1GI4A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi4A02
3SJ9A 2BY7X 1FJSA 2NU4E 1C2FA 1BHXF 1K21H 5IYTA 2Z9JA 3BG4C 2O8TA 4X6PA 4AFSA 2XWAA 1O30A 5JBAS 1AVXA 3MFJA 1TGSZ 2VVUA 2OC1A 1C1PA 1FPHH 2P3UB 1BITA 1OPHB 2KAIB 4B2CA 5HYOA 4CH2B 2BOKA 3PWBA 2P3TB 1ZTJA 1N8OC 2NU1E 3T27A 4KTSA 8ESTE 1DANH 5LGOA 3B23B 2BY5X 1ESTA 4DOQA 1QJ7B 4ZMAH 2PHBA 3VXFH 2BB4A 1O5DH 2BXUH 1P2IA 5ETXA 5A0BA 1V2OT 2ZWLH 3UOUA 3AAVA 1EP5A 3TJVA 1ZRKA 4WWYA 1S85A 3T62A 2G55A 4HI3A 4FUJA 2ZGBH 1EAIA 1ETSH 3FP8E 1FV9A 1TFXA 2A4QA 1GJ7B 5DPAA 2FMJA 4CHAC 5PTPA 2FOEA 3FP6E 1UVPA 3QUMP 3MH4A 1LO6A 1ZJKA 2PKSC 2CHAC 3BIVH 4I32A 2FI3E 1WUNH 1PPEE 3M3SA 2A7HA 1AMHA 1K1PA 4ABAA 3LONA 3UPEA 3A7XA 1O2YA 2FP7B 3K6YA 1S82A 2A4OA 1C4V2 2BY8X 1GVZA 3QLPH 3TK5A 5FPTA 2JETC 3GCOA 3E0PB 1UHBA 4YT7H 5EXMA 1AB9B 4NA9H 1QA7A 1Y59T 4MDSA 1ARBA 3LC3A 2SGFE 1C5RA 1KXDA 3OYPA 2Z6BD 2F91A 2A32A 1IQFA 2BY6X 1QBOA 1QB6A 2GT8A 3A8CA 1BTZA 3OTJE 3L33A 3RXRA 3GDUA 2OD3B 3CENA 1C1VH 1GI9B 3BV9B 1V2WT 2HWLB 4ZROA 1TRNA 1WBGB 1V2PT 3GYMA 3M3TA 1O2OA 5DP3A 4FUDA 2P93A 2LNCA 3FP7E 4YT6H 1GMCG 1L4DA 1O32A 2FM2A 4ESTE 2DE8A 4X8TH 1W14U 2OXSA 3PB1E 4OS6A 7ESTE 1TOMH 1C2LA 1TAWA 5GXPA 1KTTB 4CRDA 4KP0A 5JB9S 1TX6A 2BMGB 1ZHPA 3B9FH 3F68H 5GCHF 2B8OH 2J94A 1GBMA 1C5ZB 1C9PA 1JIRA 1HIAA 3HKIB 3E8LA 1QIXB 3QGNB 3HKJB 2W26A 2Z94A 1O3FA 2BDIA 4IC5A 3BSQA 1M9UA 1NPMA 2OQ5A 2OBOA 2BDHA 1UTJA 1KYNA 2BZ6H 1FONA 3U8RH 1EAUA 1JWTA 2ODPA 3VEQB 3RXSA 1T8MA 1TNIA 3QK1A 2G4TA 1G9IE 3A83A 4SGBE 4NGAH 1C5WB 3EA7A 1AE8H 3SV6A 2H6MA 1GHXH 1GI5A 1W2KH 1BHXB 1V2ST 3NCLA 2ZU4A 1O2GH 1RTFB 3C27B 1LQDB 3EQ0H 1CT0E 3KQBA 1IQNA 1FY5A 4OS1A 4NWLA 3SU2A 1C1SA 5EPYA 1BMMH 1ZSLA 3A7WA 5JPMH 2ZGHA 2HGTH 1GCTB 1AWHB 4BAOB 1NRSH 4X6MA 1TBZH 3F9HA 1MTUA 2G52A 2SGDE 1ZMJA 1ARCA 1TGBA 1O2WA 1GJAB 1D6RA 2GKVE 2ZU2A 3RMMH 4BANB 3SU4A 5C1XA 3T26A 1GBFA 2A45B 1MH0A 1V2MT 5LPRA 2IPHA 1MCVA 1MKWK 1DX5M 2EA3A 1FIWA 1TQ7B 1IQGA 4AOQA 1EPTA 1EOLA 1G32B 5AVDA 3EDXB 1F7ZA 3VB3A 1ABIH 2ZU1A 4AFQA 3M35A 1QJ1B 2BD5A 2BLVA 2D2DA 4WMDA 2H2ZA 1C5OH 1T7CA 3MI4A 3OY6U 3MO9A 1DDJA 1A5HA 1SGIB 4I31A 1TA2A 5EW2H 3ODFA 2PKSB 2CHAB 2VU8E 1E38B 1BRUP 1FNIA 2ASUB 1W0YH 1C9TA 1A3EH 3M61U 4XE4A 2WPKS 1RD3B 1KLTA 1CU1A 3V12A 1BIOA 5GPIB 3CS0A 5E2OA 1C5VA 3SQHE 1EOJA 1DOJA 1TB6H 4XFQA 2XTTB 1F0SA 2JETB 3TGIE 3DUXH 3SU5A 3H5CB 3NXPA 1TWXB 1TE0A 2ZCHP 3GY2A 4ABJA 2ZGJA 4FUIA 1THPB 2J38A 1AZ8A 2GDEH 3PM3A 2A7CA 5GWZA 1GHAF 1O2IA 4FUEA 3NPSA 1C1TA 1V2TT 3RXFA 4WXIA 1ZPCA 1DUEA 1SLVB 1GWAA 1V2JT 3QWCH 2QA9E 1EJMA 1GBAA 2R0KA 1CHOF 3V0XA 2H9EH 4DURA 1LHGH 2VIPA 1MQ5A 3RXMA 2PKAB 1P11E 1B0FA 2DE9A 1P12E 1F0TA 1P57B 1SGRE 3SI4H 5DP4A 1BBRK 2BVRH 1TNLA 4X2VA 3ZZAA 4D7FA 6GCHG 2CJIA 4YTAA 1P05A 4X8VH 1T32A 5TJXA 1E0FD 3SHAH 2ZI2H 3SGQE 1K1IA 1W13U 5FBEA 2FIRH 1A0HB 4IMQA 3F9FA 1V2RT 1D4PB 1NFWA 2TBSA 4CRBA 3STIA 2ANWA 1Z1IA 1WSSH 3RXHA 1B5GH 2GVFA 1BTPA 1AVWA 1P9UA 1C5PA 3SI3H 2OC7A 1ELCA 2R2MB 3QGJA 1GBLA 4CR9A 3M7TA 1VGCC 5JDUB 3SU3A 3ZVCA 5CE1A 1ZYOA 1U6QA 2VWNA 5GCHG 1CA0B 1YF4A 4ZHLU 2STAE 1QHRB 2HLCA 1BQYA 2FEQH 1AI8H 1LHFH 1N6YA 1BRBE 1QRXA 3FZDA 5FPYA 5I25A 4OS4A 3W95A 3M36A 3QX5H 1FMGA 3E90B 1PPZA 1XUHA 1SHYA 3E91A 4NCYA 1LVBA 2PTNA 1BTXA 1GHWH 1HRTH 1SLWB 3U98H 2NU2E 4YOJA 1C2MA 2QF3A 2I6SA 4JZEH 2FODA 2LPRA 2IN2A 1AIXH 1MZAA 3BTME 4AB8A 1QTFA 1S6HA 1T4VH 1HAXB 4MPUA 3BEFB 1XM1A 2ANMH 3MOCA 4ZAEA 1ELGA 3A82A 2UWPA 1UK4A 1MAYA 1XMNB 2NU3E 4FU7A 5G4BA 2C8ZB 2STBE 3RU4E 2BDYA 4JMYA 1LKAA 5CHAB 2Z3CA 4K8BA 1H4WA 1ZRBA 2C3SA 3LIWA 4INHA 1SQAA 1X7AC 1RGQA 5HMAA 1ELBA 3MU5A 2FOFA 4FVDA 1WAYB 4X1NU 5EQSA 1TNKA 5LPFA 1Z71A 1O36A 2ZNKH 3QZRA 2TGPZ 1TPPA 1GHVH 1AWFH 1SC8U 2ZDKA 3ZVAA 1F5KU 3WY8A 3T29A 2RCEA 2AH4X 2F9UA 1O2VA 1YPHE 1GMHG 2J95A 2GCTC 4I8LA 3M7QA 3MU0A 5CMXH 6ESTA 1O2JA 3A81A 1MZDA 2ZGCA 3I77A 2HOBA 2OLGA 2RDLA 4SGAE 2BD7A 4A6LA 2V3HH 1VJ9U 1TIOA 4B1TA 7LPRA 4BAQB 4Y7BA 3A7YA 1OP2A 1LCYA 1QCPA 1LTOA 2BVSH 1IQMA 1V6DA 2TRMA 1TBRH 3SU0A 4UFGH 2SGQE 2BD9A 1YBWA 2FDAA 3AAUA 2PLXA 4INLA 3SGAE 1EQ9A 1AB9C 5A8XA 2AYWA 2BHGA 3ZZ8A 3A88A 2P3FH 2G51A 1L4ZA 2XC0A 1TMUH 1O3LA 3P92A 3RXQA 4AZ2B 2VIVA 3URCA 5L2ZH 1EPTB 3BTFE 1N6XA 1UCYH 3T25A 3LT3A 1XX9A 2V3OH 2SNWA 3RXLA 4JYUH 1W11U 2C4FH 3KQDA 1BRAA 1GMCF 1QQ4A 2Q1JA 1BTHH 5F03A 1NN6A 1D3DB 3TJNA 1UO6A 1Z1JA 2ODQA 1EP6A 1QNJA 4UFEH 1SGQE 2AERH 1BUIA 1FPCH 1ZTLA 2ESTE 1C5UA 3SO3A 3SORA 3TK6A 1ZTKA 3TNSA 1Y3VA 4FUFA 1G3BA 3NZIA 5EQQA 1MKXK 1DY9A 4YM9A 1B0EA 1ZLRA 2UUJB 1GI1A 5FX6A 1OWIA 5E8EH 2ODYB 4H6TA 2UWLA 1LVYA 2FLRH 1EZSC 3P95A 1KXFA 3UOPA 5JBBS 3M5LA 1BBRE 1FLEE 1W7XH 2BLWA 2YNBA 4TYDA 5F8XA 5JB8S 1O5GH 2V0BA 2WUCA 2ZECA 2PTCE 4UONA 1MUEB 1P2JA 3LKWA 3BTEE 2BD2A 2WPJS 5C3NA 1NROH 1FY8E 1UTNA 4ZKSU 4XDEA 3ZV8A 1VGCB 4H6SB 1E35B 1L2EA 3R0FA 3W94A 3MYWA 3MH5A 4AFUA 5JYIA 4I8KA 1THRH 3SW2B 1VCQA 4D7GA 1GHYH 2ZP0H 1TX8A 1K9OE 1OS8A 2Y7XA 3RXKA 1T4UH 1RRKA 4U30A 5DP5A 2P16A 1GBEA 1O2KA 1THSH 3A7VA 2H9TH 3RLYH 2EI7A 1L1GA 2AS9A 5C2ZA 3RU4D 3PV4A 2VIDA 2ZFSA 4B2AA 1C2HA 3HGNA 1MBMA 4CBOA 2CGAA 4NSYA 1UMAH 1HYLA 1P10A 3ZZ9A 1GCTC 3O8BA 4BXSA 1C1OA 3RXOA 1SB1H 1Z8JB 4K8YA 4YESB 1GDQA 4RKOB 1KXBA 1CBWC 5L30H 1KLIH 5C1UA 4J1YA 3V3MA 1OWHA 4IGDA 3O8DA 1UVTH 1Z8RA 3C1KA 3BF6H 8LPRA 2F9BH 1AKSA 4MNXA 1SLXB 1A0JA 4X0WU 2A4GA 2GX4A 1HV7A 1DVAH 1BTYA 2JKHA 1F2SE 1NY22 1VJAU 2FZZA 2PV9B 3A7TA 3Q3KA 1EATA 1MCTA 3CS7A 2AMQA 2GCTB 4B74A 5F8TA 5FAHA 1GJCB 3P17H 4E05H 2R3YA 4A1XA 1SGNE 3MNSA 2Q6FA 3MH7A 4NFFA 2O8MA 2AIPA 1LMWB 4JCNA 4FUCA 3A86A 1HFDA 1S5SA 4UD9H 2GTBA 1GI6A 1NRNH 4DW2U 3U1JB 3GOVB 3MH6A 1FXYA 4BAMB 4UFDH 2BDGA 1MKXH 4ZKRU 4K60A 2ZHWH 4CREA 1F92A 1GG6B 2ZF0H 1NS3A 3MNCA 1EB2A 1WYKA 4U2WA 2VJ1A 5DKMA 3M3VA 1AN1E 1K1JA 4D9QA 1YCPH 1SGCA 3SHCH 5A2MH 2AEIH 3NWUA 1UTPA 1DFPA 4TY7A 5FCKA 3MMGA 2ZTXA 1OOKB 2W3KA 1OYTH 4XOJA 1H8DH 3UIRA 1SGYE 4FU8A 1GI7B 4NZQA 1KTSB 2W3IA 2PGBB 2XW9A 1Q31A 4ISLA 1YYY1 1E37B 3UTUH 2W7SA 1D3TB 3FZZA 4NFEA 6GCHF 1NESE 2GT7A 1C1UH 4IN1A 3P6ZB 1O3DA 2B9LA 2FOMB 1OP0A 1QL9A 1F0RA 5T6DA 4DT7B 4X2XA 5EG4A 2ZIQH 1IHSH 1VCWA 3FFGA 4FUHA 1WU1A 1IAUA 4KKDA 4B76A 1P04A 1YPHC 1YPJH 4AN7A 5IDKA 1A46H 3K65B 2P94A 1FN6A 2YNAA 1YPMH 1O5EH 1FAKH 3U69H 5T6GA 1ESBA 3PWCA 3ZZDA 1C2DA 3JZ2B 1KDQA 4BAKB 1D6WA 1CT4E 1ZHMA 3RMLH 4K69A 1CGJE 1P09A 3RXGA 1CGHA 4X8UH 1AY6H 4IBLH 3SNCA 3D65E 1W12U 3M37A 4Q7ZA 1QRWA 2Q6GA 5EQRA 1CA0C 1C5TA 1MTSA 4GPGA 4BNRA 1O3NA 4O3TA 3UWJH 4THNH 2PWXA 2BYAX 2BQWB 3MO3A 1TNJA 2ZDVH 2QAAA 3UQOA 4Y79A 8GCHG 2B0FA 4NA8A 1P01A 1XVOA 1JBUH 3DFLA 1EZUC 3Q77A 4JZIA 3V7TA 1XXFA 3AASA 2VWLA 3RXIA 4U32A 1P2NA 4D8NA 1ANEA 1CA8B 1BOQA 2Y82A 5HM2A 1RFNA 3PYHA 2CF8H 1EAXA 1TA6A 3Q00A 5AF9H 2EI6A 2VIOA 5A0AE 1AGJA 3NKKA 1VITH 1LPGB 2WYGA 1O3EA 3SOSA 4NZLA 5C1YA 4ISHH 3O8RA 5CHAC 1TMTH 1EJAA 2ZFQH 4E7NA 4WH6A 5EW1H 3GY6A 3MNBA 3IITA 5C20A 1HJ9A 2QXIA 1WTHD 4NSVA 2Y81A 2R9PA 1NT1A 1KIGH 3KNXA 1MQ6A 1CBWB 1MTWA 1KSNA 2ILNA 2R2WU 9ESTA 1O5BB 2ZPQA 1GMHF 2BDBA 1ZHRA 1RS0A 4DGJA 2THFB 4OGXA 3U9AH 3SQEE 1AFEH 2B7DH 1ELEE 4JK6A 1SGDE 4DCDA 4ISOA 1FZZA 2C8WB 2QF0A 1PPGE 3E3TA 2BTCE 1O3CA 3P8OA 3PO1B 1WV7H 1IOEA 4OS2A 3B8JA 4R0IA 4CRCA 5A8YA 5EXLA 1O3HA 5HXFA 2VINA 1LHEH 3H7OA 4F4OC 1SFIA 3L6PA 2ZKSA 1O2XA 2BX3A 1BTUA 1GHZA 1BT7A 2ZA5A 1PPFE 2EEKA 1ETRH 1NRPH 3I78A 3TH2H 2ZDMA 2ZFTA 1IQHA 1P2KA 1TRYA 2GZ7A 1HAPH 1AKSB 2FTMA 5AFZH 3ZYEA 1EUFA 2G5NA 1O2HA 3RMNH 1S0QA 1BMNH 1O2UA 1EPTC 4I7YH 4K3JA 3SUDA 3ZZ3A 1P0SH 1WQVH 2BLQA 4MPVA 1SOTA 2VIWA 2VWOA 2ZO3H 3TVJB 2Y5GA 1AZZA 3EA8A 4YO9A 1HUTH 4RSPA 1QL7A 4Y6DA 3A85A 3LGYA 3KF2A 4IS5A 3QO6A 4YOIA 7KMEH 3PLBA 3RXDA 3SZNA 2RA3A 5BPEA 3P8FA 1V2VT 3LU9B 4IMZA 5ESTE 2SGEE 2AMPA 1Q3XA 1GPZA 1NFUA 2AIQA 4GSOA 1LHCH 1S81A 3Q3YA 4UE7H 2BD8A 2ZDNA 3ZZ6A 1RJXB 5BRRE 3H7TA 3LDXH 2HPQH 4K5ZA 4BTTB 1UHBB 3Q76A 1YM0A 4Y11E 1ELDE 1ELFA 1OWJA 2F9NA 4CRFA 3UQVA 4JYVH 4ABHA 1C5YB 1YLDA 1YP9A 2XBWA 3M7UA 4AB9A 1OWDA 3BN9A 1C5NH 1GBIA 1FN8A 3M5NA 2SGPE 3GCTG 3SJIA 1SI5H 1WCZA 2OTVA 1UCYK 1WTGH 3Q3XA 2CN0H 1RTLA 1EZQA 1S6FA 1A5IA 1YLCA 3LH1A 4AORA 2AGGX 1O33A 1J16A 1ZPZA 5EGMA 1TGCA 1AVGH 1TYNA 2PR3A 1Z6EA 1ZSKA 4BAHB 4A92A 4DG4A 3GISB 2G8TA 1O3AA 1IQEA 2CXVA 2CV3A 3M5OA 4KELA 2H1UA 4O9VA 3SNAA 2GZ8A 5L2YH 4ABGA 1T8OA 2ZU5A 5ABWA 3SU6A 1O3KA 2ZFFH 4E06H 2WPLS 1ORFA 1ZR0A 3MTYA 5DO4H 2BY9X 1KXEA 7GCHF 2EI8A 2NWNA 1HJAB 3PLKA 1VZQH 4MVNA 2CMYA 3SUEA 1SVPA 1J9CH 3UR6A 1E36B 1O2SA 1S84A 1KDQB 3NUMA 4FUBA 1HIAB 2J92A 2A0QB 2GGVB 1BJVA 4LXBH 2ZPRA 2ZQ1A 1C2IA 1HAHH 4R8TB 5SGAE 1XUFA 2ANYA 2FLBH 1CE5A 1UVUH 2HVXA 4BOHA 4NIXA 3ZVFA 2HNTE 3MU8A 2TPIZ 1O3MA 1LVMA 3E0NB 1UTMA 4Y71A 2FI4E 2PW8H 1N1LA 3RXVA 1P8VC 4HZHA 4FUGA 3SGBE 1GDNA 1VCPA 1G36A 3PTBA 5E0JA 2G81E 3FVFB 1XKAC 3VFEA 1AD8H 2WPHS 3BTQE 4BTIB 4NIVA 1QBVH 1KY9A 1HB0B 3I29A 1CVWH 1EX3A 2PFEA 1HGTH 1Y3XA 4Y76A 3RXCA 3LJJA 2ANKH 2PUXB 1DSTA 1FUJA 3GY3A 3TNTA 1GJBB 5H4IB 2R3UA 3PMAB 1O5AB 1F5RA 1MMJN 8KME2 1FQ3A 5E2PA 5DGJA 4CH8B 3S0NA 3P8NA 1Z8GA 1EJNA 1ZZZA 1TRMA 5FPSA 4CBNA 1SSXA 4DVAU 1BB0B 1JMOH 4I33A 5C67A 1QL8A 4JZDH 4X6NA 2VIQA 3HK6B 1YPLH 1AUJA 2IJOB 1GG6C 3ATIA 4ABBA 3ZZ4A 4MLFB 1UK3A 5FXLA 3JZ1B 1ZGIA 1ESAA 3S69A 3ZZCA 4ZKOU 2Z3DA 1RIWC 2GMTB 3ZVBA 1J14A 2ZQ2A 3VB4A 2D8WA 1QFKH 2VVCA 4K2YA 1QGFA 1INCA 4MPXA 4CRAA 2JH5D 3TPIZ 3FANA 1HDTH 1DLEA 2WYJA 1O2PA 1YGCH 1P2QA 2AGEX 1P3CA 1O0DH 1F5LA 4MTBA 3KL6A 2FPZA 1DE7H 5A8ZA 2JH0D 1Y5UT 2OUAA 4JZFH 4ABEA 3TJOA 1DXPA 4J2YB 2Z7FE 4ASHA 1GHBG 4I8HA 4MNYA 2QGRA 4K1TA 3LGWA 4Q80A 2ZC9H 4H4FA 5JBCS 1HXEH 6CHAC 2A5KA 1IQLA 3F1SB 1O2RA 1HAZB 1LPKB 1Y5AT 1ZGVA 1EAWA 3PROA 3M5MA 3VB6A 3MU4A 4YLQH 2BQ6B 2O8LA 2WV5A 3QDZB 3RC6A 1GJ4H 1TOCB 5E0HA 2VNTA 3UNQA 1O2LA 3KQCA 4BXWA 1TPAE 1YCPK 1C1WH 3UFAA 4IN2A 3KEEA 8GCHF 4AX9H 2FYRA 2WPMS 1V2UT 2ALPA 2W7UA 4ZXXH 1IQIA 1MAXA 4WF8A 3K9XB 4OS7A 2VWMA 4Q7XA 1EKBB 2H5CA 3GY7A 1O3BA 3DT0H 1ETTH 2BD4A 1LPZB 1O3PB 1GL1A 2D1JA 2TGDA 3MU1A 5EXNA 2XWBI 3T5FH 4UDWH 1UCYE 3A8DA 2BDCA 3OSYA 4TPIZ 1UVSH 3RC5A 2XRCA 1YKTA 1GMDG 4GCHF 4MPWA 1QR3E 5A09A 5DK1A 1CQQA 5HGGA 1ID5H 1AE5A 2FO9A 4Z6AH 1GI2A 4AGJA 3FAOA 1NTPA 2QV1A 1ANBA 4NWKA 1F0UA 4ZUHA 2P8OB 3E16B 1GGDB 1GCDA 1L1NA 3GCHB 1ZPBA 1O38A 2I6QA 3UUZA 7GCHG 4H42U 1W10U 5DJ7A 3UWIA 1JRSA 2FOGA 2ZEBA 3ZZ7A 1C2JA 2PSYA 2ZHQH 2Y5HA 5DG6A 1TPOA 4IC6A 1AO5A 1O2TA 1PQAA 2QY0B 2XYAA 3IG6B 5K7RA 3GYLB 1Q2WA 3UREA 1A7SA 2JH6D 1O3IA 4CRGA 3UNSA 4D76A 3KCGH 1IHTH 3TJUA 3A8BA 2ZZUH 1GBHA 2BD3A 1NRRH 1SQOA 1RTKA 1CHGA 2Z9IA 3UR9A 1ELVA 3PO1C 1YCPM 5FHTA 2ZHDA 1MTNC 2FOBA 2G5VA 1QA0A 1OWKA 1CT2E 3ZZBA 1PQ7A 5DP7A 3ATMA 2A1DB 2V35A 2FI5E 2PUQH 1AU8A 1GI8B 1T8LA 1C2KA 2ULLA 3A89A 1UTQA 4Q2KA 1Z8IB 1G3EA 3SV7A 1HLTH 1SQTA 4KTUA 1XUJA 1J15A 1O5FH 3KQEA 4ZHAA 3LJOA 1C5LH 2OP9A 1A4WH 4LZ1H 1SR5C 2ZCKP 3DA9B 2H5DA 3V13A 2QYIA 4HGCA 3GY5A 3MNXA 2FESH 2OQUA 1A0LA 2GDDA 1BDAA 1YPKH 2B5TB 3SBKA 1ANCA 1ELAA 5GDSH 1RIWB 2HRVA 3ESTA 2J4IA 1TABE 1Y3UA 4ABFA 2PKAA 2OC8A 1Y5BT 2Z9KA 1UTKA 1SGFA 1SLUB 1V2LT 1XUIA 1GDUA 1ZSJA 2ZTZA 2HNTC 1CSOE 1KXCA 2P95A 1GVKB 4GHQA 2P59A 3S9BA 4WJG2 2SFAA 3A80A 1BRCE 1SOZA 5EU8A 2W5EA 4CR5A 1P02A 3SNDA 1J17T 1DS2E 2Q6DA 2EC9H 3PMHB 1JXPA 5TCCA 1VR1H 3L3TA 4LZ4B 1YPEH 1LVOA 1P2OA 3EE0B 1UK2A 2ZDAH 2QXHA 1G37A 4B73A 4ZHMU 1BJUA 2HNTF 3VGCB 3SNEA 2FS9A 1QQUA 2A5AA 1P03A 1O2MA 6CHAB 3GCTF 2XBVA 2Y80A 1ANDA 3LH3A 1GBJA 1ACBE 1GJ6A 4WH8A 2PGQB 1AFQB 2BDAA 1QB9A 4YOGA 5DP6A 4Y10E 4M7GA 1C5MD 1O2ZA 4A7IB 2SGAA 1HXFH 1K1LA 1K1NA 1HAIH 1XXDA 3HATH 2Y5FA 2XCNA 2WV4A 3TH3H 1ELTA 1MU8B 1IQJA 3RP2A 1W3CA 1RXPA 4X2WA 1NC6A 1C1NA 1HAVA 4K1SA 2XXLA 5EODA 4DY7B 5EPNA 1TNHA 3RXTA 2O9QA 2Z9GA 1WOFA 1SL3A 1HPGA 2ZTYA 2A2QH 4MG3A 1GI4A 1CGIE 1G2MA 5HM9A 2J34A 3ATLA 1DITH 2GCHG 1C4Y2 3U8TH 1O35A 2QIQA 1UTOA 2Z3EA 4PROA 4ZKNU 3AVZA 3SU1A 5F8ZA 4DIHH 2FYQA 4X1SU 4FXGH 4LK4A 5DP9A 2TGAA 4Y8XA 3E6PH 2BM2A 2ALVA 1HJAC 3LGUA 3SUGA 5I46H 3ATKA 1TX7A 2WPIS 3RXPA 4B2BA 2HPPH 1GL0E 4AYYB 5LH8A 1G3CA 1Y8TA 1QRZA 5GJ4B 3D62A 1KLJH 3HK3B 3RXJA 4GCHG 1H9HE 1GBDA 3GY8A 1K2I1 1VITG 1C4U2 3BEUA 1EZXC 1TLDA 1P3EA 4X6OA 4TWYA 3TLOA 4JYTA 1BTWA 1SHHB 1PQ5A 3ZVDA 1GJ8B 3ZV9A 3E1XB 1V2KT 5F6MA 4ZH8A 3O8CA 1MU6B 4AG2A 5A0CA 3GCNA 3QTVH 3LGTA 4Y8ZA 3T28A 1UJ1A 1A1RA 4NIYA 2GP9B 1QBNA 3QZQA 2VGCC 3RM0H 1ZOMA 4E7RG 5C5OA 3BG4B 4AYVB 3ZZ5A 3S7KB 1PPHE 2J9NA 1FIZA 4WVPE 4ABDA 2FOAA 1MTNB 3ZVGA 3BTKE 5DP8A 1PFXC 3ODDA 4AGKA 1N8OB 4X2YA 3SV2H 3LGIA 1DT2A 2WUBA 1PQ8A 2SNVA 3GICB 1DWBH 3U1IB 3RXAA 1C5XB 4DIIH 5JBTA 1HCGA 1QB1A 4AFZA 2C93B 1T8NA 4TY6A 4Y0YE 2VH6A 3ELAH 3AW1A 5AFYH 5B6OA 1LQEA 2F3CE 1UVOA 3F9GA 4ABIA 1SGTA 4I8JA 5E0GA 3BG8A 4B75A 2GMTC 1NFYA 1HBTH 2AMDA 1NZQH 2GD4B 2XCFA 4CHAB 3F6UH 4NIWA 1EASA 1PPBH 1H9LB 1IQKA 2FOHA 1CO7E 2UUFB 1DXWA 1H8IH 3PMBB 2V6NA 3RXEA 4ISNA 5FCRA 1EXFA 1QURH 3DD2H 3OU0A 3SUFA 1FAXA 1DWCH 1GHBF 1MD8A 3UNRA 3RXBA 4O03A 3RDZA 1C1MA 2FOCA 3BTDE 2O8WA 1O5CB 3HPTB 2DUCA 1BA8B 1O2NA 1PPCE 2F9VA 2VVVA 1SG8B 1O3JA 5LPEA 3N7OA 1TONA 3A84A 2F83A 4TWWA 4X8SH 1K1OA 3NK8A 4OGYA 1W7GH 4YZUA 4MQAA 4JZ1A 4O97A 4DJZB 3ZVEA 1OP8A 1O2QA 1K28D 2OCVB 1GBTA 1TALA 5J4QA 1MTVA 3DFJA 2TGTA 1ABJH 3HGPA 2UUKB 4GHTA 3S9AA 2Z9LA 2TIOA 4AG1A 2BOHB 3MHWU 5L6NH 1LDTT 2J2UA 6LPRA 1UTLM 2XC4A 1OKXA 4WXVA 3OY5U 5AHGH 1BCUH 5J4SA 1HAOH 2ZPSA 4MNVA 1GMDF 3EGKH 3RXUA 1Z6JH 3ITIA 4X1QU 1L1JA 1C1RA 1XUKA 2R0LA 3K6ZA 1E34B 4JK5A 4HTCH 1GJ5H 1TBQH 2VH0A 1ZMLA 3OX7U 1TQ0B 3SV9A 2K1QA 1A5GH 2C8XB 2GV7A 5C5NA 4WMFA 1T31A 3LPRA 2Y7ZA 2BX4A 4VGCC 1O3GA 4BTUB 1NFXA 1JRTA 3R3GB 1O37A 1NRQH 1SGPE 1SGFG 5T6FA 3URDA 1TNGA 2G00A 2G4UA 2KAIA 1LHDH 2P8OC 3D49H 1AHTH 2A2XH 3RU4T 9LPRA 1DWEH 1DM4B 4X1RU 2XC5A 4KTCA 1GGDC 3GCHC 3LOXA 4X1PU 1TGTA 3BEIB 3TGKE 1MKWH 3SN8A 1HAVB 2O8UA 2FX4A 2OINA 3AW0A 1OWEA 1WQSA 4QT8C 1PJPA 1PYTD 4XBDA 3BIUH 3PMJA 1TMBH 3QN7A 1J8AA 3K2UA 2WINI 3VB7A 1BZXE 1GJ9B 2ZDLA 1A2CH 3ATWA 1ZJDA 4Q7YA 4UFFH 2Y6TA 2ZGXH 2OC0A 2UWOA 3BTTE 2A5IA 2VGCB 4GAWA 1O3OA 2C90B 3EYDA 3CP7A 2ZFRH 2GZ9A 2ZU3A 3SJOA 1O31A 3G01A 3PTNA 4F49A 5EOKA 4OS5A 2H9HA 3KHVA 4XSKU 4INKA 4U01A 4GUXA 1DWDH 2XBXA 1SGEE 2OBQA 1FY4A 2UUYA 3LC5A 1NM6A 3TIUA 1DICA 1XKBC 3KIDU 4WMEA 1TGNA 3TGJE 2D26C 3GDVA 1DUAA 2RG3A 1O34A 1S83A 3SJ8A 1GI3A 1HJ8A 3TU7H 4ISIH 3IWMA 4MNWA 1V2NT 3RC4A 1BMLA 1FDPA 1XVMA 2VB0A 1C2GA 1BBRH 3EA9A 3S7HB 1G3DA 2F9OA 3PLPA 2BZAA 1DLKB 1Z7KA 1C5SA 1SBWA 4FU9A 4HFPB 2F9PA 4IW4E 2AGIX 1D9IA 3GY4A 3TK9A 1NU7B 1Y3WA 1O39A 4GLYA 4RKJB 5FBIA 2FXRA 4FVBA 2ZFPH 1DY8A 4Y7AA 2BVXH 1B7XB 4Y0ZE 4Y8YA 1NU9A 1EB1H 3A87A 4GVUA 1ZMNA 1PYTC 1FI8A 1JOUB 1FY1A 3SJKA 3VB5A 3STJA 4YLUA 1OSSA 3RMOH 1GVLA 2CF9H 3VGCC 2PSXA 1SFQB 4TPYA 5T3HA 4KGAA 3MWIU 1MD7A 5FX5A 1GBBA 4B71A 1D3QB 2YOLA 4A5TS 4A1TA 1KXAA 2A7JA 5TCAA 1W8BH 3MO6A 1AFQC 3P70B 3DHKH 4D9RA 1L0ZA 1NO9H 4XBBA 4NG9H 3P8GA 1K22H 1GHAG 1HAYB 2A31A 2ZCLP 3A7ZA 1OXGA 1GI0A 2RA0A 1QY6A 1HAGE 3RLWH 1Y3YA 1QJ6B 3LGVA 3BTHE 1H9IE 2ZHFH 2GCHF 3ZYDA 2A4RA 1JIMA 4Z0KA 3RM2H 1CHOG 2BXTH 3TITA 1YPGH 1H1BA 2QXJA 1SPJA 2XBYA 1V3XA 2HALA 4I8GA 1V2QT 4RN6A 1DPOA 2QN5T 1XUGA 3BTGE 3VXEH 3UY9A 1S0RA 3SNBA 1K1MA 5ESBA 3F9EA 4NA7A 1YC0A 2IOTA 3U8OH 2BQ7B 3S9CA 2FWWA 3ENSB 3EAJA 1MBQA 3D23A 3VPKA 2XNIA 4A1VA 2M5TA 2QCYA 4K1EA 4VGCB 1AUTC 1VITF 2FS8A 2GV6A 4O3UA 4WY3A 2NU0E 1BMAA 3RUOA 2ZG0H 3KGPA 1AQ7A 1G2LA 2QXGA 2FX6A 4ZXYH 2FTLE 1C5QA 1C2EA 1FY3A 1G30B 1P2MA 2C8YB 3A8AA 1W0ZU 4XBCA 2QC2A 4UEHH 1OX1A 1LKBA 1P06A 2AFQB 3GDSA 5K0HA 1C1QA 1HNEE 1GBKA 3BTWE 1DSUA 1OYQA 3T2NA 3SV8A 1GJDB 1TPSA 1A61H 2BLOA 3TH4H 1GBCA 2ZHEH 5GIBA 4LOYH 1SMFE 3QTOH 1A3BH 3KN2A 1D3PB 1P9SA
chains in the Genus database with same CATH superfamily
5C0TA 3SJ9A 2BY7X 1FJSA 2NU4E 1C2FA 1BHXF 1K21H 5IYTA 2Z9JA 3BG4C 2O8TA 4X6PA 4AFSA 2XWAA 1O30A 5JBAS 1AVXA 3MFJA 1TGSZ 2VVUA 2OC1A 1C1PA 1FPHH 2P3UB 1BITA 1OPHB 2KAIB 4B2CA 5HYOA 4CH2B 2BOKA 3PWBA 2P3TB 1ZTJA 1N8OC 4ACBA 2NU1E 3T27A 4KTSA 8ESTE 1DANH 5LGOA 3B23B 2BY5X 1ESTA 4DOQA 1QJ7B 4ZMAH 2IPQX 2PHBA 3VXFH 2BB4A 1O5DH 2BXUH 1P2IA 5ETXA 5A0BA 1V2OT 2ZWLH 3UOUA 3AAVA 1EP5A 3TJVA 2AHME 1ZRKA 4WWYA 1S85A 3T62A 2G55A 4HI3A 4FUJA 2ZGBH 1EAIA 1ETSH 3FP8E 1FV9A 1TFXA 2A4QA 1GJ7B 5DPAA 2FMJA 4CHAC 5PTPA 2FOEA 3FP6E 1UVPA 3QUMP 3MH4A 1LO6A 1ZJKA 2PKSC 2CHAC 3BIVH 4I32A 2FI3E 1WUNH 1PPEE 3M3SA 2A7HA 1AMHA 1K1PA 4ABAA 2HVYB 3LONA 3UPEA 3A7XA 1O2YA 2FP7B 3K6YA 1S82A 2A4OA 1C4V2 2BY8X 1GVZA 3QLPH 3TK5A 3F0PA 5FPTA 2JETC 3GCOA 3E0PB 1UHBA 4YT7H 5EXMA 1AB9B 4NA9H 1QA7A 1Y59T 4MDSA 1ARBA 3LC3A 2SGFE 1C5RA 1KXDA 3OYPA 2Z6BD 2F91A 2A32A 1IQFA 2BY6X 1QBOA 1QB6A 2GT8A 3DCLA 3A8CA 1BTZA 3OTJE 3L33A 5F53A 3RXRA 3GDUA 2OD3B 3CENA 1C1VH 1GI9B 3BV9B 1V2WT 2HWLB 4ZROA 1TRNA 1WBGB 1V2PT 3GYMA 3M3TA 1O2OA 5DP3A 4FUDA 2P93A 2LNCA 3FP7E 4YT6H 1GMCG 1L4DA 1O32A 2FM2A 4ESTE 2DE8A 4X8TH 1W14U 2OXSA 3PB1E 4OS6A 7ESTE 1YWUA 1WDIA 1TOMH 1C2LA 1TAWA 5GXPA 1KTTB 2JDID 4CRDA 4KP0A 3CNRA 1UW7A 5JB9S 1TX6A 2BMGB 1ZHPA 3B9FH 3F68H 5GCHF 2B8OH 2J94A 1GBMA 1C5ZB 1C9PA 1JIRA 1HIAA 3HKIB 5T1VA 3E8LA 1QIXB 4FETA 3QGNB 4Z1MD 3HKJB 2W26A 2Z94A 1O3FA 2BDIA 4IC5A 3BSQA 3WWFA 1M9UA 1NPMA 2OQ5A 2OBOA 2BDHA 1UTJA 1KYNA 2BZ6H 1FONA 3U8RH 1EAUA 1JWTA 2ODPA 3VEQB 3RXSA 1T8MA 1TNIA 3QK1A 2G4TA 1G9IE 3A83A 4SGBE 4NGAH 1C5WB 3EA7A 1AE8H 3SV6A 2H6MA 1GHXH 1GI5A 1W2KH 1BHXB 1V2ST 3NCLA 2ZU4A 1O2GH 1RTFB 3C27B 1LQDB 3EQ0H 1CT0E 3KQBA 1IQNA 1FY5A 4OS1A 4NWLA 3SU2A 4ZCNA 1C1SA 5EPYA 1BMMH 1ZSLA 3A7WA 5JPMH 2ZGHA 2HGTH 1GCTB 1AWHB 4BAOB 1NRSH 4X6MA 1TBZH 3F9HA 1MTUA 2G52A 2SGDE 1ZMJA 1ARCA 1TGBA 1O2WA 1GJAB 1D6RA 2GKVE 2ZU2A 3RMMH 4BANB 3SU4A 5C1XA 3T26A 1GBFA 2A45B 4FOUC 1MH0A 1V2MT 5LPRA 2IPHA 1MCVA 1MKWK 1DX5M 2EA3A 1FIWA 1TQ7B 1IQGA 4AOQA 1EPTA 1EOLA 1G32B 5AVDA 3EDXB 1F7ZA 3VB3A 3AK5A 1ABIH 2ZU1A 4AFQA 3M35A 1QJ1B 2BD5A 2BLVA 2D2DA 4WMDA 2H2ZA 1C5OH 1T7CA 3MI4A 3OY6U 3MO9A 1DDJA 1A5HA 1SGIB 4I31A 1TA2A 3SZEA 5EW2H 3ODFA 2PKSB 2CHAB 2VU8E 1E38B 1BRUP 1FNIA 2ASUB 1W0YH 1C9TA 1A3EH 3M61U 4XE4A 2WPKS 1RD3B 2WHXA 1KLTA 1CU1A 3V12A 1BIOA 5GPIB 3CS0A 5E2OA 1C5VA 3SQHE 1EOJA 1DOJA 1TB6H 4XFQA 2XTTB 1F0SA 2JETB 3TGIE 3DUXH 3SU5A 3H5CB 3NXPA 1TWXB 1TE0A 2ZCHP 3GY2A 4ABJA 2ZGJA 4FUIA 1THPB 2J38A 1AZ8A 2GDEH 3PM3A 2A7CA 5GWZA 1GHAF 1O2IA 4FUEA 3NPSA 1C1TA 1V2TT 4Q63A 3RXFA 4WXIA 1ZPCA 1DUEA 1WXRA 1SLVB 5C0UA 3PRDA 1GWAA 1V2JT 3QWCH 2QA9E 1EJMA 1GBAA 2R0KA 1CHOF 3V0XA 2H9EH 4DURA 1LHGH 2YMSD 2VIPA 1MQ5A 3RXMA 2PKAB 1P11E 1B0FA 2DE9A 1P12E 1F0TA 1P57B 2PP6A 1SGRE 3SI4H 3PV5A 3DSGA 5DP4A 1BBRK 2BVRH 3WWBA 1TNLA 4X2VA 3ZZAA 4D7FA 6GCHG 2CJIA 4YTAA 1P05A 4X8VH 1T32A 5TJXA 1E0FD 3SHAH 2ZI2H 3SGQE 1K1IA 1W13U 5FBEA 2FIRH 1A0HB 4IMQA 3F9FA 1V2RT 1D4PB 1NFWA 2TBSA 4CRBA 3STIA 2ANWA 1Z1IA 1WSSH 3RXHA 1B5GH 2GVFA 1BTPA 1AVWA 1P9UA 1C5PA 3SI3H 2OC7A 1ELCA 2R2MB 3QGJA 1GBLA 4CR9A 4XRNA 3M7TA 1VGCC 5JDUB 3SU3A 3ZVCA 5CE1A 1ZYOA 1U6QA 2VWNA 5GCHG 1CA0B 1YF4A 4DT4A 4ZHLU 2STAE 1QHRB 2HLCA 1BQYA 2FEQH 1AI8H 1LHFH 1N6YA 1BRBE 1QRXA 3FZDA 5FPYA 5I25A 4OS4A 3W95A 3M36A 3QX5H 1FMGA 3E90B 1PPZA 1XUHA 1SHYA 3E91A 4NCYA 1LVBA 2PTNA 1BTXA 1GHWH 1HRTH 1SLWB 3U98H 2NU2E 4YOJA 1C2MA 2QF3A 2I6SA 4JZEH 2FODA 2LPRA 2IN2A 1AIXH 1MZAA 3BTME 4AB8A 1QTFA 1S6HA 1T4VH 1HAXB 4MPUA 3BEFB 1XM1A 2ANMH 3MOCA 2WSSD 4ZAEA 1ELGA 3F2HA 3A82A 2UWPA 1UK4A 1MAYA 1XMNB 2NU3E 4FU7A 5G4BA 2C8ZB 2STBE 3RU4E 2BDYA 4JMYA 1LKAA 5CHAB 2Z3CA 2YMSC 4K8BA 1H4WA 1ZRBA 2C3SA 3LIWA 4INHA 1SQAA 1X7AC 1RGQA 5HMAA 1ELBA 3MU5A 2FOFA 2KCOA 4FVDA 1WAYB 4X1NU 5EQSA 1TNKA 5LPFA 1Z71A 1O36A 2ZNKH 3QZRA 2TGPZ 1TPPA 4M9FA 1GHVH 1AWFH 1SC8U 2ZDKA 3ZVAA 1F5KU 3UB0A 3WY8A 3T29A 2RCEA 2AH4X 2F9UA 1O2VA 1YPHE 1GMHG 2J95A 2GCTC 4I8LA 3M7QA 3MU0A 5CMXH 6ESTA 1O2JA 3A81A 1MZDA 2ZGCA 3I77A 2HOBA 2OLGA 2RDLA 4SGAE 2BD7A 4A6LA 2V3HH 1VJ9U 1TIOA 4B1TA 7LPRA 4BAQB 4Y7BA 3A7YA 1OP2A 1LCYA 1QCPA 1LTOA 2BVSH 1IQMA 1V6DA 2TRMA 1TBRH 3SU0A 4UFGH 1SQRA 2SGQE 2BD9A 1YBWA 2OK5A 2FDAA 3AAUA 2PLXA 4INLA 3SGAE 1EQ9A 1AB9C 5A8XA 2AYWA 2BHGA 3ZZ8A 3A88A 2P3FH 2G51A 1L4ZA 2XC0A 1TMUH 1O3LA 3P92A 3RXQA 4AZ2B 3GS9A 2VIVA 3URCA 5L2ZH 1EPTB 3WW7A 3BTFE 1N6XA 1UCYH 3T25A 3LT3A 1XX9A 2V3OH 2K0QA 2SNWA 3RXLA 4JYUH 1W11U 2C4FH 3KQDA 1BRAA 1GMCF 1QQ4A 2Q1JA 1BTHH 5F03A 1NN6A 1D3DB 3TJNA 1UO6A 1Z1JA 2ODQA 1EP6A 4RT1A 1QNJA 4UFEH 1SGQE 2AERH 1BUIA 1FPCH 1ZTLA 2ESTE 1C5UA 3SO3A 3SORA 3TK6A 1YY3A 1ZTKA 2KX4A 3TNSA 1Y3VA 4FUFA 1G3BA 4B6EA 3NZIA 5EQQA 1MKXK 1DY9A 4YM9A 1B0EA 1ZLRA 2UUJB 1GI1A 5FX6A 1OWIA 5E8EH 2WZQA 2ODYB 4H6TA 2UWLA 1LVYA 2FLRH 1EZSC 3P95A 1KXFA 3UOPA 5JBBS 3M5LA 1BBRE 1FLEE 1W7XH 2BLWA 2YNBA 4TYDA 5F8XA 5JB8S 1O5GH 2V0BA 2WUCA 2ZECA 2PTCE 4UONA 2J97A 1MUEB 1P2JA 3LKWA 3BTEE 2BD2A 2WPJS 3FN8A 1NROH 5C3NA 1FY8E 1UTNA 4ZKSU 4XDEA 3ZV8A 1VGCB 4H6SB 1E35B 1L2EA 3R0FA 3W94A 3F3BA 2KCPA 3MYWA 3MH5A 4AFUA 5JYIA 4I8KA 1THRH 3SW2B 1VCQA 4D7GA 1GHYH 2ZP0H 1TX8A 1K9OE 1OS8A 2Y7XA 3RXKA 1T4UH 1RRKA 4U30A 5DP5A 2P16A 1GBEA 1O2KA 1THSH 3A7VA 2H9TH 3RLYH 2EI7A 1L1GA 2AS9A 5C2ZA 5EJZA 3RU4D 3PV4A 2VIDA 2ZFSA 4B2AA 1C2HA 5DN6D 3HGNA 1MBMA 4CBOA 2CGAA 4NSYA 1UMAH 4RI0A 1HYLA 1P10A 3ZZ9A 1S6LA 1GCTC 3O8BA 4BXSA 1C1OA 3RXOA 1SB1H 1Z8JB 4K8YA 4YESB 5HIZA 1GDQA 4RKOB 2KFWA 4RT0A 1KXBA 1CBWC 2YMSB 5L30H 1KLIH 5C1UA 4J1YA 3V3MA 1OWHA 4IGDA 3O8DA 1UVTH 1Z8RA 5B6LA 3C1KA 3BF6H 8LPRA 2F9BH 1AKSA 4MNXA 1H8ED 1SLXB 1A0JA 4X0WU 2A4GA 2GX4A 1HV7A 1DVAH 1BTYA 2JKHA 1F2SE 1NY22 1VJAU 2FZZA 2F43B 2PV9B 3A7TA 3Q3KA 1EATA 1MCTA 3CS7A 2AMQA 2GCTB 4B74A 5F8TA 5FAHA 1GJCB 3P17H 4E05H 2R3YA 4A1XA 1SGNE 3MNSA 2Q6FA 3MH7A 4NFFA 2O8MA 2AIPA 1LMWB 4JCNA 4FUCA 3A86A 1HFDA 1S5SA 4UD9H 2GTBA 1GI6A 1NRNH 4DW2U 3U1JB 3GOVB 3MH6A 1FXYA 4BAMB 4UFDH 2BDGA 1MKXH 4ACAA 4ZKRU 4K60A 2ZHWH 3H09A 4CREA 1F92A 1GG6B 2ZF0H 1NS3A 3MNCA 1EB2A 1WYKA 4U2WA 2VJ1A 5DKMA 3M3VA 1AN1E 1K1JA 1KMHB 4D9QA 1YCPH 1SGCA 3SHCH 5A2MH 2AEIH 3NWUA 1UTPA 1DFPA 4TY7A 5FCKA 3MMGA 2ZTXA 1OOKB 2W3KA 1OYTH 4XOJA 1H8DH 3UIRA 1SGYE 4FU8A 1GI7B 2HLDD 4NZQA 1KTSB 2W3IA 2PGBB 2XW9A 1Q31A 4ISLA 2GJGA 1YYY1 1E37B 3UTUH 2W7SA 5IK2D 1D3TB 2JJ1D 3FZZA 4NFEA 6GCHF 1NESE 2GT7A 1C1UH 4IN1A 3P6ZB 1O3DA 2B9LA 2FOMB 1OP0A 1QL9A 1F0RA 5T6DA 2LELA 4DT7B 4X2XA 5EG4A 2ZIQH 1IHSH 1VCWA 3FFGA 4FUHA 1WU1A 1IAUA 4KKDA 4B76A 1P04A 1YPHC 1YPJH 4AN7A 5IDKA 1A46H 3K65B 2P94A 1FN6A 2YNAA 1YPMH 1O5EH 1FAKH 3U69H 5T6GA 1VKYA 1ESBA 3OE7D 3PWCA 3ZZDA 1C2DA 3JZ2B 1KDQA 4BAKB 1D6WA 1CT4E 1ZHMA 3RMLH 4K69A 1CGJE 1P09A 3RXGA 1CGHA 4X8UH 1AY6H 4IBLH 3SNCA 5HKKD 3D65E 1W12U 3FKSD 3M37A 4Q7ZA 2J5UA 1QRWA 2Q6GA 5EQRA 1CA0C 1C5TA 1MTSA 4GPGA 4BNRA 3KYGA 1O3NA 4O3TA 3UWJH 4THNH 2PWXA 2L74A 2BYAX 2BQWB 3MO3A 1TNJA 2ZDVH 2QAAA 3UQOA 4Y79A 8GCHG 2B0FA 4NA8A 1P01A 1XVOA 1JBUH 3DFLA 3NRLA 2J98A 1EZUC 3Q77A 4JZIA 3V7TA 1XXFA 3AASA 2VWLA 3RXIA 4U32A 1P2NA 4D8NA 1ANEA 1CA8B 1BOQA 2Y82A 5HM2A 1E1RD 1RFNA 3PYHA 2CF8H 1EAXA 1TA6A 3Q00A 5AF9H 1YLNA 3F0OA 2EI6A 2VIOA 5A0AE 1AGJA 3NKKA 1VITH 1LPGB 2WYGA 1O3EA 4I86A 3SOSA 4NZLA 4P02A 5C1YA 4ISHH 3O8RA 5CHAC 1TMTH 1EJAA 2ZFQH 4E7NA 4WH6A 5EW1H 3GY6A 3MNBA 3IITA 5C20A 1HJ9A 2QXIA 1WTHD 4NSVA 5FL7D 2Y81A 2R9PA 1NT1A 1KIGH 3KNXA 1MQ6A 1CBWB 1MTWA 1KSNA 2ILNA 2R2WU 9ESTA 1O5BB 2ZPQA 1GMHF 2BDBA 1ZHRA 1RS0A 4DGJA 2THFB 4OGXA 3U9AH 3SQEE 1AFEH 2B7DH 1ELEE 4JK6A 1SGDE 4DCDA 4ISOA 1FZZA 2C8WB 2QF0A 1PPGE 3E3TA 2BTCE 1O3CA 3P8OA 3PO1B 1WV7H 1IOEA 4OS2A 3B8JA 4R0IA 4CRCA 5A8YA 5EXLA 1O3HA 5HXFA 2VINA 1LHEH 3H7OA 4F4OC 1SFIA 3L6PA 2ZKSA 1O2XA 2BX3A 1BTUA 1GHZA 1BT7A 2ZA5A 1PPFE 2EEKA 1ETRH 1NRPH 3I78A 3TH2H 2ZDMA 2ZFTA 1IQHA 1P2KA 1TRYA 2GZ7A 1HAPH 1AKSB 2FTMA 5AFZH 3ZYEA 1EUFA 2G5NA 4TSFD 1O2HA 1FX0B 3RMNH 4Q4LA 1S0QA 1BMNH 1O2UA 1EPTC 4I7YH 4K3JA 3SUDA 3ZZ3A 1P0SH 1WQVH 2BLQA 4MPVA 1SOTA 2VIWA 2VWOA 2ZO3H 3TVJB 2Y5GA 1AZZA 3EA8A 4YO9A 1HUTH 4RSPA 1QL7A 2KZ4A 4Y6DA 3A85A 3LGYA 3KF2A 4IS5A 3QO6A 4F48B 4YOIA 7KMEH 3PLBA 3RXDA 3SZNA 2RA3A 5BPEA 3P8FA 3EE7A 1V2VT 3LU9B 4IMZA 5ESTE 2SGEE 2AMPA 1Q3XA 1GPZA 1NFUA 2AIQA 4GSOA 1LHCH 1S81A 3Q3YA 4UE7H 2BD8A 2ZDNA 3ZZ6A 1RJXB 5BRRE 3H7TA 4YXWD 3LDXH 2HPQH 4K5ZA 4XD7D 4BTTB 1UHBB 3Q76A 1YM0A 4Y11E 1ELDE 1ELFA 1OWJA 2KCAA 2F9NA 4CRFA 3UQVA 4JYVH 4ABHA 1C5YB 1YLDA 1YP9A 2XBWA 3M7UA 4AB9A 1OWDA 3BN9A 1C5NH 1GBIA 1FN8A 3M5NA 2SGPE 3GCTG 3SJIA 1SI5H 1WCZA 2OTVA 1UCYK 1WTGH 3Q3XA 2CN0H 1RTLA 1EZQA 1S6FA 1A5IA 1YLCA 3LH1A 4AORA 2AGGX 1O33A 1J16A 1ZPZA 5EGMA 1TGCA 1AVGH 1TYNA 2PR3A 1Z6EA 1ZSKA 4BAHB 4A92A 4DG4A 3GISB 2G8TA 1O3AA 1IQEA 2CXVA 2CV3A 3M5OA 4KELA 3KYFA 2H1UA 4O9VA 3SNAA 3W1EA 2GZ8A 5L2YH 4ABGA 5CHBA 1T8OA 2ZU5A 5ABWA 3SU6A 1O3KA 2ZFFH 4E06H 2WPLS 1ORFA 1ZR0A 3MTYA 5DO4H 2BY9X 1KXEA 7GCHF 2EI8A 2IJD1 2NWNA 1HJAB 3PLKA 1VZQH 4MVNA 2CMYA 3SUEA 1SVPA 3FOAA 1J9CH 3UR6A 1E36B 1O2SA 1S84A 1KDQB 3NUMA 4FUBA 1HIAB 2J92A 1MABB 2A0QB 2GGVB 3F2GA 1BJVA 4LXBH 2ZPRA 2ZQ1A 1C2IA 1HAHH 4R8TB 5SGAE 1XUFA 2ANYA 2FLBH 1CE5A 1UVUH 2HVXA 3VG8A 4BOHA 4NIXA 3ZVFA 2HNTE 3MU8A 2TPIZ 1O3MA 1LVMA 3E0NB 3PRBA 1UTMA 4Y71A 2FI4E 2PW8H 1N1LA 3RXVA 4OM9A 1P8VC 2J98B 4HZHA 4FUGA 3SGBE 1GDNA 1VCPA 1G36A 3PTBA 2QF5A 5E0JA 2G81E 3FVFB 1XKAC 3VFEA 1AD8H 2WPHS 5KECA 3BTQE 4BTIB 5EIYA 4NIVA 1QBVH 1KY9A 1HB0B 2WV9A 3I29A 1CVWH 1EX3A 2PFEA 1HGTH 1Y3XA 4Y76A 3RXCA 3LJJA 2ANKH 5EJ1A 2PUXB 1DSTA 1FUJA 3GY3A 3TNTA 1GJBB 5H4IB 2R3UA 1W0JD 3PMAB 1O5AB 1F5RA 1MMJN 1OHHD 8KME2 1K0HA 1FQ3A 5E2PA 5DGJA 4CH8B 3S0NA 3P8NA 1Z8GA 2V3MA 1EJNA 1ZZZA 1TRMA 5FPSA 4CBNA 1SSXA 4DVAU 1BB0B 1JMOH 4I33A 5C67A 1QL8A 4JZDH 4X6NA 2VIQA 3HK6B 1YPLH 1AUJA 2IJOB 1GG6C 3ATIA 4ABBA 3ZZ4A 4MLFB 1UK3A 5FXLA 3JZ1B 1ZGIA 1ESAA 3S69A 3ZZCA 4ZKOU 2Z3DA 1RIWC 2GMTB 3ZVBA 1J14A 2ZQ2A 3VB4A 2D8WA 1QFKH 2VVCA 4K2YA 1QGFA 4B6FA 1INCA 4MPXA 4CRAA 2JH5D 3TPIZ 3FANA 1BMFD 1HDTH 1DLEA 2WYJA 1O2PA 1YGCH 1P2QA 2AGEX 1P3CA 2LP6A 1O0DH 1F5LA 4MTBA 3KL6A 2FPZA 1DE7H 5A8ZA 2JH0D 4ASUD 1Y5UT 2OUAA 4JZFH 4ABEA 3TJOA 1DXPA 4J2YB 2Z7FE 4ASHA 1GHBG 4I8HA 4MNYA 2QGRA 4K1TA 3LGWA 4Q80A 2ZC9H 4H4FA 5JBCS 1HXEH 6CHAC 2A5KA 1IQLA 3F1SB 2CK3D 1O2RA 1HAZB 1LPKB 1Y5AT 1ZGVA 1EAWA 3PROA 3M5MA 3VB6A 3MU4A 4YLQH 2BQ6B 2O8LA 2WV5A 3QDZB 3RC6A 1GJ4H 2K8IA 1TOCB 5E0HA 2VNTA 3UNQA 1O2LA 3KQCA 4BXWA 1TPAE 1YCPK 1C1WH 3UFAA 4IN2A 5GNDA 3KEEA 8GCHF 4AX9H 2FYRA 2WPMS 1V2UT 2ALPA 2W7UA 4ZXXH 1IQIA 1MAXA 4WF8A 3K9XB 4OS7A 2VWMA 4Q7XA 2JJ2D 1EKBB 2H5CA 3GY7A 1O3BA 3DT0H 1ETTH 2BD4A 1LPZB 1O3PB 1GL1A 2D1JA 2TGDA 3MU1A 5EXNA 2XWBI 3T5FH 4UDWH 1UCYE 3A8DA 2BDCA 3OSYA 4TPIZ 1UVSH 3RC5A 3DSPA 2XRCA 1YKTA 1GMDG 4GCHF 4MPWA 1QR3E 5A09A 5DK1A 1CQQA 5HGGA 1ID5H 1AE5A 2FO9A 4Z6AH 1GI2A 4AGJA 3FAOA 1NTPA 2QV1A 1ANBA 4NWKA 1F0UA 4ZUHA 2P8OB 3E16B 1GGDB 1GCDA 1L1NA 3GCHB 1ZPBA 1O38A 2I6QA 3UUZA 7GCHG 4H42U 1W10U 5DJ7A 3UWIA 1JRSA 2L6OA 2FOGA 2ZEBA 3ZZ7A 1C2JA 2PSYA 2ZHQH 2Y5HA 5DG6A 1TPOA 4IC6A 1AO5A 1O2TA 1PQAA 2QY0B 2XYAA 3IG6B 5K7RA 3GYLB 1Q2WA 3UREA 1A7SA 2JH6D 1O3IA 4CRGA 3UNSA 4D76A 3KCGH 1IHTH 3TJUA 3A8BA 2ZZUH 1GBHA 1SKYE 2BD3A 1NRRH 1SQOA 1RTKA 1CHGA 2W6ID 2Z9IA 3UR9A 1ELVA 3PO1C 1YCPM 5FHTA 2ZHDA 1MTNC 2FOBA 2G5VA 1QA0A 1OWKA 1CT2E 3ZZBA 1PQ7A 5DP7A 2XNDD 3ATMA 2A1DB 2V35A 2FI5E 2PUQH 1AU8A 1GI8B 1T8LA 1C2KA 2ULLA 3A89A 1UTQA 4Q2KA 1Z8IB 1G3EA 3SV7A 1HLTH 1SQTA 4KTUA 4F55A 1XUJA 1J15A 1O5FH 3KQEA 4ZHAA 3LJOA 1C5LH 2OP9A 1A4WH 4LZ1H 1SR5C 2ZCKP 3DA9B 2H5DA 3V13A 2QYIA 4HGCA 3GY5A 3MNXA 2FESH 2OQUA 1A0LA 2GDDA 1BDAA 1YPKH 2B5TB 3SBKA 1ANCA 1ELAA 5GDSH 1RIWB 2HRVA 3ESTA 2J4IA 1TABE 1Y3UA 4ABFA 2PKAA 2OC8A 1Y5BT 2Z9KA 1UTKA 1SGFA 1SLUB 5CDFE 1V2LT 5C94A 1XUIA 1GDUA 1ZSJA 2ZTZA 2HNTC 1CSOE 1KXCA 2P95A 1GVKB 1QZ8A 2P59A 4GHQA 3S9BA 4WJG2 2SFAA 3A80A 1BRCE 3U28C 1SOZA 5EU8A 2W5EA 4CR5A 1P02A 3SNDA 1J17T 1DS2E 2Q6DA 2EC9H 3PMHB 1JXPA 5TCCA 1VR1H 3L3TA 2RFKC 4LZ4B 1YPEH 1LVOA 5C17A 1P2OA 2WPDD 1UK2A 2ZDAH 3EE0B 2QXHA 1G37A 2JIZD 4B73A 4ZHMU 1BJUA 2HNTF 3VGCB 3SNEA 2FS9A 1QQUA 2A5AA 1P03A 1O2MA 6CHAB 3GCTF 2XBVA 2Y80A 1ANDA 3LH3A 1GBJA 1ACBE 1GJ6A 4WH8A 2PGQB 1AFQB 2BDAA 1QB9A 4YOGA 5DP6A 4Y10E 4M7GA 1C5MD 1O2ZA 4A7IB 2SGAA 1HXFH 1K1LA 1K1NA 1HAIH 1XXDA 3HATH 2Y5FA 2XCNA 2WV4A 3TH3H 1ELTA 1MU8B 1IQJA 3RP2A 1W3CA 1RXPA 4X2WA 1NC6A 1C1NA 1HAVA 2EQNA 2XXLA 4K1SA 5EODA 4DY7B 3MQKC 5EPNA 1TNHA 3RXTA 2O9QA 2Z9GA 1WOFA 1SL3A 1HPGA 2ZTYA 2A2QH 4MG3A 1GI4A 1CGIE 1G2MA 5HM9A 2J34A 3ATLA 1DITH 2GCHG 1C4Y2 3U8TH 1O35A 2QIQA 1UTOA 2Z3EA 4PROA 4ZKNU 3AVZA 2W6JD 5F8ZA 3SU1A 4DIHH 2FYQA 4X1SU 4FXGH 4LK4A 5HIYA 4AC9A 5DP9A 2TGAA 4Y8XA 3E6PH 2BM2A 2ALVA 1HJAC 3LGUA 3SUGA 5I46H 5DSFA 1NBME 3ATKA 1TX7A 2WPIS 3RXPA 4B2BA 2HPPH 1GL0E 4AYYB 5LH8A 1G3CA 1Y8TA 1QRZA 5GJ4B 3D62A 1KLJH 3HK3B 3RXJA 4GCHG 1H9HE 1GBDA 3GY8A 1K2I1 1VITG 1C4U2 3BEUA 1EZXC 1TLDA 1P3EA 3N99A 4TWYA 4X6OA 3TLOA 4JYTA 1BTWA 1SHHB 1PQ5A 3ZVDA 1GJ8B 3ZV9A 3E1XB 1V2KT 5F6MA 4ZH8A 3O8CA 1MU6B 4AG2A 5A0CA 3GCNA 3QTVH 3LGTA 4Y8ZA 3T28A 1UJ1A 1A1RA 4NIYA 2GP9B 1QBNA 3QZQA 2VGCC 3RM0H 1ZOMA 4E7RG 5C5OA 3BG4B 4AYVB 3ZZ5A 3DSOA 3S7KB 1PPHE 2J9NA 1FIZA 4WVPE 4ABDA 2FOAA 1MTNB 3ZVGA 3BTKE 5DP8A 1PFXC 3ODDA 4AGKA 1N8OB 4X2YA 3SV2H 2F4LA 3LGIA 1DT2A 2WUBA 1PQ8A 2SNVA 3GICB 1DWBH 3U1IB 3RXAA 1C5XB 4DIIH 5JBTA 1HCGA 3FO8D 2KM0A 1QB1A 4AFZA 2C93B 1T8NA 4TY6A 4Y0YE 2VH6A 3ELAH 3AW1A 5AFYH 5B6OA 1LQEA 2F3CE 2KR7A 1UVOA 3F9GA 3SYJA 4ABIA 1SGTA 4I8JA 5E0GA 3KQ5A 3BG8A 4B75A 2GMTC 1NFYA 1HBTH 2AMDA 1NZQH 2GD4B 2XCFA 4CHAB 3F6UH 4NIWA 1EASA 1PPBH 1H9LB 1IQKA 2FOHA 1CO7E 2V7QD 2UUFB 1DXWA 1H8IH 3PMBB 2V6NA 3RXEA 4ISNA 5FCRA 1EXFA 1QURH 3DD2H 3OU0A 3SUFA 1FAXA 1DWCH 1GHBF 1MD8A 3UNRA 3RXBA 4O03A 3RDZA 2RDEA 1C1MA 2FOCA 3BTDE 2O8WA 1O5CB 3HPTB 2DUCA 1BA8B 1O2NA 1PPCE 2F9VA 2VVVA 1SG8B 1O3JA 5LPEA 3N7OA 1TONA 3A84A 2F83A 4TWWA 4X8SH 1K1OA 3NK8A 4OGYA 1W7GH 4YZUA 4MQAA 4JZ1A 4O97A 4DJZB 3ZVEA 1OP8A 2M2AA 1O2QA 1K28D 2OCVB 1GBTA 1TALA 5J4QA 1MTVA 3DFJA 2TGTA 2VBCA 1ABJH 3HGPA 2UUKB 4GHTA 3S9AA 2Z9LA 2TIOA 4TT3D 4AG1A 2BOHB 3MHWU 5L6NH 1LDTT 2J2UA 6LPRA 1UTLM 2XC4A 1OKXA 5EJLA 4WXVA 3OY5U 5AHGH 1BCUH 5J4SA 1HAOH 2ZPSA 4MNVA 1GMDF 3EGKH 3RXUA 1Z6JH 3ITIA 4X1QU 1L1JA 1C1RA 1XUKA 2R0LA 3K6ZA 1E34B 1NBMD 4HG6A 4JK5A 4HTCH 1GJ5H 1TBQH 2VH0A 1ZMLA 3OX7U 1TQ0B 3SV9A 2K1QA 1A5GH 2C8XB 2GV7A 5C5NA 4WMFA 1T31A 3LPRA 2Y7ZA 2BX4A 4VGCC 1O3GA 4BTUB 1NFXA 1JRTA 3R3GB 1O37A 1NRQH 1E79D 1SGPE 1SGFG 5T6FA 3URDA 1TNGA 2G00A 2G4UA 2KAIA 1LHDH 2P8OC 3D49H 1AHTH 2A2XH 3RU4T 9LPRA 1DWEH 1DM4B 4X1RU 2XC5A 4KTCA 1GGDC 3GCHC 3LOXA 4X1PU 1TGTA 3BEIB 3TGKE 1MKWH 3SN8A 1HAVB 2O8UA 2FX4A 2OINA 3AW0A 1OWEA 1W0KD 1WQSA 4QT8C 1PJPA 1PYTD 3UAIC 4XBDA 3BIUH 3PMJA 1TMBH 3OFND 3QN7A 1J8AA 3K2UA 2WINI 3VB7A 4P00A 1BZXE 1GJ9B 2ZDLA 1A2CH 3ATWA 1ZJDA 4Q7YA 4UFFH 5KGOA 2Y6TA 2ZGXH 2OC0A 2UWOA 3BTTE 2A5IA 2VGCB 4GAWA 1O3OA 2C90B 3EYDA 3CP7A 2ZFRH 2GZ9A 2ZU3A 3SJOA 1O31A 3G01A 3PTNA 4F49A 5EOKA 4OS5A 2H9HA 3KHVA 4XSKU 4INKA 4U01A 4GUXA 1DWDH 2XBXA 1SGEE 2OBQA 1FY4A 1E1QD 2UUYA 3LC5A 1NM6A 1H8HD 1DICA 1XKBC 3TIUA 3KIDU 3N7DA 4WMEA 1TGNA 3TGJE 2D26C 3GDVA 3OEHD 1DUAA 2RG3A 1O34A 1S83A 3SJ8A 1GI3A 1HJ8A 3TU7H 5KEDA 4ISIH 3IWMA 4MNWA 1V2NT 3RC4A 1BMLA 1FDPA 1XVMA 2VB0A 1C2GA 1BBRH 3EA9A 3S7HB 1G3DA 2F9OA 3PLPA 3PV2A 2BZAA 1DLKB 1Z7KA 1C5SA 1SBWA 4FU9A 4HFPB 2F9PA 4IW4E 2AGIX 1D9IA 3GY4A 3TK9A 1NU7B 1Y3WA 1O39A 4GLYA 4RKJB 5FBIA 2FXRA 4FVBA 2ZFPH 1DY8A 4Y7AA 2BVXH 1B7XB 4Y0ZE 4Y8YA 1NU9A 1EB1H 3A87A 4GVUA 1ZMNA 1PYTC 1FI8A 1JOUB 1FY1A 3SJKA 3VB5A 3STJA 4YLUA 1OSSA 3RMOH 1GVLA 2CF9H 3VGCC 2PSXA 1SFQB 4TPYA 5T3HA 3OAAD 4KGAA 3MWIU 1MD7A 5FX5A 1GBBA 4B71A 1D3QB 2YOLA 4A5TS 4A1TA 3OEED 1KXAA 2A7JA 5TCAA 1W8BH 3MO6A 1AFQC 3P70B 3DHKH 4D9RA 2QF4A 1L0ZA 1NO9H 4XBBA 4NG9H 3P8GA 1K22H 1GHAG 1HAYB 2A31A 2ZCLP 3A7ZA 1OXGA 1GI0A 2RA0A 1QY6A 2EY4C 1HAGE 3RLWH 1Y3YA 1QJ6B 3LGVA 3BTHE 1H9IE 2ZHFH 2GCHF 3ZYDA 2A4RA 1JIMA 4Z0KA 3RM2H 1CHOG 2BXTH 3TITA 1YPGH 1H1BA 2QXJA 2XOKD 1SPJA 2XBYA 1V3XA 2HALA 4I8GA 1V2QT 4RN6A 1DPOA 2QN5T 1XUGA 3BTGE 3VXEH 3UY9A 1S0RA 3SNBA 1K1MA 5ESBA 3F9EA 4NA7A 1YC0A 2IOTA 3U8OH 2BQ7B 3S9CA 2FWWA 3ENSB 3EAJA 1MBQA 3D23A 3VPKA 2XNIA 4A1VA 2M5TA 2QCYA 4K1EA 3ZIAD 4VGCB 1AUTC 1VITF 2FS8A 2GV6A 4O3UA 4WY3A 2QE7D 2NU0E 1BMAA 3RUOA 2ZG0H 3KGPA 1AQ7A 2KCYA 1G2LA 2QXGA 2FX6A 4ZXYH 2FTLE 1C5QA 1C2EA 3N7EA 1FY3A 1G30B 1P2MA 2C8YB 3A8AA 1W0ZU 4XBCA 2QC2A 4UEHH 1EFRD 1OX1A 1LKBA 1P06A 2AFQB 3OTPA 3GDSA 5K0HA 1C1QA 1COWD 1HNEE 1GBKA 3BTWE 1DSUA 1OYQA 3T2NA 3SV8A 1GJDB 1TPSA 1A61H 2BLOA 3TH4H 1GBCA 2ZHEH 5GIBA 4LOYH 1SMFE 3QTOH 1A3BH 3F2FA 3KN2A 1D3PB 1P9SA
chains in the Genus database with same CATH topology
3SJ9A 2BY7X 1FJSA 2NU4E 1C2FA 1BHXF 1K21H 5IYTA 2Z9JA 3BG4C 2O8TA 4X6PA 4AFSA 2XWAA 1O30A 5JBAS 1AVXA 3MFJA 1TGSZ 2VVUA 2OC1A 1C1PA 1FPHH 2P3UB 1BITA 1OPHB 2KAIB 4B2CA 5HYOA 4CH2B 2BOKA 3PWBA 2P3TB 1ZTJA 1N8OC 2NU1E 3T27A 4KTSA 8ESTE 1DANH 5LGOA 3B23B 2BY5X 1ESTA 4DOQA 1QJ7B 4ZMAH 2PHBA 3VXFH 2BB4A 1O5DH 2BXUH 1P2IA 5ETXA 5A0BA 1V2OT 2ZWLH 3UOUA 3AAVA 1EP5A 3TJVA 1ZRKA 4WWYA 1S85A 3T62A 2G55A 4HI3A 4FUJA 2ZGBH 1EAIA 1ETSH 3FP8E 1FV9A 1TFXA 2A4QA 1GJ7B 5DPAA 2FMJA 4CHAC 5PTPA 2FOEA 3FP6E 1UVPA 3QUMP 3MH4A 1LO6A 1ZJKA 2PKSC 2CHAC 3BIVH 4I32A 2FI3E 1WUNH 1PPEE 3M3SA 2A7HA 1AMHA 1K1PA 4ABAA 3LONA 3UPEA 3A7XA 1O2YA 2FP7B 3K6YA 1S82A 2A4OA 1C4V2 2BY8X 1GVZA 3QLPH 3TK5A 5FPTA 2JETC 3GCOA 3E0PB 1UHBA 4YT7H 5EXMA 1AB9B 4NA9H 1QA7A 1Y59T 4MDSA 1ARBA 3LC3A 2SGFE 1C5RA 1KXDA 3OYPA 2Z6BD 2F91A 2A32A 1IQFA 2BY6X 1QBOA 1QB6A 2GT8A 3A8CA 1BTZA 3OTJE 3L33A 3RXRA 3GDUA 2OD3B 3CENA 1C1VH 1GI9B 3BV9B 1V2WT 2HWLB 4ZROA 1TRNA 1WBGB 1V2PT 3GYMA 3M3TA 1O2OA 5DP3A 4FUDA 2P93A 2LNCA 3FP7E 4YT6H 1GMCG 1L4DA 1O32A 2FM2A 4ESTE 2DE8A 4X8TH 1W14U 2OXSA 3PB1E 4OS6A 7ESTE 1TOMH 1C2LA 1TAWA 5GXPA 1KTTB 4CRDA 4KP0A 5JB9S 1TX6A 2BMGB 1ZHPA 3B9FH 3F68H 5GCHF 2B8OH 2J94A 1GBMA 1C5ZB 1C9PA 1JIRA 1HIAA 3HKIB 3E8LA 1QIXB 3QGNB 3HKJB 2W26A 2Z94A 1O3FA 2BDIA 4IC5A 3BSQA 1M9UA 1NPMA 2OQ5A 2OBOA 2BDHA 1UTJA 1KYNA 2BZ6H 1FONA 3U8RH 1EAUA 1JWTA 2ODPA 3VEQB 3RXSA 1T8MA 1TNIA 3QK1A 2G4TA 1G9IE 3A83A 4SGBE 4NGAH 1C5WB 3EA7A 1AE8H 3SV6A 2H6MA 1GHXH 1GI5A 1W2KH 1BHXB 1V2ST 3NCLA 2ZU4A 1O2GH 1RTFB 3C27B 1LQDB 3EQ0H 1CT0E 3KQBA 1IQNA 1FY5A 4OS1A 4NWLA 3SU2A 1C1SA 5EPYA 1BMMH 1ZSLA 3A7WA 5JPMH 2ZGHA 2HGTH 1GCTB 1AWHB 4BAOB 1NRSH 4X6MA 1TBZH 3F9HA 1MTUA 2G52A 2SGDE 1ZMJA 1ARCA 1TGBA 1O2WA 1GJAB 1D6RA 2GKVE 2ZU2A 3RMMH 4BANB 3SU4A 5C1XA 3T26A 1GBFA 2A45B 1MH0A 1V2MT 5LPRA 2IPHA 1MCVA 1MKWK 1DX5M 2EA3A 1FIWA 1TQ7B 1IQGA 4AOQA 1EPTA 1EOLA 1G32B 5AVDA 3EDXB 1F7ZA 3VB3A 1ABIH 2ZU1A 4AFQA 3M35A 1QJ1B 2BD5A 2BLVA 2D2DA 4WMDA 2H2ZA 1C5OH 1T7CA 3MI4A 3OY6U 3MO9A 1DDJA 1A5HA 1SGIB 4I31A 1TA2A 5EW2H 3ODFA 2PKSB 2CHAB 2VU8E 1E38B 1BRUP 1FNIA 2ASUB 1W0YH 1C9TA 1A3EH 3M61U 4XE4A 2WPKS 1RD3B 1KLTA 1CU1A 3V12A 1BIOA 5GPIB 3CS0A 5E2OA 1C5VA 3SQHE 1EOJA 1DOJA 1TB6H 4XFQA 2XTTB 1F0SA 2JETB 3TGIE 3DUXH 3SU5A 3H5CB 3NXPA 1TWXB 1TE0A 2ZCHP 3GY2A 4ABJA 2ZGJA 4FUIA 1THPB 2J38A 1AZ8A 2GDEH 3PM3A 2A7CA 5GWZA 1GHAF 1O2IA 4FUEA 3NPSA 1C1TA 1V2TT 3RXFA 4WXIA 1ZPCA 1DUEA 1SLVB 1GWAA 1V2JT 3QWCH 2QA9E 1EJMA 1GBAA 2R0KA 1CHOF 3V0XA 2H9EH 4DURA 1LHGH 2VIPA 1MQ5A 3RXMA 2PKAB 1P11E 1B0FA 2DE9A 1P12E 1F0TA 1P57B 1SGRE 3SI4H 5DP4A 1BBRK 2BVRH 1TNLA 4X2VA 3ZZAA 4D7FA 6GCHG 2CJIA 4YTAA 1P05A 4X8VH 1T32A 5TJXA 1E0FD 3SHAH 2ZI2H 3SGQE 1K1IA 1W13U 5FBEA 2FIRH 1A0HB 4IMQA 3F9FA 1V2RT 1D4PB 1NFWA 2TBSA 4CRBA 3STIA 2ANWA 1Z1IA 1WSSH 3RXHA 1B5GH 2GVFA 1BTPA 1AVWA 1P9UA 1C5PA 3SI3H 2OC7A 1ELCA 2R2MB 3QGJA 1GBLA 4CR9A 3M7TA 1VGCC 5JDUB 3SU3A 3ZVCA 5CE1A 1ZYOA 1U6QA 2VWNA 5GCHG 1CA0B 1YF4A 4ZHLU 2STAE 1QHRB 2HLCA 1BQYA 2FEQH 1AI8H 1LHFH 1N6YA 1BRBE 1QRXA 3FZDA 5FPYA 5I25A 4OS4A 3W95A 3M36A 3QX5H 1FMGA 3E90B 1PPZA 1XUHA 1SHYA 3E91A 4NCYA 1LVBA 2PTNA 1BTXA 1GHWH 1HRTH 1SLWB 3U98H 2NU2E 4YOJA 1C2MA 2QF3A 2I6SA 4JZEH 2FODA 2LPRA 2IN2A 1AIXH 1MZAA 3BTME 4AB8A 1QTFA 1S6HA 1T4VH 1HAXB 4MPUA 3BEFB 1XM1A 2ANMH 3MOCA 4ZAEA 1ELGA 3A82A 2UWPA 1UK4A 1MAYA 1XMNB 2NU3E 4FU7A 5G4BA 2C8ZB 2STBE 3RU4E 2BDYA 4JMYA 1LKAA 5CHAB 2Z3CA 4K8BA 1H4WA 1ZRBA 2C3SA 3LIWA 4INHA 1SQAA 1X7AC 1RGQA 5HMAA 1ELBA 3MU5A 2FOFA 4FVDA 1WAYB 4X1NU 5EQSA 1TNKA 5LPFA 1Z71A 1O36A 2ZNKH 3QZRA 2TGPZ 1TPPA 1GHVH 1AWFH 1SC8U 2ZDKA 3ZVAA 1F5KU 3WY8A 3T29A 2RCEA 2AH4X 2F9UA 1O2VA 1YPHE 1GMHG 2J95A 2GCTC 4I8LA 3M7QA 3MU0A 5CMXH 6ESTA 1O2JA 3A81A 1MZDA 2ZGCA 3I77A 2HOBA 2OLGA 2RDLA 4SGAE 2BD7A 4A6LA 2V3HH 1VJ9U 1TIOA 4B1TA 7LPRA 4BAQB 4Y7BA 3A7YA 1OP2A 1LCYA 1QCPA 1LTOA 2BVSH 1IQMA 1V6DA 2TRMA 1TBRH 3SU0A 4UFGH 2SGQE 2BD9A 1YBWA 2FDAA 3AAUA 2PLXA 4INLA 3SGAE 1EQ9A 1AB9C 5A8XA 2AYWA 2BHGA 3ZZ8A 3A88A 2P3FH 2G51A 1L4ZA 2XC0A 1TMUH 1O3LA 3P92A 3RXQA 4AZ2B 2VIVA 3URCA 5L2ZH 1EPTB 3BTFE 1N6XA 1UCYH 3T25A 3LT3A 1XX9A 2V3OH 2SNWA 3RXLA 4JYUH 1W11U 2C4FH 3KQDA 1BRAA 1GMCF 1QQ4A 2Q1JA 1BTHH 5F03A 1NN6A 1D3DB 3TJNA 1UO6A 1Z1JA 2ODQA 1EP6A 1QNJA 4UFEH 1SGQE 2AERH 1BUIA 1FPCH 1ZTLA 2ESTE 1C5UA 3SO3A 3SORA 3TK6A 1ZTKA 3TNSA 1Y3VA 4FUFA 1G3BA 3NZIA 5EQQA 1MKXK 1DY9A 4YM9A 1B0EA 1ZLRA 2UUJB 1GI1A 5FX6A 1OWIA 5E8EH 2ODYB 4H6TA 2UWLA 1LVYA 2FLRH 1EZSC 3P95A 1KXFA 3UOPA 5JBBS 3M5LA 1BBRE 1FLEE 1W7XH 2BLWA 2YNBA 4TYDA 5F8XA 5JB8S 1O5GH 2V0BA 2WUCA 2ZECA 2PTCE 4UONA 1MUEB 1P2JA 3LKWA 3BTEE 2BD2A 2WPJS 5C3NA 1NROH 1FY8E 1UTNA 4ZKSU 4XDEA 3ZV8A 1VGCB 4H6SB 1E35B 1L2EA 3R0FA 3W94A 3MYWA 3MH5A 4AFUA 5JYIA 4I8KA 1THRH 3SW2B 1VCQA 4D7GA 1GHYH 2ZP0H 1TX8A 1K9OE 1OS8A 2Y7XA 3RXKA 1T4UH 1RRKA 4U30A 5DP5A 2P16A 1GBEA 1O2KA 1THSH 3A7VA 2H9TH 3RLYH 2EI7A 1L1GA 2AS9A 5C2ZA 3RU4D 3PV4A 2VIDA 2ZFSA 4B2AA 1C2HA 3HGNA 1MBMA 4CBOA 2CGAA 4NSYA 1UMAH 1HYLA 1P10A 3ZZ9A 1GCTC 3O8BA 4BXSA 1C1OA 3RXOA 1SB1H 1Z8JB 4K8YA 4YESB 1GDQA 4RKOB 1KXBA 1CBWC 5L30H 1KLIH 5C1UA 4J1YA 3V3MA 1OWHA 4IGDA 3O8DA 1UVTH 1Z8RA 3C1KA 3BF6H 8LPRA 2F9BH 1AKSA 4MNXA 1SLXB 1A0JA 4X0WU 2A4GA 2GX4A 1HV7A 1DVAH 1BTYA 2JKHA 1F2SE 1NY22 1VJAU 2FZZA 2PV9B 3A7TA 3Q3KA 1EATA 1MCTA 3CS7A 2AMQA 2GCTB 4B74A 5F8TA 5FAHA 1GJCB 3P17H 4E05H 2R3YA 4A1XA 1SGNE 3MNSA 2Q6FA 3MH7A 4NFFA 2O8MA 2AIPA 1LMWB 4JCNA 4FUCA 3A86A 1HFDA 1S5SA 4UD9H 2GTBA 1GI6A 1NRNH 4DW2U 3U1JB 3GOVB 3MH6A 1FXYA 4BAMB 4UFDH 2BDGA 1MKXH 4ZKRU 4K60A 2ZHWH 4CREA 1F92A 1GG6B 2ZF0H 1NS3A 3MNCA 1EB2A 1WYKA 4U2WA 2VJ1A 5DKMA 3M3VA 1AN1E 1K1JA 4D9QA 1YCPH 1SGCA 3SHCH 5A2MH 2AEIH 3NWUA 1UTPA 1DFPA 4TY7A 5FCKA 3MMGA 2ZTXA 1OOKB 2W3KA 1OYTH 4XOJA 1H8DH 3UIRA 1SGYE 4FU8A 1GI7B 4NZQA 1KTSB 2W3IA 2PGBB 2XW9A 1Q31A 4ISLA 1YYY1 1E37B 3UTUH 2W7SA 1D3TB 3FZZA 4NFEA 6GCHF 1NESE 2GT7A 1C1UH 4IN1A 3P6ZB 1O3DA 2B9LA 2FOMB 1OP0A 1QL9A 1F0RA 5T6DA 4DT7B 4X2XA 5EG4A 2ZIQH 1IHSH 1VCWA 3FFGA 4FUHA 1WU1A 1IAUA 4KKDA 4B76A 1P04A 1YPHC 1YPJH 4AN7A 5IDKA 1A46H 3K65B 2P94A 1FN6A 2YNAA 1YPMH 1O5EH 1FAKH 3U69H 5T6GA 1ESBA 3PWCA 3ZZDA 1C2DA 3JZ2B 1KDQA 4BAKB 1D6WA 1CT4E 1ZHMA 3RMLH 4K69A 1CGJE 1P09A 3RXGA 1CGHA 4X8UH 1AY6H 4IBLH 3SNCA 3D65E 1W12U 3M37A 4Q7ZA 1QRWA 2Q6GA 5EQRA 1CA0C 1C5TA 1MTSA 4GPGA 4BNRA 1O3NA 4O3TA 3UWJH 4THNH 2PWXA 2BYAX 2BQWB 3MO3A 1TNJA 2ZDVH 2QAAA 3UQOA 4Y79A 8GCHG 2B0FA 4NA8A 1P01A 1XVOA 1JBUH 3DFLA 1EZUC 3Q77A 4JZIA 3V7TA 1XXFA 3AASA 2VWLA 3RXIA 4U32A 1P2NA 4D8NA 1ANEA 1CA8B 1BOQA 2Y82A 5HM2A 1RFNA 3PYHA 2CF8H 1EAXA 1TA6A 3Q00A 5AF9H 2EI6A 2VIOA 5A0AE 1AGJA 3NKKA 1VITH 1LPGB 2WYGA 1O3EA 3SOSA 4NZLA 5C1YA 4ISHH 3O8RA 5CHAC 1TMTH 1EJAA 2ZFQH 4E7NA 4WH6A 5EW1H 3GY6A 3MNBA 3IITA 5C20A 1HJ9A 2QXIA 1WTHD 4NSVA 2Y81A 2R9PA 1NT1A 1KIGH 3KNXA 1MQ6A 1CBWB 1MTWA 1KSNA 2ILNA 2R2WU 9ESTA 1O5BB 2ZPQA 1GMHF 2BDBA 1ZHRA 1RS0A 4DGJA 2THFB 4OGXA 3U9AH 3SQEE 1AFEH 2B7DH 1ELEE 4JK6A 1SGDE 4DCDA 4ISOA 1FZZA 2C8WB 2QF0A 1PPGE 3E3TA 2BTCE 1O3CA 3P8OA 3PO1B 1WV7H 1IOEA 4OS2A 3B8JA 4R0IA 4CRCA 5A8YA 5EXLA 1O3HA 5HXFA 2VINA 1LHEH 3H7OA 4F4OC 1SFIA 3L6PA 2ZKSA 1O2XA 2BX3A 1BTUA 1GHZA 1BT7A 2ZA5A 1PPFE 2EEKA 1ETRH 1NRPH 3I78A 3TH2H 2ZDMA 2ZFTA 1IQHA 1P2KA 1TRYA 2GZ7A 1HAPH 1AKSB 2FTMA 5AFZH 3ZYEA 1EUFA 2G5NA 1O2HA 3RMNH 1S0QA 1BMNH 1O2UA 1EPTC 4I7YH 4K3JA 3SUDA 3ZZ3A 1P0SH 1WQVH 2BLQA 4MPVA 1SOTA 2VIWA 2VWOA 2ZO3H 3TVJB 2Y5GA 1AZZA 3EA8A 4YO9A 1HUTH 4RSPA 1QL7A 4Y6DA 3A85A 3LGYA 3KF2A 4IS5A 3QO6A 4YOIA 7KMEH 3PLBA 3RXDA 3SZNA 2RA3A 5BPEA 3P8FA 1V2VT 3LU9B 4IMZA 5ESTE 2SGEE 2AMPA 1Q3XA 1GPZA 1NFUA 2AIQA 4GSOA 1LHCH 1S81A 3Q3YA 4UE7H 2BD8A 2ZDNA 3ZZ6A 1RJXB 5BRRE 3H7TA 3LDXH 2HPQH 4K5ZA 4BTTB 1UHBB 3Q76A 1YM0A 4Y11E 1ELDE 1ELFA 1OWJA 2F9NA 4CRFA 3UQVA 4JYVH 4ABHA 1C5YB 1YLDA 1YP9A 2XBWA 3M7UA 4AB9A 1OWDA 3BN9A 1C5NH 1GBIA 1FN8A 3M5NA 2SGPE 3GCTG 3SJIA 1SI5H 1WCZA 2OTVA