1W11U

Urokinase type plasminogen activator
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w11U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w11U01
3MH5A 4CR9A 3A7ZA 5FXLA 4F49A 1H8DH 1GI3A 4Y71A 3LKWA 2A4RA 1SGTA 5EW2H 2BXUH 1FAKH 4X6MA 1SFIA 1AHTH 3SGBE 4WH8A 2G51A 4ZXXH 3VGCB 1GI5A 2BD5A 4NA9H 1TAWA 4Q80A 1ETTH 1C2MA 2VNTA 2ZHFH 1YPEH 3SHAH 2W3KA 2ZDLA 4O3UA 3D49H 5AFYH 1AB9B 1BTYA 3NKKA 3ZZ7A 1OWIA 4DIHH 1ZYOA 2H2ZA 1O5BB 3SORA 4CRAA 1GMCF 3ZZAA 3U8OH 4K1EA 1YPLH 1ZR0A 5EQRA 4JK5A 5DP9A 1ESBA 2ODQA 3A7XA 2AERH 3PWBA 3F6UH 1P0SH 2GT7A 4ZHLU 1A46H 4BTTB 1ESAA 4B2CA 2HOBA 1P10A 3E90B 1GBIA 2B0FA 2GMTC 1L1JA 1G30B 1QY6A 1GBAA 2WV4A 1VGCB 1O2UA 2BDAA 1C5VA 1YYY1 5F03A 3ZZ3A 3BF6H 3SW2B 1N1LA 1KYNA 2ZU1A 8GCHG 1A3BH 9LPRA 5HXFA 3T26A 1ABIH 2BY6X 2I6QA 2ZDMA 3RLWH 4Y11E 1QRWA 1SHYA 2ZFQH 5EQSA 3A88A 4KTSA 4NA8A 1GL0E 1SC8U 3FP7E 2WPLS 4I8GA 4O97A 1XX9A 4BAKB 3SJ9A 2ZEBA 2FTLE 1C5NH 1DWDH 3GISB 2Z9KA 1AO5A 1P9UA 7GCHF 1ELGA 1F0UA 1NROH 1W7GH 4JZ1A 1DSUA 4MDSA 3O8CA 3UFAA 1TNIA 4I33A 2CHAC 6GCHG 4X2WA 5E0JA 1EZXC 1GJ5H 1DUEA 1KTSB 2GTBA 2ZA5A 3TVJB 4TPYA 2VWMA 3F9FA 4Q7ZA 2ZTYA 1O2KA 2NU1E 4FU8A 2PKAA 2VVVA 1NT1A 2YNBA 3P17H 1K22H 1GCDA 3O8BA 1PPFE 1FI8A 3MWIU 1KXBA 1NFWA 1RRKA 2XWAA 1Y5BT 1GDNA 1C1SA 3EQ0H 2HALA 4RN6A 5F6MA 4NIYA 1PPHE 2CXVA 3PROA 3PYHA 2M5TA 1O2LA 4NFFA 3RC4A 1CQQA 1ELBA 1QRXA 3OYPA 1NFXA 2AGGX 2ZHWH 2LNCA 3EA9A 3LGVA 3A86A 2G55A 1A4WH 1YPHE 1FN6A 1MD8A 4ABFA 3E91A 4AX9H 5A0BA 3F9GA 2AFQB 5EXNA 1G3EA 3VPKA 1NN6A 1YCPM 1TNGA 3PLBA 5ABWA 3BIUH 3ZZ5A 1Z1IA 2GT8A 1O3LA 1GJ4H 3U1JB 3BTGE 1P01A 2BD7A 1C5RA 4ABGA 4K2YA 1V2QT 2CJIA 2Z7FE 1HBTH 1BHXB 1AWHB 1D3DB 2QY0B 3M7UA 1TRNA 5EW1H 1E36B 1TX6A 1YPGH 3MHWU 1EUFA 2QV1A 3U8TH 2RA0A 3RXSA 1UVOA 1V2NT 4AYYB 3QX5H 1TX8A 1XVMA 1XKBC 4K60A 5TJXA 3RU4T 1SGFG 1J15A 2QGRA 2W7SA 1XVOA 3KCGH 1SLXB 1DDJA 2FOEA 3PO1B 1J9CH 4I8KA 1O33A 1RFNA 1GBKA 3FP8E 1NRRH 4YOGA 2BOHB 1EAUA 3MO6A 5EPYA 1GG6B 2DE8A 4WXIA 1DFPA 4BANB 3I29A 3WY8A 1O3GA 4DGJA 1HAOH 4WVPE 3VGCC 5LPEA 3C1KA 2VJ1A 1SQTA 1UTOA 3HKJB 1THSH 3M5LA 1E37B 1ZRBA 1LVMA 4UEHH 4MPUA 3STIA 4Z6AH 3LU9B 1M9UA 3MMGA 1BTXA 2FTMA 2BD8A 1BTHH 4E05H 1ARBA 2VVCA 1WU1A 2EI8A 1AVWA 3H7TA 3SQEE 1S83A 3ATLA 4CRCA 1ETSH 1OWJA 3ELAH 3F68H 3MU1A 2JH5D 1KIGH 1ZPZA 3MNCA 3VXFH 4ESTE 3QGJA 1GPZA 1WV7H 4PROA 4FUEA 3MNSA 3T25A 2XXLA 5DP6A 4JMYA 1SLWB 5FHTA 1O39A 5ESBA 3F9HA 2XW9A 3AAVA 3VB6A 1EATA 3GCNA 2HNTC 3EGKH 2PKSB 2Y7XA 5JBBS 1TBQH 3ZZ4A 5LPFA 2ZECA 1EJAA 3U69H 2CF9H 4DY7B 4B2AA 1OKXA 8KME2 3BTKE 1VJAU 1HNEE 3QDZB 5DPAA 5FCKA 3P8NA 4JZFH 1GVKB 2P8OC 1DUAA 1DOJA 1C5OH 1FONA 2A7CA 1QFKH 1W11U 5GPIB 1RXPA 2ZHQH 1F2SE 2AS9A 4MG3A 1C4Y2 3T27A 4H6TA 1XUIA 3VB7A 4VGCC 4ABEA 4YZUA 1MD7A 1UVUH 1RIWC 2BLOA 1THRH 1S0RA 4X2VA 1O3MA 2FO9A 4IMQA 2H9HA 3RXFA 2UUJB 4IS5A 1C5LH 5FPTA 1VR1H 2HVXA 3TGKE 2GVFA 4X8TH 1GI6A 2WYGA 3MH7A 4Q7YA 1IQKA 1E34B 4X8UH 3U9AH 2QYIA 2VB0A 3EA7A 1C2HA 5DG6A 2FODA 2P3UB 4Y79A 1DLKB 4THNH 3BEFB 4ZKNU 2ZU5A 2PKAB 1V2LT 4ZKSU 2A7HA 3UTUH 1O34A 3PM3A 1FMGA 5HM9A 2ZZUH 1YF4A 2SNWA 1ARCA 1O3OA 1BBRK 1C5ZB 1KY9A 8GCHF 5FBIA 3LGUA 2ZFSA 1HRTH 4IGDA 1P05A 4IN1A 3SUDA 5A0AE 1PPCE 1GMHG 2BY5X 2ZDNA 1CGJE 1P8VC 3EYDA 3SZNA 3ATMA 3SUEA 2OBOA 1O2GH 1NRNH 5E0GA 1O3FA 4X2XA 1YPHC 3L6PA 1WCZA 1DWCH 1UK4A 3QK1A 2FDAA 2G5VA 2I6SA 3RM0H 3TK9A 3ZZ8A 2Y80A 4X1NU 2ZHEH 6GCHF 3GY2A 1RD3B 1CBWB 1AI8H 1UVTH 2RDLA 1T4UH 4ABAA 2WYJA 1MU6B 1SL3A 4XBBA 3PLPA 4A1TA 1F7ZA 1PPEE 3A84A 3ATKA 5LGOA 4MPVA 2BB4A 3QTOH 1LVOA 2FX6A 1TQ7B 2RCEA 2ANMH 5JBCS 3FP6E 1T32A 4QT8C 1O5EH 5HM2A 4I8HA 4E7RG 1O32A 2R0KA 4WF8A 1V2UT 2ZQ1A 2TGAA 3GY3A 7KMEH 1SVPA 3B9FH 4FUIA 3O8RA 1JRSA 1YBWA 1BRBE 2SFAA 1AMHA 4NA7A 5TCAA 1S6FA 1BCUH 3KN2A 3T5FH 4M7GA 4CRGA 1ELDE 2XC4A 3P8OA 2V3OH 4D8NA 1N6XA 4CH2B 3RLYH 3T29A 3ZVEA 1QIXB 4MLFB 5DP8A 1BRCE 1UMAH 1XUJA 2BD4A 1BMAA 2QIQA 5E0HA 2VH0A 1ZJDA 3FZDA 5GWZA 2A45B 4X6OA 1HDTH 3IITA 1ZTLA 1C2JA 1TGNA 2ZKSA 3S7HB 2O9QA 1X7AC 4FUFA 2CV3A 4MTBA 1DY8A 3KQDA 2FM2A 1GMDG 2GMTB 4UFDH 1DM4B 3A7VA 2VIOA 1XXFA 2FOHA 1D4PB 3UREA 3MH6A 3AVZA 2GZ9A 1CSOE 3B8JA 1P2IA 1ZPCA 4OS5A 3ZVBA 1NY22 3ZZCA 1OWDA 1L1NA 1RTLA 3S9AA 1GVLA 1O3IA 1OX1A 4XOJA 1A0LA 1HAXB 3OY5U 2ZDVH 1TNLA 4B2BA 1HXEH 5AF9H 2GCHG 4JCNA 1D3PB 1GGDC 1G3BA 2C93B 3RMNH 2PKSC 2TGPZ 2OCVB 3AAUA 5CHAC 2EEKA 1P11E 2P94A 1W10U 2Y6TA 3M61U 1AKSA 1GJ8B 1K21H 1TA6A 3KHVA 2CHAB 3OY6U 1QNJA 2G5NA 3ZZBA 4AGKA 2FI4E 3E0NB 4Y7AA 4YT6H 1GHXH 2FOGA 4R8TB 2B7DH 3MO3A 4AFQA 1KXFA 4D9QA 3UPEA 4FUBA 1YLDA 4X0WU 1V2MT 3TJNA 3I77A 1L4DA 3RXHA 2OC7A 2O8MA 1S84A 2UUYA 1IHSH 1XUKA 2QXHA 4AZ2B 3RXCA 2BY7X 4JYVH 1YC0A 1MKXK 1S6HA 3NK8A 1H9LB 2NWNA 2VWLA 1GBTA 2PV9B 3TNSA 5T6GA 3GDVA 2AIPA 3C27B 3RU4D 3NZIA 1QQUA 5EGMA 1HAPH 2NU2E 4GAWA 3F9EA 5JB8S 2P59A 3GYLB 4UFFH 2XNIA 2OD3B 2FOCA 3BTEE 4ISOA 1SOZA 1PQ5A 1A5IA 1VITG 3MTYA 4K1TA 1HXFH 2ODYB 1OWEA 1O2XA 3A8AA 3M7TA 4K8BA 5C5OA 1L1GA 1G3CA 2ANKH 4LOYH 3SNDA 1SPJA 3SU2A 1GJ9B 3U1IB 3SBKA 1KXDA 3JZ2B 1HAIH 3M5NA 1P04A 2C90B 3VFEA 1TNKA 2WINI 2P16A 3OTJE 4NIVA 1FY4A 5T6DA 1GDQA 2J38A 1RTFB 1MBMA 1C4V2 3MU8A 1XKAC 1TIOA 2PR3A 4XSKU 4LXBH 1C5MD 3MO9A 1K1OA 1Z71A 3PMHB 4SGAE 3ZZDA 1NM6A 3TGIE 1RGQA 1JBUH 1ZPBA 4UONA 1B0FA 1T4VH 4X1RU 3RXPA 1HYLA 1QURH 1A5HA 1LHCH 2ALVA 2G81E 4NWLA 4FVDA 5ESTE 1UTMA 1CGHA 1HGTH 4DCDA 4INHA 2BOKA 1VCQA 2A32A 3LJOA 5C5NA 1FZZA 1O3JA 2OC8A 3RXLA 1W14U 2BQ6B 2GDEH 1O38A 5ETXA 1KXEA 4UE7H 4ISHH 1WAYB 2EC9H 4ZKRU 2ZF0H 1UO6A 4GCHG 4AB8A 5K0HA 5C1UA 4ABHA 1VJ9U 1GJAB 5J4SA 1QRZA 3SU6A 1O3CA 2TGTA 1LPKB 1GMHF 1LVYA 1FDPA 1K1IA 1SB1H 1XUFA 3E16B 2FOBA 1EASA 1LPGB 4CRDA 1C1QA 1WSSH 4Y7BA 2V35A 1QGFA 3K9XB 1MAYA 3BV9B 1FNIA 4O9VA 3E8LA 1ANDA 3U8RH 4DJZB 3DD2H 1CO7E 1OXGA 3LGIA 4NG9H 3HATH 4DIIH 4LZ4B 2GV6A 3VB4A 1HB0B 3F1SB 1TRMA 3RMLH 3H5CB 2FPZA 1G36A 1NRQH 2AIQA 3UUZA 2ZG0H 1HAVA 2ZHDA 4Y76A 3BEIB 4KKDA 2ZGCA 5L2YH 2Z9JA 1EAWA 4X2YA 4BTIB 3ZYDA 1AUJA 2P8OB 2ZTZA 1BTZA 1DITH 1B5GH 1C2LA 3KQEA 3ZVAA 2ZQ2A 2PUXB 3E3TA 3A7YA 4IW4E 3TH3H 3SNAA 4A6LA 3G01A 1PQAA 1O2SA 3PTNA 2BDHA 4VGCB 2J92A 1RIWB 1PPBH 4MVNA 4ISNA 2D1JA 3SJKA 1AZ8A 1TMTH 2G52A 3M37A 1C1PA 3ZV9A 3RXRA 3A81A 1ESTA 2F83A 1XXDA 2OP9A 2PGQB 2WUCA 5EQQA 2OLGA 4B75A 4TWYA 1KLTA 1TNHA 1AE8H 2P3FH 3RXEA 1G9IE 4MNXA 1AKSB 1TMUH 2EA3A 2WUBA 3SUFA 1ZTJA 1IQEA 1O2NA 4WY3A 3P70B 1YM0A 1C5YB 1AUTC 4BAQB 1GMDF 4AG2A 2IN2A 3A85A 4K1SA 5JB9S 3ESTA 4WMEA 2R2MB 4TPIZ 4Q7XA 1CGIE 4XE4A 4FXGH 1C4U2 2ZDAH 1WTGH 2W5EA 1SGCA 3K65B 3PMJA 1SGDE 2FIRH 3UQVA 1IQLA 1QB9A 1LPZB 2J95A 2AMPA 1BJUA 2G4TA 4UD9H 2GDDA 1O5FH 1MTNC 1SGQE 3GY7A 1UK2A 2GCTC 4B76A 3TH2H 3LGTA 1W2KH 1F0SA 2QAAA 5G4BA 1GWAA 3RXGA 5L6NH 1CHOG 1TX7A 1VITH 4E06H 1OYQA 2FWWA 2P3TB 2FLRH 1SFQB 2BD9A 5FPYA 1GJBB 1G37A 1SLVB 4GLYA 1ZZZA 2J34A 1BBRH 2KAIA 1RTKA 1V2OT 4DOQA 1P12E 2FMJA 4KP0A 1SSXA 2BQWB 5K7RA 1Z8RA 4BXSA 2QC2A 1TRYA 1O2QA 1C5WB 2C8YB 1AZZA 5C3NA 2BVSH 1LHEH 3RXJA 2GD4B 4A5TS 1PYTD 5L2ZH 1MQ6A 3PB1E 5DKMA 1L2EA 1MKWK 5GDSH 1PJPA 3LH3A 5IYTA 5GCHF 3RXIA 1GBFA 1HCGA 1V2ST 5GXPA 3BTQE 4E7NA 3SV6A 1C1RA 2BYAX 2SGEE 4X6PA 1CT0E 1OWKA 2J4IA 2F9BH 4XFQA 2H9EH 3MNBA 1Y3WA 4MNVA 3EAJA 1UVPA 2BQ7B 5EG4A 4D76A 4MQAA 4JZDH 3RDZA 2H6MA 3UWIA 1VITF 5I25A 1C5SA 4OGYA 3SV7A 1K28D 3UY9A 4INKA 2A5KA 4D7GA 2B5TB 3RXBA 3T28A 4CR5A 1CU1A 4A92A 1TOCB 1KXCA 2GZ7A 4DW2U 1NU9A 3Q3YA 1GCTC 3Q76A 5A0CA 3BEUA 1C1WH 2HGTH 1UTJA 3FANA 1P06A 1FN8A 2HWLB 2GX4A 3DFJA 1ZOMA 1J16A 3S7KB 2C8WB 1E35B 2YOLA 2D26C 4TWWA 1O31A 1O3BA 3DA9B 2BDIA 1O2IA 3EE0B 3KL6A 2TRMA 1BA8B 4XDEA 1O3NA 4ABJA 4ZMAH 1CE5A 3HK3B 4K8YA 2ZI2H 4JYUH 4KTCA 1GHAG 2A4GA 1W8BH 5BPEA 1BBRE 2JETC 4Y8YA 1N6YA 1GGDB 1O2TA 4O3TA 2QN5T 1DICA 1BMNH 1O5AB 4X1SU 1O2WA 5JBAS 3L3TA 4H42U 5CHAB 2BZ6H 1MQ5A 3SOSA 3NCLA 1NO9H 4K3JA 3BTTE 2OQUA 1CT4E 2A2QH 4YM9A 2WPIS 2BD2A 4Y8XA 3PMBB 2YNAA 2W7UA 1O30A 1GHVH 1FJSA 4R0IA 1QHRB 1HAVB 1LHDH 2UWPA 1ZSLA 4ZHMU 2OC1A 3S9CA 2GV7A 4GCHF 1FV9A 4ABDA 4DURA 1FY1A 1O3PB 3SU0A 3BG4C 1BTPA 3U98H 1GHWH 1SGFA 1P2MA 1QA0A 1SHHB 1PFXC 3MYWA 1EZUC 1C2IA 4ZHAA 1IQJA 4CRBA 4FUGA 1QR3E 1UTLM 1WQSA 2ZFFH 2WPKS 5HMAA 3LJJA 1V2WT 1SGPE 1LKBA 3DFLA 1BJVA 1PQ7A 1DE7H 3SV8A 4FU7A 4IMZA 3A7WA 4H6SB 8LPRA 2BY9X 1SMFE 4CHAC 1P2QA 3B23B 4XBCA 3LPRA 1GI1A 1ZSJA 1YGCH 5C1XA 4NIWA 2XRCA 1WYKA 3HGNA 1THPB 4B74A 1QQ4A 1P57B 2JKHA 1KTTB 2WPMS 1MKXH 3LH1A 1HAHH 3BTFE 1V2TT 1YPKH 1W0YH 4I8LA 4AFZA 1MTVA 3RC6A 4YTAA 1O3DA 3TLOA 3GCTG 1Y3YA 2OUAA 2XWBI 5AVDA 1A0HB 3PTBA 1ELTA 2Y5GA 1NFUA 1OYTH 2NU3E 2IOTA 3OX7U 4Y8ZA 1N8OC 3MU5A 2SNVA 4TY7A 4UFEH 1HLTH 1BB0B 1HJ8A 4YOJA 4NIXA 2XBYA 4J1YA 3BTHE 3LIWA 2WPJS 4OGXA 2BLVA 4ZXYH 3TK6A 4YT7H 2SGPE 2KAIB 5FCRA 1OSSA 1IQFA 2QXJA 1K2I1 3SU4A 2F3CE 5EU8A 2TIOA 5JYIA 1SG8B 4NFEA 4HZHA 2OTVA 4A1VA 1ZLRA 1C1OA 1FQ3A 1EPTC 4ISIH 4H4FA 1LQDB 3BN9A 1UJ1A 1WQVH 2ULLA 3QO6A 5FAHA 3GDSA 1LCYA 1HPGA 1GVZA 1C1NA 3H7OA 4IC5A 3SV9A 1E38B 3NUMA 4HGCA 3NXPA 1F0TA 1IQIA 1O2VA 3GY8A 1O3EA 1MTUA 1CHOF 3SNEA 3K6YA 1Y3VA 1QL7A 1YPMH 4X8VH 2XYAA 5H4IB 4X6NA 3RMMH 1QL8A 2PW8H 3KEEA 4AOQA 2ZFTA 1LHGH 1FIWA 1UTNA 2PSYA 1KSNA 2STBE 2Q6GA 5J4QA 1G2MA 1TBRH 3UR9A 3GY5A 3PLKA 2PWXA 1GI0A 1BOQA 1C1TA 4AG1A 3SU1A 1A2CH 2VIQA 5AHGH 1A0JA 5GJ4B 1AE5A 4FUHA 1Q3XA 3URDA 1GBBA 1AWFH 1B7XB 2PHBA 1TBZH 4CBOA 1C1MA 3T2NA 2R3UA 2EI6A 1AVXA 4J2YB 2QF0A 1VCPA 1ZHMA 4U32A 1VCWA 1FXYA 1DS2E 3MU0A 4OS7A 5A8XA 2FLBH 1AFEH 2AGEX 1B0EA 1TGSZ 6CHAC 1ANBA 1QBOA 2ZCLP 1UCYK 3SUGA 3QWCH 2O8TA 1P02A 5LH8A 3T62A 1Z7KA 1EAIA 4LK4A 1A7SA 1OS8A 1QL9A 3PV4A 5BRRE 4WXVA 4U2WA 1UHBB 2ZC9H 1C5QA 3RXDA 5CE1A 4DVAU 2BX3A 2ZPSA 1BMMH 1O2MA 2A2XH 1O2JA 1EX3A 1O35A 3M3SA 2A0QB 1LHFH 5DO4H 2ZGXH 1AY6H 4GPGA 4IN2A 2OINA 2JH0D 2TPIZ 2GKVE 2VWOA 2D2DA 4OS6A 2FS9A 4Y6DA 4ISLA 1C9PA 1Z8GA 1SOTA 1GBHA 1Z8JB 1ZSKA 3FVFB 1ELVA 1TQ0B 1BZXE 2R2WU 2Z3CA 3GICB 3MNXA 3A8DA 2PLXA 1CVWH 2FOAA 2UWOA 2GP9B 1V6DA 1G32B 1GHAF 1ELAA 1ETRH 1H9IE 1MTNB 2VVUA 1W13U 4A7IB 2GCTB 1T8NA 1UTPA 3BTDE 3L33A 3MI4A 4GSOA 1ZHRA 3VB5A 2Z3DA 2FZZA 2R3YA 3BTWE 1GBDA 1K1MA 1QBNA 1WBGB 3EA8A 6LPRA 4U01A 2F91A 3TIUA 2HPQH 1DSTA 1K1LA 1UVSH 3ENSB 4UFGH 1T8LA 5B6OA 2BY8X 3ZVCA 1LTOA 1ZMLA 2VIPA 3QGNB 5F8TA 1ZRKA 3Q3XA 3RUOA 1Z8IB 1KDQB 2AYWA 1W0ZU 3TPIZ 1T8MA 2J94A 1GI8B 1SGYE 1EPTA 1GI7B 1INCA 3PMAB 4I8JA 3SJ8A 3TNTA 1FUJA 2VGCC 1S0QA 1TGCA 1AN1E 1D6RA 4WH6A 1BIOA 2A1DB 5C67A 3NPSA 4D7FA 4AB9A 1DWEH 2NU0E 3R0FA 1FPHH 3SNCA 1JRTA 2V0BA 1KXAA 2XBXA 4BTUB 1MCVA 1J17T 3Q3KA 2UWLA 2XBWA 1P3EA 1GJDB 1TE0A 2F9OA 2NU4E 3P6ZB 2FXRA 4JYTA 5HYOA 2ZO3H 1NU7B 5EXLA 1AGJA 1HJ9A 1MKWH 3W94A 3ZV8A 2B9LA 3AW0A 1ZJKA 2WPHS 1AIXH 1TABE 2Q6FA 2OQ5A 1GCTB 3SQHE 4F4OC 5C1YA 2ANYA 1O5CB 1PPZA 3S9BA 3KIDU 3GCTF 1W7XH 4NSVA 1GBCA 3S0NA 3GY4A 1C5XB 2HNTF 3Q77A 1TMBH 2QXGA 1IOEA 1QTFA 4FUCA 1H9HE 4KTUA 3VEQB 5EOKA 2ZCKP 1O36A 1MTWA 1S85A 3A87A 3LONA 1TGTA 4U30A 4BXWA 1V2VT 5A8YA 3LC3A 2JETB 3HK6B 1TFXA 3W95A 3OSYA 3V0XA 2G4UA 1PQ8A 1DPOA 1GHBG 4CBNA 2FI5E 3HPTB 1O0DH 3RXOA 1BUIA 1MTSA 1MZDA 2HNTE 2SGQE 4SGBE 2RG3A 4RSPA 3QUMP 1QB6A 2C3SA 1GI9B 4WMFA 4I32A 2A4QA 2Y82A 3TU7H 3KGPA 4NGAH 4LZ1H 1QJ7B 1YCPK 3BG4B 4A1XA 4IBLH 4MPXA 1NESE 1HIAA 1SGEE 1S82A 1HJAC 3ATWA 3MU4A 3Q00A 3GCHC 2BTCE 2VIVA 3UOUA 2QA9E 1DT2A 4BAOB 1ZHPA 1GBJA 1DANH 1W12U 1A1RA 1LDTT 1ELEE 1XUHA 2ZDKA 2Z9GA 2SGDE 3D62A 5C20A 1EJNA 3P92A 1BRUP 2QXIA 2PSXA 2VINA 1IAUA 3RU4E 1L4ZA 3QZRA 1ZMNA 2BZAA 4O03A 2DE9A 4CHAB 1S81A 2XBVA 4MPWA 1P2JA 4AFSA 1ZMJA 2ZPRA 2BDBA 1T7CA 3JZ1B 5EPNA 1TPPA 1K1JA 1T8OA 4BAHB 5DJ7A 3IWMA 1QBVH 2XCNA 3RXMA 3UNSA 4CRFA 1FY8E 1EOJA 1Z1JA 1V2PT 3BSQA 1U6QA 2FI3E 1OP8A 1ANEA 3ZYEA 5TCCA 3OU0A 4FUJA 4Q2KA 2OC0A 2GCHF 3S69A 1WUNH 1BHXF 3V12A 4X8SH 1H8IH 2O8UA 1EKBB 1GJ7B 2BMGB 1EXFA 2RA3A 4NCYA 1N8OB 1DXWA 2OXSA 3A83A 2VU8E 3M5MA 1XM1A 1Y8TA 3DHKH 4FU9A 1O5GH 1WTHD 1O2RA 1ZGIA 3KQBA 3RXQA 1GI4A 3SNBA 4CH8B 3HGPA 1TOMH 1LVBA 1KLIH 1SLUB 1UK3A 3M3VA 9ESTA 2Q6DA 1C9TA 4ABBA 1BMLA 3P95A 4OS1A 2B8OH 3DUXH 3KF2A 2O8LA 1NRPH 1TB6H 1PPGE 2SGFE 1NRSH 1EB1H 2VWNA 1SGIB 2F9PA 2P93A 1EPTB 1VZQH 3TJUA 2F9VA 3SU3A 1MUEB 3QZQA 1C2KA 4GUXA 5C2ZA 3ZVFA 4OS2A 5EXMA 2A31A 1ZTKA 1D3TB 4YESB 3V7TA 1Q2WA 4K5ZA 3M35A 1AFQB 1QJ6B 3SJOA 3UIRA 4INLA 4NZQA 5DK1A 4DT7B 3ITIA 1IQGA 1C5TA 2LPRA 3SGQE 3V13A 1DXPA 1O2OA 2SGAA 2VIWA 1V2RT 1MAXA 1P2KA 1T31A 2O8WA 1TPOA 4JZIA 2PTCE 4BAMB 2BXTH 2AGIX 3RXVA 2EI7A 3MH4A 1O3KA 1TWXB 3STJA 4B71A 1Y3XA 1YLCA 2GGVB 2XTTB 3BIVH 3RM2H 1F92A 1BTUA 5DP4A 1YP9A 4ASHA 1Z6JH 3RXKA 2Z9LA 2Z94A 2ZCHP 4FUDA 2V6NA 1FIZA 3K6ZA 4YOIA 2H5DA 2H9TH 3D65E 2ILNA 5PTPA 4I7YH 4X1QU 1K1PA 4UDWH 1JWTA 2UUKB 3MFJA 1AB9C 1MH0A 4Y0YE 4OS4A 2BVXH 4WWYA 6CHAB 1UHBA 3P8FA 3AW1A 1P2OA 3PWCA 1OP2A 3V3MA 1HAGE 2BLQA 2BM2A 6ESTA 1QCPA 4WMDA 3UQOA 2A4OA 1QB1A 1NZQH 2ZGHA 3M5OA 2VH6A 2FOMB 1GI2A 1Q31A 1ABJH 3ZVDA 1V2JT 2H5CA 1TGBA 4XBDA 1DWBH 1BRAA 3M3TA 4Z0KA 4ABIA 1P9SA 1WOFA 2OBQA 1Y59T 2W3IA 1GDUA 1TNJA 5E2OA 2ZFPH 1UCYH 2G00A 2R0LA 4DG4A 1TYNA 1O3HA 1YKTA 1G2LA 1VGCC 1EOLA 1BDAA 2QCYA 1EB2A 1HIAB 3SV2H 3VXEH 3QLPH 1BT7A 2ZU2A 1ACBE 1HAZB 3ATIA 5JPMH 3E1XB 1O5DH 1OP0A 5CMXH 1IQNA 3O8DA 1DLEA 3FAOA 8ESTE 3A7TA 2JH6D 1XUGA 1GHZA 1C2FA 2H1UA 2FYRA 3FZZA 2BHGA 4GHQA 3SJIA 1GHBF 5FX6A 1ELCA 2BX4A 1EZSC 3K2UA 3SGAE 1CA0B 1P03A 1SQAA 2HRVA 1NTPA 1A3EH 4X1PU 3SI4H 2BLWA 2ZIQH 2P95A 1KDQA 3CENA 2QF3A 5IDKA 1NC6A 3RXAA 5A8ZA 1V3XA 2HLCA 1FLEE 2ZGBH 4JK6A 1GBMA 4HTCH 3UWJH 5E2PA 1JIMA 2CF8H 1S5SA 3ZZ9A 2A5AA 3UNRA 1C2EA 1LQEA 3LT3A 1SBWA 1A5GH 2W26A 2VGCB 2Y5HA 2Y5FA 1LKAA 5F8XA 2CMYA 1MBQA 1V2KT 7ESTE 1SI5H 2Y7ZA 1SQOA 3TGJE 4ZUHA 2ODPA 2BDGA 3ZZ6A 4I31A 2Q1JA 1K1NA 3A89A 1GMCG 2A7JA 1NPMA 1F5RA 1OPHB 1DVAH 1E0FD 1JMOH 1O2HA 1TPSA 4ZH8A 1TA2A 1F5KU 1C5UA 2Z9IA 2F9NA 1P09A 1K9OE 2AEIH 1RS0A 2STAE 1UCYE 3BG8A 3BTME 3M7QA 5T6FA 4AGJA 4HI3A 3LGWA 5FPSA 1SGRE 2V3HH 1GJCB 2XCFA 1TPAE 1UTQA 2J9NA 2FOFA 3ODFA 3GY6A 4RKJB 1MU8B 1TLDA 2XC5A 1C1VH 5FX5A 3CP7A 4CREA 1QJ1B 3MOCA 1IQHA 3DT0H 1ID5H 3I78A 2D8WA 1OWHA 1AFQC 1D9IA 1MMJN 4KGAA 1QA7A 1EZQA 1FY3A 4ZAEA 3R3GB 1MZAA 3D23A 1F5LA 1IHTH 3EDXB 1MCTA 1TALA 3RC5A 4ZROA 1IQMA 3HKIB 2ALPA 5DP3A 2R9PA 3ZVGA 1Y5UT 1D3QB 1CHGA 3A8BA 5DP5A 1O2ZA 3PO1C 1C1UH 5FBEA 1Y3UA 3URCA 3UNQA 4K69A 1GBEA 3VB3A 1FY5A 1JIRA 1EAXA 3N7OA 7GCHG 2Z6BD 1HUTH 1GG6C 1CT2E 1FPCH 3LGYA 2Z3EA 1JOUB 4BOHA 2PGBB 1W3CA 1HV7A 1TONA 4NZLA 1P2NA 2ZU4A 4HFPB 2ZU3A 2F9UA 3A82A 1ANCA 2PUQH 1Z6EA 2PFEA 3CS7A 1HFDA 1NFYA 2C8XB 1BTWA 4B73A 2FEQH 2ZTXA 3RXUA 1RJXB 3QTVH 3KQCA 1HJAB 2FS8A 1JXPA 5T3HA 4AYVB 3GCHB 4MNWA 2CN0H 3UR6A 1YPJH 1L0ZA 2ZGJA 2ESTE 1FAXA 1CA8B 1XMNB 4YLQH 1SR5C 4IC6A 3SN8A 3GOVB 3RP2A 1LMWB 1UTKA 5EODA 3TITA 3M36A 4JZEH 2K1QA 2A5IA 3ODDA 2PTNA 3QN7A 3E6PH 4YLUA 2ZFRH 2C4FH 1YCPH 2ZNKH 4AN7A 1C2DA 3GCOA 2TGDA 3FFGA 3RXTA 2BVRH 3SHCH 4AFUA 1GHYH 1LO6A 2AH4X 1AQ7A 3A8CA 4GVUA 2BDCA 1DX5M 2VIDA 4MNYA 1GJ6A 1EJMA 4GHTA 5SGAE 4B1TA 2BDYA 2GZ8A 5I46H 2ASUB 2UUFB 2FX4A 2FYQA 1D6WA 3SI3H 2ANWA 4KELA 3LDXH 1O3AA 2HPPH 4BNRA 4ZKOU 1C2GA 2C8ZB 2CGAA 7LPRA 1H1BA 2ZWLH 1AVGH 5DP7A 4Y0ZE 1HAYB 5GCHG 5JDUB 2Y81A 3TJOA 1Y5AT 3E0PB 1P3CA 1CA0C 1BQYA 1AU8A 3AASA 3GYMA 1BITA 3A80A 3TK5A 4TYDA 2J2UA 3P8GA 1GL1A 4TY6A 2BD3A 2TBSA 2WV5A 5DGJA 5A09A 3SO3A 1O2PA 5F8ZA 5E8EH 3RMOH 3CS0A 4NWKA 3LC5A 5A2MH 5HGGA 5GIBA 1J14A 1OOKB 2FESH 3TH4H 1J8AA 2IPHA 1AD8H 1A61H 3TJVA 3UOPA 5L30H 5JBTA 1C5PA 4Y10E 1GBLA 1PYTC 1EP6A 1F0RA 1O2YA 1ELFA 4RKOB 1O37A 3GDUA 4D9RA 1EQ9A 1NS3A 2AMDA 5AFZH 2IJOB 1ORFA 2FP7B 2XC0A 4NSYA 3SU5A 1G3DA 3IG6B 3NWUA 1H4WA 1ZGVA 2AMQA 5LPRA 2ZPQA 1EP5A 3KNXA 4AORA 1SGNE 4WJG2 2THFB 1CBWC 1DY9A 2G8TA 4YO9A 4FVBA 1KLJH 3LOXA 2DUCA 2ZP0H
chains in the Genus database with same CATH superfamily
3MH5A 4CR9A 3A7ZA 5FXLA 4F49A 2KR7A 1H8DH 1GI3A 4Y71A 3LKWA 2A4RA 1SGTA 5EW2H 2BXUH 1FAKH 4X6MA 1SFIA 1AHTH 3SGBE 4WH8A 2G51A 4ZXXH 3VGCB 1GI5A 2BD5A 4NA9H 1TAWA 2RDEA 4Q80A 1ETTH 1C2MA 2WZQA 2VNTA 2ZHFH 1YPEH 3SHAH 2W3KA 2ZDLA 4O3UA 3D49H 5AFYH 1AB9B 1BTYA 3NKKA 3ZZ7A 1OWIA 4DIHH 1ZYOA 2H2ZA 1O5BB 3SORA 4FETA 4CRAA 1GMCF 3ZZAA 2WHXA 3U8OH 4K1EA 1YPLH 1ZR0A 3FOAA 5EQRA 4JK5A 5DP9A 1ESBA 2ODQA 3A7XA 2AERH 3ZIAD 3PWBA 3F6UH 1P0SH 3VG8A 2GT7A 4ZHLU 1A46H 4BTTB 1ESAA 4B2CA 2HOBA 1P10A 3E90B 1GBIA 2B0FA 2GMTC 1L1JA 1G30B 1QY6A 1GBAA 2WV4A 1VGCB 1O2UA 2BDAA 1C5VA 1YYY1 5F03A 3ZZ3A 3BF6H 3SW2B 1N1LA 1KYNA 2ZU1A 8GCHG 1A3BH 9LPRA 3OFND 3T26A 5HXFA 1ABIH 2BY6X 2I6QA 2ZDMA 3RLWH 4Y11E 1QRWA 1SHYA 2ZFQH 5EQSA 3A88A 4KTSA 2KM0A 4NA8A 1GL0E 1SC8U 3FP7E 2WPLS 4I8GA 4O97A 2LP6A 1XX9A 4BAKB 4DT4A 3SJ9A 2ZEBA 2FTLE 1C5NH 1DWDH 3GISB 2Z9KA 1AO5A 1P9UA 7GCHF 1ELGA 1F0UA 1NROH 1W7GH 4JZ1A 1DSUA 4MDSA 3O8CA 3UFAA 1TNIA 3DSOA 4I33A 3W1EA 2CHAC 6GCHG 4X2WA 5E0JA 1EZXC 1GJ5H 1DUEA 1KTSB 2GTBA 2ZA5A 3TVJB 4TPYA 2VWMA 3F9FA 4Q7ZA 2ZTYA 1O2KA 2NU1E 4FU8A 2PKAA 2VVVA 1NT1A 2YNBA 3P17H 1K22H 1GCDA 3O8BA 1PPFE 1FI8A 3MWIU 1KXBA 1NFWA 1RRKA 2XWAA 1Y5BT 1GDNA 1C1SA 3EQ0H 2HALA 4RN6A 5F6MA 4NIYA 1PPHE 2CXVA 3PROA 3PYHA 2M5TA 1O2LA 4NFFA 2W6ID 3RC4A 1CQQA 1ELBA 1QRXA 3OYPA 1NFXA 2AGGX 2ZHWH 2LNCA 3EA9A 3LGVA 3A86A 3CNRA 2G55A 1A4WH 1YPHE 1FN6A 1MD8A 4ABFA 3E91A 4AX9H 1KMHB 3F9GA 5A0BA 2AFQB 5KGOA 5EXNA 1G3EA 3VPKA 1NN6A 1YCPM 1TNGA 3PLBA 5ABWA 3BIUH 3ZZ5A 1Z1IA 2GT8A 1O3LA 1GJ4H 3U1JB 3BTGE 1P01A 2BD7A 1C5RA 4ABGA 4K2YA 1V2QT 2CJIA 2Z7FE 1HBTH 1BHXB 1AWHB 1D3DB 2QY0B 3M7UA 1TRNA 5EW1H 2M2AA 1E36B 1TX6A 1YPGH 3MHWU 1EUFA 2QV1A 3U8TH 2RA0A 3RXSA 1UVOA 1V2NT 4AYYB 3QX5H 1TX8A 1XVMA 1XKBC 4K60A 5TJXA 4M9FA 3RU4T 1SGFG 1J15A 2QGRA 2W7SA 1XVOA 3KCGH 1SLXB 1DDJA 2FOEA 3PO1B 1J9CH 4I8KA 1O33A 1RFNA 1GBKA 3FP8E 1NRRH 4YOGA 2BOHB 1EAUA 3MO6A 5EPYA 3SZEA 1GG6B 2DE8A 4WXIA 1DFPA 4BANB 3I29A 3WY8A 1O3GA 4DGJA 1HAOH 4WVPE 3VGCC 5LPEA 3C1KA 2VJ1A 1SQTA 1UTOA 1W0KD 3HKJB 3PV2A 1THSH 3M5LA 2LELA 1E37B 1ZRBA 1LVMA 4UEHH 4MPUA 3STIA 4Z6AH 3LU9B 1M9UA 3MMGA 1BTXA 2FTMA 2BD8A 1BTHH 2WSSD 4E05H 1ARBA 2VVCA 1WU1A 2EI8A 1AVWA 3H7TA 3SQEE 3WW7A 1H8ED 1S83A 3ATLA 4CRCA 1ETSH 5FL7D 1E1RD 2YMSD 1OWJA 3ELAH 3F68H 3MU1A 5T1VA 2JH5D 1KIGH 1ZPZA 3MNCA 3VXFH 4ESTE 3QGJA 1GPZA 1WV7H 4PROA 4FUEA 2L74A 3MNSA 3T25A 2XXLA 5DP6A 4JMYA 1SLWB 5FHTA 1O39A 5ESBA 3F9HA 2XW9A 3AAVA 3VB6A 1EATA 3GCNA 2HNTC 3EGKH 2PKSB 2Y7XA 5JBBS 1TBQH 3ZZ4A 5LPFA 2ZECA 1EJAA 3U69H 3OEED 2CF9H 4DY7B 4B2AA 1OKXA 8KME2 3BTKE 1VJAU 1HNEE 3QDZB 5DPAA 5FCKA 3P8NA 4JZFH 1GVKB 2P8OC 1DUAA 4OM9A 1DOJA 1C5OH 1FONA 2A7CA 1QFKH 1W11U 5GPIB 1RXPA 2ZHQH 1F2SE 2AS9A 4MG3A 1C4Y2 3T27A 3DSPA 4H6TA 1XUIA 3VB7A 5GNDA 4VGCC 4ABEA 4YZUA 1MD7A 1UVUH 1RIWC 2BLOA 1THRH 1S0RA 4X2VA 1O3MA 2FO9A 4IMQA 5HIZA 2H9HA 3RXFA 2UUJB 4IS5A 1C5LH 5FPTA 1VR1H 2HVXA 3TGKE 2GVFA 4X8TH 1GI6A 2WYGA 3MH7A 4Q7YA 3KQ5A 2QF4A 1IQKA 1E34B 4X8UH 3U9AH 2QYIA 2VB0A 3EA7A 1C2HA 3FO8D 5DG6A 2FODA 2P3UB 4Y79A 4ASUD 1DLKB 4THNH 3BEFB 4ZKNU 2ZU5A 2PKAB 1V2LT 4ZKSU 2A7HA 3UTUH 1O34A 3PM3A 1FMGA 5HM9A 2ZZUH 1YF4A 2SNWA 1ARCA 2JJ2D 1O3OA 1SKYE 1BBRK 1C5ZB 1KY9A 8GCHF 5FBIA 3LGUA 2ZFSA 1HRTH 4IGDA 1P05A 4IN1A 3SUDA 5A0AE 5F53A 1PPCE 1GMHG 2BY5X 2ZDNA 1CGJE 1P8VC 3EYDA 3SZNA 3ATMA 3SUEA 2OBOA 1O2GH 1NRNH 5E0GA 1O3FA 4X2XA 1YPHC 3L6PA 1WCZA 1DWCH 1UK4A 3QK1A 2FDAA 2G5VA 2I6SA 3RM0H 3TK9A 3ZZ8A 2Y80A 4X1NU 2ZHEH 6GCHF 3GY2A 1RD3B 1CBWB 1AI8H 1UVTH 2RDLA 1T4UH 4ABAA 2WYJA 5C0UA 1MU6B 1SL3A 4XBBA 3PLPA 4A1TA 1F7ZA 2W6JD 1PPEE 3A84A 3ATKA 5LGOA 4MPVA 2BB4A 1QZ8A 3QTOH 1LVOA 2FX6A 1TQ7B 2RCEA 2ANMH 5JBCS 3FP6E 1T32A 4QT8C 1O5EH 5HM2A 4I8HA 4E7RG 1O32A 2R0KA 4WF8A 1V2UT 2ZQ1A 2TGAA 3GY3A 7KMEH 5IK2D 1SVPA 3B9FH 4FUIA 3O8RA 1JRSA 1YBWA 1BRBE 2SFAA 1AMHA 4NA7A 5TCAA 1S6FA 1BCUH 3KN2A 3T5FH 4M7GA 4CRGA 1ELDE 2XC4A 3P8OA 2V3OH 4D8NA 1N6XA 4CH2B 3RLYH 3T29A 3ZVEA 1QIXB 4MLFB 5DP8A 1BRCE 1UMAH 1XUJA 2BD4A 2KCPA 1BMAA 2QIQA 5E0HA 2VH0A 1ZJDA 3FZDA 5GWZA 2A45B 4X6OA 1HDTH 3IITA 1ZTLA 1C2JA 1TGNA 2ZKSA 3S7HB 2O9QA 1X7AC 3F0OA 4FUFA 2CV3A 4MTBA 1DY8A 3KQDA 2FM2A 1GMDG 2GMTB 4UFDH 1DM4B 3A7VA 2VIOA 1XXFA 2FOHA 1D4PB 3UREA 3MH6A 3AVZA 3PRDA 2GZ9A 1CSOE 3B8JA 1P2IA 1ZPCA 4OS5A 3ZVBA 1NY22 3ZZCA 1OWDA 1L1NA 1RTLA 3S9AA 1GVLA 2CK3D 1O3IA 1OX1A 3N7EA 4XOJA 1A0LA 1HAXB 3OY5U 2ZDVH 1E79D 1TNLA 4B2BA 1HXEH 5AF9H 2GCHG 4JCNA 1D3PB 1GGDC 1G3BA 2C93B 3RMNH 2PKSC 2TGPZ 2OCVB 3AAUA 5CHAC 2EEKA 1P11E 2P94A 4HG6A 1W10U 2Y6TA 3M61U 1AKSA 1GJ8B 1K21H 1TA6A 3KHVA 2CHAB 3OY6U 1QNJA 2G5NA 3ZZBA 4AGKA 2FI4E 3E0NB 4Y7AA 4YT6H 1GHXH 2FOGA 4R8TB 2B7DH 3MO3A 4AFQA 1KXFA 4D9QA 3UPEA 4FUBA 1YLDA 4X0WU 1WDIA 1V2MT 3TJNA 3I77A 1L4DA 3RXHA 2F43B 2OC7A 2O8MA 1S84A 2UUYA 5CHBA 1IHSH 1XUKA 2QXHA 4AZ2B 3RXCA 2BY7X 4JYVH 1YC0A 1MKXK 1S6HA 3NK8A 1H9LB 2NWNA 2VWLA 1GBTA 2PV9B 3TNSA 5T6GA 3GDVA 2AIPA 3C27B 3RU4D 3NZIA 1QQUA 5EGMA 4AC9A 3OAAD 1HAPH 2NU2E 4GAWA 3F9EA 5JB8S 2P59A 3GYLB 4UFFH 2XNIA 2OD3B 3DSGA 2FOCA 3BTEE 4ISOA 2EY4C 1SOZA 1PQ5A 1A5IA 1VITG 1S6LA 3UB0A 3MTYA 4K1TA 1HXFH 2ODYB 1OWEA 1O2XA 3A8AA 3M7TA 4K8BA 5C5OA 1L1GA 1G3CA 2ANKH 4LOYH 3SNDA 1SPJA 3NRLA 3SU2A 1GJ9B 3U1IB 3SBKA 1KXDA 3JZ2B 1HAIH 3M5NA 1P04A 2C90B 3VFEA 1TNKA 2WINI 2P16A 3OTJE 4NIVA 1FY4A 5T6DA 1GDQA 2J38A 1RTFB 1MBMA 1UW7A 1C4V2 2JIZD 3MU8A 1XKAC 1TIOA 2PR3A 4XSKU 4LXBH 1C5MD 3EE7A 3MO9A 1K1OA 1Z71A 3PMHB 4SGAE 3ZZDA 1NM6A 3TGIE 1RGQA 1JBUH 1ZPBA 3F2FA 4UONA 1B0FA 1T4VH 4X1RU 3RXPA 1HYLA 1QURH 3WWBA 1A5HA 1LHCH 2ALVA 2G81E 4NWLA 4FVDA 5ESTE 1UTMA 1CGHA 1HGTH 4DCDA 4INHA 2BOKA 1VCQA 2A32A 3LJOA 5C5NA 1FZZA 5EJLA 1O3JA 2OC8A 3RXLA 1W14U 2BQ6B 2GDEH 1O38A 5ETXA 1KXEA 1YWUA 4ISHH 1WAYB 2EC9H 4UE7H 4ZKRU 2ZF0H 1UO6A 4GCHG 4AB8A 5K0HA 5C1UA 4ABHA 1VJ9U 5B6LA 1GJAB 5J4SA 1QRZA 3SU6A 1O3CA 2TGTA 1LPKB 1GMHF 5HKKD 1LVYA 1FDPA 1K1IA 1SB1H 1XUFA 3E16B 2FOBA 1EASA 1LPGB 4CRDA 1C1QA 1WSSH 4Y7BA 3DCLA 2V35A 1QGFA 3K9XB 1MAYA 3BV9B 1FNIA 4O9VA 5C0TA 3E8LA 1ANDA 3U8RH 4DJZB 3DD2H 1CO7E 1OXGA 3LGIA 4NG9H 3HATH 4DIIH 1H8HD 3OTPA 4LZ4B 2GV6A 3VB4A 1HB0B 3F1SB 1MABB 1TRMA 3RMLH 3H5CB 2FPZA 1G36A 1NRQH 2AIQA 3UUZA 2ZG0H 2OK5A 1HAVA 2ZHDA 4Y76A 3BEIB 4KKDA 2ZGCA 5L2YH 2Z9JA 1EAWA 4X2YA 4BTIB 3ZYDA 2XNDD 1AUJA 2P8OB 2ZTZA 1BTZA 4RI0A 1DITH 1B5GH 1C2LA 3KQEA 3ZVAA 2ZQ2A 2PUXB 2HLDD 3E3TA 3A7YA 4IW4E 3TH3H 4B6FA 3SNAA 4A6LA 3G01A 1PQAA 1O2SA 3PTNA 2BDHA 4VGCB 2J92A 1RIWB 1PPBH 4MVNA 4ISNA 2D1JA 3SJKA 5KECA 1AZ8A 1TMTH 2G52A 3M37A 1C1PA 3ZV9A 2XOKD 3RXRA 3A81A 1ESTA 2F83A 1XXDA 2OP9A 2PGQB 2WUCA 5EQQA 2OLGA 4B75A 4TWYA 1KLTA 1TNHA 1AE8H 2P3FH 3RXEA 1G9IE 4MNXA 1AKSB 1TMUH 5KEDA 2EA3A 2WUBA 3SUFA 1ZTJA 4XRNA 1IQEA 1O2NA 4WY3A 3P70B 1YM0A 1C5YB 1AUTC 4BAQB 1GMDF 4AG2A 2IN2A 3A85A 4K1SA 5JB9S 3ESTA 4WMEA 2R2MB 4TPIZ 4Q7XA 1CGIE 4XE4A 4FXGH 1C4U2 2ZDAH 1WTGH 2KFWA 2W5EA 1SGCA 3K65B 3PMJA 1SGDE 2FIRH 3UQVA 1IQLA 1QB9A 1LPZB 3WWFA 2J95A 2AMPA 1BJUA 2G4TA 2PP6A 4UD9H 2GDDA 1O5FH 1MTNC 1SGQE 3GY7A 1UK2A 2GCTC 4B76A 3TH2H 3LGTA 1W2KH 1F0SA 2QAAA 5G4BA 1GWAA 3RXGA 5L6NH 1CHOG 1TX7A 1VITH 4E06H 1OYQA 4Q63A 2FWWA 2FLRH 2P3TB 1SFQB 2BD9A 5FPYA 1GJBB 1G37A 1SLVB 4GLYA 1ZZZA 2J34A 1BBRH 2KAIA 1RTKA 1V2OT 4DOQA 1P12E 2FMJA 4KP0A 1SSXA 2BQWB 4I86A 5K7RA 1Z8RA 4BXSA 2QC2A 1TRYA 1O2QA 5DSFA 1C5WB 2C8YB 1AZZA 5C3NA 2BVSH 1LHEH 2L6OA 3RXJA 2GD4B 4A5TS 1PYTD 5L2ZH 1MQ6A 3PB1E 5DKMA 1L2EA 1MKWK 5GDSH 1PJPA 3LH3A 5IYTA 5GCHF 3RXIA 1GBFA 1HCGA 1V2ST 5GXPA 3BTQE 4E7NA 3SV6A 1C1RA 2BYAX 2SGEE 4X6PA 1CT0E 1OWKA 2J4IA 2F9BH 4XFQA 2H9EH 3MNBA 1Y3WA 4MNVA 3EAJA 1UVPA 2BQ7B 5EG4A 4D76A 4MQAA 4JZDH 3RDZA 2H6MA 3UWIA 1VITF 5I25A 1C5SA 4OGYA 3SV7A 1K28D 3UY9A 4INKA 2A5KA 4D7GA 2B5TB 1NBMD 3RXBA 3T28A 4CR5A 1CU1A 4A92A 1TOCB 1KXCA 2GZ7A 4DW2U 1NU9A 3Q3YA 1GCTC 3Q76A 5A0CA 3BEUA 1C1WH 1K0HA 2HGTH 1UTJA 2K8IA 3FANA 1P06A 1FN8A 2HWLB 2GX4A 3DFJA 1ZOMA 1J16A 3S7KB 2C8WB 1E35B 2YOLA 2D26C 4TWWA 1O31A 1O3BA 3DA9B 2BDIA 1O2IA 3EE0B 3KL6A 2TRMA 1BA8B 4XDEA 1O3NA 4ABJA 4ZMAH 1CE5A 3HK3B 4K8YA 2ZI2H 4JYUH 4KTCA 1GHAG 2A4GA 1W8BH 5BPEA 1BBRE 2JETC 4Y8YA 1N6YA 1GGDB 1O2TA 4O3TA 2QN5T 1DICA 1BMNH 1O5AB 4X1SU 1O2WA 5JBAS 3L3TA 4H42U 5CHAB 2BZ6H 1MQ5A 3SOSA 3NCLA 1NO9H 4K3JA 3BTTE 2OQUA 1CT4E 2A2QH 4YM9A 2WPIS 2BD2A 4Y8XA 3PMBB 2YNAA 2W7UA 1WXRA 1O30A 1GHVH 1FJSA 4R0IA 2RFKC 1QHRB 1HAVB 1LHDH 2UWPA 1ZSLA 4ZHMU 4ACBA 2OC1A 3S9CA 2GV7A 4GCHF 1FV9A 4ABDA 4DURA 1FY1A 1O3PB 3SU0A 3BG4C 1BTPA 3U98H 1GHWH 1SGFA 1P2MA 1QA0A 1SHHB 5C94A 1PFXC 3MYWA 2J5UA 1EZUC 1C2IA 4ZHAA 1IQJA 4CRBA 4FUGA 1QR3E 1UTLM 1WQSA 2ZFFH 2WPKS 5HMAA 3LJJA 1V2WT 1SGPE 1LKBA 3DFLA 1BJVA 1PQ7A 1DE7H 3SV8A 4FU7A 4IMZA 3A7WA 4H6SB 8LPRA 2BY9X 1SMFE 4CHAC 1P2QA 3B23B 4XBCA 2V3MA 3LPRA 1GI1A 2J97A 1ZSJA 1YGCH 5C1XA 4NIWA 2XRCA 1WYKA 3HGNA 1THPB 4B74A 1QQ4A 1P57B 2EQNA 1KTTB 2JKHA 1MKXH 2WPMS 3LH1A 1HAHH 3BTFE 1V2TT 3FKSD 1YPKH 1W0YH 4I8LA 4AFZA 1MTVA 3RC6A 4YTAA 1O3DA 3TLOA 3GCTG 1Y3YA 2OUAA 2XWBI 5AVDA 1A0HB 3PTBA 1ELTA 2Y5GA 1NFUA 1OYTH 2NU3E 2IOTA 3OX7U 4Y8ZA 1N8OC 3MU5A 2SNVA 3PV5A 4TY7A 4UFEH 1HLTH 1BB0B 1HJ8A 4YOJA 4NIXA 2XBYA 4J1YA 3BTHE 3LIWA 2WPJS 4OGXA 2BLVA 4ZXYH 4F55A 3TK6A 4YT7H 2SGPE 2KAIB 5FCRA 1OSSA 1IQFA 2QXJA 1K2I1 3SU4A 2F3CE 5EU8A 2TIOA 5JYIA 1SG8B 4NFEA 4HZHA 2OTVA 4A1VA 1ZLRA 1C1OA 1FQ3A 1EPTC 4ISIH 1YLNA 4H4FA 1LQDB 1NBME 3BN9A 1UJ1A 1WQVH 2ULLA 3QO6A 5FAHA 3GDSA 1LCYA 1HPGA 1GVZA 2KZ4A 1C1NA 3H7OA 4IC5A 3SV9A 1E38B 3NUMA 4HGCA 3NXPA 1F0TA 1IQIA 1O2VA 3U28C 3GY8A 1O3EA 1MTUA 1CHOF 3SNEA 3K6YA 1Y3VA 1QL7A 1YPMH 4X8VH 2XYAA 5H4IB 4RT0A 4X6NA 3RMMH 1QL8A 2PW8H 3KEEA 3F2GA 2ZFTA 4AOQA 1LHGH 1FIWA 1UTNA 2PSYA 1KSNA 2STBE 2Q6GA 2IJD1 5J4QA 1G2MA 1TBRH 3UR9A 3GY5A 3PLKA 2PWXA 1GI0A 1BOQA 1C1TA 4AG1A 3SU1A 1A2CH 2VIQA 5AHGH 1A0JA 5GJ4B 1AE5A 4FUHA 1Q3XA 3URDA 1GBBA 1AWFH 1B7XB 2QE7D 2PHBA 1TBZH 4CBOA 1C1MA 3T2NA 2R3UA 2EI6A 1AVXA 4J2YB 2QF0A 1VCPA 1ZHMA 4U32A 1VCWA 1FXYA 1DS2E 3MU0A 4OS7A 5A8XA 2FLBH 1AFEH 2AGEX 1B0EA 1TGSZ 6CHAC 1ANBA 1QBOA 2ZCLP 1UCYK 3SUGA 3QWCH 2O8TA 1P02A 5LH8A 3T62A 1Z7KA 1EAIA 4LK4A 1A7SA 1OS8A 1QL9A 3PV4A 5BRRE 4WXVA 4U2WA 1UHBB 3MQKC 2ZC9H 1C5QA 3RXDA 5CE1A 4DVAU 2BX3A 2ZPSA 1BMMH 1O2MA 2A2XH 1O2JA 1EX3A 1O35A 1YY3A 3M3SA 2A0QB 1LHFH 5DO4H 2ZGXH 1AY6H 4GPGA 2F4LA 4IN2A 2OINA 2JH0D 2TPIZ 2GKVE 4P00A 2VWOA 2D2DA 4OS6A 2FS9A 4Y6DA 4ISLA 1C9PA 1Z8GA 1SOTA 1GBHA 1Z8JB 1ZSKA 3FVFB 2WV9A 1ELVA 1TQ0B 1BZXE 2R2WU 2Z3CA 3GICB 3MNXA 3A8DA 2PLXA 1CVWH 2FOAA 2UWOA 3UAIC 2GP9B 1V6DA 1G32B 1GHAF 1ELAA 1ETRH 1H9IE 1MTNB 2VVUA 1W13U 4A7IB 2GCTB 1T8NA 1UTPA 3BTDE 3L33A 3MI4A 5DN6D 4GSOA 1ZHRA 3VB5A 2Z3DA 2FZZA 2R3YA 3BTWE 1GBDA 1K1MA 1QBNA 1WBGB 3EA8A 4RT1A 6LPRA 4U01A 2F91A 3TIUA 2HPQH 1DSTA 1K1LA 1UVSH 3ENSB 4UFGH 1T8LA 5B6OA 2BY8X 3ZVCA 4B6EA 1LTOA 1ZMLA 2VIPA 3QGNB 5F8TA 1ZRKA 3Q3XA 3RUOA 1Z8IB 1KDQB 2AYWA 3F3BA 1W0ZU 3TPIZ 1T8MA 2J94A 1GI8B 1SGYE 1EPTA 4ZCNA 1GI7B 1INCA 3PMAB 4I8JA 3SJ8A 3TNTA 1FUJA 2VGCC 1S0QA 1TGCA 1AN1E 1D6RA 4WH6A 1BIOA 2A1DB 5C67A 3NPSA 4D7FA 4AB9A 1DWEH 2NU0E 2AHME 1FPHH 3R0FA 3SNCA 1JRTA 2V0BA 1KXAA 2XBXA 4BTUB 1MCVA 1J17T 3Q3KA 2UWLA 2XBWA 1P3EA 1GJDB 1TE0A 2F9OA 2NU4E 3P6ZB 2FXRA 4JYTA 5HYOA 2ZO3H 1NU7B 5EXLA 1AGJA 1HJ9A 1MKWH 3W94A 3ZV8A 1OHHD 2B9LA 1ZJKA 2WPHS 3AW0A 1AIXH 1TABE 2Q6FA 2OQ5A 1GCTB 3SQHE 4F4OC 5C1YA 2ANYA 1O5CB 1PPZA 3S9BA 3KIDU 3GCTF 1W7XH 4NSVA 1GBCA 3S0NA 3GY4A 1C5XB 2HNTF 2KX4A 2K0QA 3Q77A 1TMBH 2QXGA 1IOEA 1QTFA 4FUCA 1H9HE 4KTUA 3VEQB 5EOKA 2ZCKP 1O36A 1MTWA 1S85A 3A87A 3LONA 1TGTA 4U30A 4BXWA 1V2VT 5A8YA 3LC3A 2JETB 3HK6B 1TFXA 2YMSC 3W95A 3OSYA 3V0XA 2G4UA 1PQ8A 1DPOA 1GHBG 4CBNA 2FI5E 3HPTB 1O0DH 3RXOA 1BUIA 1MTSA 1MZDA 2HNTE 2SGQE 4SGBE 2RG3A 4RSPA 3QUMP 1QB6A 2C3SA 1GI9B 4WMFA 2WPDD 4I32A 2A4QA 2Y82A 3TU7H 2VBCA 3KGPA 4NGAH 4LZ1H 1QJ7B 1YCPK 3BG4B 4A1XA 4IBLH 4MPXA 1NESE 1HIAA 1SGEE 1S82A 4Z1MD 1HJAC 3ATWA 3MU4A 3Q00A 3GCHC 2BTCE 2VIVA 3UOUA 2QA9E 1DT2A 4BAOB 1ZHPA 1GBJA 3PRBA 1DANH 1W12U 1A1RA 1LDTT 1ELEE 1XUHA 1W0JD 2Z9GA 2SGDE 2ZDKA 3D62A 5C20A 1EJNA 3P92A 1BRUP 2QXIA 2PSXA 2VINA 1IAUA 3RU4E 1L4ZA 3QZRA 1ZMNA 2BZAA 4O03A 2DE9A 4CHAB 1S81A 2XBVA 4MPWA 1P2JA 4AFSA 1ZMJA 2ZPRA 2BDBA 1T7CA 3JZ1B 2GJGA 5EPNA 1TPPA 1K1JA 1T8OA 4BAHB 5DJ7A 4ACAA 3IWMA 1QBVH 2XCNA 3RXMA 3UNSA 4CRFA 1FY8E 1EOJA 1Z1JA 1V2PT 3BSQA 1U6QA 2FI3E 1OP8A 1ANEA 3ZYEA 5TCCA 3OU0A 4FUJA 4Q2KA 2OC0A 2GCHF 3S69A 1WUNH 1BHXF 3V12A 4X8SH 1H8IH 2O8UA 1EKBB 1GJ7B 2BMGB 1EXFA 2RA3A 4NCYA 1N8OB 1DXWA 2OXSA 3A83A 2VU8E 3M5MA 1XM1A 1Y8TA 3DHKH 4FU9A 1O5GH 1WTHD 1O2RA 1ZGIA 3KQBA 3RXQA 1GI4A 3SNBA 4CH8B 3HGPA 1TOMH 1LVBA 1KLIH 1SLUB 1UK3A 3M3VA 9ESTA 2Q6DA 1C9TA 4ABBA 1BMLA 3P95A 4OS1A 2B8OH 3DUXH 3KF2A 2O8LA 1NRPH 2KCAA 1TB6H 1PPGE 2SGFE 1NRSH 1EB1H 2QF5A 2VWNA 1SGIB 2F9PA 2P93A 1EPTB 1VZQH 3TJUA 2F9VA 3SU3A 1MUEB 3QZQA 1C2KA 4GUXA 5C2ZA 3ZVFA 4OS2A 5EXMA 3H09A 3OEHD 2A31A 1ZTKA 1D3TB 4YESB 3V7TA 1Q2WA 4K5ZA 3M35A 1AFQB 1QJ6B 3SJOA 3UIRA 4INLA 4NZQA 5DK1A 1FX0B 4DT7B 3ITIA 1IQGA 1C5TA 2LPRA 3SGQE 3V13A 1DXPA 1O2OA 2SGAA 2VIWA 2JDID 1V2RT 1MAXA 1P2KA 3AK5A 1T31A 2O8WA 1TPOA 4JZIA 2PTCE 4BAMB 2BXTH 2AGIX 3RXVA 2EI7A 3MH4A 3GS9A 1O3KA 1VKYA 1TWXB 3STJA 4B71A 1Y3XA 1YLCA 2GGVB 2XTTB 3BIVH 3RM2H 1F92A 1BTUA 5DP4A 1YP9A 4ASHA 1Z6JH 2J98A 3RXKA 2Z9LA 2Z94A 2ZCHP 4FUDA 2V6NA 1FIZA 3K6ZA 4YOIA 2H5DA 2H9TH 3D65E 2ILNA 5PTPA 4I7YH 4X1QU 1K1PA 4UDWH 1JWTA 2UUKB 4F48B 3MFJA 1AB9C 1MH0A 4Y0YE 4OS4A 2BVXH 4WWYA 5CDFE 6CHAB 1UHBA 3P8FA 3AW1A 1P2OA 3PWCA 1OP2A 3V3MA 1HAGE 2BLQA 2BM2A 6ESTA 1QCPA 4WMDA 1COWD 2A4OA 3UQOA 1QB1A 1NZQH 2ZGHA 3M5OA 2VH6A 2FOMB 1GI2A 1Q31A 1ABJH 3ZVDA 1V2JT 2H5CA 1TGBA 4XBDA 1DWBH 1BRAA 3M3TA 4Z0KA 4ABIA 1P9SA 1WOFA 2OBQA 1Y59T 2W3IA 1GDUA 1TNJA 5E2OA 2ZFPH 1UCYH 2G00A 2R0LA 4DG4A 1TYNA 1O3HA 1YKTA 1G2LA 1VGCC 1EOLA 1BDAA 2QCYA 1EB2A 1HIAB 3SV2H 3VXEH 3QLPH 1BT7A 2ZU2A 1ACBE 1HAZB 3ATIA 5JPMH 3E1XB 1O5DH 1OP0A 3N7DA 5CMXH 1IQNA 3O8DA 1DLEA 3FAOA 3FN8A 8ESTE 3A7TA 2KCOA 2JH6D 1XUGA 1GHZA 1C2FA 2H1UA 2FYRA 3FZZA 2BHGA 4GHQA 3SJIA 1GHBF 5FX6A 1ELCA 2BX4A 1EZSC 3K2UA 3SGAE 1CA0B 1P03A 1SQAA 2HRVA 1NTPA 1A3EH 4X1PU 3SI4H 2BLWA 2ZIQH 2P95A 1KDQA 3CENA 2QF3A 5IDKA 1NC6A 3RXAA 5A8ZA 1V3XA 2HLCA 1FLEE 2ZGBH 4JK6A 1GBMA 4HTCH 3UWJH 5E2PA 1JIMA 2CF8H 1S5SA 3ZZ9A 2A5AA 3KYFA 3UNRA 1C2EA 1LQEA 3LT3A 1SBWA 4P02A 1A5GH 2W26A 2VGCB 2Y5HA 2Y5FA 1LKAA 5F8XA 2CMYA 1MBQA 1V2KT 7ESTE 1SI5H 2Y7ZA 1SQOA 3TGJE 4ZUHA 2ODPA 2BDGA 3ZZ6A 4I31A 2Q1JA 1K1NA 3A89A 1GMCG 2A7JA 1NPMA 1F5RA 1BMFD 1OPHB 1DVAH 1E0FD 1JMOH 1O2HA 1TPSA 4ZH8A 1TA2A 1F5KU 1C5UA 2Z9IA 2F9NA 1P09A 1K9OE 2AEIH 1RS0A 2STAE 1UCYE 3BG8A 3BTME 3M7QA 5T6FA 4AGJA 4HI3A 3LGWA 5FPSA 1SGRE 2V3HH 1GJCB 2XCFA 1TPAE 1UTQA 2J9NA 2FOFA 3ODFA 4Q4LA 3GY6A 4RKJB 1MU8B 1TLDA 2XC5A 1C1VH 5FX5A 3SYJA 3CP7A 4CREA 1QJ1B 3MOCA 1IQHA 3DT0H 1ID5H 3I78A 2D8WA 1OWHA 1AFQC 1D9IA 1MMJN 4KGAA 1QA7A 1EZQA 1FY3A 4ZAEA 3R3GB 1MZAA 3D23A 1F5LA 1IHTH 3EDXB 1MCTA 1TALA 3RC5A 4ZROA 1IQMA 3HKIB 2ALPA 5DP3A 2R9PA 3ZVGA 1Y5UT 1D3QB 1CHGA 4TT3D 2HVYB 3A8BA 5DP5A 1O2ZA 5EIYA 3PO1C 1C1UH 5FBEA 1Y3UA 2YMSB 3UNQA 3KYGA 3URCA 4K69A 1GBEA 3VB3A 1FY5A 1JIRA 1EAXA 3N7OA 7GCHG 2Z6BD 1HUTH 1GG6C 1CT2E 1FPCH 3LGYA 2Z3EA 1JOUB 4BOHA 1W3CA 2PGBB 1HV7A 1TONA 4NZLA 1P2NA 2J98B 2ZU4A 2ZU3A 4HFPB 2F9UA 3A82A 5C17A 1ANCA 2PUQH 1Z6EA 5EJZA 2PFEA 2JJ1D 3CS7A 1HFDA 4YXWD 1NFYA 2C8XB 4FOUC 1BTWA 4B73A 2FEQH 2ZTXA 3RXUA 1RJXB 3QTVH 3KQCA 3OE7D 1HJAB 2FS8A 1JXPA 5T3HA 4AYVB 3GCHB 4MNWA 2CN0H 3UR6A 1YPJH 1L0ZA 2ZGJA 2ESTE 2V7QD 1FAXA 1CA8B 1XMNB 4YLQH 1SR5C 4IC6A 3SN8A 3GOVB 3RP2A 1LMWB 1UTKA 5EODA 3TITA 3M36A 4JZEH 2K1QA 2A5IA 3N99A 3ODDA 2PTNA 3QN7A 3E6PH 4YLUA 2ZFRH 2C4FH 1YCPH 2ZNKH 4AN7A 1C2DA 3GCOA 2TGDA 3FFGA 3RXTA 2BVRH 3SHCH 4AFUA 1GHYH 1LO6A 2AH4X 1AQ7A 3A8CA 4GVUA 2BDCA 1DX5M 2VIDA 4MNYA 1GJ6A 1EJMA 5HIYA 4GHTA 5SGAE 4B1TA 2BDYA 2GZ8A 5I46H 2ASUB 2UUFB 2FX4A 2FYQA 1D6WA 3F0PA 3SI3H 2ANWA 4KELA 3LDXH 1O3AA 2HPPH 4BNRA 4ZKOU 1SQRA 1C2GA 2C8ZB 2CGAA 7LPRA 1E1QD 1H1BA 2ZWLH 1AVGH 5DP7A 4Y0ZE 1HAYB 5GCHG 5JDUB 2Y81A 3TJOA 1Y5AT 3E0PB 1P3CA 3F2HA 1CA0C 1BQYA 1AU8A 1EFRD 4XD7D 3AASA 3GYMA 1BITA 3A80A 3TK5A 4TYDA 2J2UA 3P8GA 1GL1A 4TY6A 2BD3A 2TBSA 2WV5A 5DGJA 5A09A 3SO3A 1O2PA 5F8ZA 5E8EH 3RMOH 3CS0A 4NWKA 3LC5A 5A2MH 5HGGA 5GIBA 1J14A 1OOKB 2FESH 3TH4H 1J8AA 2IPQX 2IPHA 1AD8H 1A61H 3TJVA 3UOPA 5L30H 5JBTA 1C5PA 4Y10E 1GBLA 1PYTC 1EP6A 1F0RA 1O2YA 1ELFA 4RKOB 1O37A 3GDUA 4D9RA 1EQ9A 1NS3A 2AMDA 5AFZH 2IJOB 1ORFA 2FP7B 2XC0A 4NSYA 3SU5A 1G3DA 3IG6B 3NWUA 1H4WA 5EJ1A 1ZGVA 2AMQA 5LPRA 2ZPQA 1EP5A 3KNXA 4AORA 2KCYA 1SGNE 4WJG2 2THFB 1CBWC 4TSFD 1DY9A 2G8TA 4YO9A 4FVBA 1KLJH 3LOXA 2DUCA 2ZP0H
chains in the Genus database with same CATH topology
3MH5A 4CR9A 3A7ZA 5FXLA 4F49A 1H8DH 1GI3A 4Y71A 3LKWA 2A4RA 1SGTA 5EW2H 2BXUH 1FAKH 4X6MA 1SFIA 1AHTH 3SGBE 4WH8A 2G51A 4ZXXH 3VGCB 1GI5A 2BD5A 4NA9H 1TAWA 4Q80A 1ETTH 1C2MA 2VNTA 2ZHFH 1YPEH 3SHAH 2W3KA 2ZDLA 4O3UA 3D49H 5AFYH 1AB9B 1BTYA 3NKKA 3ZZ7A 1OWIA 4DIHH 1ZYOA 2H2ZA 1O5BB 3SORA 4CRAA 1GMCF 3ZZAA 3U8OH 4K1EA 1YPLH 1ZR0A 5EQRA 4JK5A 5DP9A 1ESBA 2ODQA 3A7XA 2AERH 3PWBA 3F6UH 1P0SH 2GT7A 4ZHLU 1A46H 4BTTB 1ESAA 4B2CA 2HOBA 1P10A 3E90B 1GBIA 2B0FA 2GMTC 1L1JA 1G30B 1QY6A 1GBAA 2WV4A 1VGCB 1O2UA 2BDAA 1C5VA 1YYY1 5F03A 3ZZ3A 3BF6H 3SW2B 1N1LA 1KYNA 2ZU1A 8GCHG 1A3BH 9LPRA 5HXFA 3T26A 1ABIH 2BY6X 2I6QA 2ZDMA 3RLWH 4Y11E 1QRWA 1SHYA 2ZFQH 5EQSA 3A88A 4KTSA 4NA8A 1GL0E 1SC8U 3FP7E 2WPLS 4I8GA 4O97A 1XX9A 4BAKB 3SJ9A 2ZEBA 2FTLE 1C5NH 1DWDH 3GISB 2Z9KA 1AO5A 1P9UA 7GCHF 1ELGA 1F0UA 1NROH 1W7GH 4JZ1A 1DSUA 4MDSA 3O8CA 3UFAA 1TNIA 4I33A 2CHAC 6GCHG 4X2WA 5E0JA 1EZXC 1GJ5H 1DUEA 1KTSB 2GTBA 2ZA5A 3TVJB 4TPYA 2VWMA 3F9FA 4Q7ZA 2ZTYA 1O2KA 2NU1E 4FU8A 2PKAA 2VVVA 1NT1A 2YNBA 3P17H 1K22H 1GCDA 3O8BA 1PPFE 1FI8A 3MWIU 1KXBA 1NFWA 1RRKA 2XWAA 1Y5BT 1GDNA 1C1SA 3EQ0H 2HALA 4RN6A 5F6MA 4NIYA 1PPHE 2CXVA 3PROA 3PYHA 2M5TA 1O2LA 4NFFA 3RC4A 1CQQA 1ELBA 1QRXA 3OYPA 1NFXA 2AGGX 2ZHWH 2LNCA 3EA9A 3LGVA 3A86A 2G55A 1A4WH 1YPHE 1FN6A 1MD8A 4ABFA 3E91A 4AX9H 5A0BA 3F9GA 2AFQB 5EXNA 1G3EA 3VPKA 1NN6A 1YCPM 1TNGA 3PLBA 5ABWA 3BIUH 3ZZ5A 1Z1IA 2GT8A 1O3LA 1GJ4H 3U1JB 3BTGE 1P01A 2BD7A 1C5RA 4ABGA 4K2YA 1V2QT 2CJIA 2Z7FE 1HBTH 1BHXB 1AWHB 1D3DB 2QY0B 3M7UA 1TRNA 5EW1H 1E36B 1TX6A 1YPGH 3MHWU 1EUFA 2QV1A 3U8TH 2RA0A 3RXSA 1UVOA 1V2NT 4AYYB 3QX5H 1TX8A 1XVMA 1XKBC 4K60A 5TJXA 3RU4T 1SGFG 1J15A 2QGRA 2W7SA 1XVOA 3KCGH 1SLXB 1DDJA 2FOEA 3PO1B 1J9CH 4I8KA 1O33A 1RFNA 1GBKA 3FP8E 1NRRH 4YOGA 2BOHB 1EAUA 3MO6A 5EPYA 1GG6B 2DE8A 4WXIA 1DFPA 4BANB 3I29A 3WY8A 1O3GA 4DGJA 1HAOH 4WVPE 3VGCC 5LPEA 3C1KA 2VJ1A 1SQTA 1UTOA 3HKJB 1THSH 3M5LA 1E37B 1ZRBA 1LVMA 4UEHH 4MPUA 3STIA 4Z6AH 3LU9B 1M9UA 3MMGA 1BTXA 2FTMA 2BD8A 1BTHH 4E05H 1ARBA 2VVCA 1WU1A 2EI8A 1AVWA 3H7TA 3SQEE 1S83A 3ATLA 4CRCA 1ETSH 1OWJA 3ELAH 3F68H 3MU1A 2JH5D 1KIGH 1ZPZA 3MNCA 3VXFH 4ESTE 3QGJA 1GPZA 1WV7H 4PROA 4FUEA 3MNSA 3T25A 2XXLA 5DP6A 4JMYA 1SLWB 5FHTA 1O39A 5ESBA 3F9HA 2XW9A 3AAVA 3VB6A 1EATA 3GCNA 2HNTC 3EGKH 2PKSB 2Y7XA 5JBBS 1TBQH 3ZZ4A 5LPFA 2ZECA 1EJAA 3U69H 2CF9H 4DY7B 4B2AA 1OKXA 8KME2 3BTKE 1VJAU 1HNEE 3QDZB 5DPAA 5FCKA 3P8NA 4JZFH 1GVKB 2P8OC 1DUAA 1DOJA 1C5OH 1FONA 2A7CA 1QFKH 1W11U 5GPIB 1RXPA 2ZHQH 1F2SE 2AS9A 4MG3A 1C4Y2 3T27A 4H6TA 1XUIA 3VB7A 4VGCC 4ABEA 4YZUA 1MD7A 1UVUH 1RIWC 2BLOA 1THRH 1S0RA 4X2VA 1O3MA 2FO9A 4IMQA 2H9HA 3RXFA 2UUJB 4IS5A 1C5LH 5FPTA 1VR1H 2HVXA 3TGKE 2GVFA 4X8TH 1GI6A 2WYGA 3MH7A 4Q7YA 1IQKA 1E34B 4X8UH 3U9AH 2QYIA 2VB0A 3EA7A 1C2HA 5DG6A 2FODA 2P3UB 4Y79A 1DLKB 4THNH 3BEFB 4ZKNU 2ZU5A 2PKAB 1V2LT 4ZKSU 2A7HA 3UTUH 1O34A 3PM3A 1FMGA 5HM9A 2ZZUH 1YF4A 2SNWA 1ARCA 1O3OA 1BBRK 1C5ZB 1KY9A 8GCHF 5FBIA 3LGUA 2ZFSA 1HRTH 4IGDA 1P05A 4IN1A 3SUDA 5A0AE 1PPCE 1GMHG 2BY5X 2ZDNA 1CGJE 1P8VC 3EYDA 3SZNA 3ATMA 3SUEA 2OBOA 1O2GH 1NRNH 5E0GA 1O3FA 4X2XA 1YPHC 3L6PA 1WCZA 1DWCH 1UK4A 3QK1A 2FDAA 2G5VA 2I6SA 3RM0H 3TK9A 3ZZ8A 2Y80A 4X1NU 2ZHEH 6GCHF 3GY2A 1RD3B 1CBWB 1AI8H 1UVTH 2RDLA 1T4UH 4ABAA 2WYJA 1MU6B 1SL3A 4XBBA 3PLPA 4A1TA 1F7ZA 1PPEE 3A84A 3ATKA 5LGOA 4MPVA 2BB4A 3QTOH 1LVOA 2FX6A 1TQ7B 2RCEA 2ANMH 5JBCS 3FP6E 1T32A 4QT8C 1O5EH 5HM2A 4I8HA 4E7RG 1O32A 2R0KA 4WF8A 1V2UT 2ZQ1A 2TGAA 3GY3A 7KMEH 1SVPA 3B9FH 4FUIA 3O8RA 1JRSA 1YBWA 1BRBE 2SFAA 1AMHA 4NA7A 5TCAA 1S6FA 1BCUH 3KN2A 3T5FH 4M7GA 4CRGA 1ELDE 2XC4A 3P8OA 2V3OH 4D8NA 1N6XA 4CH2B 3RLYH 3T29A 3ZVEA 1QIXB 4MLFB 5DP8A 1BRCE 1UMAH 1XUJA 2BD4A 1BMAA 2QIQA 5E0HA 2VH0A 1ZJDA 3FZDA 5GWZA 2A45B 4X6OA 1HDTH 3IITA 1ZTLA 1C2JA 1TGNA 2ZKSA 3S7HB 2O9QA 1X7AC 4FUFA 2CV3A 4MTBA 1DY8A 3KQDA 2FM2A 1GMDG 2GMTB 4UFDH 1DM4B 3A7VA 2VIOA 1XXFA 2FOHA 1D4PB 3UREA 3MH6A 3AVZA 2GZ9A 1CSOE 3B8JA 1P2IA 1ZPCA 4OS5A 3ZVBA 1NY22 3ZZCA 1OWDA 1L1NA 1RTLA 3S9AA 1GVLA 1O3IA 1OX1A 4XOJA 1A0LA 1HAXB 3OY5U 2ZDVH 1TNLA 4B2BA 1HXEH 5AF9H 2GCHG 4JCNA 1D3PB 1GGDC 1G3BA 2C93B 3RMNH 2PKSC 2TGPZ 2OCVB 3AAUA 5CHAC 2EEKA 1P11E 2P94A 1W10U 2Y6TA 3M61U 1AKSA 1GJ8B 1K21H 1TA6A 3KHVA 2CHAB 3OY6U 1QNJA 2G5NA 3ZZBA 4AGKA 2FI4E 3E0NB 4Y7AA 4YT6H 1GHXH 2FOGA 4R8TB 2B7DH 3MO3A 4AFQA 1KXFA 4D9QA 3UPEA 4FUBA 1YLDA 4X0WU 1V2MT 3TJNA 3I77A 1L4DA 3RXHA 2OC7A 2O8MA 1S84A 2UUYA 1IHSH 1XUKA 2QXHA 4AZ2B 3RXCA 2BY7X 4JYVH 1YC0A 1MKXK 1S6HA 3NK8A 1H9LB 2NWNA 2VWLA 1GBTA 2PV9B 3TNSA 5T6GA 3GDVA 2AIPA 3C27B 3RU4D 3NZIA 1QQUA 5EGMA 1HAPH 2NU2E 4GAWA 3F9EA 5JB8S 2P59A 3GYLB 4UFFH 2XNIA 2OD3B 2FOCA 3BTEE 4ISOA 1SOZA 1PQ5A 1A5IA 1VITG 3MTYA 4K1TA 1HXFH 2ODYB 1OWEA 1O2XA 3A8AA 3M7TA 4K8BA 5C5OA 1L1GA 1G3CA 2ANKH 4LOYH 3SNDA 1SPJA 3SU2A 1GJ9B 3U1IB 3SBKA 1KXDA 3JZ2B 1HAIH 3M5NA 1P04A 2C90B 3VFEA 1TNKA 2WINI 2P16A 3OTJE 4NIVA 1FY4A 5T6DA 1GDQA 2J38A 1RTFB 1MBMA 1C4V2 3MU8A 1XKAC 1TIOA 2PR3A 4XSKU 4LXBH 1C5MD 3MO9A 1K1OA 1Z71A 3PMHB 4SGAE 3ZZDA 1NM6A 3TGIE 1RGQA 1JBUH 1ZPBA 4UONA 1B0FA 1T4VH 4X1RU 3RXPA 1HYLA 1QURH 1A5HA 1LHCH 2ALVA 2G81E 4NWLA 4FVDA 5ESTE 1UTMA 1CGHA 1HGTH 4DCDA 4INHA 2BOKA 1VCQA 2A32A 3LJOA 5C5NA 1FZZA 1O3JA 2OC8A 3RXLA 1W14U 2BQ6B 2GDEH 1O38A 5ETXA 1KXEA 4UE7H 4ISHH 1WAYB 2EC9H 4ZKRU 2ZF0H 1UO6A 4GCHG 4AB8A 5K0HA 5C1UA 4ABHA 1VJ9U 1GJAB 5J4SA 1QRZA 3SU6A 1O3CA 2TGTA 1LPKB 1GMHF 1LVYA 1FDPA 1K1IA 1SB1H 1XUFA 3E16B 2FOBA 1EASA 1LPGB 4CRDA 1C1QA 1WSSH 4Y7BA 2V35A 1QGFA 3K9XB 1MAYA 3BV9B 1FNIA 4O9VA 3E8LA 1ANDA 3U8RH 4DJZB 3DD2H 1CO7E 1OXGA 3LGIA 4NG9H 3HATH 4DIIH 4LZ4B 2GV6A 3VB4A 1HB0B 3F1SB 1TRMA 3RMLH 3H5CB 2FPZA 1G36A 1NRQH 2AIQA 3UUZA 2ZG0H 1HAVA 2ZHDA 4Y76A 3BEIB 4KKDA 2ZGCA 5L2YH 2Z9JA 1EAWA 4X2YA 4BTIB 3ZYDA 1AUJA 2P8OB 2ZTZA 1BTZA 1DITH 1B5GH 1C2LA 3KQEA 3ZVAA 2ZQ2A 2PUXB 3E3TA 3A7YA 4IW4E 3TH3H 3SNAA 4A6LA 3G01A 1PQAA 1O2SA 3PTNA 2BDHA 4VGCB 2J92A 1RIWB 1PPBH 4MVNA 4ISNA 2D1JA 3SJKA 1AZ8A 1TMTH 2G52A 3M37A 1C1PA 3ZV9A 3RXRA 3A81A 1ESTA 2F83A 1XXDA 2OP9A 2PGQB 2WUCA 5EQQA 2OLGA 4B75A 4TWYA 1KLTA 1TNHA 1AE8H 2P3FH 3RXEA 1G9IE 4MNXA 1AKSB 1TMUH 2EA3A 2WUBA 3SUFA 1ZTJA 1IQEA 1O2NA 4WY3A 3P70B 1YM0A 1C5YB 1AUTC 4BAQB 1GMDF 4AG2A 2IN2A 3A85A 4K1SA 5JB9S 3ESTA 4WMEA 2R2MB 4TPIZ 4Q7XA 1CGIE 4XE4A 4FXGH 1C4U2 2ZDAH 1WTGH 2W5EA 1SGCA 3K65B 3PMJA 1SGDE 2FIRH 3UQVA 1IQLA 1QB9A 1LPZB 2J95A 2AMPA 1BJUA 2G4TA 4UD9H 2GDDA 1O5FH 1MTNC 1SGQE 3GY7A 1UK2A 2GCTC 4B76A 3TH2H 3LGTA 1W2KH 1F0SA 2QAAA 5G4BA 1GWAA 3RXGA 5L6NH 1CHOG 1TX7A 1VITH 4E06H 1OYQA 2FWWA 2P3TB 2FLRH 1SFQB 2BD9A 5FPYA 1GJBB 1G37A 1SLVB 4GLYA 1ZZZA 2J34A 1BBRH 2KAIA 1RTKA 1V2OT 4DOQA 1P12E 2FMJA 4KP0A 1SSXA 2BQWB 5K7RA 1Z8RA 4BXSA 2QC2A 1TRYA 1O2QA 1C5WB 2C8YB 1AZZA 5C3NA 2BVSH 1LHEH 3RXJA 2GD4B 4A5TS 1PYTD 5L2ZH 1MQ6A 3PB1E 5DKMA 1L2EA 1MKWK 5GDSH 1PJPA 3LH3A 5IYTA 5GCHF 3RXIA 1GBFA 1HCGA 1V2ST 5GXPA 3BTQE 4E7NA 3SV6A 1C1RA 2BYAX 2SGEE 4X6PA 1CT0E 1OWKA 2J4IA 2F9BH 4XFQA 2H9EH 3MNBA 1Y3WA 4MNVA 3EAJA 1UVPA 2BQ7B 5EG4A 4D76A 4MQAA 4JZDH 3RDZA 2H6MA 3UWIA 1VITF 5I25A 1C5SA 4OGYA 3SV7A 1K28D 3UY9A 4INKA 2A5KA 4D7GA 2B5TB 3RXBA 3T28A 4CR5A 1CU1A 4A92A 1TOCB 1KXCA 2GZ7A 4DW2U 1NU9A 3Q3YA 1GCTC 3Q76A 5A0CA 3BEUA 1C1WH 2HGTH 1UTJA 3FANA 1P06A 1FN8A 2HWLB 2GX4A 3DFJA 1ZOMA 1J16A 3S7KB 2C8WB 1E35B 2YOLA 2D26C 4TWWA 1O31A 1O3BA 3DA9B 2BDIA 1O2IA 3EE0B 3KL6A 2TRMA 1BA8B 4XDEA 1O3NA 4ABJA 4ZMAH 1CE5A 3HK3B 4K8YA 2ZI2H 4JYUH 4KTCA 1GHAG 2A4GA 1W8BH 5BPEA 1BBRE 2JETC 4Y8YA 1N6YA 1GGDB 1O2TA 4O3TA 2QN5T 1DICA 1BMNH 1O5AB 4X1SU 1O2WA 5JBAS 3L3TA 4H42U 5CHAB 2BZ6H 1MQ5A 3SOSA 3NCLA 1NO9H 4K3JA 3BTTE 2OQUA 1CT4E 2A2QH 4YM9A 2WPIS 2BD2A 4Y8XA 3PMBB 2YNAA 2W7UA 1O30A 1GHVH 1FJSA 4R0IA 1QHRB 1HAVB 1LHDH 2UWPA 1ZSLA 4ZHMU 2OC1A 3S9CA 2GV7A 4GCHF 1FV9A 4ABDA 4DURA 1FY1A 1O3PB 3SU0A 3BG4C 1BTPA 3U98H 1GHWH 1SGFA 1P2MA 1QA0A 1SHHB 1PFXC 3MYWA 1EZUC 1C2IA