1GI4A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi4A02
3F68H 3FP7E 1QB1A 5GJ4B 1XVOA 8KME2 1YCPH 3O8CA 5C5OA 1QJ6B 1TPPA 2PR3A 2ALVA 4IW4E 2HWLB 1XUIA 4YLUA 3ZV8A 4H4FA 1VCPA 3GISB 1K1LA 1A5GH 3ZVAA 1QFKH 1WU1A 2STBE 5L2ZH 4FXGH 3RXKA 2BB4A 2JKHA 4U30A 3V7TA 1O36A 1RS0A 2ANMH 1HAXB 3HPTB 4I8GA 4HGCA 4TY6A 4RSPA 5DP8A 1BUIA 1BB0B 1D3PB 3UREA 2GT7A 1OP2A 3UFAA 1EAUA 1O2VA 3E8LA 4BAMB 4DW2U 3A8BA 4DVAU 1Z1IA 4NA8A 1NS3A 1TQ0B 1O2IA 1UCYE 4BAHB 2QV1A 1YC0A 1ZPZA 1P3CA 1SPJA 1G37A 2JH0D 3SUEA 1C2HA 1GBMA 2UUJB 1FI8A 1QJ7B 2ZHEH 1ELTA 3A8DA 2PSXA 4AZ2B 2FWWA 3P8NA 2D26C 4UFFH 1H9IE 2ZF0H 1JIRA 3BSQA 1KTSB 3SQHE 3SI3H 3PLBA 1O5BB 3A8AA 2AYWA 1V3XA 2ZQ2A 2GT8A 2BDIA 3Q3YA 2OQUA 5FX5A 2PUQH 1V2MT 3SU6A 3UOUA 3KQCA 3QK1A 1UHBA 2A5KA 1UMAH 1IQNA 4LK4A 2NU1E 2GVFA 4Y76A 3OY6U 1BMNH 2CV3A 1XXDA 4TY7A 4ZXXH 5A2MH 1FDPA 1ELGA 1MH0A 1VR1H 2ZHQH 3LGWA 3U8RH 5JBCS 1N8OB 3ITIA 1P0SH 1PQAA 2TBSA 4LOYH 3MI4A 4TWYA 1UVOA 1Z8JB 1O2PA 1OPHB 4BXWA 1F5KU 1E0FD 1C1UH 1RJXB 4CRCA 4D7FA 2ZU1A 1FY8E 1VITF 3ZZCA 4SGBE 1VCWA 4NZQA 1ZSKA 3VB4A 1C5WB 1S5SA 1FIWA 3PMBB 2VIDA 4ZHAA 1GI3A 5E2PA 1O37A 3RXDA 4CR5A 1XKBC 1SHYA 2O8WA 1GHAF 5FPYA 4BXSA 2CHAC 4NZLA 4MPUA 1S84A 2ZDNA 1O2GH 2FYQA 3OYPA 2BTCE 2C8YB 3PMJA 2OC0A 1V2TT 3PWCA 1EPTB 1WUNH 4IS5A 1HJ8A 1O3BA 1B5GH 1DLEA 1DWBH 1K9OE 1YKTA 3BN9A 3GDSA 4I8KA 2BLQA 1HAOH 2HRVA 1GGDB 2GCTC 1QBNA 1OWIA 1O32A 3KN2A 1F0RA 5HM9A 2QXJA 3ODDA 4TYDA 3E0PB 2BD7A 2VINA 3UWIA 3GY7A 3F9EA 1GMCG 3SNBA 1PQ7A 2J34A 1GHWH 1MTNC 4ISIH 3VPKA 3M5LA 3KL6A 4NA9H 1HXFH 1ZHPA 2QIQA 2R2WU 1LQEA 3A84A 3AW0A 2SFAA 2P94A 1NROH 2PGBB 1GMDG 3UR9A 5FCRA 1C5QA 1YGCH 2C8XB 2VWMA 2Z3EA 1E36B 1LVBA 2J2UA 2OINA 3LH1A 1RRKA 1WAYB 1Y3WA 4XOJA 1LTOA 3RU4E 2BM2A 1O2SA 1AN1E 1S0RA 1DPOA 3MTYA 3BTKE 1TGSZ 1MD7A 1HAVB 1ETRH 3A81A 3OY5U 1X7AC 2JH6D 1HYLA 2F9BH 1P10A 1Y5UT 1O5FH 1TB6H 1PPZA 1BDAA 1GBIA 4YO9A 1GJ8B 4WXIA 4YZUA 1TE0A 2PGQB 1MZAA 5JBTA 1XUHA 4NSYA 2RCEA 3ZZ3A 1GBCA 4NIVA 2GGVB 3LC3A 2BDGA 3I77A 2C4FH 4KP0A 1HIAA 1UTLM 5AFZH 5T6DA 1MBMA 3RMMH 2Y7ZA 3NWUA 3QWCH 2BY5X 1V2OT 4MNYA 1XKAC 2EI8A 2WV5A 1KYNA 1YM0A 1BMAA 4AYYB 1HCGA 1W11U 2ZGXH 2TGTA 3MU8A 2CGAA 3RXTA 1O2OA 1YPKH 4WMDA 2I6QA 3EE0B 3MHWU 1DANH 2VB0A 1QL7A 1O3MA 1KLJH 3MU0A 1CA0C 2FODA 2FI3E 3STJA 1YPJH 1Z8IB 4Y7BA 1T8LA 3ZYEA 1QRXA 3U8OH 4D76A 2Y82A 1LKBA 1V2ST 3MNCA 3NK8A 1MMJN 3OTJE 2FOCA 1XM1A 3MNXA 1CBWC 1W0ZU 3A80A 2BQ6B 1AE8H 4OS2A 4ISOA 4WH8A 3V13A 3EAJA 3GDVA 4Y6DA 3EA8A 2HNTE 2SNWA 1ANEA 1IAUA 4LZ4B 4BAKB 2VIVA 1TWXB 3RXMA 1RTFB 4ABFA 5ETXA 1IHSH 1A61H 1CT0E 4MDSA 4X6PA 3AASA 1HJAB 1NPMA 1P09A 4JYUH 4X1SU 5E0GA 2B7DH 3RM2H 1RGQA 1C1QA 4NFEA 1GHVH 1JBUH 4YM9A 2ASUB 2TRMA 3SO3A 4ZH8A 1C5MD 1Y5AT 4Q80A 2GZ7A 2V6NA 1YPHE 4X2VA 4DG4A 4PROA 3SOSA 3SHCH 1C1VH 5FCKA 1ZZZA 9LPRA 1M9UA 2O8UA 1TA6A 4A1XA 2GMTC 3KF2A 5HMAA 5DP4A 3SUDA 1HB0B 1V2LT 1O3FA 4VGCC 3PMAB 1EZSC 3ZZDA 1SLVB 1O2WA 3S9AA 1BBRE 1XUJA 1GMCF 1JRTA 1O3HA 1XVMA 1O2JA 2FO9A 2JETC 3M35A 5EOKA 4WJG2 1O2KA 1PPEE 1GMDF 3TK6A 1PPGE 4IBLH 1HRTH 1YCPM 1IQGA 2QXIA 2ZO3H 4ISLA 2B8OH 1TRMA 2XCNA 3SW2B 1EATA 3QGNB 4Y10E 4U2WA 4CRFA 4X2WA 1KLTA 1Q3XA 1DY8A 1TONA 2Z3CA 1Y3UA 3FZZA 1O3DA 1E37B 3RXHA 1JWTA 4X6MA 1TA2A 4WMFA 4JK5A 1KLIH 2Q6GA 1P2JA 1B0EA 1A2CH 1J9CH 1PPFE 3RXLA 4B71A 5TCCA 2ULLA 2HPPH 2OTVA 1KIGH 2BD5A 1D3QB 1NU9A 5DPAA 2G55A 2XRCA 2XC5A 1H8IH 1UHBB 3TVJB 1EAWA 1CT4E 5F03A 3DD2H 1EJAA 3ZVBA 1MKXK 1O5CB 4NIXA 3ZZ8A 1HPGA 2KAIA 1C5PA 1YBWA 1NO9H 2CF9H 2NWNA 4YOIA 8ESTE 2DE9A 4UE7H 1UCYH 1Y3XA 3RXOA 1SGEE 1WV7H 2Y5FA 4ABBA 3LOXA 1EPTC 2QXGA 2V0BA 5HM2A 2VGCB 3IG6B 2PKSB 1C5UA 3QLPH 1EOLA 3NKKA 3M36A 3H7OA 2SGPE 2OXSA 2WUCA 3LGVA 3CENA 3BTFE 1QL9A 1Z8RA 1L1NA 1L4DA 2G51A 3T2NA 1O3LA 2R0KA 3UNSA 4H42U 2ZWLH 2STAE 4O9VA 2QYIA 1WBGB 3OSYA 4UD9H 1FPHH 1UTPA 3A7VA 1OWHA 5CHAC 2W7UA 2F3CE 3VXFH 2ZU2A 1ZRBA 1BTXA 1UTQA 4YESB 3P70B 2BD8A 2H1UA 1YCPK 3A7XA 3AW1A 3KQDA 1HBTH 1BMLA 2ZGHA 3TITA 1B0FA 1SR5C 5J4SA 1AWHB 2G00A 3HK3B 4CHAB 3N7OA 3UOPA 4E7RG 1O33A 1KXCA 1C5XB 3UR6A 1Z7KA 2VIPA 1D9IA 5C1YA 1EAIA 1F7ZA 2GD4B 3JZ2B 3TIUA 2QF3A 9ESTA 5EGMA 2ZFRH 3K9XB 4XBDA 2B5TB 1PYTC 5A09A 2P59A 2FOFA 1J17T 1DLKB 4HZHA 1SLUB 1A5HA 1TFXA 3VEQB 2P3UB 2FMJA 1MAYA 1C1WH 5EODA 1EJNA 5DK1A 3SUFA 1DX5M 1G9IE 3ATLA 1MBQA 3SJ8A 4YOGA 5ESTE 8GCHG 2YOLA 1TBQH 1VJAU 3CS7A 3SUGA 3UNQA 1QHRB 3PV4A 3VB5A 1QRWA 2XXLA 2ZU5A 3LC5A 4MTBA 4NCYA 5DP6A 1THPB 3D23A 1YPLH 4KTUA 1SGNE 1HIAB 4FUEA 4X8VH 1ZPBA 2F9PA 1ZTLA 1SGFG 3VB3A 2VIWA 1GG6B 1IQHA 1GHZA 2OC1A 4OS6A 1XUKA 5LGOA 1ESTA 4FU9A 2AH4X 2NU4E 2ZFSA 3GCHB 1H1BA 2D2DA 2BZAA 1LVOA 6LPRA 5EXMA 1G3EA 3E91A 1TQ7B 1BHXF 1WCZA 2TIOA 2FPZA 1Y3YA 5E2OA 1HGTH 2P93A 1BZXE 1AFQB 1FNIA 4ZHLU 1TALA 1C4V2 1HDTH 1CGIE 1UVSH 2G4UA 2XCFA 2RA0A 2BLOA 4DOQA 2EC9H 1PYTD 1SQTA 1HAYB 3FVFB 5FBIA 3RDZA 3TGIE 1RFNA 4X1NU 5C5NA 4KTCA 2AIPA 3MO6A 1ELDE 2C8WB 5A0CA 1G36A 2ZTXA 1BTWA 1TNJA 5GCHG 4ZAEA 3T62A 3ZYDA 1FY3A 5IYTA 5EW1H 1NFYA 1O2RA 1O31A 1NRPH 5EG4A 4IMZA 1E38B 2UUYA 4AX9H 3QX5H 1P2KA 1PQ5A 3SGBE 3RP2A 1ZMNA 4JZFH 3S9BA 3T26A 2WPKS 1K1JA 2Z9GA 3GCOA 1BTPA 2CN0H 1Z6JH 3CS0A 1RIWB 2ZC9H 1YPMH 1QB6A 2ODPA 1AO5A 1V2RT 1QL8A 4MNVA 3RXPA 1TAWA 3NXPA 4O3UA 1SC8U 3UWJH 4AB9A 2GDDA 1HNEE 3URDA 1W7GH 2BD3A 1NRNH 1VGCB 7ESTE 3M5NA 1FJSA 3W95A 2ZPRA 4LXBH 3EGKH 1EXFA 1YPGH 1QQUA 1KSNA 1PFXC 4IN1A 2Y7XA 3MH7A 1QY6A 1VITH 3KQBA 2C90B 1RTKA 1N6YA 1OWJA 1FY1A 1WTGH 1YP9A 1NRQH 3BEUA 1QGFA 3QTVH 4ISHH 4X1PU 1IOEA 5A0BA 1O3JA 3QZRA 3SU3A 2FOBA 2FESH 1D3TB 2I6SA 2DUCA 3T25A 1GMHG 1DDJA 1ORFA 2XWAA 1GI2A 2BDCA 2ZPSA 4FU7A 5L6NH 4AG2A 2QXHA 2HOBA 2TGPZ 1BRUP 2PV9B 1MU8B 4Y0ZE 1SQOA 2ILNA 4CH2B 1DFPA 4RKOB 4ABGA 3KNXA 2BXUH 4JZIA 3BTTE 2ZGCA 1T8MA 2ODQA 4JYVH 1SGTA 3SJ9A 5GWZA 2P8OB 2Z6BD 1HAZB 1THRH 3L6PA 2GKVE 5DP5A 3P17H 2OD3B 3SV6A 1Z1JA 2BLVA 3Q00A 1ZJKA 1FXYA 3M3VA 1EASA 1P8VC 5F6MA 1P2IA 4Z6AH 3U9AH 1AUTC 4MPVA 4I33A 1GI5A 3A7WA 5CE1A 1CQQA 1OKXA 2ZKSA 6CHAC 1TBZH 2VGCC 2PKSC 1JRSA 1C5OH 3M7QA 1QA0A 2ANWA 1ELVA 3RC6A 1CT2E 3RXEA 1ETTH 2XTTB 4WVPE 2SGEE 3BG4B 2KAIB 1GHBG 3TH2H 1AKSA 2OC8A 1ELAA 2YNAA 1TNHA 3A8CA 4JYTA 4YTAA 3GDUA 2AFQB 3ZVDA 1UTNA 2HNTF 5HXFA 1O35A 3BTME 1V2JT 1UVTH 5DP3A 1HUTH 3E6PH 1V2VT 3ZVCA 1AD8H 1EZQA 1F0TA 1ARCA 2PTCE 2ZHWH 4IMQA 1SLXB 4A1TA 1GHYH 1C4U2 3VFEA 1O34A 1ACBE 5BPEA 1W13U 1JOUB 4F4OC 1K1OA 3TLOA 1DWCH 3GCTF 1FAKH 1LHFH 4Y8YA 2VH6A 5LPFA 1P01A 2R0LA 3ZZBA 2PWXA 1D6RA 1AB9B 3RLWH 1ZSJA 1GDQA 3M5OA 1CHOG 1DITH 1AVWA 7GCHG 2G8TA 2VIOA 1HFDA 4ZUHA 1DS2E 1C4Y2 1MKWH 4CRAA 3SI4H 1FN6A 4KGAA 1N6XA 3PLPA 2Z9IA 3HKJB 4AGKA 1CGHA 1K2I1 2FS9A 3BIUH 1B7XB 2VNTA 2ZCLP 4GPGA 1V2NT 3C27B 1C2IA 4X1QU 2W3IA 1QBVH 3SNCA 1EB1H 2BQWB 3GY8A 5F8ZA 3SQEE 1YLCA 3BTHE 3L33A 1ZGVA 5EQSA 2AERH 1LVMA 1TNKA 2PKAA 1C5YB 4XDEA 5H4IB 2AMQA 2BD9A 5K0HA 2F9OA 2XWBI 3V0XA 3SU4A 3VGCB 1VCQA 2FOEA 3QDZB 4OS7A 2BMGB 5HGGA 4RN6A 1NTPA 5DGJA 1GI4A 1QBOA 1QR3E 1HAIH 1ZGIA 1NRRH 3MNBA 2VWLA 5EQRA 1K21H 4ZKNU 1C5ZB 2EI7A 4MPXA 1HAGE 5JB9S 1GBFA 1MTVA 2BX3A 2ZA5A 4K8YA 2QF0A 1AMHA 2ZDKA 3BG8A 5A0AE 1QB9A 4GHTA 3TNTA 4GCHG 1KXAA 3TGKE 4B1TA 1KXFA 1SGFA 1BMMH 4AYVB 3L3TA 3LJOA 2IPHA 3B23B 1E35B 1QNJA 2BY8X 1S6HA 1O2XA 1GCTB 1GBLA 2CMYA 2WPMS 1C5SA 3A7TA 3GYMA 1EP6A 1GI6A 2A4GA 2BY9X 3QGJA 1GPZA 1P12E 1F92A 1V2QT 2QAAA 4MNXA 4JZDH 3SBKA 5A8XA 1IQMA 2VIQA 1W8BH 1C1PA 2GCHG 1ZMJA 3SJIA 1MTWA 3LIWA 4ZKRU 2Z7FE 2WPHS 5TCAA 2QY0B 3S7KB 3GYLB 1MUEB 5AVDA 3LGUA 3EDXB 3ODFA 3WY8A 2R3YA 1FZZA 1PQ8A 1UCYK 1L2EA 4K3JA 2BDAA 1AI8H 3PTNA 3S69A 1MZDA 5E0HA 3NCLA 3QN7A 5DKMA 4KTSA 4O03A 1K22H 3LH3A 3RXBA 1EKBB 4Q7ZA 2THFB 3P95A 2ZGJA 4INKA 2BXTH 2WPJS 2ZFPH 3PROA 2GP9B 5JPMH 1O3CA 4IC6A 1PPHE 1ABIH 1QA7A 2FZZA 4FUCA 4AORA 2FLRH 2P3FH 4DCDA 1WYKA 4THNH 1Z6EA 2G52A 2Z9JA 4DIIH 2SGFE 4K2YA 5EPYA 3ATIA 1OS8A 1O5GH 2A5AA 1AE5A 3ZZ5A 3TPIZ 2HALA 3U69H 2LNCA 3A83A 1D4PB 2VWOA 3HATH 2EI6A 4Y11E 1SVPA 1LO6A 1SFIA 3U98H 1TABE 2A4RA 2Y6TA 2ZHFH 3M61U 1C1RA 1GVLA 3LPRA 4YOJA 5E8EH 3VB7A 4RKJB 3E90B 4HTCH 1S81A 4K5ZA 2ZU4A 2UWOA 1ZYOA 1P06A 2FI5E 3M37A 2F83A 3F9FA 3M3SA 5FX6A 3LT3A 6GCHG 2A4OA 3EQ0H 1MCVA 4BOHA 3S7HB 3RU4T 3OU0A 1CHOF 1OYTH 7GCHF 4BTTB 5IDKA 3HKIB 1AWFH 1V2KT 4GAWA 4Q7YA 4B74A 2ZDLA 1Y59T 4GLYA 5C67A 3PB1E 1O2MA 1O3OA 2OLGA 4I31A 2JH5D 1C1OA 1L1JA 1QQ4A 5JBBS 4A5TS 3BEIB 4XBBA 1TRYA 2R2MB 3TJUA 1YLDA 3EA7A 5C1UA 5FXLA 2BYAX 1DUEA 1T7CA 1SGDE 1TGCA 2PHBA 3MO3A 5EPNA 3PM3A 3A86A 4M7GA 1H9LB 3RXRA 1N8OC 1BQYA 4O3TA 2FYRA 3ZVEA 1KDQA 3A89A 2AIQA 1KY9A 2Y81A 1XMNB 4A6LA 4DURA 1AZZA 5DJ7A 1K1IA 1BHXB 1JMOH 1T8OA 1O3GA 2CJIA 1T4UH 1D6WA 2H9EH 4D9QA 1RTLA 1G2LA 5JB8S 4JZEH 3BG4C 1O3KA 2Z9KA 1MU6B 5BRRE 1IQKA 1P04A 3E1XB 1BRAA 4AG1A 2QN5T 4AOQA 2XBYA 1EB2A 2A4QA 1F2SE 4ASHA 1C2KA 1F0SA 1TLDA 3K6YA 4GVUA 5FBEA 3SJKA 3OX7U 4Y8XA 1RXPA 4KELA 4MQAA 4FUDA 3SV8A 3GY2A 1A46H 3MH5A 1MCTA 1AKSB 4TWWA 1ESBA 3PMHB 4A92A 2P16A 3FP8E 3TJNA 1EZXC 2D8WA 2FOGA 1P2QA 4TPYA 1TNIA 4FUHA 1GGDC 3ZZ6A 1BT7A 3TJOA 3TJVA 2GCHF 2A0QB 3RM0H 3A7ZA 2ZZUH 1DSUA 2RDLA 3TNSA 1GVKB 2BY7X 1GJDB 3PO1B 2UWPA 1BTYA 2FLBH 3BEFB 1THSH 1HJ9A 2OCVB 3SHAH 2IN2A 1TMBH 1EPTA 4A7IB 1SFQB 1NC6A 1ZRKA 2A7CA 1WSSH 2ESTE 2ZDAH 3ZV9A 1IQIA 1O2UA 1C5NH 3O8BA 1OOKB 5LPRA 5K7RA 1AHTH 1TX8A 4AN7A 1C2FA 3SNEA 2ZTYA 3O8RA 3HK6B 3UPEA 2SGQE 3P6ZB 1CE5A 5F8XA 5J4QA 2WINI 2W3KA 1P9UA 1SGRE 3Q3XA 1GBAA 1TPSA 1CU1A 1O2TA 5EQQA 2PKAB 1A0HB 4XBCA 3RXSA 1OP8A 4B76A 1W12U 5HYOA 1LHCH 2BLWA 4R8TB 1DSTA 1UTMA 2F9VA 1ZTKA 1LHEH 2QGRA 4BANB 2OUAA 2V35A 4K60A 2Y80A 2A2QH 1S85A 4FU8A 4J2YB 3DFLA 2H9TH 4HI3A 2YNBA 5G4BA 1AY6H 1T32A 3M7UA 2H2ZA 2BD4A 4GHQA 3MU4A 1LMWB 1HAHH 1A0LA 3LGIA 4FVBA 4Y8ZA 5FPSA 2EA3A 4AFZA 4AFQA 1WQSA 3A82A 3LGTA 3EYDA 4OS4A 3U1IB 1C1NA 1O3EA 2ZIQH 5ABWA 2FX6A 3V12A 2Q6DA 3URCA 1J16A 1SGIB 1K1PA 1P11E 1BTUA 1C5LH 3RXAA 1TIOA 1S82A 2W26A 3T27A 2ZU3A 2XYAA 3QTOH 1ZLRA 2ZCHP 3R3GB 1YF4A 1C9TA 1O30A 2HGTH 1S6FA 4CBNA 3TU7H 2BZ6H 3GCNA 4B2AA 3ZVFA 5FAHA 1O2ZA 3O8DA 5JBAS 1KXDA 1FUJA 3SU1A 1HJAC 1FLEE 4Y7AA 2GTBA 3H5CB 2A31A 1MKXH 4A1VA 4DT7B 4YT7H 1J15A 1V6DA 1AFEH 2XNIA 3KIDU 1DY9A 3RLYH 4BTIB 3S9CA 1ZHRA 1O5DH 1N1LA 3RXIA 1ANCA 2RA3A 1ABJH 4INLA 1D3DB 2OQ5A 2R3UA 3M5MA 1ESAA 3A87A 3SV7A 1P57B 1O3PB 3KQEA 3RMNH 2VJ1A 1CBWB 1LPKB 4B75A 2OP9A 1Y8TA 3PYHA 2XBVA 4AFSA 1TX7A 1GI0A 4MNWA 1K28D 4ABAA 1OSSA 1C2JA 4MPWA 3ATWA 1GBDA 1TOMH 1GBTA 1GJ6A 1BITA 1P2OA 3RXVA 3QZQA 2H5CA 1O3AA 1H9HE 2WUBA 1NT1A 4NSVA 4K1TA 3ZZ4A 2A2XH 2TPIZ 2ZFQH 3SU5A 3W94A 1ELCA 3M7TA 2FEQH 4ABIA 1W0YH 2PLXA 1DXPA 3UTUH 1EZUC 4HFPB 4XSKU 1PPCE 3Q77A 2XW9A 3FFGA 1O2YA 3D65E 5TJXA 4CREA 3A85A 2F9UA 1UO6A 1JIMA 1Q31A 2GMTB 1GJAB 2XBWA 1SBWA 5LPEA 4H6SB 3AVZA 1WQVH 1HLTH 1SG8B 4VGCB 5FPTA 2BHGA 3I29A 4FUJA 1W10U 1P02A 4WY3A 3ZZ7A 2ZTZA 8LPRA 3NUMA 5SGAE 1AQ7A 1SI5H 3HGNA 2ZHDA 2BDHA 2BOHB 1CGJE 4NIWA 4QT8C 4ABEA 3RXUA 1LPGB 8GCHF 4NWKA 2HPQH 2JETB 3E3TA 1UVPA 3LJJA 4UONA 3P8OA 4UFEH 1KDQB 3ENSB 2H9HA 2ALPA 2BDBA 1Q2WA 1TX6A 2BQ7B 1OWKA 3SNAA 1LQDB 5AF9H 1BBRH 1GL1A 1QJ1B 4FVDA 3UQVA 1GJ9B 1AVXA 3UIRA 3SNDA 1ID5H 2Z3DA 3ATMA 4D8NA 5C2ZA 1TMTH 3U8TH 2Q1JA 1XX9A 2PUXB 3F6UH 3I78A 2Y5GA 1E34B 1TRNA 3FANA 3HGPA 1AU8A 1TGBA 1NESE 1BTHH 3BIVH 1DICA 3RC5A 4X2XA 4K69A 3PO1C 3T29A 1LDTT 2FDAA 4CH8B 2TGAA 4F49A 1Y5BT 1Z71A 2A7JA 3FP6E 3SORA 1HV7A 1C1SA 1C1MA 3SJOA 3EA9A 1ARBA 3BF6H 3D62A 1SQAA 2FOAA 4CHAC 1NN6A 1S0QA 1SSXA 1GBEA 1PPBH 4D9RA 1EP5A 3KGPA 2BX4A 2O9QA 6ESTA 4Y0YE 3KEEA 4UDWH 5PTPA 3FAOA 1F5RA 4MG3A 2QC2A 4AGJA 2Z94A 1SGYE 3UNRA 4Z0KA 5F8TA 5GCHF 1ZPCA 4E05H 2W7SA 1V2UT 4UEHH 1P3EA 1PJPA 3TK9A 1T31A 1VZQH 1ELBA 4B2CA 3B8JA 2AMPA 2GDEH 2BVRH 4WF8A 3UUZA 1FV9A 1A1RA 1O2LA 2C8ZB 3MOCA 2VVVA 5JYIA 1SL3A 1L4ZA 1F0UA 2VWNA 5EXLA 5I46H 3AAUA 4FUBA 1QCPA 3T28A 1ZTJA 5GXPA 4WH6A 2FM2A 4Q7XA 2QCYA 3TH3H 5CHAB 5DG6A 1IQLA 1UK2A 2ODYB 3MWIU 2VVUA 1S83A 1ELFA 4DGJA 2AGGX 2UWLA 1L1GA 3K6ZA 1NFXA 1A0JA 1NZQH 2A45B 1GG6C 1AIXH 1GHXH 2AEIH 2HVXA 4J1YA 1OX1A 2UUKB 1FIZA 2FOMB 1C2LA 3G01A 4Y79A 1G32B 1J8AA 3GY3A 2O8MA 4H6TA 4NFFA 1GJ7B 1SLWB 3GCHC 3RU4D 2PSYA 4ISNA 1ANDA 3SU2A 3SV9A 1BCUH 1VJ9U 2P3TB 1LHDH 4Y71A 2BVXH 2CF8H 3SGAE 1UK4A 4YLQH 2HNTC 3MH4A 5C3NA 2ZQ1A 1GMHF 3GY5A 4JMYA 2WYJA 1NFUA 1A5IA 3QO6A 4IN2A 1AFQC 1IQFA 1NM6A 1GBHA 2NU0E 4WWYA 2WV4A 1HXEH 5A8YA 1C1TA 2PW8H 3NZIA 2XC0A 1UTKA 2A7HA 2Z9LA 4NA7A 1DE7H 5JDUB 1H8DH 1FMGA 3P8FA 2FXRA 4NWLA 2K1QA 1T4VH 4LZ1H 1GI1A 2FI4E 2V3OH 2IOTA 1ETSH 2EEKA 1MQ5A 1YPHC 3KHVA 1MQ6A 3UY9A 4XE4A 3TGJE 1RD3B 1GDNA 1GJBB 1XXFA 1W2KH 4B73A 3BTGE 4KKDA 1KXBA 4FUIA 4X0WU 2AMDA 1TPOA 3RXJA 1U6QA 3BTQE 3V3MA 5T6GA 1A3EH 1IQJA 1OP0A 3P8GA 4E7NA 1GBBA 2D1JA 2P95A 4JCNA 1GCDA 2ZDVH 1GHBF 1RIWC 1INCA 2ZFFH 1JXPA 2ZFTA 4DIHH 3SU0A 1LHGH 3BV9B 5GPIB 1ZHMA 3Q76A 2SNVA 2WPIS 2ZDMA 4U01A 1SGPE 1O0DH 3RXQA 1VGCC 4OGXA 3BTEE 1O5AB 1UTJA 5C1XA 3K2UA 1AUJA 3IWMA 4CRDA 2J92A 2O8LA 1K1MA 2OC7A 1EQ9A 1EOJA 1ZOMA 4ABDA 1W7XH 3RC4A 3RMLH 3VB6A 2BDYA 4IC5A 4D7GA 2VH0A 2G81E 4BAOB 4CR9A 1GWAA 1SHHB 1CA8B 3C1KA 5ESBA 1KXEA 1WOFA 2FTMA 2O8TA 4YT6H 4I8JA 2RG3A 1C5RA 2G5NA 4K8BA 1C2EA 3KCGH 1FAXA 2AGEX 1GVZA 4K1EA 5T6FA 4INHA 1BJUA 1SMFE 1BRBE 4NGAH 4X2YA 4CRGA 4ZKSU 2FX4A 2XBXA 2FP7B 3PWBA 1ELEE 2J4IA 3MO9A 2C3SA 2R9PA 4OS1A 1TYNA 1TBRH 1SGQE 2NU3E 1GJ5H 2FS8A 4ZROA 3BTWE 2P8OC 3LDXH 2GZ8A 4K1SA 2BVSH 2FIRH 1Z8GA 1UJ1A 3F1SB 4B2BA 4R0IA 1HAPH 1BIOA 1DVAH 2ZECA 4MLFB 3STIA 2BOKA 1OWEA 2FOHA 3LGYA 1GDUA 1DM4B 4JK6A 3RXCA 1DWEH 1TGTA 1BJVA 1XUGA 3MMGA 5I25A 4I32A 3A7YA 1C2GA 1DWDH 3B9FH 3GOVB 1SB1H 1TPAE 2BY6X 1BOQA 1L0ZA 4SGAE 2B9LA 1QURH 1AVGH 1O3IA 2B0FA 3K65B 3ZVGA 4FUGA 3TK5A 2ZI2H 4ZHMU 1O2NA 2QA9E 4GCHF 5DO4H 4MVNA 3MFJA 3VXEH 5CMXH 1FY4A 4BAQB 1NY22 4DJZB 1SOZA 3LKWA 1KTTB 1O2HA 1OXGA 2BD2A 1GBJA 2NU2E 3E16B 2GV7A 4X6NA 4X8UH 2ANYA 1ANBA 2AGIX 3DHKH 3ZZ9A 2LPRA 4TPIZ 1P9SA 3MU1A 1EUFA 2DE8A 1UVUH 2Q6FA 2W5EA 1H4WA 4AB8A 4FUFA 1TNLA 2H5DA 3DT0H 1P2NA 5GDSH 3DUXH 1OYQA 1GL0E 4OS5A 4U32A 1CHGA 1AB9C 2M5TA 1ZSLA 3MH6A 3MU5A 1GI7B 3ZZAA 4NG9H 3QUMP 4CRBA 5FHTA 6CHAB 2GZ9A 4NIYA 1BTZA 2SGAA 4WXVA 1MD8A 2ZP0H 4UFDH 3UQOA 4UFGH 2VU8E 1FPCH 1NFWA 2A32A 4ZKOU 1P05A 4ABHA 1FONA 4GSOA 1DUAA 3FZDA 2WPLS 1G3DA 2J95A 3M3TA 3NPSA 3DFJA 4BNRA 2PFEA 4E06H 5LH8A 2J9NA 1FY5A 1CVWH 1QIXB 2G5VA 2ZG0H 2IJOB 4ABJA 2CHAB 2A5IA 3VGCC 3RUOA 4O97A 2TGDA 5EW2H 1LCYA 4I8LA 1QTFA 1TGNA 2AS9A 2GX4A 2SGDE 2ZPQA 3GY6A 3MYWA 2ANKH 3GY4A 3P92A 1P2MA 3E0NB 3DA9B 2GCTB 1C9PA 2A1DB 4Q2KA 5DP9A 2F9NA 1SOTA 4ZXYH 3T5FH 1O5EH 1T8NA 2GV6A 4X6OA 1DT2A 3BTDE 2XC4A 1OWDA 1HAVA 1CSOE 1MTNB 3D49H 1CO7E 2G4TA 4BTUB 3H7TA 4WMEA 6GCHF 5L30H 1GI8B 5DP7A 4I8HA 3SZNA 2HLCA 3CP7A 3ESTA 4IGDA 1V2PT 2VVCA 1GJ4H 1GCTC 7LPRA 1SGCA 1C2MA 3MNSA 2PTNA 3GICB 1ZJDA 3S0NA 1C5TA 3A88A 1O39A 1IQEA 2F91A 3SV2H 3RMOH 1YPEH 3IITA 1MTUA 1DOJA 2ZEBA 5E0JA 1J14A 1W3CA 1K1NA 2J38A 2C93B 1MTSA 1GBKA 5AFYH 3RXFA 1A3BH 1LPZB 1MAXA 4JZ1A 3F9HA 1G30B 1NRSH 1O38A 3LONA 1BRCE 1FN8A 1Y3VA 1BBRK 1BA8B 1A7SA 4ESTE 5A8ZA 3F9GA 5GIBA 1UTOA 1TOCB 1P03A 4GUXA 1O2QA 3SGQE 1G3BA 2CXVA 1AGJA 1FQ3A 1QRZA 1VITG 4X1RU 1AZ8A 5T3HA 5L2YH 1C5VA 1IHTH 5C20A 2FTLE 1GHAG 2V3HH 1UK3A 4X8TH 4X8SH 1EAXA 4OGYA 1ZMLA 1TNGA 4I7YH 3Q3KA 1EX3A 1W14U 3PLKA 2J94A 3ATKA 3PTBA 3TH4H 1CA0B 2ZNKH 7KMEH 3GCTG 4CBOA 1LVYA 1TMUH 3SN8A 3RXGA 4ZMAH 1DXWA 3U1JB 5B6OA 1GI9B 2WYGA 2ZGBH 1NU7B 3AAVA 5EXNA 1A4WH 4AFUA 4DY7B 2UUFB 1ZR0A 3LU9B 1YYY1 2Y5HA 3JZ1B 1XUFA 1G2MA 1WTHD 2OBQA 1LKAA 1V2WT 1G3CA 1O3NA 1C2DA 3R0FA 1EJMA 1GJCB 5EU8A 1MKWK 3ELAH 5AHGH 2H6MA 1F5LA 2ZCKP 2OBOA 4XFQA
chains in the Genus database with same CATH superfamily
3F68H 3FP7E 1QB1A 5GJ4B 1XVOA 8KME2 1YCPH 3O8CA 5C5OA 1QJ6B 1TPPA 2PR3A 2ALVA 4IW4E 2HWLB 1XUIA 4YLUA 3ZV8A 4H4FA 1VCPA 3GISB 1H8ED 1K1LA 2PP6A 1A5GH 3ZVAA 1QFKH 1WU1A 2STBE 5L2ZH 4FXGH 3RXKA 2BB4A 2JKHA 4U30A 3V7TA 1O36A 1RS0A 2ANMH 1HAXB 3HPTB 4I8GA 4HGCA 4TY6A 4RSPA 5DP8A 1BUIA 1BB0B 1D3PB 3UREA 2GT7A 1OP2A 3UFAA 1EAUA 1O2VA 2LELA 3E8LA 4BAMB 4DW2U 3A8BA 4DVAU 1Z1IA 4NA8A 1NS3A 5T1VA 1TQ0B 1O2IA 1UCYE 2WZQA 4BAHB 2QV1A 1YC0A 1ZPZA 1P3CA 1SPJA 1G37A 1E1QD 2JH0D 3SUEA 1C2HA 1GBMA 2UUJB 1FI8A 1QJ7B 1FX0B 2ZHEH 1ELTA 3A8DA 2PSXA 4AZ2B 2FWWA 3P8NA 2D26C 4UFFH 1H9IE 2ZF0H 1E79D 1JIRA 3BSQA 1KTSB 2WSSD 4XRNA 3SQHE 3SI3H 3PLBA 4FOUC 1O5BB 3A8AA 2AYWA 1V3XA 2ZQ2A 2GT8A 2BDIA 3Q3YA 2OQUA 5FX5A 2PUQH 1V2MT 3SU6A 3UOUA 3KQCA 3QK1A 1UHBA 2A5KA 1UMAH 1IQNA 4LK4A 2NU1E 2GVFA 4Y76A 3OY6U 1BMNH 2CV3A 1XXDA 4TY7A 4ZXXH 5A2MH 1FDPA 1ELGA 1MH0A 1VR1H 2ZHQH 3LGWA 3U8RH 5JBCS 3FKSD 1N8OB 3ITIA 1P0SH 1PQAA 2TBSA 4LOYH 3MI4A 4TWYA 1UVOA 1Z8JB 1O2PA 1OPHB 4BXWA 1F5KU 1E0FD 1C1UH 1RJXB 4CRCA 4D7FA 2ZU1A 1FY8E 1VITF 3ZZCA 4SGBE 3WWFA 1VCWA 5FL7D 4NZQA 1ZSKA 3VB4A 1C5WB 1S5SA 1FIWA 3PMBB 2VIDA 4ZHAA 1GI3A 5E2PA 1O37A 3RXDA 4CR5A 1XKBC 1SHYA 2O8WA 1GHAF 5FPYA 4BXSA 2CHAC 4NZLA 2KX4A 4MPUA 1S84A 2ZDNA 1O2GH 2FYQA 2F43B 2BTCE 3OYPA 2C8YB 3PMJA 2OC0A 1V2TT 3PWCA 1EPTB 1WUNH 4IS5A 1HJ8A 1O3BA 1B5GH 1DLEA 1DWBH 1K9OE 1YKTA 3BN9A 3GDSA 4I8KA 2F4LA 2BLQA 1HAOH 2HRVA 1GGDB 2GCTC 1QBNA 1OWIA 1O32A 3KN2A 1F0RA 5HM9A 2QXJA 3ODDA 4TYDA 3E0PB 2BD7A 2VINA 3UWIA 3GY7A 3F9EA 1GMCG 3SNBA 1PQ7A 2J34A 4Q4LA 1GHWH 1MTNC 4ISIH 3VPKA 3M5LA 3KL6A 4NA9H 1HXFH 1ZHPA 2QIQA 2R2WU 1LQEA 3A84A 3AW0A 4DT4A 2SFAA 2P94A 1NROH 2PGBB 1GMDG 3UR9A 5FCRA 2W6ID 2K8IA 1C5QA 1YGCH 2C8XB 2VWMA 2Z3EA 1E36B 2JJ1D 1LVBA 2J2UA 2OINA 3LH1A 1RRKA 1WAYB 1Y3WA 4XOJA 1LTOA 3RU4E 2BM2A 1O2SA 1AN1E 1S0RA 1DPOA 3MTYA 2W6JD 3BTKE 1TGSZ 1MD7A 1HAVB 1ETRH 3A81A 3OY5U 1X7AC 2JH6D 1HYLA 2F9BH 1P10A 1Y5UT 3PV2A 1O5FH 1TB6H 1PPZA 1BDAA 1GBIA 4YO9A 1GJ8B 4WXIA 4YZUA 1TE0A 2PGQB 1MZAA 5JBTA 1XUHA 4NSYA 2RCEA 3ZZ3A 1GBCA 4NIVA 2GGVB 3LC3A 2BDGA 3PRBA 3N7EA 3I77A 2C4FH 4KP0A 1HIAA 1UTLM 5AFZH 5T6DA 1MBMA 3RMMH 2Y7ZA 3NWUA 3QWCH 2BY5X 1V2OT 4MNYA 1XKAC 2EI8A 2WV5A 1KYNA 1YM0A 3OE7D 1BMAA 4AYYB 1HCGA 1W11U 2ZGXH 2TGTA 3MU8A 1S6LA 2CGAA 3RXTA 1O2OA 1YPKH 4WMDA 2I6QA 3EE0B 3MHWU 1DANH 2VB0A 2QF4A 1QL7A 1O3MA 1KLJH 3MU0A 1CA0C 2FODA 2FI3E 3STJA 1YPJH 1Z8IB 4Y7BA 1T8LA 3ZYEA 1QRXA 3U8OH 4D76A 2Y82A 1LKBA 1V2ST 3MNCA 3NK8A 1MMJN 3OTJE 2QE7D 2FOCA 1XM1A 3MNXA 1CBWC 2IJD1 1W0ZU 3A80A 2BQ6B 1AE8H 4OS2A 4ISOA 2HLDD 4WH8A 3V13A 4ACAA 3EAJA 3GDVA 4Y6DA 3EA8A 2HNTE 2SNWA 1ANEA 1IAUA 4LZ4B 4BAKB 2VIVA 2J98A 1TWXB 3RXMA 1RTFB 4ABFA 5ETXA 1IHSH 1A61H 1CT0E 4MDSA 4X6PA 3AASA 1HJAB 1OHHD 1NPMA 1P09A 2KCOA 4JYUH 4X1SU 3UAIC 5E0GA 2B7DH 3RM2H 1RGQA 1C1QA 4NFEA 1GHVH 1JBUH 4YM9A 5C0UA 2ASUB 2TRMA 3SO3A 4ZH8A 1C5MD 1Y5AT 4Q80A 2GZ7A 2V6NA 1YPHE 4X2VA 4DG4A 4PROA 3SOSA 3SHCH 4F55A 1C1VH 5FCKA 1ZZZA 9LPRA 1M9UA 2O8UA 1TA6A 4A1XA 2GMTC 3KF2A 5HMAA 5DP4A 3SUDA 1HB0B 1V2LT 1O3FA 4VGCC 3PMAB 1EZSC 3ZZDA 1SLVB 1O2WA 3S9AA 1BBRE 1XUJA 1GMCF 1JRTA 1O3HA 1XVMA 1O2JA 2FO9A 2KR7A 2JETC 3M35A 5EOKA 4ACBA 4WJG2 1O2KA 1PPEE 1GMDF 3TK6A 1PPGE 4IBLH 1HRTH 1YCPM 1IQGA 2QXIA 2ZO3H 4ISLA 2B8OH 1TRMA 2XCNA 3SW2B 1EATA 3QGNB 4Y10E 4U2WA 4CRFA 4X2WA 1KLTA 1Q3XA 1DY8A 1TONA 2Z3CA 1Y3UA 3FZZA 1O3DA 1E37B 3RXHA 1JWTA 4X6MA 1TA2A 4WMFA 4JK5A 1KLIH 2Q6GA 1P2JA 1B0EA 1A2CH 1J9CH 1PPFE 3RXLA 4B71A 3DSOA 5TCCA 2ULLA 2HPPH 2OTVA 3DSPA 1KIGH 2BD5A 1D3QB 1NU9A 5DPAA 3EE7A 2G55A 2XRCA 2XC5A 1H8IH 1UHBB 2KCPA 3TVJB 1EAWA 1CT4E 5F03A 3DD2H 1EJAA 3ZVBA 1MKXK 1O5CB 4NIXA 3ZZ8A 1HPGA 2KAIA 1C5PA 1YBWA 1EFRD 1NO9H 2K0QA 2CF9H 2NWNA 4YOIA 8ESTE 2DE9A 4UE7H 1UCYH 1Y3XA 3RXOA 1SGEE 1WV7H 2Y5FA 4ABBA 3LOXA 1EPTC 2QXGA 2V0BA 5HM2A 2VGCB 3IG6B 2PKSB 1C5UA 3QLPH 1EOLA 3NKKA 3M36A 3H7OA 2SGPE 3W1EA 2OXSA 2WUCA 3LGVA 4F48B 3CENA 3BTFE 1QL9A 1Z8RA 1L1NA 1L4DA 2G51A 3T2NA 1O3LA 2R0KA 3UNSA 4RI0A 4H42U 2ZWLH 2STAE 4O9VA 2QYIA 1WBGB 3OSYA 4UD9H 1FPHH 1UTPA 3A7VA 1OWHA 5CHAC 2W7UA 2F3CE 3VXFH 2ZU2A 1ZRBA 1BTXA 1UTQA 4YESB 3P70B 2BD8A 2H1UA 1YCPK 3A7XA 3AW1A 3KQDA 1HBTH 1BMLA 2ZGHA 3TITA 1B0FA 1SR5C 5J4SA 1AWHB 2G00A 3HK3B 4CHAB 3N7OA 3UOPA 4E7RG 1O33A 1KXCA 1C5XB 3UR6A 1Z7KA 2VIPA 1D9IA 5C1YA 1EAIA 1F7ZA 2KFWA 2GD4B 3JZ2B 3TIUA 2QF3A 9ESTA 5EGMA 2ZFRH 3K9XB 2KZ4A 4XBDA 2B5TB 1PYTC 5A09A 2P59A 2FOFA 1J17T 1DLKB 4HZHA 1SLUB 1A5HA 1TFXA 3VEQB 2P3UB 5DSFA 2FMJA 1MAYA 1C1WH 5EODA 1EJNA 5DK1A 3SUFA 1DX5M 1G9IE 3ATLA 1MBQA 3SJ8A 4YOGA 5ESTE 8GCHG 2YOLA 5CHBA 1TBQH 1VJAU 3CS7A 3SUGA 3UNQA 1QHRB 3PV4A 3VB5A 1QRWA 2XXLA 2ZU5A 3LC5A 4MTBA 4NCYA 5DP6A 1THPB 5EJ1A 3D23A 1YPLH 4KTUA 1SGNE 1HIAB 3NRLA 4FUEA 4X8VH 1ZPBA 2F9PA 1ZTLA 1SGFG 3VB3A 2VIWA 1GG6B 1IQHA 1GHZA 2OC1A 4OS6A 1XUKA 5LGOA 1ESTA 4FU9A 2AH4X 2NU4E 2ZFSA 3GCHB 1H1BA 2D2DA 2BZAA 1LVOA 6LPRA 5EXMA 1G3EA 3E91A 1TQ7B 1BHXF 1WCZA 5B6LA 2TIOA 2FPZA 1Y3YA 5E2OA 1HGTH 2P93A 1WXRA 1BZXE 1AFQB 1FNIA 4RT0A 2QF5A 4ZHLU 1TALA 1C4V2 1HDTH 1CGIE 1UVSH 2G4UA 2XCFA 2RA0A 5CDFE 2BLOA 4DOQA 2EC9H 1PYTD 1SQTA 1H8HD 1YY3A 5KECA 1HAYB 3FVFB 5FBIA 3RDZA 3TGIE 4ASUD 1RFNA 2LP6A 4X1NU 5C5NA 2VBCA 2AIPA 3MO6A 4KTCA 1ELDE 2C8WB 5A0CA 1G36A 2ZTXA 1BTWA 1TNJA 5GCHG 4ZAEA 3T62A 3ZYDA 1FY3A 5IYTA 5EW1H 1NFYA 1O2RA 1O31A 1NRPH 5EG4A 4IMZA 1E38B 2UUYA 4AX9H 3QX5H 1P2KA 1PQ5A 3SGBE 3RP2A 1ZMNA 4JZFH 3S9BA 3T26A 2WPKS 1K1JA 2Z9GA 3GCOA 1BTPA 2CN0H 2V7QD 1Z6JH 3CS0A 1RIWB 2ZC9H 1YPMH 1QB6A 2ODPA 1AO5A 1V2RT 1QL8A 4MNVA 3RXPA 1TAWA 3NXPA 3F0PA 4O3UA 1SC8U 3UWJH 4AB9A 2GDDA 1HNEE 2YMSB 3URDA 1W7GH 2BD3A 4B6EA 1NRNH 1VGCB 7ESTE 3M5NA 1FJSA 3W95A 2ZPRA 4LXBH 3EGKH 1EXFA 1YPGH 1QQUA 1KSNA 1PFXC 4IN1A 2Y7XA 4ZCNA 3MH7A 1QY6A 1VITH 3KQBA 2C90B 1RTKA 1N6YA 1OWJA 1FY1A 3U28C 1WTGH 1YP9A 1NRQH 3BEUA 1QGFA 3QTVH 4ISHH 4X1PU 1IOEA 5A0BA 1O3JA 3QZRA 3SU3A 2FOBA 2FESH 1D3TB 1W0KD 2OK5A 2I6SA 2DUCA 3T25A 1GMHG 1DDJA 1ORFA 2XWAA 2JDID 1GI2A 2BDCA 2ZPSA 4FU7A 5L6NH 4AG2A 2QXHA 2HOBA 2TGPZ 1BRUP 2PV9B 1MU8B 4Y0ZE 1SQOA 2ILNA 4CH2B 1DFPA 4RKOB 4ABGA 3KNXA 2BXUH 4JZIA 3BTTE 2ZGCA 1T8MA 2ODQA 4JYVH 1SGTA 3SJ9A 5GWZA 2P8OB 2Z6BD 1HAZB 2JJ2D 5GNDA 1THRH 3L6PA 2GKVE 5DP5A 3P17H 2OD3B 5C0TA 3SV6A 1Z1JA 2BLVA 3Q00A 1ZJKA 1FXYA 3M3VA 1EASA 1P8VC 5F6MA 1P2IA 4Z6AH 3U9AH 1AUTC 4MPVA 4I86A 4I33A 1GI5A 3A7WA 5CE1A 1CQQA 1OKXA 2ZKSA 6CHAC 1TBZH 2VGCC 2PKSC 1JRSA 1C5OH 3M7QA 1QA0A 2ANWA 1ELVA 3RC6A 1CT2E 3RXEA 1ETTH 2XTTB 4WVPE 2SGEE 3BG4B 2KAIB 1GHBG 3TH2H 1AKSA 2OC8A 1ELAA 2YNAA 1TNHA 3A8CA 4JYTA 4YTAA 3GDUA 2AFQB 3ZVDA 1UTNA 2HNTF 5HXFA 1O35A 3BTME 1V2JT 1UVTH 5DP3A 1HUTH 3E6PH 1V2VT 3ZVCA 1AD8H 1EZQA 1F0TA 1ARCA 2PTCE 2ZHWH 4IMQA 3OEHD 1SLXB 4A1TA 1GHYH 1C4U2 3VFEA 1O34A 1ACBE 5BPEA 1W13U 1JOUB 4F4OC 4HG6A 1K1OA 3TLOA 1DWCH 3GCTF 1FAKH 1LHFH 5HIZA 4Y8YA 2VH6A 5LPFA 1P01A 2R0LA 3ZZBA 2PWXA 1D6RA 1AB9B 3RLWH 1ZSJA 1GDQA 2JIZD 3M5OA 1CHOG 1DITH 1AVWA 7GCHG 2G8TA 2VIOA 1HFDA 4ZUHA 1DS2E 1C4Y2 1MKWH 4CRAA 3SI4H 1FN6A 4KGAA 1N6XA 3PLPA 2Z9IA 3HKJB 4AGKA 1CGHA 1K2I1 2FS9A 3BIUH 1B7XB 2VNTA 2ZCLP 4GPGA 1V2NT 3C27B 1C2IA 4X1QU 2W3IA 1QBVH 3SNCA 1EB1H 2BQWB 3GY8A 4OM9A 5F8ZA 1YLCA 3BTHE 3L33A 3SQEE 1ZGVA 5EQSA 2AERH 1LVMA 1TNKA 2PKAA 1C5YB 5EIYA 4XDEA 5H4IB 2AMQA 2OBOA 1E1RD 2BD9A 5K0HA 2F9OA 2XWBI 3SYJA 3V0XA 3SU4A 3VGCB 1VCQA 2FOEA 3QDZB 4OS7A 2BMGB 4M9FA 5HGGA 4RN6A 1NTPA 1KMHB 2EQNA 5DGJA 1GI4A 1QBOA 1QR3E 1HAIH 1ZGIA 1NRRH 3MNBA 2VWLA 5EQRA 1K21H 5IK2D 4ZKNU 1C5ZB 2EI7A 4MPXA 1HAGE 5JB9S 1GBFA 1MTVA 2BX3A 2ZA5A 4K8YA 2QF0A 1AMHA 2ZDKA 3BG8A 3WWBA 5A0AE 1QB9A 3F2FA 4GHTA 3TNTA 3F2HA 4GCHG 1KXAA 3TGKE 4B1TA 1KXFA 1SGFA 1BMMH 4AYVB 3L3TA 3LJOA 2IPHA 3B23B 1E35B 1QNJA 2BY8X 1S6HA 2CK3D 1O2XA 1GCTB 1GBLA 2CMYA 1C5SA 2WPMS 3A7TA 3GYMA 1EP6A 1GI6A 2A4GA 2M2AA 2BY9X 3QGJA 1GPZA 1P12E 1F92A 1V2QT 2QAAA 4MNXA 4JZDH 3SBKA 5A8XA 1IQMA 2VIQA 1W8BH 1C1PA 2GCHG 1ZMJA 3SJIA 1MTWA 3LIWA 4ZKRU 2Z7FE 2WPHS 5TCAA 2QY0B 3S7KB 3GYLB 1MUEB 5AVDA 3LGUA 3EDXB 3ODFA 3WY8A 2R3YA 1FZZA 1PQ8A 1UCYK 1L2EA 4K3JA 3FN8A 2BDAA 1AI8H 3PTNA 3S69A 1MZDA 5E0HA 3NCLA 3QN7A 5DKMA 4KTSA 4O03A 1K22H 3LH3A 3RXBA 1EKBB 4Q7ZA 2THFB 3P95A 2ZGJA 4INKA 2BXTH 2WPJS 2ZFPH 3PROA 2GP9B 5JPMH 1O3CA 4IC6A 1PPHE 1ABIH 3KYFA 1QA7A 2FZZA 4FUCA 4AORA 2FLRH 2P3FH 4DCDA 1WYKA 4THNH 1Z6EA 2G52A 2Z9JA 4DIIH 2SGFE 4K2YA 5EPYA 3ATIA 1OS8A 1O5GH 2A5AA 1AE5A 3ZZ5A 3TPIZ 2HALA 3U69H 2LNCA 3A83A 1D4PB 2VWOA 3HATH 2EI6A 4Y11E 1SVPA 1LO6A 1SFIA 3U98H 1TABE 2A4RA 2Y6TA 2ZHFH 2EY4C 3M61U 1C1RA 1GVLA 3LPRA 4YOJA 5E8EH 3VB7A 4RKJB 3E90B 4HTCH 1S81A 4K5ZA 2KM0A 2UWOA 2ZU4A 1ZYOA 1P06A 2FI5E 3M37A 2F83A 3VG8A 3F9FA 3DCLA 3M3SA 3LT3A 5FX6A 6GCHG 2A4OA 3EQ0H 1MCVA 4BOHA 3S7HB 3RU4T 3OU0A 5C17A 1CHOF 1OYTH 7GCHF 4BTTB 5IDKA 3HKIB 1AWFH 1V2KT 4GAWA 4Q7YA 4B74A 2ZDLA 1Y59T 4GLYA 5C67A 1VKYA 3PB1E 1O2MA 1O3OA 2OLGA 4I31A 2JH5D 1C1OA 1L1JA 1QQ4A 5JBBS 4A5TS 3BEIB 4XBBA 1TRYA 2R2MB 3TJUA 1YLDA 3EA7A 5C1UA 5EJZA 2BYAX 1DUEA 5FXLA 1T7CA 1SGDE 1TGCA 5C94A 5HIYA 2PHBA 3MO3A 5EPNA 3PM3A 3A86A 4M7GA 1H9LB 3RXRA 1N8OC 1BQYA 4O3TA 2FYRA 3ZVEA 1KDQA 3A89A 5DN6D 2AIQA 1KY9A 2Y81A 1XMNB 4A6LA 4DURA 1AZZA 5DJ7A 1K1IA 2WHXA 1BHXB 1W0JD 1JMOH 1T8OA 1O3GA 2CJIA 1T4UH 2KCAA 1D6WA 2H9EH 4D9QA 1RTLA 1G2LA 1SQRA 4JZEH 5JB8S 3BG4C 1O3KA 2Z9KA 1MU6B 5BRRE 1IQKA 1P04A 3E1XB 1BRAA 4AG1A 2QN5T 4AOQA 2XBYA 1EB2A 2A4QA 1F2SE 4ASHA 1C2KA 1F0SA 2WV9A 4TT3D 1TLDA 3K6YA 4GVUA 5FBEA 3SJKA 3OX7U 4Y8XA 1RXPA 4KELA 4MQAA 4FUDA 3SV8A 3GY2A 1A46H 3MH5A 1MCTA 1AKSB 4TWWA 1ESBA 3PMHB 4A92A 2P16A 3FP8E 3TJNA 1EZXC 2D8WA 2FOGA 1P2QA 4TPYA 1TNIA 4FUHA 1GGDC 3ZZ6A 1BT7A 3TJOA 3TJVA 2GCHF 4RT1A 2A0QB 3RM0H 3A7ZA 2ZZUH 1DSUA 2RDLA 3TNSA 3H09A 1GVKB 2BY7X 1GJDB 3PO1B 2UWPA 1BTYA 2FLBH 3BEFB 1THSH 1HJ9A 2OCVB 3SHAH 2IN2A 1TMBH 1EPTA 4A7IB 1SFQB 1NC6A 1ZRKA 2A7CA 1WSSH 2ESTE 2ZDAH 3ZV9A 1IQIA 1O2UA 1C5NH 3O8BA 1OOKB 3ZIAD 5LPRA 5K7RA 1AHTH 1TX8A 4AN7A 1C2FA 3SNEA 2ZTYA 3O8RA 3HK6B 3UPEA 2SGQE 3P6ZB 1CE5A 5F8XA 5J4QA 2WINI 2W3KA 2WPDD 1P9UA 1SGRE 3Q3XA 1GBAA 1TPSA 1CU1A 1O2TA 5EQQA 2PKAB 1A0HB 4XBCA 3RXSA 1OP8A 4B76A 1W12U 5HYOA 1LHCH 2BLWA 4R8TB 1DSTA 1UTMA 2F9VA 1ZTKA 1LHEH 2QGRA 4BANB 4B6FA 2OUAA 2V35A 4K60A 4P02A 2Y80A 2A2QH 1S85A 4FU8A 4J2YB 3DFLA 2H9TH 4HI3A 2YNBA 5G4BA 1AY6H 1T32A 3M7UA 2H2ZA 2BD4A 4GHQA 3MU4A 1LMWB 1HAHH 1A0LA 3LGIA 4FVBA 4Y8ZA 5FPSA 2EA3A 4AFZA 4AFQA 1WQSA 3A82A 3LGTA 3EYDA 4OS4A 3U1IB 1C1NA 2ZIQH 5ABWA 2FX6A 3V12A 2Q6DA 3URCA 1J16A 1SGIB 1K1PA 1P11E 1BTUA 1C5LH 3RXAA 1TIOA 1S82A 2W26A 3T27A 2ZU3A 2XYAA 3QTOH 1ZLRA 2ZCHP 3GS9A 1YF4A 3R3GB 3OTPA 1C9TA 1O30A 2HGTH 2IPQX 1S6FA 4CBNA 3TU7H 2BZ6H 3GCNA 4FETA 4B2AA 3ZVFA 5FAHA 1O2ZA 3O8DA 5JBAS 1KXDA 1FUJA 5KEDA 3SU1A 1HJAC 1FLEE 4Y7AA 2GTBA 3H5CB 2A31A 1MKXH 4A1VA 4DT7B 4YT7H 1J15A 1V6DA 3WW7A 1AFEH 2XNIA 3KIDU 1DY9A 3RLYH 4BTIB 3S9CA 1ZHRA 1O5DH 1N1LA 3RXIA 3OAAD 2J98B 1ANCA 2RA3A 1ABJH 4INLA 1D3DB 2OQ5A 2R3UA 3M5MA 1ESAA 3A87A 3SV7A 1P57B 1O3PB 3KQEA 3RMNH 2VJ1A 1CBWB 1LPKB 4B75A 2OP9A 1Y8TA 3PYHA 2XBVA 4AFSA 1TX7A 1GI0A 4MNWA 2L74A 1K28D 4ABAA 1OSSA 1C2JA 2GJGA 4MPWA 3OEED 3ATWA 1GBDA 1TOMH 1GBTA 1GJ6A 1BITA 1K0HA 1P2OA 3RXVA 3QZQA 2H5CA 3KYGA 1O3AA 1H9HE 2WUBA 1NT1A 4NSVA 4K1TA 3ZZ4A 2A2XH 2TPIZ 2ZFQH 3SU5A 3W94A 1ELCA 3M7TA 2FEQH 4ABIA 1YLNA 1W0YH 2PLXA 1DXPA 3UTUH 1EZUC 4HFPB 4XSKU 1PPCE 3Q77A 2XW9A 3FFGA 1O2YA 3D65E 5TJXA 2L6OA 4CREA 3A85A 2F9UA 1UO6A 1JIMA 2HVYB 1Q31A 2GMTB 1GJAB 2XBWA 1SBWA 5LPEA 4H6SB 3AVZA 3FOAA 1WQVH 1HLTH 1SG8B 4VGCB 5FPTA 2BHGA 3I29A 4FUJA 1W10U 1P02A 4WY3A 3ZZ7A 2ZTZA 8LPRA 3NUMA 5SGAE 1AQ7A 1SI5H 3HGNA 2ZHDA 2BDHA 2BOHB 1CGJE 4NIWA 4QT8C 4ABEA 3RXUA 1LPGB 8GCHF 4NWKA 2HPQH 2JETB 3E3TA 1UVPA 3LJJA 4UONA 3P8OA 4UFEH 1KDQB 3ENSB 2H9HA 2ALPA 2BDBA 1Q2WA 1TX6A 2BQ7B 1OWKA 3SNAA 1LQDB 5AF9H 1BBRH 1GL1A 1QJ1B 4FVDA 1SKYE 3UQVA 1GJ9B 1AVXA 3UIRA 3SNDA 1ID5H 2Z3DA 3ATMA 4D8NA 5C2ZA 1TMTH 3U8TH 2Q1JA 1XX9A 2PUXB 3F6UH 3I78A 2Y5GA 1E34B 1TRNA 3FANA 3HGPA 1AU8A 1TGBA 1NESE 1BTHH 3BIVH 1DICA 3RC5A 4X2XA 4K69A 3PO1C 3T29A 1LDTT 2FDAA 1WDIA 4CH8B 2J97A 2TGAA 4XD7D 4F49A 4AC9A 1Y5BT 1Z71A 2A7JA 3FP6E 3SORA 1HV7A 1C1SA 1C1MA 3SJOA 3EA9A 1ARBA 3BF6H 3D62A 1SQAA 2FOAA 4CHAC 1NN6A 1S0QA 1SSXA 1GBEA 1PPBH 4D9RA 1EP5A 3KGPA 2BX4A 2O9QA 6ESTA 4Y0YE 3KEEA 4UDWH 5PTPA 5HKKD 3FAOA 1F5RA 4MG3A 2QC2A 4AGJA 2Z94A 1SGYE 3UNRA 4Z0KA 5F8TA 5GCHF 1ZPCA 4E05H 2W7SA 1YWUA 1V2UT 4UEHH 1P3EA 1PJPA 3TK9A 1T31A 1VZQH 1ELBA 4B2CA 3PRDA 3B8JA 2AMPA 2GDEH 2BVRH 4WF8A 3UUZA 1FV9A 1A1RA 1O2LA 2C8ZB 3MOCA 2VVVA 3N7DA 5JYIA 3AK5A 1SL3A 1L4ZA 1F0UA 2VWNA 5EXLA 5I46H 3AAUA 4FUBA 1QCPA 3F2GA 3T28A 1ZTJA 5GXPA 4WH6A 1QZ8A 2FM2A 4Q7XA 2QCYA 3TH3H 5CHAB 5DG6A 2RDEA 1IQLA 1UK2A 2ODYB 3MWIU 2VVUA 1S83A 1ELFA 4DGJA 2AGGX 3N99A 2UWLA 1L1GA 3K6ZA 1NFXA 1A0JA 1NZQH 2A45B 1GG6C 1AIXH 1GHXH 2AEIH 2HVXA 4J1YA 1OX1A 2UUKB 1FIZA 2FOMB 1C2LA 3G01A 4Y79A 1NBME 1G32B 1J8AA 3GY3A 2O8MA 4H6TA 4NFFA 1GJ7B 1SLWB 2J5UA 3GCHC 3RU4D 2PSYA 4ISNA 1ANDA 3SU2A 3SV9A 1BCUH 1VJ9U 2P3TB 1LHDH 4Y71A 2BVXH 2CF8H 3SGAE 1UK4A 3PV5A 4YLQH 2HNTC 3MH4A 5C3NA 2ZQ1A 1GMHF 3GY5A 4JMYA 1NBMD 2WYJA 1NFUA 1A5IA 3QO6A 4IN2A 1AFQC 1IQFA 1NM6A 1GBHA 2NU0E 4WWYA 2WV4A 1HXEH 5A8YA 1C1TA 2PW8H 3NZIA 2XC0A 3SZEA 1UTKA 2A7HA 2Z9LA 4NA7A 1DE7H 5JDUB 1H8DH 1FMGA 3P8FA 2FXRA 4NWLA 2K1QA 1T4VH 4LZ1H 1GI1A 4YXWD 2FI4E 2V3OH 2IOTA 1ETSH 2EEKA 1MQ5A 1YPHC 3KHVA 1MQ6A 3UY9A 4XE4A 3TGJE 1RD3B 1GDNA 1GJBB 1XXFA 1W2KH 4B73A 5F53A 3BTGE 4KKDA 1KXBA 4FUIA 4X0WU 2AMDA 1TPOA 3RXJA 1U6QA 3BTQE 3V3MA 5T6GA 1A3EH 1IQJA 1OP0A 3P8GA 4E7NA 1GBBA 2D1JA 2P95A 4JCNA 1GCDA 2ZDVH 1GHBF 1RIWC 1INCA 2ZFFH 1JXPA 2ZFTA 4DIHH 3SU0A 1LHGH 3BV9B 5GPIB 1ZHMA 3Q76A 2SNVA 2WPIS 2ZDMA 2YMSC 4U01A 1SGPE 1O0DH 3F0OA 3RXQA 1VGCC 4OGXA 3BTEE 1O5AB 1UTJA 5C1XA 3K2UA 1AUJA 3IWMA 4CRDA 2J92A 2O8LA 1K1MA 2OC7A 1EQ9A 1EOJA 1ZOMA 4ABDA 1W7XH 3RC4A 3RMLH 3VB6A 2BDYA 4IC5A 4D7GA 4TSFD 2VH0A 2G81E 4BAOB 4CR9A 1GWAA 1SHHB 1CA8B 3C1KA 5ESBA 1KXEA 1WOFA 2FTMA 2O8TA 4YT6H 4I8JA 2RG3A 1C5RA 2G5NA 4K8BA 1C2EA 3KCGH 3UB0A 1FAXA 2AGEX 1GVZA 4K1EA 5T6FA 4INHA 1BJUA 1SMFE 1BRBE 4NGAH 4X2YA 4CRGA 4ZKSU 2FX4A 2XBXA 2FP7B 3PWBA 1ELEE 2J4IA 3MO9A 2C3SA 2R9PA 4OS1A 1TYNA 1TBRH 1SGQE 2NU3E 1GJ5H 2FS8A 4ZROA 3BTWE 2P8OC 3LDXH 2GZ8A 4K1SA 2BVSH 2FIRH 1Z8GA 1UJ1A 3F1SB 4B2BA 4R0IA 1HAPH 1BIOA 1DVAH 2ZECA 4MLFB 3STIA 1MABB 2BOKA 1OWEA 2FOHA 3LGYA 1GDUA 1DM4B 4JK6A 3RXCA 1DWEH 1TGTA 1BJVA 1XUGA 2YMSD 3MMGA 5I25A 4I32A 3A7YA 1C2GA 1DWDH 3B9FH 3GOVB 2V3MA 1SB1H 1TPAE 2BY6X 1BOQA 1L0ZA 4SGAE 2B9LA 1QURH 1AVGH 1O3IA 2B0FA 3K65B 3ZVGA 4FUGA 3TK5A 2ZI2H 4ZHMU 1O2NA 2QA9E 4GCHF 5DO4H 4MVNA 3MFJA 3VXEH 5CMXH 1FY4A 4BAQB 1NY22 4DJZB 1SOZA 4P00A 3LKWA 1KTTB 1O2HA 2XNDD 1OXGA 2BD2A 1GBJA 2NU2E 3E16B 2GV7A 4X6NA 4X8UH 2ANYA 1ANBA 2AGIX 3DHKH 3ZZ9A 2LPRA 4TPIZ 1P9SA 3MU1A 1EUFA 2DE8A 1UVUH 2Q6FA 2W5EA 1H4WA 4AB8A 4FUFA 1TNLA 2H5DA 3DT0H 1P2NA 5GDSH 3DUXH 1OYQA 1GL0E 4OS5A 4U32A 1CHGA 1AB9C 2M5TA 1ZSLA 3MH6A 3MU5A 1GI7B 3ZZAA 4NG9H 3QUMP 4CRBA 5FHTA 3F3BA 6CHAB 2GZ9A 4NIYA 1BTZA 2SGAA 4WXVA 1MD8A 5KGOA 2ZP0H 4UFDH 3UQOA 4UFGH 2VU8E 1FPCH 1NFWA 2A32A 4ZKOU 1P05A 4ABHA 1FONA 4GSOA 1DUAA 3FZDA 2WPLS 1G3DA 2J95A 3M3TA 3NPSA 3DFJA 4BNRA 2PFEA 4E06H 5LH8A 2J9NA 1FY5A 1CVWH 1QIXB 2G5VA 2ZG0H 2IJOB 4ABJA 2CHAB 2A5IA 3VGCC 3RUOA 4O97A 2TGDA 5EW2H 1LCYA 4I8LA 1QTFA 1TGNA 2AS9A 2GX4A 2SGDE 2ZPQA 3GY6A 3MYWA 2ANKH 3GY4A 3P92A 1P2MA 3E0NB 3DA9B 2GCTB 1C9PA 2A1DB 4Q2KA 5DP9A 2F9NA 1SOTA 4ZXYH 3T5FH 1O5EH 1T8NA 2GV6A 4X6OA 1DT2A 3BTDE 2XC4A 1OWDA 1HAVA 1CSOE 1MTNB 3D49H 1CO7E 2G4TA 4BTUB 3H7TA 4WMEA 6GCHF 5L30H 1GI8B 5DP7A 2XOKD 4I8HA 3SZNA 2HLCA 3CP7A 3ESTA 4IGDA 1V2PT 2VVCA 1GJ4H 4Z1MD 1GCTC 3FO8D 7LPRA 1SGCA 2RFKC 1C2MA 3MNSA 2PTNA 3GICB 1ZJDA 3S0NA 1C5TA 3A88A 4Q63A 1O39A 1IQEA 2F91A 3SV2H 3RMOH 1YPEH 3IITA 1MTUA 1DOJA 2ZEBA 3DSGA 5E0JA 1J14A 1W3CA 1K1NA 2J38A 2C93B 1MTSA 1GBKA 5AFYH 3RXFA 1A3BH 1LPZB 1MAXA 4JZ1A 3F9HA 1G30B 1NRSH 1O38A 3LONA 3MQKC 1BRCE 1FN8A 1Y3VA 1BBRK 1BA8B 1A7SA 4ESTE 5A8ZA 3F9GA 5GIBA 1UTOA 2AHME 1TOCB 1P03A 4GUXA 1O2QA 3SGQE 1G3BA 2CXVA 1AGJA 1FQ3A 1QRZA 1VITG 4X1RU 1AZ8A 5T3HA 1COWD 5L2YH 1C5VA 1IHTH 5C20A 2FTLE 5EJLA 1GHAG 2V3HH 1UK3A 4X8TH 4X8SH 3KQ5A 1EAXA 4OGYA 1ZMLA 1TNGA 4I7YH 1BMFD 3CNRA 3Q3KA 1EX3A 1W14U 3PLKA 2J94A 3ATKA 3PTBA 3TH4H 1CA0B 2ZNKH 3OFND 7KMEH 3GCTG 4CBOA 1LVYA 1TMUH 3SN8A 3RXGA 4ZMAH 1DXWA 3U1JB 2KCYA 5B6OA 1GI9B 2WYGA 2ZGBH 1NU7B 3AAVA 5EXNA 1A4WH 4AFUA 4DY7B 1UW7A 2UUFB 1ZR0A 3LU9B 1YYY1 2Y5HA 3JZ1B 1XUFA 1G2MA 1WTHD 2OBQA 1LKAA 1V2WT 1G3CA 1O3NA 1C2DA 3R0FA 1EJMA 1GJCB 5EU8A 1MKWK 3ELAH 5AHGH 2H6MA 1F5LA 2ZCKP 1O3EA 4XFQA
chains in the Genus database with same CATH topology
3F68H 3FP7E 1QB1A 5GJ4B 1XVOA 8KME2 1YCPH 3O8CA 5C5OA 1QJ6B 1TPPA 2PR3A 2ALVA 4IW4E 2HWLB 1XUIA 4YLUA 3ZV8A 4H4FA 1VCPA 3GISB 1K1LA 1A5GH 3ZVAA 1QFKH 1WU1A 2STBE 5L2ZH 4FXGH 3RXKA 2BB4A 2JKHA 4U30A 3V7TA 1O36A 1RS0A 2ANMH 1HAXB 3HPTB 4I8GA 4HGCA 4TY6A 4RSPA 5DP8A 1BUIA 1BB0B 1D3PB 3UREA 2GT7A 1OP2A 3UFAA 1EAUA 1O2VA 3E8LA 4BAMB 4DW2U 3A8BA 4DVAU 1Z1IA 4NA8A 1NS3A 1TQ0B 1O2IA 1UCYE 4BAHB 2QV1A 1YC0A 1ZPZA 1P3CA 1SPJA 1G37A 2JH0D 3SUEA 1C2HA 1GBMA 2UUJB 1FI8A 1QJ7B 2ZHEH 1ELTA 3A8DA 2PSXA 4AZ2B 2FWWA 3P8NA 2D26C 4UFFH 1H9IE 2ZF0H 1JIRA 3BSQA 1KTSB 3SQHE 3SI3H 3PLBA 1O5BB 3A8AA 2AYWA 1V3XA 2ZQ2A 2GT8A 2BDIA 3Q3YA 2OQUA 5FX5A 2PUQH 1V2MT 3SU6A 3UOUA 3KQCA 3QK1A 1UHBA 2A5KA 1UMAH 1IQNA 4LK4A 2NU1E 2GVFA 4Y76A 3OY6U 1BMNH 2CV3A 1XXDA 4TY7A 4ZXXH 5A2MH 1FDPA 1ELGA 1MH0A 1VR1H 2ZHQH 3LGWA 3U8RH 5JBCS 1N8OB 3ITIA 1P0SH 1PQAA 2TBSA 4LOYH 3MI4A 4TWYA 1UVOA 1Z8JB 1O2PA 1OPHB 4BXWA 1F5KU 1E0FD 1C1UH 1RJXB 4CRCA 4D7FA 2ZU1A 1FY8E 1VITF 3ZZCA 4SGBE 1VCWA 4NZQA 1ZSKA 3VB4A 1C5WB 1S5SA 1FIWA 3PMBB 2VIDA 4ZHAA 1GI3A 5E2PA 1O37A 3RXDA 4CR5A 1XKBC 1SHYA 2O8WA 1GHAF 5FPYA 4BXSA 2CHAC 4NZLA 4MPUA 1S84A 2ZDNA 1O2GH 2FYQA 3OYPA 2BTCE 2C8YB 3PMJA 2OC0A 1V2TT 3PWCA 1EPTB 1WUNH 4IS5A 1HJ8A 1O3BA 1B5GH 1DLEA 1DWBH 1K9OE 1YKTA 3BN9A 3GDSA 4I8KA 2BLQA 1HAOH 2HRVA 1GGDB 2GCTC 1QBNA 1OWIA 1O32A 3KN2A 1F0RA 5HM9A 2QXJA 3ODDA 4TYDA 3E0PB 2BD7A 2VINA 3UWIA 3GY7A 3F9EA 1GMCG 3SNBA 1PQ7A 2J34A 1GHWH 1MTNC 4ISIH 3VPKA 3M5LA 3KL6A 4NA9H 1HXFH 1ZHPA 2QIQA 2R2WU 1LQEA 3A84A 3AW0A 2SFAA 2P94A 1NROH 2PGBB 1GMDG 3UR9A 5FCRA 1C5QA 1YGCH 2C8XB 2VWMA 2Z3EA 1E36B 1LVBA 2J2UA 2OINA 3LH1A 1RRKA 1WAYB 1Y3WA 4XOJA 1LTOA 3RU4E 2BM2A 1O2SA 1AN1E 1S0RA 1DPOA 3MTYA 3BTKE 1TGSZ 1MD7A 1HAVB 1ETRH 3A81A 3OY5U 1X7AC 2JH6D 1HYLA 2F9BH 1P10A 1Y5UT 1O5FH 1TB6H 1PPZA 1BDAA 1GBIA 4YO9A 1GJ8B 4WXIA 4YZUA 1TE0A 2PGQB 1MZAA 5JBTA 1XUHA 4NSYA 2RCEA 3ZZ3A 1GBCA 4NIVA 2GGVB 3LC3A 2BDGA 3I77A 2C4FH 4KP0A 1HIAA 1UTLM 5AFZH 5T6DA 1MBMA 3RMMH 2Y7ZA 3NWUA 3QWCH 2BY5X 1V2OT 4MNYA 1XKAC 2EI8A 2WV5A 1KYNA 1YM0A 1BMAA 4AYYB 1HCGA 1W11U 2ZGXH 2TGTA 3MU8A 2CGAA 3RXTA 1O2OA 1YPKH 4WMDA 2I6QA 3EE0B 3MHWU 1DANH 2VB0A 1QL7A 1O3MA 1KLJH 3MU0A 1CA0C 2FODA 2FI3E 3STJA 1YPJH 1Z8IB 4Y7BA 1T8LA 3ZYEA 1QRXA 3U8OH 4D76A 2Y82A 1LKBA 1V2ST 3MNCA 3NK8A 1MMJN 3OTJE 2FOCA 1XM1A 3MNXA 1CBWC 1W0ZU 3A80A 2BQ6B 1AE8H 4OS2A 4ISOA 4WH8A 3V13A 3EAJA 3GDVA 4Y6DA 3EA8A 2HNTE 2SNWA 1ANEA 1IAUA 4LZ4B 4BAKB 2VIVA 1TWXB 3RXMA 1RTFB 4ABFA 5ETXA 1IHSH 1A61H 1CT0E 4MDSA 4X6PA 3AASA 1HJAB 1NPMA 1P09A 4JYUH 4X1SU 5E0GA 2B7DH 3RM2H 1RGQA 1C1QA 4NFEA 1GHVH 1JBUH 4YM9A 2ASUB 2TRMA 3SO3A 4ZH8A 1C5MD 1Y5AT 4Q80A 2GZ7A 2V6NA 1YPHE 4X2VA 4DG4A 4PROA 3SOSA 3SHCH 1C1VH 5FCKA 1ZZZA 9LPRA 1M9UA 2O8UA 1TA6A 4A1XA 2GMTC 3KF2A 5HMAA 5DP4A 3SUDA 1HB0B 1V2LT 1O3FA 4VGCC 3PMAB 1EZSC 3ZZDA 1SLVB 1O2WA 3S9AA 1BBRE 1XUJA 1GMCF 1JRTA 1O3HA 1XVMA 1O2JA 2FO9A 2JETC 3M35A 5EOKA 4WJG2 1O2KA 1PPEE 1GMDF 3TK6A 1PPGE 4IBLH 1HRTH 1YCPM 1IQGA 2QXIA 2ZO3H 4ISLA 2B8OH 1TRMA 2XCNA 3SW2B 1EATA 3QGNB 4Y10E 4U2WA 4CRFA 4X2WA 1KLTA 1Q3XA 1DY8A 1TONA 2Z3CA 1Y3UA 3FZZA 1O3DA 1E37B 3RXHA 1JWTA 4X6MA 1TA2A 4WMFA 4JK5A 1KLIH 2Q6GA 1P2JA 1B0EA 1A2CH 1J9CH 1PPFE 3RXLA 4B71A 5TCCA 2ULLA 2HPPH 2OTVA 1KIGH 2BD5A 1D3QB 1NU9A 5DPAA 2G55A 2XRCA 2XC5A 1H8IH 1UHBB 3TVJB 1EAWA 1CT4E 5F03A 3DD2H 1EJAA 3ZVBA 1MKXK 1O5CB 4NIXA 3ZZ8A 1HPGA 2KAIA 1C5PA 1YBWA 1NO9H 2CF9H 2NWNA 4YOIA 8ESTE 2DE9A 4UE7H 1UCYH 1Y3XA 3RXOA 1SGEE 1WV7H 2Y5FA 4ABBA 3LOXA 1EPTC 2QXGA 2V0BA 5HM2A 2VGCB 3IG6B 2PKSB 1C5UA 3QLPH 1EOLA 3NKKA 3M36A 3H7OA 2SGPE 2OXSA 2WUCA 3LGVA 3CENA 3BTFE 1QL9A 1Z8RA 1L1NA 1L4DA 2G51A 3T2NA 1O3LA 2R0KA 3UNSA 4H42U 2ZWLH 2STAE 4O9VA 2QYIA 1WBGB 3OSYA 4UD9H 1FPHH 1UTPA 3A7VA 1OWHA 5CHAC 2W7UA 2F3CE 3VXFH 2ZU2A 1ZRBA 1BTXA 1UTQA 4YESB 3P70B 2BD8A 2H1UA 1YCPK 3A7XA 3AW1A 3KQDA 1HBTH 1BMLA 2ZGHA 3TITA 1B0FA 1SR5C 5J4SA 1AWHB 2G00A 3HK3B 4CHAB 3N7OA 3UOPA 4E7RG 1O33A 1KXCA 1C5XB 3UR6A 1Z7KA 2VIPA 1D9IA 5C1YA 1EAIA 1F7ZA 2GD4B 3JZ2B 3TIUA 2QF3A 9ESTA 5EGMA 2ZFRH 3K9XB 4XBDA 2B5TB 1PYTC 5A09A 2P59A 2FOFA 1J17T 1DLKB 4HZHA 1SLUB 1A5HA 1TFXA 3VEQB 2P3UB 2FMJA 1MAYA 1C1WH 5EODA 1EJNA 5DK1A 3SUFA 1DX5M 1G9IE 3ATLA 1MBQA 3SJ8A 4YOGA 5ESTE 8GCHG 2YOLA 1TBQH 1VJAU 3CS7A 3SUGA 3UNQA 1QHRB 3PV4A 3VB5A 1QRWA 2XXLA 2ZU5A 3LC5A 4MTBA 4NCYA 5DP6A 1THPB 3D23A 1YPLH 4KTUA 1SGNE 1HIAB 4FUEA 4X8VH 1ZPBA 2F9PA 1ZTLA 1SGFG 3VB3A 2VIWA 1GG6B 1IQHA 1GHZA 2OC1A 4OS6A 1XUKA 5LGOA 1ESTA 4FU9A 2AH4X 2NU4E 2ZFSA 3GCHB 1H1BA 2D2DA 2BZAA 1LVOA 6LPRA 5EXMA 1G3EA 3E91A 1TQ7B 1BHXF 1WCZA 2TIOA 2FPZA 1Y3YA 5E2OA 1HGTH 2P93A 1BZXE 1AFQB 1FNIA 4ZHLU 1TALA 1C4V2 1HDTH 1CGIE 1UVSH 2G4UA 2XCFA 2RA0A 2BLOA 4DOQA 2EC9H 1PYTD 1SQTA 1HAYB 3FVFB 5FBIA 3RDZA 3TGIE 1RFNA 4X1NU 5C5NA 4KTCA 2AIPA 3MO6A 1ELDE 2C8WB 5A0CA 1G36A 2ZTXA 1BTWA 1TNJA 5GCHG 4ZAEA 3T62A 3ZYDA 1FY3A 5IYTA 5EW1H 1NFYA 1O2RA 1O31A 1NRPH 5EG4A 4IMZA 1E38B 2UUYA 4AX9H 3QX5H 1P2KA 1PQ5A 3SGBE 3RP2A 1ZMNA 4JZFH 3S9BA 3T26A 2WPKS 1K1JA 2Z9GA 3GCOA 1BTPA 2CN0H 1Z6JH 3CS0A 1RIWB 2ZC9H 1YPMH 1QB6A 2ODPA 1AO5A 1V2RT 1QL8A 4MNVA 3RXPA 1TAWA 3NXPA 4O3UA 1SC8U 3UWJH 4AB9A 2GDDA 1HNEE 3URDA 1W7GH 2BD3A 1NRNH 1VGCB 7ESTE 3M5NA 1FJSA 3W95A 2ZPRA 4LXBH 3EGKH 1EXFA 1YPGH 1QQUA 1KSNA 1PFXC 4IN1A 2Y7XA 3MH7A 1QY6A 1VITH 3KQBA 2C90B 1RTKA 1N6YA 1OWJA 1FY1A 1WTGH 1YP9A 1NRQH 3BEUA 1QGFA 3QTVH 4ISHH 4X1PU 1IOEA 5A0BA 1O3JA 3QZRA 3SU3A 2FOBA 2FESH 1D3TB 2I6SA 2DUCA 3T25A 1GMHG 1DDJA 1ORFA 2XWAA 1GI2A 2BDCA 2ZPSA 4FU7A 5L6NH 4AG2A 2QXHA 2HOBA 2TGPZ 1BRUP 2PV9B 1MU8B 4Y0ZE 1SQOA 2ILNA 4CH2B 1DFPA 4RKOB 4ABGA 3KNXA 2BXUH 4JZIA 3BTTE 2ZGCA 1T8MA 2ODQA 4JYVH 1SGTA 3SJ9A 5GWZA 2P8OB 2Z6BD 1HAZB 1THRH 3L6PA 2GKVE 5DP5A 3P17H 2OD3B 3SV6A 1Z1JA 2BLVA 3Q00A 1ZJKA 1FXYA 3M3VA 1EASA 1P8VC 5F6MA 1P2IA 4Z6AH 3U9AH 1AUTC 4MPVA 4I33A 1GI5A 3A7WA 5CE1A 1CQQA 1OKXA 2ZKSA 6CHAC 1TBZH 2VGCC 2PKSC 1JRSA 1C5OH 3M7QA 1QA0A 2ANWA 1ELVA 3RC6A 1CT2E 3RXEA 1ETTH 2XTTB 4WVPE 2SGEE 3BG4B 2KAIB 1GHBG 3TH2H 1AKSA 2OC8A 1ELAA 2YNAA 1TNHA 3A8CA 4JYTA 4YTAA 3GDUA 2AFQB 3ZVDA 1UTNA 2HNTF 5HXFA 1O35A 3BTME 1V2JT 1UVTH 5DP3A 1HUTH 3E6PH 1V2VT 3ZVCA 1AD8H 1EZQA 1F0TA 1ARCA 2PTCE 2ZHWH 4IMQA 1SLXB 4A1TA 1GHYH 1C4U2 3VFEA 1O34A 1ACBE 5BPEA 1W13U 1JOUB 4F4OC 1K1OA 3TLOA 1DWCH 3GCTF 1FAKH 1LHFH 4Y8YA 2VH6A 5LPFA 1P01A 2R0LA 3ZZBA 2PWXA 1D6RA 1AB9B 3RLWH 1ZSJA 1GDQA 3M5OA 1CHOG 1DITH 1AVWA 7GCHG 2G8TA 2VIOA 1HFDA 4ZUHA 1DS2E 1C4Y2 1MKWH 4CRAA 3SI4H 1FN6A 4KGAA 1N6XA 3PLPA 2Z9IA 3HKJB 4AGKA 1CGHA 1K2I1 2FS9A 3BIUH 1B7XB 2VNTA 2ZCLP 4GPGA 1V2NT 3C27B 1C2IA 4X1QU 2W3IA 1QBVH 3SNCA 1EB1H 2BQWB 3GY8A 5F8ZA 3SQEE 1YLCA 3BTHE 3L33A 1ZGVA 5EQSA 2AERH 1LVMA 1TNKA 2PKAA 1C5YB 4XDEA 5H4IB 2AMQA 2BD9A 5K0HA 2F9OA 2XWBI 3V0XA 3SU4A 3VGCB 1VCQA 2FOEA 3QDZB 4OS7A 2BMGB 5HGGA 4RN6A 1NTPA 5DGJA 1GI4A 1QBOA 1QR3E 1HAIH 1ZGIA 1NRRH 3MNBA 2VWLA 5EQRA 1K21H 4ZKNU 1C5ZB 2EI7A 4MPXA 1HAGE 5JB9S 1GBFA 1MTVA 2BX3A 2ZA5A 4K8YA 2QF0A 1AMHA 2ZDKA 3BG8A 5A0AE 1QB9A 4GHTA 3TNTA 4GCHG 1KXAA 3TGKE 4B1TA 1KXFA 1SGFA 1BMMH 4AYVB 3L3TA 3LJOA 2IPHA 3B23B 1E35B 1QNJA 2BY8X 1S6HA 1O2XA 1GCTB 1GBLA 2CMYA 2WPMS 1C5SA 3A7TA 3GYMA 1EP6A 1GI6A 2A4GA 2BY9X 3QGJA 1GPZA 1P12E 1F92A 1V2QT 2QAAA 4MNXA 4JZDH 3SBKA 5A8XA 1IQMA 2VIQA 1W8BH 1C1PA 2GCHG 1ZMJA 3SJIA 1MTWA 3LIWA 4ZKRU 2Z7FE 2WPHS 5TCAA 2QY0B 3S7KB 3GYLB 1MUEB 5AVDA 3LGUA 3EDXB 3ODFA 3WY8A 2R3YA 1FZZA 1PQ8A 1UCYK 1L2EA 4K3JA 2BDAA 1AI8H 3PTNA 3S69A 1MZDA 5E0HA 3NCLA 3QN7A 5DKMA 4KTSA 4O03A 1K22H 3LH3A 3RXBA 1EKBB 4Q7ZA 2THFB 3P95A 2ZGJA 4INKA 2BXTH 2WPJS 2ZFPH 3PROA 2GP9B 5JPMH 1O3CA 4IC6A 1PPHE 1ABIH 1QA7A 2FZZA 4FUCA 4AORA 2FLRH 2P3FH 4DCDA 1WYKA 4THNH 1Z6EA 2G52A 2Z9JA 4DIIH 2SGFE 4K2YA 5EPYA 3ATIA 1OS8A 1O5GH 2A5AA 1AE5A 3ZZ5A 3TPIZ 2HALA 3U69H 2LNCA 3A83A 1D4PB 2VWOA 3HATH 2EI6A 4Y11E 1SVPA 1LO6A 1SFIA 3U98H 1TABE 2A4RA 2Y6TA 2ZHFH 3M61U 1C1RA 1GVLA 3LPRA 4YOJA