7A 1DOJA 1RIWC 2FLBH 1N1LA 2CN0H 2BD2A 2ZFTA 3FP7E 1SMFE 4ASHA 1T32A 3Q3XA 4WXIA 3RXBA 3NK8A 1XVOA 2BDGA 2BX4A 1O3GA 1ESBA 1O3CA 3MI4A 3MHWU 1BTPA 3GCTF 5K7RA 3HK6B 2RA0A 5K0HA 1CGIE 3U9AH 2BVSH 2TIOA 4D9QA 1W3CA 4ZXYH 3M5MA 2UWOA 1QGFA 3RXTA 1GG6C 2B7DH 1B7XB 3SNAA 1YM0A 1GCDA 3ZZDA 1YCPH 1CQQA 1Y5UT 1UTMA 3SU5A 1ESAA 1L1JA 1BBRE 2UUYA 4THNH 1AU8A 1DWDH 1W0ZU 1EPTB 1AN1E 4AYVB 2ALPA 1PQAA 4NZLA 3NXPA 4CH2B 1TX8A 4WVPE 1LQDB 2GMTC 1HAXB 1RXPA 1Z1JA 2XCNA 1C1RA 2Z6BD 1EJMA 1KXBA 5CHAB 1QIXB 1AVGH 2UUJB 1TRMA 4B74A 1P2KA 1ZZZA 1ZMJA 4X1SU 1C2HA 1F92A 4U01A 2HNTF 3SHAH 4FUBA 1O5EH 1PYTC 2A7HA 5GJ4B 4ABGA 1O2UA 3VB6A 1WUNH 1D3DB 2QN5T 3F1SB 3Q3YA 4H6SB 2QXGA 1SFIA 1LTOA 1OS8A 4YESB 1GJ4H 2CGAA 3MH4A 2GV7A 3SW2B 1V2MT 1HIAB 2UUKB 2PW8H 2ANKH 2ZHFH 1NU9A 2F9VA 1H1BA 1TPPA 2OCVB 4MNXA 1F5KU 4VGCB 2Z9JA 5EQQA 1ARCA 1ZPBA 2ZECA 1KXEA 1TMBH 1WCZA 2CJIA 1GGDC 5A0CA 4RKOB 4AX9H 4JZ1A 1THRH 3T5FH 6ESTA 5EW1H 1AZ8A 2RG3A 5I25A 3TK6A 4NIWA 1TGSZ 3P8OA 1O32A 4KGAA 1L4ZA 3F9HA 1TFXA 2BZAA 2BDYA 3MO9A 3UWJH 1GBAA 2B9LA 1O33A 2A1DB 5HM9A 1V2QT 1C5RA 1ANEA 4DW2U 1DUAA 1GJBB 2GCTB 4XBBA 3BEUA 8KME2 3RXMA 4NA8A 1C5QA 2PLXA 1KYNA 1TRNA 2GDEH 4I8GA 1ELAA 2UWPA 1K1JA 4DURA 1PPEE 3ZZ5A 4A1XA 2CHAC 2ZQ2A 1NRSH 4ZH8A 5EOKA 3RMOH 3EAJA 3M36A 4KKDA 1KSNA 2AH4X 1PPZA 2ZF0H 5E0GA 3HGNA 3M5OA 3LC3A 2OLGA 5BRRE 3U69H 2PTNA 1NZQH 2WPLS 1CT2E 2XBXA 4YZUA 3RM0H 2HGTH 2R3YA 5FBEA 3ATIA 4WWYA 4XSKU 2SNVA 1O3OA 1UTQA 4YTAA 3V13A 5GWZA 2ZG0H 3LJJA 3VPKA 3NCLA 1BTYA 3BTEE 3RUOA 1RIWB 4TY6A 2BTCE 5DKMA 4YO9A 4B1TA 2QYIA 2BXTH 3A8CA 3F9EA 1DSTA 1LPGB 1F7ZA 1HJ8A 1UTLM 1YCPM 3BTME 1AVWA 4HFPB 4JK5A 1HAYB 2BOHB 2NU1E 2Q1JA 2TGAA 1TNIA 5EQSA 4AFUA 5AHGH 2GVFA 2TPIZ 1GG6B 1P57B 2R9PA 3BF6H 1EAWA 4BTUB 4X8UH 1O3NA 1P9UA 1CSOE 1SGFG 2Y7ZA 1ELCA 2WYJA 1QBOA 1SLUB 1VCPA 1V3XA 2QAAA 2ZEBA 3SNEA 1OKXA 1S85A 5T6GA 1QRZA 1NRQH 1TQ0B 3RXEA 2GMTB 3FVFB 1O2HA 1GBDA 1C5LH 1KLJH 3MYWA 3SUFA 3CS0A 2ZFSA 1HNEE 2H9EH 5AVDA 5DP5A 1AFEH 3GY7A 5L6NH 3VB4A 1GBIA 1E37B 5FX6A 4FU8A 3BIVH 4X0WU 2XC0A 3ZZ8A 1MKWK 1EOJA 1DUEA 1NM6A 1EASA 1TNJA 2PSXA 2NWNA 2W7UA 5CE1A 2FX4A 1ORFA 3PO1C 1F5LA 5A8YA 1O2ZA 1K1OA 3A85A 2VB0A 1P2OA 3F9GA 3UOUA 3SV9A 1C5MD 2A31A 1QB6A 2Z3CA 3LOXA 1NRPH 1NPMA 3ATKA 1LHFH 1P2IA 1Y3XA 2F9BH 2OP9A 1FV9A 1GGDB 1IQGA 3GISB 2ZGJA 1LHDH 4ABHA 1GI2A 3PV4A 1Z8IB 3QX5H 1O5CB 1AVXA 2A7JA 1MZAA 4CR9A 4MVNA 1FDPA 1A0HB 1OWEA 3A7XA 1ELDE 2GD4B 3MNCA 1NFWA 1DANH 2C4FH 1BHXF 3A82A 2Y6TA 1W11U 4MG3A 5FCKA 2FX6A 4AB8A 4LZ4B 1VR1H 1T8OA 1SC8U 1HLTH 3E90B 4H6TA 4RN6A 1FONA 1K1NA 4NFEA 3AVZA 1SFQB 1S81A 4FUCA 4E06H 5FAHA 2CHAB 1GBHA 1C1OA 1GI6A 1AHTH 1OSSA 1Y3UA 3BTDE 1GMDG 4NSVA 8LPRA 2FI5E 2QXIA 5DJ7A 3GDVA 3SN8A 1HJ9A 1OP8A 2AGIX 1AE8H 2BD7A 2FDAA 2EI8A 2VVUA 1OWHA 2WV5A 3RLYH 1FAKH 2BQ7B 1GCTC 2QY0B 3IWMA 3VB5A 4F49A 1A7SA 1GBMA 2O8TA 1BMAA 3K6ZA 1RJXB 1N8OB 3S9CA 1GMDF 2BY5X 1EZUC 4BAKB 3SU2A 1AI8H 1T8MA 3AAVA 3MNSA 5DGJA 1SL3A 2C8ZB 1RGQA 1SGNE 2XBVA 2P95A 1FY8E 2ZTXA 2O8LA 1O30A 4Y11E 1QB1A 3KF2A 1AD8H 1EP6A 4DCDA 4Q7YA 1J9CH 3N7OA 4GCHG 4XBCA 2VIVA 5IDKA 2J94A 2XXLA 3RXLA 1RRKA 1F0UA 1GHVH 2ZFPH 2G51A 3GY4A 3QTVH 1G2MA 1SQAA 4JCNA 3RXGA 1SLVB 1GVLA 4JYTA 1GI5A 1Z8RA 4X6NA 1HAZB 3LT3A 4CREA 1XUHA 7ESTE 1IOEA 1P11E 2OC7A 4H42U 1VJAU 1C2LA 1O2GH 4CR5A 1V2KT 4NA7A 1P3EA 3M3SA 1MQ5A 1SGQE 5EXNA 4I32A 2GGVB 1QA0A 3PM3A 4GCHF 3HKIB 4LXBH 2ASUB 3O8BA 3PLBA 4ZKSU 1X7AC 3OX7U 3LKWA 1ACBE 3RXJA 5E2PA 4LK4A 3RXRA 2XRCA 3GICB 3O8RA 4WXVA 1O5AB 3MH7A 3RXIA 1P2QA 4DT7B 1SI5H 1SGFA 4INLA 1O2PA 1HFDA 5LGOA 3LH1A 3SO3A 2TRMA 3KIDU 3RXAA 1V2RT 4YLUA 3U8RH 1J8AA 1P05A 2XBYA 1ZHPA 2XC5A 5FPSA 1T8LA 2F3CE 4BNRA 1BITA 1T7CA 2JH0D 4D9RA 3M5LA 1EUFA 2FIRH 4ABJA 1AIXH 3AW1A 4NA9H 1GJAB 2OTVA 3LGTA 3MTYA 5A2MH 2FP7B 3BSQA 3CP7A 3P70B 3PO1B 3SNCA 2Q6FA 3H5CB 1PPGE 2R0KA 4X8TH 2BDAA 1O2TA 3DHKH 1E36B 5C1YA 1ID5H 1AKSA 3SJKA 1TONA 1SGPE 2FM2A 1ELFA 4I8KA 4NFFA 1E38B 1FY3A 3LGIA 3EYDA 1FLEE 3QGNB 1DLKB 3L33A 1BRUP 1SOTA 1A3BH 2BXUH 2VGCC 1G3DA 3A84A 3LONA 1EAIA 1AUTC 1Y8TA 4CRCA 1YPEH 4O9VA 1F0RA 1VGCC 1GI0A 1MD8A 2Q6DA 3T25A 3AW0A 1QL8A 1YKTA 1H9LB 3C27B 3BG8A 1RFNA 4FUJA 2PTCE 3BEFB 1GI9B 4UD9H 1LPKB 4K2YA 2PKAA 3MU5A 1C5TA 4INKA 4LZ1H 3M7QA 1IQFA 2J95A 2FXRA 4BXWA 4WY3A 4B73A 1Y5AT 5EXLA 4GPGA 1ZHRA 3EA8A 5LPFA 2PGQB 5AFYH 1GCTB 2FI4E 1EP5A 4R8TB 1O2KA 1NROH 1QJ1B 2B5TB 4K60A 3H7OA 1O2RA 1L1NA 2QIQA 3GY3A 1IQEA 1EJAA 1NS3A 3M3TA 3RLWH 1DS2E 5DP8A 2G52A 2AMQA 4NIVA 2ZU5A 1O2YA 1LPZB 5GIBA 1BJVA 1PPCE 5GPIB 2AMDA 3TH3H 2CV3A 1FNIA 3BTQE 1XMNB 4Y8ZA 1AKSB 2R0LA 5HYOA 3D49H 1AE5A 1ESTA 4MQAA 4ZHAA 5DG6A 4Y10E 3VFEA 2Y5FA 3A89A 1GBJA 5L2ZH 5E0HA 2PGBB 3T2NA 1TNHA 1C2EA 2NU0E 5DK1A 1BHXB 3U98H 2ZFFH 4KTSA 1LVMA 1MCTA 1LKAA 5EQRA 3VGCC 1ARBA 2ZFQH 1GI3A 4X6OA 5HGGA 1BTWA 3ODFA 1V2PT 1SPJA 3MFJA 1KIGH 1UVSH 4Q7XA 3ZZ4A 3STIA 2J38A 1P09A 1TOMH 4CH8B 2J34A 2ZIQH 4IW4E 2EI6A 2ZGCA 3UPEA 2PKAB 1GI8B 3RXDA 1SQTA 1BTZA 1PQ5A 3BTWE 3PMHB 3Q77A 1CU1A 2F9OA 2Y5HA 3M3VA 1S84A 1TX7A 4A5TS 1LHGH 1A0JA 2FTMA 4JZIA 2RA3A 2TGTA 4LOYH 4OS5A 1SSXA 1WYKA 2PWXA 3U8OH 3TNTA 1QB9A 1CE5A 3UR9A 1GHXH 1TQ7B 4DY7B 1K1IA 3BTKE 4Q80A 1UCYE 3DT0H 1TALA 2KAIA 2XWAA 5IYTA 4KP0A 2VWLA 1RTLA 2FOGA 3TGKE 3RXQA 1ELBA 1H9HE 2ZDLA 1DXWA 7GCHG 1SGTA 2FTLE 4IC5A 3PB1E 3SUGA 2AIPA 1D6WA 2ANMH 2FMJA 5F8XA 2CXVA 3P8NA 3ODDA 3UNQA 3E16B 1HAIH 4XBDA 4BXSA 4BAHB 3SQEE 1CBWC 2BD5A 1K21H 3RXUA 1YPJH 4TWWA 7GCHF 1C5SA 2FI3E 5FPYA 1O39A 2C90B 3SJIA 1FIZA 1H4WA 1K1LA 4Y8XA 1P8VC 2IN2A 1DWCH 5DP7A 5AF9H 2FODA 1KXFA 1V2LT 3ZZBA 2Y5GA 3F6UH 3FP6E 1C1WH 2A4RA 2P3UB 4DVAU 1E0FD 4K8YA 1E35B 1MU6B 3U8TH 3UQOA 1EOLA 1S83A 3RXSA 2ZP0H 3S9AA 4NZQA 3V3MA 1O2WA 2BHGA 4UFFH 3E0PB 1EATA 1Z6EA 1YLCA 3NWUA 3P6ZB 1OP0A 2A7CA 1MTNC 3V7TA 1V2UT 2FWWA 1CO7E 1A5IA 4I33A 1GVZA 1S82A 1A2CH 2ANWA 4NSYA 2V35A 4ESTE 3GY6A 3B8JA 3K9XB 3OY5U 1MTUA 2KAIB 4ZHMU 1GHYH 1MU8B 1Q3XA 2OUAA 3RU4E 3LC5A 3UFAA 2BM2A 4BTIB 1SBWA 2NU3E 1BRCE 3B23B 2XC4A 3RMNH 3ESTA 1C5WB 3T27A 1K1MA 2K1QA 3QGJA 1QTFA 3RXHA 1O2MA 3Q00A 1ZMLA 1YPLH 3P92A 1EX3A 3DUXH 3PMAB 1XKAC 3SJ9A 2BMGB 3PTBA 4UE7H 2W3IA 3BTTE 3VGCB 1YC0A 2PUQH 1ELVA 1CHOG 1Y3WA 1AQ7A 1BBRH 1GHAG 5HMAA 2AFQB 2ZDAH 1THPB 1V2JT 4IBLH 1QBNA 2FOHA 4K69A 2BY8X 7KMEH 1FY5A 3GDSA 2C8YB 1FN8A 1TGNA 2Q6GA 1AY6H 3UWIA 3GYMA 4HZHA 1GHBG 4A7IB 1MCVA 1YF4A 2H5DA 3D23A 2FS9A 3KHVA 1W0YH 2OQ5A 1CHOF 3P95A 1GHAF 3KCGH 3GYLB 3BG4C 1O0DH 3RXFA 1P04A 1BQYA 1GI1A 5GCHG 3ZYEA 1GHBF 1DX5M 2DUCA 2A5AA 1OX1A 2VIPA 2HNTC 2M5TA 3PYHA 1GI4A 3EGKH 5C1XA 3SGQE 3A8DA 4I31A 2SFAA 1WV7H 1BDAA 2BYAX 1FJSA 1NESE 3ZZ6A 3A7WA 1HXFH 1DVAH 5GCHF 4UFDH 1BMLA 2P59A 1IAUA 3LGVA 1TB6H 1JMOH 1YLDA 1GDQA 3MO6A 5EXMA 1ELEE 2Z9GA 1M9UA 1TA2A 2SGAA 4KELA 4X2WA 1F5RA 4H4FA 3R0FA 1DE7H 3KN2A 1CBWB 1SVPA 2P16A 2OBQA 1J15A 5LH8A 4AN7A 2OINA 1PQ7A 4Z6AH 4O03A 2AIQA 2BY9X 1O3AA 1ELGA 2ZDNA 1GBEA 4TWYA 1O2LA 2D2DA 5DO4H 1TLDA 1C5NH 4JZEH 3Q3KA 3M5NA 3TGJE 1E34B 1KLTA 3QK1A 3MU1A 3WY8A 2Z9LA 1C1TA 2GT8A 1RTFB 1Y3YA 3ZZCA 1W8BH 2AYWA 1G3EA 4TPYA 3ZVGA 2BD4A 3TJUA 4RSPA 3RMLH 2VINA 4BOHA 4AZ2B 4AOQA 1EQ9A 1FN6A 1KXDA 4ISIH 2H1UA 4GUXA 2HPPH 4FUFA 5LPRA 3AASA 4X2XA 1ZTKA 2G5NA 3MNBA 1AWFH 2IJOB 1MTNB 1MBMA 1MH0A 1ZRBA 2VNTA 5ESBA 3SV2H 3ELAH 1P2JA 1P06A 3SGAE 1VITH 1WU1A 3TGIE 3UTUH 5L30H 4OS7A 1V2WT 2OXSA 2F9UA 1C1VH 1Z8GA 1EKBB 1OOKB 3EA7A 2ZGHA 1ETRH 4U30A 3C1KA 2O8WA 1TAWA 1XX9A 4AG1A 1ZGIA 1CGJE
chains in the Genus database with same CATH superfamily
3TJOA 4NIYA 3FANA 2WPMS 1BTUA 2R2MB 3CNRA 1SGEE 1DT2A 4P02A 2P8OC 1ABJH 4ABFA 2A5KA 3LH3A 3NPSA 3QDZB 3SJOA 2AEIH 3URDA 1FI8A 4E7RG 4RKJB 5B6OA 1ZYOA 2ZU1A 1HB0B 1MKXK 2JETC 4BAOB 3R3GB 4CRBA 1C2IA 1T4UH 4F4OC 2D26C 1GBLA 1P01A 4AFQA 6GCHG 3PWCA 2ZFRH 2ODPA 5JBAS 2ZNKH 1HCGA 2H9TH 3E1XB 2A32A 4Q2KA 3RM2H 3BG4B 1QURH 1MUEB 1CVWH 3KQCA 1AFQC 1O3MA 3KGPA 8ESTE 1TWXB 4RT1A 3SNDA 4I8LA 6GCHF 1O3LA 1GI7B 1C2FA 2Z9KA 3UREA 4MPVA 3EE0B 1TA6A 8GCHG 2AMPA 3UAIC 1FAXA 4JMYA 1BIOA 3T62A 2YMSC 3KEEA 1JIMA 1GBKA 2BQWB 3B9FH 1XUGA 1YY3A 5JBTA 1C1SA 5C1UA 1JRTA 2D1JA 3SV7A 2G8TA 1YCPK 2EY4C 2P93A 4NWKA 3SHCH 4FUDA 1C2GA 3TPIZ 2ZPRA 4GHQA 2WUBA 2ZCHP 3S9BA 3M37A 1NRRH 3CS7A 3PLPA 4UFEH 3DFJA 3H7TA 3RU4T 2SGQE 2ZO3H 2Z9IA 1S6FA 1AGJA 2AERH 2VVCA 1TPAE 1HAGE 4WMFA 1B0EA 2GJGA 5BPEA 3RXOA 2W6ID 3NKKA 1OYQA 1VJ9U 4X8VH 5CDFE 1QHRB 1WOFA 1IQIA 4B6FA 4DJZB 3RC4A 1GJ9B 2WPKS 4MPWA 2QV1A 4ZKOU 4DOQA 2WINI 2A2XH 2J2UA 2WPJS 2Z7FE 1FY1A 2VIOA 2ODQA 3ATLA 1XKBC 3VB7A 1NFUA 1K28D 3ZVEA 1VCWA 5EGMA 1ZOMA 2PUXB 1SGRE 2QF4A 5T6DA 3F2GA 3KL6A 4OS1A 5SGAE 2ZDKA 1A61H 2BLVA 2HPQH 3U28C 1XVMA 1O38A 2ZCLP 3SI4H 1Y3VA 1O2NA 2XBWA 1HAHH 2FLRH 1A46H 1SR5C 3OTJE 2F9PA 1ZRKA 3VXEH 1OYTH 3RMMH 1YPHC 3SGBE 3A88A 1FZZA 3E3TA 4FVBA 1CHGA 1A0LA 3RC5A 5JB8S 1W12U 1JXPA 3TJNA 4NCYA 2ZQ1A 4SGBE 2GDDA 1LHCH 3QTOH 4GLYA 2JH5D 1NY22 2CMYA 1P3CA 1TYNA 1DWEH 4K1EA 5TJXA 3L3TA 3HPTB 2F91A 1NBME 3F0OA 4JYVH 2VH0A 2ZU3A 3ZVAA 2ZKSA 3F9FA 2P8OB 4X1NU 3TIUA 3URCA 2C8WB 1FPCH 1GBCA 2VVVA 5LPEA 1QNJA 4MNYA 4X1PU 1HV7A 3SV8A 2JETB 1GJ7B 1P03A 4YOIA 3SU3A 1ANCA 5JBCS 2IJD1 3A81A 1EAXA 1E1QD 2J92A 1ZJDA 2WZQA 1G3BA 1TABE 2TGDA 3VXFH 1EZXC 3PV5A 1U6QA 1OP2A 1BMNH 4Q4LA 2KZ4A 1O5FH 2TBSA 1JOUB 1P12E 3ZYDA 1G2LA 3OFND 1XM1A 3D62A 2R2WU 2SGPE 1P10A 2C8XB 2F9NA 2BLQA 2VIDA 1C5UA 2R3UA 4NIXA 1D3TB 4UEHH 3LDXH 5G4BA 4IS5A 3PTNA 1YPGH 1AFQB 2A0QB 1TE0A 3I77A 3QN7A 4JZFH 1BRBE 2AGGX 2QF0A 3BV9B 9ESTA 1KTSB 5H4IB 4ISHH 2AS9A 1J16A 4A1VA 5HXFA 1BTHH 1LVBA 3DCLA 4MPXA 1UMAH 3M35A 3IITA 1LCYA 1GJ5H 2YMSB 1FQ3A 1TBRH 3BIUH 1O3EA 3LGYA 3ZVCA 3ZV9A 1AB9C 2FOEA 1T8NA 2JKHA 3OSYA 5ESTE 1K1PA 1BMMH 1SHHB 1SG8B 1K9OE 4ABEA 5T3HA 1XUFA 1KXCA 5DP4A 4O97A 3PLKA 5C5OA 1WQSA 2EC9H 2GP9B 3MU4A 3UQVA 1QJ7B 1ETSH 4D76A 4Q7ZA 3ATWA 1HXEH 3SV6A 5AFZH 3FO8D 2B0FA 3OYPA 5A0BA 3UB0A 1C2DA 4Y6DA 1GDUA 3FZDA 3OU0A 1WDIA 2PFEA 2ZC9H 3ZZ9A 2A4OA 3Q76A 4ZKRU 4D7FA 1BRAA 2W7SA 2IOTA 3GY5A 2BLOA 4B2AA 2Z3DA 2ILNA 3FAOA 2GZ9A 1MQ6A 1LDTT 3BTFE 1ZLRA 4Y7BA 1DSUA 1V2NT 3MU8A 2ALVA 1QCPA 2VIQA 2RFKC 4E05H 2HLDD 2ZWLH 1D6RA 1KDQA 4DG4A 2OQUA 1C2MA 4GVUA 3F2FA 2XW9A 3G01A 4B76A 4R0IA 1ABIH 1KTTB 2TGPZ 1TMUH 1SGIB 5HKKD 4HI3A 3GCNA 4CBOA 1QY6A 1CA0C 1MTSA 2SNWA 1MMJN 3MWIU 1UHBA 3UNSA 5EW2H 3TH2H 1LHEH 1W7XH 3GY2A 1EZQA 3TK5A 3M7UA 2BDHA 5CMXH 2Y82A 2P94A 1XUJA 1OWKA 2JIZD 1UTJA 1ZJKA 4FUHA 2ZDVH 4CRGA 1TNKA 2ESTE 3GY8A 5I46H 1FUJA 1V2OT 1DY9A 1FPHH 4U32A 1GHWH 1HUTH 2CF9H 1SOZA 1Z7KA 3U1JB 2UWLA 1C4U2 4ASUD 1HYLA 3P17H 2G81E 3K65B 4IN2A 2KCAA 2ZCKP 2KCPA 1O2SA 1BZXE 2GZ7A 3P8FA 2BX3A 1IQHA 5C17A 2VGCB 3D65E 2V6NA 5E2OA 1GMCG 3EA9A 3E0NB 1FY4A 2K0QA 4B2BA 2HWLB 4FU7A 2BDIA 5PTPA 2OC1A 4BAQB 1QQ4A 2V3HH 1IQJA 3F2HA 5C94A 1HGTH 1VGCB 3MH6A 2GCHG 4YOJA 5EPNA 2V3OH 2QCYA 3PRDA 1V2VT 1ETTH 4ACBA 1SGCA 2HRVA 5A8XA 1YGCH 1H9IE 3MO3A 1MBQA 1GMCF 1KDQB 1W10U 3ZVBA 1IHSH 2XNIA 1RTKA 3SU4A 3V12A 1ZSKA 2VWNA 1MD7A 4FETA 1C5PA 4UDWH 4RI0A 1O37A 1TRYA 1NFXA 2GCHF 1VITG 1D3PB 1J14A 3S69A 4E7NA 2G55A 1VZQH 1Z8JB 3I78A 1IQLA 1V2ST 4X1QU 3FP8E 4ZAEA 4JYUH 5C2ZA 2YNAA 1UHBB 1HPGA 1PFXC 1C1UH 2W3KA 1PPHE 1QQUA 1G30B 1UCYH 1AB9B 3JZ1B 4AB9A 2Z3EA 5JDUB 3WW7A 1O3IA 2XNDD 1G32B 1L1GA 1GJ6A 2YOLA 4WF8A 1EXFA 4OS6A 3SUDA 1YBWA 1GBBA 2J4IA 1O2QA 1DXPA 2QGRA 2V7QD 2VJ1A 1TGCA 1VITF 1CT4E 1MAYA 1CGHA 2QC2A 1N6YA 4HG6A 4ABAA 3JZ2B 5KECA 3NZIA 4B75A 1WTGH 3A7TA 1HDTH 4KTUA 4MTBA 1NTPA 1TPOA 3NUMA 1WAYB 2STAE 3KQDA 3A8AA 3T26A 3EQ0H 5ABWA 1TIOA 1JRSA 1T31A 2Z94A 4ISNA 4WH8A 1WSSH 2BD8A 2STBE 3LGUA 1DPOA 1C1PA 2D8WA 3QZQA 1C5XB 4X8SH 4CBNA 1FXYA 3FOAA 1G37A 1GJCB 4Y79A 1DY8A 3EE7A 2J97A 3A8BA 4I7YH 1DFPA 2O8UA 4FVDA 3MMGA 4ZKNU 1EB2A 4DIIH 2ZHDA 3PROA 1SLXB 3UR6A 3RXCA 2NU2E 3P8GA 2ZA5A 5F8ZA 4BANB 4QT8C 1CA0B 1A3EH 3E8LA 1O5GH 3RXPA 1TNGA 1Y59T 1SQOA 1UTNA 4UONA 1IHTH 1BB0B 4FOUC 5EJ1A 1IQKA 4A1TA 1L2EA 3QLPH 2H9HA 3E6PH 1Z71A 3MNXA 4MDSA 1O36A 3HK3B 3ZZ3A 2BB4A 4Y71A 1FMGA 4B71A 1KLIH 1BTXA 2VWOA 3SQHE 2OC0A 5JPMH 3O8DA 3HKJB 2ZTYA 1TNLA 4ISOA 5EODA 1O3BA 1C5ZB 1OPHB 1HAVA 5ETXA 2GTBA 1UO6A 1GPZA 3S7HB 2W5EA 1C4Y2 1GBTA 2J98A 3F3BA 4D8NA 5CHBA 1AO5A 3OY6U 4A6LA 2G4TA 3BN9A 2PR3A 4MNWA 4FUIA 2AGEX 4MNVA 1KMHB 1O3JA 5DP6A 2ZZUH 2ZU4A 1S6HA 2RDLA 3GOVB 2VWMA 3PV2A 1DWBH 5DP3A 1N8OC 2A45B 2HNTE 3IG6B 3SNBA 3VEQB 5F03A 4BAMB 4AG2A 1C5VA 4K1SA 2FEQH 5FBIA 1B0FA 1ZSLA 1YPMH 2F83A 2FOCA 3LPRA 6LPRA 2GX4A 1WXRA 1BA8B 1NFYA 1L4DA 1S6LA 2H2ZA 2JH6D 1BJUA 4NWLA 3ITIA 2PHBA 1NU7B 4UFGH 1C2KA 1GL1A 1SGYE 4RT0A 2SGFE 1EB1H 4DGJA 5A8ZA 1K2I1 2P3FH 4Y7AA 4K1TA 2QA9E 4ZROA 5JB9S 4DT4A 1W7GH 3UIRA 4YM9A 3A7YA 4WJG2 3K6YA 2THFB 4YLQH 3SBKA 5TCAA 2LPRA 3A86A 2ZDMA 2VBCA 2OBOA 3PWBA 4ISLA 5EU8A 1B5GH 2WPHS 1E1RD 3O8CA 1HAVB 1S0RA 1SGDE 2BY6X 1GHZA 5B6LA 2VIWA 5GXPA 1KXAA 5FXLA 3ATMA 2BY7X 3PMJA 2QF3A 2J9NA 1H8IH 2Y81A 1C5YB 1C9PA 1QJ6B 1ZSJA 1DLEA 4ABBA 4CRAA 4AYYB 3EDXB 3RXKA 2BDBA 2EEKA 2P3TB 1ZTJA 5E8EH 3QWCH 3TU7H 1O2VA 1GJDB 3LGWA 1QR3E 4X2VA 3OTPA 5IK2D 3KQBA 3QO6A 4OGXA 4FUGA 1QRXA 4GSOA 3SU1A 3SJ8A 5C20A 5JBBS 5DN6D 2IPHA 1HAPH 1O2OA 1A4WH 1EAUA 4MLFB 1QL7A 2BZ6H 4PROA 3SI3H 1O5DH 1YPKH 5EG4A 1UVUH 1GDNA 2OC8A 1GBFA 1O3KA 4NG9H 4BTTB 3S7KB 5F8TA 4ZMAH 4FU9A 2VU8E 2W26A 4CHAC 3DD2H 1GJ8B 5DSFA 4YT7H 4I8JA 1EJNA 4TY7A 1H8DH 3STJA 1IQNA 2C93B 1THSH 4ZXXH 3DFLA 2XWBI 1QRWA 4IMQA 3SU0A 1INCA 1P2MA 1G9IE 1O35A 1UTKA 1DITH 4AGJA 3LU9B 1FIWA 1MAXA 1V6DA 3U1IB 1ZHMA 4B2CA 2PKSC 1JBUH 1O2XA 4JZDH 1G3CA 1XUIA 1YP9A 4GHTA 3SOSA 3AAUA 3ZVFA 5E0JA 4FUEA 2O9QA 4NGAH 1TBQH 3TK9A 4ABIA 1O5BB 8GCHF 4SGAE 2FOMB 4OS4A 1GL0E 1NC6A 3UY9A 2A4GA 2BLWA 2HVYB 2I6QA 2G4UA 3V0XA 3QUMP 1QFKH 1S5SA 5HM2A 1XXDA 1ZGVA 2F4LA 1FX0B 1UTPA 3W94A 1JWTA 1TBZH 1HJAC 5DP9A 1UCYK 4ABDA 2DE9A 3SZNA 2ZI2H 2GT7A 2WUCA 4AFZA 1MTVA 4WMDA 1TX6A 2LNCA 5C0TA 2PSYA 2F43B 1LVOA 4HGCA 3DSPA 1IQMA 1RS0A 3ZZ7A 4IGDA 1F0TA 5FX5A 1NRNH 3SORA 3ZV8A 4X2YA 1SKYE 4K3JA 3RP2A 1KY9A 4Y8YA 2ZTZA 1GWAA 3T28A 3CENA 3TNSA 4M7GA 1OHHD 2YNBA 1TMTH 3K2UA 2HOBA 3TITA 3KNXA 1TPSA 2HLCA 3GCHC 1AUJA 1DM4B 4XOJA 4HTCH 1C1QA 3SU6A 2BOKA 3RXVA 3TH4H 1JIRA 1GVKB 3A80A 4K8BA 1WBGB 1PPFE 1HBTH 6CHAC 1P0SH 2RDEA 1LKBA 3TLOA 1BBRK 1NO9H 2QF5A 2ZHEH 2UUFB 1F2SE 3MU0A 1SHYA 7LPRA 3UNRA 1W2KH 5FPTA 4OS2A 3F68H 2Y7XA 9LPRA 2A2QH 1LMWB 3FFGA 2FS8A 1L0ZA 3A87A 4U2WA 4X6MA 4ZHLU 3QZRA 2CK3D 4K5ZA 1SB1H 2ZU2A 1O31A 4I8HA 1UJ1A 4X1RU 1HRTH 2FZZA 2ZGXH 4DIHH 1NN6A 1O3HA 2DE8A 2FOAA 1UVOA 1YPHE 5FCRA 4FXGH 2RCEA 5A09A 2XCFA 3A7ZA 2ANYA 2CF8H 4CRDA 1ELTA 4Y0YE 3ZVDA 2G5VA 3HGPA 5F6MA 1GMHG 1Q2WA 1UVPA 1D3QB 3MH5A 4A92A 2Y80A 1UK2A 3VB3A 1D9IA 4D7GA 1ANDA 1OWDA 2VH6A 2WSSD 1Y5BT 1BUIA 1AMHA 2FPZA 3NRLA 4INHA 4CHAB 1A1RA 1OWJA 4GAWA 1OWIA 2SGEE 1MTWA 1GMHF 2FOFA 3E91A 2G00A 2BDCA 2O8MA 2V0BA 3PMBB 4KTCA 2PV9B 3N7EA 5C0UA 2HVXA 1O34A 2H6MA 4F55A 2FESH 5A0AE 2QXHA 5FHTA 2GKVE 5C3NA 2FOBA 3M7TA 1C9TA 1WQVH 4Z0KA 4X6PA 4IN1A 4WMEA 3GDUA 1ZR0A 3N99A 2PKSB 2ZHQH 3UUZA 1K22H 4ZUHA 3ZZAA 4TYDA 1CT0E 1PQ8A 1UVTH 3FZZA 1QL9A 3L6PA 1XUKA 2XYAA 1BOQA 2FYRA 2GV6A 4B6EA 1EPTC 5L2YH 1A5HA 1EZSC 4IMZA 3TJVA 1C4V2 3AK5A 5T1VA 3I29A 2EA3A 1DICA 2HALA 5J4SA 1ZPZA 2KX4A 1TGTA 2C3SA 2BVXH 3FKSD 2FO9A 5CHAC 5GDSH 1HAOH 4O3TA 4Y76A 4AGKA 1HJAB 1C5OH 1C1MA 1ZPCA 3BEIB 1YWUA 3KQEA 2ODYB 2ZGBH 2WPIS 3WWFA 1LO6A 4CRFA 1Q31A 1H8HD 2WYGA 2OD3B 3S0NA 1P2NA 1W13U 2SGDE 5J4QA 2ULLA 3BTGE 4Y0ZE 5C5NA 3ENSB 1O3FA 1SLWB 3RU4D 1O3PB 4TPIZ 4VGCC 1ZMNA 3TVJB 4XDEA 4WH6A 2B8OH 2H5CA 5JYIA 1DDJA 1G36A 2ZPSA 5EPYA 3GCHB 1O2IA 2GZ8A 3A83A 1PPBH 3A7VA 3DSGA 1QBVH 1A5GH 1MKWH 1J17T 2ZHWH 5TCCA 1BCUH 2QXJA 4XE4A 4IC6A 1C2JA 2KR7A 4AORA 6CHAB 1D4PB 2WPDD 2ZPQA 4J2YB 3RDZA 3SUEA 1O2JA 2WV4A 3BTHE 2JJ2D 1VCQA 1PYTD 2A5IA 1V2TT 1TOCB 4O3UA 1EPTA 2I6SA 2W6JD 2GCTC 4YOGA 5FL7D 2XTTB 2BD9A 1CA8B 3UOPA 1WTHD 3MOCA 1XXFA 4OGYA 3LIWA 3T29A 5C67A 1F0SA 1MKXH 1UK3A 4YT6H 4XFQA 1RD3B 3M61U 3HATH 1PJPA 1YYY1 1T4VH 1C1NA 2BD3A 3RC6A 1BT7A 1AZZA 1TGBA 4AFSA 1ZTLA 2NU4E 5F53A 1NT1A 2A4QA 2BQ6B 1LVYA 2BVRH 3GCOA 5DPAA 1AWHB 1UK4A 1Z1IA 4J1YA 1OXGA 1UTOA 1W14U 1S0QA 1HIAA 1P02A 3LJOA 1O3DA 1QA7A 3W95A 1Z6JH 1ANBA 4MPUA 5T6FA 3GCTG 1P9SA 1MZDA 2FYQA 4JK6A 1LQEA 1N6XA 3DA9B 2EI7A 1DOJA 1RIWC 2FLBH 3PRBA 1N1LA 2CN0H 2BD2A 2ZFTA 3FP7E 1SMFE 4ASHA 1T32A 3Q3XA 4WXIA 2EQNA 3RXBA 3NK8A 1XVOA 2BDGA 2BX4A 1O3GA 1ESBA 1O3CA 3FN8A 3MI4A 3MHWU 1BTPA 3GCTF 5K7RA 3HK6B 2RA0A 5K0HA 1CGIE 3U9AH 2BVSH 2TIOA 4D9QA 1W3CA 4ZXYH 3M5MA 2UWOA 1QGFA 3RXTA 1GG6C 2B7DH 1B7XB 3SNAA 1YM0A 1GCDA 3ZZDA 1YCPH 1CQQA 1Y5UT 1UTMA 1SQRA 1ESAA 1L1JA 1BBRE 2UUYA 3SU5A 4THNH 1AU8A 1DWDH 1W0ZU 1EPTB 1AN1E 4AYVB 2ALPA 1PQAA 4NZLA 3NXPA 4CH2B 1TX8A 4WVPE 1LQDB 2GMTC 1HAXB 1RXPA 1Z1JA 2XCNA 1C1RA 2Z6BD 1EJMA 1KXBA 5CHAB 1QIXB 1AVGH 2UUJB 1TRMA 4B74A 1P2KA 1ZZZA 1ZMJA 4X1SU 1C2HA 1F92A 4U01A 2HNTF 3SHAH 4FUBA 1O5EH 1PYTC 2A7HA 5GJ4B 4ABGA 1O2UA 3VB6A 1WUNH 1D3DB 2QN5T 3F1SB 3Q3YA 5GNDA 4H6SB 2QXGA 1SFIA 1LTOA 1OS8A 4YESB 1GJ4H 2CGAA 4XD7D 3MH4A 2GV7A 3SW2B 1V2MT 1HIAB 2UUKB 2PW8H 2ANKH 2ZHFH 1NU9A 2F9VA 1H1BA 1TPPA 2OCVB 4MNXA 1F5KU 4VGCB 2Z9JA 5EQQA 1ARCA 1ZPBA 2ZECA 1KXEA 1TMBH 1WCZA 2CJIA 1GGDC 5A0CA 2LP6A 4RKOB 4AX9H 4JZ1A 1THRH 3T5FH 6ESTA 5EW1H 1AZ8A 2RG3A 5I25A 3TK6A 4NIWA 1TGSZ 3P8OA 1O32A 4KGAA 1L4ZA 3F9HA 1TFXA 2BZAA 2BDYA 3MO9A 3UWJH 1GBAA 2B9LA 1O33A 2A1DB 5HM9A 1V2QT 1C5RA 1ANEA 4DW2U 1DUAA 1GJBB 2GCTB 4XBBA 3BEUA 8KME2 3RXMA 4NA8A 1C5QA 2PLXA 1KYNA 1TRNA 2GDEH 4I8GA 1ELAA 2UWPA 1K1JA 4DURA 1PPEE 3ZZ5A 4A1XA 2CHAC 2ZQ2A 1NRSH 4ZH8A 5EOKA 3RMOH 3EAJA 3M36A 4KKDA 1KSNA 2AH4X 1PPZA 2ZF0H 5E0GA 3HGNA 3M5OA 3LC3A 2OLGA 5BRRE 3U69H 2PTNA 1NZQH 2WPLS 1CT2E 2XBXA 4YZUA 2KM0A 3RM0H 2HGTH 2R3YA 5FBEA 3ATIA 4WWYA 4XSKU 2SNVA 1O3OA 1UTQA 4YTAA 3V13A 5GWZA 2ZG0H 3LJJA 3VPKA 3NCLA 1BTYA 3BTEE 3WWBA 3RUOA 3DSOA 1RIWB 3N7DA 1E79D 4TY6A 2BTCE 2KFWA 5DKMA 4YO9A 4B1TA 2QYIA 2BXTH 3A8CA 3F9EA 1DSTA 1LPGB 1F7ZA 1HJ8A 1UTLM 1YCPM 3BTME 1AVWA 4HFPB 4JK5A 1HAYB 1W0KD 2BOHB 2NU1E 2Q1JA 2TGAA 1TNIA 5EQSA 4AFUA 5AHGH 2GVFA 2TPIZ 1GG6B 1P57B 2R9PA 3BF6H 1EAWA 4BTUB 4X8UH 1O3NA 1P9UA 1CSOE 3VG8A 1SGFG 2Y7ZA 1ELCA 2WYJA 1QBOA 1SLUB 1VCPA 1V3XA 2QAAA 2ZEBA 3SNEA 1OKXA 1S85A 5T6GA 1QRZA 1NRQH 1TQ0B 3RXEA 2GMTB 3FVFB 1O2HA 1GBDA 2WV9A 1C5LH 2IPQX 1KLJH 3MYWA 3SUFA 3CS0A 2ZFSA 2J98B 1HNEE 2H9EH 2KCYA 5AVDA 5DP5A 1AFEH 3GY7A 5L6NH 3VB4A 1GBIA 1E37B 5FX6A 4FU8A 3BIVH 4X0WU 2XC0A 3ZZ8A 1MKWK 1EOJA 1DUEA 1NM6A 1EASA 1TNJA 2PSXA 2NWNA 2W7UA 5CE1A 2FX4A 1ORFA 2K8IA 2L6OA 3PO1C 1F5LA 5A8YA 1O2ZA 1K1OA 3A85A 2VB0A 1P2OA 3F9GA 3UOUA 3SV9A 1C5MD 2A31A 1QB6A 2Z3CA 3LOXA 1NRPH 1NPMA 3ATKA 1LHFH 1P2IA 1Y3XA 2F9BH 2OP9A 1FV9A 2PP6A 1GGDB 1IQGA 3GISB 2ZGJA 1LHDH 4ABHA 1GI2A 3PV4A 1Z8IB 3QX5H 1NBMD 1O5CB 1AVXA 2A7JA 1MZAA 4CR9A 4MVNA 1FDPA 1A0HB 1OWEA 3A7XA 1ELDE 2GD4B 3MNCA 1NFWA 1DANH 2C4FH 1BHXF 3A82A 2Y6TA 1W11U 4MG3A 2AHME 2FX6A 5FCKA 4AB8A 4LZ4B 1VR1H 5EIYA 1T8OA 1SC8U 1HLTH 3E90B 4H6TA 4RN6A 1FONA 1K1NA 4YXWD 4NFEA 3AVZA 1SFQB 1S81A 4FUCA 4E06H 5FAHA 2CHAB 1GBHA 1C1OA 1GI6A 1AHTH 1OSSA 1Y3UA 3BTDE 1GMDG 4NSVA 8LPRA 2FI5E 2QXIA 5DJ7A 3GDVA 3SN8A 1HJ9A 1OP8A 2AGIX 1AE8H 2BD7A 2FDAA 2EI8A 2VVUA 1OWHA 2WV5A 3RLYH 1FAKH 2BQ7B 1GCTC 2QY0B 2J5UA 3IWMA 3VB5A 4F49A 1A7SA 1GBMA 2O8TA 1BMAA 3K6ZA 1RJXB 1N8OB 3S9CA 1GMDF 2BY5X 1EZUC 4BAKB 3SU2A 1AI8H 1T8MA 3AAVA 3MNSA 5DGJA 1SL3A 2C8ZB 1RGQA 1SGNE 2XBVA 2P95A 1FY8E 2ZTXA 2O8LA 1O30A 4Y11E 2JDID 1QB1A 3KF2A 1AD8H 1EP6A 4DCDA 4Q7YA 1J9CH 3N7OA 2JJ1D 4GCHG 4XBCA 2VIVA 5IDKA 2J94A 2XXLA 3RXLA 1RRKA 1F0UA 1GHVH 2ZFPH 2G51A 3GY4A 3QTVH 1G2MA 1SQAA 4JCNA 3RXGA 1SLVB 1GVLA 4JYTA 1GI5A 1Z8RA 4X6NA 1HAZB 3LT3A 4CREA 1XUHA 7ESTE 1IOEA 1P11E 2OC7A 4H42U 1VJAU 1C2LA 1O2GH 4CR5A 1V2KT 4NA7A 1P3EA 3M3SA 1MQ5A 1SGQE 5EXNA 4I32A 2GGVB 1QA0A 3PM3A 4GCHF 3HKIB 4LXBH 2ASUB 3MQKC 3O8BA 3PLBA 4ZKSU 1X7AC 3OX7U 3LKWA 1ACBE 3RXJA 5E2PA 4LK4A 3RXRA 2XRCA 3GICB 3O8RA 4WXVA 1O5AB 3MH7A 3RXIA 1P2QA 4DT7B 1SI5H 1SGFA 4INLA 3OEED 1O2PA 1HFDA 5LGOA 3LH1A 5EJLA 3SO3A 2TRMA 3KIDU 3RXAA 1V2RT 4YLUA 3U8RH 1J8AA 1P05A 2XBYA 1ZHPA 2XC5A 5FPSA 1T8LA 2F3CE 4BNRA 1BITA 1T7CA 2JH0D 4D9RA 3M5LA 1EUFA 2LELA 2FIRH 4ABJA 1AIXH 3AW1A 4NA9H 3KYFA 1GJAB 2OTVA 3LGTA 3MTYA 5A2MH 2FP7B 3BSQA 3CP7A 3P70B 3PO1B 3SNCA 2Q6FA 3H5CB 1PPGE 3KYGA 2R0KA 4X8TH 2BDAA 1O2TA 3DHKH 1E36B 5KGOA 5C1YA 1ID5H 1AKSA 3SJKA 1TONA 1SGPE 2FM2A 1ELFA 4I8KA 4NFFA 4I86A 1E38B 1FY3A 3LGIA 3EYDA 1FLEE 3QGNB 1DLKB 3L33A 1BRUP 1SOTA 1A3BH 2BXUH 2VGCC 1G3DA 4ACAA 3A84A 3LONA 1EAIA 1AUTC 1Y8TA 5HIYA 4CRCA 1YPEH 4O9VA 1F0RA 1VGCC 1GI0A 2M2AA 1MD8A 2Q6DA 3T25A 3AW0A 1QL8A 1YKTA 1H9LB 3C27B 3BG8A 1RFNA 4FUJA 2PTCE 3BEFB 1GI9B 4UD9H 1LPKB 1UW7A 4K2YA 2PKAA 3MU5A 1C5TA 4INKA 4LZ1H 3M7QA 1IQFA 2J95A 2FXRA 4BXWA 4WY3A 4B73A 1Y5AT 5EXLA 4GPGA 1ZHRA 3EA8A 5LPFA 2PGQB 4TT3D 1GCTB 5AFYH 2FI4E 1EP5A 4Q63A 4R8TB 1O2KA 1NROH 1QJ1B 3F0PA 2B5TB 4K60A 3H7OA 1O2RA 3ZIAD 1L1NA 2QIQA 4Z1MD 3GY3A 1IQEA 3W1EA 1EJAA 1NS3A 5EJZA 3M3TA 3RLWH 1DS2E 5DP8A 2G52A 2AMQA 4NIVA 2ZU5A 1O2YA 1LPZB 5GIBA 1VKYA 1BJVA 1PPCE 5GPIB 2AMDA 3TH3H 2CV3A 1FNIA 3BTQE 1XMNB 1QZ8A 4Y8ZA 1AKSB 2R0LA 5HYOA 3D49H 1AE5A 1ESTA 4MQAA 4ZHAA 4TSFD 5DG6A 4Y10E 3VFEA 2OK5A 2Y5FA 3A89A 1GBJA 5L2ZH 5E0HA 2PGBB 3T2NA 1TNHA 1C2EA 2NU0E 5DK1A 1BHXB 3U98H 2ZFFH 4KTSA 1LVMA 1MCTA 1LKAA 5EQRA 3VGCC 1ARBA 2ZFQH 1GI3A 4X6OA 5HGGA 4ZCNA 1BTWA 3ODFA 1V2PT 1SPJA 3MFJA 1KIGH 3SZEA 1UVSH 4Q7XA 3ZZ4A 3STIA 2J38A 1P09A 1TOMH 4CH8B 2J34A 2ZIQH 4IW4E 2EI6A 2ZGCA 3SYJA 3UPEA 2PKAB 1GI8B 3RXDA 1SQTA 2QE7D 1BTZA 1PQ5A 3BTWE 3PMHB 3Q77A 1CU1A 2F9OA 2Y5HA 3M3VA 1S84A 1TX7A 4A5TS 1LHGH 1A0JA 2FTMA 4JZIA 2RA3A 2TGTA 4LOYH 4OS5A 1SSXA 1WYKA 2PWXA 3U8OH 3TNTA 1QB9A 1CE5A 3UR9A 1GHXH 1TQ7B 4DY7B 5KEDA 1K1IA 3BTKE 4Q80A 1UCYE 3DT0H 1TALA 2KAIA 2XWAA 5IYTA 4KP0A 2VWLA 1RTLA 2FOGA 3TGKE 3RXQA 1ELBA 1H9HE 2ZDLA 1DXWA 7GCHG 1SGTA 1COWD 2FTLE 2XOKD 4IC5A 3PB1E 3SUGA 2AIPA 1D6WA 2WHXA 2ANMH 2FMJA 5F8XA 2CXVA 3P8NA 3ODDA 3UNQA 3E16B 1HAIH 4XBDA 4BXSA 4BAHB 3SQEE 1CBWC 2BD5A 1K21H 3RXUA 3GS9A 1YPJH 4TWWA 7GCHF 1C5SA 2FI3E 5FPYA 1O39A 2C90B 3SJIA 1FIZA 1H4WA 1K1LA 4Y8XA 1P8VC 2IN2A 1DWCH 1H8ED 5DP7A 5AF9H 2FODA 1KXFA 1V2LT 3ZZBA 2Y5GA 3F6UH 3FP6E 1C1WH 2A4RA 2P3UB 4DVAU 1E0FD 4K8YA 1E35B 1MU6B 3U8TH 3UQOA 1EOLA 1S83A 3RXSA 2ZP0H 3S9AA 4NZQA 3V3MA 1O2WA 2BHGA 4UFFH 3E0PB 3OAAD 1EATA 1Z6EA 1YLCA 3NWUA 3P6ZB 1OP0A 2A7CA 1MTNC 3V7TA 1V2UT 2FWWA 1CO7E 1A5IA 4I33A 1GVZA 1S82A 1A2CH 2ANWA 4NSYA 2V35A 4ESTE 3GY6A 3B8JA 3K9XB 3OY5U 1MTUA 2KAIB 4ZHMU 1GHYH 1MU8B 1Q3XA 2OUAA 3RU4E 3LC5A 3UFAA 2BM2A 4BTIB 1SBWA 2NU3E 1BRCE 3B23B 2XC4A 3RMNH 3ESTA 1C5WB 3T27A 1K1MA 2K1QA 3QGJA 1QTFA 3RXHA 5HIZA 1O2MA 3Q00A 1ZMLA 1YPLH 3P92A 1EX3A 3DUXH 3PMAB 1XKAC 3SJ9A 2BMGB 3PTBA 4UE7H 1BMFD 2W3IA 3BTTE 3VGCB 1YC0A 3OE7D 2PUQH 1ELVA 1CHOG 1Y3WA 1AQ7A 1BBRH 1GHAG 5HMAA 2AFQB 2ZDAH 1EFRD 1THPB 1V2JT 1W0JD 4AC9A 4IBLH 1QBNA 2FOHA 4K69A 2BY8X 7KMEH 1FY5A 3GDSA 2C8YB 1FN8A 1TGNA 2Q6GA 1AY6H 3UWIA 1K0HA 3GYMA 4HZHA 1GHBG 2KCOA 4A7IB 1MCVA 1YF4A 2H5DA 3D23A 2FS9A 3KHVA 1W0YH 2OQ5A 1CHOF 3P95A 1GHAF 3KCGH 3GYLB 3BG4C 1O0DH 3RXFA 1P04A 1BQYA 1GI1A 5GCHG 3ZYEA 1GHBF 1DX5M 2DUCA 2A5AA 1OX1A 2VIPA 2HNTC 2M5TA 3PYHA 1GI4A 3EGKH 5C1XA 3SGQE 3A8DA 3OEHD 4I31A 2SFAA 1WV7H 1BDAA 2BYAX 3KQ5A 1FJSA 1NESE 4P00A 3ZZ6A 3A7WA 1HXFH 1DVAH 4M9FA 5GCHF 4UFDH 1BMLA 2P59A 1IAUA 3LGVA 1TB6H 1JMOH 1YLDA 1GDQA 3MO6A 5EXMA 1ELEE 2Z9GA 1M9UA 1TA2A 2SGAA 4KELA 4X2WA 1F5RA 4H4FA 3R0FA 1DE7H 3KN2A 1CBWB 1SVPA 2P16A 2L74A 2OBQA 1J15A 5LH8A 4AN7A 2OINA 1PQ7A 4Z6AH 4O03A 2AIQA 2BY9X 1O3AA 1ELGA 1MABB 2ZDNA 1GBEA 4TWYA 1O2LA 2D2DA 5DO4H 1TLDA 1C5NH 4JZEH 3Q3KA 3M5NA 3TGJE 1E34B 1KLTA 3QK1A 3MU1A 3WY8A 2Z9LA 1C1TA 2YMSD 2GT8A 1RTFB 2V3MA 1Y3YA 3ZZCA 1W8BH 2AYWA 1G3EA 4TPYA 3ZVGA 2BD4A 3TJUA 4RSPA 3RMLH 2VINA 4BOHA 4AZ2B 4AOQA 1EQ9A 1FN6A 1KXDA 4ISIH 2H1UA 4GUXA 4F48B 2HPPH 4FUFA 5LPRA 3AASA 4X2XA 1ZTKA 2G5NA 3MNBA 1AWFH 2IJOB 1MTNB 1MBMA 1MH0A 1ZRBA 2VNTA 5ESBA 3SV2H 3ELAH 1P2JA 1P06A 3SGAE 1VITH 1WU1A 3TGIE 3UTUH 1YLNA 5L30H 4OS7A 4XRNA 1V2WT 2OXSA 2F9UA 1C1VH 1Z8GA 1EKBB 1OOKB 3EA7A 2ZGHA 1ETRH 4U30A 3C1KA 2O8WA 1TAWA 1XX9A 3H09A 4AG1A 4OM9A 1ZGIA 1CGJE
chains in the Genus database with same CATH topology
3TJOA 4NIYA 3FANA 2WPMS 1BTUA 2R2MB 1SGEE 1DT2A 2P8OC 1ABJH 4ABFA 2A5KA 3LH3A 3NPSA 3QDZB 3SJOA 2AEIH 3URDA 1FI8A 4E7RG 4RKJB 5B6OA 1ZYOA 2ZU1A 1HB0B 1MKXK 2JETC 4BAOB 3R3GB 4CRBA 1C2IA 1T4UH 4F4OC 2D26C 1GBLA 1P01A 4AFQA 6GCHG 3PWCA 2ZFRH 2ODPA 5JBAS 2ZNKH 1HCGA 2H9TH 3E1XB 2A32A 4Q2KA 3RM2H 3BG4B 1QURH 1MUEB 1CVWH 3KQCA 1AFQC 1O3MA 3KGPA 8ESTE 1TWXB 3SNDA 4I8LA 6GCHF 1O3LA 1GI7B 1C2FA 2Z9KA 3UREA 4MPVA 3EE0B 1TA6A 8GCHG 2AMPA 1FAXA 4JMYA 1BIOA 3T62A 3KEEA 1JIMA 1GBKA 2BQWB 3B9FH 1XUGA 5JBTA 1C1SA 5C1UA 1JRTA 2D1JA 3SV7A 2G8TA 1YCPK 2P93A 4NWKA 3SHCH 4FUDA 1C2GA 3TPIZ 2ZPRA 4GHQA 2WUBA 2ZCHP 3S9BA 3M37A 1NRRH 3CS7A 3PLPA 4UFEH 3DFJA 3H7TA 3RU4T 2SGQE 2ZO3H 2Z9IA 1S6FA 1AGJA 2AERH 2VVCA 1TPAE 1HAGE 4WMFA 1B0EA 5BPEA 3RXOA 3NKKA 1OYQA 1VJ9U 4X8VH 1QHRB 1WOFA 1IQIA 4DJZB 3RC4A 1GJ9B 2WPKS 4MPWA 2QV1A 4ZKOU 4DOQA 2WINI 2A2XH 2J2UA 2WPJS 2Z7FE 1FY1A 2VIOA 2ODQA 3ATLA 1XKBC 3VB7A 1NFUA 1K28D 3ZVEA 1VCWA 5EGMA 1ZOMA 2PUXB 1SGRE 5T6DA 3KL6A 4OS1A 5SGAE 2ZDKA 1A61H 2BLVA 2HPQH 1XVMA 1O38A 2ZCLP 3SI4H 1Y3VA 1O2NA 2XBWA 1HAHH 2FLRH 1A46H 1SR5C 3OTJE 2F9PA 1ZRKA 3VXEH 1OYTH 3RMMH 1YPHC 3SGBE 3A88A 1FZZA 3E3TA 4FVBA 1CHGA 1A0LA 3RC5A 5JB8S 1W12U 1JXPA 3TJNA 4NCYA 2ZQ1A 4SGBE 2GDDA 1LHCH 3QTOH 4GLYA 2JH5D 1NY22 2CMYA 1P3CA 1TYNA 1DWEH 4K1EA 5TJXA 3L3TA 3HPTB 2F91A 4JYVH 2VH0A 2ZU3A 3ZVAA 2ZKSA 3F9FA 2P8OB 4X1NU 3TIUA 3URCA 2C8WB 1FPCH 1GBCA 2VVVA 5LPEA 1QNJA 4MNYA 4X1PU 1HV7A 3SV8A 2JETB 1GJ7B 1P03A 4YOIA 3SU3A 1ANCA 5JBCS 3A81A 1EAXA 2J92A 1ZJDA 1G3BA 1TABE 2TGDA 3VXFH 1EZXC 1U6QA 1OP2A 1BMNH 1O5FH 2TBSA 1JOUB 1P12E 3ZYDA 1G2LA 1XM1A 3D62A 2R2WU 2SGPE 1P10A 2C8XB 2F9NA 2BLQA 2VIDA 1C5UA 2R3UA 4NIXA 1D3TB 4UEHH 3LDXH 5G4BA 4IS5A 3PTNA 1YPGH 1AFQB 2A0QB 1TE0A 3I77A 3QN7A 4JZFH 1BRBE 2AGGX 2QF0A 3BV9B 9ESTA 1KTSB 5H4IB 4ISHH 2AS9A 1J16A 4A1VA 5HXFA 1BTHH 1LVBA 4MPXA 1UMAH 3M35A 3IITA 1LCYA 1GJ5H 1FQ3A 1TBRH 3BIUH 1O3EA 3LGYA 3ZVCA 3ZV9A 1AB9C 2FOEA 1T8NA 2JKHA 3OSYA 5ESTE 1K1PA 1BMMH 1SHHB 1SG8B 1K9OE 4ABEA 5T3HA 1XUFA 1KXCA 5DP4A 4O97A 3PLKA 5C5OA 1WQSA 2EC9H 2GP9B 3MU4A 3UQVA 1QJ7B 1ETSH 4D76A 4Q7ZA 3ATWA 1HXEH 3SV6A 5AFZH 2B0FA 3OYPA 5A0BA 1C2DA 4Y6DA 1GDUA 3FZDA 3OU0A 2PFEA 2ZC9H 3ZZ9A 2A4OA 3Q76A 4ZKRU 4D7FA 1BRAA 2W7SA 2IOTA 3GY5A 2BLOA 4B2AA 2Z3DA 2ILNA 3FAOA 2GZ9A 1MQ6A 1LDTT 3BTFE 1ZLRA 4Y7BA 1DSUA 1V2NT 3MU8A 2ALVA 1QCPA 2VIQA 4E05H 2ZWLH 1D6RA 1KDQA 4DG4A 2OQUA 1C2MA 4GVUA 2XW9A 3G01A 4B76A 4R0IA 1ABIH 1KTTB 2TGPZ 1TMUH 1SGIB 4HI3A 3GCNA 4CBOA 1QY6A 1CA0C 1MTSA 2SNWA 1MMJN 3MWIU 1UHBA 3UNSA 5EW2H 3TH2H 1LHEH 1W7XH 3GY2A 1EZQA 3TK5A 3M7UA 2BDHA 5CMXH 2Y82A 2P94A 1XUJA 1OWKA 1UTJA 1ZJKA 4FUHA 2ZDVH 4CRGA 1TNKA 2ESTE 3GY8A 5I46H 1FUJA 1V2OT 1DY9A 1FPHH 4U32A 1GHWH 1HUTH 2CF9H 1SOZA 1Z7KA 3U1JB 2UWLA 1C4U2 1HYLA 3P17H 2G81E 3K65B 4IN2A 2ZCKP 1O2SA 1BZXE 2GZ7A 3P8FA 2BX3A 1IQHA 2VGCB 3D65E 2V6NA 5E2OA 1GMCG 3EA9A 3E0NB 1FY4A 4B2BA 2HWLB 4FU7A 2BDIA 5PTPA 2OC1A 4BAQB 1QQ4A 2V3HH 1IQJA 1HGTH 1VGCB 3MH6A 2GCHG 4YOJA 5EPNA 2V3OH 2QCYA 1V2VT 1ETTH 1SGCA 2HRVA 5A8XA 1YGCH 1H9IE 3MO3A 1MBQA 1GMCF 1KDQB 1W10U 3ZVBA 1IHSH 2XNIA 1RTKA 3SU4A 3V12A 1ZSKA 2VWNA 1MD7A 1C5PA 4UDWH 1O37A 1TRYA 1NFXA 2GCHF 1VITG 1D3PB 1J14A 3S69A 4E7NA 2G55A 1VZQH 1Z8JB 3I78A 1IQLA 1V2ST 4X1QU 3FP8E 4ZAEA 4JYUH 5C2ZA 2YNAA 1UHBB 1HPGA 1PFXC 1C1UH 2W3KA 1PPHE 1QQUA 1G30B 1UCYH 1AB9B 3JZ1B 4AB9A 2Z3EA 5JDUB 1O3IA 1G32B 1L1GA 1GJ6A 2YOLA 4WF8A 1EXFA 4OS6A 3SUDA 1YBWA 1GBBA 2J4IA 1O2QA 1DXPA 2QGRA 2VJ1A 1TGCA 1VITF 1CT4E 1MAYA 1CGHA 2QC2A 1N6YA 4ABAA 3JZ2B 3NZIA 4B75A 1WTGH 3A7TA 1HDTH 4KTUA 4MTBA 1NTPA 1TPOA 3NUMA 1WAYB 2STAE 3KQDA 3A8AA 3T26A 3EQ0H 5ABWA 1TIOA 1JRSA 1T31A 2Z94A 4ISNA 4WH8A 1WSSH 2BD8A 2STBE 3LGUA 1DPOA 1C1PA 2D8WA 3QZQA 1C5XB 4X8SH 4CBNA 1FXYA 1G37A 1GJCB 4Y79A 1DY8A 3A8BA 4I7YH 1DFPA 2O8UA 4FVDA 3MMGA 4ZKNU 1EB2A 4DIIH 2ZHDA 3PROA 1SLXB 3UR6A 3RXCA 2NU2E 3P8GA 2ZA5A 5F8ZA 4BANB 4QT8C 1CA0B 1A3EH 3E8LA 1O5GH 3RXPA 1TNGA 1Y59T 1SQOA 1UTNA 4UONA 1IHTH 1BB0B 1IQKA 4A1TA 1L2EA 3QLPH 2H9HA 3E6PH 1Z71A 3MNXA 4MDSA 1O36A 3HK3B 3ZZ3A 2BB4A 4Y71A 1FMGA 4B71A 1KLIH 1BTXA 2VWOA 3SQHE 2OC0A 5JPMH 3O8DA 3HKJB 2ZTYA 1TNLA 4ISOA 5EODA 1O3BA 1C5ZB 1OPHB 1HAVA 5ETXA 2GTBA 1UO6A 1GPZA 3S7HB 2W5EA 1C4Y2 1GBTA 4D8NA 1AO5A 3OY6U 4A6LA 2G4TA 3BN9A 2PR3A 4MNWA 4FUIA 2AGEX 4MNVA 1O3JA 5DP6A 2ZZUH 2ZU4A 1S6HA 2RDLA 3GOVB 2VWMA 1DWBH 5DP3A 1N8OC 2A45B 2HNTE 3IG6B 3SNBA 3VEQB 5F03A 4BAMB 4AG2A 1C5VA 4K1SA 2FEQH 5FBIA 1B0FA 1ZSLA 1YPMH 2F83A 2FOCA 3LPRA 6LPRA 2GX4A 1BA8B 1NFYA 1L4DA 2H2ZA 2JH6D 1BJUA 4NWLA 3ITIA 2PHBA 1NU7B 4UFGH 1C2KA 1GL1A 1SGYE 2SGFE 1EB1H 4DGJA 5A8ZA 1K2I1 2P3FH 4Y7AA 4K1TA 2QA9E 4ZROA 5JB9S 1W7GH 3UIRA 4YM9A 3A7YA 4WJG2 3K6YA 2THFB 4YLQH 3SBKA 5TCAA 2LPRA 3A86A 2ZDMA 2OBOA 3PWBA 4ISLA 5EU8A 1B5GH 2WPHS 3O8CA 1HAVB 1S0RA 1SGDE 2BY6X 1GHZA 2VIWA 5GXPA 1KXAA 5FXLA 3ATMA 2BY7X 3PMJA 2QF3A 2J9NA 1H8IH 2Y81A 1C5YB 1C9PA 1QJ6B 1ZSJA 1DLEA 4ABBA 4CRAA 4AYYB 3EDXB 3RXKA 2BDBA 2EEKA 2P3TB 1ZTJA 5E8EH 3QWCH 3TU7H 1O2VA 1GJDB 3LGWA 1QR3E 4X2VA 3KQBA 3QO6A 4OGXA 4FUGA 1QRXA 4GSOA 3SU1A 3SJ8A 5C20A 5JBBS 2IPHA 1HAPH 1O2OA 1A4WH 1EAUA 4MLFB 1QL7A 2BZ6H 4PROA 3SI3H 1O5DH 1YPKH 5EG4A 1UVUH 1GDNA 2OC8A 1GBFA 1O3KA 4NG9H 4BTTB 3S7KB 5F8TA 4ZMAH 4FU9A 2VU8E 2W26A 4CHAC 3DD2H 1GJ8B 4YT7H 4I8JA 1EJNA 4TY7A 1H8DH 3STJA 1IQNA 2C93B 1THSH 4ZXXH 3DFLA 2XWBI 1QRWA 4IMQA 3SU0A 1INCA 1P2MA 1G9IE 1O35A 1UTKA 1DITH 4AGJA 3LU9B 1FIWA 1MAXA 1V6DA 3U1IB 1ZHMA 4B2CA 2PKSC 1JBUH 1O2XA 4JZDH 1G3CA 1XUIA 1YP9A 4GHTA 3SOSA 3AAUA 3ZVFA 5E0JA 4FUEA 2O9QA 4NGAH 1TBQH 3TK9A 4ABIA 1O5BB 8GCHF 4SGAE 2FOMB 4OS4A 1GL0E 1NC6A 3UY9A 2A4GA 2BLWA 2I6QA 2G4UA 3V0XA 3QUMP 1QFKH 1S5SA 5HM2A 1XXDA 1ZGVA 1UTPA 3W94A 1JWTA 1TBZH 1HJAC 5DP9A 1UCYK 4ABDA 2DE9A 3SZNA 2ZI2H 2GT7A 2WUCA 4AFZA 1MTVA 4WMDA 1TX6A 2LNCA 2PSYA 1LVOA 4HGCA 1IQMA 1RS0A 3ZZ7A 4IGDA 1F0TA 5FX5A 1NRNH 3SORA 3ZV8A 4X2YA 4K3JA 3RP2A 1KY9A 4Y8YA 2ZTZA 1GWAA 3T28A 3CENA 3TNSA 4M7GA 2YNBA 1TMTH 3K2UA 2HOBA 3TITA 3KNXA 1TPSA 2HLCA 3GCHC 1AUJA 1DM4B 4XOJA 4HTCH 1C1QA 3SU6A 2BOKA 3RXVA 3TH4H 1JIRA 1GVKB 3A80A 4K8BA 1WBGB 1PPFE 1HBTH 6CHAC 1P0SH 1LKBA 3TLOA 1BBRK 1NO9H 2ZHEH 2UUFB 1F2SE 3MU0A 1SHYA 7LPRA 3UNRA 1W2KH 5FPTA 4OS2A 3F68H 2Y7XA 9LPRA 2A2QH 1LMWB 3FFGA 2FS8A 1L0ZA 3A87A 4U2WA 4X6MA 4ZHLU 3QZRA 4K5ZA 1SB1H 2ZU2A 1O31A 4I8HA 1UJ1A 4X1RU 1HRTH 2FZZA 2ZGXH 4DIHH 1NN6A 1O3HA 2DE8A 2FOAA 1UVOA 1YPHE 5FCRA 4FXGH 2RCEA 5A09A 2XCFA 3A7ZA 2ANYA 2CF8H 4CRDA 1ELTA 4Y0YE 3ZVDA 2G5VA 3HGPA 5F6MA 1GMHG 1Q2WA 1UVPA 1D3QB 3MH5A 4A92A 2Y80A 1UK2A 3VB3A 1D9IA 4D7GA 1ANDA 1OWDA 2VH6A 1Y5BT 1BUIA 1AMHA 2FPZA 4INHA 4CHAB 1A1RA 1OWJA 4GAWA 1OWIA 2SGEE 1MTWA 1GMHF 2FOFA 3E91A 2G00A 2BDCA 2O8MA 2V0BA 3PMBB 4KTCA 2PV9B 2HVXA 1O34A 2H6MA 5A0AE 2FESH 2QXHA 5FHTA 2GKVE 5C3NA 2FOBA 3M7TA 1C9TA 1WQVH 4Z0KA 4X6PA 4IN1A 4WMEA 3GDUA 1ZR0A 2PKSB 2ZHQH 3UUZA 1K22H 4ZUHA 3ZZAA 4TYDA 1CT0E 1PQ8A 1UVTH 3FZZA 1QL9A 3L6PA 1XUKA 2XYAA 1BOQA 2FYRA 2GV6A 1EPTC 5L2YH 1A5HA 1EZSC 4IMZA 3TJVA 1C4V2 3I29A 2EA3A 1DICA 2HALA 5J4SA 1ZPZA 1TGTA 2C3SA 2BVXH 2FO9A 5CHAC 5GDSH 1HAOH 4O3TA 4Y76A 4AGKA 1HJAB 1C5OH 1C1MA 1ZPCA 3BEIB 3KQEA 2ODYB 2ZGBH 2WPIS 1LO6A 4CRFA 1Q31A 2WYGA 2OD3B 3S0NA 1P2NA 1W13U 2SGDE 5J4QA 2ULLA 3BTGE 4Y0ZE 5C5NA 3ENSB 1O3FA 1SLWB 3RU4D 1O3PB 4TPIZ 4VGCC 1ZMNA 3TVJB 4XDEA 4WH6A 2B8OH 2H5CA 5JYIA 1DDJA 1G36A 2ZPSA 5EPYA 3GCHB 1O2IA 2GZ8A 3A83A 1PPBH 3A7VA 1QBVH 1A5GH 1MKWH 1J17T 2ZHWH 5TCCA 1BCUH 2QXJA 4XE4A 4IC6A 1C2JA 4AORA 6CHAB 1D4PB 2ZPQA 4J2YB 3RDZA 3SUEA 1O2JA 2WV4A 3BTHE 1VCQA 1PYTD 2A5IA 1V2TT 1TOCB 4O3UA 1EPTA 2I6SA 2GCTC 4YOGA 2XTTB 2BD9A 1CA8B 3UOPA 1WTHD 3MOCA 1XXFA 4OGYA 3LIWA 3T29A 5C67A 1F0SA 1MKXH 1UK3A 4YT6H 4XFQA 1RD3B 3M61U 3HATH 1PJPA 1YYY1 1T4VH 1C1NA 2BD3A 3RC6A 1BT7A 1AZZA 1TGBA 4AFSA 1ZTLA 2NU4E 1NT1A 2A4QA 2BQ6B 1LVYA 2BVRH 3GCOA 5DPAA 1AWHB 1UK4A 1Z1IA 4J1YA 1OXGA 1UTOA