1TRMA

The three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title The three-dimensional structure of Asn102 mutant of trypsin: role of Asp102 in serine protease catalysis.
pubmed rcsb
source organism Rattus rattus
molecule tags Hydrolase (serine proteinase)
total genus 50
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1987-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trmA02
4FU7A 1BZXE 1TGCA 2QF3A 4TWWA 1VITF 2VIQA 1P12E 2P8OC 4MVNA 1KSNA 1JXPA 1GBDA 5BPEA 3MH5A 1ABJH 4CRBA 1G3CA 4ABBA 4O3UA 3IITA 4DY7B 3M3TA 4CRFA 1GVKB 1IQJA 3RC4A 1OS8A 4BAOB 4BOHA 4BTIB 3UNQA 2Z9IA 3RXTA 1FY4A 1SHYA 1T8LA 5HM9A 1WOFA 1HDTH 1FAKH 3PWBA 1XVMA 3LPRA 4YOIA 1GMCG 1O36A 2BVRH 4XBDA 2ZDMA 1UO6A 2ZGXH 3FAOA 5DP9A 2F9BH 3I29A 4JK5A 1O5DH 4B2CA 3S0NA 1MD8A 1TYNA 2P3FH 4D76A 2ALVA 3K9XB 1PPBH 4JYUH 1SHHB 1CT4E 3DUXH 2BDHA 2FTMA 1CBWB 4UFEH 1SLVB 1QIXB 1LDTT 4FUCA 1J14A 1O2GH 2FOEA 3BEIB 4ASHA 1ELCA 1VCWA 3T28A 1BTPA 3PB1E 3KGPA 1GHWH 1B7XB 2ZHDA 1W10U 1YKTA 1ACBE 1Y59T 1C5OH 1O2LA 3TH3H 1YGCH 1NFXA 1V2WT 3LIWA 1C1RA 2UWLA 2H5CA 3SORA 2ZDAH 4GHQA 4XBCA 1SGCA 1SG8B 2OQUA 2BTCE 3GY4A 5GWZA 1M9UA 5L2YH 4WH6A 2Z3CA 1P10A 4IS5A 2GV6A 2I6QA 4DG4A 1TPPA 2C8WB 3ZZ9A 2BLOA 4BNRA 3MH6A 3A80A 1IQLA 2ASUB 4ZHLU 2PSXA 1TPAE 4B2AA 5T6DA 3BN9A 1LHGH 1D6WA 4AFQA 4E05H 3CS7A 1HAXB 2Y5FA 1HAZB 1ZSLA 4X6NA 4BTTB 1A0JA 1SGQE 1XXDA 4IC6A 3TVJB 2ZCKP 2ZU3A 4ZHMU 3NUMA 2GT8A 1P06A 1OWDA 5C2ZA 2BVXH 5EXNA 1ELTA 1UTOA 2BD9A 1DX5M 2OP9A 1JOUB 2R3YA 2G81E 3STJA 3MNCA 1TX7A 5GXPA 1HJ8A 2PWXA 2H5DA 4GVUA 2A32A 1MAXA 3ATMA 3A85A 3FANA 1LKBA 5JPMH 1IQMA 3SJKA 4XSKU 1ZLRA 2JETC 9ESTA 4K69A 1J17T 2OUAA 1AE8H 1SQOA 4CH8B 1EUFA 1MD7A 3OSYA 3WY8A 1SGPE 1GI9B 3VFEA 2UWPA 5DP5A 3ZZ7A 1AFQB 1LMWB 1GL0E 1QB6A 3BTWE 1JMOH 3SQHE 5DK1A 2BQWB 3RXKA 1CHGA 1P3EA 1KDQB 1LVMA 1N8OB 4X0WU 3Q3XA 4ESTE 2VIDA 5FAHA 1HLTH 1WTGH 3RLWH 1TONA 1F0TA 3VB7A 2ZTZA 5GJ4B 6CHAB 2GCTC 1O37A 2EC9H 1NZQH 3RP2A 5FPYA 1YPGH 3BEUA 1TGNA 2XTTB 5A0BA 2Q6DA 1WBGB 1MAYA 5FCKA 1WYKA 3T5FH 4F49A 4DIIH 3SOSA 1C4Y2 5EGMA 4DGJA 3SNBA 1AWFH 2VVCA 1GG6C 2PFEA 3V3MA 3ZV8A 3P92A 3SN8A 1GI6A 1O2OA 4D7GA 3MU1A 4B71A 1EJNA 2ESTE 1F5KU 3UQVA 1P03A 2R9PA 2ZC9H 1EPTB 1FY3A 1BHXF 4HI3A 1GMHF 1V2QT 3TGIE 2R3UA 5AFZH 1YPJH 4LZ1H 1HAPH 1NFYA 2JKHA 1HB0B 1F0SA 3F6UH 1A61H 1O2RA 3O8CA 5IDKA 1G3DA 1O3HA 4Q7ZA 4O3TA 4Y11E 1O3MA 3GOVB 1KTTB 1GHAF 6ESTA 3VGCB 3SUFA 1MQ5A 2CV3A 3MU0A 1SGFG 2A31A 3BTKE 1EJMA 1DFPA 2QIQA 2A2XH 4ABAA 1ZMJA 2H9EH 3A86A 1SQTA 3BG4B 3QX5H 4I7YH 5J4SA 4MG3A 2ZEBA 1CHOF 1HGTH 1WQSA 1GWAA 5DPAA 2AIQA 1ELVA 1W2KH 3N7OA 4TY7A 1ELGA 3LONA 3OY5U 3SHAH 3CENA 1MUEB 2YNAA 4WMFA 1GHXH 1DPOA 5EPYA 3AASA 1YPHC 2UUYA 1QTFA 3NZIA 4DVAU 1J9CH 3KF2A 1Z8RA 2Y5HA 4E7RG 1OWEA 2ODYB 1G37A 2STBE 2TIOA 1NU9A 1QRWA 2R2MB 1CBWC 2OQ5A 3PLKA 1GBAA 2NU2E 1XXFA 3RXSA 1H9HE 3T25A 1ZOMA 1GBBA 2ZQ2A 1NY22 1S84A 2PTNA 4IN2A 4NSYA 1RD3B 4X8TH 1UVOA 1O5AB 1W14U 1AN1E 3U9AH 1O2TA 2DE9A 4JZFH 1TMUH 1V3XA 1QFKH 1OSSA 4OS7A 3T2NA 3MYWA 3C27B 1GBFA 2FI3E 1VITG 2HALA 4B74A 1SPJA 2HLCA 4ZKRU 3MFJA 1PYTC 1MKXH 3SV2H 1MKWK 2UUJB 4HTCH 1GI7B 1A3BH 5T6FA 5JBTA 2PHBA 2OC0A 2V6NA 3GCHB 1O3FA 2Z9LA 1NC6A 4K60A 1OKXA 1FJSA 2ZNKH 2DUCA 1BMMH 1D3PB 1P02A 3RXOA 3DFLA 1ZJKA 1VCQA 2CF8H 1O2KA 1P2MA 4JMYA 3SU5A 2BD2A 1TALA 1MBQA 3LGYA 1O5FH 4KTUA 1C5MD 1E0FD 2J4IA 3LGVA 4CR5A 4MPUA 3V7TA 4AYVB 1QBVH 1BMLA 1GDQA 1G3EA 3UR6A 2BLVA 3SGAE 1C1VH 3GCNA 3MH7A 5EU8A 1TOCB 1O2ZA 1F5LA 1ETSH 1C1MA 2QXJA 2HNTC 3RXQA 1K1JA 1HAOH 1C5XB 2PR3A 1UTPA 2ZP0H 4JYTA 4A5TS 1K22H 1AFQC 2A4OA 5DP6A 2AMQA 1C2MA 3A7XA 4X1QU 1RXPA 2BD3A 3MWIU 4ZUHA 3QTVH 3VXFH 2ALPA 1CGHA 4NWLA 3GY7A 2Y6TA 1O3IA 5E8EH 4CHAB 2XC0A 1N8OC 3BIVH 5AF9H 2XCFA 1ZHMA 3QK1A 4ZXYH 2GVFA 4HGCA 1MTWA 1MZDA 1D4PB 2QF0A 4RKOB 6CHAC 2ZHWH 4JK6A 1IHSH 2V0BA 3ENSB 3BG8A 3V12A 4X2XA 2WYJA 4AORA 3SJIA 1OYTH 4CRAA 1QL7A 1FDPA 1LVOA 1ANBA 1BBRH 1PQ7A 2A7HA 2B0FA 3TK9A 1D3TB 4X1SU 1KIGH 4J1YA 2H1UA 2A2QH 1CT2E 2G51A 2Z9KA 1SOZA 2D8WA 1GJ4H 1G9IE 2C90B 1UVPA 4GPGA 3TK5A 4U2WA 1EPTC 5K0HA 1O2MA 1O2NA 3F9EA 2J95A 1Z6EA 1EKBB 1GBHA 1BUIA 2QXGA 1ZRKA 2VWNA 5EQQA 3O8RA 8LPRA 4ABJA 1BJVA 1QGFA 3T27A 2PKAB 2I6SA 4CH2B 2TPIZ 2O8UA 3KQCA 1GBLA 2BOKA 1TRYA 1PQ8A 2G4UA 1HNEE 3VGCC 2G4TA 2O8LA 1SVPA 1CVWH 2C93B 1XUFA 1HYLA 1HUTH 1O2QA 1S82A 2FXRA 1OP0A 2Y80A 2AIPA 1IOEA 1K2I1 2HNTF 1QR3E 1PQ5A 3BG4C 3GDVA 2AGIX 2BX4A 1FY5A 3SV8A 2A5AA 1VITH 1AFEH 8KME2 3QN7A 4R0IA 2BX3A 2FMJA 3AW0A 3RXFA 4ABGA 5F8TA 3SNEA 4ZXXH 2BY7X 4BAQB 3VEQB 1KY9A 2VWLA 2SFAA 5ABWA 1BRBE 1S81A 2D26C 1BHXB 4XE4A 3NCLA 2ZECA 4Y0ZE 1UHBB 1UCYE 3VPKA 3PWCA 5C3NA 2R0LA 2ZF0H 3PMHB 2P94A 2KAIA 3AAUA 3PTBA 2XWAA 1WV7H 2P59A 4ISIH 2FTLE 1T32A 4SGBE 1FY1A 5IYTA 4Q7XA 2BVSH 3OY6U 1L4DA 1QL8A 3ZV9A 2AMPA 3F9HA 3E16B 4AOQA 1GMHG 3RXAA 3UREA 2J92A 5C1XA 1SQAA 1WSSH 4Y6DA 2QCYA 1P09A 1XM1A 1H1BA 1THPB 4K1TA 3SUEA 3KQDA 3U8OH 1N1LA 4NWKA 1GHAG 3MO6A 1ETRH 1W0ZU 2PGQB 3U8TH 4AN7A 2FWWA 1ESTA 2G8TA 4RKJB 1O3OA 2Z94A 1C2JA 2FOBA 2V35A 4NIYA 1CHOG 3ZZ4A 1IQIA 1DM4B 4DW2U 1P2NA 3PLBA 2GGVB 1GBKA 3QZQA 1A0LA 2PLXA 3Q3KA 3ZZ5A 2A4GA 1TGTA 1CA8B 1SLWB 2D2DA 4XDEA 3SI4H 4MNWA 1EZQA 5C5NA 2EI6A 3RU4D 2VWOA 5CHAB 3HGPA 1C1PA 3SJ9A 2Z3EA 4CBOA 1QB9A 1O3CA 1HJ9A 2BDCA 3P8FA 1IQHA 2GZ8A 1B0FA 6GCHF 3E6PH 1CGIE 3UWIA 2NU0E 2BLQA 1FPHH 1NS3A 1KXEA 1UTJA 3PROA 1C5NH 2GP9B 2XWBI 1GJ5H 2FI5E 5G4BA 4XOJA 4Y79A 3KHVA 3A8BA 3GISB 2XXLA 8ESTE 1SGYE 5DG6A 1QY6A 1XUHA 2SGFE 1V2JT 1LPGB 3P6ZB 5HXFA 2YNBA 1AVXA 1TAWA 2QGRA 3BIUH 4CHAC 3ESTA 3JZ1B 3RXDA 1C2IA 1DLKB 2VIOA 3T26A 2BB4A 4D9QA 4K2YA 1BJUA 1S83A 1OYQA 2ZWLH 3A7TA 2UUKB 1GBIA 1ELDE 2FX4A 3FVFB 3QUMP 1GI4A 1TMBH 2G00A 3B9FH 3DA9B 1YYY1 4GLYA 3UY9A 4O97A 2RDLA 1ABIH 2TGAA 1TPSA 1A7SA 5EPNA 4GAWA 2BD5A 1NTPA 5L2ZH 4RN6A 1KXCA 1Q3XA 1P9SA 2WV5A 1V2OT 2ANMH 3KN2A 3H7OA 1CO7E 1MCVA 1C1UH 1H8DH 2HRVA 4INKA 3UNRA 4BAKB 1G2LA 5DP7A 2VVVA 3H5CB 4O03A 3OYPA 5GIBA 3SU1A 4BXSA 3SV9A 1Y5UT 3ZVFA 7GCHF 1EB2A 2CMYA 3SU2A 1L2EA 4NA9H 4TYDA 1HIAA 3ODFA 1DOJA 3BTTE 1UTLM 2J9NA 1DWBH 3ZZ8A 1UK3A 2XC4A 3RXIA 3NXPA 1QQ4A 2FPZA 3MU5A 1ARBA 4IN1A 5JB8S 1SGIB 2FYQA 1FLEE 3S69A 3EDXB 1A5HA 2A4RA 1TX6A 1Z7KA 2FIRH 1O3GA 2BOHB 2A0QB 1C9PA 3DT0H 1C5LH 1N6XA 2G5NA 1WU1A 2ZFPH 1C2HA 1ZZZA 2ULLA 3RXLA 4K8YA 4CRGA 1QBNA 2GMTB 1H4WA 5LPEA 1EAUA 2BD4A 1Y3UA 3VB6A 2TRMA 1RTLA 1A2CH 5C67A 4YOGA 1O30A 1HV7A 3P70B 3MU8A 1UVTH 3SV7A 1AZ8A 1EX3A 1FN8A 4WXIA 1XKBC 3KIDU 2HGTH 3RXPA 1C2EA 2A5KA 1DITH 4ISNA 1C5SA 2FOMB 3SO3A 4A92A 4KTSA 1H9LB 1BMAA 5JBBS 1QRZA 1ZHPA 3P8OA 3SZNA 1C2GA 1KXDA 3E1XB 3E8LA 3GY8A 4MNXA 2F9VA 1TPOA 2QY0B 3ZZAA 4X6MA 1FIZA 1O32A 5GCHF 3UNSA 4ABHA 1ZSJA 1GBMA 3RXRA 1CA0B 1MQ6A 1P01A 2FOCA 3TPIZ 1V2KT 2XBYA 2JH5D 4UFDH 3TLOA 2R0KA 1DDJA 1MBMA 2EEKA 1ELAA 2ZIQH 2BDAA 2FODA 2BM2A 2CF9H 1AHTH 1S5SA 2H9HA 1A5GH 4UD9H 3EQ0H 2OC8A 1AUTC 1O2YA 3IG6B 1Z1JA 3A82A 2QYIA 3SU4A 1VR1H 2HOBA 3KL6A 1FAXA 3LDXH 5EOKA 2Y7ZA 4VGCB 3DD2H 5LPFA 2A7CA 3UFAA 1KTSB 1ETTH 4NZQA 1T7CA 1AI8H 1TA6A 1FPCH 1JBUH 2BZ6H 3LGTA 4JZ1A 1NFWA 2C8YB 3D65E 3ZVEA 4AG2A 2C8XB 5CHAC 1OP2A 1DY8A 1THSH 4UFFH 1TBZH 5HYOA 1SGNE 2H6MA 1Y3XA 1O5CB 4FXGH 1ESAA 1GBJA 1ZR0A 5DO4H 1EOLA 2FI4E 4Q7YA 1GJ7B 3U1JB 3O8BA 2B5TB 1UCYK 3VB4A 1DICA 3VB3A 1CQQA 2ZO3H 3VXEH 4ABFA 3M5LA 2A5IA 2ZFQH 2GCHF 4UFGH 3EYDA 1LKAA 4OS4A 1EASA 1UTMA 1GCTB 2BXUH 2QN5T 4TPYA 1JIRA 4H6SB 1YPHE 1SOTA 4B75A 1GI1A 5JB9S 1GCDA 1SFIA 2V3HH 2ZGCA 5AVDA 3VB5A 2ODPA 3GY3A 4BTUB 3RU4E 1D3DB 3ATWA 2Q1JA 3SU6A 1O3BA 4NA8A 3PYHA 3U1IB 4B73A 5L30H 1NRQH 1MTSA 2BD8A 4GUXA 2AYWA 1O3LA 5B6OA 1EAXA 3SV6A 1AO5A 4FUFA 2AERH 4MPWA 3M5OA 4X2YA 2TGPZ 3DFJA 1UK2A 1GHBF 1SGFA 1O5BB 3P8GA 1HAVA 4E7NA 1DWEH 5LPRA 1C5QA 1NT1A 4A6LA 2OBOA 2NU3E 5C1YA 4ZROA 4WXVA 4HFPB 4YLQH 1A3EH 2DE8A 3OU0A 4YT7H 2OCVB 4ISHH 3TU7H 3PTNA 3LGIA 1MU8B 2Y82A 1FN6A 6GCHG 8GCHF 3F9GA 3SGQE 1SMFE 1C2FA 1TBRH 3S9AA 5FBEA 5CE1A 3SGBE 2GDEH 1O2IA 3A7VA 3M37A 1QQUA 4WH8A 2A1DB 5JDUB 1EZUC 1FXYA 3SNCA 3FP8E 5A8YA 3E90B 3Q3YA 4U01A 2PTCE 4OS6A 1F92A 4U32A 3AW1A 3K6YA 1RS0A 3F1SB 2BY8X 1F2SE 2BY9X 2G5VA 2SGEE 2VIVA 3LGWA 2Q6GA 2C8ZB 1YCPK 2IPHA 1MZAA 4YLUA 2SGPE 1EB1H 1Y8TA 2GMTC 4CREA 1DUEA 1V2PT 3MNBA 3TITA 2WPHS 1G36A 2J2UA 3QO6A 5I46H 5FPSA 1ZPBA 3PV4A 4MPVA 3SHCH 4CRDA 3F68H 4FUJA 1O34A 2CN0H 3PM3A 3NWUA 3MO9A 4AFUA 1FMGA 5DGJA 1V2MT 4LXBH 4ISOA 2GD4B 1AMHA 1DS2E 1ORFA 1VJAU 4NIWA 3RXMA 4H4FA 1TQ0B 1A46H 3RMOH 1WUNH 3RXJA 4ZKOU 1IQKA 3RMLH 1HRTH 1T31A 3EA7A 1CA0C 1PPHE 2W3KA 2AMDA 7GCHG 4OGXA 2THFB 2GKVE 3RMMH 1TRMA 3E91A 3TJUA 1AQ7A 5EODA 2W7SA 2PKSB 1C5WB 3GYLB 3ATIA 3MOCA 1E34B 1O2XA 5JYIA 1C1SA 1TQ7B 3B23B 1YPLH 4NFEA 1HXEH 1BTUA 5EG4A 1SBWA 4AGJA 1N6YA 4YZUA 1SGDE 3FFGA 2BYAX 4B1TA 1RTKA 6LPRA 1MMJN 2ANWA 2OXSA 1TGBA 4DT7B 3RC5A 3TJNA 3TH2H 4LOYH 1HBTH 5GDSH 4VGCC 2FYRA 1GHZA 2TBSA 3KNXA 1W12U 2BHGA 1TIOA 2O9QA 1LHFH 3HKJB 3QDZB 5ESTE 2O8MA 1BBRE 4GHTA 1FQ3A 3GDSA 4MLFB 4AB8A 1K28D 3EAJA 1GHVH 1SB1H 2VIPA 4WMEA 5HMAA 5FPTA 4FU9A 3CP7A 1V2LT 3GY5A 2W26A 1BRCE 1A1RA 4YOJA 2O8WA 3ODDA 4SGAE 2W5EA 2XCNA 3G01A 4ISLA 3Q76A 3S9BA 2FDAA 4AZ2B 4X1PU 2QV1A 4Y7BA 5GCHG 1P04A 5TCCA 4WVPE 1CSOE 2B7DH 3RXVA 1P05A 1TMTH 1XUKA 1NO9H 2H9TH 2FS9A 4Y8ZA 2WPIS 1TBQH 2ZKSA 2XYAA 1PPGE 4FVDA 2CHAB 1GCTC 1O3EA 2GZ7A 2OC1A 5T3HA 3URCA 1DWDH 4I33A 1DANH 1LO6A 1GPZA 4DOQA 2NU4E 3STIA 1AUJA 2ZDNA 1INCA 4CR9A 3ZVAA 1K1IA 5EW2H 1AKSA 1ZRBA 1QB1A 2VVUA 1HPGA 1V2VT 2ZTXA 3Q00A 4XFQA 4Y71A 1HXFH 2IOTA 1E37B 1QNJA 1V6DA 1YP9A 1YPKH 2AS9A 2XBWA 1C5VA 3R0FA 1DLEA 4GSOA 1TE0A 3ELAH 4X2VA 2VWMA 1ZTKA 2RG3A 4MNYA 1GGDB 1G32B 5FXLA 2KAIB 3RU4T 1IHTH 3FZDA 2F91A 3AAVA 4IGDA 1A0HB 5JBCS 1AU8A 1DVAH 5AHGH 1SSXA 1OOKB 2BDGA 4CRCA 1BTWA 2FOHA 3M3SA 1JWTA 4K1SA 1RFNA 1TNLA 1KLIH 5C20A 2QA9E 3BTEE 3UTUH 1BRUP 1AVGH 1F5RA 4X1RU 1HAHH 2FESH 2FLRH 1NPMA 1W7XH 4X8UH 4A7IB 1SGTA 1QRXA 1T8MA 3MU4A 1IQNA 1LQEA 1BTZA 2GCHG 5TJXA 1AVWA 3K65B 4YESB 4F4OC 3TGKE 5K7RA 2PUXB 2QXIA 3MHWU 4I31A 1BTXA 1QA0A 5EXMA 2P3UB 3HGNA 1UK4A 3GYMA 3MH4A 2ZI2H 4OS2A 3M5NA 4THNH 4BXWA 4KP0A 2CJIA 4UE7H 2Y5GA 4NSVA 2XRCA 2A45B 1GI0A 3M35A 1SLUB 4JCNA 1KLJH 1Z8GA 2AEIH 1UVUH 4WF8A 3LOXA 4DCDA 4RSPA 1HJAB 2O8TA 3SNAA 1FONA 1O39A 1ZHRA 1SLXB 1PQAA 4FUGA 1P57B 5H4IB 3GCHC 2G52A 4IBLH 3ATKA 1OP8A 1NRSH 1FNIA 3DHKH 1O3PB 2C4FH 1QJ7B 4MPXA 1LQDB 2VINA 2JH0D 4WWYA 3CS0A 1C5RA 1EATA 1GHBG 1LVBA 1LVYA 3OX7U 5DKMA 2XBXA 3LJJA 2GZ9A 1QA7A 4MDSA 4Y8XA 3ZVGA 2XBVA 1UTNA 1DXWA 2AH4X 3SJOA 2BD7A 3A81A 1K21H 1ZGVA 1S0QA 3A83A 5F6MA 4JYVH 2BQ7B 1KLTA 1XUJA 1YF4A 3A8AA 1P11E 4AFSA 1ANCA 5EXLA 1DWCH 1MTNB 8GCHG 1SGRE 2W3IA 2ZPQA 2VGCB 5EW1H 5EQRA 2PKSC 1GMDF 3P8NA 2EA3A 1BTYA 1A4WH 2SNVA 1G30B 1PPFE 4NGAH 3SNDA 3W94A 1QL9A 1PYTD 5A0CA 2BDYA 1IQFA 4FUEA 3ZYDA 1Z8JB 3RM0H 4I32A 3E0NB 3HK6B 4IC5A 4YT6H 1GI8B 2ZGHA 2ZCLP 1GL1A 1TLDA 4MQAA 3EE0B 3ZZ6A 1SR5C 2OINA 1B5GH 1ZGIA 3RXBA 5DP8A 1MKXK 1EXFA 4Y76A 3SI3H 1Z6JH 4ZAEA 1GBCA 3S9CA 2PSYA 1GHYH 1MKWH 4Y0YE 1P2KA 1GI3A 1D9IA 3LKWA 2F9OA 4CBNA 1TNIA 2AFQB 1HIAB 3UWJH 4Y7AA 1BIOA 1NESE 3BTHE 3BSQA 3I78A 1BTHH 3QWCH 4ZKNU 4A1TA 3TGJE 2ILNA 2OLGA 4HZHA 4JZIA 4I8GA 1LPKB 2PUQH 1KXBA 5FCRA 2CHAC 1DE7H 1JIMA 1LHDH 4MNVA 1O38A 2Y81A 3A88A 1HAGE 3M7QA 4Y10E 1ANEA 1ELEE 1QJ1B 4E06H 1HAYB 2HVXA 2RA3A 3LT3A 3O8DA 4GCHF 4ZHAA 1Y3YA 3SJ8A 4ZMAH 3EA9A 2VB0A 1P0SH 4ABEA 1ZSKA 1RTFB 1H8IH 4FUDA 3F9FA 1Z1IA 3BTFE 3BV9B 3KCGH 1ZYOA 2NU1E 2RCEA 2GT7A 3T62A 1PPCE 2WV4A 4H6TA 1GGDC 1O35A 5ETXA 1UTQA 1JRSA 3RM2H 1O31A 3D23A 1Q31A 2AGEX 1DSTA 5F03A 3ITIA 1AWHB 5DP4A 3TJOA 1K1PA 2P95A 2SGAA 2VNTA 3JZ2B 3S7KB 1GVZA 4Q2KA 2SGDE 1F0UA 1ZPCA 3A7ZA 2ZDLA 4ZKSU 3M7UA 2J38A 1BBRK 1O2UA 2XW9A 1C1TA 1O2VA 2WUBA 1Q2WA 2F83A 2UUFB 3NPSA 1GDUA 3PMJA 1L4ZA 1V2RT 4NIVA 1GBTA 2A7JA 2J34A 1NRRH 1ZTLA 4INLA 3ZVCA 3M61U 3M5MA 1O2PA 1CGJE 2CGAA 1DXPA 3FP7E 1BRAA 4IMQA 4IMZA 1EZXC 3D62A 3Q77A 1UMAH 2AGGX 1FZZA 1OPHB 3MTYA 5FX6A 2FS8A 1EAIA 1W3CA 1Z8IB 5I25A 5J4QA 1AY6H 2OTVA 3A84A 4X6PA 1IQGA 1V2UT 4I8HA 1HJAC 2HWLB 1GDNA 1QCPA 1K1NA 3RXUA 4BAMB 1AD8H 1C5TA 2WINI 1B0EA 1MU6B 1P2QA 1GJ8B 2BZAA 2Z9JA 1P2JA 3SUDA 3E3TA 1LHEH 1S85A 1XX9A 4AYYB 1Y5AT 3KQEA 2ZZUH 2FO9A 2GTBA 3MNSA 3RMNH 3TH4H 3ZVBA 2VH6A 2ZFFH 1AGJA 2BMGB 1KXFA 3M36A 2G55A 4NIXA 4R8TB 1HAIH 2W7UA 1UTKA 2UWOA 3A7YA 2IN2A 2WPLS 1TOMH 5DP3A 1GI2A 1YM0A 5E0JA 5LGOA 1JRTA 4K1EA 2ZHEH 2ZU2A 3TNTA 4NG9H 1VGCB 1QBOA 1MTNC 3QGJA 2VGCC 2C3SA 2ZFTA 1P9UA 1W13U 3GY6A 1KDQA 4I8KA 2NWNA 2ZU1A 4K3JA 1EZSC 1TRNA 3QGNB 2BQ6B 1C1WH 5C1UA 5F8XA 3GCTF 1SGEE 1RIWB 3BTDE 4JZDH 2Z3DA 1VJ9U 4FUIA 1W8BH 1ESBA 1P2IA 3NKKA 1EP6A 3PMBB 2EI7A 3UPEA 1HAVB 1LTOA 7KMEH 3ZZ3A 1GJDB 1DT2A 4OGYA 2ANKH 2F9UA 3SU0A 1O33A 4XBBA 1IAUA 2ZHQH 1C2LA 5FX5A 1BITA 1K9OE 1C5PA 3M7TA 1AB9B 3SW2B 3V13A 4BAHB 1DSUA 3TK6A 4YM9A 2ZU4A 1EPTA 5AFYH 5C5OA 3UOUA 2WPMS 1AZZA 1C4U2 2ZFSA 1O5GH 1TB6H 2EI8A 2BY6X 1AE5A 1YLDA 3RXHA 1YC0A 4X1NU 1O3DA 1IQEA 2P3TB 4AGKA 3UR9A 2GV7A 1EOJA 1V2TT 5FHTA 1GJBB 4TY6A 2ZQ1A 5T6GA 3SUGA 3A8DA 4PROA 4AB9A 1TNGA 4KGAA 2HPQH 2ZFRH 1T8OA 1S6FA 1XVOA 4FUBA 5E2OA 1GMDG 3URDA 2V3OH 1GJCB 3UOPA 1ARCA 3MMGA 1MTVA 2FOFA 3KEEA 1K1MA 1E35B 4TPIZ 1FY8E 4X2WA 4A1VA 1TNHA 4NFFA 4I8LA 3ZZDA 7LPRA 2FM2A 2WPJS 1MH0A 1Z71A 4J2YB 3C1KA 3S7HB 2ZGBH 4YO9A 4NA7A 4WJG2 4OS5A 1C2KA 2BDBA 3LU9B 1BMNH 3MI4A 2F3CE 1T8NA 1BA8B 1C1OA 1BDAA 2HNTE 3HK3B 4LK4A 1O2WA 1RJXB 5E0GA 1FV9A 3PLPA 1GVLA 1KXAA 2SNWA 1NU7B 1UJ1A 1X7AC 3UUZA 3FP6E 4TWYA 4I8JA 5SGAE 4UONA 2STAE 1QHRB 4X6OA 2BLWA 3P95A 1O0DH 1C1NA 3EGKH 5A0AE 2PGBB 3NK8A 2OBQA 1D6RA 3LC5A 4Y8YA 3BTME 4AFZA 1J8AA 1L1GA 2VJ1A 3QZRA 1H9IE 1O5EH 3A7WA 1WQVH 5HM2A 1XMNB 1GMCF 3PO1B 4FUHA 1UVSH 2A4QA 3ZYEA 1VCPA 5HGGA 1GJ6A 1V2NT 1C5UA 2K1QA 1AIXH 1PPZA 1TA2A 4D9RA 4UEHH 4GCHG 1QJ6B 3FZZA 1CT0E 1ID5H 1CU1A 1PFXC 3E0PB 5A2MH 2BXTH 2JH6D 3K6ZA 1OX1A 2VU8E 3GICB 1Y5BT 1RRKA 2HPPH 2ZHFH 1EAWA 1HCGA 4Z6AH 3L33A 5A8XA 1SC8U 1Y3VA 1P8VC 1ANDA 3M3VA 4WY3A 1BB0B 4A1XA 3LJOA 1J15A 1D3QB 2TGTA 2F9NA 3BTQE 1O2JA 4U30A 5E2PA 1V2ST 2CXVA 3BEFB 3GCOA 1K1LA 5TCAA 3ATLA 2P8OB 1YPEH 1FUJA 2LPRA 4K8BA 3V0XA 5LH8A 1THRH 5E0HA 4X8VH 1VGCC 1XUGA 2FX6A 1A5IA 1OXGA 3KQBA 4X8SH 1BOQA 2B9LA 1GI5A 1SL3A 1P3CA 3IWMA 3RUOA 2ZDKA 3RXGA 1MTUA 1OWJA 1GJAB 4MTBA 1AKSB 1NM6A 1PPEE 2Z7FE 3TJVA 1PJPA 2RA0A 3K2UA 1XKAC 4UDWH 2FLBH 1RIWC 9LPRA 1L1JA 2F9PA 3UIRA 1GBEA 3HPTB 4D7FA 1OWIA 3BTGE 1C9TA 5FBIA 2XNIA 3SU3A 3LC3A 3BF6H 4KKDA 1TX8A 2ODQA 2OC7A 1OWKA 2FOGA 1S0RA 1G3BA 1C5ZB 1C2DA 1YLCA 1RGQA 2FEQH 3H7TA 1WAYB 1SFQB 2ZPSA 1F7ZA 4B2BA 1G2MA 4AG1A 1W11U 3ZZBA 3LH1A 3P17H 3RDZA 1AB9C 2IJOB 3B8JA 4Z0KA 2QXHA 4KTCA 1J16A 3A8CA 4IW4E 1L1NA 2WUCA 4FVBA 4DJZB 1TWXB 2ZCHP 2QAAA 2R2WU 3LGUA 1QURH 1T4UH 1C5YB 2FP7B 2LNCA 2PKAA 1O2SA 4M7GA 4D8NA 1F0RA 2XC5A 1NFUA 1WTHD 3GDUA 3TNSA 1L0ZA 2H2ZA 2ZG0H 1LHCH 1WCZA 4LZ4B 1TABE 2B8OH 4B76A 1W0YH 1TFXA 3RXCA 3A89A 1VZQH 1LPZB 1C4V2 1LCYA 1DUAA 1FIWA 3RXEA 3W95A 2P16A 5JBAS 1NRNH 4NCYA 1K1OA 1MCTA 3TIUA 4H42U 1NRPH 1XUIA 3L6PA 1BT7A 1Y3WA 1UCYH 2ZU5A 3A87A 3GCTG 1EJAA 5BRRE 5ESBA 1ELFA 2Q6FA 5PTPA 1OWHA 4QT8C 1ZMLA 1EP5A 1W7GH 4INHA 1SI5H 3I77A 2BY5X 2GDDA 4ABDA 5F8ZA 1S6HA 3RLYH 1UHBA 1TGSZ 1O3NA 2GX4A 1ZPZA 3EA8A 2D1JA 2JETB 1BQYA 2VIWA 2QC2A 4FU8A 1BCUH 5CMXH 1ZMNA 3SBKA 2WYGA 1ZTJA 3R3GB 4WMDA 2BDIA 4BANB 4DURA 2FOAA 1KYNA 3QLPH 1EQ9A 1GJ9B 3ZVDA 1DY9A 2VH0A 3MO3A 3HATH 2PW8H 4K5ZA 3MNXA 2ZA5A 1E36B 1T4VH 4NZLA 1U6QA 1O3KA 3OTJE 1ZJDA 3QTOH 3U69H 1E38B 1TNKA 2GCTB 2Z6BD 1ELBA 2ZDVH 1YBWA 3GY2A 3PO1C 3PMAB 4ZH8A 2J94A 3L3TA 2YOLA 4YTAA 4JZEH 1NROH 5L6NH 3D49H 2ANYA 1O3JA 2OD3B 2TGDA 1TNJA 1CE5A 7ESTE 4OS1A 4ABIA 4DIHH 1YPMH 5EQSA 4AX9H 1GG6B 5A8ZA 2ZTYA 3ZZCA 2ZGJA 4Q80A 2Z9GA 1O2HA 2ZPRA 1P2OA 3U8RH 3SQEE 1O3AA 3T29A 2Y7XA 2P93A 4KELA 5A09A 1HFDA 2PV9B 2FZZA 3HKIB 3U98H 2M5TA 3AVZA 1C1QA 2WPKS 1NN6A 3UQOA 5GPIB 1YCPH 3LH3A 5DJ7A 1FI8A 4O9VA 3RC6A 1YCPM 2SGQE
chains in the Genus database with same CATH superfamily
4FU7A 1BZXE 1TGCA 2QF3A 4TWWA 1VITF 2VIQA 1P12E 2P8OC 4MVNA 1KSNA 5T1VA 1JXPA 1GBDA 5BPEA 3MH5A 1ABJH 4CRBA 1G3CA 4ABBA 4O3UA 3IITA 4DY7B 3M3TA 4CRFA 5FL7D 1GVKB 1IQJA 2EQNA 1OS8A 3RC4A 4BAOB 4BOHA 4BTIB 3UNQA 2Z9IA 3RXTA 1FY4A 1SHYA 1T8LA 5HM9A 1WOFA 1HDTH 1FAKH 3PWBA 1XVMA 3LPRA 4YOIA 1GMCG 1O36A 2BVRH 4XBDA 2ZDMA 1UO6A 2XNDD 2ZGXH 3FAOA 5DP9A 2F9BH 4P02A 3I29A 4JK5A 1O5DH 4B2CA 3S0NA 1MD8A 1TYNA 2P3FH 4D76A 2ALVA 3K9XB 3SYJA 1PPBH 4JYUH 1SHHB 1CT4E 3DUXH 2BDHA 4RT1A 2FTMA 1CBWB 4UFEH 1SLVB 1QIXB 1LDTT 4FUCA 1J14A 1O2GH 2FOEA 3BEIB 3U28C 4ASHA 1ELCA 1VCWA 3T28A 1BTPA 3PB1E 3KGPA 1GHWH 1B7XB 2ZHDA 1W10U 1YKTA 1ACBE 1Y59T 1C5OH 1O2LA 3TH3H 1YGCH 1NFXA 1V2WT 3LIWA 1C1RA 2UWLA 2H5CA 3SORA 2ZDAH 4GHQA 4XBCA 1SGCA 1SG8B 2OQUA 2BTCE 3GY4A 5GWZA 1M9UA 5L2YH 4WH6A 2Z3CA 1P10A 4IS5A 2GV6A 2I6QA 4DG4A 1TPPA 2C8WB 3ZZ9A 2BLOA 4BNRA 3MH6A 3A80A 1IQLA 2QF5A 2ASUB 4ZHLU 2PSXA 1TPAE 4B2AA 5T6DA 3BN9A 1LHGH 1D6WA 4AFQA 4E05H 3CS7A 1HAXB 2Y5FA 1HAZB 1ZSLA 4X6NA 4BTTB 1A0JA 1SGQE 1XXDA 4IC6A 5HIZA 3TVJB 2ZCKP 2ZU3A 4ZHMU 3NUMA 2GT8A 2CK3D 1P06A 1OWDA 5C2ZA 2BVXH 5EXNA 1ELTA 1UTOA 2BD9A 1DX5M 2OP9A 1JOUB 2R3YA 2G81E 3STJA 3MNCA 1TX7A 5GXPA 1HJ8A 2PWXA 2H5DA 4GVUA 2A32A 1MAXA 3ATMA 3A85A 3FANA 1LKBA 5JPMH 1IQMA 3SJKA 4XSKU 1ZLRA 2JETC 9ESTA 4K69A 4RI0A 1J17T 1SQOA 1AE8H 2OUAA 4CH8B 1EUFA 1MD7A 3OSYA 5GNDA 3WY8A 1SGPE 1GI9B 3VFEA 2UWPA 5DP5A 3ZZ7A 1AFQB 1LMWB 5KGOA 1GL0E 1QB6A 3BTWE 1JMOH 3SQHE 5DK1A 2BQWB 3RXKA 1CHGA 1P3EA 1KDQB 1LVMA 1N8OB 4X0WU 3Q3XA 4ESTE 2VIDA 5FAHA 1HLTH 1WTGH 3RLWH 1TONA 1F0TA 3VB7A 5C0UA 5EIYA 2ZTZA 5GJ4B 6CHAB 2GCTC 1O37A 2EC9H 1NZQH 3RP2A 5FPYA 1YPGH 3BEUA 1TGNA 2XTTB 5A0BA 2Q6DA 1WBGB 1MAYA 5FCKA 1WYKA 3T5FH 2WV9A 4F49A 4DIIH 3SOSA 1C4Y2 5EGMA 4DGJA 3SNBA 1AWFH 2VVCA 3W1EA 1GG6C 2PFEA 3V3MA 3ZV8A 3P92A 3SN8A 1GI6A 1O2OA 4D7GA 3WWBA 3MU1A 4B71A 1EJNA 2ESTE 1F5KU 3UQVA 1P03A 2R9PA 3FOAA 2ZC9H 1EPTB 1FY3A 1BHXF 4HI3A 1GMHF 1V2QT 4Q4LA 3TGIE 2R3UA 5AFZH 1YPJH 4LZ1H 1HAPH 1NFYA 2JKHA 4DT4A 1HB0B 3FKSD 1F0SA 3F6UH 1A61H 1KMHB 1O2RA 3O8CA 5IDKA 1G3DA 1O3HA 4Q7ZA 4TSFD 4O3TA 4Y11E 1O3MA 1VKYA 1KTTB 3GOVB 1GHAF 6ESTA 3VGCB 3SUFA 1MQ5A 2CV3A 3MU0A 1SGFG 2A31A 3BTKE 1EJMA 1DFPA 2QIQA 2A2XH 4ABAA 1ZMJA 2H9EH 3A86A 1SQTA 3BG4B 3QX5H 4I7YH 5J4SA 5B6LA 4MG3A 2ZEBA 1CHOF 1HGTH 1WQSA 3UAIC 1GWAA 5DPAA 2AIQA 1ELVA 1W2KH 3N7OA 4TY7A 1ELGA 3LONA 3OY5U 3SHAH 3CENA 1MUEB 2GJGA 3PRBA 2YNAA 4WMFA 1GHXH 1DPOA 5EPYA 3AASA 1YPHC 2UUYA 1QTFA 5KEDA 3NZIA 2HLDD 4DVAU 1J9CH 3KF2A 1Z8RA 2Y5HA 4E7RG 1OWEA 1COWD 2ODYB 1G37A 2STBE 2TIOA 1NU9A 1QRWA 2R2MB 1CBWC 2W6JD 2OQ5A 3PLKA 1GBAA 2NU2E 1XXFA 3RXSA 1H9HE 3T25A 1ZOMA 1GBBA 2ZQ2A 1NY22 3DSOA 1S84A 2PTNA 4IN2A 4NSYA 1RD3B 4X8TH 1UVOA 1O5AB 1W14U 1AN1E 3U9AH 1O2TA 2DE9A 4JZFH 1TMUH 1V3XA 1QFKH 1OSSA 4OS7A 3T2NA 3MYWA 3C27B 1GBFA 2FI3E 1VITG 2HALA 4B74A 1SPJA 2HLCA 4ZKRU 3MFJA 1PYTC 1MKXH 3SV2H 1MKWK 2UUJB 4HTCH 1GI7B 1A3BH 5T6FA 5JBTA 2PHBA 2OC0A 2V6NA 3GCHB 1O3FA 2Z9LA 1NC6A 4K60A 1OKXA 1FJSA 2ZNKH 2DUCA 1BMMH 1D3PB 1P02A 3RXOA 3DFLA 1ZJKA 1VCQA 2CF8H 1O2KA 5IK2D 1P2MA 4JMYA 3SU5A 2BD2A 1TALA 1MBQA 3LGYA 1O5FH 4KTUA 1C5MD 1WXRA 1E0FD 2J4IA 3LGVA 4CR5A 4MPUA 3V7TA 4AYVB 1QBVH 1BMLA 1GDQA 1G3EA 3UR6A 2BLVA 3SGAE 1C1VH 3GCNA 3MH7A 5EU8A 1TOCB 1O2ZA 1F5LA 1ETSH 1C1MA 2QXJA 2HNTC 3RXQA 1K1JA 1HAOH 1C5XB 2PR3A 1UTPA 2ZP0H 4JYTA 4A5TS 1K22H 2KCPA 1AFQC 2A4OA 5DP6A 2AMQA 1C2MA 3A7XA 4X1QU 1RXPA 2BD3A 3MWIU 4ZUHA 3QTVH 3VXFH 2ALPA 1CGHA 4NWLA 3GY7A 2Y6TA 2KM0A 1O3IA 5E8EH 4CHAB 2XC0A 1N8OC 3BIVH 5AF9H 2XCFA 1ZHMA 3QK1A 4ZXYH 2GVFA 4HGCA 1MTWA 1MZDA 1D4PB 2QF0A 4RKOB 6CHAC 2ZHWH 4JK6A 1IHSH 4XD7D 2V0BA 3ENSB 2EY4C 3BG8A 4X2XA 3V12A 1SKYE 2WYJA 4AORA 3SJIA 1OYTH 4CRAA 1QL7A 1FDPA 1LVOA 1ANBA 1BBRH 1PQ7A 2A7HA 2B0FA 3TK9A 1D3TB 4X1SU 1KIGH 4J1YA 2H1UA 2A2QH 1CT2E 5KECA 2G51A 2Z9KA 1SOZA 2D8WA 1GJ4H 1G9IE 2C90B 1UVPA 4GPGA 3F3BA 3TK5A 4U2WA 1EPTC 5K0HA 1O2MA 1O2NA 3F9EA 1W0KD 2J95A 1Z6EA 1EKBB 1GBHA 1BUIA 2QXGA 1ZRKA 2VWNA 5EQQA 3O8RA 8LPRA 4ABJA 1BJVA 1QGFA 3T27A 2PKAB 2I6SA 4CH2B 2TPIZ 2O8UA 3KQCA 1GBLA 2BOKA 1TRYA 1PQ8A 2OK5A 2G4UA 1HNEE 3VGCC 2G4TA 2O8LA 1SVPA 1CVWH 2C93B 1XUFA 1HYLA 1HUTH 2JIZD 1O2QA 1S82A 2FXRA 1OP0A 2Y80A 2AIPA 1NBMD 1IOEA 1K2I1 2HNTF 1QR3E 1PQ5A 3BG4C 3GDVA 2AGIX 2BX4A 1FY5A 3SV8A 2A5AA 1VITH 3FN8A 1AFEH 8KME2 3QN7A 4R0IA 2BX3A 2FMJA 3AW0A 3RXFA 4ABGA 5F8TA 3SNEA 4ZXXH 2BY7X 2WSSD 4BAQB 3VEQB 1KY9A 2VWLA 2SFAA 5ABWA 1BRBE 2M2AA 1S81A 2D26C 1BHXB 4XE4A 3NCLA 2ZECA 4Y0ZE 1UHBB 1UCYE 5DN6D 3VPKA 3PWCA 5C3NA 2R0LA 2ZF0H 3PMHB 2P94A 2KAIA 3AAUA 3PTBA 2XWAA 1WV7H 2P59A 4ISIH 2FTLE 1T32A 4SGBE 1FY1A 5IYTA 4Q7XA 2BVSH 3OY6U 1L4DA 1QL8A 3ZV9A 3DCLA 3OEHD 2AMPA 3F9HA 3E16B 4AOQA 1GMHG 3RXAA 3UREA 2J92A 5C1XA 1SQAA 1WSSH 4Y6DA 2JJ2D 2QCYA 1P09A 1XM1A 1H1BA 1THPB 4K1TA 3SUEA 3KQDA 5C94A 3U8OH 1N1LA 3DSGA 1GHAG 3MO6A 4NWKA 4AC9A 1ETRH 1W0ZU 2PGQB 3U8TH 4AN7A 2RFKC 2FWWA 1ESTA 2G8TA 4RKJB 1O3OA 2Z94A 1C2JA 1SQRA 2FOBA 1MABB 2V35A 4NIYA 3WW7A 3FO8D 1CHOG 3ZZ4A 1IQIA 1DM4B 4DW2U 1P2NA 4B6EA 3PLBA 2GGVB 1GBKA 3QZQA 1A0LA 2PLXA 3Q3KA 3ZZ5A 5HIYA 2A4GA 1TGTA 1CA8B 1SLWB 2D2DA 4XDEA 3SI4H 4MNWA 1EZQA 5C5NA 2JJ1D 2EI6A 3RU4D 2VWOA 5CHAB 3HGPA 1C1PA 1WDIA 3SJ9A 2Z3EA 4CBOA 1QB9A 1O3CA 1HJ9A 2BDCA 3P8FA 1IQHA 2GZ8A 1B0FA 6GCHF 3E6PH 1CGIE 3UWIA 2NU0E 2BLQA 1FPHH 1NS3A 1KXEA 1UTJA 3PROA 1C5NH 2GP9B 2XWBI 1GJ5H 2FI5E 5G4BA 4XOJA 2LP6A 4Y79A 3KHVA 3A8BA 3GISB 2VBCA 2XXLA 8ESTE 1SGYE 5DG6A 1QY6A 1XUHA 2SGFE 1V2JT 1LPGB 3P6ZB 5HXFA 2YNBA 1AVXA 1TAWA 2QGRA 3BIUH 4CHAC 3ESTA 3JZ1B 3RXDA 1C2IA 1DLKB 2VIOA 3T26A 2BB4A 4D9QA 4K2YA 1BJUA 1S83A 1OYQA 2ZWLH 3A7TA 2UUKB 1GBIA 1ELDE 2FX4A 3FVFB 3QUMP 1GI4A 1TMBH 2G00A 3B9FH 3DA9B 1YYY1 4GLYA 3UY9A 4O97A 2RDLA 1ABIH 2TGAA 1TPSA 1A7SA 5EPNA 4GAWA 2BD5A 1NTPA 5L2ZH 4RN6A 1KXCA 1Q3XA 1P9SA 2WV5A 1V2OT 2ANMH 3KN2A 3H7OA 1CO7E 1MCVA 1C1UH 1H8DH 2HRVA 4INKA 3UNRA 4BAKB 1G2LA 2KX4A 5DP7A 2VVVA 3H5CB 4O03A 3OYPA 5GIBA 3SU1A 4BXSA 3SV9A 1Y5UT 3ZVFA 7GCHF 1EB2A 2CMYA 3SU2A 1L2EA 4NA9H 4TYDA 1HIAA 3ODFA 1DOJA 3BTTE 1UTLM 2J9NA 1DWBH 3ZZ8A 1UK3A 2XC4A 3RXIA 3NXPA 1QQ4A 2FPZA 4ACBA 3MU5A 1ARBA 4IN1A 5JB8S 2KR7A 1SGIB 2FYQA 1FLEE 3S69A 3EDXB 1A5HA 2A4RA 1TX6A 1Z7KA 2FIRH 1O3GA 3KYFA 2BOHB 2A0QB 1C9PA 3DT0H 1C5LH 1N6XA 2G5NA 1WU1A 2ZFPH 1C2HA 1ZZZA 1YLNA 2ULLA 3RXLA 4K8YA 4CRGA 1QBNA 2GMTB 1H4WA 5LPEA 1EAUA 2BD4A 1Y3UA 3VB6A 2TRMA 1RTLA 1A2CH 3F0PA 5C67A 4YOGA 1O30A 1HV7A 3P70B 3MU8A 1UVTH 3SV7A 1AZ8A 1EX3A 1FN8A 4WXIA 1XKBC 3KIDU 2HGTH 3RXPA 1C2EA 2A5KA 1DITH 4ISNA 2AHME 1C5SA 2FOMB 3SO3A 4A92A 4KTSA 1H9LB 1BMAA 5JBBS 1QRZA 1ZHPA 3P8OA 3SZNA 1C2GA 1KXDA 3E1XB 3E8LA 3GY8A 4MNXA 2F9VA 1TPOA 2QY0B 3ZZAA 4X6MA 1FIZA 1O32A 5GCHF 3UNSA 1NBME 4ABHA 1ZSJA 1GBMA 3RXRA 1CA0B 1E1RD 1MQ6A 1P01A 2FOCA 3TPIZ 1V2KT 2XBYA 2JH5D 4UFDH 3TLOA 2R0KA 1DDJA 1MBMA 2EEKA 1ELAA 2ZIQH 2J97A 2BDAA 2FODA 2BM2A 2CF9H 1AHTH 1S5SA 2H9HA 1A5GH 4UD9H 3EQ0H 2OC8A 1AUTC 1O2YA 3IG6B 1Z1JA 3A82A 2QYIA 3SU4A 5CHBA 1VR1H 2HOBA 3F2FA 3KL6A 1FAXA 3LDXH 5EOKA 2Y7ZA 4VGCB 3DD2H 5LPFA 2A7CA 3UFAA 1KTSB 1ETTH 4NZQA 1T7CA 1AI8H 1TA6A 1FPCH 1JBUH 2BZ6H 3LGTA 4JZ1A 1NFWA 2C8YB 3D65E 3ZVEA 4AG2A 2C8XB 5CHAC 1OP2A 1DY8A 1THSH 4UFFH 1TBZH 5HYOA 1SGNE 2H6MA 1Y3XA 1O5CB 4FXGH 1ESAA 1GBJA 1ZR0A 5DO4H 1EOLA 2FI4E 4Q7YA 1GJ7B 3U1JB 3O8BA 2B5TB 1UCYK 3VB4A 1DICA 3VB3A 4FOUC 1CQQA 2ZO3H 3VXEH 4ABFA 3M5LA 2A5IA 2ZFQH 2GCHF 4UFGH 3EYDA 1LKAA 4OS4A 1EASA 1UTMA 1GCTB 2BXUH 2QN5T 4TPYA 1JIRA 3PV5A 1YPHE 1SOTA 4H6SB 4B75A 1GI1A 5JB9S 1GCDA 1SFIA 2V3HH 2ZGCA 5AVDA 3VB5A 2ODPA 5DSFA 3GY3A 4BTUB 3RU4E 1D3DB 3ATWA 2Q1JA 3SU6A 1O3BA 4NA8A 3PYHA 3U1IB 4B73A 5L30H 1NRQH 1MTSA 2BD8A 4GUXA 2AYWA 1O3LA 5B6OA 1EAXA 3SV6A 1AO5A 4FUFA 2AERH 4MPWA 3M5OA 4X2YA 2TGPZ 3DFJA 1UK2A 1GHBF 1SGFA 1O5BB 3P8GA 1HAVA 4E7NA 1DWEH 5LPRA 1C5QA 1NT1A 4A6LA 2OBOA 2NU3E 5C1YA 4ZROA 4WXVA 4HFPB 4YLQH 1A3EH 2DE8A 4HG6A 3OU0A 4YT7H 2OCVB 4ISHH 3TU7H 3PTNA 3LGIA 1MU8B 2Y82A 1FN6A 6GCHG 8GCHF 3F9GA 3SGQE 1SMFE 1C2FA 1TBRH 3S9AA 5FBEA 2K8IA 5CE1A 3SGBE 2GDEH 1O2IA 3A7VA 3M37A 1QQUA 4WH8A 2A1DB 5JDUB 1EZUC 1FXYA 3SNCA 3FP8E 5A8YA 3E90B 3Q3YA 4U01A 2PTCE 4OS6A 1F92A 4U32A 3AW1A 3K6YA 1RS0A 3F1SB 2BY8X 1F2SE 2BY9X 2G5VA 2SGEE 2VIVA 3LGWA 2Q6GA 2C8ZB 1YCPK 2IPHA 1MZAA 4YLUA 2SGPE 1EB1H 1Y8TA 2GMTC 4CREA 1DUEA 1V2PT 3MNBA 3TITA 2WPHS 1G36A 2W6ID 2J2UA 3QO6A 5I46H 5FPSA 1ZPBA 3PV4A 4MPVA 3SHCH 4CRDA 3F68H 4FUJA 1O34A 2CN0H 3PM3A 3NWUA 3MO9A 4AFUA 1FMGA 5DGJA 3OE7D 1V2MT 4LXBH 4ISOA 2GD4B 1AMHA 1DS2E 1ORFA 1VJAU 4NIWA 2F4LA 3RXMA 4H4FA 1TQ0B 1A46H 3RMOH 1WUNH 3RXJA 4ZKOU 1IQKA 3RMLH 1HRTH 1T31A 3EA7A 1CA0C 1PPHE 2W3KA 2AMDA 7GCHG 4TT3D 4OGXA 2THFB 2GKVE 3RMMH 1TRMA 3E91A 2KZ4A 3TJUA 1AQ7A 5EODA 2W7SA 2PKSB 1C5WB 3GYLB 3ATIA 3MOCA 1E34B 1O2XA 5JYIA 1C1SA 1TQ7B 3B23B 1YPLH 4NFEA 1HXEH 1BTUA 5EG4A 1SBWA 4AGJA 1N6YA 4YZUA 1SGDE 3FFGA 2BYAX 4B1TA 1RTKA 6LPRA 1MMJN 2ANWA 2OXSA 1TGBA 4DT7B 3RC5A 3TJNA 3TH2H 4LOYH 1HBTH 5GDSH 4VGCC 2QF4A 2FYRA 1GHZA 2TBSA 3KNXA 1W12U 2BHGA 1TIOA 4F55A 2O9QA 1LHFH 2XOKD 3HKJB 3QDZB 5ESTE 2O8MA 1BBRE 4GHTA 1FQ3A 3GDSA 4MLFB 4AB8A 1K28D 3EAJA 1GHVH 1SB1H 2VIPA 4WMEA 5HMAA 5FPTA 4FU9A 3CP7A 1V2LT 3GY5A 2W26A 4ACAA 1BRCE 1A1RA 4YOJA 2O8WA 3ODDA 4SGAE 2W5EA 2XCNA 3G01A 4ISLA 3Q76A 3S9BA 2FDAA 4AZ2B 4X1PU 2QV1A 4Y7BA 5GCHG 1P04A 5TCCA 4WVPE 1CSOE 2B7DH 3RXVA 1P05A 1TMTH 1XUKA 1NO9H 2H9TH 2FS9A 4Y8ZA 2WPIS 1TBQH 2ZKSA 2XYAA 1PPGE 4FVDA 2CHAB 1GCTC 1O3EA 2GZ7A 2OC1A 5T3HA 3URCA 1DWDH 4I33A 1DANH 2J98A 1LO6A 1GPZA 4DOQA 2NU4E 3STIA 1K0HA 1AUJA 2ZDNA 1INCA 4CR9A 3ZVAA 1K1IA 5EW2H 1AKSA 1ZRBA 1QB1A 2VVUA 4Q63A 1HPGA 1V2VT 2ZTXA 3Q00A 4XFQA 4Y71A 4OM9A 1HXFH 2IOTA 1E37B 1QNJA 1V6DA 1YP9A 1YPKH 2AS9A 2XBWA 1C5VA 3R0FA 1DLEA 4ASUD 4GSOA 1TE0A 3ELAH 4X2VA 2VWMA 1ZTKA 2RG3A 4MNYA 1GGDB 1G32B 5FXLA 3MQKC 2KAIB 3RU4T 1IHTH 3FZDA 2F91A 3AAVA 4IGDA 1A0HB 5JBCS 1AU8A 1DVAH 5AHGH 1H8HD 1SSXA 1OOKB 2BDGA 5HKKD 4CRCA 1BTWA 2FOHA 3M3SA 1JWTA 4K1SA 1RFNA 1TNLA 1KLIH 5C20A 2QA9E 2KCAA 3BTEE 3UTUH 1BRUP 1AVGH 1E79D 1F5RA 4X1RU 1HAHH 2FESH 2FLRH 1NPMA 1W7XH 4X8UH 4A7IB 1SGTA 1QRXA 1T8MA 3MU4A 1IQNA 4Z1MD 1LQEA 1BTZA 2GCHG 5TJXA 1AVWA 3K65B 4YESB 4F4OC 3TGKE 5K7RA 1E1QD 2PUXB 2QXIA 3H09A 3MHWU 4I31A 1BTXA 1QA0A 5EXMA 2P3UB 3HGNA 3N7EA 1UK4A 3GYMA 3MH4A 2ZI2H 4OS2A 3M5NA 4THNH 4BXWA 4KP0A 2CJIA 4UE7H 2Y5GA 4NSVA 2XRCA 2A45B 1GI0A 3M35A 1SLUB 4JCNA 1KLJH 1Z8GA 2AEIH 1UVUH 4WF8A 3LOXA 4DCDA 4RSPA 1HJAB 2O8TA 3SNAA 1FONA 1O39A 2QE7D 1ZHRA 1SLXB 1PQAA 4FUGA 1P57B 5H4IB 3GCHC 2G52A 4IBLH 1BMFD 3ATKA 5C0TA 1OP8A 1NRSH 3KQ5A 1FNIA 3DHKH 1O3PB 2C4FH 1QJ7B 4MPXA 1LQDB 2VINA 2JH0D 4WWYA 3CS0A 1C5RA 1EATA 1GHBG 2L6OA 1LVBA 1LVYA 3OX7U 5DKMA 2XBXA 3LJJA 2GZ9A 1QA7A 4MDSA 4Y8XA 3ZVGA 2XBVA 1UTNA 1DXWA 2AH4X 3SJOA 2BD7A 3A81A 1K21H 1ZGVA 1S0QA 3A83A 5F6MA 4JYVH 2BQ7B 1KLTA 1XUJA 1YF4A 3A8AA 1P11E 4AFSA 1ANCA 5EXLA 1DWCH 1MTNB 8GCHG 1SGRE 2W3IA 2ZPQA 2VGCB 5EW1H 5EQRA 2PKSC 1GMDF 3P8NA 2EA3A 1BTYA 1A4WH 2SNVA 1G30B 1PPFE 4NGAH 3SNDA 3W94A 1QL9A 1PYTD 5A0CA 2BDYA 1IQFA 4FUEA 3ZYDA 1Z8JB 3RM0H 4I32A 3E0NB 3HK6B 4IC5A 4YT6H 1GI8B 3SZEA 2ZGHA 5C17A 2ZCLP 1GL1A 2JDID 1TLDA 4MQAA 3EE0B 3ZZ6A 3OTPA 1SR5C 2OINA 1B5GH 1ZGIA 1QZ8A 5DP8A 3RXBA 1MKXK 1EXFA 4Y76A 3SI3H 1Z6JH 4ZAEA 1GBCA 3S9CA 2PSYA 1GHYH 1MKWH 4Y0YE 1P2KA 1GI3A 1S6LA 1D9IA 3LKWA 2F9OA 4CBNA 2YMSB 1TNIA 2AFQB 1HIAB 3UWJH 4Y7AA 1BIOA 3F2GA 1NESE 3BTHE 3BSQA 3I78A 1BTHH 3QWCH 4ZKNU 4A1TA 3TGJE 2ILNA 2OLGA 4RT0A 4HZHA 4JZIA 4I8GA 1LPKB 2PUQH 1KXBA 5FCRA 2CHAC 1DE7H 1JIMA 1LHDH 4MNVA 1O38A 2Y81A 3A88A 1HAGE 3M7QA 4Y10E 2WZQA 1ANEA 1ELEE 1QJ1B 4E06H 1HAYB 2HVXA 3EE7A 2RA3A 3LT3A 3O8DA 4GCHF 4ZHAA 1Y3YA 3SJ8A 4ZMAH 3EA9A 2VB0A 1P0SH 4ABEA 1ZSKA 1RTFB 1H8IH 3N99A 4FUDA 3F9FA 1Z1IA 3BTFE 4ZCNA 3BV9B 3KCGH 1ZYOA 2KFWA 2NU1E 2RCEA 2GT7A 3T62A 1PPCE 2WV4A 4H6TA 1GGDC 1O35A 5ETXA 1UTQA 1JRSA 3RM2H 1O31A 2F43B 3D23A 1Q31A 2AGEX 1DSTA 5F03A 3ITIA 1AWHB 5DP4A 3TJOA 1K1PA 2P95A 2SGAA 2VNTA 3JZ2B 3S7KB 1GVZA 4Q2KA 2SGDE 1F0UA 1ZPCA 3A7ZA 2KCOA 2ZDLA 4ZKSU 2PP6A 3M7UA 2J38A 1BBRK 3ZIAD 1O2UA 2XW9A 1C1TA 1O2VA 2WUBA 3F0OA 1Q2WA 2F83A 4YXWD 2UUFB 3NPSA 1GDUA 3PMJA 1L4ZA 1V2RT 4NIVA 3UB0A 1GBTA 2A7JA 2J34A 1NRRH 1ZTLA 4INLA 3ZVCA 3M61U 3M5MA 5EJZA 1O2PA 1CGJE 2CGAA 1DXPA 3FP7E 1BRAA 4IMQA 4IMZA 1EZXC 3D62A 3Q77A 1UMAH 2AGGX 1FZZA 1OPHB 3MTYA 5FX6A 2FS8A 1EAIA 1W3CA 1Z8IB 3AK5A 5I25A 5J4QA 1AY6H 2OTVA 3A84A 1FX0B 4X6PA 1IQGA 1V2UT 4I8HA 1HJAC 2HWLB 1GDNA 1QCPA 1K1NA 3RXUA 4BAMB 1AD8H 1C5TA 2WINI 1B0EA 1YWUA 1MU6B 1P2QA 1GJ8B 2BZAA 2Z9JA 1P2JA 3SUDA 3E3TA 5F53A 1LHEH 1S85A 1XX9A 4AYYB 1Y5AT 3KQEA 2ZZUH 2FO9A 2GTBA 3MNSA 3RMNH 3TH4H 3ZVBA 2VH6A 2ZFFH 1AGJA 2BMGB 1KXFA 3M36A 2G55A 3PV2A 4NIXA 4R8TB 1HAIH 2W7UA 1UTKA 2UWOA 3A7YA 2IN2A 2WPLS 1EFRD 2IPQX 1TOMH 5DP3A 1GI2A 1YM0A 5E0JA 5LGOA 1JRTA 4K1EA 2ZHEH 2ZU2A 3TNTA 4NG9H 1VGCB 1QBOA 1MTNC 3QGJA 2VGCC 2C3SA 2ZFTA 1P9UA 1W13U 3GY6A 1KDQA 4I8KA 2NWNA 2ZU1A 4K3JA 1EZSC 1TRNA 3QGNB 2BQ6B 1C1WH 5C1UA 5F8XA 3GCTF 1SGEE 1RIWB 1W0JD 3BTDE 4JZDH 2Z3DA 1VJ9U 4FUIA 1W8BH 1ESBA 3CNRA 1P2IA 3NKKA 1EP6A 3PMBB 2EI7A 3UPEA 1HAVB 1LTOA 3N7DA 7KMEH 3ZZ3A 1GJDB 1DT2A 4OGYA 2ANKH 2F9UA 3SU0A 1O33A 4XBBA 1IAUA 2ZHQH 1C2LA 5FX5A 1BITA 1K9OE 1C5PA 3M7TA 1AB9B 3SW2B 3V13A 4BAHB 1DSUA 3TK6A 4YM9A 2ZU4A 1EPTA 5AFYH 5C5OA 3UOUA 2WPMS 1AZZA 1C4U2 2ZFSA 1O5GH 1TB6H 2EI8A 2YMSC 2BY6X 1AE5A 5EJLA 4B6FA 1YLDA 3RXHA 1YC0A 4X1NU 1O3DA 2V7QD 1IQEA 2P3TB 4AGKA 3UR9A 2GV7A 1EOJA 1V2TT 5FHTA 1GJBB 4TY6A 2ZQ1A 5T6GA 3SUGA 3A8DA 4PROA 4AB9A 1TNGA 4KGAA 2HPQH 2ZFRH 1T8OA 1S6FA 1XVOA 2WHXA 4FUBA 5E2OA 1GMDG 3URDA 2V3OH 1GJCB 3UOPA 1ARCA 3MMGA 1MTVA 2FOFA 3KEEA 1K1MA 1E35B 4TPIZ 1FY8E 4X2WA 4A1VA 1TNHA 4NFFA 4I8LA 2RDEA 3ZZDA 7LPRA 2FM2A 2WPJS 3F2HA 1MH0A 1Z71A 4J2YB 3C1KA 3S7HB 2ZGBH 4YO9A 4NA7A 2L74A 4OS5A 4WJG2 1C2KA 2BDBA 3LU9B 1BMNH 3MI4A 2F3CE 1T8NA 1BA8B 1C1OA 1BDAA 2HNTE 3HK3B 4LK4A 1O2WA 1RJXB 5E0GA 1FV9A 3PLPA 1GVLA 1KXAA 1H8ED 2SNWA 1UW7A 1NU7B 1UJ1A 1X7AC 3UUZA 2J5UA 3FP6E 4TWYA 4I8JA 5SGAE 4UONA 2STAE 1QHRB 4X6OA 2BLWA 3P95A 1O0DH 1C1NA 3EGKH 5A0AE 2PGBB 3NK8A 2OBQA 1D6RA 3LC5A 4Y8YA 3BTME 4AFZA 1J8AA 1L1GA 2VJ1A 3QZRA 1H9IE 1O5EH 3A7WA 1WQVH 5HM2A 1XMNB 1GMCF 3PO1B 5CDFE 3VG8A 4FUHA 2HVYB 1UVSH 2A4QA 3ZYEA 1VCPA 5HGGA 1GJ6A 1V2NT 1C5UA 2K1QA 1AIXH 1PPZA 1TA2A 4D9RA 4UEHH 4GCHG 1QJ6B 3FZZA 1CT0E 1ID5H 3OAAD 1CU1A 1PFXC 3E0PB 5A2MH 2BXTH 2JH6D 3K6ZA 1OX1A 2VU8E 3GICB 1Y5BT 1RRKA 2HPPH 2ZHFH 1EAWA 1HCGA 4Z6AH 3L33A 5A8XA 1SC8U 1Y3VA 1P8VC 1ANDA 3M3VA 4WY3A 1BB0B 4A1XA 3LJOA 1J15A 1D3QB 2TGTA 2F9NA 3BTQE 1O2JA 4U30A 5E2PA 1V2ST 2CXVA 3BEFB 3GCOA 1K1LA 5TCAA 3ATLA 2P8OB 1YPEH 1FUJA 5EJ1A 2LPRA 4K8BA 3V0XA 5LH8A 3DSPA 1THRH 5E0HA 4X8VH 1VGCC 2WPDD 1XUGA 2FX6A 1A5IA 1OXGA 3KQBA 4X8SH 3NRLA 2J98B 1BOQA 2B9LA 1GI5A 1SL3A 1P3CA 3IWMA 3RUOA 2ZDKA 4FETA 1MTUA 3RXGA 1OWJA 1GJAB 4MTBA 1AKSB 1NM6A 1PPEE 3OFND 2Z7FE 3TJVA 1PJPA 2RA0A 1OHHD 3K2UA 1XKAC 4UDWH 2FLBH 1RIWC 9LPRA 1L1JA 2F9PA 3KYGA 1GBEA 3UIRA 3HPTB 4D7FA 1OWIA 3BTGE 1C9TA 5FBIA 2XNIA 3SU3A 3LC3A 3BF6H 4P00A 4KKDA 1TX8A 2LELA 2ODQA 2OC7A 1OWKA 2FOGA 1S0RA 1G3BA 1C5ZB 1C2DA 1YLCA 1RGQA 2FEQH 3H7TA 1WAYB 1SFQB 2ZPSA 1F7ZA 4B2BA 1G2MA 4AG1A 1W11U 3ZZBA 3LH1A 3P17H 3RDZA 1AB9C 2IJOB 3B8JA 4Z0KA 2QXHA 4KTCA 1J16A 3A8CA 4IW4E 1L1NA 2WUCA 4FVBA 4DJZB 1TWXB 2ZCHP 2QAAA 2R2WU 3LGUA 1QURH 1T4UH 1C5YB 2FP7B 2LNCA 2PKAA 1O2SA 4M7GA 4D8NA 1F0RA 2XC5A 4I86A 1NFUA 1WTHD 3GDUA 3TNSA 1L0ZA 2H2ZA 2ZG0H 1LHCH 1WCZA 4LZ4B 1TABE 2B8OH 3GS9A 4B76A 1W0YH 3WWFA 1TFXA 3RXCA 3A89A 1VZQH 1LPZB 1C4V2 1LCYA 1DUAA 1FIWA 3RXEA 3W95A 2P16A 5JBAS 1NRNH 4NCYA 1K1OA 1MCTA 3TIUA 4H42U 1NRPH 1XUIA 4F48B 3L6PA 1BT7A 1Y3WA 1UCYH 2ZU5A 3A87A 3GCTG 1EJAA 5BRRE 5ESBA 1ELFA 2Q6FA 5PTPA 1OWHA 4QT8C 1ZMLA 4XRNA 3OEED 1EP5A 1W7GH 4INHA 1SI5H 3I77A 2BY5X 2GDDA 4ABDA 5F8ZA 1S6HA 3RLYH 1UHBA 1TGSZ 1O3NA 2GX4A 3PRDA 1ZPZA 3EA8A 2D1JA 2JETB 1BQYA 2K0QA 2QC2A 2VIWA 2KCYA 4FU8A 1BCUH 5CMXH 1ZMNA 2YMSD 3SBKA 2WYGA 1ZTJA 3R3GB 4WMDA 2BDIA 4BANB 4DURA 2FOAA 4M9FA 1KYNA 3QLPH 1EQ9A 1GJ9B 3ZVDA 1DY9A 2VH0A 3MO3A 3HATH 2PW8H 4K5ZA 3MNXA 2ZA5A 1E36B 1T4VH 4NZLA 1U6QA 1O3KA 3OTJE 1ZJDA 3QTOH 3U69H 1E38B 1YY3A 1TNKA 2GCTB 2Z6BD 1ELBA 2ZDVH 1YBWA 3GY2A 3PO1C 3PMAB 4ZH8A 2J94A 3L3TA 2YOLA 4YTAA 4JZEH 1NROH 5L6NH 3D49H 2ANYA 1O3JA 2OD3B 2TGDA 1TNJA 1CE5A 7ESTE 4OS1A 4ABIA 4DIHH 1YPMH 5EQSA 4AX9H 1GG6B 5A8ZA 2ZTYA 3ZZCA 2ZGJA 4Q80A 2Z9GA 1O2HA 2ZPRA 1P2OA 3U8RH 3SQEE 1O3AA 3T29A 2Y7XA 2P93A 4KELA 5A09A 1HFDA 2PV9B 2FZZA 3HKIB 3U98H 2M5TA 3AVZA 1C1QA 2WPKS 1NN6A 2V3MA 3UQOA 2IJD1 5GPIB 1YCPH 3LH3A 5DJ7A 1FI8A 4O9VA 3RC6A 1YCPM 2SGQE
chains in the Genus database with same CATH topology
4FU7A 1BZXE 1TGCA 2QF3A 4TWWA 1VITF 2VIQA 1P12E 2P8OC 4MVNA 1KSNA 1JXPA 1GBDA 5BPEA 3MH5A 1ABJH 4CRBA 1G3CA 4ABBA 4O3UA 3IITA 4DY7B 3M3TA 4CRFA 1GVKB 1IQJA 3RC4A 1OS8A 4BAOB 4BOHA 4BTIB 3UNQA 2Z9IA 3RXTA 1FY4A 1SHYA 1T8LA 5HM9A 1WOFA 1HDTH 1FAKH 3PWBA 1XVMA 3LPRA 4YOIA 1GMCG 1O36A 2BVRH 4XBDA 2ZDMA 1UO6A 2ZGXH 3FAOA 5DP9A 2F9BH 3I29A 4JK5A 1O5DH 4B2CA 3S0NA 1MD8A 1TYNA 2P3FH 4D76A 2ALVA 3K9XB 1PPBH 4JYUH 1SHHB 1CT4E 3DUXH 2BDHA 2FTMA 1CBWB 4UFEH 1SLVB 1QIXB 1LDTT 4FUCA 1J14A 1O2GH 2FOEA 3BEIB 4ASHA 1ELCA 1VCWA 3T28A 1BTPA 3PB1E 3KGPA 1GHWH 1B7XB 2ZHDA 1W10U 1YKTA 1ACBE 1Y59T 1C5OH 1O2LA 3TH3H 1YGCH 1NFXA 1V2WT 3LIWA 1C1RA 2UWLA 2H5CA 3SORA 2ZDAH 4GHQA 4XBCA 1SGCA 1SG8B 2OQUA 2BTCE 3GY4A 5GWZA 1M9UA 5L2YH 4WH6A 2Z3CA 1P10A 4IS5A 2GV6A 2I6QA 4DG4A 1TPPA 2C8WB 3ZZ9A 2BLOA 4BNRA 3MH6A 3A80A 1IQLA 2ASUB 4ZHLU 2PSXA 1TPAE 4B2AA 5T6DA 3BN9A 1LHGH 1D6WA 4AFQA 4E05H 3CS7A 1HAXB 2Y5FA 1HAZB 1ZSLA 4X6NA 4BTTB 1A0JA 1SGQE 1XXDA 4IC6A 3TVJB 2ZCKP 2ZU3A 4ZHMU 3NUMA 2GT8A 1P06A 1OWDA 5C2ZA 2BVXH 5EXNA 1ELTA 1UTOA 2BD9A 1DX5M 2OP9A 1JOUB 2R3YA 2G81E 3STJA 3MNCA 1TX7A 5GXPA 1HJ8A 2PWXA 2H5DA 4GVUA 2A32A 1MAXA 3ATMA 3A85A 3FANA 1LKBA 5JPMH 1IQMA 3SJKA 4XSKU 1ZLRA 2JETC 9ESTA 4K69A 1J17T 2OUAA 1AE8H 1SQOA 4CH8B 1EUFA 1MD7A 3OSYA 3WY8A 1SGPE 1GI9B 3VFEA 2UWPA 5DP5A 3ZZ7A 1AFQB 1LMWB 1GL0E 1QB6A 3BTWE 1JMOH 3SQHE 5DK1A 2BQWB 3RXKA 1CHGA 1P3EA 1KDQB 1LVMA 1N8OB 4X0WU 3Q3XA 4ESTE 2VIDA 5FAHA 1HLTH 1WTGH 3RLWH 1TONA 1F0TA 3VB7A 2ZTZA 5GJ4B 6CHAB 2GCTC 1O37A 2EC9H 1NZQH 3RP2A 5FPYA 1YPGH 3BEUA 1TGNA 2XTTB 5A0BA 2Q6DA 1WBGB 1MAYA 5FCKA 1WYKA 3T5FH 4F49A 4DIIH 3SOSA 1C4Y2 5EGMA 4DGJA 3SNBA 1AWFH 2VVCA 1GG6C 2PFEA 3V3MA 3ZV8A 3P92A 3SN8A 1GI6A 1O2OA 4D7GA 3MU1A 4B71A 1EJNA 2ESTE 1F5KU 3UQVA 1P03A 2R9PA 2ZC9H 1EPTB 1FY3A 1BHXF 4HI3A 1GMHF 1V2QT 3TGIE 2R3UA 5AFZH 1YPJH 4LZ1H 1HAPH 1NFYA 2JKHA 1HB0B 1F0SA 3F6UH 1A61H 1O2RA 3O8CA 5IDKA 1G3DA 1O3HA 4Q7ZA 4O3TA 4Y11E 1O3MA 3GOVB 1KTTB 1GHAF 6ESTA 3VGCB 3SUFA 1MQ5A 2CV3A 3MU0A 1SGFG 2A31A 3BTKE 1EJMA 1DFPA 2QIQA 2A2XH 4ABAA 1ZMJA 2H9EH 3A86A 1SQTA 3BG4B 3QX5H 4I7YH 5J4SA 4MG3A 2ZEBA 1CHOF 1HGTH 1WQSA 1GWAA 5DPAA 2AIQA 1ELVA 1W2KH 3N7OA 4TY7A 1ELGA 3LONA 3OY5U 3SHAH 3CENA 1MUEB 2YNAA 4WMFA 1GHXH 1DPOA 5EPYA 3AASA 1YPHC 2UUYA 1QTFA 3NZIA 4DVAU 1J9CH 3KF2A 1Z8RA 2Y5HA 4E7RG 1OWEA 2ODYB 1G37A 2STBE 2TIOA 1NU9A 1QRWA 2R2MB 1CBWC 2OQ5A 3PLKA 1GBAA 2NU2E 1XXFA 3RXSA 1H9HE 3T25A 1ZOMA 1GBBA 2ZQ2A 1NY22 1S84A 2PTNA 4IN2A 4NSYA 1RD3B 4X8TH 1UVOA 1O5AB 1W14U 1AN1E 3U9AH 1O2TA 2DE9A 4JZFH 1TMUH 1V3XA 1QFKH 1OSSA 4OS7A 3T2NA 3MYWA 3C27B 1GBFA 2FI3E 1VITG 2HALA 4B74A 1SPJA 2HLCA 4ZKRU 3MFJA 1PYTC 1MKXH 3SV2H 1MKWK 2UUJB 4HTCH 1GI7B 1A3BH 5T6FA 5JBTA 2PHBA 2OC0A 2V6NA 3GCHB 1O3FA 2Z9LA 1NC6A 4K60A 1OKXA 1FJSA 2ZNKH 2DUCA 1BMMH 1D3PB 1P02A 3RXOA 3DFLA 1ZJKA 1VCQA 2CF8H 1O2KA 1P2MA 4JMYA 3SU5A 2BD2A 1TALA 1MBQA 3LGYA 1O5FH 4KTUA 1C5MD 1E0FD 2J4IA 3LGVA 4CR5A 4MPUA 3V7TA 4AYVB 1QBVH 1BMLA 1GDQA 1G3EA 3UR6A 2BLVA 3SGAE 1C1VH 3GCNA 3MH7A 5EU8A 1TOCB 1O2ZA 1F5LA 1ETSH 1C1MA 2QXJA 2HNTC 3RXQA 1K1JA 1HAOH 1C5XB 2PR3A 1UTPA 2ZP0H 4JYTA 4A5TS 1K22H 1AFQC 2A4OA 5DP6A 2AMQA 1C2MA 3A7XA 4X1QU 1RXPA 2BD3A 3MWIU 4ZUHA 3QTVH 3VXFH 2ALPA 1CGHA 4NWLA 3GY7A 2Y6TA 1O3IA 5E8EH 4CHAB 2XC0A 1N8OC 3BIVH 5AF9H 2XCFA 1ZHMA 3QK1A 4ZXYH 2GVFA 4HGCA 1MTWA 1MZDA 1D4PB 2QF0A 4RKOB 6CHAC 2ZHWH 4JK6A 1IHSH 2V0BA 3ENSB 3BG8A 3V12A 4X2XA 2WYJA 4AORA 3SJIA 1OYTH 4CRAA 1QL7A 1FDPA 1LVOA 1ANBA 1BBRH 1PQ7A 2A7HA 2B0FA 3TK9A 1D3TB 4X1SU 1KIGH 4J1YA 2H1UA 2A2QH 1CT2E 2G51A 2Z9KA 1SOZA 2D8WA 1GJ4H 1G9IE 2C90B 1UVPA 4GPGA 3TK5A 4U2WA 1EPTC 5K0HA 1O2MA 1O2NA 3F9EA 2J95A 1Z6EA 1EKBB 1GBHA 1BUIA 2QXGA 1ZRKA 2VWNA 5EQQA 3O8RA 8LPRA 4ABJA 1BJVA 1QGFA 3T27A 2PKAB 2I6SA 4CH2B 2TPIZ 2O8UA 3KQCA 1GBLA 2BOKA 1TRYA 1PQ8A 2G4UA 1HNEE 3VGCC 2G4TA 2O8LA 1SVPA 1CVWH 2C93B 1XUFA 1HYLA 1HUTH 1O2QA 1S82A 2FXRA 1OP0A 2Y80A 2AIPA 1IOEA 1K2I1 2HNTF 1QR3E 1PQ5A 3BG4C 3GDVA 2AGIX 2BX4A 1FY5A 3SV8A 2A5AA 1VITH 1AFEH 8KME2 3QN7A 4R0IA 2BX3A 2FMJA 3AW0A 3RXFA 4ABGA 5F8TA 3SNEA 4ZXXH 2BY7X 4BAQB 3VEQB 1KY9A 2VWLA 2SFAA 5ABWA 1BRBE 1S81A 2D26C 1BHXB 4XE4A 3NCLA 2ZECA 4Y0ZE 1UHBB 1UCYE 3VPKA 3PWCA 5C3NA 2R0LA 2ZF0H 3PMHB 2P94A 2KAIA 3AAUA 3PTBA 2XWAA 1WV7H 2P59A 4ISIH 2FTLE 1T32A 4SGBE 1FY1A 5IYTA 4Q7XA 2BVSH 3OY6U 1L4DA 1QL8A 3ZV9A 2AMPA 3F9HA 3E16B 4AOQA 1GMHG 3RXAA 3UREA 2J92A 5C1XA 1SQAA 1WSSH 4Y6DA 2QCYA 1P09A 1XM1A 1H1BA 1THPB 4K1TA 3SUEA 3KQDA 3U8OH 1N1LA 4NWKA 1GHAG 3MO6A 1ETRH 1W0ZU 2PGQB 3U8TH 4AN7A 2FWWA 1ESTA 2G8TA 4RKJB 1O3OA 2Z94A 1C2JA 2FOBA 2V35A 4NIYA 1CHOG 3ZZ4A 1IQIA 1DM4B 4DW2U 1P2NA 3PLBA 2GGVB 1GBKA 3QZQA 1A0LA 2PLXA 3Q3KA 3ZZ5A 2A4GA 1TGTA 1CA8B 1SLWB 2D2DA 4XDEA 3SI4H 4MNWA 1EZQA 5C5NA 2EI6A 3RU4D 2VWOA 5CHAB 3HGPA 1C1PA 3SJ9A 2Z3EA 4CBOA 1QB9A 1O3CA 1HJ9A 2BDCA 3P8FA 1IQHA 2GZ8A 1B0FA 6GCHF 3E6PH 1CGIE 3UWIA 2NU0E 2BLQA 1FPHH 1NS3A 1KXEA 1UTJA 3PROA 1C5NH 2GP9B 2XWBI 1GJ5H 2FI5E 5G4BA 4XOJA 4Y79A 3KHVA 3A8BA 3GISB 2XXLA 8ESTE 1SGYE 5DG6A 1QY6A 1XUHA 2SGFE 1V2JT 1LPGB 3P6ZB 5HXFA 2YNBA 1AVXA 1TAWA 2QGRA 3BIUH 4CHAC 3ESTA 3JZ1B 3RXDA 1C2IA 1DLKB 2VIOA 3T26A 2BB4A 4D9QA 4K2YA 1BJUA 1S83A 1OYQA 2ZWLH 3A7TA 2UUKB 1GBIA 1ELDE 2FX4A 3FVFB 3QUMP 1GI4A 1TMBH 2G00A 3B9FH 3DA9B 1YYY1 4GLYA 3UY9A 4O97A 2RDLA 1ABIH 2TGAA 1TPSA 1A7SA 5EPNA 4GAWA 2BD5A 1NTPA 5L2ZH 4RN6A 1KXCA 1Q3XA 1P9SA 2WV5A 1V2OT 2ANMH 3KN2A 3H7OA 1CO7E 1MCVA 1C1UH 1H8DH 2HRVA 4INKA 3UNRA 4BAKB 1G2LA 5DP7A 2VVVA 3H5CB 4O03A 3OYPA 5GIBA 3SU1A 4BXSA 3SV9A 1Y5UT 3ZVFA 7GCHF 1EB2A 2CMYA 3SU2A 1L2EA 4NA9H 4TYDA 1HIAA 3ODFA 1DOJA 3BTTE 1UTLM 2J9NA 1DWBH 3ZZ8A 1UK3A 2XC4A 3RXIA 3NXPA 1QQ4A 2FPZA 3MU5A 1ARBA 4IN1A 5JB8S 1SGIB 2FYQA 1FLEE 3S69A 3EDXB 1A5HA 2A4RA 1TX6A 1Z7KA 2FIRH 1O3GA 2BOHB 2A0QB 1C9PA 3DT0H 1C5LH 1N6XA 2G5NA 1WU1A 2ZFPH 1C2HA 1ZZZA 2ULLA 3RXLA 4K8YA 4CRGA 1QBNA 2GMTB 1H4WA 5LPEA 1EAUA 2BD4A 1Y3UA 3VB6A 2TRMA 1RTLA 1A2CH 5C67A 4YOGA 1O30A 1HV7A 3P70B 3MU8A 1UVTH 3SV7A 1AZ8A 1EX3A 1FN8A 4WXIA 1XKBC 3KIDU 2HGTH 3RXPA 1C2EA 2A5KA 1DITH 4ISNA 1C5SA 2FOMB 3SO3A 4A92A 4KTSA 1H9LB 1BMAA 5JBBS 1QRZA 1ZHPA 3P8OA 3SZNA 1C2GA 1KXDA 3E1XB 3E8LA 3GY8A 4MNXA 2F9VA 1TPOA 2QY0B 3ZZAA 4X6MA 1FIZA 1O32A 5GCHF 3UNSA 4ABHA 1ZSJA 1GBMA 3RXRA 1CA0B 1MQ6A 1P01A 2FOCA 3TPIZ 1V2KT 2XBYA 2JH5D 4UFDH 3TLOA 2R0KA 1DDJA 1MBMA 2EEKA 1ELAA 2ZIQH 2BDAA 2FODA 2BM2A 2CF9H 1AHTH 1S5SA 2H9HA 1A5GH 4UD9H 3EQ0H 2OC8A 1AUTC 1O2YA 3IG6B 1Z1JA 3A82A 2QYIA 3SU4A 1VR1H 2HOBA 3KL6A 1FAXA 3LDXH 5EOKA 2Y7ZA 4VGCB 3DD2H 5LPFA 2A7CA 3UFAA 1KTSB 1ETTH 4NZQA 1T7CA 1AI8H 1TA6A 1FPCH 1JBUH 2BZ6H 3LGTA 4JZ1A 1NFWA 2C8YB 3D65E 3ZVEA 4AG2A 2C8XB 5CHAC 1OP2A 1DY8A 1THSH 4UFFH 1TBZH 5HYOA 1SGNE 2H6MA 1Y3XA 1O5CB 4FXGH 1ESAA 1GBJA 1ZR0A 5DO4H 1EOLA 2FI4E 4Q7YA 1GJ7B 3U1JB 3O8BA 2B5TB 1UCYK 3VB4A 1DICA 3VB3A 1CQQA 2ZO3H 3VXEH 4ABFA 3M5LA 2A5IA 2ZFQH 2GCHF 4UFGH 3EYDA 1LKAA 4OS4A 1EASA 1UTMA 1GCTB 2BXUH 2QN5T 4TPYA 1JIRA 4H6SB 1YPHE 1SOTA 4B75A 1GI1A 5JB9S 1GCDA 1SFIA 2V3HH 2ZGCA 5AVDA 3VB5A 2ODPA 3GY3A 4BTUB 3RU4E 1D3DB 3ATWA 2Q1JA 3SU6A 1O3BA 4NA8A 3PYHA 3U1IB 4B73A 5L30H 1NRQH 1MTSA 2BD8A 4GUXA 2AYWA 1O3LA 5B6OA 1EAXA 3SV6A 1AO5A 4FUFA 2AERH 4MPWA 3M5OA 4X2YA 2TGPZ 3DFJA 1UK2A 1GHBF 1SGFA 1O5BB 3P8GA 1HAVA 4E7NA 1DWEH 5LPRA 1C5QA 1NT1A 4A6LA 2OBOA 2NU3E 5C1YA 4ZROA 4WXVA 4HFPB 4YLQH 1A3EH 2DE8A 3OU0A 4YT7H 2OCVB 4ISHH 3TU7H 3PTNA 3LGIA 1MU8B 2Y82A 1FN6A 6GCHG 8GCHF 3F9GA 3SGQE 1SMFE 1C2FA 1TBRH 3S9AA 5FBEA 5CE1A 3SGBE 2GDEH 1O2IA 3A7VA 3M37A 1QQUA 4WH8A 2A1DB 5JDUB 1EZUC 1FXYA 3SNCA 3FP8E 5A8YA 3E90B 3Q3YA 4U01A 2PTCE 4OS6A 1F92A 4U32A 3AW1A 3K6YA 1RS0A 3F1SB 2BY8X 1F2SE 2BY9X 2G5VA 2SGEE 2VIVA 3LGWA 2Q6GA 2C8ZB 1YCPK 2IPHA 1MZAA 4YLUA 2SGPE 1EB1H 1Y8TA 2GMTC 4CREA 1DUEA 1V2PT 3MNBA 3TITA 2WPHS 1G36A 2J2UA 3QO6A 5I46H 5FPSA 1ZPBA 3PV4A 4MPVA 3SHCH 4CRDA 3F68H 4FUJA 1O34A 2CN0H