1TRMA

The three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine proteinase)
molecule keywords TRYPSIN
publication title The three-dimensional structure of Asn102 mutant of trypsin: role of Asp102 in serine protease catalysis.
pubmed rcsb
source organism Rattus rattus
total genus 50
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1987-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trmA02
1XVOA 2VGCC 1GI9B 4K60A 4OGXA 1O31A 1O3JA 5JB9S 3A82A 3M5OA 1Y8TA 1BTUA 1MTNB 3SNEA 1TIOA 1Q2WA 2FYQA 1W7XH 2Z9KA 2AFQB 1AVXA 1ZTLA 3S69A 3A85A 1CHOG 2XC4A 3UOUA 2C8ZB 4ABDA 2ODQA 1SL3A 4BANB 4CHAC 3M7QA 2EA3A 2WPHS 4Y8YA 1EPTA 1BHXB 1BOQA 2UUFB 5F03A 4NSYA 3GCOA 2ZTZA 2Q6GA 2AMDA 3AAUA 3BV9B 1C1TA 1H8IH 2H5CA 2XC5A 2C8XB 1QNJA 3IG6B 4IMZA 3M7UA 1O2JA 3MO6A 1J16A 1ARBA 4JMYA 3T29A 2RDLA 1GBBA 3NWUA 1S84A 2FI4E 2F3CE 3LDXH 3TK6A 1C1NA 5BRRE 1HYLA 3LOXA 2PHBA 1GBKA 4ISNA 5C5OA 2TGAA 2WPIS 2QIQA 2BDBA 2CN0H 5EW1H 2ZF0H 1IOEA 2Z7FE 1O38A 1GJCB 1RGQA 1YPHC 2GT8A 4XDEA 2NU4E 2AMPA 5EPNA 3KQBA 4K1TA 1Z8GA 1LQDB 1Y3VA 3MWIU 1SHHB 3RXVA 1TWXB 1VZQH 1JMOH 1FPHH 4FUJA 3SI4H 4K1EA 3RXJA 1UMAH 1D9IA 1TPOA 4GSOA 2V35A 3ODFA 3ZZ6A 3ZVAA 1OYQA 1C5XB 1MKXK 4NFFA 2ZQ2A 1GG6B 3R0FA 3VGCC 2QY0B 1K1OA 3D62A 1CT0E 3SU0A 3ZV8A 1LO6A 4JZFH 1HNEE 4WXVA 2ILNA 1O5CB 1C1VH 4FU9A 4BAHB 2FESH 1OWEA 1GCTC 1QHRB 1QQUA 2W3IA 1IQHA 5DP4A 4RSPA 1SGNE 5IYTA 1THSH 4CBNA 1W3CA 2BDCA 1Z6EA 1KLTA 2HPPH 3C27B 3S0NA 4ISLA 4KKDA 1BBRH 2VH6A 3QTOH 1QJ1B 3SU2A 1IQMA 4Q7ZA 1TOCB 3QX5H 4FVDA 4I33A 5CMXH 1TLDA 4KTSA 3SUFA 3E3TA 2C4FH 2ZHEH 3L6PA 2O8UA 1CA0C 2F9VA 3UNRA 4UEHH 1AD8H 3LJJA 4H6TA 1MZDA 1QB1A 1GBTA 3DHKH 3TIUA 1D3DB 3SNDA 4ZKNU 1FI8A 4DY7B 1SBWA 1SLVB 1FONA 3CS7A 3W94A 1SGPE 1XKBC 1DWEH 4D7GA 7GCHG 1SR5C 2AS9A 2PUXB 3GY4A 3RM0H 4AB9A 1P10A 3Q3YA 3FP8E 3RXAA 3A7ZA 4JK5A 1C5TA 4ABFA 2WPJS 2Y5GA 2FOMB 1TRYA 3M5NA 3UR9A 1EJNA 1BITA 2D26C 1E37B 3GY3A 1GDQA 1QURH 1P03A 1UVPA 1TRMA 4FUIA 1ELBA 1QB9A 4GCHG 1MH0A 2ZFTA 4DCDA 2PKAB 2WV5A 4WWYA 2A32A 1O3FA 1INCA 1T31A 4K5ZA 2J34A 2NU3E 1D3TB 1BMLA 2A4QA 1ARCA 1G30B 2QCYA 4GAWA 1WSSH 1C2LA 2SGEE 5DPAA 3SUGA 4MPXA 1U6QA 2FLRH 3E1XB 1GHZA 4ABAA 3GY2A 2XBXA 2A5KA 4XSKU 4LZ4B 3RC4A 2XCFA 4YOJA 4ISOA 2GCTC 1F0SA 3E91A 5DO4H 1O2TA 1DANH 1O2VA 2EI8A 3SU3A 4FUHA 2J94A 3BTQE 1C9PA 3MU5A 1BMNH 3UQOA 2OTVA 2Z3CA 2ZHFH 1C5MD 3SU4A 3MMGA 3UR6A 3H7TA 1GI2A 1MZAA 5L2YH 1SLXB 1Y5AT 1QBVH 3PYHA 3RXLA 4BNRA 2PGQB 2B5TB 3A81A 3UNSA 1WTHD 1SLUB 4VGCC 2Z3EA 1RD3B 1GBCA 4U2WA 2H9TH 5AFZH 1C9TA 1KLJH 1P05A 1EAUA 1GHVH 1AFQB 1D3QB 1KLIH 1S0QA 1VJ9U 2WPKS 4Z6AH 3RXFA 2OQ5A 2FOGA 4NSVA 1IQJA 1BA8B 3GDVA 1EZSC 1FPCH 3ZZAA 2XC0A 3A8DA 1OS8A 1P06A 1O2LA 1NROH 4ABBA 2AH4X 4DVAU 2BM2A 3MU1A 1HGTH 1QTFA 1HCGA 1GBDA 5EGMA 4CRBA 2WYGA 2P3TB 1E38B 1KXCA 1A46H 2HALA 2OXSA 2TIOA 2ZHWH 1AI8H 3RC6A 2BD5A 2QF0A 3RU4T 6LPRA 2P16A 2D8WA 2BDGA 2F9UA 1Z8IB 1WV7H 1ZHRA 1L0ZA 4IN1A 3CENA 1GBIA 4BOHA 2TBSA 4E7RG 5FAHA 4IBLH 1ZSKA 3VFEA 4OS1A 3FZZA 1XXFA 2XWBI 1ZMNA 3UTUH 1ELDE 1SFQB 1F2SE 4Y7BA 4TY7A 3SV8A 3QZRA 2ULLA 1C5UA 4X6OA 3ZZ3A 2ODPA 3SGAE 4XE4A 2RA3A 1J9CH 3E0NB 3TH2H 5C5NA 1OPHB 3LPRA 1C1UH 5AVDA 1HJ8A 3R3GB 1OWJA 3QWCH 4AN7A 3UWJH 2DE8A 3KQCA 1BIOA 2XWAA 1MKXH 1FAKH 2P8OC 1N8OB 1VCWA 1V2KT 2V3HH 4IMQA 4NZLA 5K7RA 1C1SA 3PMBB 1QR3E 3A87A 5F6MA 1DSUA 3S7KB 1EB2A 1SI5H 2I6SA 1IAUA 5A8XA 2BB4A 1KTTB 1TONA 2VINA 1NS3A 4JZIA 1O3MA 1C2GA 2A4OA 1LPZB 1GJ7B 2R0KA 1BQYA 1ZTKA 3NK8A 3D49H 4XBCA 2C93B 1L4DA 2Q6FA 1F0UA 3LC3A 2ZDAH 5T6GA 1VITH 1N6YA 4XBBA 3RXIA 1E36B 2BD4A 2A31A 2GP9B 3PTNA 1PPEE 3TNTA 1RIWC 2B8OH 1V2UT 2CGAA 2J38A 4AFSA 2Y82A 2Q6DA 1DLKB 1JIMA 1LVYA 2FOFA 1NRNH 3SU6A 4CHAB 1FMGA 2ZKSA 4ZKRU 1GJ9B 1GJ6A 2JKHA 3JZ2B 4YESB 2G8TA 1S6HA 1JRTA 3QGJA 5DJ7A 1ZGVA 2OCVB 1IQEA 8GCHF 1KXFA 2Y5FA 1OKXA 4HZHA 2BZ6H 5EQRA 3SHAH 1NRSH 1UTJA 5LPRA 3A7TA 1GBMA 3M5MA 3UOPA 1O5BB 4J1YA 4MPUA 2VIQA 1LHCH 3P8FA 4DW2U 3GDSA 1K1PA 3T27A 2F9BH 2THFB 5EW2H 1GHBG 1P0SH 1DVAH 2ANKH 3SJOA 1J17T 2OBQA 1C1PA 1GHBF 1HAGE 1SGQE 5F8ZA 1K1LA 1PPFE 2FX4A 4BTIB 1SOTA 1TX7A 1VCQA 1XUHA 1C5SA 2PKAA 4Y71A 4CR5A 1LTOA 4B75A 1Z8RA 4WJG2 1EAIA 3BTEE 1O3IA 4MG3A 2JH0D 1EATA 1GHXH 2KAIA 3KHVA 1SGDE 2ZDVH 1TA2A 1W12U 1CVWH 2HRVA 4OS4A 1BJVA 3RU4E 1MCVA 1SGRE 1V2VT 2BD3A 1BRCE 2Y81A 2Z9JA 2A4RA 1NY22 2A2XH 2BDHA 1O2PA 4AORA 4RN6A 4MVNA 3TU7H 4JZ1A 1AKSB 4AX9H 1CO7E 1FY8E 3F6UH 5G4BA 1EP5A 1OWDA 2ZU3A 1EASA 2CXVA 1PQ5A 3BTHE 1C5VA 1F0TA 1TQ7B 1GDUA 1DLEA 1W0ZU 3LH1A 4XFQA 4KTUA 3B8JA 1C5ZB 2R3YA 2BY5X 2BY8X 5GCHG 5DP3A 3GCHC 2UWLA 1TNLA 3DA9B 4I8HA 5GCHF 2BLOA 5GWZA 5FBIA 1UCYK 1SGIB 1TNKA 1A5HA 4NA8A 3F68H 3I29A 1C5OH 1YBWA 1SGFG 1NN6A 1YPJH 1VITG 1H8DH 1LCYA 2JH6D 2H9HA 1NPMA 6CHAB 1ANEA 1ELTA 2VH0A 2XBYA 1CA0B 2UUJB 4LXBH 3ZYDA 1VITF 5A2MH 1CBWB 3F1SB 3MI4A 3RXBA 1QA0A 1XX9A 1GI3A 4FUDA 1YLDA 3SJKA 3RXEA 1C1RA 1Y3YA 1EKBB 3NCLA 1A0JA 2AERH 3ZVFA 4AGJA 5DP6A 1DT2A 4SGAE 2BY9X 1C5RA 4X1RU 3MH5A 1H9HE 5DP9A 1DICA 1TGBA 2BHGA 1Z1JA 1V2WT 1K1MA 2A7HA 5DKMA 4ZKOU 4K1SA 1V2JT 3FVFB 1WCZA 2QXJA 5DG6A 1O2ZA 3PWBA 2BTCE 1Q3XA 4WF8A 1TB6H 1QA7A 1ELCA 4TYDA 1M9UA 1O39A 1HAVA 5F8XA 5FBEA 2PSYA 1AVGH 2XRCA 3M5LA 1FV9A 1GHAG 1PPHE 4AYVB 4YOGA 3GOVB 3SN8A 3OU0A 1GHAF 4YTAA 1Z1IA 3S9AA 2GZ9A 2ZPRA 3LGIA 1W0YH 2GMTC 1O3EA 2GCTB 2YNBA 4IS5A 5EXNA 1ETRH 3RXHA 4OGYA 1RTLA 4WH8A 1A2CH 5DP8A 1A0LA 3BTTE 1O2NA 4B2CA 1MU8B 1JOUB 1TFXA 3U1JB 1WBGB 4B71A 1SB1H 5FHTA 2VJ1A 3UUZA 4R0IA 2B7DH 1PPZA 1EUFA 4VGCB 4O97A 4K3JA 2FTLE 3NPSA 1UVUH 3MH4A 1FZZA 1O5AB 3RXDA 5FX6A 1TNGA 3MO9A 3LC5A 4ASHA 4ISHH 1A5GH 4K69A 2P94A 1G37A 2A7CA 2D1JA 3LGYA 2QXIA 1NO9H 1H1BA 1D6WA 1OWKA 4ZAEA 2AIPA 2GZ7A 1SC8U 1A61H 5ABWA 1B0FA 2XCNA 3M3SA 1E34B 3OY5U 1LHGH 3SI3H 3QDZB 2FIRH 4I8LA 3MTYA 1ZPBA 3ZVCA 3E6PH 2A5AA 3DFJA 1TABE 1FUJA 4CBOA 1DX5M 1O2YA 2QXGA 3TH3H 2IN2A 1AN1E 5T6FA 1BT7A 2ZDMA 3A83A 2BMGB 1S81A 1GL0E 2ZO3H 1CGHA 5L30H 4ZXXH 2A1DB 3SU5A 1AZZA 2SGQE 2Z9LA 1IQIA 2VU8E 3T62A 1GJBB 3TNSA 3VB4A 1ZLRA 3PTBA 1TPSA 4X1NU 5JBBS 3C1KA 1UVSH 1CA8B 1HJAC 3P70B 2CJIA 1LKBA 3SV2H 3BTGE 3QTVH 1ZPZA 5A09A 1ZGIA 2RCEA 2WINI 4FUFA 1GBAA 3P6ZB 4Q7YA 5AFYH 3UFAA 3QUMP 5E0GA 3KF2A 3RMOH 1PFXC 4ABGA 3SQEE 3U8TH 3LGWA 3VB7A 5HXFA 2P8OB 5I46H 3GY7A 4Y76A 2OP9A 2CF8H 5BPEA 2YNAA 4GPGA 1EX3A 1DUEA 3ITIA 3SJIA 1AKSA 1KTSB 2I6QA 1YPMH 1O3OA 5EG4A 2AGIX 8KME2 3EYDA 1VR1H 3DFLA 3RXSA 3I78A 3PLBA 3BIUH 5HMAA 5HM2A 1Z71A 1HAOH 1ABJH 5A0CA 3GCNA 3MHWU 1GBHA 2HVXA 3SUDA 1AMHA 1DSTA 1T4UH 1UCYH 4RKJB 1LHEH 3M3TA 1ZYOA 2VWMA 1RIWB 4IGDA 2YOLA 2C8WB 1WUNH 2ZPSA 1ORFA 1L2EA 1CSOE 1MTSA 3A7XA 2B0FA 2WV4A 5CHAC 2PLXA 3MNSA 3TGKE 1SLWB 3WY8A 1DPOA 4NFEA 3SGQE 3VXFH 1YPHE 1S83A 4CRDA 3BF6H 4Y0ZE 1WYKA 1TMBH 1TX6A 3SJ8A 3QZQA 3SW2B 1UTLM 6CHAC 4UFEH 2AGEX 4NWKA 3LGVA 3TK9A 3TGJE 1CBWC 1XM1A 2D2DA 1J8AA 1W8BH 4MNYA 2CF9H 2TGTA 2GZ8A 1ELFA 5JBCS 4NIXA 3K2UA 1QQ4A 2ZIQH 1K1IA 4K8BA 2FS9A 3MNXA 2DUCA 3SJ9A 2BQWB 3E16B 1QFKH 1TA6A 1MKWH 4NIYA 2R9PA 4AFUA 1CQQA 4I7YH 2M5TA 1TPAE 4KELA 1J14A 4I8JA 3STJA 1GI7B 1KXAA 1P2QA 3RLWH 4O3UA 2QV1A 3RMLH 1RFNA 4X6MA 4AGKA 1L1JA 3ESTA 1WU1A 1A3BH 2KAIB 4FUCA 3BG4C 1O30A 2EI7A 3GISB 1GJAB 1Y59T 3FZDA 5EQQA 4X8VH 3U8OH 2ZCKP 2VWNA 1IQFA 1ACBE 1AUJA 3KCGH 1LVOA 1DUAA 1KYNA 2XBVA 1O5DH 5JYIA 3HGNA 5C20A 1GI1A 2J4IA 3BEUA 1DOJA 1QRXA 4O3TA 1AY6H 3D65E 3GCHB 5EPYA 1C1WH 3QLPH 1O3GA 3T25A 2HGTH 3HGPA 1KXBA 2Z94A 3A8CA 2QAAA 2BQ6B 4O03A 4HTCH 1N1LA 2ZA5A 3PO1C 2ZZUH 4GHQA 2A2QH 4ZXYH 1O3HA 1VGCC 5LPEA 1EP6A 2Z6BD 3OY6U 1FIZA 1V2ST 3PLKA 1T8LA 2UUKB 3A86A 4KP0A 1WQVH 5GJ4B 4NZQA 1PPCE 4X0WU 1C5NH 3PROA 1NTPA 4ISIH 1SSXA 4CRAA 1DE7H 1XUFA 1PYTD 4CR9A 1MTWA 4NWLA 3SNCA 3M36A 1P2MA 3AW0A 1BRAA 4ZKSU 1NU9A 1GHYH 2FOBA 3E8LA 1E35B 1W10U 1Z7KA 4NG9H 4MQAA 2FXRA 1MAXA 2Z9IA 3GICB 4YT6H 4AFZA 4TPYA 1P04A 3V12A 1K1JA 3MH6A 1EZQA 2C8YB 1HPGA 1UTKA 4CREA 2ZU1A 3RLYH 1QL8A 3RXMA 1CGIE 3TPIZ 5LH8A 1V2PT 2HNTC 2ZFPH 1WAYB 4H4FA 1QBNA 5E0HA 1DXPA 1PQ8A 2O8WA 3HPTB 2BXTH 2F91A 5DGJA 1MUEB 5T3HA 5EOKA 2PFEA 1BTZA 3EQ0H 1O5GH 1YGCH 1MQ5A 1OSSA 3ZVEA 2XTTB 1HAVB 2J2UA 3KL6A 3TITA 2GMTB 2Z3DA 1ZSLA 4AOQA 1GGDC 1KDQB 2OC1A 3GY5A 4B1TA 2W26A 4JK6A 4YM9A 3TJUA 3PWCA 5EXLA 3SV6A 3MNBA 1GI4A 1O2UA 1SG8B 1UK3A 1ZJKA 2PTNA 1A3EH 2BX4A 2OD3B 3F9EA 1BRUP 3EA7A 1F7ZA 2GCHG 1HAXB 3U1IB 2ODYB 4Y11E 3MU0A 4A1VA 4A1XA 3A84A 3SNAA 1UVTH 2GCHF 3ODDA 4AYYB 1ELEE 3AW1A 3F9FA 2HNTE 3SU1A 3K65B 1NFXA 3RMNH 2GDEH 1H4WA 1BB0B 1UTMA 1IHTH 3UREA 1ID5H 4IC6A 4I8GA 4I8KA 1SVPA 1SMFE 3P95A 4ESTE 1O2IA 2UWOA 1C5PA 1CT4E 1TALA 3BEFB 1A5IA 1F0RA 2Z9GA 2A45B 4OS5A 1UTOA 2IPHA 4UONA 5GPIB 2FYRA 5AF9H 4R8TB 3P8GA 3H7OA 3PB1E 3OX7U 2GD4B 3BTKE 4A92A 2SNVA 1TNJA 2ZG0H 3RXTA 5ETXA 3TJOA 1C2IA 2ZFSA 5GIBA 4DG4A 1BTPA 2HWLB 1V3XA 2F9OA 1JIRA 1T8NA 1F5KU 2BDYA 4XBDA 2GV6A 1O34A 1C5LH 3ZZCA 1DWDH 3TGIE 1GJ5H 3QGNB 1O3KA 4X2YA 1F92A 5J4QA 1JXPA 5HYOA 5A0BA 4GLYA 4Q80A 3LH3A 4MTBA 1GPZA 8GCHG 1AQ7A 2CHAB 4X2WA 2Y5HA 4BTTB 1V2MT 4BAQB 1CHGA 1HJAB 2NU2E 2XBWA 3CP7A 3JZ1B 2AMQA 2PGBB 4BTUB 1P3EA 3U8RH 4NGAH 2WUBA 4YLUA 2P3UB 3T2NA 1O2XA 4O9VA 1X7AC 1BHXF 1BTXA 1DY9A 3SQHE 2BOKA 1W11U 1MQ6A 1TBRH 3ATLA 1GMCF 4IC5A 2OLGA 1AO5A 4E05H 5E8EH 4LK4A 3H5CB 4NIWA 1HUTH 2BVRH 3RXOA 1O36A 3O8DA 1ESTA 1L4ZA 3P8NA 1Y5BT 3GCTF 2LNCA 3VB6A 1ZZZA 4KTCA 5E0JA 1P02A 5K0HA 2ZNKH 2AIQA 3M3VA 3AAVA 2VB0A 4ZROA 5HGGA 1BJUA 4MDSA 1O0DH 2ZTYA 3P8OA 2J92A 3QK1A 5T6DA 7LPRA 1IQNA 3ZVGA 4JZEH 1EB1H 1PPGE 1ZTJA 2GKVE 4Y10E 1XUKA 1KY9A 1YCPK 1ZSJA 3OTJE 1P12E 1DS2E 1BTHH 1GL1A 1P2OA 4UFFH 1HDTH 3SO3A 1H9LB 1PPBH 2GV7A 1G2LA 2BOHB 5CHAB 1CE5A 4A1TA 2XXLA 3TJVA 3OYPA 1OOKB 1FY4A 2VIDA 3M7TA 3PLPA 2BLWA 2PKSC 1QY6A 2ZU5A 5TCAA 5DK1A 4MLFB 2FEQH 2BDIA 3BN9A 4X8TH 1K28D 1EOJA 3ZZ9A 3ZV9A 2ZPQA 4FU7A 4X1SU 3S9CA 2IOTA 5JPMH 1ELAA 2FLBH 5SGAE 1MD7A 5C1UA 1TMUH 1UK4A 3FP7E 1SGCA 1T4VH 1SQAA 2A5IA 5EXMA 4BXWA 3P92A 2QGRA 1AUTC 3Q77A 4DGJA 4QT8C 5A8YA 1IQLA 2OQUA 5CE1A 1O2WA 1SPJA 1UTNA 1TBQH 3VXEH 2TGDA 3DUXH 5PTPA 2C3SA 2BDAA 1NFUA 3MU4A 4JYTA 1N6XA 2BY7X 2CMYA 2ZWLH 5DP7A 4INLA 1YLCA 1J15A 1XVMA 1O3LA 4DURA 2ZI2H 1K9OE 1ANCA 1ZRKA 3ELAH 2O8LA 4GVUA 4WXIA 5LGOA 1F5LA 1JBUH 1AGJA 1UTQA 3A8AA 1C5QA 1AWFH 1BRBE 4FU8A 1SQTA 1JRSA 3SV7A 1GBEA 3BG4B 3BSQA 3A80A 3IWMA 2RA0A 4ZMAH 1T8OA 2PR3A 1KDQA 2G5NA 1ESAA 4X2XA 1AB9C 2F83A 1NC6A 5GXPA 4CRCA 3O8RA 2PSXA 1ANBA 5AHGH 1DM4B 1LPGB 2ZU4A 2Y6TA 3BIVH 3URDA 1XUIA 3GY8A 1AZ8A 2PWXA 2BLVA 3PO1B 4F49A 1CU1A 4YLQH 1LQEA 1GBJA 1A1RA 1C2DA 5C67A 1MBQA 1VGCB 2ALVA 5JBTA 2AYWA 1XUJA 2WYJA 2PV9B 1O37A 2AEIH 3I77A 2ZDLA 4E06H 2G81E 4Y79A 3GDUA 1GMDG 3PMJA 1ZJDA 5F8TA 1QRZA 3UY9A 1ZRBA 1TMTH 1GMDF 4GUXA 4MNXA 3PMAB 3LGTA 1O2KA 2V0BA 2PUQH 3L33A 4I32A 4LZ1H 2P3FH 1MBMA 2W7UA 1C2FA 1GBLA 3SNBA 3NXPA 4K8YA 3SUEA 1YYY1 2J9NA 4UD9H 3PV4A 3M35A 1F5RA 2ZP0H 3F9HA 4E7NA 4NCYA 5A8ZA 2AGGX 2FODA 1BTWA 2CV3A 2FI3E 1TE0A 1GI8B 1V2NT 2SGPE 1MTVA 1YP9A 2SGFE 1FIWA 1TGCA 3GYMA 2O8TA 3Q3KA 2O8MA 3FFGA 3T26A 3W95A 1MU6B 2ALPA 2CHAC 3ATMA 2BD7A 2ZECA 1TNIA 4H42U 2F9NA 2SGDE 4U30A 1FY5A 3ENSB 1FY1A 1V6DA 3B9FH 4THNH 1GGDB 4CH2B 1S0RA 3HK6B 5EU8A 3A8BA 3RDZA 1A4WH 2R0LA 3UNQA 1CHOF 3EA8A 5FPTA 5H4IB 1DITH 1HAIH 3PM3A 4JYVH 1HAYB 1G3DA 1A7SA 4A7IB 1HAHH 1BUIA 1HV7A 2NU0E 4X6NA 2H9EH 2ZDKA 3U9AH 3T5FH 1EPTC 2XNIA 1GI0A 1P11E 3ZZ8A 1WTGH 1Z8JB 3M37A 2ZDNA 1C1QA 2JH5D 1O3DA 3HKIB 1DY8A 4Y8ZA 2ZFQH 1OP8A 4X2VA 2NWNA 3UWIA 1YCPH 3KNXA 5L6NH 1GVKB 3SHCH 5FX5A 2FWWA 2BD2A 2C90B 2ZHQH 4HI3A 1FNIA 1FY3A 1MD8A 4Q7XA 2FS8A 2V6NA 6GCHG 1FDPA 1O5EH 1SGYE 4J2YB 1OP0A 1O32A 4ZHLU 6GCHF 1K1NA 1HLTH 3QN7A 3S9BA 3SV9A 1TOMH 3MO3A 3UIRA 4FXGH 2HPQH 1OXGA 5I25A 2FI5E 2R3UA 2OINA 1Z6JH 3CS0A 1A0HB 3EA9A 2FPZA 1FXYA 2ASUB 1O2MA 4TPIZ 3ZZ5A 1AWHB 1S85A 1LVBA 3RXGA 1PJPA 1ZR0A 4CRFA 3K6ZA 2R2WU 1K21H 2IJOB 1AE5A 4X6PA 5C1YA 1P2IA 3ATKA 1YCPM 3VEQB 1DWBH 4MNWA 3V0XA 5FCKA 1TPPA 3F9GA 2VVCA 4MPVA 3DT0H 2A4GA 5LPFA 1QL9A 1YM0A 1HBTH 2QYIA 4Y0YE 1PQ7A 1UVOA 2G4TA 3UPEA 3SGBE 3URCA 1OWIA 3ZYEA 1NFWA 1BDAA 1FJSA 4WVPE 3FAOA 1ZMLA 2ZGCA 4D9RA 1DDJA 1UHBB 1Y3WA 2OC7A 1G3BA 3RUOA 1QCPA 3SORA 4B73A 2FTMA 3SZNA 1W7GH 4AZ2B 2H2ZA 3VB3A 1DWCH 4NA7A 3ZZBA 1ZHMA 4ABJA 1GVZA 4MNVA 7GCHF 4Y8XA 1ETTH 3KEEA 1EJAA 4LOYH 2ZQ1A 3ZZ7A 1QBOA 9LPRA 4ZUHA 2ZGHA 3TLOA 4FUEA 2ZFFH 1EQ9A 1FAXA 1SGTA 1XKAC 1UCYE 1AVWA 2FZZA 2QC2A 8ESTE 2WPLS 1KIGH 3HKJB 4GCHF 3GY6A 4U32A 1AE8H 1QJ6B 2ZGBH 3LKWA 1GJ8B 3MU8A 1BBRE 3RXKA 1T7CA 1TGNA 5JB8S 4CRGA 3A7WA 3N7OA 1QIXB 2VIPA 4A6LA 1NM6A 2GDDA 5JBAS 3NKKA 1YC0A 1BTYA 2PKSB 1T32A 5E2OA 1NRRH 1G32B 1HIAB 4SGBE 5C1XA 2UUYA 1P09A 2BVSH 7KMEH 2V3OH 4D8NA 1GI6A 2TPIZ 4BAKB 4BAMB 3Q3XA 1G36A 1VCPA 4DT7B 2FOHA 4Y6DA 1HAPH 1O2QA 1IQKA 2OC0A 2GX4A 1LKAA 2VIWA 1YPGH 1JWTA 4ZH8A 2BD9A 2BVXH 3ZVBA 2OC8A 1G2MA 1HB0B 3Q76A 4TY6A 3TH4H 2W5EA 1GDNA 3MFJA 3BTFE 2VIVA 4U01A 1S82A 3K6YA 2A7JA 2JETC 4WMEA 3A89A 3PMHB 1OP2A 3MH7A 2G4UA 1TYNA 1QB6A 1QRWA 5EODA 2W7SA 4Q2KA 1NZQH 1P01A 1UK2A 1G9IE 1O3NA 1FLEE 1KXDA 1P2JA 4PROA 2RG3A 3BTME 5A0AE 1O3CA 1TAWA 2WPMS 4HFPB 4FUGA 1IHSH 1S5SA 2ZGJA 3KGPA 3V3MA 1V2QT 4YO9A 3ATWA 1TRNA 1ESBA 1WOFA 2ZTXA 3AVZA 3VPKA 2P59A 1HXFH 4DOQA 1AB9B 1MTNC 3RXPA 1XXDA 1L1NA 1MMJN 5C2ZA 9ESTA 3IITA 1AFEH 4Z0KA 4ABHA 1HXEH 2BXUH 3EE0B 2STBE 1P57B 1ZOMA 1C1MA 4MPWA 4D76A 3M61U 3E90B 5EQSA 3ZZ4A 5GDSH 1FQ3A 1PYTC 1FN8A 1HRTH 1E0FD 1RS0A 1EAXA 4WMFA 1EOLA 1CGJE 1P9UA 1W14U 4K2YA 5C3NA 5L2ZH 1GJDB 1O2GH 1BZXE 1B0EA 4OS7A 3STIA 3RU4D 3SBKA 1O3BA 1GVLA 2ZEBA 3LU9B 1THRH 1V2LT 1O33A 5TJXA 3ZVDA 1EZUC 4AG1A 1ABIH 1MAYA 3U69H 2VWOA 2VVVA 3EGKH 1W13U 1IQGA 4WY3A 1C2HA 1AHTH 4JYUH 1LVMA 1NT1A 1RRKA 4DJZB 1SOZA 2A0QB 2FO9A 5B6OA 1ANDA 4X8UH 4FUBA 1ZMJA 1EAWA 1GG6C 4X1QU 1NESE 1UTPA 2HLCA 2SNWA 4B2AA 3V13A 4WMDA 4IN2A 3RXCA 1K22H 2XYAA 1ETSH 1PQAA 2VGCB 1SGFA 2G51A 3FANA 2FOAA 2W3KA 4YZUA 2QA9E 1V2TT 5JDUB 5HM9A 2HNTF 1D3PB 1AU8A 5TCCA 1Y3XA 4M7GA 5FXLA 1S6FA 1RTFB 3LGUA 1GJ4H 2BD8A 1C1OA 3B23B 1DXWA 1P3CA 3E0PB 3NUMA 3LJOA 2TRMA 1OWHA 4B74A 1B5GH 4YT7H 2ZU2A 1ZPCA 3BG8A 2F9PA 1UHBA 4UFDH 1FN6A 1GMCG 2QN5T 4ZHMU 1EZXC 2FOEA 1GMHG 3RC5A 4I31A 1AIXH 3MOCA 1EPTB 1VJAU 3TVJB 1GMHF 3DD2H 3GCTG 1GHWH 2NU1E 2H1UA 1KXEA 1NRQH 2ZGXH 3U98H 4AFQA 8LPRA 4UDWH 1ELGA 1HJ9A 6ESTA 1SGEE 2BLQA 1YPEH 2ZC9H 2Q1JA 2PW8H 3AASA 1YF4A 3LT3A 2Y7ZA 4OS6A 2FDAA 1C4U2 1TNHA 4ABIA 1O2OA 1OX1A 3SOSA 1NFYA 2FX6A 3LONA 2GVFA 1BCUH 4FVBA 1LHFH 1K2I1 1NRPH 2ESTE 1O3PB 2UWPA 5FPYA 4H6SB 1G3CA 1ELVA 1SFIA 4JCNA 1O2HA 1O5FH 4HGCA 3VGCB 3S7HB 2FM2A 1HIAA 1EJMA 4INHA 1YKTA 4F4OC 1QJ7B 2BX3A 1SHYA 4KGAA 2G55A 2LPRA 2BQ7B 1XUGA 1GCTB 1O2SA 1V2RT 1OYTH 2ANMH 1GCDA 5DP5A 3L3TA 2ANYA 4D9QA 2BY6X 4TWYA 1V2OT 3P17H 3ZZDA 5FCRA 1LPKB 1LHDH 1L1GA 2BYAX 2EC9H 1HAZB 1RTKA 2EEKA 2K1QA 2B9LA 2ZFRH 1RJXB 1B7XB 1CT2E 1MTUA 3HATH 1Y5UT 2GGVB 3RXUA 3KIDU 3NZIA 4DIIH 1QL7A 2G52A 4NA9H 1LMWB 2OBOA 4RKOB 2P95A 1GWAA 3VB5A 1T8MA 2BZAA 1BBRK 2FOCA 2QXHA 3GYLB 4A5TS 4UE7H 2STAE 3Q00A 1WQSA 3ATIA 1RXPA 4AG2A 2SFAA 1TGSZ 2PTCE 3RMMH 4WH6A 5J4SA 2DE9A 3OSYA 4TWWA 1AFQC 3KQDA 1W2KH 3HK3B 1TBZH 1TQ0B 1TX8A 1UJ1A 3BTDE 4D7FA 1P8VC 1C5YB 2VWLA 1C2EA 2VVUA 1HFDA 1O2RA 4X1PU 1LDTT 4B76A 2H6MA 1UO6A 2WUCA 5ESBA 1D6RA 4OS2A 3FP6E 1C4V2 5E2PA 2ZCHP 5ESTE 2Y80A 1C4Y2 3RM2H 3TK5A 1MKWK 1ZHPA 2SGAA 3O8BA 4ABEA 4UFGH 3RXQA 4IW4E 3G01A 2GT7A 7ESTE 2ZCLP 2ZHDA 1C2MA 2FP7B 1C5WB 2QF3A 3KN2A 2R2MB 4B2BA 2G00A 4CH8B 1TGTA 3EAJA 1P9SA 1QGFA 1P2KA 4GHTA 2GTBA 3LIWA 1Y3UA 2HOBA 1Q31A 4INKA 1XMNB 2OUAA 1MCTA 2TGPZ 3A88A 5FPSA 2ANWA 3RP2A 1YPKH 1P2NA 4BXSA 1KSNA 3QO6A 2EI6A 2VIOA 1BMMH 3O8CA 3TJNA 1G3EA 3EDXB 1O3AA 1D4PB 3T28A 2FMJA 2P93A 2J95A 3A7VA 2XW9A 3BTWE 3K9XB 2VNTA 1C2JA 3V7TA 1SQOA 2JETB 2G5VA 1N8OC 4NIVA 1YPLH 1GI5A 4XOJA 1THPB 4Y7AA 3BEIB 3A7YA 4JZDH 4BAOB 4X8SH 3KQEA 1BMAA 4AB8A 3UQVA 5IDKA 3MNCA 1C2KA 1O35A 4YOIA 1EXFA 4ZHAA 2O9QA 1H9IE 1NU7B 1DFPA 3MYWA 4DIHH 2Y7XA 3RXRA 2H5DA 3D23A 1GBFA
chains in the Genus database with same CATH superfamily
1XVOA 4TSFD 2VGCC 1GI9B 4K60A 4OGXA 1O31A 1O3JA 5JB9S 3A82A 3M5OA 1Y8TA 1BTUA 1MTNB 2KCAA 3SNEA 1TIOA 1Q2WA 2FYQA 1W7XH 2Z9KA 2AFQB 1AVXA 1ZTLA 1YLNA 3S69A 3A85A 1CHOG 2XC4A 3UOUA 2C8ZB 4ABDA 2ODQA 1SL3A 4BANB 4CHAC 3M7QA 3NRLA 5DSFA 2EA3A 2WPHS 4Y8YA 1EPTA 1BHXB 1BOQA 2UUFB 5F03A 4NSYA 3GCOA 2ZTZA 2Q6GA 2AMDA 3AAUA 3BV9B 1C1TA 1H8IH 2H5CA 2XC5A 2C8XB 1QNJA 3IG6B 4IMZA 3M7UA 1O2JA 3MO6A 1J16A 1ARBA 4JMYA 3T29A 2RDLA 1GBBA 3NWUA 1S84A 2FI4E 2F3CE 3LDXH 3TK6A 1C1NA 5BRRE 1HYLA 3LOXA 2PHBA 1GBKA 4ISNA 5C5OA 2TGAA 2WPIS 2QIQA 1OHHD 2BDBA 2CN0H 5EW1H 2ZF0H 1IOEA 2Z7FE 1O38A 1GJCB 1RGQA 1YPHC 2GT8A 4XDEA 2NU4E 2AMPA 5EPNA 3KQBA 4K1TA 1Z8GA 1LQDB 1Y3VA 3MWIU 1SHHB 3RXVA 1TWXB 1VZQH 1JMOH 1FPHH 4FUJA 3SI4H 4K1EA 3RXJA 1UMAH 1D9IA 1TPOA 4GSOA 2V35A 3ODFA 4XRNA 1QZ8A 3ZZ6A 3ZVAA 1OYQA 1C5XB 1MKXK 3GS9A 4NFFA 2ZQ2A 1GG6B 3R0FA 3VGCC 2QY0B 1K1OA 3D62A 1CT0E 3SU0A 3ZV8A 1LO6A 4JZFH 1HNEE 4WXVA 2ILNA 1O5CB 1C1VH 4FU9A 4BAHB 2FESH 1OWEA 1GCTC 1QHRB 1QQUA 2W3IA 1IQHA 5DP4A 4RSPA 1SGNE 5IYTA 1THSH 4CBNA 1W3CA 2BDCA 1Z6EA 1KLTA 2KZ4A 4XD7D 2HPPH 2YMSB 3C27B 3S0NA 4ISLA 4KKDA 1BBRH 2VH6A 3QTOH 1QJ1B 3SU2A 1IQMA 4Q7ZA 1TOCB 3QX5H 4FVDA 4I33A 5CMXH 2JIZD 1TLDA 4KTSA 3SUFA 3E3TA 2C4FH 2ZHEH 3L6PA 2O8UA 1CA0C 2F9VA 3UNRA 4UEHH 1AD8H 3LJJA 4H6TA 1MZDA 1QB1A 1GBTA 3DHKH 3TIUA 2J98A 4OM9A 1D3DB 3SNDA 4ZKNU 1FI8A 4DY7B 1SBWA 1SLVB 1FONA 3CS7A 3W94A 1SGPE 1XKBC 1DWEH 4D7GA 2K0QA 7GCHG 2IPQX 1SR5C 2AS9A 2PUXB 3GY4A 3RM0H 4AB9A 1P10A 2OK5A 3Q3YA 3FP8E 3RXAA 3A7ZA 4JK5A 1C5TA 4ABFA 2WPJS 2Y5GA 2FOMB 1TRYA 3M5NA 4I86A 3UR9A 1EJNA 1BITA 2D26C 1E37B 3GY3A 1GDQA 1QURH 1P03A 1UVPA 1TRMA 4FUIA 1ELBA 1QB9A 4GCHG 1MH0A 2ZFTA 4DCDA 2PKAB 2V7QD 2WV5A 4WWYA 2A32A 1O3FA 1INCA 1T31A 4K5ZA 2J34A 2NU3E 1D3TB 1BMLA 2A4QA 1ARCA 1G30B 2QCYA 4GAWA 1WSSH 1C2LA 2SGEE 5DPAA 3SUGA 4MPXA 1U6QA 4F48B 2FLRH 3E1XB 1GHZA 4ABAA 3GY2A 2XBXA 2A5KA 4XSKU 4LZ4B 3RC4A 2XCFA 4YOJA 4ISOA 2GCTC 1F0SA 3E91A 5DO4H 4Q4LA 1O2TA 1DANH 1O2VA 2EI8A 3SU3A 4FUHA 2J94A 3BTQE 1C9PA 3MU5A 1BMNH 3UQOA 2OTVA 2Z3CA 2ZHFH 1C5MD 3SU4A 3MMGA 5C0UA 3UR6A 3H7TA 1GI2A 1MZAA 4Z1MD 5L2YH 1SLXB 1Y5AT 1QBVH 3PYHA 3RXLA 4BNRA 2PGQB 2B5TB 3A81A 3UAIC 3UNSA 1WTHD 1SLUB 4VGCC 2Z3EA 1RD3B 1GBCA 4U2WA 2H9TH 5AFZH 1C9TA 1KLJH 1P05A 1EAUA 4AC9A 1GHVH 1AFQB 1D3QB 1KLIH 1S0QA 1VJ9U 2WPKS 4Z6AH 3RXFA 2OQ5A 2FOGA 4NSVA 1IQJA 1BA8B 3GDVA 3FKSD 1EZSC 1FPCH 3ZZAA 2XC0A 3A8DA 1OS8A 1P06A 1O2LA 1NROH 4ABBA 2AH4X 4DVAU 2BM2A 3F2GA 3MU1A 1HGTH 3SYJA 1QTFA 2AHME 1HCGA 1GBDA 5EGMA 4CRBA 2WYGA 2P3TB 1E38B 1KXCA 1A46H 2HALA 2OXSA 2TIOA 2ZHWH 1AI8H 3RC6A 2BD5A 2QF0A 3RU4T 6LPRA 2P16A 2D8WA 2BDGA 2F9UA 1Z8IB 1WV7H 1ZHRA 1L0ZA 4IN1A 3CENA 1GBIA 4BOHA 2TBSA 4E7RG 5FAHA 4IBLH 1ZSKA 3VFEA 4OS1A 3FZZA 1XXFA 2XWBI 1ZMNA 3UTUH 1ELDE 1SFQB 1F2SE 4Y7BA 4TY7A 3SV8A 3QZRA 2ULLA 1C5UA 4X6OA 3ZZ3A 2ODPA 3SGAE 4XE4A 2RA3A 1J9CH 3E0NB 3TH2H 5C5NA 1OPHB 3LPRA 1C1UH 5AVDA 3OTPA 1HJ8A 5B6LA 3R3GB 1OWJA 2EQNA 3QWCH 2VBCA 4AN7A 3UWJH 2DE8A 3KQCA 1BIOA 2XWAA 1MKXH 1FAKH 2P8OC 1N8OB 1VCWA 1V2KT 2V3HH 4IMQA 4NZLA 5K7RA 1C1SA 3PMBB 1QR3E 3A87A 5F6MA 1DSUA 3S7KB 1EB2A 1SI5H 2I6SA 1IAUA 5A8XA 2BB4A 2KM0A 1KTTB 1TONA 2VINA 1NS3A 4JZIA 1O3MA 1C2GA 2A4OA 1LPZB 1GJ7B 2R0KA 1BQYA 1ZTKA 3NK8A 3D49H 4XBCA 2C93B 1L4DA 2Q6FA 1F0UA 3LC3A 2ZDAH 5T6GA 1VITH 1N6YA 3OE7D 4XBBA 3RXIA 1E36B 2BD4A 2A31A 2GP9B 1KMHB 3PTNA 1PPEE 3TNTA 1RIWC 2B8OH 1V2UT 2CGAA 2J38A 4AFSA 2QF5A 2Y82A 2Q6DA 1DLKB 1JIMA 1LVYA 2FOFA 1NRNH 3SU6A 4CHAB 1FMGA 2ZKSA 4ZKRU 1GJ9B 1GJ6A 2JKHA 3JZ2B 4YESB 2G8TA 1S6HA 1JRTA 3QGJA 5DJ7A 2IJD1 1ZGVA 2OCVB 1IQEA 8GCHF 1KXFA 2Y5FA 1OKXA 4HZHA 2BZ6H 5EQRA 3SHAH 1NRSH 1UTJA 3EE7A 5LPRA 3A7TA 1GBMA 2F43B 3M5MA 3UOPA 1O5BB 4J1YA 4MPUA 2VIQA 1LHCH 3P8FA 4DW2U 3GDSA 1K1PA 3T27A 2F9BH 2THFB 5EW2H 3PRBA 1GHBG 1P0SH 1DVAH 2ANKH 3SJOA 1J17T 2OBQA 1C1PA 1GHBF 1HAGE 1SGQE 5F8ZA 1K1LA 1PPFE 2FX4A 4BTIB 1SOTA 2PP6A 1TX7A 1VCQA 1XUHA 1C5SA 2PKAA 4Y71A 4CR5A 1LTOA 4B75A 1Z8RA 4WJG2 1EAIA 3BTEE 1O3IA 4MG3A 2JH0D 1EATA 1GHXH 2KAIA 3KHVA 1SGDE 2ZDVH 1TA2A 1W12U 1CVWH 2HRVA 4OS4A 1BJVA 3RU4E 1MCVA 1SGRE 1V2VT 2BD3A 1BRCE 2Y81A 2Z9JA 2A4RA 1NY22 2A2XH 1YWUA 2BDHA 1O2PA 4AORA 4RN6A 4MVNA 3TU7H 4JZ1A 1AKSB 4RT0A 4AX9H 1CO7E 1FY8E 3F6UH 5G4BA 1EP5A 1OWDA 2ZU3A 1EASA 2CXVA 1PQ5A 5KECA 3BTHE 1C5VA 1F0TA 1TQ7B 3D23A 1GDUA 1DLEA 1W0ZU 3LH1A 4XFQA 2WPDD 4KTUA 3B8JA 1C5ZB 3KYGA 2R3YA 2BY5X 2BY8X 2V3MA 5GCHG 5DP3A 3GCHC 2UWLA 1SQRA 1TNLA 3DA9B 4I8HA 5GCHF 2BLOA 5GWZA 5FBIA 1UCYK 4Q63A 1SGIB 1TNKA 1A5HA 4NA8A 3F68H 3I29A 1C5OH 2F4LA 1YBWA 1SGFG 1NN6A 1YPJH 1VITG 1H8DH 1LCYA 2JH6D 2H9HA 1NPMA 6CHAB 1ANEA 1ELTA 2VH0A 2XBYA 1CA0B 2UUJB 4LXBH 3ZYDA 1VITF 5A2MH 1CBWB 3F1SB 3MI4A 3RXBA 1QA0A 1XX9A 1GI3A 4FUDA 5T1VA 1YLDA 3SJKA 3RXEA 1C1RA 1Y3YA 1EKBB 3NCLA 1A0JA 2J98B 2AERH 3ZVFA 4AGJA 5DP6A 1DT2A 4SGAE 2BY9X 1C5RA 4X1RU 3MH5A 1H9HE 5DP9A 1DICA 1TGBA 1FX0B 2BHGA 1Z1JA 1V2WT 1K1MA 2A7HA 5DKMA 4ZKOU 4K1SA 1V2JT 3FVFB 1WCZA 2QXJA 5DG6A 1O2ZA 3PWBA 2BTCE 1Q3XA 4WF8A 3OAAD 1TB6H 1QA7A 1ELCA 4TYDA 1M9UA 1O39A 1HAVA 5F8XA 5FBEA 2PSYA 1AVGH 2XRCA 3M5LA 1FV9A 1GHAG 1PPHE 1UW7A 4AYVB 2J97A 4YOGA 3GOVB 3SN8A 1K0HA 1W0KD 3OU0A 1GHAF 4YTAA 1Z1IA 3DSPA 3S9AA 2GZ9A 2ZPRA 3LGIA 1W0YH 2GMTC 1O3EA 2GCTB 2YNBA 4IS5A 5EXNA 1ETRH 3RXHA 4OGYA 1RTLA 4WH8A 1A2CH 5DP8A 1A0LA 3SZEA 3BTTE 1O2NA 4B2CA 1MU8B 1JOUB 1TFXA 3U1JB 1WBGB 3FN8A 4B71A 1SB1H 2WSSD 5FHTA 2VJ1A 2HLDD 3UUZA 4R0IA 2B7DH 1PPZA 1EUFA 4VGCB 4O97A 4K3JA 2FTLE 3NPSA 1UVUH 3MH4A 1FZZA 1O5AB 3RXDA 5FX6A 1TNGA 3MO9A 3LC5A 4ASHA 4ISHH 1A5GH 4K69A 2P94A 1G37A 5KEDA 2A7CA 2D1JA 3LGYA 2QXIA 1NO9H 1H1BA 1D6WA 1OWKA 4ZAEA 2AIPA 2GZ7A 1SC8U 1A61H 5ABWA 1B0FA 2XCNA 3M3SA 1E34B 3OY5U 1LHGH 3SI3H 3QDZB 2FIRH 4I8LA 3MTYA 1ZPBA 3ZVCA 3E6PH 2A5AA 3DFJA 1TABE 1FUJA 4CBOA 1DX5M 1O2YA 2QXGA 3U28C 3TH3H 2IN2A 1AN1E 5T6FA 1BT7A 2ZDMA 3A83A 2BMGB 1S81A 1GL0E 2ZO3H 1CGHA 5L30H 4ZXXH 2A1DB 3SU5A 1AZZA 2SGQE 2Z9LA 4RI0A 1IQIA 2VU8E 3T62A 1GJBB 3TNSA 3VB4A 1ZLRA 3PTBA 1TPSA 4X1NU 5JBBS 3C1KA 1UVSH 1CA8B 1HJAC 2JDID 3P70B 2CJIA 3N7EA 1LKBA 3SV2H 3BTGE 3QTVH 2J5UA 1ZPZA 5A09A 1ZGIA 2RCEA 2WINI 4FUFA 1GBAA 3P6ZB 4Q7YA 5AFYH 3UFAA 3QUMP 5E0GA 3KF2A 3RMOH 1PFXC 4ABGA 3SQEE 3U8TH 3LGWA 3VB7A 5HXFA 2P8OB 5I46H 3GY7A 4Y76A 3WWFA 2OP9A 2CF8H 5BPEA 2YNAA 4GPGA 1EX3A 1DUEA 3ITIA 3SJIA 1AKSA 1KTSB 2I6QA 1YPMH 1O3OA 5EG4A 2AGIX 4P00A 8KME2 3EYDA 1VR1H 4ZCNA 3DFLA 3DSOA 3RXSA 3I78A 3PLBA 3BIUH 5HMAA 5HM2A 1Z71A 1HAOH 1ABJH 5A0CA 3GCNA 3MHWU 1GBHA 2HVXA 3SUDA 1AMHA 1DSTA 1T4UH 1UCYH 4RKJB 1LHEH 2XOKD 1ZYOA 2VWMA 3M3TA 1RIWB 4IGDA 2YOLA 2C8WB 1WUNH 2ZPSA 1ORFA 1L2EA 1CSOE 1MTSA 3A7XA 2B0FA 2WV4A 5CHAC 2PLXA 3MNSA 3TGKE 1SLWB 3WY8A 1DPOA 4NFEA 3SGQE 3VXFH 1YPHE 1S83A 2M2AA 4CRDA 3BF6H 4Y0ZE 1WYKA 1TMBH 1TX6A 3SJ8A 3QZQA 3SW2B 1UTLM 6CHAC 4UFEH 2AGEX 4NWKA 3LGVA 2QE7D 3TK9A 3TGJE 1CBWC 1XM1A 2D2DA 1J8AA 5GNDA 1W8BH 2XNDD 4MNYA 2CF9H 2TGTA 2GZ8A 1ELFA 5JBCS 4NIXA 3K2UA 1QQ4A 2ZIQH 1K1IA 4K8BA 1NBMD 2FS9A 3MNXA 2DUCA 3SJ9A 2BQWB 3E16B 1QFKH 1TA6A 1MKWH 4NIYA 2R9PA 4AFUA 1CQQA 4I7YH 2M5TA 1TPAE 4KELA 1J14A 4I8JA 3STJA 1GI7B 1KXAA 1P2QA 3RLWH 4O3UA 2QV1A 3RMLH 1RFNA 4X6MA 4AGKA 1L1JA 2KCYA 3ESTA 1WU1A 1A3BH 2KAIB 4FUCA 3BG4C 1O30A 2EI7A 3GISB 1GJAB 1Y59T 3FZDA 5EQQA 4X8VH 3U8OH 2ZCKP 2VWNA 1IQFA 1ACBE 1AUJA 3KCGH 1LVOA 1DUAA 5EJ1A 1KYNA 2XBVA 1O5DH 5JYIA 3HGNA 5C20A 1GI1A 1SKYE 2J4IA 3BEUA 1DOJA 1QRXA 4O3TA 1AY6H 3D65E 3GCHB 5EPYA 1C1WH 3QLPH 1O3GA 3T25A 2HGTH 3HGPA 1KXBA 2Z94A 3A8CA 2QAAA 2BQ6B 4O03A 4HTCH 1N1LA 2ZA5A 3PO1C 2ZZUH 2L74A 4GHQA 3OEED 1VKYA 2A2QH 4ZXYH 1O3HA 1VGCC 5LPEA 1EP6A 2Z6BD 3OY6U 1FIZA 1V2ST 3PLKA 4B6FA 1T8LA 2UUKB 3A86A 4KP0A 1WQVH 5GJ4B 4NZQA 1PPCE 4X0WU 1C5NH 3PROA 1NTPA 4ISIH 1SSXA 4CRAA 1DE7H 1XUFA 1PYTD 4CR9A 1MTWA 4NWLA 3SNCA 3M36A 1P2MA 3AW0A 1BRAA 4ZKSU 4TT3D 1NU9A 1GHYH 2FOBA 3E8LA 1E35B 1W10U 1Z7KA 4NG9H 4MQAA 2FXRA 1MAXA 2Z9IA 3GICB 4YT6H 4AFZA 4TPYA 1P04A 3V12A 1K1JA 3MH6A 1EZQA 2C8YB 1HPGA 1UTKA 4CREA 2ZU1A 3RLYH 1QL8A 3RXMA 1CGIE 3TPIZ 5LH8A 1V2PT 2HNTC 2ZFPH 1WAYB 4H4FA 1QBNA 5E0HA 1DXPA 1PQ8A 2O8WA 3HPTB 2BXTH 2F91A 5DGJA 1MUEB 5T3HA 5EOKA 2PFEA 1BTZA 4M9FA 3EQ0H 1O5GH 1YGCH 1MQ5A 1OSSA 3ZVEA 2XTTB 1HAVB 2J2UA 3KL6A 3TITA 2GMTB 2Z3DA 1ZSLA 4AOQA 1GGDC 1KDQB 2OC1A 3GY5A 4B1TA 2W26A 4JK6A 4YM9A 3TJUA 3PWCA 5EXLA 3SV6A 3MNBA 1GI4A 1O2UA 1SG8B 1UK3A 1ZJKA 2PTNA 1A3EH 2BX4A 2OD3B 3F9EA 1BRUP 3EA7A 3F2FA 1F7ZA 2GCHG 1HAXB 3U1IB 2ODYB 4Y11E 3MU0A 4A1VA 4A1XA 3A84A 3SNAA 1UVTH 2GCHF 3ODDA 4AYYB 1ELEE 3AW1A 3F9FA 2HNTE 2LP6A 3SU1A 3K65B 1NFXA 3RMNH 2GDEH 1H4WA 1BB0B 1UTMA 1IHTH 3UREA 1ID5H 4IC6A 4I8GA 4I8KA 1SVPA 1SMFE 3P95A 4ESTE 1O2IA 2UWOA 1C5PA 1CT4E 1TALA 1WDIA 3BEFB 1A5IA 1F0RA 2Z9GA 2A45B 4OS5A 1UTOA 2IPHA 3N7DA 4UONA 5GPIB 2FYRA 5AF9H 4R8TB 3P8GA 3H7OA 3PB1E 3OX7U 2GD4B 3BTKE 4A92A 2SNVA 1TNJA 2ZG0H 2RFKC 3RXTA 5ETXA 3TJOA 1C2IA 2ZFSA 2WHXA 5GIBA 1BTPA 4DG4A 5IK2D 2GJGA 2HWLB 1V3XA 2F9OA 1JIRA 1T8NA 1F5KU 2BDYA 4XBDA 2GV6A 1O34A 1C5LH 3ZZCA 3CNRA 1DWDH 3TGIE 1GJ5H 3QGNB 1O3KA 4X2YA 1F92A 3PRDA 5J4QA 1JXPA 5HYOA 5A0BA 4GLYA 4Q80A 3LH3A 4MTBA 5EJZA 1GPZA 8GCHG 1AQ7A 2CHAB 2K8IA 4X2WA 2Y5HA 4BTTB 1V2MT 4BAQB 1CHGA 1HJAB 2NU2E 2XBWA 3CP7A 3JZ1B 2AMQA 2PGBB 4BTUB 1P3EA 3U8RH 4NGAH 2WUBA 4YLUA 2P3UB 3T2NA 1O2XA 4O9VA 1X7AC 1BHXF 3OFND 1BTXA 1DY9A 3F3BA 3FOAA 5C0TA 4ACAA 3SQHE 2BOKA 1W11U 1MQ6A 1TBRH 3ATLA 1GMCF 4IC5A 2OLGA 1AO5A 4E05H 5E8EH 4LK4A 3H5CB 4NIWA 1HUTH 2BVRH 3RXOA 1O36A 3O8DA 1ESTA 1L4ZA 3P8NA 1Y5BT 3GCTF 2LNCA 3VB6A 1ZZZA 4KTCA 5E0JA 1P02A 5K0HA 2ZNKH 2AIQA 3M3VA 3AAVA 2VB0A 4ZROA 5HGGA 1BJUA 4MDSA 1O0DH 2LELA 2ZTYA 3P8OA 2J92A 3QK1A 5T6DA 7LPRA 2JJ1D 1IQNA 3ZVGA 4JZEH 1EB1H 1PPGE 1ZTJA 2GKVE 4Y10E 1XUKA 1KY9A 1YCPK 1ZSJA 3OTJE 1P12E 1DS2E 1BTHH 1GL1A 1P2OA 4UFFH 2EY4C 1HDTH 3SO3A 1H9LB 1PPBH 5EIYA 2GV7A 1G2LA 2BOHB 5CHAB 1CE5A 4A1TA 2XXLA 3TJVA 3OYPA 1OOKB 1FY4A 2VIDA 3M7TA 3PLPA 2BLWA 2PKSC 1QY6A 2ZU5A 2KX4A 5DK1A 5TCAA 4MLFB 2FEQH 2BDIA 3BN9A 4X8TH 1K28D 1EOJA 3ZZ9A 3ZV9A 2ZPQA 4FU7A 4X1SU 3S9CA 2IOTA 5JPMH 1ELAA 2FLBH 5SGAE 1MD7A 5C1UA 1TMUH 1UK4A 3FP7E 1SGCA 1T4VH 1MABB 1SQAA 2A5IA 5EXMA 4BXWA 3P92A 2QGRA 1AUTC 3Q77A 4DGJA 4QT8C 5A8YA 1IQLA 2OQUA 5CE1A 1O2WA 1SPJA 1UTNA 1TBQH 3VXEH 2TGDA 3DUXH 1E1QD 5PTPA 2C3SA 2BDAA 1NFUA 3MU4A 4JYTA 1N6XA 2BY7X 2CMYA 4P02A 2ZWLH 5DP7A 4INLA 1YLCA 1J15A 1XVMA 1O3LA 4DURA 3PV5A 2ZI2H 1K9OE 1ANCA 1ZRKA 3ELAH 2O8LA 4GVUA 4WXIA 5LGOA 1F5LA 1JBUH 1AGJA 1UTQA 3A8AA 1C5QA 1AWFH 1BRBE 4FU8A 1SQTA 1JRSA 3SV7A 1GBEA 3BG4B 3BSQA 3A80A 3IWMA 2RA0A 4ZMAH 1T8OA 2PR3A 1KDQA 2G5NA 1ESAA 4X2XA 1AB9C 2F83A 1NC6A 5GXPA 4CRCA 3O8RA 2PSXA 1ANBA 5AHGH 1DM4B 1LPGB 2ZU4A 2Y6TA 3BIVH 3URDA 1XUIA 3GY8A 5C17A 1AZ8A 2PWXA 2BLVA 3PO1B 4F49A 1CU1A 4YLQH 1LQEA 1GBJA 1A1RA 1C2DA 5C67A 1MBQA 1VGCB 2ALVA 5JBTA 2AYWA 1H8HD 1XUJA 2WYJA 2PV9B 1O37A 2AEIH 3I77A 4FETA 2ZDLA 4E06H 2G81E 4Y79A 3GDUA 1GMDG 3PMJA 1ZJDA 5F8TA 1QRZA 3UY9A 1ZRBA 1TMTH 1GMDF 4GUXA 4MNXA 3PMAB 3LGTA 1O2KA 2L6OA 2V0BA 3F2HA 2PUQH 3L33A 4I32A 5C94A 4LZ1H 2P3FH 1MBMA 4B6EA 2W7UA 1C2FA 1GBLA 3SNBA 3NXPA 4K8YA 3SUEA 1YYY1 2J9NA 4UD9H 3PV4A 3M35A 1F5RA 2ZP0H 3F9HA 4E7NA 4NCYA 5A8ZA 5FL7D 2AGGX 2FODA 1BTWA 2CV3A 2FI3E 1TE0A 1GI8B 1V2NT 2SGPE 1MTVA 1YP9A 2SGFE 1FIWA 1TGCA 5DN6D 3GYMA 2O8TA 3Q3KA 2O8MA 3FFGA 3T26A 3W95A 1MU6B 2ALPA 2CHAC 3ATMA 2BD7A 2ZECA 1TNIA 4H42U 2F9NA 2SGDE 4U30A 1FY5A 3ENSB 1FY1A 1V6DA 3B9FH 4THNH 1E1RD 1GGDB 4CH2B 1S0RA 3HK6B 5EU8A 3A8BA 3RDZA 1A4WH 2R0LA 3UNQA 1CHOF 3EA8A 3DSGA 5F53A 5FPTA 5H4IB 1DITH 1HAIH 3PM3A 4JYVH 1HAYB 4RT1A 1G3DA 1A7SA 4A7IB 1HAHH 1BUIA 2RDEA 1HV7A 2NU0E 4X6NA 2CK3D 2H9EH 2ZDKA 3U9AH 3T5FH 1EPTC 2XNIA 5CHBA 1GI0A 1EFRD 1P11E 3ZZ8A 1WTGH 1Z8JB 3M37A 2ZDNA 1C1QA 2JH5D 1O3DA 3HKIB 1DY8A 4Y8ZA 3W1EA 2ZFQH 1OP8A 4X2VA 4ACBA 2NWNA 4DT4A 3UWIA 1YCPH 3KNXA 5L6NH 1GVKB 3SHCH 5FX5A 2FWWA 2BD2A 2C90B 2ZHQH 4HI3A 1FNIA 1FY3A 1COWD 1MD8A 4Q7XA 2FS8A 2V6NA 6GCHG 5HIYA 1FDPA 1O5EH 1SGYE 4J2YB 1OP0A 1O32A 4ZHLU 6GCHF 1K1NA 1HLTH 3QN7A 3S9BA 3SV9A 1TOMH 3MO3A 3UIRA 4FXGH 2HPQH 1OXGA 5I25A 2FI5E 2R3UA 2OINA 1Z6JH 3CS0A 1A0HB 3EA9A 2FPZA 1FXYA 2ASUB 1O2MA 4TPIZ 3ZZ5A 1AWHB 1S85A 1LVBA 3RXGA 1PJPA 1ZR0A 4CRFA 3K6ZA 2R2WU 1K21H 2IJOB 1AE5A 4X6PA 5C1YA 1P2IA 3ATKA 1YCPM 3VEQB 1DWBH 4MNWA 3V0XA 5FCKA 1TPPA 3F9GA 2VVCA 4MPVA 3DT0H 2A4GA 5LPFA 1QL9A 1YM0A 1HBTH 2QYIA 2WZQA 4Y0YE 1PQ7A 1UVOA 2G4TA 3UPEA 3SGBE 3URCA 3N99A 1OWIA 3ZYEA 1NFWA 1BDAA 1FJSA 4WVPE 3FAOA 1ZMLA 2ZGCA 4D9RA 1DDJA 1UHBB 1Y3WA 2OC7A 1G3BA 3RUOA 1QCPA 3SORA 4B73A 2FTMA 3SZNA 1W7GH 4AZ2B 2H2ZA 3VB3A 1DWCH 4NA7A 3ZZBA 1ZHMA 4ABJA 5HIZA 1GVZA 4MNVA 7GCHF 4Y8XA 1ETTH 3KEEA 1EJAA 4LOYH 2ZQ1A 3ZZ7A 1QBOA 9LPRA 1BMFD 4ZUHA 2ZGHA 3TLOA 4FUEA 2ZFFH 1EQ9A 1FAXA 1SGTA 1XKAC 1UCYE 1AVWA 2FZZA 2QC2A 8ESTE 2WPLS 1KIGH 3HKJB 4GCHF 3GY6A 4U32A 1AE8H 1QJ6B 2ZGBH 3LKWA 1GJ8B 3MU8A 1BBRE 3RXKA 1T7CA 1TGNA 5JB8S 4CRGA 3A7WA 3N7OA 1QIXB 2VIPA 4A6LA 4HG6A 1NM6A 2GDDA 5JBAS 3NKKA 1YC0A 1BTYA 2PKSB 1T32A 5E2OA 1NRRH 1G32B 1HIAB 3KQ5A 4SGBE 5C1XA 2WV9A 2UUYA 2KCOA 1P09A 2BVSH 7KMEH 2V3OH 4D8NA 1GI6A 2TPIZ 4ASUD 4BAKB 4BAMB 3Q3XA 3MQKC 1G36A 1VCPA 4DT7B 2FOHA 4Y6DA 1HAPH 1O2QA 1IQKA 2OC0A 2GX4A 1LKAA 2VIWA 1YPGH 1JWTA 5EJLA 4ZH8A 2BD9A 2BVXH 3ZVBA 2HVYB 2OC8A 1G2MA 1HB0B 3Q76A 4TY6A 3TH4H 2W5EA 1GDNA 3MFJA 3BTFE 2VIVA 3ZIAD 4U01A 1S82A 3K6YA 2A7JA 2JETC 3WWBA 4WMEA 3A89A 3PMHB 1OP2A 3MH7A 2G4UA 1TYNA 1QB6A 1QRWA 5EODA 2W7SA 4Q2KA 1W0JD 1NZQH 1P01A 1UK2A 1G9IE 1O3NA 1FLEE 1KXDA 1P2JA 4PROA 2RG3A 3BTME 5A0AE 1O3CA 1NBME 1TAWA 2WPMS 4HFPB 4FUGA 1IHSH 1S5SA 2ZGJA 3KGPA 3V3MA 1V2QT 4YO9A 3ATWA 1TRNA 1ESBA 1WOFA 2ZTXA 3AVZA 3VPKA 2P59A 1HXFH 3KYFA 4DOQA 1AB9B 1MTNC 3RXPA 1XXDA 1L1NA 1MMJN 5C2ZA 9ESTA 3IITA 1AFEH 4Z0KA 4ABHA 1HXEH 2BXUH 3EE0B 3PV2A 2STBE 1P57B 1ZOMA 4FOUC 1C1MA 4MPWA 4D76A 3M61U 3E90B 5EQSA 3ZZ4A 5GDSH 1FQ3A 1PYTC 1FN8A 1HRTH 1E0FD 1RS0A 1EAXA 4WMFA 1EOLA 1CGJE 1P9UA 1W14U 4K2YA 5C3NA 5L2ZH 1GJDB 1O2GH 2YMSD 1BZXE 1B0EA 4OS7A 3STIA 3RU4D 3SBKA 1O3BA 1GVLA 2ZEBA 3LU9B 1THRH 1V2LT 1O33A 5TJXA 3ZVDA 1EZUC 4AG1A 1ABIH 1MAYA 3U69H 2KFWA 2VWOA 2VVVA 3EGKH 3F0PA 1W13U 1S6LA 1IQGA 4WY3A 1C2HA 1AHTH 4JYUH 1LVMA 1NT1A 1RRKA 4DJZB 1SOZA 2A0QB 2FO9A 5B6OA 1ANDA 4X8UH 3F0OA 4FUBA 1ZMJA 1EAWA 1GG6C 2W6ID 4X1QU 1NESE 1UTPA 2HLCA 2SNWA 4B2AA 4F55A 3V13A 4WMDA 4IN2A 3RXCA 1K22H 2XYAA 1ETSH 1PQAA 2VGCB 1SGFA 2G51A 3FANA 2FOAA 2W3KA 4YZUA 2QA9E 1V2TT 5JDUB 5HM9A 2HNTF 1D3PB 1AU8A 5TCCA 1Y3XA 4M7GA 5FXLA 1S6FA 1RTFB 3LGUA 1GJ4H 2BD8A 2YMSC 1C1OA 3B23B 2KCPA 1DXWA 1P3CA 3E0PB 3NUMA 3LJOA 3OEHD 2TRMA 1OWHA 4B74A 1B5GH 4YT7H 2ZU2A 1ZPCA 3BG8A 2F9PA 1UHBA 4UFDH 1WXRA 1FN6A 1GMCG 2QN5T 4ZHMU 1EZXC 2FOEA 1GMHG 3RC5A 5CDFE 4I31A 1AIXH 3MOCA 1EPTB 1VJAU 3TVJB 1GMHF 3DD2H 3GCTG 3FO8D 1GHWH 2NU1E 2H1UA 1KXEA 1NRQH 2ZGXH 3U98H 4AFQA 8LPRA 4UDWH 1ELGA 1HJ9A 1H8ED 6ESTA 4YXWD 1SGEE 2BLQA 1YPEH 2ZC9H 2Q1JA 2PW8H 3AASA 1YF4A 3LT3A 3H09A 2Y7ZA 4OS6A 2FDAA 1C4U2 1TNHA 4ABIA 1O2OA 1OX1A 3SOSA 1NFYA 2FX6A 3LONA 2GVFA 1BCUH 4FVBA 1LHFH 1K2I1 1NRPH 2ESTE 1O3PB 2UWPA 5FPYA 4H6SB 1G3CA 1ELVA 1SFIA 4JCNA 1O2HA 1O5FH 4HGCA 3VGCB 3S7HB 2FM2A 1HIAA 1EJMA 4INHA 1YKTA 4F4OC 1QJ7B 2BX3A 1SHYA 4KGAA 2G55A 1YY3A 2LPRA 2BQ7B 1XUGA 1GCTB 1O2SA 1V2RT 1OYTH 2ANMH 1GCDA 5DP5A 3L3TA 2ANYA 4D9QA 2BY6X 4TWYA 1V2OT 3P17H 3ZZDA 5FCRA 1LPKB 1LHDH 1L1GA 2BYAX 2EC9H 1HAZB 1RTKA 2EEKA 2K1QA 2B9LA 2ZFRH 1RJXB 1B7XB 1CT2E 1MTUA 3HATH 1Y5UT 2GGVB 3RXUA 3KIDU 3NZIA 4DIIH 5HKKD 1QL7A 2G52A 4NA9H 1LMWB 2OBOA 1E79D 4RKOB 2P95A 3VG8A 1GWAA 3VB5A 1T8MA 2BZAA 1BBRK 2FOCA 2QXHA 3GYLB 4A5TS 4UE7H 2STAE 3Q00A 1WQSA 3ATIA 1RXPA 4AG2A 2SFAA 1TGSZ 2PTCE 3RMMH 4WH6A 5J4SA 2DE9A 3OSYA 4TWWA 1AFQC 3KQDA 1W2KH 3HK3B 1TBZH 1TQ0B 1TX8A 1UJ1A 3BTDE 4D7FA 1P8VC 1C5YB 2VWLA 1C2EA 2VVUA 1HFDA 1O2RA 4X1PU 1LDTT 4B76A 2H6MA 1UO6A 2WUCA 5ESBA 1D6RA 2W6JD 4OS2A 3FP6E 1C4V2 5E2PA 2ZCHP 5ESTE 2Y80A 1C4Y2 2JJ2D 3RM2H 3TK5A 1MKWK 1ZHPA 2SGAA 3O8BA 4ABEA 4UFGH 3RXQA 4IW4E 3G01A 2GT7A 7ESTE 2ZCLP 2ZHDA 1C2MA 2FP7B 1C5WB 2QF3A 3KN2A 2R2MB 4B2BA 2G00A 4CH8B 1TGTA 3EAJA 1P9SA 3DCLA 1QGFA 1P2KA 2KR7A 4GHTA 2GTBA 3LIWA 1Y3UA 2HOBA 1Q31A 4INKA 1XMNB 2OUAA 1MCTA 2TGPZ 3A88A 5FPSA 2ANWA 3RP2A 1YPKH 1P2NA 4BXSA 3AK5A 1KSNA 3QO6A 2EI6A 2VIOA 1BMMH 3O8CA 3TJNA 1G3EA 3EDXB 1O3AA 5KGOA 1D4PB 3T28A 2FMJA 2P93A 3WW7A 2J95A 3A7VA 2XW9A 3BTWE 3K9XB 2VNTA 1C2JA 3V7TA 1SQOA 2JETB 2G5VA 1N8OC 4NIVA 1YPLH 1GI5A 4XOJA 1THPB 4Y7AA 3BEIB 3A7YA 4JZDH 4BAOB 4X8SH 3KQEA 1BMAA 4AB8A 3UQVA 5IDKA 3MNCA 1C2KA 3UB0A 1O35A 4YOIA 1EXFA 4ZHAA 2O9QA 1H9IE 1NU7B 1DFPA 3MYWA 4DIHH 2Y7XA 3RXRA 2H5DA 2QF4A 1GBFA
chains in the Genus database with same CATH topology
1XVOA 2VGCC 1GI9B 4K60A 4OGXA 1O31A 1O3JA 5JB9S 3A82A 3M5OA 1Y8TA 1BTUA 1MTNB 3SNEA 1TIOA 1Q2WA 2FYQA 1W7XH 2Z9KA 2AFQB 1AVXA 1ZTLA 3S69A 3A85A 1CHOG 2XC4A 3UOUA 2C8ZB 4ABDA 2ODQA 1SL3A 4BANB 4CHAC 3M7QA 2EA3A 2WPHS 4Y8YA 1EPTA 1BHXB 1BOQA 2UUFB 5F03A 4NSYA 3GCOA 2ZTZA 2Q6GA 2AMDA 3AAUA 3BV9B 1C1TA 1H8IH 2H5CA 2XC5A 2C8XB 1QNJA 3IG6B 4IMZA 3M7UA 1O2JA 3MO6A 1J16A 1ARBA 4JMYA 3T29A 2RDLA 1GBBA 3NWUA 1S84A 2FI4E 2F3CE 3LDXH 3TK6A 1C1NA 5BRRE 1HYLA 3LOXA 2PHBA 1GBKA 4ISNA 5C5OA 2TGAA 2WPIS 2QIQA 2BDBA 2CN0H 5EW1H 2ZF0H 1IOEA 2Z7FE 1O38A 1GJCB 1RGQA 1YPHC 2GT8A 4XDEA 2NU4E 2AMPA 5EPNA 3KQBA 4K1TA 1Z8GA 1LQDB 1Y3VA 3MWIU 1SHHB 3RXVA 1TWXB 1VZQH 1JMOH 1FPHH 4FUJA 3SI4H 4K1EA 3RXJA 1UMAH 1D9IA 1TPOA 4GSOA 2V35A 3ODFA 3ZZ6A 3ZVAA 1OYQA 1C5XB 1MKXK 4NFFA 2ZQ2A 1GG6B 3R0FA 3VGCC 2QY0B 1K1OA 3D62A 1CT0E 3SU0A 3ZV8A 1LO6A 4JZFH 1HNEE 4WXVA 2ILNA 1O5CB 1C1VH 4FU9A 4BAHB 2FESH 1OWEA 1GCTC 1QHRB 1QQUA 2W3IA 1IQHA 5DP4A 4RSPA 1SGNE 5IYTA 1THSH 4CBNA 1W3CA 2BDCA 1Z6EA 1KLTA 2HPPH 3C27B 3S0NA 4ISLA 4KKDA 1BBRH 2VH6A 3QTOH 1QJ1B 3SU2A 1IQMA 4Q7ZA 1TOCB 3QX5H 4FVDA 4I33A 5CMXH 1TLDA 4KTSA 3SUFA 3E3TA 2C4FH 2ZHEH 3L6PA 2O8UA 1CA0C 2F9VA 3UNRA 4UEHH 1AD8H 3LJJA 4H6TA 1MZDA 1QB1A 1GBTA 3DHKH 3TIUA 1D3DB 3SNDA 4ZKNU 1FI8A 4DY7B 1SBWA 1SLVB 1FONA 3CS7A 3W94A 1SGPE 1XKBC 1DWEH 4D7GA 7GCHG 1SR5C 2AS9A 2PUXB 3GY4A 3RM0H 4AB9A 1P10A 3Q3YA 3FP8E 3RXAA 3A7ZA 4JK5A 1C5TA 4ABFA 2WPJS 2Y5GA 2FOMB 1TRYA 3M5NA 3UR9A 1EJNA 1BITA 2D26C 1E37B 3GY3A 1GDQA 1QURH 1P03A 1UVPA 1TRMA 4FUIA 1ELBA 1QB9A 4GCHG 1MH0A 2ZFTA 4DCDA 2PKAB 2WV5A 4WWYA 2A32A 1O3FA 1INCA 1T31A 4K5ZA 2J34A 2NU3E 1D3TB 1BMLA 2A4QA 1ARCA 1G30B 2QCYA 4GAWA 1WSSH 1C2LA 2SGEE 5DPAA 3SUGA 4MPXA 1U6QA 2FLRH 3E1XB 1GHZA 4ABAA 3GY2A 2XBXA 2A5KA 4XSKU 4LZ4B 3RC4A 2XCFA 4YOJA 4ISOA 2GCTC 1F0SA 3E91A 5DO4H 1O2TA 1DANH 1O2VA 2EI8A 3SU3A 4FUHA 2J94A 3BTQE 1C9PA 3MU5A 1BMNH 3UQOA 2OTVA 2Z3CA 2ZHFH 1C5MD 3SU4A 3MMGA 3UR6A 3H7TA 1GI2A 1MZAA 5L2YH 1SLXB 1Y5AT 1QBVH 3PYHA 3RXLA 4BNRA 2PGQB 2B5TB 3A81A 3UNSA 1WTHD 1SLUB 4VGCC 2Z3EA 1RD3B 1GBCA 4U2WA 2H9TH 5AFZH 1C9TA 1KLJH 1P05A 1EAUA 1GHVH 1AFQB 1D3QB 1KLIH 1S0QA 1VJ9U 2WPKS 4Z6AH 3RXFA 2OQ5A 2FOGA 4NSVA 1IQJA 1BA8B 3GDVA 1EZSC 1FPCH 3ZZAA 2XC0A 3A8DA 1OS8A 1P06A 1O2LA 1NROH 4ABBA 2AH4X 4DVAU 2BM2A 3MU1A 1HGTH 1QTFA 1HCGA 1GBDA 5EGMA 4CRBA 2WYGA 2P3TB 1E38B 1KXCA 1A46H 2HALA 2OXSA 2TIOA 2ZHWH 1AI8H 3RC6A 2BD5A 2QF0A 3RU4T 6LPRA 2P16A 2D8WA 2BDGA 2F9UA 1Z8IB 1WV7H 1ZHRA 1L0ZA 4IN1A 3CENA 1GBIA 4BOHA 2TBSA 4E7RG 5FAHA 4IBLH 1ZSKA 3VFEA 4OS1A 3FZZA 1XXFA 2XWBI 1ZMNA 3UTUH 1ELDE 1SFQB 1F2SE 4Y7BA 4TY7A 3SV8A 3QZRA 2ULLA 1C5UA 4X6OA 3ZZ3A 2ODPA 3SGAE 4XE4A 2RA3A 1J9CH 3E0NB 3TH2H 5C5NA 1OPHB 3LPRA 1C1UH 5AVDA 1HJ8A 3R3GB 1OWJA 3QWCH 4AN7A 3UWJH 2DE8A 3KQCA 1BIOA 2XWAA 1MKXH 1FAKH 2P8OC 1N8OB 1VCWA 1V2KT 2V3HH 4IMQA 4NZLA 5K7RA 1C1SA 3PMBB 1QR3E 3A87A 5F6MA 1DSUA 3S7KB 1EB2A 1SI5H 2I6SA 1IAUA 5A8XA 2BB4A 1KTTB 1TONA 2VINA 1NS3A 4JZIA 1O3MA 1C2GA 2A4OA 1LPZB 1GJ7B 2R0KA 1BQYA 1ZTKA 3NK8A 3D49H 4XBCA 2C93B 1L4DA 2Q6FA 1F0UA 3LC3A 2ZDAH 5T6GA 1VITH 1N6YA 4XBBA 3RXIA 1E36B 2BD4A 2A31A 2GP9B 3PTNA 1PPEE 3TNTA 1RIWC 2B8OH 1V2UT 2CGAA 2J38A 4AFSA 2Y82A 2Q6DA 1DLKB 1JIMA 1LVYA 2FOFA 1NRNH 3SU6A 4CHAB 1FMGA 2ZKSA 4ZKRU 1GJ9B 1GJ6A 2JKHA 3JZ2B 4YESB 2G8TA 1S6HA 1JRTA 3QGJA 5DJ7A 1ZGVA 2OCVB 1IQEA 8GCHF 1KXFA 2Y5FA 1OKXA 4HZHA 2BZ6H 5EQRA 3SHAH 1NRSH 1UTJA 5LPRA 3A7TA 1GBMA 3M5MA 3UOPA 1O5BB 4J1YA 4MPUA 2VIQA 1LHCH 3P8FA 4DW2U 3GDSA 1K1PA 3T27A 2F9BH 2THFB 5EW2H 1GHBG 1P0SH 1DVAH 2ANKH 3SJOA 1J17T 2OBQA 1C1PA 1GHBF 1HAGE 1SGQE 5F8ZA 1K1LA 1PPFE 2FX4A 4BTIB 1SOTA 1TX7A 1VCQA 1XUHA 1C5SA 2PKAA 4Y71A 4CR5A 1LTOA 4B75A 1Z8RA 4WJG2 1EAIA 3BTEE 1O3IA 4MG3A 2JH0D 1EATA 1GHXH 2KAIA 3KHVA 1SGDE 2ZDVH 1TA2A 1W12U 1CVWH 2HRVA 4OS4A 1BJVA 3RU4E 1MCVA 1SGRE 1V2VT 2BD3A 1BRCE 2Y81A 2Z9JA 2A4RA 1NY22 2A2XH 2BDHA 1O2PA 4AORA 4RN6A 4MVNA 3TU7H 4JZ1A 1AKSB 4AX9H 1CO7E 1FY8E 3F6UH 5G4BA 1EP5A 1OWDA 2ZU3A 1EASA 2CXVA 1PQ5A 3BTHE 1C5VA 1F0TA 1TQ7B 1GDUA 1DLEA 1W0ZU 3LH1A 4XFQA 4KTUA 3B8JA 1C5ZB 2R3YA 2BY5X 2BY8X 5GCHG 5DP3A 3GCHC 2UWLA 1TNLA 3DA9B 4I8HA 5GCHF 2BLOA 5GWZA 5FBIA 1UCYK 1SGIB 1TNKA 1A5HA 4NA8A 3F68H 3I29A 1C5OH 1YBWA 1SGFG 1NN6A 1YPJH 1VITG 1H8DH 1LCYA 2JH6D 2H9HA 1NPMA 6CHAB 1ANEA 1ELTA 2VH0A 2XBYA 1CA0B 2UUJB 4LXBH 3ZYDA 1VITF 5A2MH 1CBWB 3F1SB 3MI4A 3RXBA 1QA0A 1XX9A 1GI3A 4FUDA 1YLDA 3SJKA 3RXEA 1C1RA 1Y3YA 1EKBB 3NCLA 1A0JA 2AERH 3ZVFA 4AGJA 5DP6A 1DT2A 4SGAE 2BY9X 1C5RA 4X1RU 3MH5A 1H9HE 5DP9A 1DICA 1TGBA 2BHGA 1Z1JA 1V2WT 1K1MA 2A7HA 5DKMA 4ZKOU 4K1SA 1V2JT 3FVFB 1WCZA 2QXJA 5DG6A 1O2ZA 3PWBA 2BTCE 1Q3XA 4WF8A 1TB6H 1QA7A 1ELCA 4TYDA 1M9UA 1O39A 1HAVA 5F8XA 5FBEA 2PSYA 1AVGH 2XRCA 3M5LA 1FV9A 1GHAG 1PPHE 4AYVB 4YOGA 3GOVB 3SN8A 3OU0A 1GHAF 4YTAA 1Z1IA 3S9AA 2GZ9A 2ZPRA 3LGIA 1W0YH 2GMTC 1O3EA 2GCTB 2YNBA 4IS5A 5EXNA 1ETRH 3RXHA 4OGYA 1RTLA 4WH8A 1A2CH 5DP8A 1A0LA 3BTTE 1O2NA 4B2CA 1MU8B 1JOUB 1TFXA 3U1JB 1WBGB 4B71A 1SB1H 5FHTA 2VJ1A 3UUZA 4R0IA 2B7DH 1PPZA 1EUFA 4VGCB 4O97A 4K3JA 2FTLE 3NPSA 1UVUH 3MH4A 1FZZA 1O5AB 3RXDA 5FX6A 1TNGA 3MO9A 3LC5A 4ASHA 4ISHH 1A5GH 4K69A 2P94A 1G37A 2A7CA 2D1JA 3LGYA 2QXIA 1NO9H 1H1BA 1D6WA 1OWKA 4ZAEA 2AIPA 2GZ7A 1SC8U 1A61H 5ABWA 1B0FA 2XCNA 3M3SA 1E34B 3OY5U 1LHGH 3SI3H 3QDZB 2FIRH 4I8LA 3MTYA 1ZPBA 3ZVCA 3E6PH 2A5AA 3DFJA 1TABE 1FUJA 4CBOA 1DX5M 1O2YA 2QXGA 3TH3H 2IN2A 1AN1E 5T6FA 1BT7A 2ZDMA 3A83A 2BMGB 1S81A 1GL0E 2ZO3H 1CGHA 5L30H 4ZXXH 2A1DB 3SU5A 1AZZA 2SGQE 2Z9LA 1IQIA 2VU8E 3T62A 1GJBB 3TNSA 3VB4A 1ZLRA 3PTBA 1TPSA 4X1NU 5JBBS 3C1KA 1UVSH 1CA8B 1HJAC 3P70B 2CJIA 1LKBA 3SV2H 3BTGE 3QTVH 1ZPZA 5A09A 1ZGIA 2RCEA 2WINI 4FUFA 1GBAA 3P6ZB 4Q7YA 5AFYH 3UFAA 3QUMP 5E0GA 3KF2A 3RMOH 1PFXC 4ABGA 3SQEE 3U8TH 3LGWA 3VB7A 5HXFA 2P8OB 5I46H 3GY7A 4Y76A 2OP9A 2CF8H 5BPEA 2YNAA 4GPGA 1EX3A 1DUEA 3ITIA 3SJIA 1AKSA 1KTSB 2I6QA 1YPMH 1O3OA 5EG4A 2AGIX 8KME2 3EYDA 1VR1H 3DFLA 3RXSA 3I78A 3PLBA 3BIUH 5HMAA 5HM2A 1Z71A 1HAOH 1ABJH 5A0CA 3GCNA 3MHWU 1GBHA 2HVXA 3SUDA 1AMHA 1DSTA 1T4UH 1UCYH 4RKJB 1LHEH 3M3TA 1ZYOA 2VWMA 1RIWB 4IGDA 2YOLA 2C8WB 1WUNH 2ZPSA 1ORFA 1L2EA 1CSOE 1MTSA 3A7XA 2B0FA 2WV4A 5CHAC 2PLXA 3MNSA 3TGKE 1SLWB 3WY8A 1DPOA 4NFEA 3SGQE 3VXFH 1YPHE 1S83A 4CRDA 3BF6H 4Y0ZE 1WYKA 1TMBH 1TX6A 3SJ8A 3QZQA 3SW2B 1UTLM 6CHAC 4UFEH 2AGEX 4NWKA 3LGVA 3TK9A 3TGJE 1CBWC 1XM1A 2D2DA 1J8AA 1W8BH 4MNYA 2CF9H 2TGTA 2GZ8A 1ELFA 5JBCS 4NIXA 3K2UA 1QQ4A 2ZIQH 1K1IA 4K8BA 2FS9A 3MNXA 2DUCA 3SJ9A 2BQWB 3E16B 1QFKH 1TA6A 1MKWH 4NIYA 2R9PA 4AFUA 1CQQA 4I7YH 2M5TA 1TPAE 4KELA 1J14A 4I8JA 3STJA 1GI7B 1KXAA 1P2QA 3RLWH 4O3UA 2QV1A 3RMLH 1RFNA 4X6MA 4AGKA 1L1JA 3ESTA 1WU1A 1A3BH 2KAIB 4FUCA 3BG4C 1O30A 2EI7A 3GISB 1GJAB 1Y59T 3FZDA 5EQQA 4X8VH 3U8OH 2ZCKP 2VWNA 1IQFA 1ACBE 1AUJA 3KCGH 1LVOA 1DUAA 1KYNA 2XBVA 1O5DH 5JYIA 3HGNA 5C20A 1GI1A 2J4IA 3BEUA 1DOJA 1QRXA 4O3TA 1AY6H 3D65E 3GCHB 5EPYA 1C1WH 3QLPH 1O3GA 3T25A 2HGTH 3HGPA 1KXBA 2Z94A 3A8CA 2QAAA 2BQ6B 4O03A 4HTCH 1N1LA 2ZA5A 3PO1C 2ZZUH 4GHQA 2A2QH 4ZXYH 1O3HA 1VGCC 5LPEA 1EP6A 2Z6BD 3OY6U 1FIZA 1V2ST 3PLKA 1T8LA 2UUKB 3A86A 4KP0A 1WQVH 5GJ4B 4NZQA 1PPCE 4X0WU 1C5NH 3PROA 1NTPA 4ISIH 1SSXA 4CRAA 1DE7H 1XUFA 1PYTD 4CR9A 1MTWA 4NWLA 3SNCA 3M36A 1P2MA 3AW0A 1BRAA 4ZKSU 1NU9A 1GHYH 2FOBA 3E8LA 1E35B 1W10U 1Z7KA 4NG9H 4MQAA 2FXRA 1MAXA 2Z9IA 3GICB 4YT6H 4AFZA 4TPYA 1P04A 3V12A 1K1JA 3MH6A 1EZQA 2C8YB 1HPGA 1UTKA 4CREA 2ZU1A 3RLYH 1QL8A 3RXMA 1CGIE 3TPIZ 5LH8A 1V2PT 2HNTC 2ZFPH 1WAYB 4H4FA 1QBNA 5E0HA 1DXPA 1PQ8A 2O8WA 3HPTB 2BXTH 2F91A 5DGJA 1MUEB 5T3HA 5EOKA 2PFEA 1BTZA 3EQ0H 1O5GH 1YGCH 1MQ5A 1OSSA 3ZVEA 2XTTB 1HAVB 2J2UA 3KL6A 3TITA 2GMTB 2Z3DA 1ZSLA 4AOQA 1GGDC 1KDQB 2OC1A 3GY5A 4B1TA 2W26A 4JK6A 4YM9A 3TJUA 3PWCA 5EXLA 3SV6A 3MNBA 1GI4A 1O2UA 1SG8B 1UK3A 1ZJKA 2PTNA 1A3EH 2BX4A 2OD3B 3F9EA 1BRUP 3EA7A 1F7ZA 2GCHG 1HAXB 3U1IB 2ODYB 4Y11