1TRMA

The three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title The three-dimensional structure of Asn102 mutant of trypsin: role of Asp102 in serine protease catalysis.
pubmed rcsb
source organism Rattus rattus
molecule tags Hydrolase (serine proteinase)
total genus 50
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1987-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trmA02
1MU8B 3MU8A 1LMWB 1SLXB 5I46H 2ZPSA 1F7ZA 1AI8H 1ARBA 1LHDH 2QCYA 1LHFH 5JPMH 2VVVA 5DP9A 3OYPA 2XXLA 3BEIB 3RLYH 1LHEH 4YLUA 3UTUH 1DUAA 4OS5A 2GV7A 2IPHA 1L4ZA 1GVZA 1DXWA 2Z9LA 1EOJA 1SGPE 3VB4A 1P2NA 4AFSA 3N7OA 1TGCA 1HV7A 1IHSH 2M5TA 3RU4D 1BTYA 1GBEA 3VGCC 3LGTA 2Z7FE 5HXFA 4ZUHA 3U69H 5L2YH 2QGRA 2FYQA 4D76A 2P16A 4B71A 1C9PA 2AGIX 2ZGHA 3GISB 3ZZCA 3NXPA 2ILNA 3H7OA 2AERH 2FXRA 4K60A 3ZZDA 2C93B 1UTNA 1T31A 4CH8B 2BXTH 1GBDA 1SOZA 1GVLA 1ZSLA 1ELDE 1SLUB 1F0TA 3LKWA 4I7YH 1MQ5A 2BLQA 2FOHA 4K8BA 4Y7AA 3SUFA 3PLBA 1QJ7B 1T8LA 3P70B 4DIHH 3EE0B 3RM0H 1SGDE 4MNVA 4YZUA 1DITH 1O3CA 2H2ZA 1UCYE 4GVUA 2A2QH 3QZQA 1ZPZA 4CREA 1K1IA 1XUKA 4E7NA 4DW2U 1O5GH 1KDQA 3GY5A 4X6NA 3QDZB 4Q7ZA 3RXHA 3RMNH 4MLFB 3LDXH 3U98H 1DOJA 2H9TH 1O2NA 2WYGA 2HALA 2F9UA 1S5SA 4Y11E 1UO6A 2OC7A 3P8GA 5JBAS 1SLWB 4UFEH 2ZDNA 5TCCA 5DK1A 1EB2A 4CBOA 1BTPA 3UWJH 3S7HB 2VWLA 1LKAA 1OOKB 1SHHB 1YKTA 1V2NT 1A3BH 5FXLA 1HCGA 3SNEA 2GCTC 4Y10E 5FHTA 1GL1A 1S83A 1WU1A 4F4OC 4GCHG 1DPOA 3VB5A 2OC0A 1S82A 1HAPH 1ZSKA 3P8OA 4PROA 1C5PA 3M37A 1GG6B 4X1SU 1BJVA 2BLWA 2BD4A 4ESTE 2AMQA 3NZIA 2FTMA 3UFAA 1XXFA 1V2JT 2VH6A 3AVZA 5A2MH 2G52A 1ELTA 2BX4A 4OGXA 1O2SA 1G37A 2BVRH 3GCTG 3QZRA 1QY6A 4JYTA 1J17T 3RXDA 2ZIQH 3TH2H 2OC1A 2UUYA 1C2DA 2QY0B 3ZVFA 1KXFA 1QQ4A 2BXUH 2Y5FA 4K1TA 1YPGH 1IHTH 4H42U 2Q6GA 3SJIA 1D9IA 2VIOA 3NCLA 2FOAA 1C4U2 1OWEA 9ESTA 1FPHH 5CMXH 1W2KH 2A0QB 2C8WB 1K1MA 2WPMS 4JK5A 3M5MA 3B23B 1AWHB 2BD5A 1MBQA 1C2KA 5SGAE 2WINI 5JB8S 2PHBA 1LPGB 4BAOB 2GDDA 3S0NA 1VCPA 3SU3A 3GDVA 3MHWU 4CRFA 4Y8ZA 3SHCH 1RTFB 4E06H 2PSYA 2J2UA 3ZZAA 1GI7B 2QV1A 1C1VH 3SZNA 3PMJA 1Y3VA 1YCPH 2NU1E 1MTNC 4GPGA 2P94A 4H4FA 2XBXA 4Y79A 3V0XA 4E05H 3E91A 2XTTB 4WXVA 3GY8A 1FY8E 2FOEA 1A0LA 5GJ4B 3CENA 1AKSB 1QIXB 2OINA 3PB1E 4Y0YE 1DWDH 2BY5X 3TU7H 3A80A 1OP0A 4R0IA 5EXNA 4OS6A 3VFEA 2QYIA 1TQ0B 1QB1A 2DE8A 1QQUA 4FU9A 1P2QA 1EJAA 1MH0A 3RMOH 1QL9A 4AG2A 1C1RA 3NPSA 3TITA 1GJCB 1P2IA 1QJ6B 3OSYA 1DT2A 1SHYA 2PKSB 2Z3DA 3BIUH 4SGAE 5EOKA 3P92A 1VITG 4WVPE 2VU8E 2F9BH 2KAIA 2XC0A 1MUEB 3RXIA 3D65E 3HGNA 2QXHA 3RXGA 2ANYA 2HNTE 2PGBB 4XSKU 1QFKH 2B8OH 1ELVA 3DUXH 4TY7A 4DURA 2FM2A 2JH0D 3FAOA 1A3EH 3PMHB 1MTUA 3SOSA 1BMAA 3BTTE 4H6SB 1CGJE 2J94A 3U9AH 3O8DA 1C5VA 1SOTA 1LVYA 1TFXA 1UTLM 4Y8XA 1HXEH 1UVSH 2QF3A 3DHKH 4WH6A 2HVXA 2Y7ZA 2ULLA 2ZFSA 1UK4A 2GZ7A 1G2MA 1QNJA 5B6OA 1GL0E 1FIWA 5GPIB 4GCHF 2ZC9H 1LKBA 3SGBE 1K1JA 2NU3E 4CR5A 2WUBA 2ZU5A 3PLPA 2TIOA 3Q3YA 3UIRA 2R3UA 1C5MD 1K1PA 1JMOH 2H9HA 1C1UH 1LO6A 2VJ1A 3S7KB 1GG6C 4ZHLU 3O8RA 1NT1A 2F9NA 1EAUA 4NG9H 3ELAH 4UD9H 2Z6BD 3QTVH 1TGBA 1Z1IA 1OWJA 1V6DA 2H9EH 2R0KA 4D8NA 3RXBA 3OU0A 1VGCB 1GBFA 1KXCA 1P01A 3RXKA 1QURH 3SUGA 1BBRH 1TRMA 4Y0ZE 5AFZH 3UNRA 3E8LA 1JRTA 1EP6A 2AFQB 2DE9A 2FI4E 3MWIU 3QWCH 2GT8A 4DG4A 1A61H 4THNH 2G55A 5F8TA 1WAYB 3DT0H 1TRYA 4HFPB 1HUTH 1GDNA 1AMHA 1H9IE 4ISLA 4F49A 4IBLH 3A89A 3MH7A 1KYNA 1WTHD 1ZLRA 3T2NA 3SO3A 3ZV8A 4IN1A 2ESTE 1CT4E 1FY3A 5F8XA 2JETB 2PSXA 2QN5T 4NWKA 1WV7H 3RXLA 5LGOA 1HAYB 1EP5A 4K5ZA 2SNVA 5A8ZA 1ZHRA 3SNCA 1WQSA 2ZP0H 1PQ7A 4DJZB 2BQ6B 1AE8H 2PKAA 1XM1A 1D3TB 5T6FA 1HAGE 2J95A 1O37A 3E16B 1C2IA 1SG8B 4AB8A 5EG4A 1VCQA 2ZO3H 1P05A 1H9HE 2ZCHP 1P03A 4VGCB 1NTPA 3RXMA 3UREA 1M9UA 2BZ6H 5FX5A 4ZXXH 1C1SA 1TE0A 2FLRH 2BDCA 4WWYA 1AFQC 1YBWA 3SV8A 1TBZH 3A88A 1Y3WA 1HDTH 4MPVA 3TNTA 2WPLS 1V2OT 3BSQA 2AIPA 1O5EH 1QBVH 1AFEH 1UTOA 1ETSH 1ZGIA 1S0RA 1C5OH 2BDYA 1HJAB 3LPRA 5E0GA 1O3AA 1O2TA 3D62A 3Q3KA 2YNBA 1OKXA 1T8NA 1BMNH 1Z71A 4I8GA 3ATIA 1O2MA 2I6QA 2W3KA 3A8BA 2TGTA 3T25A 4WF8A 1HIAB 2PKSC 3E90B 3ZYEA 1QB6A 1NO9H 2K1QA 4B74A 2A5IA 1AZ8A 4NSYA 1Z1JA 4WMDA 1ZPBA 1T32A 1NRRH 4MDSA 5EQSA 1GJ5H 1P3CA 3BTGE 1EUFA 1OXGA 1ZJDA 1V2MT 2NU0E 4A1TA 1ZR0A 3ESTA 2ZHFH 4Y71A 3BTFE 3VGCB 1O2VA 5A0BA 1TOCB 3RLWH 4X2XA 1ABIH 2FS9A 1XUIA 4TWYA 2F91A 2A4QA 1PQ8A 4U2WA 2ZNKH 3KIDU 4Q7YA 1FZZA 2XW9A 1L4DA 2V0BA 1BJUA 1BZXE 3RXPA 1DWEH 4AGJA 1QRWA 3BF6H 2A31A 2RA0A 3MU5A 5FCRA 2FWWA 2VH0A 5K0HA 3PMBB 1GDUA 2BQWB 4O03A 2BDBA 2OBQA 1XUGA 1PPFE 2BDGA 1W3CA 1Z8GA 3GCNA 3GCOA 1HYLA 4I8LA 1AO5A 1AHTH 3MNCA 1O3JA 5PTPA 1QA0A 1IQMA 2A32A 2QXIA 2BMGB 1XUFA 5DG6A 2PTCE 1VGCC 5HYOA 1OWKA 2JH5D 1P11E 1TBRH 1PPZA 3LIWA 1C2FA 2ZU2A 1DICA 1O3OA 3UQOA 1C1WH 1C1PA 1GHVH 3MNBA 5E8EH 1BTXA 3PV4A 2BDHA 3UNQA 4NSVA 5EQQA 3UOUA 1Z8IB 2F9OA 1BHXF 1FI8A 2EI6A 1JOUB 2BB4A 1DS2E 4Z6AH 2BOHB 4UEHH 3GCHC 1P2OA 3SUEA 4NA8A 4IMQA 2VWNA 2ALVA 1DWBH 1SGTA 1Z6EA 3LONA 4M7GA 2ZZUH 2GCTB 2JETC 3LGWA 1OSSA 1C4Y2 5FPTA 4NGAH 1C5LH 2H5CA 3SV7A 1C5TA 3SJ8A 1V2KT 3ATMA 3ZYDA 3AAVA 3GY4A 1O3DA 4CRDA 1F5RA 4OS2A 1KY9A 5DJ7A 1MTVA 1KLTA 2OQUA 2D2DA 1HB0B 4IMZA 1CA8B 1MKWH 4K1SA 4HZHA 1YGCH 1O33A 3KGPA 3SBKA 1NRNH 4O3TA 5ESBA 1HAVA 2FO9A 1QA7A 3O8BA 2OC8A 2ALPA 4FU8A 3RXVA 1ELBA 3ZV9A 8LPRA 1GMHF 1OP2A 2A5AA 3UWIA 4WH8A 1CVWH 1ZHMA 3RXAA 3G01A 4GLYA 1UHBB 1O3GA 1TNIA 1EXFA 1CA0B 1O5CB 1P09A 1O34A 3HKIB 2XC4A 5FCKA 1W0ZU 1FPCH 2GGVB 1BQYA 2ODQA 1JIRA 4WJG2 1Z8RA 2C4FH 2VVUA 5EXMA 1MKXK 3Q76A 1RRKA 5BRRE 4E7RG 2ZDVH 1SGFA 1TNKA 3MYWA 1BTZA 5GDSH 2ANKH 1NRPH 1OX1A 1MD8A 1GJ4H 1WQVH 1QL7A 5ABWA 2YNAA 1O2UA 1NRSH 2F9VA 3QGNB 5E2OA 4XDEA 2ZF0H 3VB6A 1WOFA 2GX4A 1SI5H 3U1JB 2BD7A 4BOHA 2IN2A 5FAHA 1OYQA 4I32A 4KP0A 1AE5A 1C5RA 1GI4A 3LT3A 3FVFB 1O3MA 3U8OH 3KQDA 1MTNB 1A5HA 1MZAA 3TJUA 3PM3A 2ZFFH 1FY1A 4BTTB 1O3FA 2OP9A 1TX6A 2BZAA 4FU7A 1GPZA 4NIYA 3HATH 2O9QA 4INHA 4XE4A 1PPBH 3VPKA 2OBOA 3SU2A 4FUIA 1TPAE 1B5GH 1P3EA 5LPFA 2Q1JA 2UWLA 4UONA 3TNSA 2QXGA 2XYAA 1S6FA 3SJ9A 1FQ3A 1TABE 3M7QA 3VB7A 4DCDA 1MQ6A 5C67A 4X0WU 4ZAEA 1RTLA 4A7IB 3RM2H 3L3TA 2EEKA 5A8YA 1CHOF 2FODA 3QLPH 1FDPA 1EAIA 1P10A 1C2HA 1J14A 1TMBH 5L6NH 1QTFA 5EPNA 2SGPE 1V2VT 4FUHA 2F9PA 1UMAH 1THSH 2R0LA 4AFQA 5JB9S 2ZA5A 4O97A 3S9AA 2AGGX 3K2UA 4LK4A 2BDIA 4NA9H 1FN8A 1NZQH 4HGCA 3SHAH 1NRQH 1TNHA 3KCGH 4BANB 5DO4H 1SGQE 4UE7H 1YP9A 5DP5A 2BOKA 2WV4A 2Y7XA 1AN1E 1K1NA 1O5DH 1O31A 3U8TH 3TLOA 4FUEA 2DUCA 5I25A 2CMYA 3LOXA 1PJPA 4DIIH 2J38A 1SVPA 4ASHA 3M7TA 1IQEA 3ZVBA 4I8HA 2TRMA 3FFGA 1O2XA 1O3PB 1EASA 1ELGA 1WYKA 3A86A 5HGGA 1WUNH 3VXFH 4WMEA 1F0UA 3GY3A 1BUIA 1JIMA 1UTPA 3LGYA 3UOPA 1TGSZ 3RXFA 4LOYH 2Y81A 2OXSA 1PFXC 1TGNA 1WTGH 4ABAA 3V12A 2FZZA 4BNRA 1VJAU 1ZMJA 2A1DB 2XRCA 2ZPRA 1F2SE 3L6PA 3SNBA 3SUDA 2VWOA 4FUFA 1C2LA 3LGIA 3DD2H 2SFAA 4NIWA 1V2PT 1GI0A 1CA0C 1ZJKA 2QF0A 2BYAX 4MG3A 5C20A 1ANEA 1YPHC 1GBCA 4D9QA 1YLCA 1RD3B 2FESH 4Q2KA 1HJ8A 1G3BA 3MNXA 4FXGH 2FDAA 3UR9A 1EZSC 1SB1H 3A84A 1D3QB 1ZGVA 2P59A 3M35A 1BMLA 2FOGA 1J15A 2AYWA 4TPYA 2RDLA 4OS4A 1O36A 3PTBA 4Y6DA 1DFPA 2SNWA 4TWWA 3RXRA 1N1LA 4RKJB 3EA9A 2NWNA 3HKJB 1SFIA 3SN8A 1G3CA 1DXPA 3A7ZA 1UVTH 2TGDA 4KTCA 4Y7BA 1NESE 1FIZA 4OS1A 2W26A 1C5NH 2NU2E 4OS7A 1HAHH 1SL3A 3ZVDA 1XXDA 1P2KA 2XNIA 4A92A 1AFQB 1EB1H 4X1NU 1A0HB 5GXPA 1N6XA 4MNXA 4YM9A 1L1NA 1UK3A 1DDJA 4AGKA 5JBBS 1FV9A 1EPTB 1T8OA 1D3DB 1SR5C 2VIVA 1S81A 2UUKB 3C1KA 4BTIB 1GJ9B 2V35A 4AB9A 4J2YB 1O32A 5F6MA 2BTCE 2OQ5A 2ZHEH 1WCZA 2VB0A 1Y5BT 2TPIZ 3T27A 3RMLH 4NFFA 2Z9IA 1ANDA 2ZI2H 1TGTA 3Q00A 3GDUA 2BD3A 1ARCA 3CP7A 1SMFE 5BPEA 4AN7A 2ZHWH 3RU4E 3AW0A 3LU9B 4GSOA 5HM2A 1LHGH 1HXFH 1QBNA 3W94A 1IQIA 2ZFPH 1SQTA 1NFXA 1CBWB 1ZPCA 2F83A 3F68H 3V13A 1W7GH 1BCUH 1ANBA 3ZVCA 2YOLA 1GJ8B 1P02A 3FANA 4MPWA 5A0AE 2UUFB 3MH6A 3K6YA 4D7GA 3SU6A 1EAWA 2Y5HA 1QCPA 4DOQA 1VJ9U 5DPAA 2GCHF 4O3UA 1EAXA 2FIRH 1KIGH 3MO9A 2QAAA 2BDAA 1YCPK 1TX7A 3LGVA 5FBEA 1S0QA 2Z9KA 1A0JA 3I77A 1Z7KA 2P3UB 3UPEA 5A8XA 1H8DH 4NFEA 3A85A 1W11U 2G5VA 4YOIA 5CHAC 1L1GA 3RC4A 3SU0A 4I8JA 1O38A 1O2JA 5TCAA 2FPZA 4AG1A 3IG6B 3TPIZ 2AEIH 2GTBA 1O3NA 1Y3YA 4D7FA 1F92A 1TX8A 1TPSA 1HAZB 3DFJA 5L30H 3EQ0H 2ZECA 2ZHDA 5CE1A 2V3HH 5IYTA 4BAHB 3SV2H 2CHAB 4JZ1A 3MMGA 5C5OA 4NA7A 2W7SA 1A1RA 5C1YA 2J4IA 1GCTC 2HPPH 3P95A 5T3HA 3GCHB 2WUCA 1GBTA 3S9CA 3M7UA 2GMTC 3C27B 3QX5H 2TBSA 4X6OA 1H8IH 2H5DA 2UWPA 3BG8A 1QL8A 7ESTE 1NROH 1HAIH 5GCHF 2FOCA 1X7AC 3HK3B 2A2XH 2A7CA 1BIOA 4UFDH 4ABBA 2BQ7B 1KDQB 3SNDA 3SORA 3URCA 2ZQ1A 1GBIA 1DSUA 3M3VA 4KELA 1UCYH 1HAXB 1HPGA 4ABHA 4MPXA 1A5GH 1OYTH 2JH6D 1ESTA 2A4RA 1N8OB 3FP6E 3W95A 4YLQH 1P2JA 1GI5A 2EC9H 1NPMA 2OLGA 2HRVA 5EW2H 1V2RT 3D49H 3HGPA 1ZRKA 4NCYA 3ZVGA 1C1QA 3D23A 1Q2WA 3F1SB 1QB9A 1GMHG 4X8TH 3RC5A 1K2I1 3P8FA 3P17H 3A83A 1EPTC 3MH4A 1Z8JB 1BBRK 1K28D 4X6MA 1DX5M 1GVKB 1GBKA 1GHAF 2XC5A 1BRAA 1GMDF 5EXLA 3E0NB 1F5LA 1GHBG 1TQ7B 1AWFH 3OTJE 2A45B 1YPEH 1AD8H 4MTBA 3H7TA 1C1OA 3RUOA 5EU8A 2JKHA 1CSOE 2OD3B 1RIWC 1HAOH 2XBWA 1IAUA 1Q3XA 5LPRA 2PV9B 4XBDA 1EZUC 4X6PA 4I33A 1CO7E 4LXBH 1G3DA 1HRTH 3T26A 2VIWA 1QGFA 1MTSA 1O3EA 2RA3A 1CBWC 1O2ZA 1TNGA 3S9BA 2HNTF 1YCPM 5JYIA 3RMMH 2AH4X 1BHXB 2TGAA 2VINA 5J4QA 1MTWA 3HPTB 5FPSA 1HJ9A 1MD7A 3ATKA 1T7CA 2R2MB 2HLCA 1LPZB 5LH8A 1GHZA 3I29A 4NZQA 2Q6FA 2ZEBA 2BD8A 4JCNA 3TGKE 2FI5E 3SI3H 1BOQA 1ELAA 5EQRA 3A7XA 1SPJA 4AFUA 1ESBA 4IW4E 1Y5AT 1FJSA 1MAYA 4GHQA 4GUXA 4AX9H 1XMNB 4ZMAH 2D8WA 1O2LA 4DT7B 3JZ1B 3STIA 5IDKA 2CV3A 4MQAA 2GV6A 2VIDA 1YPHE 1D3PB 1GMCF 3BTEE 4BAKB 4X1QU 3GY7A 1O2GH 1YPMH 1DANH 1DLKB 4R8TB 2FX4A 5GWZA 2AIQA 1AIXH 1E37B 5JBCS 4RKOB 4X8VH 3VB3A 1RTKA 2FX6A 2G51A 2A5KA 2VIPA 1CHOG 1PPGE 1MAXA 3A8CA 1FNIA 1BTUA 1GJ7B 3ODFA 1GBMA 1EATA 2R3YA 2CHAC 3SJOA 4MVNA 1TB6H 5T6GA 3ZVEA 1ZRBA 2FTLE 3MU0A 1O2IA 3PTNA 3Q77A 1IQGA 5HMAA 1B0FA 1V2TT 2NU4E 1PQAA 2SGEE 4INLA 1KXAA 1BTHH 6LPRA 1L2EA 1XVOA 3GY2A 1BT7A 3GYLB 2RG3A 1MKXH 1K1LA 3LJJA 4BXSA 7GCHG 1IQLA 1KXDA 1C5WB 1RJXB 4YESB 2KAIB 1SGCA 1V2UT 3K6ZA 2BM2A 2O8MA 3P8NA 1DY9A 3LJOA 8ESTE 4YT7H 2GT7A 1P57B 4FUJA 3FZZA 3LGUA 1MMJN 2BVXH 1ETRH 4AOQA 2GVFA 3PWBA 4CH2B 1TPOA 3M5LA 4ABGA 2P3TB 1KTTB 2STBE 1VITH 1XVMA 4JYUH 2ZDLA 1HBTH 1P8VC 3I78A 3RXCA 5F8ZA 1HNEE 2SGFE 3E6PH 4INKA 1N8OC 2Z9GA 1W13U 2GDEH 1AKSA 3EGKH 2VVCA 1V2QT 1W0YH 3MH5A 4FVBA 1KXEA 4KTUA 3KQBA 4CRBA 3CS0A 3KQEA 2XBVA 3BEUA 1BRCE 1YYY1 2CGAA 2GD4B 1C5UA 1V2WT 1ORFA 1O30A 1GHBF 2OUAA 1DM4B 3MTYA 1E36B 1C2EA 1ELCA 3MU1A 4D9RA 4XBBA 3PROA 5FPYA 3UY9A 1BRUP 4X8SH 2PUXB 2XWBI 1C2JA 1ELEE 4CRAA 2BY9X 1VZQH 2P8OC 3HK6B 5ESTE 3URDA 3ZZ9A 2CJIA 1EKBB 4GAWA 1DVAH 1WSSH 1XX9A 4FUGA 1KXBA 1GBHA 1FAXA 1H4WA 1IQHA 4MNWA 3WY8A 1ZTKA 4I31A 4ISOA 3MI4A 3GY6A 1ZSJA 1GJDB 1V3XA 1K22H 3S69A 2Z3EA 1BB0B 2PGQB 3A8DA 2C90B 3F9GA 3A87A 2OCVB 4B2CA 1RXPA 3RXJA 2FS8A 1YPLH 2BD2A 1V2LT 3EAJA 1XUJA 2FI3E 1GI2A 4ZKRU 1GI3A 3SU1A 1ZYOA 3SNAA 1GBBA 2ZCLP 1T4VH 1GCDA 3MU4A 4IC6A 1MKWK 2R2WU 4IC5A 2P3FH 1ZTJA 5C5NA 1T4UH 1BBRE 4KKDA 3SJKA 8KME2 2WPJS 2PKAB 4ABJA 1IQFA 1NC6A 4XFQA 4LZ1H 4FUDA 1C4V2 2Y80A 5FBIA 1DY8A 2PFEA 1OP8A 2XCNA 1F0SA 4JZFH 1PPCE 1O0DH 4B2AA 5HM9A 2ZFQH 3TGJE 3TK5A 1SSXA 4J1YA 3A7TA 1MBMA 4ZROA 3LH1A 1KLIH 1TIOA 1TA2A 4U30A 2ZGJA 3EYDA 3VEQB 5T6DA 4UFGH 3M5NA 4DGJA 2O8LA 2SGAA 1TRNA 1SQOA 1B7XB 1A46H 1QRXA 4RN6A 1W12U 2ZDMA 1K9OE 1O3IA 2V6NA 4XBCA 1AY6H 1THPB 3A7WA 1HGTH 7GCHF 1TALA 1CQQA 2ZU4A 4FUBA 4A6LA 1NFYA 5JBTA 5DP7A 4X1PU 2QA9E 1OWIA 1FY5A 3PO1B 1A7SA 5EPYA 4IGDA 2Y5GA 4TPIZ 1AUJA 1H9LB 1FLEE 4B73A 2QXJA 2GCHG 4AFZA 2PR3A 1L1JA 2FEQH 1IQNA 1UJ1A 2HGTH 1S85A 5CHAB 2ODYB 2P95A 1GBAA 1PYTD 6GCHG 1BTWA 1PPHE 3P6ZB 3T5FH 1FN6A 1SC8U 1P9SA 4YOGA 1TMTH 1AVWA 1K1OA 2FOFA 3SV9A 1LPKB 3LC3A 4MPUA 3O8CA 2AS9A 4YO9A 3KEEA 1AQ7A 3TVJB 1O2YA 1RFNA 2LNCA 3T29A 1P0SH 2WV5A 1B0EA 3QUMP 3TH3H 1TWXB 2Y6TA 1TBQH 1Y59T 1GGDB 1S84A 1NN6A 4KGAA 4U01A 3PYHA 1IQKA 2O8TA 2GKVE 1GJBB 1YLDA 3BIVH 4K1EA 1GCTB 2G8TA 4YTAA 5GIBA 3V7TA 4B76A 4ZHAA 1NY22 2O8UA 1AB9C 1HIAA 3SGAE 1GHXH 2TGPZ 2GMTB 3H5CB 1O3BA 3BV9B 1SGFG 1G3EA 1NM6A 1INCA 5DKMA 1OPHB 2W5EA 1Z6JH 1LVBA 1HFDA 2G81E 2ZTXA 1QBOA 2ZDAH 1O2KA 1GI9B 3PLKA 4B2BA 1E34B 5AVDA 3IITA 4X2VA 4FVDA 1Y3UA 2C8XB 8GCHF 2ZGCA 2CF9H 5GCHG 2ZQ2A 3UR6A 1O5BB 2ASUB 2J92A 2IJOB 3KQCA 1CE5A 3GICB 4Q80A 1O2WA 1NU9A 1SGNE 1GHYH 4MNYA 4IS5A 4BAQB 5J4SA 1FMGA 3A8AA 3UNSA 1SQAA 1EQ9A 2QIQA 1O35A 3BTKE 5AHGH 2Z3CA 1G9IE 3NKKA 4ABIA 2BLVA 1MU6B 3M36A 4H6TA 3TH4H 3NK8A 3NUMA 1J9CH 1CGHA 1MZDA 4BXWA 2CF8H 2G5NA 2FMJA 1P04A 2ZGBH 1AZZA 1BMMH 1WBGB 1RGQA 1ZOMA 1NFWA 1SGIB 4I8KA 3ITIA 2PWXA 2A7HA 1GHAG 1LQDB 1HAVB 4K3JA 1GMDG 1RIWB 1OWHA 4ZXYH 1O2HA 4ABEA 3BN9A 1CHGA 2WYJA 3KF2A 4IN2A 3ATWA 2G4UA 1KLJH 1CGIE 1TMUH 2BY7X 1DLEA 3BG4B 4HI3A 3TJNA 1LHCH 4HTCH 1O2RA 5E0HA 2XWAA 4CHAB 1GBLA 3F9HA 2VNTA 2W7UA 4CR9A 1J16A 1AVXA 4ZH8A 1G36A 4X1RU 2C8ZB 4OGYA 3ZZ4A 2ZTZA 4QT8C 4AZ2B 3A81A 4DVAU 2WPIS 3OX7U 4CRGA 6ESTA 5A09A 2ZWLH 1EJMA 4BAMB 1LVMA 1JRSA 1JWTA 2EI8A 2THFB 1XKAC 3ZZ7A 2IOTA 4SGBE 7KMEH 2A4OA 1DWCH 1OWDA 1TYNA 2OTVA 2SGQE 3BTHE 4JMYA 5ETXA 3B8JA 1CT2E 3MOCA 4JZDH 4B75A 1NFUA 1V2ST 3PO1C 1SGRE 1O3KA 2VWMA 1FUJA 1YM0A 2BX3A 3QK1A 4Q7XA 1SGYE 6GCHF 1SLVB 3EA8A 3T28A 3GOVB 5DP3A 2EA3A 2ZU3A 3V3MA 3JZ2B 5TJXA 4Z0KA 5EODA 1SBWA 3TK6A 2D1JA 2ZDKA 1J8AA 1FY4A 3MNSA 2B5TB 1UHBA 3FP8E 2R9PA 3RXTA 1GMCG 3A7VA 3M61U 1TONA 4K8YA 1ZZZA 2J9NA 2FLBH 2P93A 4Y76A 4LZ4B 1QJ1B 1NS3A 2XBYA 1DE7H 1GGDC 2VGCB 1C1TA 3B9FH 2FOBA 3U8RH 1D6RA 1RS0A 5DP4A 2VIQA 3U1IB 3LC5A 3K65B 1O39A 1O2QA 2ZKSA 3KNXA 2GZ8A 3GCTF 1TAWA 2CXVA 4FUCA 4CBNA 3E1XB 3E0PB 1CT0E 1ID5H 3MO3A 1TLDA 4O9VA 3RXSA 1ZMLA 3R3GB 5K7RA 5E2PA 3R0FA 1LVOA 3F9EA 2V3OH 3ZZ8A 2SGDE 1GWAA 1PPEE 3BTDE 1D4PB 2BY6X 1NU7B 2QC2A 1P06A 1W8BH 4JZEH 3ZZBA 2XCFA 1UVPA 4ISIH 1UK2A 1H1BA 2B9LA 1A4WH 1Q31A 3TJOA 4A5TS 1FXYA 3T62A 1JXPA 1HLTH 3ODDA 3F6UH 1EZXC 1GHWH 1LQEA 1C5ZB 3GYMA 6CHAB 5AFYH 2D26C 4WMFA 1TA6A 4K2YA 3ZZ6A 1LDTT 2ZTYA 4JYVH 3LH3A 1C1MA 2BHGA 2FOMB 3RXOA 2ZGXH 1YC0A 2AMDA 4TYDA 1O2OA 2Y82A 3SU5A 3SQEE 3STJA 4X2WA 5JDUB 2BVSH 5C1UA 1MCVA 7LPRA 2BLOA 4WXIA 1LTOA 1FONA 3QN7A 2ZG0H 2Q6DA 2F3CE 3RXEA 2ODPA 1CU1A 2ZCKP 1D6WA 1G2LA 3PMAB 2B0FA 1E35B 2P8OB 3OY6U 3F9FA 1P2MA 3KHVA 3ENSB 3GDSA 1TNJA 2PLXA 3EDXB 1UTQA 4K69A 4ABFA 3IWMA 1IOEA 1O2PA 1KSNA 2J34A 3RP2A 1UTKA 3EA7A 3Q3XA 4UFFH 1UVUH 3BG4C 2PW8H 3BEFB 2HWLB 4RSPA 1W7XH 1FAKH 1QHRB 4B1TA 1T8MA 4CHAC 4JZIA 5L2ZH 1YPKH 4YT6H 5C2ZA 4AORA 1W14U 1THRH 5EGMA 1VITF 1DSTA 2B7DH 3ATLA 3UQVA 2H6MA 1G32B 1G30B 1C9TA 2EI7A 3SV6A 1O3LA 2FP7B 1S6HA 3NWUA 2ZFTA 1GDQA 4U32A 1U6QA 3VXEH 1UCYK 2LPRA 4ISHH 4YOJA 4AYVB 3SGQE 1Y3XA 3BTWE 4X8UH 1VCWA 1YF4A 3AASA 1E38B 1E0FD 4NIVA 3MFJA 3BTME 2C3SA 2Z9JA 1W10U 1EZQA 2UUJB 1ZMNA 3TK9A 1VR1H 4XOJA 1TPPA 3TJVA 3CS7A 5C3NA 4TY6A 2RCEA 5F03A 2PUQH 2Z94A 4Y8YA 1C5QA 3MO6A 1ELFA 9LPRA 2O8WA 2WPKS 1C5SA 3RU4T 2ZU1A 1O3HA 1P12E 3M5OA 1KTSB 3DA9B 4CRCA 1O5AB 3SW2B 2GZ9A 3RXUA 1EX3A 3KN2A 1ZHPA 1P9UA 1C5YB 1K21H 2G4TA 3SQHE 1GJAB 1ACBE 4JK6A 1QR3E 3QO6A 3RDZA 1ANCA 2ANWA 4AYYB 1ETTH 1BITA 2VGCC 1AUTC 1EOLA 1UTJA 2UWOA 4ZHMU 4ISNA 1GJ6A 1UTMA 2WPHS 5A0CA 1Y8TA 4KTSA 2CN0H 1JBUH 5FX6A 1GI8B 3BTQE 1MCTA 1N6YA 5EW1H 1ZTLA 1DUEA 4A1VA 1C2MA 1Y5UT 2H1UA 2AGEX 3RC6A 3QTOH 4ZKSU 4ZKNU 1QRZA 3QGJA 3TGIE 1LCYA 2ZHQH 2HNTC 1TNLA 2C8YB 2G00A 6CHAC 2BY8X 1AU8A 1GBJA 1AVGH 3L33A 4X2YA 1EJNA 3DFLA 3OY5U 4NIXA 1F5KU 2BD9A 2HOBA 1SFQB 3TIUA 1XUHA 3A82A 5DGJA 1EPTA 2ANMH 4GHTA 3E3TA 3PWCA 3SU4A 1C1NA 5AF9H 1ABJH 1AGJA 1BDAA 1C2GA 1GI1A 1OS8A 5LPEA 1A2CH 3K9XB 3KL6A 1UVOA 3FZDA 3M3SA 4BTUB 1C5XB 3ZZ3A 1BA8B 5G4BA 3ZVAA 1GI6A 4VGCC 3FP7E 3RXQA 4NZLA 2ZPQA 1L0ZA 2GP9B 1AB9B 3A7YA 4WY3A 2I6SA 5E0JA 3AW1A 5DP6A 2FYRA 2W3IA 4ABDA 3AAUA 2A4GA 2ZFRH 4UDWH 5H4IB 2PTNA 1F0RA 3ZZ5A 1BRBE 1SGEE 5DP8A 2STAE 2HPQH 4DY7B 1XKBC 4NWLA 3UUZA 1HJAC 5C1XA 1PQ5A 1A5IA 3M3TA 3SI4H 2A7JA 4ZKOU 1YPJH 1PYTC 1O5FH 1TOMH 1ESAA 2AMPA 1IQJA 8GCHG 4A1XA
chains in the Genus database with same CATH superfamily
1MU8B 3MU8A 1LMWB 1SLXB 5I46H 2ZPSA 1F7ZA 1AI8H 1ARBA 1LHDH 2QCYA 1LHFH 5JPMH 2VVVA 5DP9A 3OYPA 2IJD1 2XXLA 3BEIB 3RLYH 1LHEH 3OFND 4YLUA 3UTUH 3PV2A 1DUAA 4OS5A 2GV7A 2IPHA 3W1EA 4FOUC 1L4ZA 1GVZA 1DXWA 2Z9LA 1EOJA 1SGPE 3VB4A 1P2NA 4AFSA 3N7OA 1TGCA 1HV7A 1IHSH 2M5TA 3RU4D 1BTYA 1GBEA 3VGCC 3LGTA 2Z7FE 5HXFA 4ZUHA 3U69H 5L2YH 2QGRA 2FYQA 4D76A 2P16A 5DN6D 4B71A 1C9PA 2AGIX 2ZGHA 3GISB 3ZZCA 3NXPA 2ILNA 3H7OA 4HG6A 2AERH 2FXRA 3N7DA 4K60A 3ZZDA 2C93B 1UTNA 1T31A 4CH8B 2BXTH 1GBDA 1SOZA 1GVLA 1ZSLA 1ELDE 1SLUB 1F0TA 3LKWA 4I7YH 1MQ5A 2BLQA 2FOHA 4K8BA 4Y7AA 3SUFA 3PLBA 1QJ7B 1T8LA 3P70B 4DIHH 3EE0B 3RM0H 1SGDE 4MNVA 3GS9A 4YZUA 1DITH 1O3CA 2H2ZA 1UCYE 4GVUA 2A2QH 3F2GA 3QZQA 1ZPZA 4CREA 1K1IA 1XUKA 4E7NA 4DW2U 1O5GH 1KDQA 3GY5A 4X6NA 3QDZB 4Q7ZA 3RXHA 3RMNH 4MLFB 3LDXH 3U98H 1DOJA 2H9TH 1O2NA 2WYGA 2HALA 2F9UA 1S5SA 4Y11E 1UO6A 2OC7A 3P8GA 5JBAS 1SLWB 1YY3A 4UFEH 2ZDNA 5TCCA 5DK1A 1EB2A 4CBOA 1BTPA 3UWJH 3S7HB 2VWLA 1LKAA 1OOKB 1SHHB 4P00A 1YKTA 1V2NT 1A3BH 5FXLA 1HCGA 3SNEA 2GCTC 4Y10E 5FHTA 1GL1A 1S83A 1WU1A 4F4OC 4GCHG 1DPOA 3VB5A 2OC0A 1S82A 1HAPH 1ZSKA 3P8OA 4PROA 1C5PA 3M37A 1GG6B 4X1SU 1BJVA 2BLWA 4ZCNA 2BD4A 4ESTE 2AMQA 3NZIA 2FTMA 3UFAA 1XXFA 1V2JT 2VH6A 3AVZA 5A2MH 2G52A 1ELTA 2KZ4A 2BX4A 4OGXA 1O2SA 1G37A 2BVRH 3GCTG 3QZRA 1QY6A 4JYTA 1J17T 5T1VA 3RXDA 4M9FA 2ZIQH 5KGOA 3TH2H 2W6JD 2OC1A 2UUYA 1C2DA 2QY0B 3ZVFA 1KXFA 1QQ4A 2BXUH 2Y5FA 4K1TA 1YPGH 1IHTH 4H42U 2Q6GA 3DSPA 3SJIA 1D9IA 2VIOA 3NCLA 2FOAA 1C4U2 1OWEA 9ESTA 1FPHH 5CMXH 1W2KH 2A0QB 2C8WB 1K1MA 2WPMS 4JK5A 5EJLA 3M5MA 3B23B 1AWHB 1COWD 2BD5A 1MBQA 1C2KA 5SGAE 2WINI 5JB8S 2PHBA 1LPGB 4BAOB 2GDDA 3S0NA 1VCPA 3SU3A 3GDVA 3MHWU 3SYJA 4CRFA 4Y8ZA 3SHCH 1RTFB 4E06H 2PSYA 2J2UA 2K0QA 3ZZAA 1GI7B 2QV1A 1C1VH 3SZNA 3PMJA 1Y3VA 1YCPH 2NU1E 1MTNC 4GPGA 4XD7D 2P94A 4H4FA 2XBXA 4Y79A 3V0XA 4E05H 3E91A 2XTTB 4WXVA 3GY8A 1FY8E 2FOEA 1A0LA 5CHBA 5GJ4B 3CENA 1AKSB 1QIXB 2OINA 3PB1E 4Y0YE 1DWDH 2BY5X 3TU7H 3A80A 1OP0A 4R0IA 5EXNA 4OS6A 3VFEA 2QYIA 1TQ0B 1QB1A 2DE8A 1QQUA 4FU9A 1P2QA 1EJAA 1MH0A 3RMOH 1QL9A 4AG2A 1C1RA 3NPSA 3TITA 1GJCB 1P2IA 1QJ6B 3OSYA 3FKSD 1DT2A 1SHYA 2PKSB 2Z3DA 3BIUH 4SGAE 5EOKA 3P92A 1VITG 4WVPE 2VU8E 2F9BH 2KAIA 2XC0A 1MUEB 3RXIA 3D65E 3HGNA 2QXHA 3RXGA 2ANYA 2HNTE 2PGBB 4XSKU 1QFKH 2B8OH 1ELVA 3DUXH 4TY7A 4DURA 2FM2A 2JH0D 2L6OA 3FAOA 1A3EH 3PMHB 1MTUA 3SOSA 1BMAA 3BTTE 4ACBA 4H6SB 1CGJE 2J94A 3U9AH 3O8DA 3ZIAD 1C5VA 1SOTA 1LVYA 1TFXA 1UTLM 4Y8XA 1HXEH 1UVSH 2QF3A 2LP6A 3DHKH 2HVXA 4WH6A 2Y7ZA 2ULLA 2ZFSA 1UK4A 2GZ7A 1G2MA 1QNJA 5B6OA 1GL0E 1FIWA 5FL7D 4TT3D 5GPIB 4GCHF 2ZC9H 3KQ5A 1LKBA 3SGBE 1K1JA 2NU3E 4CR5A 2WUBA 2ZU5A 3PLPA 2TIOA 3Q3YA 3UIRA 2R3UA 1C5MD 1K1PA 1JMOH 2H9HA 1C1UH 1LO6A 2VJ1A 3S7KB 1GG6C 4ZHLU 3O8RA 1NT1A 2F9NA 1EAUA 4NG9H 3ELAH 4UD9H 2Z6BD 3QTVH 1TGBA 1Z1IA 1OWJA 1V6DA 2H9EH 2R0KA 4D8NA 4DT4A 3RXBA 3OU0A 1VGCB 1GBFA 1KXCA 1P01A 3RXKA 1QURH 3SUGA 1BBRH 1TRMA 4Y0ZE 5AFZH 3UNRA 3E8LA 1JRTA 1EP6A 2AFQB 2DE9A 2FI4E 3MWIU 1W0JD 3QWCH 2GT8A 4DG4A 1A61H 4THNH 2G55A 5F8TA 1WAYB 3DT0H 1TRYA 4HFPB 1HUTH 1GDNA 1AMHA 2EY4C 1H9IE 4ISLA 4F49A 4IBLH 3A89A 3MH7A 1KYNA 1E79D 1WTHD 1ZLRA 3T2NA 3SO3A 3ZV8A 4IN1A 2ESTE 1CT4E 1FY3A 5F8XA 2JETB 2PSXA 2QN5T 4NWKA 1WV7H 3RXLA 5LGOA 1HAYB 1EP5A 4K5ZA 2SNVA 2AHME 1ZHRA 2QE7D 3SNCA 5A8ZA 1WQSA 2ZP0H 1PQ7A 4DJZB 2BQ6B 1AE8H 3F0OA 2PKAA 1XM1A 1D3TB 5T6FA 1HAGE 2J95A 1FX0B 1O37A 3E16B 1C2IA 1SG8B 4AB8A 5EG4A 1VCQA 2ZO3H 1P05A 2M2AA 2JJ1D 1H9HE 2ZCHP 1P03A 4VGCB 1NTPA 3RXMA 3UREA 1M9UA 2BZ6H 5FX5A 4ZXXH 1C1SA 1TE0A 2FLRH 2BDCA 4WWYA 1AFQC 1YBWA 3SV8A 1TBZH 3A88A 1Y3WA 1HDTH 4MPVA 3TNTA 2WPLS 1V2OT 3BSQA 2AIPA 1O5EH 1QBVH 1AFEH 1UTOA 1ETSH 1ZGIA 1S0RA 1C5OH 2BDYA 1HJAB 3LPRA 2OK5A 5E0GA 1O3AA 1O2TA 3D62A 3Q3KA 2YNBA 1OKXA 4RI0A 4ACAA 1T8NA 1BMNH 1Z71A 5F53A 4I8GA 3ATIA 1O2MA 2I6QA 2KM0A 2W3KA 3A8BA 2TGTA 3T25A 4WF8A 1HIAB 2PKSC 3E90B 3ZYEA 1QB6A 1NO9H 2K1QA 4B74A 2A5IA 1AZ8A 4NSYA 1Z1JA 4WMDA 1ZPBA 1T32A 2J98B 1NRRH 4MDSA 5EQSA 1GJ5H 1P3CA 3BTGE 1EUFA 1OXGA 1ZJDA 4OM9A 1V2MT 2NU0E 4A1TA 1ZR0A 3ESTA 2ZHFH 4Y71A 3BTFE 3VGCB 1O2VA 5A0BA 1TOCB 3RLWH 4X2XA 1ABIH 2FS9A 1XUIA 4TWYA 2F91A 2A4QA 1PQ8A 4U2WA 2ZNKH 3KIDU 4Q7YA 1FZZA 2XW9A 1L4DA 2V0BA 1BJUA 1BZXE 3RXPA 1DWEH 4AGJA 1QRWA 3BF6H 2A31A 2RA0A 3MU5A 5FCRA 2FWWA 2VH0A 5K0HA 2KCPA 3PMBB 2QF5A 1GDUA 2BQWB 4O03A 2BDBA 2OBQA 1XUGA 1PPFE 2BDGA 1W3CA 1Z8GA 3GCNA 3GCOA 1HYLA 4I8LA 1AO5A 1AHTH 3MNCA 5EIYA 1O3JA 5PTPA 1QA0A 1IQMA 2A32A 2QXIA 3SZEA 2BMGB 1XUFA 5DG6A 2PTCE 1VGCC 5HYOA 1OWKA 2JH5D 1P11E 1TBRH 1PPZA 3LIWA 1C2FA 2QF4A 2ZU2A 1DICA 1O3OA 3UQOA 1C1WH 2V3MA 1C1PA 1GHVH 5GNDA 3MNBA 5E8EH 1BTXA 3PV4A 2BDHA 2KCOA 3UNQA 4NSVA 5EQQA 3UOUA 1Z8IB 2KCYA 2F9OA 1BHXF 1FI8A 2EI6A 1JOUB 2BB4A 1DS2E 4Z6AH 2BOHB 4UEHH 3GCHC 1P2OA 3SUEA 2XNDD 2RFKC 4NA8A 4IMQA 2VWNA 2ALVA 1DWBH 1SGTA 1Z6EA 3LONA 4M7GA 2ZZUH 5EJZA 2GCTB 2JETC 3LGWA 1OSSA 1C4Y2 5FPTA 4NGAH 1C5LH 2H5CA 3SV7A 1C5TA 3SJ8A 1V2KT 3ATMA 3ZYDA 3AAVA 1H8HD 3GY4A 1O3DA 4CRDA 1F5RA 4OS2A 1KY9A 5DJ7A 1MTVA 1KLTA 2OQUA 2D2DA 1HB0B 3WWFA 4IMZA 1CA8B 1MKWH 4K1SA 4HZHA 1YGCH 3WWBA 1O33A 3KGPA 3SBKA 1NRNH 4O3TA 5ESBA 1HAVA 2FO9A 1QA7A 3O8BA 2OC8A 2ALPA 4FU8A 3RXVA 1ELBA 3ZV9A 8LPRA 1GMHF 1OP2A 3H09A 2A5AA 3UWIA 4WH8A 1CVWH 1ZHMA 3RXAA 3G01A 4GLYA 1UHBB 1O3GA 1TNIA 1EXFA 1CA0B 1O5CB 1P09A 1O34A 3HKIB 2XC4A 5FCKA 1W0ZU 1FPCH 2GGVB 1BQYA 2ODQA 1JIRA 4WJG2 1Z8RA 2C4FH 2VVUA 5EXMA 1MKXK 3Q76A 1RRKA 5BRRE 4E7RG 2ZDVH 1SGFA 1TNKA 3MYWA 1BTZA 5GDSH 2ANKH 1NRPH 1OX1A 1MD8A 1GJ4H 1WQVH 1QL7A 5ABWA 3VG8A 2YNAA 1O2UA 1NRSH 2F9VA 3QGNB 5E2OA 4XDEA 2ZF0H 3VB6A 1WOFA 2GX4A 1SI5H 3U1JB 2BD7A 4BOHA 2IN2A 5FAHA 1OYQA 4I32A 4KP0A 1AE5A 1C5RA 1GI4A 3LT3A 3N99A 3FVFB 1O3MA 3U8OH 3KQDA 1MTNB 1A5HA 1MZAA 3TJUA 3PM3A 2ZFFH 1FY1A 4BTTB 1O3FA 2OP9A 1TX6A 2BZAA 4FU7A 1GPZA 4NIYA 3HATH 2O9QA 1H8ED 4INHA 4XE4A 1PPBH 3VPKA 2OBOA 3SU2A 4FUIA 1TPAE 1B5GH 1P3EA 5LPFA 2Q1JA 2UWLA 4UONA 3TNSA 2QXGA 4Z1MD 2XYAA 1S6FA 4I86A 3SJ9A 1FQ3A 1TABE 3M7QA 3VB7A 4DCDA 1MQ6A 5C67A 4X0WU 4ZAEA 1RTLA 4A7IB 3RM2H 3L3TA 2EEKA 5A8YA 1CHOF 2FODA 3QLPH 1FDPA 1EAIA 1P10A 1C2HA 1J14A 1TMBH 5L6NH 1QTFA 5EPNA 2SGPE 1V2VT 4FUHA 2F9PA 1UMAH 1THSH 2R0LA 4AFQA 5JB9S 3DSOA 2ZA5A 4O97A 4Q4LA 3S9AA 2AGGX 3K2UA 4LK4A 4RT0A 2BDIA 4NA9H 1FN8A 1NZQH 4HGCA 3SHAH 1NRQH 1TNHA 3KCGH 4BANB 5DO4H 1SGQE 4UE7H 1YP9A 5DP5A 2BOKA 2WV4A 2Y7XA 1AN1E 1K1NA 1O5DH 1O31A 3U8TH 3TLOA 4FUEA 2DUCA 5I25A 2CMYA 3LOXA 1PJPA 4DIIH 2J38A 1SVPA 2HLDD 4ASHA 3M7TA 1IQEA 3ZVBA 4I8HA 2TRMA 3FFGA 1O2XA 1O3PB 1EASA 1ELGA 1WYKA 3A86A 5HGGA 1WUNH 3VXFH 1NBME 4WMEA 1F0UA 3GY3A 1BUIA 1JIMA 1UTPA 3LGYA 3UOPA 1TGSZ 3RXFA 4LOYH 2Y81A 2OXSA 1PFXC 1TGNA 1WTGH 4ABAA 3V12A 2FZZA 4BNRA 1VJAU 5C0UA 1ZMJA 2A1DB 2XRCA 2ZPRA 1F2SE 3L6PA 3SNBA 3SUDA 2VWOA 4FUFA 1C2LA 3LGIA 3PRBA 2SFAA 3DD2H 4NIWA 1V2PT 1GI0A 1CA0C 1ZJKA 2QF0A 5C17A 2BYAX 4MG3A 5C20A 1ANEA 1YPHC 3OEHD 1GBCA 4D9QA 1YLCA 1SQRA 1RD3B 2FESH 4Q2KA 1HJ8A 1G3BA 3MNXA 4FXGH 2FDAA 3UR9A 5EJ1A 1EZSC 1SB1H 3A84A 1D3QB 1ZGVA 2P59A 3M35A 1BMLA 2FOGA 1J15A 2AYWA 4TPYA 2RDLA 4OS4A 1O36A 3PTBA 4Y6DA 1DFPA 2SNWA 2CK3D 4TWWA 3RXRA 2J98A 1N1LA 4RKJB 3EA9A 5HIYA 2NWNA 3HKJB 1SFIA 3SN8A 1G3CA 1DXPA 3A7ZA 1UVTH 2TGDA 4KTCA 4Y7BA 3PRDA 1SKYE 1NESE 1FIZA 4OS1A 2W26A 1C5NH 2NU2E 4OS7A 1HAHH 1SL3A 3ZVDA 1XXDA 1P2KA 2XNIA 4A92A 1VKYA 1AFQB 2YMSD 1EB1H 4X1NU 1A0HB 5GXPA 1N6XA 4MNXA 4YM9A 1L1NA 1UK3A 1DDJA 4AGKA 5JBBS 1FV9A 1EPTB 1T8OA 3AK5A 1D3DB 1SR5C 2VIVA 1S81A 2UUKB 3C1KA 5DSFA 4BTIB 1GJ9B 2V35A 4AB9A 4J2YB 1O32A 5F6MA 2BTCE 2OQ5A 4B6FA 2ZHEH 1WCZA 2VB0A 1Y5BT 2TPIZ 3T27A 3RMLH 4NFFA 2Z9IA 1ANDA 2ZI2H 1TGTA 3Q00A 3GDUA 2BD3A 1ARCA 3CP7A 1SMFE 5BPEA 4AN7A 2ZHWH 3RU4E 2L74A 3AW0A 3LU9B 4GSOA 5HM2A 1LHGH 1HXFH 1QBNA 3W94A 1IQIA 4FETA 2ZFPH 1SQTA 1NFXA 1CBWB 1ZPCA 2F83A 3F68H 3V13A 1W7GH 1BCUH 1ANBA 1E1QD 3ZVCA 2YOLA 1GJ8B 1P02A 3FANA 4MPWA 5A0AE 2UUFB 3MH6A 3K6YA 5IK2D 4D7GA 3SU6A 1EAWA 2Y5HA 1QCPA 4DOQA 1VJ9U 5DPAA 2GCHF 4O3UA 1EAXA 2FIRH 1KIGH 3MO9A 2QAAA 2BDAA 1YCPK 1TX7A 3LGVA 5FBEA 1S0QA 2Z9KA 1A0JA 3I77A 1Z7KA 2P3UB 3UPEA 5A8XA 1H8DH 4NFEA 3A85A 1W11U 2G5VA 4YOIA 3F2FA 5CHAC 1L1GA 3N7EA 3RC4A 3SU0A 4I8JA 1O38A 1O2JA 5TCAA 2FPZA 4AG1A 3IG6B 3TPIZ 2AEIH 2GTBA 1O3NA 1Y3YA 4D7FA 1F92A 1TX8A 1TPSA 1HAZB 4TSFD 3DFJA 5L30H 3EQ0H 2ZECA 2ZHDA 5CE1A 2V3HH 5IYTA 4BAHB 3SV2H 2CHAB 4JZ1A 3MMGA 5C5OA 4NA7A 2J5UA 2W7SA 1A1RA 5C1YA 2J4IA 1GCTC 2HPPH 3P95A 5T3HA 3GCHB 2WUCA 1GBTA 3S9CA 3M7UA 2GMTC 3C27B 3QX5H 1BMFD 2TBSA 4X6OA 1H8IH 2H5DA 2UWPA 3BG8A 1QL8A 7ESTE 1NROH 1HAIH 5GCHF 2FOCA 1X7AC 3HK3B 2A2XH 2A7CA 1BIOA 4UFDH 4ABBA 2BQ7B 1KDQB 3SNDA 3SORA 3URCA 2ZQ1A 1GBIA 1UW7A 1DSUA 3M3VA 4KELA 1UCYH 1HAXB 1HPGA 4ABHA 4MPXA 1A5GH 1OYTH 2JH6D 1ESTA 2A4RA 1N8OB 3FP6E 3W95A 4YLQH 1P2JA 1GI5A 2EC9H 1NPMA 2OLGA 2HRVA 5EW2H 1V2RT 3D49H 3HGPA 1ZRKA 4NCYA 3ZVGA 1OHHD 1C1QA 3D23A 1Q2WA 3F1SB 1QB9A 1GMHG 4X8TH 3RC5A 1K2I1 3P8FA 3P17H 3A83A 1EPTC 3MH4A 1Z8JB 1BBRK 1K28D 4X6MA 1DX5M 1GVKB 1GBKA 1GHAF 2XC5A 3F3BA 1BRAA 1GMDF 4YXWD 5EXLA 3E0NB 1F5LA 1GHBG 1TQ7B 1AWFH 3OTJE 2A45B 1YPEH 1AD8H 4MTBA 3H7TA 1C1OA 3RUOA 5EU8A 2JKHA 1CSOE 2OD3B 1RIWC 1HAOH 2XBWA 1IAUA 1Q3XA 5LPRA 2PV9B 4XBDA 1EZUC 4X6PA 4I33A 1CO7E 4LXBH 1G3DA 1HRTH 3T26A 2VIWA 1QGFA 1QZ8A 1MTSA 1O3EA 2RA3A 1CBWC 1O2ZA 1TNGA 3S9BA 2HNTF 1YCPM 5JYIA 3RMMH 2AH4X 1BHXB 2TGAA 2VINA 5J4QA 1MTWA 3HPTB 5FPSA 1HJ9A 1MD7A 3ATKA 1T7CA 2R2MB 2HLCA 1LPZB 5LH8A 1GHZA 3I29A 4NZQA 5C94A 2RDEA 2Q6FA 2ZEBA 2BD8A 4JCNA 3TGKE 2FI5E 3SI3H 1BOQA 1ELAA 5EQRA 2KCAA 3A7XA 1SPJA 4AFUA 1ESBA 4IW4E 1Y5AT 1FJSA 1MAYA 4GHQA 4GUXA 4AX9H 2XOKD 1XMNB 4ZMAH 2D8WA 1O2LA 4DT7B 3JZ1B 3STIA 5IDKA 2CV3A 4MQAA 2GV6A 2F43B 2VIDA 1YPHE 1D3PB 1GMCF 3BTEE 3OE7D 4BAKB 4X1QU 3GY7A 1O2GH 1YPMH 1DANH 3DSGA 3MQKC 1DLKB 4R8TB 2FX4A 5GWZA 2AIQA 1AIXH 1E37B 5JBCS 4RKOB 4X8VH 3VB3A 1RTKA 2FX6A 4Q63A 2G51A 5KECA 2A5KA 2VIPA 1CHOG 1PPGE 1MAXA 3A8CA 1FNIA 1BTUA 1GJ7B 3ODFA 1GBMA 1EATA 2R3YA 2CHAC 3SJOA 4MVNA 1TB6H 5T6GA 3ZVEA 1ZRBA 2FTLE 3MU0A 1O2IA 2WZQA 3PTNA 3Q77A 1IQGA 5HMAA 1B0FA 1V2TT 2NU4E 1PQAA 2SGEE 4INLA 1KXAA 1BTHH 6LPRA 1L2EA 1XVOA 3GY2A 1BT7A 3GYLB 2YMSB 3FOAA 2RG3A 1MKXH 1K1LA 3LJJA 4BXSA 7GCHG 1IQLA 1KXDA 1C5WB 1RJXB 4YESB 2KAIB 1MABB 1SGCA 1V2UT 3K6ZA 2BM2A 2O8MA 3P8NA 1DY9A 3LJOA 8ESTE 4YT7H 2GT7A 1P57B 4FUJA 3FZZA 3LGUA 1MMJN 2BVXH 1ETRH 4AOQA 2GVFA 3PWBA 4CH2B 1TPOA 3M5LA 4ABGA 2P3TB 1KTTB 2STBE 1VITH 1XVMA 4JYUH 2ZDLA 1HBTH 1P8VC 3I78A 3RXCA 5F8ZA 1HNEE 2SGFE 3E6PH 4INKA 1N8OC 2Z9GA 1W13U 2GDEH 1AKSA 3EGKH 2VVCA 1V2QT 1W0YH 3MH5A 4FVBA 1KXEA 4KTUA 3KQBA 4ASUD 4CRBA 3CS0A 3KQEA 2XBVA 3BEUA 1BRCE 1YYY1 2CGAA 2GD4B 1C5UA 1V2WT 1ORFA 2WHXA 1O30A 1GHBF 2OUAA 4P02A 1DM4B 3MTYA 1E36B 1C2EA 1ELCA 2VBCA 3MU1A 4D9RA 4XBBA 3PROA 5FPYA 3UY9A 1BRUP 4X8SH 2PUXB 2XWBI 1C2JA 1ELEE 4CRAA 2BY9X 1VZQH 2P8OC 3HK6B 5ESTE 3URDA 1WXRA 3ZZ9A 2CJIA 1EKBB 4GAWA 1DVAH 1WSSH 1XX9A 4FUGA 1KXBA 1GBHA 1FAXA 1H4WA 1IQHA 4MNWA 3WY8A 1ZTKA 4I31A 4ISOA 3MI4A 3GY6A 1ZSJA 1GJDB 1V3XA 1K22H 3S69A 2Z3EA 1BB0B 2PGQB 3A8DA 2C90B 3F9GA 3A87A 1E1RD 2OCVB 4B2CA 1RXPA 3RXJA 2FS8A 2KX4A 1YPLH 2BD2A 1V2LT 3EAJA 1XUJA 2FI3E 1GI2A 4ZKRU 1GI3A 3SU1A 1ZYOA 3SNAA 1GBBA 2ZCLP 1T4VH 1GCDA 3MU4A 4IC6A 1MKWK 2R2WU 4IC5A 3U28C 2P3FH 1ZTJA 5C5NA 1T4UH 1BBRE 4KKDA 3SJKA 8KME2 2WPJS 2PKAB 4ABJA 5C0TA 1IQFA 1NC6A 4XFQA 4LZ1H 3OTPA 4FUDA 1C4V2 2Y80A 5FBIA 1DY8A 2PFEA 1OP8A 2XCNA 1F0SA 4JZFH 1PPCE 1O0DH 4B2AA 5HM9A 2ZFQH 3TGJE 3TK5A 1SSXA 2K8IA 4J1YA 3A7TA 1MBMA 4ZROA 3LH1A 1KLIH 1TIOA 1TA2A 4U30A 2ZGJA 3EYDA 3VEQB 5T6DA 4UFGH 3M5NA 4DGJA 2O8LA 2SGAA 1TRNA 1SQOA 5HKKD 1B7XB 1A46H 1QRXA 4RN6A 1W12U 2ZDMA 1K9OE 1O3IA 2V6NA 4XBCA 1AY6H 1THPB 3A7WA 1HGTH 7GCHF 1TALA 1CQQA 2ZU4A 4FUBA 4A6LA 1NFYA 5JBTA 5DP7A 2YMSC 4X1PU 2QA9E 1OWIA 1FY5A 3PO1B 1A7SA 5EPYA 4IGDA 2Y5GA 4TPIZ 1AUJA 1H9LB 1FLEE 4B73A 2QXJA 2GCHG 4AFZA 2KR7A 1L1JA 2FEQH 2PR3A 1K0HA 1IQNA 1UJ1A 2HGTH 1S85A 5CHAB 2ODYB 2P95A 1GBAA 1PYTD 6GCHG 1BTWA 1PPHE 3P6ZB 3T5FH 1FN6A 1SC8U 1P9SA 4YOGA 1TMTH 1AVWA 1K1OA 2FOFA 3SV9A 1LPKB 3LC3A 4MPUA 3O8CA 2AS9A 4YO9A 3KEEA 1AQ7A 3TVJB 1O2YA 1RFNA 2LNCA 3T29A 1P0SH 2WV5A 1B0EA 3PV5A 3QUMP 3TH3H 1TWXB 2Y6TA 1TBQH 1Y59T 1GGDB 1S84A 1NN6A 4KGAA 4U01A 3PYHA 1IQKA 2O8TA 2GKVE 1GJBB 1YLDA 3BIVH 4K1EA 1GCTB 2G8TA 4YTAA 5GIBA 3V7TA 4B76A 4ZHAA 1NY22 2O8UA 1AB9C 1HIAA 3SGAE 1GHXH 4F48B 2TGPZ 2GMTB 3H5CB 1O3BA 3BV9B 1SGFG 1G3EA 1NM6A 1INCA 5DKMA 1OPHB 2W5EA 1Z6JH 1LVBA 3NRLA 1HFDA 3FN8A 2G81E 2ZTXA 1QBOA 2ZDAH 1O2KA 2F4LA 1GI9B 3PLKA 4B2BA 1E34B 5AVDA 3IITA 4X2VA 4FVDA 1Y3UA 2C8XB 8GCHF 2ZGCA 2CF9H 1YLNA 2ZQ2A 2JJ2D 5GCHG 3UR6A 1O5BB 2ASUB 2J92A 2IJOB 3KQCA 1CE5A 3GICB 4Q80A 1O2WA 1NU9A 1SGNE 1GHYH 4MNYA 4IS5A 4BAQB 5J4SA 1FMGA 3A8AA 3UNSA 1SQAA 1EQ9A 2QIQA 2JIZD 1O35A 3BTKE 5AHGH 2Z3CA 1G9IE 3NKKA 4ABIA 2BLVA 1MU6B 3M36A 4H6TA 3TH4H 3NK8A 3NUMA 1J9CH 1CGHA 1MZDA 4BXWA 2CF8H 2G5NA 2FMJA 1P04A 2ZGBH 3CNRA 1AZZA 1BMMH 1WBGB 1RGQA 1ZOMA 1NFWA 1SGIB 4I8KA 3ITIA 2PWXA 3DCLA 2A7HA 1GHAG 1LQDB 1HAVB 2J97A 1GMDG 4K3JA 1RIWB 1OWHA 4ZXYH 1O2HA 4ABEA 3BN9A 1CHGA 2WYJA 3KF2A 4IN2A 3ATWA 2G4UA 1KLJH 1CGIE 1TMUH 2BY7X 1DLEA 3BG4B 4HI3A 3TJNA 1LHCH 4HTCH 1O2RA 5E0HA 2XWAA 4CHAB 1GBLA 3F9HA 2PP6A 2VNTA 2W7UA 4CR9A 1J16A 1AVXA 4ZH8A 1G36A 4X1RU 2JDID 2C8ZB 4OGYA 3ZZ4A 2ZTZA 4QT8C 4AZ2B 4B6EA 3A81A 4DVAU 2WPIS 3OX7U 4CRGA 6ESTA 5A09A 2ZWLH 1EJMA 4BAMB 1LVMA 1JRSA 1JWTA 2EI8A 2THFB 1XKAC 3ZZ7A 2IOTA 4SGBE 7KMEH 2A4OA 1DWCH 1OWDA 1TYNA 1WDIA 2OTVA 2SGQE 3BTHE 4JMYA 5ETXA 3B8JA 1CT2E 3MOCA 4JZDH 4B75A 1NFUA 1V2ST 3PO1C 1SGRE 1O3KA 2VWMA 1FUJA 1YM0A 2BX3A 3QK1A 4Q7XA 1SGYE 2EQNA 6GCHF 1SLVB 3EA8A 3T28A 3GOVB 5DP3A 2EA3A 2ZU3A 3V3MA 3JZ2B 5TJXA 4Z0KA 5EODA 1SBWA 3TK6A 2D1JA 2ZDKA 1J8AA 1FY4A 3MNSA 2B5TB 1KMHB 1UHBA 3FP8E 2R9PA 3RXTA 1GMCG 3A7VA 5HIZA 3M61U 1TONA 4K8YA 1ZZZA 2J9NA 2FLBH 2P93A 4Y76A 4LZ4B 1QJ1B 4F55A 3OAAD 1NS3A 2XBYA 1DE7H 1GGDC 2VGCB 1C1TA 3B9FH 2FOBA 2LELA 3U8RH 1D6RA 1RS0A 5DP4A 2VIQA 3U1IB 3LC5A 3K65B 1O39A 1O2QA 2ZKSA 3KNXA 3WW7A 2GZ8A 3GCTF 1YWUA 1TAWA 2CXVA 4FUCA 3KYGA 4CBNA 3E1XB 3E0PB 1CT0E 1ID5H 3MO3A 1TLDA 4O9VA 3RXSA 1ZMLA 3R3GB 5K7RA 5E2PA 3R0FA 1LVOA 3F9EA 2KFWA 2V3OH 3ZZ8A 2SGDE 1GWAA 1PPEE 3BTDE 1D4PB 2BY6X 5KEDA 1NU7B 2QC2A 1P06A 1W8BH 4JZEH 3ZZBA 2XCFA 1UVPA 2GJGA 4ISIH 1UK2A 1H1BA 2B9LA 1A4WH 1Q31A 3TJOA 4A5TS 1FXYA 3T62A 1JXPA 1HLTH 3ODDA 3F6UH 1EZXC 1GHWH 1LQEA 1C5ZB 3GYMA 6CHAB 5AFYH 2D26C 4WMFA 1TA6A 4K2YA 3ZZ6A 1LDTT 2ZTYA 4JYVH 3LH3A 1C1MA 2BHGA 2FOMB 3RXOA 2ZGXH 1YC0A 2AMDA 4TYDA 1O2OA 2Y82A 2WSSD 3SU5A 3SQEE 3STJA 4X2WA 5JDUB 4AC9A 2BVSH 5C1UA 1MCVA 7LPRA 2BLOA 4WXIA 1LTOA 1FONA 3QN7A 2ZG0H 2Q6DA 2F3CE 3RXEA 2ODPA 1CU1A 2ZCKP 1D6WA 1G2LA 3PMAB 2B0FA 1E35B 2P8OB 3OY6U 3F9FA 1P2MA 3KHVA 4XRNA 3ENSB 3GDSA 1TNJA 2PLXA 3EDXB 1UTQA 4K69A 4ABFA 3IWMA 1IOEA 1O2PA 1KSNA 2J34A 3RP2A 1UTKA 3EA7A 3Q3XA 4UFFH 1UVUH 3BG4C 2PW8H 3BEFB 2HWLB 4RSPA 1W7XH 1FAKH 1QHRB 4B1TA 1T8MA 1W0KD 4CHAC 4JZIA 5L2ZH 1YPKH 3UB0A 4YT6H 5C2ZA 4AORA 1W14U 1THRH 5EGMA 1VITF 1DSTA 5CDFE 2B7DH 3ATLA 3UQVA 2H6MA 1G32B 1G30B 2WPDD 1C9TA 2EI7A 3SV6A 1O3LA 2FP7B 1S6HA 3NWUA 2ZFTA 1GDQA 5B6LA 4U32A 4RT1A 1U6QA 3VXEH 1UCYK 2LPRA 4ISHH 4YOJA 4AYVB 3SGQE 1Y3XA 3BTWE 3OEED 4X8UH 1VCWA 1YF4A 3AASA 1E38B 1E0FD 4NIVA 3MFJA 3BTME 2C3SA 2Z9JA 1W10U 1EZQA 2UUJB 1ZMNA 3TK9A 1VR1H 4XOJA 1TPPA 3TJVA 3CS7A 5C3NA 4TY6A 2RCEA 5F03A 2PUQH 2Z94A 4Y8YA 1C5QA 3MO6A 1ELFA 9LPRA 2V7QD 2O8WA 2WPKS 1C5SA 3RU4T 2ZU1A 3FO8D 1O3HA 1P12E 2W6ID 3M5OA 1KTSB 3DA9B 4CRCA 1O5AB 3SW2B 2GZ9A 3RXUA 1EX3A 3KN2A 1ZHPA 1P9UA 1C5YB 1K21H 2G4TA 3SQHE 1GJAB 1ACBE 4JK6A 1QR3E 3QO6A 3RDZA 1ANCA 2ANWA 4AYYB 1ETTH 1BITA 2VGCC 2WV9A 1AUTC 1EOLA 1UTJA 2UWOA 4ZHMU 4ISNA 3UAIC 1GJ6A 1UTMA 2WPHS 5A0CA 1Y8TA 4KTSA 2CN0H 1JBUH 5FX6A 1GI8B 3BTQE 1MCTA 1NBMD 1N6YA 5EW1H 1ZTLA 1DUEA 4A1VA 1C2MA 1Y5UT 2H1UA 3F2HA 2AGEX 3RC6A 3QTOH 4ZKSU 3KYFA 4ZKNU 1QRZA 3QGJA 3TGIE 1LCYA 2ZHQH 2HNTC 1TNLA 2C8YB 2G00A 6CHAC 2BY8X 1AU8A 1GBJA 2HVYB 1AVGH 3L33A 4X2YA 1EJNA 3DFLA 3OY5U 4NIXA 1F5KU 2BD9A 2HOBA 1SFQB 3EE7A 3F0PA 3TIUA 1XUHA 3A82A 5DGJA 1EPTA 2ANMH 4GHTA 3E3TA 3PWCA 3SU4A 1C1NA 2IPQX 5AF9H 1ABJH 1AGJA 1BDAA 1C2GA 1GI1A 1OS8A 5LPEA 1A2CH 3K9XB 3KL6A 1UVOA 3FZDA 3M3SA 4BTUB 1C5XB 1EFRD 3ZZ3A 1BA8B 5G4BA 3ZVAA 1GI6A 4VGCC 3FP7E 3RXQA 4NZLA 2ZPQA 1L0ZA 2GP9B 1AB9B 3A7YA 4WY3A 2I6SA 5E0JA 3AW1A 5DP6A 2FYRA 2W3IA 4ABDA 3AAUA 2A4GA 2ZFRH 4UDWH 5H4IB 2PTNA 1F0RA 3ZZ5A 1BRBE 1S6LA 1SGEE 5DP8A 2STAE 2HPQH 4DY7B 1XKBC 4NWLA 3UUZA 1HJAC 5C1XA 1PQ5A 1A5IA 3M3TA 3SI4H 2A7JA 4ZKOU 1YPJH 1PYTC 1O5FH 1TOMH 1ESAA 2AMPA 1IQJA 8GCHG 4A1XA
chains in the Genus database with same CATH topology
1MU8B 3MU8A 1LMWB 1SLXB 5I46H 2ZPSA 1F7ZA 1AI8H 1ARBA 1LHDH 2QCYA 1LHFH 5JPMH 2VVVA 5DP9A 3OYPA 2XXLA 3BEIB 3RLYH 1LHEH 4YLUA 3UTUH 1DUAA 4OS5A 2GV7A 2IPHA 1L4ZA 1GVZA 1DXWA 2Z9LA 1EOJA 1SGPE 3VB4A 1P2NA 4AFSA 3N7OA 1TGCA 1HV7A 1IHSH 2M5TA 3RU4D 1BTYA 1GBEA 3VGCC 3LGTA 2Z7FE 5HXFA 4ZUHA 3U69H 5L2YH 2QGRA 2FYQA 4D76A 2P16A 4B71A 1C9PA 2AGIX 2ZGHA 3GISB 3ZZCA 3NXPA 2ILNA 3H7OA 2AERH 2FXRA 4K60A 3ZZDA 2C93B 1UTNA 1T31A 4CH8B 2BXTH 1GBDA 1SOZA 1GVLA 1ZSLA 1ELDE 1SLUB 1F0TA 3LKWA 4I7YH 1MQ5A 2BLQA 2FOHA 4K8BA 4Y7AA 3SUFA 3PLBA 1QJ7B 1T8LA 3P70B 4DIHH 3EE0B 3RM0H 1SGDE 4MNVA 4YZUA 1DITH 1O3CA 2H2ZA 1UCYE 4GVUA 2A2QH 3QZQA 1ZPZA 4CREA 1K1IA 1XUKA 4E7NA 4DW2U 1O5GH 1KDQA 3GY5A 4X6NA 3QDZB 4Q7ZA 3RXHA 3RMNH 4MLFB 3LDXH 3U98H 1DOJA 2H9TH 1O2NA 2WYGA 2HALA 2F9UA 1S5SA 4Y11E 1UO6A 2OC7A 3P8GA 5JBAS 1SLWB 4UFEH 2ZDNA 5TCCA 5DK1A 1EB2A 4CBOA 1BTPA 3UWJH 3S7HB 2VWLA 1LKAA 1OOKB 1SHHB 1YKTA 1V2NT 1A3BH 5FXLA 1HCGA 3SNEA 2GCTC 4Y10E 5FHTA 1GL1A 1S83A 1WU1A 4F4OC 4GCHG 1DPOA 3VB5A 2OC0A 1S82A 1HAPH 1ZSKA 3P8OA 4PROA 1C5PA 3M37A 1GG6B 4X1SU 1BJVA 2BLWA 2BD4A 4ESTE 2AMQA 3NZIA 2FTMA 3UFAA 1XXFA 1V2JT 2VH6A 3AVZA 5A2MH 2G52A 1ELTA 2BX4A 4OGXA 1O2SA 1G37A 2BVRH 3GCTG 3QZRA 1QY6A 4JYTA 1J17T 3RXDA 2ZIQH 3TH2H 2OC1A 2UUYA 1C2DA 2QY0B 3ZVFA 1KXFA 1QQ4A 2BXUH 2Y5FA 4K1TA 1YPGH 1IHTH 4H42U 2Q6GA 3SJIA 1D9IA 2VIOA 3NCLA 2FOAA 1C4U2 1OWEA 9ESTA 1FPHH 5CMXH 1W2KH 2A0QB 2C8WB 1K1MA 2WPMS 4JK5A 3M5MA 3B23B 1AWHB 2BD5A 1MBQA 1C2KA 5SGAE 2WINI 5JB8S 2PHBA 1LPGB 4BAOB 2GDDA 3S0NA 1VCPA 3SU3A 3GDVA 3MHWU 4CRFA 4Y8ZA 3SHCH 1RTFB 4E06H 2PSYA 2J2UA 3ZZAA 1GI7B 2QV1A 1C1VH 3SZNA 3PMJA 1Y3VA 1YCPH 2NU1E 1MTNC 4GPGA 2P94A 4H4FA 2XBXA 4Y79A 3V0XA 4E05H 3E91A 2XTTB 4WXVA 3GY8A 1FY8E 2FOEA 1A0LA 5GJ4B 3CENA 1AKSB 1QIXB 2OINA 3PB1E 4Y0YE 1DWDH 2BY5X 3TU7H 3A80A 1OP0A 4R0IA 5EXNA 4OS6A 3VFEA 2QYIA 1TQ0B 1QB1A 2DE8A 1QQUA 4FU9A 1P2QA 1EJAA 1MH0A 3RMOH 1QL9A 4AG2A 1C1RA 3NPSA 3TITA 1GJCB 1P2IA 1QJ6B 3OSYA 1DT2A 1SHYA 2PKSB 2Z3DA 3BIUH 4SGAE 5EOKA 3P92A 1VITG 4WVPE 2VU8E 2F9BH 2KAIA 2XC0A 1MUEB 3RXIA 3D65E 3HGNA 2QXHA 3RXGA 2ANYA 2HNTE 2PGBB 4XSKU 1QFKH 2B8OH 1ELVA 3DUXH 4TY7A 4DURA 2FM2A 2JH0D 3FAOA 1A3EH 3PMHB 1MTUA 3SOSA 1BMAA 3BTTE 4H6SB 1CGJE 2J94A 3U9AH 3O8DA 1C5VA 1SOTA 1LVYA 1TFXA 1UTLM 4Y8XA 1HXEH 1UVSH 2QF3A 3DHKH 4WH6A 2HVXA 2Y7ZA 2ULLA 2ZFSA 1UK4A 2GZ7A 1G2MA 1QNJA 5B6OA 1GL0E 1FIWA 5GPIB 4GCHF 2ZC9H 1LKBA 3SGBE 1K1JA 2NU3E 4CR5A 2WUBA 2ZU5A 3PLPA 2TIOA 3Q3YA 3UIRA 2R3UA 1C5MD 1K1PA 1JMOH 2H9HA 1C1UH 1LO6A 2VJ1A 3S7KB 1GG6C 4ZHLU 3O8RA 1NT1A 2F9NA 1EAUA 4NG9H 3ELAH 4UD9H 2Z6BD 3QTVH 1TGBA 1Z1IA 1OWJA 1V6DA 2H9EH 2R0KA 4D8NA 3RXBA 3OU0A 1VGCB 1GBFA 1KXCA 1P01A 3RXKA 1QURH 3SUGA 1BBRH 1TRMA 4Y0ZE 5AFZH 3UNRA 3E8LA 1JRTA 1EP6A 2AFQB 2DE9A 2FI4E 3MWIU 3QWCH 2GT8A 4DG4A 1A61H 4THNH 2G55A 5F8TA 1WAYB 3DT0H 1TRYA 4HFPB 1HUTH 1GDNA 1AMHA 1H9IE 4ISLA 4F49A 4IBLH 3A89A 3MH7A 1KYNA 1WTHD 1ZLRA 3T2NA 3SO3A 3ZV8A 4IN1A 2ESTE 1CT4E 1FY3A 5F8XA 2JETB 2PSXA 2QN5T 4NWKA 1WV7H 3RXLA 5LGOA 1HAYB 1EP5A 4K5ZA 2SNVA 5A8ZA 1ZHRA 3SNCA 1WQSA 2ZP0H 1PQ7A 4DJZB 2BQ6B 1AE8H 2PKAA 1XM1A 1D3TB 5T6FA 1HAGE 2J95A 1O37A 3E16B 1C2IA 1SG8B 4AB8A 5EG4A 1VCQA 2ZO3H 1P05A 1H9HE 2ZCHP 1P03A 4VGCB 1NTPA 3RXMA 3UREA 1M9UA 2BZ6H 5FX5A 4ZXXH 1C1SA 1TE0A 2FLRH 2BDCA 4WWYA 1AFQC 1YBWA 3SV8A 1TBZH 3A88A 1Y3WA 1HDTH 4MPVA 3TNTA 2WPLS 1V2OT 3BSQA 2AIPA 1O5EH 1QBVH 1AFEH 1UTOA 1ETSH 1ZGIA 1S0RA 1C5OH 2BDYA 1HJAB 3LPRA 5E0GA 1O3AA 1O2TA 3D62A 3Q3KA 2YNBA 1OKXA 1T8NA 1BMNH 1Z71A 4I8GA 3ATIA 1O2MA 2I6QA 2W3KA 3A8BA 2TGTA 3T25A 4WF8A 1HIAB 2PKSC 3E90B 3ZYEA 1QB6A 1NO9H 2K1QA 4B74A 2A5IA 1AZ8A 4NSYA 1Z1JA 4WMDA 1ZPBA 1T32A 1NRRH 4MDSA 5EQSA 1GJ5H 1P3CA 3BTGE 1EUFA 1OXGA 1ZJDA 1V2MT 2NU0E 4A1TA 1ZR0A 3ESTA 2ZHFH 4Y71A 3BTFE 3VGCB 1O2VA 5A0BA 1TOCB 3RLWH 4X2XA 1ABIH 2FS9A 1XUIA 4TWYA 2F91A 2A4QA 1PQ8A 4U2WA 2ZNKH 3KIDU 4Q7YA 1FZZA 2XW9A 1L4DA 2V0BA 1BJUA 1BZXE 3RXPA 1DWEH 4AGJA 1QRWA 3BF6H 2A31A 2RA0A 3MU5A 5FCRA 2FWWA 2VH0A 5K0HA 3PMBB 1GDUA 2BQWB 4O03A 2BDBA 2OBQA 1XUGA 1PPFE 2BDGA 1W3CA 1Z8GA 3GCNA 3GCOA 1HYLA 4I8LA 1AO5A 1AHTH 3MNCA 1O3JA 5PTPA 1QA0A 1IQMA 2A32A 2QXIA 2BMGB 1XUFA 5DG6A 2PTCE 1VGCC 5HYOA 1OWKA 2JH5D 1P11E 1TBRH 1PPZA 3LIWA 1C2FA 2ZU2A 1DICA 1O3OA 3UQOA 1C1WH 1C1PA 1GHVH 3MNBA 5E8EH 1BTXA 3PV4A 2BDHA 3UNQA 4NSVA 5EQQA 3UOUA 1Z8IB 2F9OA 1BHXF 1FI8A 2EI6A 1JOUB 2BB4A 1DS2E 4Z6AH 2BOHB 4UEHH 3GCHC 1P2OA 3SUEA 4NA8A 4IMQA 2VWNA 2ALVA 1DWBH 1SGTA 1Z6EA 3LONA 4M7GA 2ZZUH 2GCTB 2JETC 3LGWA 1OSSA 1C4Y2 5FPTA 4NGAH 1C5LH 2H5CA 3SV7A 1C5TA 3SJ8A 1V2KT 3ATMA 3ZYDA 3AAVA 3GY4A 1O3DA 4CRDA 1F5RA 4OS2A 1KY9A 5DJ7A 1MTVA 1KLTA 2OQUA 2D2DA 1HB0B 4IMZA 1CA8B 1MKWH 4K1SA 4HZHA 1YGCH 1O33A 3KGPA 3SBKA 1NRNH 4O3TA 5ESBA 1HAVA 2FO9A 1QA7A 3O8BA 2OC8A 2ALPA 4FU8A 3RXVA 1ELBA 3ZV9A 8LPRA 1GMHF 1OP2A 2A5AA 3UWIA 4WH8A 1CVWH 1ZHMA 3RXAA 3G01A 4GLYA 1UHBB 1O3GA 1TNIA 1EXFA 1CA0B 1O5CB 1P09A 1O34A 3HKIB 2XC4A 5FCKA 1W0ZU 1FPCH 2GGVB 1BQYA 2ODQA 1JIRA 4WJG2 1Z8RA 2C4FH 2VVUA 5EXMA 1MKXK 3Q76A 1RRKA 5BRRE 4E7RG 2ZDVH 1SGFA 1TNKA 3MYWA 1BTZA 5GDSH 2ANKH 1NRPH 1OX1A 1MD8A 1GJ4H 1WQVH 1QL7A 5ABWA 2YNAA 1O2UA 1NRSH 2F9VA 3QGNB 5E2OA 4XDEA 2ZF0H 3VB6A 1WOFA 2GX4A 1SI5H 3U1JB 2BD7A 4BOHA 2IN2A 5FAHA 1OYQA 4I32A 4KP0A 1AE5A 1C5RA 1GI4A 3LT3A 3FVFB 1O3MA 3U8OH 3KQDA 1MTNB 1A5HA 1MZAA 3TJUA 3PM3A 2ZFFH 1FY1A 4BTTB 1O3FA 2OP9A 1TX6A 2BZAA 4FU7A 1GPZA 4NIYA 3HATH 2O9QA 4INHA 4XE4A 1PPBH 3VPKA 2OBOA 3SU2A 4FUIA 1TPAE 1B5GH 1P3EA 5LPFA 2Q1JA 2UWLA 4UONA 3TNSA 2QXGA 2XYAA 1S6FA 3SJ9A 1FQ3A 1TABE 3M7QA 3VB7A 4DCDA 1MQ6A 5C67A 4X0WU 4ZAEA 1RTLA 4A7IB 3RM2H 3L3TA 2EEKA 5A8YA 1CHOF 2FODA 3QLPH 1FDPA 1EAIA 1P10A 1C2HA 1J14A 1TMBH 5L6NH 1QTFA 5EPNA 2SGPE 1V2VT 4FUHA 2F9PA 1UMAH 1THSH 2R0LA 4AFQA 5JB9S 2ZA5A 4O97A 3S9AA 2AGGX 3K2UA 4LK4A 2BDIA 4NA9H 1FN8A 1NZQH 4HGCA 3SHAH 1NRQH 1TNHA 3KCGH 4BANB 5DO4H 1SGQE 4UE7H 1YP9A 5DP5A 2BOKA 2WV4A 2Y7XA 1AN1E 1K1NA 1O5DH 1O31A 3U8TH 3TLOA 4FUEA 2DUCA 5I25A 2CMYA 3LOXA 1PJPA 4DIIH 2J38A 1SVPA 4ASHA 3M7TA 1IQEA 3ZVBA 4I8HA 2TRMA 3FFGA 1O2XA 1O3PB 1EASA 1ELGA 1WYKA 3A86A 5HGGA 1WUNH 3VXFH 4WMEA 1F0UA 3GY3A 1BUIA 1JIMA 1UTPA 3LGYA 3UOPA 1TGSZ 3RXFA 4LOYH 2Y81A 2OXSA 1PFXC 1TGNA 1WTGH 4ABAA 3V12A 2FZZA 4BNRA 1VJAU 1ZMJA 2A1DB 2XRCA 2ZPRA 1F2SE 3L6PA 3SNBA 3SUDA 2VWOA 4FUFA 1C2LA 3LGIA 3DD2H 2SFAA 4NIWA 1V2PT 1GI0A 1CA0C 1ZJKA 2QF0A 2BYAX 4MG3A 5C20A 1ANEA 1YPHC 1GBCA 4D9QA 1YLCA 1RD3B 2FESH 4Q2KA 1HJ8A 1G3BA 3MNXA 4FXGH 2FDAA 3UR9A 1EZSC 1SB1H 3A84A 1D3QB 1ZGVA 2P59A 3M35A 1BMLA 2FOGA 1J15A 2AYWA 4TPYA 2RDLA 4OS4A 1O36A 3PTBA 4Y6DA 1DFPA 2SNWA 4TWWA 3RXRA 1N1LA 4RKJB 3EA9A 2NWNA 3HKJB 1SFIA 3SN8A 1G3CA 1DXPA 3A7ZA 1UVTH 2TGDA 4KTCA 4Y7BA 1NESE 1FIZA 4OS1A 2W26A 1C5NH 2NU2E 4OS7A 1HAHH 1SL3A 3ZVDA 1XXDA 1P2KA 2XNIA 4A92A 1AFQB 1EB1H 4X1NU 1A0HB 5GXPA 1N6XA 4MNXA 4YM9A 1L1NA 1UK3A 1DDJA 4AGKA 5JBBS 1FV9A 1EPTB 1T8OA 1D3DB 1SR5C 2VIVA 1S81A 2UUKB 3C1KA 4BTIB 1GJ9B 2V35A 4AB9A 4J2YB 1O32A 5F6MA 2BTCE 2OQ5A 2ZHEH 1WCZA 2VB0A 1Y5BT 2TPIZ 3T27A 3RMLH 4NFFA 2Z9IA 1ANDA 2ZI2H 1TGTA 3Q00A 3GDUA 2BD3A 1ARCA 3CP7A 1SMFE 5BPEA 4AN7A 2ZHWH 3RU4E 3AW0A 3LU9B 4GSOA 5HM2A 1LHGH 1HXFH 1QBNA 3W94A 1IQIA 2ZFPH 1SQTA 1NFXA 1CBWB 1ZPCA 2F83A 3F68H 3V13A 1W7GH 1BCUH 1ANBA 3ZVCA 2YOLA 1GJ8B 1P02A 3FANA 4MPWA 5A0AE 2UUFB 3MH6A 3K6YA 4D7GA 3SU6A 1EAWA 2Y5HA 1QCPA 4DOQA 1VJ9U 5DPAA 2GCHF 4O3UA 1EAXA 2FIRH 1KIGH 3MO9A 2QAAA 2BDAA 1YCPK 1TX7A 3LGVA 5FBEA 1S0QA 2Z9KA 1A0JA 3I77A 1Z7KA 2P3UB 3UPEA 5A8XA 1H8DH 4NFEA 3A85A 1W11U 2G5VA 4YOIA 5CHAC 1L1GA 3RC4A 3SU0A 4I8JA 1O38A 1O2JA 5TCAA 2FPZA 4AG1A 3IG6B 3TPIZ 2AEIH 2GTBA 1O3NA 1Y3YA 4D7FA 1F92A 1TX8A 1TPSA 1HAZB 3DFJA 5L30H 3EQ0H 2ZECA 2ZHDA 5CE1A 2V3HH 5IYTA 4BAHB 3SV2H 2CHAB 4JZ1A 3MMGA 5C5OA 4NA7A 2W7SA 1A1RA 5C1YA 2J4IA 1GCTC 2HPPH 3P95A 5T3HA 3GCHB 2WUCA 1GBTA 3S9CA 3M7UA 2GMTC 3C27B 3QX5H 2TBSA 4X6OA