1TRMA

The three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of Asn102 mutant of trypsin: role of Asp102 in serine protease catalysis.
pubmed rcsb
source organism Rattus rattus
molecule tags Hydrolase (serine proteinase)
molecule keywords TRYPSIN
total genus 50
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1987-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trmA02
1ETSH 2TGPZ 4U32A 2BDHA 4HTCH 1TOMH 3V7TA 1GJ5H 1O3OA 2ZU4A 1ZMNA 1FAXA 4GCHF 1O3HA 3RXVA 3NZIA 4FUCA 5CE1A 1FJSA 4D8NA 1C2FA 2GMTB 2HALA 2BD4A 3SJOA 1AY6H 1TMTH 3UQOA 2ZGBH 1GBFA 3RXBA 5C67A 3LDXH 3UUZA 1IQKA 4YLQH 3TNTA 2FXRA 2BLQA 4TWWA 3RXPA 3GYLB 1YM0A 2WUCA 1TNJA 2AMQA 4D7FA 1OWHA 2BLWA 1HIAA 1P2OA 2A32A 3M5MA 2P8OB 2IOTA 1CA0B 3BN9A 3SV9A 3VXFH 4WXIA 1O3DA 1OKXA 1TB6H 1DANH 4FUHA 2ZTYA 2R0KA 1GVKB 5HMAA 2BHGA 3S0NA 1C5XB 1O36A 3SI3H 1PPGE 3GCTG 1O2RA 1XXDA 2GZ9A 1O2UA 1XVOA 1C2EA 1YPJH 2G5NA 1Z8IB 3MH4A 3RP2A 4UONA 1TBRH 2IPHA 1SFIA 3TNSA 1L4DA 1ANCA 3VB4A 3RXAA 1AI8H 2STBE 2Y81A 3TK9A 1LCYA 2XWBI 4E7RG 1C5OH 3QTOH 1VGCC 4LOYH 3I78A 3ZZCA 2BQWB 1Y59T 3QZQA 3DHKH 1GI2A 1GMHF 1PFXC 3FZZA 5T6DA 4MPUA 3PMBB 4B76A 1LHDH 5T6GA 5I25A 1E38B 1UTKA 2PSXA 1GI7B 3ZZ9A 1Z1JA 3TH3H 3SJKA 2O8WA 1O31A 1NFYA 1ESAA 4O9VA 1ANEA 2QXGA 3BTWE 3PO1B 1HJAC 1NROH 1K1NA 1KY9A 1Y3UA 1FIWA 1OWIA 1PJPA 2OQUA 1A5HA 1QQUA 1BTZA 1CGJE 2HPPH 2A2QH 3ATKA 1Y8TA 3GYMA 3ZZ6A 3D23A 5C5OA 2A45B 3RC6A 2XC0A 1GJ8B 1P05A 1TX8A 3SUDA 1C5YB 3LGVA 4BOHA 1V2QT 3W94A 1MTUA 4LXBH 1CGIE 1LVBA 2PKSC 4NG9H 1BIOA 3SNCA 1YF4A 2VB0A 4JYVH 4Y76A 5A0BA 1O2VA 1WSSH 1MMJN 1TYNA 1C1RA 2A1DB 3PM3A 4NFEA 1O2PA 1AB9B 3SJIA 2BDCA 3NPSA 2ZQ2A 4Y0ZE 5A0AE 4FUFA 3FVFB 1DUAA 3GICB 4M7GA 4LK4A 1GCTB 1BZXE 1TPSA 1EB2A 4R8TB 1F0TA 3EA8A 3MH5A 3Q3YA 4BXWA 1GMDF 1U6QA 4WWYA 4J2YB 3M5OA 4Q7XA 3V3MA 5DK1A 1ELFA 2F83A 3SNAA 1GHVH 2F9NA 1EKBB 4YLUA 2ZPQA 1CA0C 1GI4A 3KGPA 2GT7A 3RXCA 1G37A 2FS9A 2ZDVH 3NCLA 2BM2A 1P0SH 1QGFA 2OBQA 2FX6A 1MH0A 1XUJA 1FI8A 2PWXA 1J15A 1GDQA 1NFXA 5TCAA 1EPTB 1C5MD 1AFEH 1B7XB 4YTAA 1TAWA 4MLFB 3SNBA 2OLGA 1D6WA 1T8OA 2R9PA 3LU9B 5F6MA 1SFQB 4X1PU 2ZKSA 1RTLA 4BANB 3OY6U 4NIVA 4TWYA 4KTUA 1FY4A 2IN2A 1WOFA 3TH2H 2FZZA 1YKTA 4X1SU 3G01A 3ITIA 1FUJA 1BHXB 3A8BA 4DURA 3LPRA 1A61H 1EP6A 1BTPA 3QN7A 1TGNA 1QL8A 1FAKH 2O8TA 2O8LA 3E3TA 1ANDA 1SHHB 4UFFH 4MNYA 4IW4E 1NS3A 1G36A 4WMEA 1LVOA 2Q6FA 4CR9A 1O2OA 1GI1A 1SSXA 3EDXB 3VGCB 2XNIA 1EP5A 1BT7A 3B9FH 1CHOF 2NU1E 5EQRA 3BG4C 5F8TA 1BRUP 1PQ8A 1NC6A 1IQMA 2VWMA 3UPEA 4ISNA 3MNXA 4X6PA 1SI5H 2GVFA 2NWNA 3UREA 1DY9A 1Z8GA 2TGTA 3OYPA 2SGEE 2FLBH 1P2KA 2BY6X 3I77A 2GP9B 2H9TH 1SMFE 1TIOA 3KHVA 1OWJA 1NZQH 5AHGH 4UD9H 2K1QA 5EQQA 2Z9JA 3U8TH 2J92A 1HAOH 1H1BA 1V2UT 2A4OA 1O2MA 1PPHE 1V2MT 5GCHG 1HJAB 3BEFB 1A46H 1AUJA 1XUHA 3GY8A 1CQQA 1HYLA 2STAE 1V2ST 1AHTH 3SU1A 4J1YA 3VFEA 2PKAA 1A0LA 3WY8A 5LPFA 5DG6A 3RXQA 2A5KA 1FY8E 4PROA 2XWAA 3DFJA 2XXLA 4AFSA 1C4V2 3V12A 1PPBH 3QWCH 5K0HA 1GJ9B 1KXFA 1C2DA 1Z6EA 1H8DH 2CGAA 3VB3A 2XTTB 2VJ1A 4WH8A 3UOPA 2OC0A 2H9HA 1T8LA 1DDJA 2Z6BD 1HAZB 3D62A 5DP5A 1A0HB 4FUJA 4SGAE 1SGPE 1RTKA 2ZHWH 3F68H 1PPFE 1QRZA 3E90B 3MNCA 1H9LB 3SW2B 4AZ2B 2OBOA 1VCWA 1T8MA 2ULLA 3TITA 4DY7B 1SGYE 1W12U 3SU5A 1FNIA 1VITG 3B23B 3S7KB 3LONA 1CU1A 1PPZA 2F9BH 1DX5M 3SORA 1MTNC 1PYTC 2ZDLA 5FBIA 3E1XB 3SNDA 1DPOA 5EG4A 3ZVDA 8GCHG 2ZDNA 3AW0A 1C5SA 2HRVA 1YPKH 2XCFA 9LPRA 2P16A 1A5IA 4IGDA 3LH1A 4AFQA 2ZCLP 1ELGA 4JCNA 3SJ9A 1HXEH 2FPZA 3MWIU 3SU3A 3KN2A 3BTHE 1BTXA 1W0YH 3BIVH 2G8TA 3MO9A 1Q2WA 1FMGA 5DP6A 3SU0A 2UUKB 1ZRBA 1YLCA 5DP9A 1EATA 1W8BH 3RXTA 2PSYA 1ZTLA 2Q1JA 2GT8A 2V6NA 2P59A 4Q7ZA 3TIUA 4K2YA 2BDBA 1MCTA 2B0FA 3O8RA 4NGAH 1SOTA 2H6MA 2CHAC 1A7SA 1TOCB 3MOCA 1IQFA 2VWLA 1P06A 1UVUH 1GDUA 1H9HE 2PGBB 3NUMA 2GDDA 1H9IE 1HPGA 4XBDA 1AGJA 1AVGH 3T27A 4IN1A 1IHSH 1MKXH 1NO9H 1S6HA 2ZF0H 2FOAA 5HYOA 2CN0H 2G00A 1P2JA 3UOUA 1L2EA 1W3CA 2EI8A 1P03A 1OXGA 1SLWB 3OX7U 2H2ZA 3MO3A 1G3CA 3T29A 4A6LA 2ZU2A 3SJ8A 1GHAG 2HNTF 1LPGB 4AG2A 2J34A 1FPHH 1GI0A 3E91A 3ZVAA 2ALPA 5SGAE 1TPPA 3HKJB 1H8IH 2PLXA 1Y3YA 3DT0H 2Z9IA 6CHAB 2Y7ZA 1JIRA 2ZFRH 1NFUA 4WMFA 1SGFG 5G4BA 1CVWH 1LKBA 4SGBE 2BTCE 4BTUB 2ZFPH 1S81A 2ODYB 4RSPA 1FY3A 3F9EA 1AE8H 4WVPE 4OS6A 3N7OA 1E37B 4ZXXH 2W7SA 2BX4A 3C27B 4Y8ZA 5GIBA 2FOCA 2ZEBA 2Y5HA 3FP8E 4JMYA 5JBAS 1GL0E 1GVZA 1MTWA 2JETB 1UVPA 4ZAEA 1EAXA 2BB4A 4YOGA 1EQ9A 1TWXB 1Y3WA 5EODA 2GZ7A 3PMJA 5L2YH 4ZHMU 1TNHA 2P95A 3BTDE 1FQ3A 5A8YA 1D3TB 5EW1H 2FOFA 1UVSH 1HDTH 4IC6A 1SVPA 4B75A 3KIDU 3E16B 1YCPK 2V0BA 1SGCA 1EASA 1NM6A 2J2UA 4K3JA 4MQAA 4GPGA 3FP6E 4K8BA 1GBIA 5C20A 1RJXB 5BRRE 1LPKB 2FI5E 3F9GA 4YM9A 3TK5A 1AO5A 1C1MA 2B7DH 2O9QA 2ZFQH 1FXYA 3P8FA 1EZSC 3RU4D 3SV6A 1Y5UT 2WYJA 3RMMH 2BZAA 1KXEA 3BTQE 1ORFA 2AFQB 2PTCE 3QTVH 3U1IB 3PO1C 4ISOA 4UDWH 1EOJA 3S7HB 7GCHG 2FO9A 1WU1A 2F9VA 2ZO3H 4ZKNU 4I31A 2ZGJA 2F91A 1UCYE 3LGUA 1ZMJA 1KLJH 3KQEA 1NRSH 1BMNH 1YPGH 1C5RA 3A7YA 1DXPA 1Y3VA 3NWUA 1J8AA 1V3XA 4X1QU 1QA0A 2V35A 1UCYK 2Y6TA 4XOJA 1C1NA 4ABIA 3SNEA 1TALA 3PWCA 4NZLA 1RGQA 1RIWB 2DE9A 1MAYA 1QB6A 3LKWA 1UTQA 3JZ2B 2HWLB 1YPEH 2WV5A 4VGCB 1NT1A 2Q6GA 1ZR0A 1O2YA 5A8XA 4ABDA 3UR9A 2ZFFH 5A8ZA 1ARBA 4K69A 2UWOA 1J17T 3RC5A 2FOEA 1YCPM 1ZRKA 2G4TA 2QCYA 2XRCA 1FN8A 1O3LA 1P09A 4Y0YE 2HNTE 3D49H 2FESH 1BBRK 3UFAA 1MBQA 3HK3B 3Q77A 5HM9A 4OGYA 3GY3A 1SGDE 1THSH 1C2JA 1K1PA 3SO3A 4GLYA 3SV7A 1FONA 1L0ZA 1N6XA 2C8WB 3P95A 4X2YA 3A82A 1WBGB 2WUBA 2PW8H 3KNXA 1CA8B 2GGVB 3ZZ7A 3RM2H 3BTKE 3GDUA 2AYWA 3BTFE 2KAIA 3BSQA 1ZSLA 4B71A 2ZECA 2VVVA 1VR1H 4YOJA 3IITA 1B5GH 3HGNA 1WAYB 3Q76A 2A31A 1BMLA 2HLCA 5DP7A 1P02A 3TU7H 1KYNA 2UWPA 2BOKA 2F9UA 2R2MB 1F5LA 3MYWA 5GCHF 3RXHA 1ELCA 1GBJA 1N8OB 3PTBA 3A7VA 1C4U2 4U30A 1O5GH 4ZKOU 2XYAA 2BQ7B 3W95A 3F9HA 5F8ZA 1AZZA 3O8CA 1TPOA 3LJOA 4TY7A 1QJ1B 1O34A 1GMCF 3PROA 4D9RA 1GHWH 1Q3XA 4U2WA 2OTVA 2HPQH 2R3UA 4UEHH 3KCGH 2FS8A 1C1UH 3SUEA 1KXCA 1ETTH 4ABEA 2WINI 5JBCS 2TGAA 4GHQA 4NIWA 1O2NA 2SGFE 2WPKS 4HFPB 1BJUA 2FDAA 3A7XA 4YT6H 1DFPA 1YPMH 2ZI2H 4CH2B 3QGNB 1DUEA 2BDIA 4KTSA 1O3BA 3K2UA 5FCKA 5DPAA 1O39A 4INLA 4JK5A 5DP8A 1QIXB 2VIDA 3PMAB 1IQEA 5DP4A 2LNCA 5T3HA 3RMNH 1OWKA 1GBLA 3GDVA 1G3EA 2UUYA 2G52A 2H5CA 4Y10E 3L33A 3A89A 1C1SA 5FAHA 3GCNA 3RUOA 3PV4A 4DCDA 3BIUH 3GY7A 1J9CH 3TJNA 2AGEX 1TGTA 1T4UH 4IMQA 1YLDA 2GX4A 3CENA 4I8LA 5A2MH 1MD7A 2ILNA 2GCHF 4ZMAH 1KXDA 3PLKA 1WQVH 4JZIA 1K1JA 1RS0A 1VJAU 1GBHA 2OC7A 1P9UA 2SFAA 1KTSB 3PLBA 4AYVB 5L6NH 1FIZA 3P92A 3GY4A 3ZVCA 2BY5X 5HXFA 1C5VA 4UFEH 6GCHF 1YBWA 1Z8JB 3ZZ8A 1DWCH 2G51A 4X8VH 2C93B 4B2BA 1BTHH 2PGQB 4ABBA 2QY0B 1SGQE 3F1SB 1WCZA 3OU0A 5DGJA 1WQSA 3AASA 3A8AA 4OS1A 4Q80A 1ELTA 3T25A 4BAOB 1A0JA 2Z3CA 1O30A 4Y71A 1IQLA 1HBTH 3H5CB 2FODA 3TGKE 5EPNA 1T31A 2ZG0H 5EU8A 2BDAA 2ZPRA 2Y82A 4RKJB 4AX9H 3UNQA 1LKAA 1LQEA 4D9QA 5AVDA 5ESTE 3T62A 1DE7H 3EYDA 1UTNA 2FOHA 2D2DA 2KAIB 1VJ9U 2W3IA 4A7IB 1AKSA 2FMJA 3GISB 1O5CB 5A0CA 2ZGXH 1V2WT 3TJVA 4NWKA 1ZHMA 1ZPZA 2ODPA 1QTFA 2A5IA 2VVCA 4JZ1A 3ZVBA 1TQ7B 2ANWA 5F03A 1O3NA 4ZROA 1K28D 3SU6A 1F7ZA 1BTYA 2Z9GA 7ESTE 3SBKA 3CP7A 3QGJA 2P3UB 1TNGA 1UK3A 2QIQA 2PHBA 2JH6D 2FI3E 1TFXA 2EEKA 4Y8YA 4MPXA 1UTLM 1EZXC 1S85A 1LMWB 4GUXA 3T5FH 1BJVA 1LTOA 1B0FA 4XDEA 5FPSA 2C4FH 3UTUH 2GDEH 1O32A 3AAVA 1J14A 2JETC 2XBXA 5E0GA 4GCHG 2AIQA 4KGAA 3TH4H 1BMAA 3HK6B 4O03A 4LZ4B 1HIAB 1A5GH 1GBTA 5C1XA 1MQ6A 2RG3A 3ZZ3A 1GGDB 1HAPH 1NRPH 3LOXA 2V3HH 8KME2 1MTVA 1ZPCA 4RKOB 1IQNA 3RU4E 3U98H 1SGRE 3IWMA 1ETRH 1SG8B 4KKDA 3RXDA 1LPZB 2R3YA 1UVTH 1ZLRA 2BQ6B 1G30B 1NRQH 2BX3A 1ACBE 3SV2H 4O97A 7GCHF 1P2QA 4K5ZA 4CBNA 4GHTA 5C3NA 4I8KA 1G2MA 2G5VA 3Q3XA 1JBUH 2I6SA 1QR3E 2A4RA 1UHBA 2QAAA 2J94A 1RRKA 4ZXYH 1A3EH 4IN2A 1UO6A 2BOHB 1HV7A 3M7TA 2A2XH 4TPIZ 4ABJA 2VVUA 1SGEE 4NA8A 1O2IA 5L30H 5JPMH 5L2ZH 1TRYA 3TK6A 2YNBA 1A4WH 3CS7A 1C5LH 5IYTA 1CSOE 2CXVA 3DD2H 1D6RA 4FUDA 4LZ1H 5DKMA 1UMAH 3ATMA 3K9XB 3RXJA 4YESB 3RXGA 3ZZAA 1DLKB 2ZHFH 2A4GA 1TBZH 1AUTC 1THPB 2WPJS 4DIHH 2GCTB 6LPRA 1BUIA 4HGCA 1NPMA 4AGJA 1C5NH 3QX5H 1O2JA 1S84A 1QBOA 4O3UA 3RXRA 1VITH 1CT4E 1BHXF 3KQDA 4NCYA 1TGCA 1YPHE 1O38A 3NK8A 1GJ7B 2Z3EA 1SL3A 4VGCC 3M7UA 5J4SA 1GBCA 2THFB 2VGCB 2BY7X 3MU8A 1WUNH 2OP9A 1XM1A 1C2IA 1O3KA 3RXOA 3P8OA 1MCVA 3QDZB 2CMYA 3A83A 4XBBA 5TJXA 1O2WA 1V2NT 2FEQH 2NU3E 3AVZA 3P8NA 1HAGE 1ZTKA 2ZDMA 1HLTH 4Z6AH 1O5DH 1JIMA 2JH0D 1HAVA 4AFUA 3S9AA 2P8OC 3BTGE 1O3IA 2J9NA 1TMBH 3ZYDA 4E06H 2BD7A 4D76A 2IJOB 1OWDA 1O5FH 1QB1A 1V2JT 2G55A 3S69A 1MU8B 1QL9A 2B5TB 3UNSA 4WF8A 1GHXH 1BITA 3SN8A 1JXPA 4MNVA 4KELA 5JB8S 3KEEA 1ZOMA 2VINA 2AGIX 3PB1E 5LH8A 1UTPA 2ASUB 1C2LA 3M5NA 1MKXK 1BBRH 1DSUA 3AW1A 5E0JA 4OS4A 1AU8A 2ANMH 2RA0A 2ZIQH 4B1TA 4MDSA 1NRNH 3ODDA 1GCDA 3HGPA 3QLPH 1HAYB 1QL7A 1Z7KA 2BYAX 6ESTA 4H42U 4X8UH 5GXPA 4ABHA 1C2MA 1X7AC 1TA2A 3STJA 3OY5U 2W5EA 4DT7B 1DVAH 2DUCA 3ATLA 1DS2E 1V2OT 4GSOA 5TCCA 1ELEE 1L4ZA 1MTSA 1BRAA 1UCYH 2ZDAH 1YYY1 1TMUH 2XCNA 4GAWA 1GBMA 4KP0A 5I46H 1EZUC 1M9UA 3UIRA 3HPTB 2W7UA 4Y8XA 2Z94A 3A88A 1S5SA 1F0RA 1XKAC 2PR3A 1SHYA 2P3FH 2D26C 2GD4B 4FVDA 3QZRA 2BLOA 1EJNA 2P93A 1G32B 1W7XH 3ODFA 4ZH8A 1VCPA 3BG8A 5FCRA 4TPYA 3M35A 1S82A 1ARCA 2FIRH 5LGOA 1OYQA 4D7GA 3STIA 4I33A 1WTGH 4CRFA 2XC5A 1O2HA 5C2ZA 1C2KA 1ZZZA 1DWBH 2BDYA 1FPCH 2FX4A 1HUTH 2VIPA 1P01A 1TNKA 3BF6H 2CV3A 3HATH 1RTFB 5EW2H 1JRTA 3VXEH 1YCPH 3GCTF 4F4OC 1LVMA 3EA9A 5ETXA 2Z3DA 1ABIH 2P3TB 7LPRA 2VGCC 3EQ0H 1EAUA 1EOLA 1G3DA 3BV9B 1Z8RA 1CGHA 1K22H 4CHAC 1GPZA 2TRMA 3KQBA 3SGBE 1P9SA 2GV7A 1VGCB 1O3MA 1C1VH 2CF9H 2R0LA 1HJ9A 2CJIA 2O8MA 2GCTC 3VEQB 2A0QB 2J95A 4BAMB 3A80A 3RXIA 2FP7B 4NFFA 1P10A 2O8UA 1ZHPA 4K1TA 1BA8B 2ZQ1A 3KL6A 3FZDA 5JBBS 1N8OC 2A4QA 1TLDA 1QHRB 1TNLA 2XBYA 5EQSA 2PKAB 2SGDE 1FDPA 2ZGHA 1EX3A 3Q3KA 1GBKA 1YC0A 3RXFA 7KMEH 1DITH 1SB1H 1PQ7A 4Y79A 1ZGIA 2J38A 1GJAB 5H4IB 3ZYEA 1KLIH 1JMOH 4X6MA 2HVXA 1O37A 2Z9KA 1O5BB 1K21H 1VCQA 1V6DA 3PMHB 3LGTA 3RXLA 4FUGA 2BLVA 2ESTE 1ELDE 3GCHC 1D3QB 1G3BA 3SZNA 1AVXA 1TRMA 2UUJB 1GCTC 1PYTD 2BVRH 4IMZA 4X1NU 2VNTA 1KTTB 1F5KU 3MU0A 2CHAB 1AWFH 2VWOA 2FWWA 5JBTA 1XVMA 1GHYH 3MH6A 4OS7A 2Z7FE 3S9BA 4A1XA 2NU2E 3BEUA 4RN6A 1NN6A 2BY8X 1C9PA 1ZHRA 1AQ7A 1SLUB 3ATWA 1T32A 2A7CA 3HKIB 4FUIA 1MAXA 1W0ZU 1FV9A 1TQ0B 3VB5A 4WXVA 3VB6A 1MZDA 3KQCA 1LDTT 1O2XA 2Y7XA 1PPCE 1KIGH 3FANA 3L3TA 4X6NA 3GY6A 4B73A 4CR5A 3LH3A 1LVYA 2Y80A 5FX5A 1OP2A 1C1TA 1NESE 1AD8H 3E6PH 1H4WA 5T6FA 1K1IA 1BRBE 2ZHQH 2SNWA 1TGBA 4FUEA 1SGFA 2BVSH 1KXAA 4X6OA 2ANYA 2UWLA 2VH6A 2C90B 1TBQH 2ZDKA 3MNSA 4MNWA 1IQJA 3QO6A 1C1OA 4UE7H 3C1KA 4IC5A 1TRNA 4FVBA 5AFZH 2SGPE 2B8OH 1LHEH 2FOMB 3T26A 1W10U 2C8ZB 3UY9A 1LHCH 3SQHE 4MNXA 1SQAA 2ZA5A 3F9FA 1RD3B 4I7YH 4MPWA 3RM0H 1GG6B 1OP8A 1DXWA 1QBNA 1QCPA 2BD2A 2TPIZ 4X0WU 5C1YA 1JWTA 3LGYA 4ABGA 5AF9H 4CBOA 1GMDG 1RFNA 2OC8A 3BG4B 2HGTH 3MI4A 1BRCE 1DSTA 4X2WA 4ISLA 2AH4X 4ZKSU 1G9IE 2XC4A 4OGXA 1NFWA 1TGSZ 3EAJA 2ZU3A 3LGIA 1ZSJA 1GMHG 2ZWLH 1LHFH 1JOUB 2BVXH 4ASHA 1Z71A 3R0FA 3M5LA 5AFYH 2OD3B 1T8NA 2GV6A 3GCOA 4Z0KA 4DIIH 2VU8E 1BB0B 4AGKA 1IQHA 1UK2A 1L1JA 1XUGA 3OTJE 2BD3A 4CRDA 1BDAA 1P12E 1QURH 1C5ZB 1WV7H 1K1OA 1P11E 3RXMA 5DP3A 2ZHEH 1THRH 2ZCHP 1QY6A 1ZSKA 5EGMA 4Q2KA 3LC5A 2PUQH 5E2OA 3NKKA 3QUMP 8LPRA 3PLPA 2D8WA 1GL1A 3P70B 3ZVGA 5DO4H 6GCHG 2VWNA 3O8BA 5JDUB 1TA6A 1EUFA 1XXFA 2FTMA 3RMLH 4FXGH 5EPYA 3QK1A 1V2PT 2AS9A 3B8JA 1UK4A 1P2IA 5E8EH 4ESTE 1E34B 1G2LA 3U8RH 3EE0B 2XW9A 5CHAB 4Y7AA 2WPIS 1P8VC 2QA9E 1CO7E 4A92A 4I8HA 2SGAA 1DWDH 1AKSB 1HRTH 3P17H 3MO6A 1EJMA 2ZHDA 1D3PB 1XUKA 3H7OA 4X2VA 1B0EA 2QXJA 1W14U 4XFQA 3MU1A 1CHGA 4Y11E 1W2KH 1FN6A 3TPIZ 3SGAE 4E7NA 4WJG2 3GY2A 1NY22 3T2NA 2ANKH 1QNJA 4X8SH 3EA7A 4MVNA 2WYGA 1O2ZA 4AYYB 1P04A 3UWJH 3ZVEA 2EI6A 3MFJA 1E0FD 4H6SB 1N1LA 1P3CA 1GBBA 4FU9A 2ZFSA 1TNIA 3BEIB 1AWHB 1KSNA 1DWEH 3MHWU 4CRGA 1GHBG 4F49A 1O3FA 1EPTC 1C5QA 5FPYA 1P2NA 1AE5A 1SQOA 4WMDA 4GVUA 4YT7H 2VIWA 1OWEA 1NTPA 2PKSB 1Y5BT 4NWLA 1C4Y2 2G81E 2ZTXA 3BTTE 1S0RA 5GJ4B 3OSYA 3RLWH 1HGTH 1GGDC 3LT3A 2AMPA 5EXMA 5GWZA 1GHZA 3ATIA 4NIYA 1GJ6A 4MPVA 1O3PB 4ZUHA 3K6YA 1GJDB 5FHTA 3SHAH 4B2CA 3MH7A 3MMGA 2LPRA 4ISIH 2OINA 4Y7BA 2C3SA 1D4PB 1DY8A 4AFZA 5J4QA 2AMDA 4Q7YA 6CHAC 1OP0A 2OC1A 1BTUA 4FU7A 8GCHF 1YPHC 1Y3XA 1QJ7B 1UTMA 4ABAA 1AB9C 5EXLA 4I8GA 2HNTC 2B9LA 1GI8B 1ZJKA 1MKWK 3A7WA 2ZC9H 3LIWA 1O2QA 4XE4A 1SGNE 2RDLA 4BAKB 1GI6A 2QYIA 1AMHA 1FLEE 5IDKA 1K1LA 1MUEB 2ZGCA 1INCA 1DM4B 1F92A 1V2TT 2QN5T 4IS5A 5FXLA 4A1VA 2WV4A 3SGQE 3TLOA 3ZZ5A 1D3DB 2FOGA 2XBWA 4NZQA 2NU0E 3SU2A 2H9EH 1F0SA 4IBLH 1GBAA 2JH5D 4CH8B 3RU4T 1JRSA 3Q00A 2BZ6H 1P3EA 3P6ZB 2SGQE 4BTTB 4OS5A 2C8XB 3ENSB 1K1MA 1MU6B 1OS8A 3VPKA 4A5TS 1LO6A 8ESTE 2WPMS 3L6PA 1K9OE 3LJJA 1FY1A 1NRRH 1SBWA 3M7QA 1O2TA 2ZFTA 4X8TH 3U8OH 1GI5A 1SOZA 3BTME 4O3TA 1HNEE 1GMCG 1T7CA 5FPTA 1V2KT 1O3JA 1MQ5A 2ZTZA 2F9OA 3U9AH 5ABWA 3RXEA 3PWBA 1OSSA 4TYDA 3ZVFA 5EXNA 2HOBA 2GZ8A 4BNRA 1ZPBA 3DUXH 1VITF 1QJ6B 3V0XA 3D65E 4K1EA 2J4IA 4I8JA 2YNAA 3CS0A 1RXPA 1BCUH 1HAVB 1C5PA 1L1GA 2A5AA 1ZMLA 2WPLS 2M5TA 3FAOA 1V2LT 2ZCKP 2ZNKH 1PQAA 3DFLA 2GMTC 1GBEA 1UJ1A 2EI7A 4NA9H 1E36B 1FY5A 1CT0E 4FUBA 1HXFH 1AN1E 1BMMH 1VZQH 2A7HA 2BMGB 2QV1A 3RXUA 3A8DA 4A1TA 2QC2A 3M3SA 3A7TA 1MKWH 1UTJA 1UTOA 1F0UA 2C8YB 5CHAC 1MD8A 2FM2A 1F2SE 1FZZA 5E0HA 4E05H 1EAWA 1ZTJA 4UFDH 4MG3A 1S0QA 1UHBB 2AGGX 1SLXB 2TBSA 1O3GA 3BTEE 4NIXA 5BPEA 4INKA 2BY9X 2OUAA 1CT2E 4XBCA 2VIOA 1OOKB 2YOLA 4CREA 2RA3A 1BTWA 2AERH 1W7GH 1HB0B 1O2LA 1KDQB 4X2XA 3H7TA 2VIVA 3M61U 1QBVH 1DT2A 3UR6A 5C5NA 2GCHG 3I29A 2PV9B 1HJ8A 1GI3A 3M37A 3O8DA 4CRAA 3E8LA 3ELAH 4YO9A 1GJ4H 1SR5C 2AIPA 2QF0A 3EGKH 1EB1H 1SPJA 3E0NB 3KF2A 5GPIB 5GDSH 1AIXH 4WH6A 1ESTA 2ZU5A 1F5RA 4BXSA 1ANBA 4YOIA 1QQ4A 5EOKA 1GDNA 3JZ1B 1XUIA 5HM2A 1GVLA 4UFGH 5C1UA 3GOVB 3A85A 1KLTA 1OPHB 1ESBA 1Z1IA 3F6UH 4TY6A 1C9TA 3SHCH 4AOQA 2F3CE 1NU7B 2PTNA 1O5EH 1W13U 1GHBF 1XX9A 4ABFA 4KTCA 5F8XA 2I6QA 2W3KA 4OS2A 2BD9A 2D1JA 1HCGA 3TGJE 1GBDA 1SGTA 5PTPA 1XUFA 1CE5A 3AAUA 1GG6C 2DE8A 1AFQC 4AN7A 4AG1A 4WY3A 2QXHA 1GJBB 1MZAA 4JYTA 3ZV9A 3RDZA 1KDQA 1TONA 3SI4H 2AEIH 4BTIB 3M36A 3GCHB 1AFQB 4DW2U 1ID5H 3NXPA 2V3OH 1BOQA 3URCA 3RC4A 5LPEA 1IHTH 1ABJH 1GWAA 1TX7A 1O2KA 2H5DA 1IOEA 2FYRA 3SQEE 2Z9LA 1XMNB 3A7ZA 1Q31A 3SUFA 1SLVB 4INHA 1J16A 1CBWC 4JK6A 1ELAA 1GJCB 2OCVB 1O0DH 2R2WU 2ZPSA 3PYHA 2FI4E 3GY5A 3ZZ4A 2F9PA 1LHGH 1GI9B 3A84A 1D9IA 1YPLH 5FX6A 3UWIA 5CMXH 5JB9S 1V2VT 3SU4A 3MU4A 3TJOA 1IAUA 3K65B 4MTBA 4BAHB 1DICA 1HAHH 1EAIA 4HI3A 4H6TA 4HZHA 1PQ5A 4ZHAA 1S83A 1EPTA 1QRWA 2FTLE 1IQGA 4X1RU 1O33A 3RLYH 2Y5GA 3SV8A 1TPAE 4B2AA 2ZZUH 4ZHLU 2RCEA 1C5WB 1CBWB 2UUFB 1TX6A 4BAQB 5K7RA 2ZP0H 4I32A 2EA3A 2FLRH 5FBEA 4DOQA 3R3GB 5ESBA 3ZZDA 2QF3A 4FU8A 1XKBC 3S9CA 1N6YA 1C5TA 4AB8A 3DA9B 3T28A 1O2GH 1QRXA 1ZYOA 3M3VA 3UNRA 2W26A 3A86A 4H4FA 1EXFA 2NU4E 2H1UA 1GHAF 3PTNA 1EZQA 3ESTA 3RMOH 4NSYA 2OQ5A 3URDA 2ALVA 4B74A 1DLEA 3RXSA 4JZFH 1ELVA 3TGIE 2ODQA 1A3BH 1WTHD 1C2HA 3GDSA 1MTNB 2WPHS 1NU9A 1SGIB 4NA7A 1Y5AT 1TABE 1Z6JH 2Q6DA 2TGDA 4JZEH 2QXIA 1HAXB 1RIWC 1PPEE 1AZ8A 1DOJA 1O3AA 4QT8C 9ESTA 1A2CH 1E35B 2BDGA 1IQIA 4CHAB 4THNH 4AORA 3TJUA 4CRCA 2BD8A 4ISHH 1L1NA 1ZGVA 1C1PA 3VGCC 1ZJDA 2OXSA 3A87A 4DGJA 3MTYA 4JYUH 2XBVA 3SOSA 1C5UA 2PUXB 3A8CA 3M3TA 1QA7A 4K60A 4XSKU 2BD5A 1O5AB 4CRBA 3FFGA 5HGGA 1YGCH 3RXKA 1S6FA 3U69H 4R0IA 3LGWA 1C1WH 4NSVA 2VH0A 3ZZBA 1CHOG 1QFKH 4K8YA 5DJ7A 1EJAA 3LC3A 1K2I1 3K6ZA 3MNBA 1AVWA 1C2GA 1KXBA 2FOBA 3VB7A 1P2MA 1V2RT 2BXTH 2GTBA 3TVJB 1UVOA 2QGRA 1BQYA 1OYTH 3P8GA 3SUGA 3IG6B 1T4VH 1W11U 4JZDH 1ELBA 3FP7E 1C1QA 3A81A 4DG4A 2TIOA 2VIQA 4DJZB 1P57B 1TE0A 2FYQA 1BBRE 4ZKRU 1O2SA 5B6OA 1SQTA 2G4UA 1O3EA 4YZUA 4Y6DA 4DVAU 1O35A 1A1RA 2PFEA 5JYIA 1QB9A 4U01A 2GKVE 1LQDB 2EC9H 4K1SA 3U1JB 1HAIH 3UQVA 1YP9A 2JKHA 1HFDA 1OX1A 3MU5A 1SC8U 3ZV8A 2Y5FA 2A7JA 1WYKA 4AB9A 5A09A 2SNVA 2BXUH 5LPRA 2ZU1A 5E2PA 2P94A 3E0PB 1O3CA 2CF8H 1MBMA 3V13A
chains in the Genus database with same CATH superfamily
1ETSH 2TGPZ 4U32A 2BDHA 4HTCH 1TOMH 3V7TA 1GJ5H 1O3OA 5EJ1A 2ZU4A 1ZMNA 1FAXA 3FOAA 4GCHF 1O3HA 3RXVA 3NZIA 4FUCA 5CE1A 1FJSA 4D8NA 1C2FA 2GMTB 2HALA 2BD4A 3SJOA 1AY6H 1TMTH 3UQOA 2ZGBH 1GBFA 3RXBA 5C67A 3LDXH 3UUZA 1IQKA 4YLQH 3TNTA 1FX0B 2FXRA 2BLQA 4TWWA 3RXPA 3GYLB 1YM0A 2WUCA 1TNJA 2AMQA 4D7FA 1OWHA 2BLWA 1HIAA 1P2OA 2A32A 3M5MA 2QE7D 2P8OB 2IOTA 1CA0B 3BN9A 3SV9A 3VXFH 4WXIA 1O3DA 1OKXA 1TB6H 1DANH 4FUHA 2ZTYA 2R0KA 1GVKB 5HMAA 2BHGA 3S0NA 1C5XB 1O36A 3SI3H 1PPGE 3GCTG 1O2RA 1XXDA 2GZ9A 1O2UA 1XVOA 1C2EA 1YPJH 2G5NA 1Z8IB 3MH4A 3RP2A 4UONA 1TBRH 2IPHA 1SFIA 3TNSA 1L4DA 1ANCA 3VB4A 3RXAA 1AI8H 2STBE 2Y81A 3TK9A 1LCYA 2XWBI 5HKKD 4E7RG 1C5OH 3QTOH 1VGCC 4LOYH 3I78A 3ZZCA 2BQWB 1Y59T 3QZQA 3DHKH 1GI2A 1GMHF 1PFXC 3FZZA 5T6DA 4MPUA 3PMBB 4B76A 1LHDH 5T6GA 5DN6D 5I25A 1E38B 1UTKA 2PSXA 1GI7B 4ACBA 3ZZ9A 1Z1JA 3TH3H 3SJKA 2O8WA 1O31A 1NFYA 1ESAA 4O9VA 1ANEA 2QXGA 3BTWE 3PO1B 1HJAC 1WXRA 1NROH 1K1NA 1KY9A 1Y3UA 4I86A 1FIWA 1OWIA 1PJPA 2OQUA 1A5HA 1QQUA 1BTZA 1CGJE 2HPPH 2A2QH 3ATKA 1Y8TA 3GYMA 3ZZ6A 3D23A 5C5OA 2A45B 3RC6A 2XC0A 1GJ8B 1P05A 1TX8A 3SUDA 1C5YB 3LGVA 4BOHA 1V2QT 3W94A 1MTUA 3VG8A 4LXBH 1CGIE 1LVBA 2JDID 2PKSC 4NG9H 1BIOA 3SNCA 1YF4A 2VB0A 4JYVH 4Y76A 5A0BA 1O2VA 1WSSH 1MMJN 1TYNA 1C1RA 2A1DB 3PM3A 4NFEA 1O2PA 1AB9B 3SJIA 5KECA 2BDCA 3NPSA 2ZQ2A 5FL7D 4Y0ZE 5A0AE 4FUFA 3FVFB 1DUAA 3GICB 4M7GA 4LK4A 1GCTB 1BZXE 1TPSA 1EB2A 4R8TB 1F0TA 3EA8A 3MH5A 3Q3YA 4BXWA 1GMDF 1U6QA 4TSFD 4WWYA 4J2YB 3M5OA 4Q7XA 3V3MA 5DK1A 1ELFA 2F83A 3SNAA 2V3MA 1GHVH 2F9NA 1EKBB 4YLUA 2ZPQA 4RT1A 1CA0C 3F3BA 3N99A 1GI4A 3KGPA 1MABB 2GT7A 3RXCA 1G37A 2FS9A 2ZDVH 3NCLA 2BM2A 1P0SH 1QGFA 2OBQA 2FX6A 1MH0A 1XUJA 1FI8A 2PWXA 1J15A 1GDQA 1NFXA 5TCAA 1EPTB 1C5MD 1AFEH 1B7XB 2HLDD 4YTAA 1TAWA 4MLFB 3SNBA 2OLGA 1D6WA 1T8OA 2R9PA 3LU9B 5F6MA 1SFQB 4X1PU 2ZKSA 1RTLA 4BANB 3OY6U 4NIVA 4TWYA 4KTUA 1FY4A 2IN2A 1WOFA 3TH2H 2FZZA 1YKTA 4X1SU 3G01A 3ITIA 2OK5A 1FUJA 1BHXB 3A8BA 4DURA 3LPRA 1A61H 1EP6A 1BTPA 3QN7A 1TGNA 1QL8A 1FAKH 2O8TA 2O8LA 3E3TA 1ANDA 1SHHB 4UFFH 4MNYA 4IW4E 1NS3A 1G36A 4WMEA 1LVOA 2Q6FA 4CR9A 1O2OA 1GI1A 1SSXA 3EDXB 3VGCB 2XNIA 1EP5A 1BT7A 5CHBA 3B9FH 1CHOF 2NU1E 5EQRA 5B6LA 3BG4C 5F8TA 1BRUP 1PQ8A 1NC6A 1IQMA 2VWMA 3UPEA 4ISNA 3MNXA 4X6PA 1SI5H 2GVFA 2NWNA 3UREA 1DY9A 1Z8GA 2TGTA 3OYPA 2SGEE 2FLBH 1P2KA 2BY6X 2IJD1 3I77A 2GP9B 2H9TH 1SMFE 1TIOA 3KHVA 1OWJA 1NZQH 5AHGH 4UD9H 2K1QA 5EQQA 2Z9JA 3U8TH 2J92A 1HAOH 1H1BA 1V2UT 2A4OA 1O2MA 1PPHE 1V2MT 5GCHG 1HJAB 3BEFB 1A46H 1AUJA 1XUHA 3GY8A 1CQQA 1HYLA 2STAE 1V2ST 1AHTH 2WSSD 3SU1A 4J1YA 3VFEA 2PKAA 1A0LA 3WY8A 5LPFA 5DG6A 3RXQA 2A5KA 1FY8E 4PROA 2XWAA 3DFJA 2XXLA 4AFSA 1C4V2 3V12A 1PPBH 3QWCH 5K0HA 1GJ9B 1KXFA 1C2DA 1Z6EA 1H8DH 2CGAA 3VB3A 2XTTB 2VJ1A 4WH8A 3UOPA 2OC0A 2H9HA 1T8LA 1DDJA 2Z6BD 1HAZB 3D62A 5DP5A 1E79D 1A0HB 3FN8A 4FUJA 1VKYA 4SGAE 3SZEA 1SGPE 1RTKA 2ZHWH 3F68H 1PPFE 1QRZA 3E90B 3MNCA 1H9LB 3SW2B 4AZ2B 2OBOA 1VCWA 1T8MA 2ULLA 3TITA 4DY7B 1SGYE 1W12U 3SU5A 1FNIA 1VITG 3B23B 3S7KB 2J98B 3LONA 1H8HD 1CU1A 1PPZA 2F9BH 1DX5M 3SORA 2W6ID 1MTNC 1PYTC 2ZDLA 5FBIA 3E1XB 3SNDA 4ACAA 1DPOA 5EG4A 3MQKC 3ZVDA 8GCHG 2ZDNA 3AW0A 1C5SA 2HRVA 1YPKH 2XCFA 9LPRA 2P16A 1A5IA 4IGDA 2CK3D 3LH1A 4AFQA 2ZCLP 1ELGA 4JCNA 3SJ9A 1HXEH 2FPZA 3MWIU 3SU3A 2GJGA 3KN2A 3BTHE 1BTXA 1W0YH 2KM0A 3BIVH 2G8TA 3MO9A 1Q2WA 1FMGA 5DP6A 3SU0A 2UUKB 1ZRBA 1YLCA 5DP9A 1EATA 1W8BH 3RXTA 2PSYA 1ZTLA 2Q1JA 2GT8A 2V6NA 2P59A 4Q7ZA 3TIUA 4K2YA 2BDBA 1MCTA 2B0FA 3O8RA 4NGAH 1K0HA 1SOTA 2H6MA 2CHAC 1A7SA 3PRBA 1TOCB 2F43B 3MOCA 1IQFA 1NBME 2VWLA 1P06A 1UVUH 2JJ2D 1GDUA 4AC9A 1H9HE 2PGBB 3NUMA 2GDDA 1H9IE 1HPGA 4XBDA 1AGJA 1AVGH 4RI0A 3T27A 4IN1A 1IHSH 1MKXH 1NO9H 1S6HA 2ZF0H 2KCYA 2FOAA 5HYOA 5KGOA 2CN0H 2G00A 1P2JA 3UOUA 1L2EA 1W3CA 2EI8A 1P03A 2HVYB 2YMSC 1OXGA 1SLWB 3OX7U 2H2ZA 3MO3A 1G3CA 3T29A 4A6LA 2ZU2A 3SJ8A 1GHAG 2HNTF 1LPGB 4AG2A 2J34A 1FPHH 1GI0A 3E91A 3ZVAA 2ALPA 5SGAE 1TPPA 3HKJB 1H8IH 2PLXA 1Y3YA 2JJ1D 2Z9IA 3DT0H 6CHAB 2Y7ZA 4TT3D 1JIRA 2ZFRH 1NFUA 4WMFA 1SGFG 5G4BA 1CVWH 1LKBA 4SGBE 2BTCE 4BTUB 2ZFPH 1S81A 2ODYB 4RSPA 1FY3A 3F9EA 1AE8H 4WVPE 4OS6A 3N7OA 1E37B 4ZXXH 2W7SA 2BX4A 1SKYE 3C27B 4Y8ZA 5GIBA 2FOCA 2ZEBA 2Y5HA 4B6EA 3FP8E 4JMYA 5JBAS 1GL0E 1GVZA 1MTWA 2JETB 1UVPA 4ZAEA 2WV9A 1EAXA 2BB4A 4YOGA 1EQ9A 1TWXB 1Y3WA 5EODA 2GZ7A 3PMJA 5L2YH 4ZHMU 1TNHA 2P95A 3BTDE 1FQ3A 5A8YA 1D3TB 5EW1H 2FOFA 1UVSH 1HDTH 4IC6A 1SVPA 4B75A 3KIDU 3E16B 1YCPK 2V0BA 1SGCA 1EASA 1NM6A 2J2UA 4K3JA 4MQAA 4GPGA 3FP6E 4K8BA 1GBIA 5C20A 1RJXB 5BRRE 1LPKB 2FI5E 3F9GA 4YM9A 3TK5A 1AO5A 1C1MA 3DSPA 2B7DH 2O9QA 2ZFQH 1FXYA 3P8FA 1EZSC 3RU4D 3SV6A 2KR7A 1Y5UT 2WYJA 3RMMH 2BZAA 1KXEA 3BTQE 1ORFA 2AFQB 2PTCE 3QTVH 3U1IB 3PO1C 4ISOA 4UDWH 1EOJA 3PV5A 3S7HB 7GCHG 2FO9A 1WU1A 2F9VA 2ZO3H 4ZKNU 4I31A 2ZGJA 2F91A 1UCYE 3FO8D 3LGUA 1ZMJA 1KLJH 3KQEA 1NRSH 1BMNH 1YPGH 1C5RA 3A7YA 1DXPA 1Y3VA 3NWUA 1J8AA 1V3XA 4X1QU 1QA0A 2V35A 1UCYK 2Y6TA 4XOJA 1C1NA 4ABIA 3SNEA 1TALA 3PWCA 4NZLA 1RGQA 1RIWB 2DE9A 1MAYA 1QB6A 3LKWA 1UTQA 3JZ2B 2HWLB 1YPEH 2WV5A 4VGCB 1NT1A 2Q6GA 1ZR0A 1O2YA 2KX4A 5A8XA 4ABDA 3UR9A 2ZFFH 5A8ZA 1ARBA 4K69A 2UWOA 1J17T 3RC5A 2FOEA 1YCPM 1ZRKA 2G4TA 5C94A 2QCYA 2XRCA 1FN8A 1O3LA 1P09A 4Y0YE 2L74A 2HNTE 3D49H 2FESH 1BBRK 3UFAA 1MBQA 3HK3B 3Q77A 5HM9A 4OGYA 3GY3A 1SGDE 1THSH 1C2JA 1K1PA 3SO3A 2EQNA 4GLYA 3SV7A 1FONA 1L0ZA 1N6XA 2C8WB 3P95A 4X2YA 3A82A 1WBGB 2WUBA 2PW8H 3KNXA 1CA8B 2GGVB 3ZZ7A 3RM2H 3BTKE 3GDUA 2AYWA 2EY4C 3BTFE 2KAIA 3BSQA 1ZSLA 4B71A 2ZECA 2VVVA 1VR1H 4YOJA 3IITA 1B5GH 3HGNA 1WAYB 3Q76A 2A31A 1BMLA 2HLCA 2PP6A 5DP7A 1P02A 3TU7H 2KCPA 1KYNA 2UWPA 4Z1MD 2BOKA 2F9UA 2R2MB 1F5LA 3MYWA 5GCHF 3RXHA 1ELCA 1GBJA 1N8OB 3PTBA 3A7VA 1C4U2 4U30A 1O5GH 4ZKOU 2XYAA 2BQ7B 3W95A 3F9HA 5F8ZA 1AZZA 3O8CA 1TPOA 3LJOA 4TY7A 1QJ1B 1O34A 1GMCF 3PROA 4D9RA 1GHWH 1Q3XA 4U2WA 2OTVA 2HPQH 2R3UA 4UEHH 3KCGH 2FS8A 1C1UH 1E1RD 3OTPA 3SUEA 1KXCA 1ETTH 4ABEA 2WINI 5JBCS 2TGAA 4GHQA 4NIWA 1O2NA 2SGFE 2WPKS 4HFPB 1BJUA 2FDAA 3A7XA 4YT6H 1DFPA 1YPMH 2ZI2H 4CH2B 3QGNB 1DUEA 2BDIA 4KTSA 1O3BA 2V7QD 3K2UA 5FCKA 5DPAA 1O39A 4INLA 2J5UA 4JK5A 5DP8A 1QIXB 2VIDA 3PMAB 1IQEA 5DP4A 2LNCA 5T3HA 3RMNH 1OWKA 1GBLA 3GDVA 1G3EA 3DSGA 2UUYA 2G52A 2H5CA 4Y10E 3L33A 3A89A 1C1SA 5FAHA 3GCNA 3RUOA 3N7DA 2L6OA 3PV4A 3KYGA 4DCDA 3BIUH 3GY7A 1J9CH 3TJNA 2AGEX 1TGTA 1T4UH 4IMQA 1YLDA 2GX4A 3CENA 4I8LA 5A2MH 1MD7A 2ILNA 2GCHF 4ZMAH 1KXDA 3PLKA 1WQVH 4JZIA 1K1JA 1RS0A 1VJAU 1GBHA 2OC7A 1P9UA 2SFAA 1KTSB 3PLBA 4AYVB 5L6NH 1FIZA 3P92A 3GY4A 3ZVCA 2BY5X 5HXFA 1C5VA 4UFEH 6GCHF 1YBWA 1Z8JB 3ZZ8A 1DWCH 2G51A 4X8VH 2C93B 2KZ4A 4B2BA 1BTHH 2PGQB 4ABBA 2QY0B 1SGQE 3F1SB 1WCZA 3OU0A 5DGJA 1WQSA 3AASA 3A8AA 4OS1A 4Q80A 1ELTA 3T25A 4BAOB 1A0JA 2Z3CA 1O30A 4Y71A 1IQLA 1HBTH 3GS9A 3H5CB 2FODA 5HIZA 3TGKE 4XD7D 5EPNA 1T31A 2ZG0H 5EU8A 2BDAA 2ZPRA 2Y82A 4RKJB 4AX9H 3UNQA 1LKAA 1LQEA 4D9QA 2LELA 5AVDA 5ESTE 3T62A 1DE7H 3EYDA 1UTNA 2FOHA 2D2DA 2KAIB 1VJ9U 2W3IA 4A7IB 1AKSA 2FMJA 3GISB 1O5CB 5A0CA 2ZGXH 1V2WT 1EFRD 3TJVA 4NWKA 1ZHMA 1ZPZA 2ODPA 1QTFA 2A5IA 2VVCA 4JZ1A 3ZVBA 1TQ7B 2ANWA 5F03A 1O3NA 2WHXA 4ZROA 1K28D 3SU6A 1F7ZA 1BTYA 2Z9GA 7ESTE 3SBKA 3CP7A 3QGJA 2P3UB 1TNGA 1UK3A 2QIQA 2PHBA 2JH6D 2FI3E 1TFXA 2EEKA 4Y8YA 4MPXA 1UTLM 1EZXC 1S85A 3F2GA 1LMWB 4GUXA 3T5FH 1BJVA 1LTOA 1B0FA 4XDEA 5FPSA 2C4FH 3UTUH 2GDEH 3UAIC 1O32A 3AAVA 1J14A 1E1QD 1WDIA 2JETC 2XBXA 5E0GA 4GCHG 2AIQA 4KGAA 3TH4H 1BMAA 3HK6B 4O03A 4LZ4B 1HIAB 1A5GH 1GBTA 5C1XA 1MQ6A 1YLNA 2RG3A 3ZZ3A 1GGDB 1HAPH 1NRPH 3LOXA 2V3HH 8KME2 1MTVA 1ZPCA 4RKOB 1IQNA 3RU4E 3U98H 1SGRE 3IWMA 1ETRH 1SG8B 4KKDA 3RXDA 1LPZB 2R3YA 1UVTH 1ZLRA 2BQ6B 1G30B 1NRQH 2BX3A 1ACBE 2WPDD 3SV2H 4O97A 7GCHF 1P2QA 4K5ZA 4CBNA 4GHTA 5C3NA 4I8KA 1G2MA 2G5VA 3Q3XA 1JBUH 2I6SA 1QR3E 2QF5A 2A4RA 1UHBA 2QAAA 2J94A 1RRKA 4ZXYH 1A3EH 4IN2A 1UO6A 4F48B 2BOHB 1HV7A 3M7TA 2A2XH 4TPIZ 4ABJA 2VVUA 1SGEE 4NA8A 1O2IA 5L30H 5JPMH 5L2ZH 1TRYA 3TK6A 2YNBA 1A4WH 3CS7A 1C5LH 5IYTA 1CSOE 2CXVA 3DD2H 1D6RA 4FUDA 4LZ1H 5DKMA 1UMAH 3ATMA 3K9XB 3RXJA 4YESB 3RXGA 3ZZAA 1DLKB 2ZHFH 2A4GA 1TBZH 1AUTC 1THPB 2WPJS 4DIHH 2GCTB 6LPRA 1BUIA 4HGCA 1NPMA 4AGJA 1C5NH 3QX5H 1O2JA 1S84A 2KCOA 1QBOA 4O3UA 3RXRA 1VITH 1CT4E 1BHXF 3KQDA 4NCYA 1TGCA 1YPHE 1O38A 3NK8A 1GJ7B 2Z3EA 1SL3A 4VGCC 3M7UA 5J4SA 1GBCA 2THFB 2VGCB 2BY7X 3MU8A 1WUNH 2OP9A 1XM1A 1C2IA 1O3KA 3RXOA 3P8OA 1MCVA 3QDZB 2CMYA 2YMSD 3A83A 2LP6A 4XBBA 5TJXA 1O2WA 1V2NT 2FEQH 2NU3E 3AVZA 3P8NA 1HAGE 1ZTKA 2ZDMA 1HLTH 4Z6AH 1O5DH 1JIMA 2JH0D 1HAVA 4AFUA 3S9AA 2P8OC 3BTGE 1O3IA 2J9NA 1TMBH 3ZYDA 4E06H 2BD7A 4M9FA 4D76A 2IJOB 1OWDA 1O5FH 1QB1A 1V2JT 2G55A 3S69A 1MU8B 1QL9A 2B5TB 4DT4A 3UNSA 1QZ8A 4WF8A 1GHXH 1BITA 3SN8A 4XRNA 1JXPA 4MNVA 4KELA 5JB8S 3KEEA 1ZOMA 2VINA 2AGIX 3PB1E 5LH8A 1UTPA 2ASUB 1C2LA 3M5NA 1MKXK 1BBRH 1DSUA 5IK2D 3AW1A 5E0JA 4OS4A 1AU8A 3WWFA 2ANMH 2RA0A 2ZIQH 4B1TA 4MDSA 1NRNH 3ODDA 1GCDA 3HGPA 3QLPH 1HAYB 1QL7A 1Z7KA 2BYAX 6ESTA 4H42U 4X8UH 5GXPA 4ABHA 1C2MA 1X7AC 1TA2A 3STJA 3OY5U 2W5EA 4DT7B 1DVAH 2DUCA 3ATLA 1DS2E 1V2OT 4GSOA 5C0UA 5TCCA 1ELEE 1L4ZA 1MTSA 1BRAA 1UCYH 2QF4A 2ZDAH 1YYY1 1TMUH 2XCNA 4GAWA 1GBMA 4KP0A 5I46H 1EZUC 1M9UA 3UIRA 3HPTB 2W7UA 4Y8XA 2Z94A 3A88A 5CDFE 1S5SA 1F0RA 1XKAC 2PR3A 1SHYA 2P3FH 2D26C 2GD4B 4FVDA 3QZRA 2BLOA 1EJNA 2P93A 1G32B 1W7XH 3ODFA 4ZH8A 1VCPA 3BG8A 5FCRA 4TPYA 3F0PA 3NRLA 3M35A 1S82A 1ARCA 2FIRH 5LGOA 1OYQA 4D7GA 3STIA 4I33A 1WTGH 4CRFA 2XC5A 1O2HA 5C2ZA 1C2KA 1ZZZA 1DWBH 2BDYA 1FPCH 2FX4A 1HUTH 2KCAA 3N7EA 2M2AA 2VIPA 1P01A 1TNKA 3BF6H 2YMSB 3PRDA 2CV3A 3HATH 1RTFB 5EW2H 1JRTA 3VXEH 1YCPH 3GCTF 4F4OC 1LVMA 3EA9A 5ETXA 2Z3DA 1ABIH 2P3TB 7LPRA 2VGCC 3EQ0H 1EAUA 1EOLA 1G3DA 3BV9B 1Z8RA 1CGHA 1K22H 4CHAC 1GPZA 2TRMA 3KQBA 3SGBE 1P9SA 2GV7A 1VGCB 3F2FA 1O3MA 1C1VH 2CF9H 2R0LA 1HJ9A 2CJIA 2O8MA 2GCTC 3VEQB 2A0QB 2J95A 4BAMB 3A80A 3RXIA 2FP7B 4NFFA 1P10A 2O8UA 1ZHPA 4K1TA 1BA8B 2ZQ1A 3KL6A 3FZDA 5JBBS 1N8OC 2A4QA 1TLDA 1QHRB 1TNLA 2W6JD 2XBYA 5EQSA 2PKAB 2SGDE 1FDPA 2ZGHA 1EX3A 3Q3KA 1GBKA 1YC0A 3F0OA 3RXFA 7KMEH 1DITH 1SB1H 1PQ7A 4Y79A 1ZGIA 2J38A 1GJAB 5GNDA 5H4IB 3ZYEA 5DSFA 1KLIH 1JMOH 4X6MA 2HVXA 1O37A 2Z9KA 3H09A 1O5BB 1K21H 1VCQA 1V6DA 3PMHB 3LGTA 3RXLA 4FUGA 2BLVA 2ESTE 1ELDE 3GCHC 1D3QB 1G3BA 3SZNA 1AVXA 1TRMA 2UUJB 1GCTC 1PYTD 2BVRH 4IMZA 4X1NU 2VNTA 1KTTB 1F5KU 3MU0A 2CHAB 1AWFH 1UW7A 2VWOA 2J98A 2FWWA 5JBTA 1XVMA 1GHYH 3MH6A 4OS7A 2Z7FE 3S9BA 4A1XA 2NU2E 3BEUA 4RN6A 5EIYA 1NN6A 2BY8X 1C9PA 1ZHRA 1AQ7A 1SLUB 3ATWA 1T32A 2A7CA 3HKIB 4FUIA 1MAXA 1W0ZU 1FV9A 1TQ0B 3VB5A 4WXVA 3VB6A 1MZDA 3KQCA 1LDTT 1O2XA 2Y7XA 1PPCE 1KIGH 3FANA 3L3TA 4X6NA 3GY6A 4B73A 4CR5A 3LH3A 1LVYA 2Y80A 5FX5A 1OP2A 1C1TA 1NESE 1AD8H 3E6PH 1H4WA 5T6FA 1K1IA 1BRBE 2ZHQH 2SNWA 1TGBA 4FUEA 1SGFA 2BVSH 1KXAA 4X6OA 2ANYA 2UWLA 2VH6A 2C90B 1TBQH 2ZDKA 3MNSA 4MNWA 1IQJA 3QO6A 1C1OA 2IPQX 2KFWA 4UE7H 3C1KA 4IC5A 1TRNA 4FVBA 5AFZH 2SGPE 2B8OH 1LHEH 2FOMB 3T26A 1W10U 2C8ZB 3UY9A 1LHCH 3SQHE 4MNXA 1SQAA 2ZA5A 3F9FA 1RD3B 4I7YH 4MPWA 3RM0H 1GG6B 1OP8A 1DXWA 1QBNA 1QCPA 2BD2A 2TPIZ 4X0WU 5C1YA 1JWTA 1BMFD 3LGYA 4ABGA 5AF9H 4CBOA 1GMDG 1RFNA 2OC8A 3BG4B 2XOKD 2HGTH 3MI4A 1BRCE 1DSTA 1W0KD 4X2WA 4ISLA 2AH4X 4ZKSU 1G9IE 2XC4A 4OGXA 1NFWA 1TGSZ 3EAJA 4RT0A 2ZU3A 3U28C 3LGIA 1ZSJA 1GMHG 2ZWLH 1LHFH 1JOUB 2BVXH 4ASHA 1Z71A 3R0FA 3M5LA 5AFYH 2OD3B 1T8NA 2GV6A 3GCOA 4Z0KA 5C17A 4DIIH 2VU8E 1BB0B 4AGKA 1IQHA 4B6FA 1UK2A 2WZQA 1L1JA 1XUGA 3OTJE 2BD3A 4CRDA 4ZCNA 1BDAA 1P12E 1QURH 1C5ZB 1WV7H 1K1OA 1P11E 3RXMA 5DP3A 2ZHEH 1THRH 2ZCHP 1QY6A 1ZSKA 5EGMA 4Q2KA 3LC5A 2PUQH 5E2OA 3NKKA 3QUMP 8LPRA 3PLPA 2D8WA 1GL1A 3P70B 3ZVGA 5DO4H 6GCHG 2VWNA 3O8BA 5JDUB 1TA6A 1EUFA 1XXFA 2FTMA 3RMLH 4FXGH 5EPYA 3QK1A 1V2PT 2AS9A 3B8JA 1UK4A 1P2IA 4YXWD 5E8EH 4ESTE 1E34B 1G2LA 3OEHD 3U8RH 3EE0B 2XW9A 5CHAB 4Y7AA 2WPIS 1P8VC 2QA9E 1CO7E 4A92A 4I8HA 2SGAA 1DWDH 1AKSB 1HRTH 3P17H 3MO6A 1EJMA 1KMHB 2ZHDA 1D3PB 1XUKA 3H7OA 4X2VA 1B0EA 2QXJA 1W14U 4XFQA 3MU1A 1CHGA 4Y11E 1W2KH 1FN6A 3TPIZ 3SGAE 4E7NA 4WJG2 3GY2A 1NY22 3T2NA 2ANKH 1QNJA 4X8SH 3EA7A 4MVNA 2WYGA 1O2ZA 4AYYB 1P04A 3PV2A 3UWJH 3ZVEA 2EI6A 3MFJA 1E0FD 4H6SB 1N1LA 1P3CA 1GBBA 4FU9A 2ZFSA 1TNIA 3BEIB 1AWHB 1KSNA 1DWEH 3MHWU 4CRGA 1GHBG 4F49A 1O3FA 1EPTC 1C5QA 5FPYA 1P2NA 1AE5A 1SQOA 4WMDA 4GVUA 5EJLA 4YT7H 2VIWA 1OWEA 1NTPA 2PKSB 1Y5BT 4NWLA 1C4Y2 2G81E 2ZTXA 3BTTE 1S0RA 3W1EA 5GJ4B 3OSYA 1S6LA 3RLWH 1HGTH 1GGDC 3LT3A 2AMPA 5EXMA 5GWZA 1GHZA 3ATIA 4NIYA 1GJ6A 4MPVA 1O3PB 4ZUHA 3K6YA 1GJDB 5FHTA 3SHAH 4B2CA 4FETA 3MH7A 4OM9A 3MMGA 2LPRA 4ISIH 2OINA 4Y7BA 2C3SA 1D4PB 1DY8A 4AFZA 5J4QA 1H8ED 2AMDA 4Q7YA 6CHAC 1OP0A 2OC1A 1BTUA 4FU7A 8GCHF 1YPHC 1Y3XA 1QJ7B 1UTMA 4ABAA 1AB9C 5EXLA 4I8GA 2HNTC 2B9LA 1GI8B 1ZJKA 1MKWK 3A7WA 2ZC9H 3LIWA 1O2QA 4XE4A 2K8IA 1SGNE 2RDLA 4BAKB 1GI6A 2QYIA 1NBMD 1AMHA 1FLEE 5IDKA 1K1LA 1MUEB 2ZGCA 1INCA 1DM4B 1F92A 1V2TT 2QN5T 4IS5A 5FXLA 4A1VA 2WV4A 3SGQE 3TLOA 3ZZ5A 1D3DB 2FOGA 2XBWA 4NZQA 2NU0E 3SU2A 2H9EH 1F0SA 3AK5A 4IBLH 1GBAA 2JH5D 4CH8B 2VBCA 3RU4T 1JRSA 3Q00A 1YY3A 2BZ6H 1P3EA 3P6ZB 2SGQE 3WWBA 4BTTB 5T1VA 4OS5A 2AHME 2C8XB 3ENSB 1K1MA 1MU6B 1OS8A 3VPKA 4A5TS 1LO6A 8ESTE 2WPMS 3L6PA 1K9OE 3LJJA 1FY1A 1NRRH 5F53A 1SBWA 3M7QA 1O2TA 2ZFTA 4X8TH 3U8OH 1GI5A 1SOZA 3BTME 4O3TA 1HNEE 1GMCG 3F2HA 1T7CA 5FPTA 1V2KT 1O3JA 1MQ5A 2ZTZA 2F9OA 3U9AH 5ABWA 3RXEA 3PWBA 1OSSA 4TYDA 3ZVFA 5EXNA 2HOBA 2GZ8A 4BNRA 4P00A 4F55A 3DCLA 1ZPBA 3DUXH 1VITF 1QJ6B 3V0XA 3D65E 3KQ5A 4K1EA 2J4IA 4I8JA 2YNAA 3CS0A 1RXPA 1BCUH 1HAVB 1C5PA 1L1GA 2A5AA 1ZMLA 2WPLS 2M5TA 3FAOA 1V2LT 2ZCKP 2ZNKH 1PQAA 3DFLA 2GMTC 1GBEA 1UJ1A 2EI7A 4NA9H 1E36B 2J97A 1FY5A 1CT0E 4FUBA 1HXFH 1AN1E 1BMMH 1VZQH 2A7HA 2BMGB 5EJZA 2QV1A 3RXUA 3A8DA 4A1TA 2QC2A 3M3SA 3A7TA 1MKWH 1UTJA 1UTOA 1F0UA 2C8YB 5CHAC 1MD8A 2FM2A 1F2SE 1FZZA 5E0HA 4E05H 1EAWA 1ZTJA 4UFDH 4MG3A 1S0QA 1UHBB 2AGGX 1SLXB 2TBSA 3OEED 5KEDA 2XNDD 1O3GA 3BTEE 4NIXA 5BPEA 4INKA 2BY9X 4Q63A 2OUAA 1CT2E 4XBCA 2VIOA 1OOKB 2YOLA 4CREA 2RA3A 1BTWA 2AERH 1W7GH 1HB0B 1O2LA 1KDQB 4X2XA 3H7TA 2VIVA 3M61U 2F4LA 1QBVH 1DT2A 3UR6A 5C5NA 2GCHG 3I29A 2PV9B 1HJ8A 1GI3A 3M37A 3O8DA 4CRAA 3E8LA 3ELAH 2K0QA 4YO9A 1GJ4H 1SR5C 2AIPA 2QF0A 3EGKH 1EB1H 1SPJA 3E0NB 4HG6A 3KF2A 5GPIB 5GDSH 1AIXH 4WH6A 1ESTA 2ZU5A 1F5RA 4BXSA 1ANBA 4YOIA 1QQ4A 2RFKC 5EOKA 1GDNA 3JZ1B 1XUIA 5HM2A 1GVLA 4UFGH 5C1UA 3GOVB 3A85A 1KLTA 1OPHB 1ESBA 1Z1IA 3F6UH 4TY6A 1C9TA 3SHCH 4AOQA 2F3CE 1NU7B 2PTNA 1O5EH 1W13U 1GHBF 1XX9A 4ABFA 4KTCA 5F8XA 2I6QA 2W3KA 4OS2A 2BD9A 2D1JA 1HCGA 3TGJE 1GBDA 1SGTA 5PTPA 1XUFA 1CE5A 1SQRA 3AAUA 1GG6C 2DE8A 1AFQC 4AN7A 4AG1A 4WY3A 2QXHA 1GJBB 1MZAA 4JYTA 3ZV9A 3RDZA 1KDQA 1TONA 5HIYA 3SI4H 2AEIH 4BTIB 3M36A 3GCHB 3KYFA 1AFQB 1YWUA 4DW2U 1ID5H 3NXPA 2V3OH 3OE7D 1BOQA 3CNRA 3URCA 3RC4A 1OHHD 5LPEA 1IHTH 1ABJH 1GWAA 1TX7A 1O2KA 2H5DA 3FKSD 1IOEA 2FYRA 3SQEE 2Z9LA 1XMNB 3A7ZA 1Q31A 3SUFA 1SLVB 4INHA 1J16A 1CBWC 4JK6A 1ELAA 1GJCB 2OCVB 1O0DH 2R2WU 2ZPSA 3PYHA 2FI4E 3GY5A 3ZZ4A 2F9PA 1LHGH 1GI9B 3A84A 1D9IA 1YPLH 5FX6A 3UWIA 5CMXH 5C0TA 5JB9S 1V2VT 3SU4A 3MU4A 3TJOA 1IAUA 3K65B 4MTBA 4BAHB 1DICA 1HAHH 1EAIA 4HI3A 4H6TA 4HZHA 1PQ5A 4ZHAA 1S83A 1EPTA 1QRWA 2FTLE 2RDEA 1IQGA 4X1RU 1O33A 3RLYH 3DSOA 2Y5GA 3SV8A 1TPAE 4B2AA 2ZZUH 4ZHLU 2RCEA 1C5WB 1CBWB 2UUFB 1TX6A 4BAQB 5K7RA 2ZP0H 4I32A 2EA3A 2FLRH 5FBEA 3UB0A 4DOQA 3R3GB 5ESBA 3ZZDA 2QF3A 4FU8A 1XKBC 3S9CA 1N6YA 1C5TA 4AB8A 3DA9B 3T28A 1O2GH 1QRXA 1ZYOA 3M3VA 3UNRA 2W26A 3A86A 4H4FA 1EXFA 2NU4E 2H1UA 4Q4LA 1GHAF 3PTNA 1EZQA 3ESTA 3RMOH 4NSYA 2OQ5A 3URDA 2ALVA 4B74A 1DLEA 3RXSA 4JZFH 1ELVA 3TGIE 2ODQA 1A3BH 1WTHD 1C2HA 3GDSA 1MTNB 2WPHS 1NU9A 3ZIAD 1SGIB 4NA7A 1Y5AT 1TABE 1Z6JH 2Q6DA 2TGDA 4ASUD 4JZEH 2QXIA 1HAXB 1RIWC 1PPEE 1AZ8A 1DOJA 1O3AA 4QT8C 9ESTA 1A2CH 1E35B 2BDGA 1IQIA 4CHAB 4THNH 4AORA 3TJUA 4CRCA 2BD8A 2JIZD 4ISHH 1L1NA 1ZGVA 1C1PA 3VGCC 1ZJDA 1W0JD 2OXSA 3A87A 4DGJA 3MTYA 4JYUH 2XBVA 3SOSA 1C5UA 1COWD 2PUXB 3A8CA 3M3TA 1QA7A 4K60A 4XSKU 2BD5A 1O5AB 4CRBA 3FFGA 3WW7A 5HGGA 1YGCH 3EE7A 3RXKA 1S6FA 3U69H 4FOUC 4R0IA 3LGWA 1C1WH 4NSVA 2VH0A 3ZZBA 1CHOG 1QFKH 4K8YA 5DJ7A 1EJAA 3LC3A 1K2I1 3K6ZA 3MNBA 1AVWA 1C2GA 1KXBA 2FOBA 3VB7A 1P2MA 1V2RT 2BXTH 4P02A 2GTBA 3TVJB 1UVOA 2QGRA 3OFND 1BQYA 1OYTH 3P8GA 3SUGA 3IG6B 1T4VH 1W11U 4JZDH 1ELBA 3FP7E 1C1QA 3A81A 4DG4A 2TIOA 2VIQA 4DJZB 1P57B 1TE0A 2FYQA 1BBRE 4ZKRU 1O2SA 5B6OA 1SQTA 2G4UA 1O3EA 4YZUA 4Y6DA 4DVAU 1O35A 1A1RA 2PFEA 5JYIA 1QB9A 4U01A 2GKVE 1LQDB 2EC9H 4K1SA 3U1JB 1HAIH 3UQVA 1YP9A 2JKHA 1HFDA 1OX1A 3MU5A 1SC8U 3ZV8A 3SYJA 2Y5FA 2A7JA 1WYKA 4AB9A 5A09A 2SNVA 2BXUH 5LPRA 2ZU1A 3OAAD 5E2PA 2P94A 3E0PB 1O3CA 2CF8H 1MBMA 3V13A
chains in the Genus database with same CATH topology
1ETSH 2TGPZ 4U32A 2BDHA 4HTCH 1TOMH 3V7TA 1GJ5H 1O3OA 2ZU4A 1ZMNA 1FAXA 4GCHF 1O3HA 3RXVA 3NZIA 4FUCA 5CE1A 1FJSA 4D8NA 1C2FA 2GMTB 2HALA 2BD4A 3SJOA 1AY6H 1TMTH 3UQOA 2ZGBH 1GBFA 3RXBA 5C67A 3LDXH 3UUZA 1IQKA 4YLQH 3TNTA 2FXRA 2BLQA 4TWWA 3RXPA 3GYLB 1YM0A 2WUCA 1TNJA 2AMQA 4D7FA 1OWHA 2BLWA 1HIAA 1P2OA 2A32A 3M5MA 2P8OB 2IOTA 1CA0B 3BN9A 3SV9A 3VXFH 4WXIA 1O3DA 1OKXA 1TB6H 1DANH 4FUHA 2ZTYA 2R0KA 1GVKB 5HMAA 2BHGA 3S0NA 1C5XB 1O36A 3SI3H 1PPGE 3GCTG 1O2RA 1XXDA 2GZ9A 1O2UA 1XVOA 1C2EA 1YPJH 2G5NA 1Z8IB 3MH4A 3RP2A 4UONA 1TBRH 2IPHA 1SFIA 3TNSA 1L4DA 1ANCA 3VB4A 3RXAA 1AI8H 2STBE 2Y81A 3TK9A 1LCYA 2XWBI 4E7RG 1C5OH 3QTOH 1VGCC 4LOYH 3I78A 3ZZCA 2BQWB 1Y59T 3QZQA 3DHKH 1GI2A 1GMHF 1PFXC 3FZZA 5T6DA 4MPUA 3PMBB 4B76A 1LHDH 5T6GA 5I25A 1E38B 1UTKA 2PSXA 1GI7B 3ZZ9A 1Z1JA 3TH3H 3SJKA 2O8WA 1O31A 1NFYA 1ESAA 4O9VA 1ANEA 2QXGA 3BTWE 3PO1B 1HJAC 1NROH 1K1NA 1KY9A 1Y3UA 1FIWA 1OWIA 1PJPA 2OQUA 1A5HA 1QQUA 1BTZA 1CGJE 2HPPH 2A2QH 3ATKA 1Y8TA 3GYMA 3ZZ6A 3D23A 5C5OA 2A45B 3RC6A 2XC0A 1GJ8B 1P05A 1TX8A 3SUDA 1C5YB 3LGVA 4BOHA 1V2QT 3W94A 1MTUA 4LXBH 1CGIE 1LVBA 2PKSC 4NG9H 1BIOA 3SNCA 1YF4A 2VB0A 4JYVH 4Y76A 5A0BA 1O2VA 1WSSH 1MMJN 1TYNA 1C1RA 2A1DB 3PM3A 4NFEA 1O2PA 1AB9B 3SJIA 2BDCA 3NPSA 2ZQ2A 4Y0ZE 5A0AE 4FUFA 3FVFB 1DUAA 3GICB 4M7GA 4LK4A 1GCTB 1BZXE 1TPSA 1EB2A 4R8TB 1F0TA 3EA8A 3MH5A 3Q3YA 4BXWA 1GMDF 1U6QA 4WWYA 4J2YB 3M5OA 4Q7XA 3V3MA 5DK1A 1ELFA 2F83A 3SNAA 1GHVH 2F9NA 1EKBB 4YLUA 2ZPQA 1CA0C 1GI4A 3KGPA 2GT7A 3RXCA 1G37A 2FS9A 2ZDVH 3NCLA 2BM2A 1P0SH 1QGFA 2OBQA 2FX6A 1MH0A 1XUJA 1FI8A 2PWXA 1J15A 1GDQA 1NFXA 5TCAA 1EPTB 1C5MD 1AFEH 1B7XB 4YTAA 1TAWA 4MLFB 3SNBA 2OLGA 1D6WA 1T8OA 2R9PA 3LU9B 5F6MA 1SFQB 4X1PU 2ZKSA 1RTLA 4BANB 3OY6U 4NIVA 4TWYA 4KTUA 1FY4A 2IN2A 1WOFA 3TH2H 2FZZA 1YKTA 4X1SU 3G01A 3ITIA 1FUJA 1BHXB 3A8BA 4DURA 3LPRA 1A61H 1EP6A 1BTPA 3QN7A 1TGNA 1QL8A 1FAKH 2O8TA 2O8LA 3E3TA 1ANDA 1SHHB 4UFFH 4MNYA 4IW4E 1NS3A 1G36A 4WMEA 1LVOA 2Q6FA 4CR9A 1O2OA 1GI1A 1SSXA 3EDXB 3VGCB 2XNIA 1EP5A 1BT7A 3B9FH 1CHOF 2NU1E 5EQRA 3BG4C 5F8TA 1BRUP 1PQ8A 1NC6A 1IQMA 2VWMA 3UPEA 4ISNA 3MNXA 4X6PA 1SI5H 2GVFA 2NWNA 3UREA 1DY9A 1Z8GA 2TGTA 3OYPA 2SGEE 2FLBH 1P2KA 2BY6X 3I77A 2GP9B 2H9TH 1SMFE 1TIOA 3KHVA 1OWJA 1NZQH 5AHGH 4UD9H 2K1QA 5EQQA 2Z9JA 3U8TH 2J92A 1HAOH 1H1BA 1V2UT 2A4OA 1O2MA 1PPHE 1V2MT 5GCHG 1HJAB 3BEFB 1A46H 1AUJA 1XUHA 3GY8A 1CQQA 1HYLA 2STAE 1V2ST 1AHTH 3SU1A 4J1YA 3VFEA 2PKAA 1A0LA 3WY8A 5LPFA 5DG6A 3RXQA 2A5KA 1FY8E 4PROA 2XWAA 3DFJA 2XXLA 4AFSA 1C4V2 3V12A 1PPBH 3QWCH 5K0HA 1GJ9B 1KXFA 1C2DA 1Z6EA 1H8DH 2CGAA 3VB3A 2XTTB 2VJ1A 4WH8A 3UOPA 2OC0A 2H9HA 1T8LA 1DDJA 2Z6BD 1HAZB 3D62A 5DP5A 1A0HB 4FUJA 4SGAE 1SGPE 1RTKA 2ZHWH 3F68H 1PPFE 1QRZA 3E90B 3MNCA 1H9LB 3SW2B 4AZ2B 2OBOA 1VCWA 1T8MA 2ULLA 3TITA 4DY7B 1SGYE 1W12U 3SU5A 1FNIA 1VITG 3B23B 3S7KB 3LONA 1CU1A 1PPZA 2F9BH 1DX5M 3SORA 1MTNC 1PYTC 2ZDLA 5FBIA 3E1XB 3SNDA 1DPOA 5EG4A 3ZVDA 8GCHG 2ZDNA 3AW0A 1C5SA 2HRVA 1YPKH 2XCFA 9LPRA 2P16A 1A5IA 4IGDA 3LH1A 4AFQA 2ZCLP 1ELGA 4JCNA 3SJ9A 1HXEH 2FPZA 3MWIU 3SU3A 3KN2A 3BTHE 1BTXA 1W0YH 3BIVH 2G8TA 3MO9A 1Q2WA 1FMGA 5DP6A 3SU0A 2UUKB 1ZRBA 1YLCA 5DP9A 1EATA 1W8BH 3RXTA 2PSYA 1ZTLA 2Q1JA 2GT8A 2V6NA 2P59A 4Q7ZA 3TIUA 4K2YA 2BDBA 1MCTA 2B0FA 3O8RA 4NGAH 1SOTA 2H6MA 2CHAC 1A7SA 1TOCB 3MOCA 1IQFA 2VWLA 1P06A 1UVUH 1GDUA 1H9HE 2PGBB 3NUMA 2GDDA 1H9IE 1HPGA 4XBDA 1AGJA 1AVGH 3T27A 4IN1A 1IHSH 1MKXH 1NO9H 1S6HA 2ZF0H 2FOAA 5HYOA 2CN0H 2G00A 1P2JA 3UOUA 1L2EA 1W3CA 2EI8A 1P03A 1OXGA 1SLWB 3OX7U 2H2ZA 3MO3A 1G3CA 3T29A 4A6LA 2ZU2A 3SJ8A 1GHAG 2HNTF 1LPGB 4AG2A 2J34A 1FPHH 1GI0A 3E91A 3ZVAA 2ALPA 5SGAE 1TPPA 3HKJB 1H8IH 2PLXA 1Y3YA 3DT0H 2Z9IA 6CHAB 2Y7ZA 1JIRA 2ZFRH 1NFUA 4WMFA 1SGFG 5G4BA 1CVWH 1LKBA 4SGBE 2BTCE 4BTUB 2ZFPH 1S81A 2ODYB 4RSPA 1FY3A 3F9EA 1AE8H 4WVPE 4OS6A 3N7OA 1E37B 4ZXXH 2W7SA 2BX4A 3C27B 4Y8ZA 5GIBA 2FOCA 2ZEBA 2Y5HA 3FP8E 4JMYA 5JBAS 1GL0E 1GVZA 1MTWA 2JETB 1UVPA 4ZAEA 1EAXA 2BB4A 4YOGA 1EQ9A 1TWXB 1Y3WA 5EODA 2GZ7A 3PMJA 5L2YH 4ZHMU 1TNHA 2P95A 3BTDE 1FQ3A 5A8YA 1D3TB 5EW1H 2FOFA 1UVSH 1HDTH 4IC6A 1SVPA 4B75A 3KIDU 3E16B 1YCPK 2V0BA 1SGCA 1EASA 1NM6A 2J2UA 4K3JA 4MQAA 4GPGA 3FP6E 4K8BA 1GBIA 5C20A 1RJXB 5BRRE 1LPKB 2FI5E 3F9GA 4YM9A 3TK5A 1AO5A 1C1MA 2B7DH 2O9QA 2ZFQH 1FXYA 3P8FA 1EZSC 3RU4D 3SV6A 1Y5UT 2WYJA 3RMMH 2BZAA 1KXEA 3BTQE 1ORFA 2AFQB 2PTCE 3QTVH 3U1IB 3PO1C 4ISOA 4UDWH 1EOJA 3S7HB 7GCHG 2FO9A 1WU1A 2F9VA 2ZO3H 4ZKNU 4I31A 2ZGJA 2F91A 1UCYE 3LGUA 1ZMJA 1KLJH 3KQEA 1NRSH 1BMNH 1YPGH 1C5RA 3A7YA 1DXPA 1Y3VA 3NWUA 1J8AA 1V3XA 4X1QU 1QA0A 2V35A 1UCYK 2Y6TA 4XOJA 1C1NA 4ABIA 3SNEA 1TALA 3PWCA 4NZLA 1RGQA 1RIWB 2DE9A 1MAYA 1QB6A 3LKWA 1UTQA 3JZ2B 2HWLB 1YPEH 2WV5A 4VGCB 1NT1A 2Q6GA 1ZR0A 1O2YA 5A8XA 4ABDA 3UR9A 2ZFFH 5A8ZA 1ARBA 4K69A 2UWOA 1J17T 3RC5A 2FOEA 1YCPM 1ZRKA 2G4TA 2QCYA 2XRCA 1FN8A 1O3LA 1P09A 4Y0YE 2HNTE 3D49H 2FESH 1BBRK 3UFAA 1MBQA 3HK3B 3Q77A 5HM9A 4OGYA 3GY3A 1SGDE 1THSH 1C2JA 1K1PA 3SO3A 4GLYA 3SV7A 1FONA 1L0ZA 1N6XA 2C8WB 3P95A 4X2YA 3A82A 1WBGB 2WUBA 2PW8H 3KNXA 1CA8B 2GGVB 3ZZ7A 3RM2H 3BTKE 3GDUA 2AYWA 3BTFE 2KAIA 3BSQA 1ZSLA 4B71A 2ZECA 2VVVA 1VR1H 4YOJA 3IITA 1B5GH 3HGNA 1WAYB 3Q76A 2A31A 1BMLA 2HLCA 5DP7A 1P02A 3TU7H 1KYNA 2UWPA 2BOKA 2F9UA 2R2MB 1F5LA 3MYWA 5GCHF 3RXHA 1ELCA 1GBJA 1N8OB 3PTBA 3A7VA 1C4U2 4U30A 1O5GH 4ZKOU 2XYAA 2BQ7B 3W95A 3F9HA 5F8ZA 1AZZA 3O8CA 1TPOA 3LJOA 4TY7A 1QJ1B 1O34A 1GMCF 3PROA 4D9RA 1GHWH 1Q3XA 4U2WA 2OTVA 2HPQH 2R3UA 4UEHH 3KCGH 2FS8A 1C1UH 3SUEA 1KXCA 1ETTH 4ABEA 2WINI 5JBCS 2TGAA 4GHQA 4NIWA 1O2NA 2SGFE 2WPKS 4HFPB 1BJUA 2FDAA 3A7XA 4YT6H 1DFPA 1YPMH 2ZI2H 4CH2B 3QGNB 1DUEA 2BDIA 4KTSA 1O3BA 3K2UA 5FCKA 5DPAA 1O39A 4INLA 4JK5A 5DP8A 1QIXB 2VIDA 3PMAB 1IQEA 5DP4A 2LNCA 5T3HA 3RMNH 1OWKA 1GBLA 3GDVA 1G3EA 2UUYA 2G52A 2H5CA 4Y10E 3L33A 3A89A 1C1SA 5FAHA 3GCNA 3RUOA 3PV4A 4DCDA 3BIUH 3GY7A 1J9CH 3TJNA 2AGEX 1TGTA 1T4UH 4IMQA 1YLDA 2GX4A 3CENA 4I8LA 5A2MH 1MD7A 2ILNA 2GCHF 4ZMAH 1KXDA 3PLKA 1WQVH 4JZIA 1K1JA 1RS0A 1VJAU 1GBHA 2OC7A 1P9UA 2SFAA 1KTSB 3PLBA 4AYVB 5L6NH 1FIZA 3P92A 3GY4A 3ZVCA 2BY5X 5HXFA 1C5VA 4UFEH 6GCHF 1YBWA 1Z8JB 3ZZ8A 1DWCH 2G51A 4X8VH 2C93B 4B2BA 1BTHH 2PGQB 4ABBA 2QY0B 1SGQE 3F1SB 1WCZA 3OU0A 5DGJA 1WQSA 3AASA 3A8AA 4OS1A 4Q80A 1ELTA 3T25A 4BAOB 1A0JA 2Z3CA 1O30A 4Y71A 1IQLA 1HBTH 3H5CB 2FODA 3TGKE 5EPNA 1T31A 2ZG0H 5EU8A 2BDAA 2ZPRA 2Y82A 4RKJB 4AX9H 3UNQA 1LKAA 1LQEA 4D9QA 5AVDA 5ESTE 3T62A 1DE7H 3EYDA 1UTNA 2FOHA 2D2DA 2KAIB 1VJ9U 2W3IA 4A7IB 1AKSA 2FMJA 3GISB 1O5CB 5A0CA 2ZGXH 1V2WT 3TJVA 4NWKA 1ZHMA 1ZPZA 2ODPA 1QTFA 2A5IA 2VVCA 4JZ1A 3ZVBA 1TQ7B 2ANWA 5F03A 1O3NA 4ZROA 1K28D 3SU6A 1F7ZA 1BTYA 2Z9GA 7ESTE 3SBKA 3CP7A 3QGJA 2P3UB 1TNGA 1UK3A 2QIQA 2PHBA 2JH6D 2FI3E 1TFXA 2EEKA 4Y8YA 4MPXA 1UTLM 1EZXC 1S85A 1LMWB 4GUXA 3T5FH 1BJVA 1LTOA 1B0FA 4XDEA 5FPSA 2C4FH 3UTUH 2GDEH 1O32A 3AAVA 1J14A 2JETC 2XBXA 5E0GA 4GCHG 2AIQA 4KGAA 3TH4H 1BMAA 3HK6B 4O03A 4LZ4B 1HIAB 1A5GH 1GBTA 5C1XA 1MQ6A 2RG3A 3ZZ3A 1GGDB 1HAPH 1NRPH 3LOXA 2V3HH 8KME2 1MTVA 1ZPCA 4RKOB 1IQNA 3RU4E 3U98H 1SGRE 3IWMA 1ETRH 1SG8B 4KKDA 3RXDA 1LPZB 2R3YA 1UVTH 1ZLRA 2BQ6B 1G30B 1NRQH 2BX3A 1ACBE 3SV2H 4O97A 7GCHF 1P2QA 4K5ZA 4CBNA 4GHTA 5C3NA 4I8KA 1G2MA 2G5VA 3Q3XA 1JBUH 2I6SA 1QR3E 2A4RA 1UHBA 2QAAA 2J94A 1RRKA 4ZXYH 1A3EH 4IN2A 1UO6A 2BOHB 1HV7A 3M7TA 2A2XH 4TPIZ 4ABJA 2VVUA 1SGEE 4NA8A 1O2IA 5L30H 5JPMH 5L2ZH 1TRYA 3TK6A 2YNBA 1A4WH 3CS7A 1C5LH 5IYTA 1CSOE 2CXVA 3DD2H 1D6RA 4FUDA 4LZ1H 5DKMA 1UMAH 3ATMA 3K9XB 3RXJA 4YESB 3RXGA 3ZZAA 1DLKB 2ZHFH 2A4GA 1TBZH 1AUTC 1THPB 2WPJS 4DIHH 2GCTB 6LPRA 1BUIA 4HGCA 1NPMA 4AGJA 1C5NH 3QX5H 1O2JA 1S84A 1QBOA 4O3UA 3RXRA 1VITH 1CT4E 1BHXF 3KQDA 4NCYA 1TGCA 1YPHE 1O38A 3NK8A 1GJ7B 2Z3EA 1SL3A 4VGCC 3M7UA 5J4SA 1GBCA 2THFB 2VGCB 2BY7X 3MU8A 1WUNH 2OP9A 1XM1A 1C2IA 1O3KA 3RXOA 3P8OA 1MCVA 3QDZB 2CMYA 3A83A 4XBBA 5TJXA 1O2WA 1V2NT 2FEQH 2NU3E 3AVZA