1W11U

Urokinase type plasminogen activator
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w11U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w11U01
1CHOF 3T27A 2FO9A 1LHFH 3MNBA 1C9PA 4JYVH 1V6DA 1EZUC 1QURH 1NRSH 1K1NA 3P17H 2R9PA 1O2TA 1EPTB 3PV4A 4MDSA 1GHAF 4RN6A 1ZRBA 5AFZH 2WPLS 3VB4A 1GJBB 3STIA 1GL1A 1GVZA 3LU9B 2BLQA 1ID5H 4O97A 4X8VH 1TPSA 1OOKB 1L1JA 4D8NA 1O3OA 1O2UA 2B5TB 4WVPE 3E6PH 4ZHMU 1GI5A 2JH6D 3RXDA 3SUEA 3GISB 5IYTA 1QB9A 1GI7B 2Z9LA 1B0FA 1MU8B 1SGDE 3KN2A 1C5MD 2H9HA 1FPHH 2J92A 1G3DA 1W0ZU 4FUGA 3S69A 4CBOA 1A5GH 2FWWA 2RG3A 4XSKU 3S7HB 4B75A 2CMYA 4WH8A 4A5TS 3KEEA 2EEKA 2Z6BD 3Q00A 1SGNE 1P0SH 3DT0H 3A85A 1IQKA 1MQ6A 1HAPH 1WTHD 2BDGA 2R0LA 1J9CH 1V2LT 1GCDA 2BY7X 1TX8A 2LPRA 1AIXH 1HAXB 1OX1A 3BTQE 1FXYA 2BLVA 2SGFE 1GMDG 1O3BA 1L1NA 3TH3H 3FFGA 1EAXA 1FUJA 8GCHF 2VVUA 2WYGA 1FONA 1L0ZA 1VR1H 2OC0A 1EJNA 1VCPA 4X2YA 3VGCB 1GI2A 2BD4A 2UUFB 2ZU1A 1D6RA 3HGPA 4H6SB 1QCPA 1MH0A 4IMZA 2FS9A 2ZHWH 2ILNA 3PMHB 2F3CE 4MPVA 1HJ8A 5C3NA 1O2GH 1O33A 3EYDA 4FUHA 1YCPM 1EB2A 5CMXH 2JH5D 3M37A 1BQYA 1C5TA 1SL3A 1D4PB 3KNXA 1EZQA 1FJSA 5DGJA 1C2FA 2AIQA 1NU7B 1QGFA 2A2XH 1GJAB 2QF0A 1V2RT 4YZUA 4YO9A 1BHXB 3BEIB 2SNVA 3BTKE 2CF9H 3LGIA 1ELBA 1JXPA 2AGIX 2BXUH 1XXFA 2ZCKP 2IN2A 3MU1A 1NFXA 1P57B 4IN2A 1P02A 2GT8A 2PR3A 3BG4B 1GVLA 3RMLH 4AX9H 5K7RA 3LDXH 1GBJA 1FAKH 2RA0A 5H4IB 4B1TA 2VIQA 5HGGA 2SGAA 2BDBA 1GJCB 1CHGA 2ZO3H 4FU8A 1C5YB 1DT2A 1FN8A 1HB0B 2I6QA 5C1YA 2Z9IA 3E8LA 3ATIA 1C4Y2 1FLEE 1HAYB 1DSTA 3TGIE 1DPOA 2GT7A 1ZMNA 5DPAA 1EASA 3EDXB 3TIUA 4R0IA 2G00A 1G3EA 1TRYA 3OY6U 3KF2A 1P01A 1FMGA 1GMHF 1QL8A 1QRWA 1AE8H 4Y0ZE 3UTUH 1WUNH 2XBYA 4CHAC 3LPRA 2VVCA 1A0HB 3UOPA 5IDKA 1P2JA 1WSSH 1GHBG 4K1TA 3V12A 1BTZA 3ELAH 1W13U 1YCPH 4D9RA 4OS7A 1YKTA 3TH2H 3UWIA 1V2VT 2ZPSA 1AO5A 1OPHB 4IN1A 1ZGIA 1QHRB 4ZMAH 1E36B 1W12U 2BDIA 1GDQA 4FUCA 1FPCH 4X2WA 1AMHA 2ZU4A 3EA7A 2P8OC 4XFQA 1BIOA 2VIOA 1DWCH 3TLOA 4FU9A 1A0JA 2Z9GA 4E7RG 2A4OA 4AFZA 2ZGCA 2W5EA 5A8XA 1WYKA 4MPXA 4ISLA 1YM0A 4X1RU 4NA8A 1PPZA 1KDQA 1PYTD 3TU7H 1HAZB 3BN9A 2G81E 4AG1A 1P12E 2PKAB 1G9IE 2IPHA 1HYLA 3F9FA 3SV9A 4DIHH 1C2LA 2BDCA 1C2JA 3UNSA 2GD4B 3PMJA 2ODQA 1ZYOA 5E0HA 2ZU5A 3SORA 1PPHE 4ABBA 1BTPA 2JH0D 3L6PA 2ZA5A 4YT6H 3AASA 3RXEA 1WU1A 2PWXA 4NIXA 2ZHFH 1MKXK 1VITH 3SU0A 2UUYA 3EAJA 1DY9A 1XUJA 3MTYA 3TGJE 4MG3A 5FX5A 2JKHA 1HUTH 3Q76A 1SSXA 5SGAE 2BZ6H 2WPIS 4NWKA 1ARBA 1TLDA 1TNHA 2BQ7B 2ESTE 3CENA 2BYAX 1K1LA 5EQRA 4JMYA 1AVWA 2H2ZA 5FCKA 2GMTC 2TGAA 5EOKA 1DXPA 2FLRH 3FVFB 1EX3A 4NFFA 1AUJA 1BTYA 3EA9A 2R3YA 1ZSJA 1TPAE 1PPFE 1E37B 2ZHDA 3ENSB 1GDNA 3PMAB 4X8TH 1WOFA 1OP8A 4LZ4B 3O8CA 4ABAA 3U1IB 1SQTA 1C1PA 2BY9X 1AUTC 1LMWB 4BTUB 4Y8YA 3EGKH 3SJ9A 2RA3A 1ZJKA 2G5NA 1T4VH 1O39A 1NFWA 1QBOA 3DHKH 4K1EA 3FZZA 4X1PU 2OC1A 2HRVA 2ZU2A 3QN7A 1QJ1B 1Y5BT 1V2NT 7GCHF 1O2XA 2RCEA 1LHDH 2WUCA 1QBVH 3GYMA 3SBKA 1O2SA 1GGDC 3BV9B 1QB6A 1V2WT 1ETTH 4K60A 1GHZA 1EAUA 2QA9E 1Z71A 4VGCC 3LH3A 5CHAB 2AMDA 4ZH8A 2R0KA 4D7GA 3GY7A 1BJUA 2AMPA 5FBIA 2O8UA 2VWLA 4YTAA 3V0XA 1O0DH 1C5OH 1P3EA 2A1DB 1C2EA 1TFXA 3A8DA 1EAWA 2AYWA 2ZU3A 2ZZUH 5HM2A 2BMGB 2XBVA 2XYAA 4CREA 1CSOE 1TGCA 4F49A 4RSPA 1MTUA 1P06A 3SNBA 3ZZ5A 4YOIA 1UJ1A 2PSXA 1LVYA 1HV7A 1QA0A 2OINA 1F5RA 5I25A 1XUHA 2HWLB 3VB5A 2UUKB 1C5WB 5FAHA 1SOZA 2P3TB 4D7FA 3LJOA 1DWDH 2ZDMA 3A7WA 1P2KA 3BTHE 5FXLA 1ZJDA 3MO9A 1X7AC 1BRUP 1O2OA 3RM0H 2D2DA 3RLWH 1YC0A 1C5PA 2AGEX 3RXSA 4DG4A 2BD8A 1PQAA 1AZ8A 1SHHB 4UDWH 1V2TT 5TJXA 1F0SA 1ZZZA 1O3GA 2GKVE 1T8LA 1XUIA 3VXFH 1CT0E 2F9PA 1ELCA 1H9IE 3OYPA 1LVOA 3RXGA 1MCTA 2FPZA 1K1IA 1SQOA 2A0QB 2ZTYA 1AFQC 1ELEE 2Y6TA 2DE8A 3TJUA 1LKAA 1O5BB 1HCGA 3ZV8A 1C1RA 1S84A 2ZDLA 4BTTB 1MCVA 2SGQE 1O3EA 3A7YA 2PFEA 4ZXXH 1JIMA 1L1GA 3LONA 1BMMH 4K2YA 1DM4B 1ESTA 1G30B 2GCHG 2W26A 2A5AA 1TMBH 1EZSC 1F0UA 4Q7YA 1ANEA 6CHAC 1NFUA 2FYRA 1DLKB 1XMNB 3GCHC 3PWCA 3MH6A 1HAGE 4IC5A 2TGTA 1MKWK 5FBEA 3SHAH 1C2HA 1CVWH 4THNH 1HAHH 3URDA 3ATKA 3E0NB 3SU4A 1W14U 3GCTF 1MMJN 2J34A 2FP7B 4I8GA 4AZ2B 4Q7XA 4NGAH 4NSYA 3GCOA 1NPMA 4O9VA 2OBOA 3KL6A 1O2YA 1ZPBA 1XUKA 3JZ1B 4JK5A 1Y5UT 2PKSC 1LO6A 1AQ7A 1NROH 4IW4E 1F0TA 1O2RA 1O3DA 1C1MA 2STBE 2JETB 1T8MA 4YLQH 3T2NA 1TRNA 3B23B 4K8YA 1BTHH 2P93A 5JBBS 4CRFA 1QQUA 4M7GA 4X8UH 1UTLM 3T26A 3JZ2B 5LPEA 1TNKA 1HJAB 1FY1A 4I31A 2HLCA 1PQ5A 5AHGH 3F9EA 1LQDB 3SV8A 5A09A 1J8AA 1UTQA 1LTOA 2TIOA 2CHAC 1SPJA 2XRCA 4ZKRU 2GCTB 3U1JB 1HRTH 3A7TA 2PUXB 2PSYA 3UWJH 1AD8H 3D65E 3RXUA 1ABIH 4YT7H 1F5LA 3NWUA 5EXLA 3IWMA 3ITIA 1QBNA 4BAHB 5L2YH 2FOFA 4SGBE 1OSSA 5JBTA 1M9UA 1DXWA 1C9TA 2WV4A 3NZIA 1P2IA 8KME2 4ZHAA 1KXCA 1GPZA 3Q3XA 5E2PA 3BTWE 1UTNA 4Y10E 1F5KU 3RC5A 1T7CA 1HAVB 2FOHA 3NPSA 5LGOA 1ELFA 3VEQB 2FOAA 3SOSA 5J4QA 3RC4A 1OYQA 2CV3A 3ZVFA 1W2KH 1VZQH 3EQ0H 2A7CA 4NZLA 2WPHS 1Z6JH 1MTVA 3RXTA 3P70B 1Y3UA 2ZQ2A 2ZCLP 2ZCHP 1C5QA 4ZROA 3R3GB 3H7OA 5T6DA 2ALPA 2ODPA 2VGCB 2F9BH 2KAIA 4WF8A 3C27B 2C8XB 3MFJA 1O3HA 1C2MA 2F9UA 3ZZ7A 5EG4A 1WCZA 3RXBA 4ABEA 1GBTA 3TPIZ 2A4RA 1KSNA 1HPGA 4R8TB 1EKBB 2ZI2H 4E05H 5EPYA 4GCHG 4INKA 2NU2E 2V35A 1GBDA 1HBTH 1Z8RA 2WYJA 2ODYB 2ZDNA 3DFJA 4CRCA 1BITA 2W7SA 1TX7A 1RIWC 1O5GH 1GCTB 1O30A 4LK4A 2ZDVH 1OWHA 1P2NA 1S0QA 1KYNA 1ZRKA 3P8FA 2OP9A 1MU6B 1VCQA 4B74A 2FOGA 1O2IA 1Q3XA 1SLWB 2PTCE 3QTOH 2OQ5A 5T3HA 4X6PA 2TGPZ 3RUOA 4FVBA 2NU1E 2D8WA 3LOXA 1ZHPA 3FZDA 4NA9H 1IQIA 1AB9C 1HNEE 3A82A 4ISNA 1BDAA 1V2QT 4X2VA 1OWJA 1TNLA 4GPGA 1BZXE 4I8HA 1EZXC 5L6NH 2QYIA 1WQVH 5C1UA 1LHCH 2ZKSA 2HPPH 1VGCB 1ACBE 1VITF 4GLYA 4U30A 2P3FH 3M5OA 3SV2H 3P8OA 1ZTJA 1MTNB 1SMFE 1IHSH 5ABWA 5AVDA 1V2ST 1QNJA 1GI0A 3S9BA 1ANBA 3OU0A 4CRBA 2C8ZB 1ORFA 2ZPQA 4ISOA 1IQJA 1EOJA 1TGSZ 5GXPA 3NK8A 4AGKA 3ZVGA 4CR9A 2ULLA 4DIIH 1AU8A 1HIAA 1UCYK 3E91A 5L30H 2DUCA 3E3TA 3MOCA 6GCHG 4QT8C 1ELGA 2GP9B 2V0BA 3GOVB 4DW2U 4FU7A 4GUXA 1O3AA 1P04A 2BY8X 3QDZB 1QRZA 3FANA 1O2NA 1OWKA 1NRNH 2LNCA 1GHWH 1J16A 1AI8H 1A2CH 4GHQA 1EB1H 1RS0A 3A89A 2AIPA 1P05A 4CBNA 3QGJA 1G2MA 4AB9A 1OWIA 4XBCA 5EXMA 2ANKH 2PLXA 3U69H 2ZGBH 2XW9A 3AAUA 2VWNA 2R2MB 1O5DH 1S83A 1DX5M 2O8MA 3HKJB 4Y7BA 1C1NA 4DOQA 1S0RA 2C4FH 1GMCG 3BG8A 1Z8IB 4K5ZA 2FX4A 4Y71A 2Z3CA 4BAOB 3TJNA 3QWCH 3P8GA 5BPEA 4OS4A 1G3BA 1SFIA 3K6ZA 4H42U 1ZMJA 5DJ7A 1DWEH 3ODDA 3LT3A 2ASUB 2XTTB 1AWHB 1T8NA 1LPGB 3AAVA 2IJOB 2A31A 2Y81A 4Z6AH 3SUGA 2DE9A 1F0RA 5C5OA 1O3MA 2ZPRA 2G8TA 3RXOA 4CH8B 4ASHA 2EI7A 4ABHA 4K8BA 1UK4A 5JBAS 1THSH 2CGAA 3SGAE 3M36A 1GJ7B 1C4U2 1P2MA 2ANYA 2VH6A 1L4DA 5DO4H 1SGRE 3T62A 4IMQA 3MWIU 1L4ZA 5GCHG 1HXEH 3MU0A 3KQCA 4DY7B 3F9HA 2Z9KA 3GY2A 1G2LA 4U32A 5F8XA 2A7HA 1JOUB 1CA8B 2BD5A 1DSUA 4A1VA 3TK6A 1C1VH 1XUFA 3TGKE 3FP6E 4IGDA 4KP0A 3RXHA 2BDHA 1HAIH 2AS9A 1H8DH 4JZIA 2GZ9A 4Q2KA 2A45B 4AOQA 3S9AA 1AHTH 1D3DB 2PUQH 1K2I1 1THPB 1O35A 1LVMA 3P95A 1GBMA 1KIGH 1NRPH 4OS1A 1CBWB 2EI6A 3UREA 1PPCE 2THFB 3M5MA 1BBRK 2AH4X 1BRBE 3UPEA 3AVZA 1GG6B 2BLOA 4AORA 1YPHC 9ESTA 1P9SA 1GJ6A 1ANDA 1GJ4H 4DURA 4OGXA 2ZP0H 3A8CA 1GBAA 5EU8A 1O3LA 3TITA 3OSYA 2BD3A 2Z7FE 1Y5AT 2HNTC 3FAOA 1IQEA 3RXCA 3S7KB 3TJOA 5B6OA 1JBUH 3G01A 5E2OA 1YPHE 1NO9H 1T31A 3SU1A 5F03A 4K1SA 3IITA 1BTWA 1C5RA 1K1OA 1UTMA 1CHOG 3VB7A 2HNTE 3PLKA 5F8ZA 1EPTC 5EODA 1BB0B 3EE0B 3MU5A 1FIZA 1HJ9A 2QY0B 1ZGVA 4PROA 3OX7U 1O5EH 4DVAU 1GHAG 1O32A 1RJXB 1Y3WA 5HM9A 3KCGH 5HYOA 4TPYA 1E34B 3BEFB 5EW1H 5CE1A 2EI8A 2BDAA 1NM6A 3BTTE 2XCNA 2H6MA 4ABGA 1A3EH 1ZSKA 1MBMA 2PTNA 2O8TA 3IG6B 1N8OB 1QJ6B 3HATH 1TWXB 5K0HA 4NCYA 3RC6A 4AYVB 4MNYA 2ZIQH 1AE5A 5GDSH 1BA8B 2YNAA 2QCYA 2HNTF 2ZTXA 1DITH 3UR9A 1EUFA 3MU8A 3F68H 4X2XA 2G4UA 3S0NA 3SV6A 1O2MA 1GI6A 4NFEA 2Q6FA 4AYYB 1SC8U 2B7DH 1YPLH 1NRQH 4Y8XA 4LOYH 1XKAC 1JRSA 1NU9A 3I29A 3A86A 4JYUH 1F2SE 2OXSA 2G5VA 1RD3B 4ABIA 3LGWA 2W3KA 1BJVA 3HGNA 3ZZBA 3SNAA 2ZDKA 1TOMH 2Z3EA 4INLA 2BB4A 2H5CA 3LC3A 1KXFA 4A92A 1GJDB 1MD7A 2BDYA 3UIRA 3A7ZA 1YPKH 1ZTLA 3VGCC 8GCHG 1H8IH 2WUBA 1DY8A 1VJAU 2VU8E 4JK6A 3PO1B 1A61H 2UUJB 1IQFA 1DUAA 2Z9JA 2VINA 1ZMLA 2O8WA 2HOBA 1ZHRA 1SBWA 1ELDE 7KMEH 1YBWA 3RXLA 5C5NA 1RTFB 3GY5A 2ZEBA 3ZVEA 2J94A 2Y7XA 3RXVA 1AWFH 5DK1A 2GDDA 5DKMA 1EJAA 4AFUA 2QXIA 3A8AA 3TK9A 3ZVCA 2GX4A 3KQDA 2OLGA 1DANH 2CF8H 3MHWU 4ZKOU 2VIVA 2XXLA 5C67A 3TVJB 1WV7H 3CS0A 1OS8A 3PLBA 3BG4C 1O2PA 4KTCA 3TH4H 4ISHH 1KTTB 3QO6A 4CH2B 2CN0H 3CP7A 4YOGA 2W7UA 1IQLA 3SJKA 1AKSA 3D23A 4BAQB 1CA0B 5FPSA 1XM1A 3U8RH 1C1OA 3SHCH 5AF9H 2BX3A 4HI3A 3VB3A 3L33A 5JPMH 3F9GA 3PTNA 2SNWA 3NXPA 4J1YA 1S6HA 1ZOMA 2OCVB 2Z94A 1S82A 1QY6A 5DP6A 1W8BH 1D9IA 1SGPE 1SVPA 3MO3A 4WH6A 4GCHF 1LVBA 2NU0E 1QJ7B 1N6XA 1BT7A 1C2KA 3RDZA 4ZAEA 1GMHG 1O2HA 2BY6X 7ESTE 3ZV9A 1YLDA 1IQMA 3D49H 1SGTA 2H9EH 1LPZB 1HLTH 3ZVBA 5A0BA 1Z7KA 2Y5HA 4HFPB 3M5LA 1K1JA 3MO6A 3GY4A 2ANWA 2VIWA 4Y76A 2P94A 3SV7A 1HFDA 2QAAA 3R0FA 2FIRH 2H9TH 5F6MA 2WINI 3W94A 1MUEB 1H4WA 4X1NU 3LGUA 1KXEA 2BVSH 4IS5A 1C1WH 2A2QH 2BM2A 5G4BA 3F1SB 2HALA 3LGYA 3PB1E 3SQEE 3UNQA 1K22H 2CXVA 3ZZDA 4ZUHA 1GHXH 1SGQE 4O3UA 3PTBA 2FDAA 1E35B 1EAIA 2ZFFH 2BY5X 2VIDA 2FM2A 4FXGH 4CRDA 1NS3A 3BTME 1HGTH 4I8JA 1H9LB 2XNIA 3QZRA 1ARCA 1AVXA 3K6YA 2SFAA 3A80A 2AGGX 1Q31A 2NU3E 1FY3A 1SGCA 1YYY1 3DFLA 1O3JA 2BQ6B 2C93B 4UE7H 2ZTZA 4BXWA 2Y7ZA 3O8RA 1GMDF 4JYTA 3M3VA 3PROA 4MLFB 2M5TA 1TABE 3RM2H 2G51A 2VIPA 1QIXB 3M5NA 3RXJA 1W11U 4NG9H 1KLIH 1V2OT 1W10U 1Z6EA 3M7QA 1HIAB 1O31A 2BXTH 3UQVA 1NTPA 1P8VC 3Q3KA 3SUFA 1NC6A 2RDLA 3EA8A 1OXGA 3SO3A 4JZEH 1EJMA 1TPPA 1ETRH 5JYIA 1DFPA 3GDUA 4ZXYH 3LGTA 1OP2A 1C5ZB 2PV9B 1C5UA 1KXDA 1P10A 5GIBA 3SU6A 1O5AB 5JBCS 3A7VA 1TNGA 1YPMH 1GI1A 3U8TH 1UHBA 1C1TA 1YCPK 4DGJA 2G55A 3HK3B 1C2DA 2VH0A 4WWYA 1LDTT 2ZQ1A 5LPFA 1SFQB 3RU4T 1UTOA 2BD9A 2GDEH 4DJZB 1MKXH 7GCHG 1C5VA 1IQGA 1V2MT 2W3IA 3U8OH 4HZHA 1G32B 3U98H 3KQBA 5CHAC 4WY3A 4INHA 3A81A 2GGVB 1WTGH 4BXSA 2BHGA 3BTDE 5AFYH 3MNSA 3RU4D 1GJ8B 4FVDA 1FQ3A 3HKIB 2OC8A 3QK1A 5DP4A 2BD2A 3A87A 1AGJA 5L2ZH 5FPYA 1KY9A 3UFAA 1UVSH 3O8DA 1RRKA 4K69A 5EXNA 3ZVDA 1OWEA 1O2JA 2Q6GA 4XOJA 3QLPH 1LCYA 1DS2E 3OY5U 1DE7H 4MNVA 1MAXA 3KGPA 4ZKNU 2BOHB 4UD9H 1THRH 2C90B 4DT7B 1ZPZA 1J15A 3GY3A 1K9OE 1TA2A 2V6NA 3VFEA 1GHBF 4CHAB 1AN1E 4UEHH 4TPIZ 1D3QB 3OTJE 5TCAA 1CGJE 2F91A 2PGQB 2BOKA 2P3UB 4X1SU 2AMQA 4YOJA 3UR6A 2P95A 4GVUA 2GV7A 4LXBH 1W3CA 1V2JT 4TWYA 1XKBC 5LH8A 1GVKB 1JRTA 1Z8GA 3V7TA 4A6LA 3MH7A 1GBBA 2A32A 1WBGB 1IOEA 1V2UT 2FOMB 2ALVA 2GV6A 5DP5A 3Q3YA 1F92A 2Q6DA 2OTVA 2P8OB 2FX6A 4Y6DA 1KXBA 1UTKA 1GBCA 3RMMH 4BAKB 2C8YB 3TK5A 2G52A 3SZNA 1TBZH 1YLCA 5BRRE 1FNIA 3Q77A 2FXRA 2OUAA 4ESTE 1CQQA 3MH4A 1CT2E 1LKBA 2V3HH 2F83A 1BMLA 1W7XH 1U6QA 2FMJA 1FDPA 1IQNA 3KQEA 3UUZA 1P11E 1S6FA 3SGBE 1MTSA 3S9CA 1H9HE 4XE4A 2Y82A 3RXPA 4D9QA 1PQ7A 4X6OA 1OWDA 4A1XA 2B0FA 2OD3B 3C1KA 3QZQA 2WPJS 3B8JA 4ABJA 1Z1JA 1KDQB 5DP8A 1TONA 1YPGH 2ZF0H 1BMNH 4BTIB 4AN7A 2H1UA 1UTJA 4X0WU 3DA9B 3K9XB 1A5IA 1A5HA 1EOLA 1G37A 1GI3A 2BLWA 3K65B 5J4SA 1UTPA 2TBSA 1GBFA 4ABDA 1RXPA 1J14A 4HGCA 3SNDA 1CO7E 4Y8ZA 3GCTG 1NFYA 2AEIH 3SI3H 1BRCE 1O3NA 5FX6A 2QXJA 1TYNA 5GPIB 2GMTB 1UCYE 1MZDA 1Z8JB 1FIWA 4JZ1A 1O2LA 4U01A 5DG6A 2STAE 1SR5C 1GJ5H 1T32A 1NN6A 3RXQA 3BF6H 2FI3E 2JETC 2FI5E 1PFXC 1QRXA 3A88A 1ZLRA 4X6MA 2YOLA 3SJOA 4AFSA 2UWPA 1GBKA 4FUFA 3ESTA 3D62A 2XC4A 1P9UA 2XBWA 1HJAC 1Y3YA 1BCUH 1NY22 1TGBA 3RXIA 4TY6A 4OS5A 4AGJA 1V2PT 1RTKA 4IC6A 3QX5H 1HAVA 2GCTC 2CJIA 3SUDA 2ZFQH 1TE0A 3NCLA 1QB1A 1KTSB 1GGDB 2VWOA 2ZFRH 3W95A 1HXFH 1LQEA 1MKWH 2BZAA 3KHVA 2QGRA 4VGCB 2C3SA 4Y11E 2C8WB 2Y80A 3P8NA 1P2QA 6LPRA 2TPIZ 2ANMH 4I32A 3GDVA 3SU3A 3V3MA 2FOCA 1SLVB 2XBXA 3A84A 1YPEH 1VCWA 4BOHA 1A3BH 3QUMP 3A7XA 3M3TA 2ZDAH 4MNWA 1NZQH 1ZPCA 1KLTA 1O2KA 4Q80A 1ESBA 3T5FH 2QXHA 1P2OA 4WMDA 1PYTC 2GVFA 1FY8E 1KLJH 4WXIA 2QN5T 1QR3E 1YF4A 3PM3A 3H5CB 3PMBB 4Y79A 1HDTH 3PWBA 1TBRH 3PLPA 3BIVH 3L3TA 1OYTH 2VGCC 3T25A 1TNIA 1KXAA 5JB9S 2SGPE 1O5FH 1P03A 1EPTA 3SI4H 2XC5A 2FI4E 1YPJH 3I78A 1A1RA 3MYWA 4FUEA 2FEQH 4MPWA 1O3CA 5A8ZA 4D76A 4I8LA 1QL7A 1AKSB 4KGAA 4RKOB 2B8OH 2ZHEH 2P16A 4B2AA 1AFQB 2ZGJA 3PYHA 1ESAA 1UO6A 1SI5H 1BBRE 1PPBH 1GCTC 1GL0E 4NA7A 1T8OA 2R3UA 1SLXB 5EGMA 5JB8S 2D26C 2NWNA 1CE5A 4O3TA 8LPRA 1G36A 1GHVH 3GY6A 1JWTA 1OP0A 2GCHF 2R2WU 3DD2H 2I6SA 2FYQA 1ETSH 1TQ0B 5A2MH 1L2EA 1SGFA 1ZSLA 4WXVA 3GYLB 4J2YB 1BMAA 2PGBB 2UWOA 3QTVH 4XDEA 3GDSA 1A7SA 5HXFA 1SQAA 2Y5FA 1N1LA 3RXRA 1SOTA 2A5IA 4CRGA 1FV9A 5E0JA 2O9QA 1AFEH 1O2ZA 2AFQB 1GI9B 1O3IA 2A5KA 3A83A 4U2WA 2OQUA 6CHAB 1RGQA 3GCHB 1VGCC 1WAYB 1UVPA 1ZHMA 1Y3VA 1O38A 4X8SH 1MTNC 2XCFA 3MH5A 1K1PA 3M3SA 1SHYA 1QFKH 1VITG 1QL9A 2VJ1A 1SGYE 4JCNA 1O36A 1D3TB 2GZ7A 1ANCA 4IBLH 4AFQA 2AERH 1O3PB 3STJA 4UFGH 1PJPA 3TNSA 1ABJH 3LIWA 2J4IA 4BNRA 3LC5A 3RLYH 4HTCH 1GBLA 1O34A 1BTXA 3ATMA 3URCA 2PKSB 5ETXA 2QC2A 3SN8A 1SB1H 1DUEA 4Z0KA 1NT1A 2F9NA 1TQ7B 2IOTA 3O8BA 5E0GA 3MNXA 3LGVA 1TBQH 1BRAA 4B73A 1MAYA 4GSOA 4ABFA 3SQHE 1XVOA 1MD8A 1CGHA 4NSVA 4E06H 5JDUB 5I46H 1QTFA 1BOQA 2FESH 1CT4E 3M61U 2VWMA 3TNTA 2VNTA 4OS2A 1K21H 3HPTB 3BTGE 1O2VA 1TGNA 2HGTH 2ZFSA 1EATA 1P3CA 1C1SA 4KELA 1C5NH 7LPRA 2CHAB 1D6WA 1DWBH 3FP7E 2A7JA 4ISIH 1O3FA 8ESTE 4CR5A 3M7TA 1RTLA 1FAXA 5ESBA 2GTBA 3MI4A 2J2UA 1H1BA 4I8KA 3BTEE 3RMOH 1EP6A 1N6YA 2WV5A 2ZNKH 3ZZ9A 4X1QU 2WPKS 3P6ZB 4FUIA 1GBHA 4LZ1H 3BEUA 1GHYH 2VVVA 1DDJA 3RMNH 4TY7A 3UNRA 1DVAH 3SNEA 3UY9A 3VPKA 4FUBA 5FHTA 1TMUH 3U9AH 1QA7A 4GAWA 5A0CA 1UCYH 4B71A 1TB6H 1JIRA 1FZZA 1MTWA 1JMOH 4WJG2 2J95A 2OBQA 3DUXH 1C2IA 4K3JA 1SGIB 4SGAE 1O5CB 1IQHA 2WPMS 5HMAA 1AZZA 2PHBA 4OGYA 1C5XB 3RXMA 1CGIE 3ZZ3A 3LJJA 1GJ9B 1UHBB 5DP9A 3ZZ8A 4BANB 4OS6A 1G3CA 1LHGH 3MMGA 1S81A 4I33A 4UFFH 1EQ9A 4ZKSU 1UVUH 1O2QA 1J17T 1Y3XA 3AW0A 1RFNA 1FN6A 3NKKA 4XBDA 2XWBI 2QXGA 3SU5A 1GBIA 3P92A 2ZWLH 1P09A 3ZZAA 1Y59T 1O37A 2XC0A 3E16B 5FPTA 4ZHLU 3A8BA 1W0YH 1XUGA 3GY8A 1TOCB 2FLBH 2VB0A 3ZYEA 2V3OH 3SW2B 2EC9H 1NRRH 3GICB 1NESE 1BHXF 1CBWC 5F8TA 1E38B 1XX9A 5PTPA 2TRMA 1VJ9U 2OC7A 2ZG0H 1TNJA 1WQSA 5EQQA 1C5LH 1RIWB 1GG6C 2KAIB 2PW8H 4FUJA 3SGQE 3SNCA 1W7GH 2PKAA 2A4QA 2O8LA 3TJVA 1DICA 2FTMA 1ELAA 4GHTA 1K1MA 1C4V2 1B0EA 2QF3A 3LKWA 3WY8A 5C20A 4Y7AA 3AW1A 1GDUA 2TGDA 1Y8TA 1ELTA 4Y0YE 1C1UH 4A7IB 2EA3A 4MQAA 1AB9B 1A0LA 1DOJA 2FODA 4RKJB 1C5SA 2P59A 3N7OA 5EQSA 2K1QA 2BQWB 1O3KA 3RXFA 2SGEE 4O03A 2D1JA 1ZTKA 3T28A 2Z3DA 3ATLA 3M35A 2GZ8A 1TAWA 3ZVAA 4B2BA 2FS8A 5DP3A 5A0AE 2FTLE 2ZGHA 4KTSA 4UFDH 1B5GH 1TA6A 1V3XA 1C2GA 5A8YA 2ZFPH 4NZQA 5LPRA 1GBEA 4JZFH 5EPNA 1UMAH 3T29A 1TIOA 1Z1IA 2B9LA 1SLUB 6GCHF 2BD7A 4MTBA 5T6GA 2F9OA 1AY6H 1Q2WA 3LH1A 1PPEE 2BTCE 3K2UA 1PQ8A 1N8OC 4X6NA 3SJIA 2YNBA 4YM9A 2Y5GA 1BBRH 1EP5A 1XVMA 2FOEA 4H4FA 1HAOH 1TALA 5GWZA 1DLEA 1ZR0A 4TWWA 1V2KT 2ZECA 4I7YH 1TMTH 5T6FA 4NIYA 1GMCF 3ZZ6A 5E8EH 2HPQH 2SGDE 4B76A 9LPRA 1FI8A 4H6TA 4YESB 4AG2A 3HK6B 1TX6A 4NIVA 1ELVA 4NWLA 1C1QA 6ESTA 4F4OC 3CS7A 4MVNA 1E0FD 1UVOA 5GJ4B 2BVXH 3RP2A 3QGNB 1CU1A 3RU4E 2J9NA 1AVGH 1PPGE 2H5DA 3BTFE 4UFEH 1MBQA 1LPKB 4BAMB 4TYDA 3PO1C 4AB8A 1EXFA 1GI8B 3MNCA 1SG8B 1T4UH 1F7ZA 1TPOA 1GWAA 1IHTH 1INCA 3I77A 1IAUA 1A4WH 3E0PB 1S5SA 3ODFA 4A1TA 4B2CA 5GCHF 1SGFG 2XWAA 4UONA 2ZC9H 2FZZA 1BTUA 2G4TA 5C2ZA 2HVXA 3ZZ4A 1OKXA 5TCCA 4DCDA 3E1XB 4JZDH 4WMEA 3BSQA 3ZZCA 3E90B 3SU2A 1UK3A 3ATWA 1MZAA 1SGEE 2Q1JA 5EW2H 1S85A 3FP8E 1UK2A 4KKDA 1XXDA 1FY5A 3F6UH 2A4GA 4CRAA 1O2WA 1TGTA 1YP9A 4FUDA 4KTUA 2ZHQH 1UVTH 2NU4E 5FCRA 1BUIA 3RXKA 1CA0C 2FOBA 3ZYDA 1MQ5A 1FY4A 1YGCH 1B7XB 4XBBA 3VXEH 3MU4A 3M7UA 3NUMA 3UQOA 1GI4A 4WMFA 1TRMA 2ZGXH 4Q7ZA 5C1XA 3B9FH 5ESTE 2QIQA 3RXAA 3GCNA 4MNXA 2J38A 2BVRH 4YLUA 5DP7A 3BIUH 3KIDU 3H7TA 1D3PB 1QQ4A 3V13A 3SJ8A 3VB6A 1A46H 2UWLA 4NIWA 2BX4A 1K28D 4MPUA 2ZFTA 2F9VA 4E7NA 3UOUA 2QV1A 1LHEH
chains in the Genus database with same CATH superfamily
1CHOF 3T27A 2FO9A 1LHFH 3MNBA 1C9PA 4JYVH 1V6DA 1EZUC 1QURH 1NRSH 1K1NA 3P17H 2R9PA 1O2TA 1EPTB 3PV4A 5CDFE 4MDSA 1GHAF 4RN6A 1ZRBA 5AFZH 2WPLS 3VB4A 1GJBB 3STIA 1GL1A 1GVZA 3LU9B 2BLQA 1ID5H 4O97A 4X8VH 1TPSA 1OOKB 1L1JA 4D8NA 1O3OA 1O2UA 2B5TB 4WVPE 3E6PH 4ZHMU 4I86A 1GI5A 2JH6D 3RXDA 3SUEA 3GISB 5IYTA 1QB9A 1GI7B 2Z9LA 1B0FA 1MU8B 3UB0A 1SGDE 2WSSD 3KN2A 1C5MD 2H9HA 2JDID 1FPHH 2J92A 1G3DA 1W0ZU 4FUGA 3S69A 4CBOA 1A5GH 5KEDA 2FWWA 2RG3A 4XSKU 2KCAA 3S7HB 4B75A 2CMYA 4WH8A 4A5TS 3KEEA 2EEKA 2Z6BD 3Q00A 1SGNE 1P0SH 3DT0H 3A85A 1IQKA 1MQ6A 1HAPH 1WTHD 5HIZA 2BDGA 2R0LA 1J9CH 1V2LT 1GCDA 2BY7X 1TX8A 2LPRA 1AIXH 1HAXB 1OX1A 3BTQE 1FXYA 2BLVA 2SGFE 1GMDG 1O3BA 1L1NA 3TH3H 4P00A 3FFGA 1EAXA 1FUJA 8GCHF 2VVUA 2WYGA 1FONA 1L0ZA 2XOKD 1VR1H 2OC0A 1EJNA 1VCPA 4X2YA 3VGCB 1GI2A 2BD4A 2UUFB 2ZU1A 1D6RA 3HGPA 4H6SB 1QCPA 1MH0A 4IMZA 2FS9A 2ZHWH 2ILNA 3PMHB 2F3CE 4MPVA 1HJ8A 5C3NA 1O2GH 1O33A 3EYDA 4FUHA 1YCPM 1EB2A 5CMXH 2JH5D 3M37A 1BQYA 1C5TA 1SL3A 1D4PB 3KNXA 1EZQA 1FJSA 5DGJA 1C2FA 2AIQA 1NU7B 1YWUA 1QGFA 2A2XH 1GJAB 2QF0A 1V2RT 4YZUA 4YO9A 1BHXB 3BEIB 2SNVA 3BTKE 2L6OA 2CF9H 3LGIA 1ELBA 1JXPA 2AGIX 2BXUH 1XXFA 2ZCKP 2IN2A 3MU1A 1NFXA 1P57B 4IN2A 5GNDA 1P02A 2GT8A 2PR3A 3BG4B 1GVLA 3RMLH 4AX9H 5K7RA 3LDXH 1GBJA 1FAKH 2RA0A 5H4IB 4B1TA 2VIQA 5HGGA 2SGAA 2BDBA 1GJCB 1CHGA 2ZO3H 4FU8A 1C5YB 1DT2A 1FN8A 1HB0B 2I6QA 5C1YA 2Z9IA 3E8LA 3ATIA 1C4Y2 1FLEE 1HAYB 1E1RD 1DSTA 3TGIE 1DPOA 2GT7A 1ZMNA 5DPAA 1EASA 3EDXB 3TIUA 4R0IA 2G00A 1G3EA 1TRYA 3OY6U 3KF2A 3FOAA 1P01A 1FMGA 1GMHF 1QL8A 1QRWA 1AE8H 4Y0ZE 3UTUH 1WUNH 2XBYA 4CHAC 3LPRA 2VVCA 1A0HB 3UOPA 5IDKA 1P2JA 1WSSH 1GHBG 4K1TA 3V12A 1BTZA 3ELAH 1W13U 1YCPH 4D9RA 3DSGA 4OS7A 1YKTA 3TH2H 3UWIA 1V2VT 2ZPSA 1AO5A 1OPHB 4IN1A 1ZGIA 1QHRB 4ZMAH 1E36B 1W12U 2BDIA 1GDQA 2KX4A 4FUCA 1FPCH 4X2WA 1AMHA 2ZU4A 3EA7A 2P8OC 4XFQA 3F2HA 1BIOA 2VIOA 1DWCH 3TLOA 4FU9A 1A0JA 2Z9GA 4E7RG 2A4OA 2YMSD 4AFZA 2ZGCA 2W5EA 5A8XA 1WYKA 4MPXA 4ISLA 1YM0A 4X1RU 4NA8A 1PPZA 1KDQA 1PYTD 3TU7H 3FN8A 1HAZB 3BN9A 2G81E 4AG1A 1P12E 2PKAB 1G9IE 2IPHA 1HYLA 3F9FA 3SV9A 4DIHH 1C2LA 2BDCA 1C2JA 3UNSA 2GD4B 3PMJA 2ODQA 1ZYOA 5E0HA 2ZU5A 3SORA 1PPHE 4ABBA 1BTPA 2JH0D 3L6PA 2ZA5A 4YT6H 3AASA 3RXEA 1WU1A 2PWXA 4NIXA 2ZHFH 1MKXK 1VITH 4XRNA 3SU0A 2UUYA 3EAJA 1DY9A 1XUJA 3MTYA 3TGJE 5DSFA 4MG3A 5FX5A 2JKHA 1HUTH 2RDEA 3Q76A 1SSXA 5SGAE 2BZ6H 2WPIS 4NWKA 1ARBA 1TLDA 1NBME 1TNHA 2BQ7B 2ESTE 3CENA 2BYAX 1K1LA 5EQRA 4JMYA 1AVWA 2H2ZA 5FCKA 2GMTC 2TGAA 5EOKA 1DXPA 2FLRH 3FVFB 1EX3A 4NFFA 1AUJA 1BTYA 1KMHB 3EA9A 2R3YA 1ZSJA 1TPAE 1PPFE 1E37B 2ZHDA 3ENSB 1GDNA 3PMAB 4X8TH 1WOFA 1OP8A 4LZ4B 3O8CA 4ABAA 3U1IB 1SQTA 1C1PA 2BY9X 1AUTC 1LMWB 4BTUB 4Y8YA 3EGKH 3SJ9A 2RA3A 1ZJKA 2G5NA 1T4VH 1O39A 1NFWA 1QBOA 3MQKC 3DHKH 4K1EA 3FZZA 4X1PU 2OC1A 2HRVA 2ZU2A 3QN7A 1QJ1B 1Y5BT 1V2NT 7GCHF 1O2XA 2RCEA 1LHDH 2WUCA 1QBVH 3GYMA 3SBKA 1O2SA 1GGDC 3BV9B 1QB6A 1V2WT 1ETTH 4K60A 1GHZA 1EAUA 2QA9E 1Z71A 4VGCC 3LH3A 5CHAB 2AMDA 4ZH8A 2R0KA 4D7GA 3GY7A 1BJUA 2VBCA 2AMPA 5FBIA 2O8UA 2VWLA 4YTAA 3V0XA 1YLNA 1O0DH 1C5OH 1P3EA 2A1DB 1C2EA 1TFXA 3A8DA 1EAWA 2AYWA 2ZU3A 2ZZUH 5HM2A 2BMGB 2XBVA 2XYAA 4CREA 1CSOE 1TGCA 4F49A 4RSPA 1MTUA 1P06A 3SNBA 3ZZ5A 4YOIA 1UJ1A 4YXWD 2PSXA 1LVYA 1HV7A 1QA0A 2OINA 1F5RA 5I25A 1XUHA 2HWLB 3VB5A 2UUKB 1C5WB 5FAHA 1SOZA 2P3TB 4D7FA 3LJOA 1DWDH 2ZDMA 3A7WA 1K0HA 1P2KA 3BTHE 5FXLA 1ZJDA 3MO9A 1X7AC 1BRUP 1O2OA 3RM0H 2D2DA 3RLWH 1YC0A 1C5PA 2AGEX 2WV9A 3RXSA 4DG4A 2BD8A 1PQAA 1AZ8A 1SHHB 4UDWH 1V2TT 5TJXA 1F0SA 1E79D 1ZZZA 1O3GA 2GKVE 1T8LA 1XUIA 1VKYA 3VXFH 1CT0E 2F9PA 1ELCA 2HLDD 2KFWA 1H9IE 3OYPA 1LVOA 3RXGA 1MCTA 2FPZA 1K1IA 1SQOA 2A0QB 2ZTYA 1AFQC 1ELEE 2Y6TA 2DE8A 3TJUA 1LKAA 1O5BB 1HCGA 3ZV8A 1C1RA 1S84A 2ZDLA 4BTTB 1MCVA 2SGQE 1O3EA 3A7YA 2PFEA 4ZXXH 1JIMA 1L1GA 3LONA 1BMMH 4K2YA 1DM4B 1ESTA 1G30B 2GCHG 2W26A 2A5AA 4RT1A 1TMBH 1EZSC 1F0UA 2JJ2D 1COWD 4Q7YA 1ANEA 6CHAC 1NFUA 2FYRA 1DLKB 1XMNB 3GCHC 3PWCA 3MH6A 1HAGE 4IC5A 2TGTA 1MKWK 5FBEA 3SHAH 1C2HA 2L74A 1CVWH 4THNH 1HAHH 3URDA 3ATKA 3E0NB 3SU4A 1W14U 3GCTF 1MMJN 2J34A 2KZ4A 2FP7B 4I8GA 4AZ2B 4Q7XA 4NGAH 4NSYA 3GCOA 3F2GA 1NPMA 4O9VA 2OBOA 3KL6A 4Q4LA 1O2YA 1ZPBA 1XUKA 3JZ1B 4JK5A 1Y5UT 2PKSC 1LO6A 1AQ7A 1NROH 2K0QA 4IW4E 1F0TA 1O2RA 1O3DA 1C1MA 2STBE 2JETB 1T8MA 4YLQH 3T2NA 1TRNA 3B23B 4K8YA 1BTHH 2P93A 5JBBS 4CRFA 1QQUA 4Q63A 4M7GA 4X8UH 1UTLM 3T26A 3JZ2B 5LPEA 1TNKA 1HJAB 1FY1A 4I31A 2HLCA 1PQ5A 5AHGH 3F9EA 1LQDB 3SV8A 5A09A 1J8AA 1UTQA 1LTOA 2TIOA 2CHAC 1SPJA 2XRCA 4ZKRU 2GCTB 3U1JB 1HRTH 3A7TA 3F0PA 2PUXB 2PSYA 3UWJH 1AD8H 3D65E 2WPDD 1ABIH 3RXUA 1F5LA 3NWUA 4YT7H 5EXLA 3IWMA 5C94A 3ITIA 5EJLA 1QBNA 4BAHB 5L2YH 2FOFA 4SGBE 1OSSA 5JBTA 1M9UA 5IK2D 1DXWA 1C9TA 2WV4A 3NZIA 1P2IA 8KME2 4ZHAA 1KXCA 1GPZA 3Q3XA 2V7QD 5E2PA 3BTWE 1UTNA 4Y10E 1F5KU 3RC5A 1T7CA 3SZEA 1HAVB 2FOHA 3NPSA 5LGOA 2YMSB 1ELFA 3VEQB 2FOAA 3SOSA 5J4QA 3RC4A 1OYQA 2CV3A 3ZVFA 1W2KH 2KR7A 1VZQH 3EQ0H 2A7CA 4NZLA 2WPHS 1Z6JH 1MTVA 3RXTA 3P70B 1Y3UA 2ZQ2A 2ZCLP 2ZCHP 1C5QA 4ZROA 3R3GB 3H7OA 3DCLA 5T6DA 2ALPA 2ODPA 2VGCB 2F9BH 2KAIA 4WF8A 3C27B 2C8XB 3MFJA 1O3HA 1C2MA 3KYGA 2F9UA 3ZZ7A 1BMFD 5EG4A 4FOUC 1WCZA 3RXBA 4ABEA 1GBTA 3TPIZ 4M9FA 2A4RA 1KSNA 1HPGA 4R8TB 1EKBB 2ZI2H 4E05H 5EPYA 4GCHG 4INKA 2NU2E 2V35A 1GBDA 1HBTH 1Z8RA 2WYJA 2ODYB 2ZDNA 3DFJA 4CRCA 1BITA 2W7SA 1TX7A 1RIWC 1O5GH 1GCTB 1O30A 4LK4A 2ZDVH 1OWHA 1P2NA 3DSPA 1S0QA 1KYNA 1ZRKA 3P8FA 2OP9A 1MU6B 1VCQA 4B74A 2FOGA 1O2IA 1Q3XA 1SLWB 2PTCE 3QTOH 2OQ5A 5T3HA 2CK3D 4X6PA 2TGPZ 3RUOA 4FVBA 2NU1E 2D8WA 3LOXA 1ZHPA 3FZDA 4NA9H 1IQIA 1AB9C 2IJD1 1HNEE 3A82A 4ISNA 1BDAA 1V2QT 1UW7A 1OWJA 4X2VA 1TNLA 4GPGA 1BZXE 1H8ED 4I8HA 1EZXC 5L6NH 2QYIA 1WQVH 5C1UA 1LHCH 2ZKSA 2HPPH 1VGCB 1ACBE 1VITF 4GLYA 4U30A 2P3FH 3M5OA 3SV2H 2KCOA 3P8OA 1ZTJA 1MTNB 1SMFE 1IHSH 5ABWA 5AVDA 1V2ST 2EY4C 1QNJA 1GI0A 3S9BA 1ANBA 3OU0A 4CRBA 2C8ZB 1ORFA 2ZPQA 4ISOA 1IQJA 1EOJA 1TGSZ 5GXPA 3NK8A 3AK5A 4AGKA 3ZVGA 2WHXA 4CR9A 2ULLA 4DIIH 1AU8A 1HIAA 1UCYK 3E91A 5L30H 2DUCA 3E3TA 3MOCA 3OEED 6GCHG 4QT8C 1ELGA 2GP9B 2V0BA 3GOVB 4DW2U 4FU7A 4GUXA 1O3AA 1P04A 2BY8X 3QDZB 1QRZA 3FANA 1O2NA 1OWKA 2XNDD 1NRNH 2LNCA 1GHWH 1J16A 1AI8H 2GJGA 1A2CH 4GHQA 1EB1H 1RS0A 3A89A 2AIPA 1P05A 4CBNA 3QGJA 1G2MA 4AB9A 1OWIA 2IPQX 4XBCA 5EXMA 2ANKH 2PLXA 3U69H 2ZGBH 2XW9A 3AAUA 2VWNA 2R2MB 1O5DH 1S83A 1DX5M 2O8MA 3HKJB 4Y7BA 1C1NA 1FX0B 4DOQA 1S0RA 2C4FH 1GMCG 3BG8A 1WDIA 1Z8IB 4K5ZA 2FX4A 4Y71A 2Z3CA 4BAOB 3TJNA 3QWCH 3P8GA 3SYJA 5BPEA 4OS4A 3NRLA 1G3BA 1SFIA 4B6FA 3K6ZA 4H42U 1ZMJA 5DJ7A 1DWEH 3ODDA 3LT3A 2ASUB 2XTTB 1AWHB 1T8NA 1LPGB 3AAVA 2IJOB 2A31A 2Y81A 4Z6AH 3SUGA 2DE9A 1F0RA 5C5OA 1O3MA 2ZPRA 2G8TA 3RXOA 4CH8B 4ASHA 2EI7A 4ABHA 4K8BA 1UK4A 5JBAS 1THSH 2CGAA 3SGAE 3M36A 1GJ7B 1C4U2 1P2MA 2ANYA 2VH6A 1L4DA 5DO4H 1SGRE 3T62A 4IMQA 3MWIU 1L4ZA 5GCHG 1HXEH 3MU0A 3KQCA 4DY7B 3F9HA 2Z9KA 3GY2A 1G2LA 4U32A 5F8XA 2A7HA 1JOUB 1CA8B 2BD5A 1DSUA 4A1VA 3TK6A 1C1VH 1XUFA 3TGKE 3FP6E 4IGDA 4KP0A 3RXHA 2BDHA 1W0JD 1HAIH 2AS9A 1H8DH 4JZIA 2GZ9A 4Q2KA 2A45B 4AOQA 3S9AA 1AHTH 1D3DB 2PUQH 1K2I1 1THPB 1O35A 1LVMA 3P95A 1GBMA 1KIGH 1NRPH 4OS1A 1CBWB 2EI6A 3UREA 1PPCE 2THFB 2JJ1D 3M5MA 1BBRK 2AH4X 1BRBE 3UPEA 3AVZA 1GG6B 2BLOA 4AORA 1YPHC 9ESTA 1P9SA 1GJ6A 1ANDA 1GJ4H 4DURA 4OGXA 2V3MA 2ZP0H 3A8CA 1GBAA 5EU8A 1O3LA 3TITA 3OSYA 2BD3A 2Z7FE 1Y5AT 2HNTC 3FAOA 1IQEA 3RXCA 3S7KB 3TJOA 5B6OA 1JBUH 3G01A 5E2OA 1YPHE 1NO9H 1T31A 3SU1A 5F03A 4K1SA 3IITA 1BTWA 1C5RA 1K1OA 1UTMA 1CHOG 3VB7A 2HNTE 3PLKA 5F8ZA 1EPTC 5EODA 1BB0B 3EE0B 3MU5A 1FIZA 1HJ9A 2QY0B 1ZGVA 4PROA 3OX7U 1O5EH 4DVAU 1GHAG 1O32A 1RJXB 1Y3WA 5HM9A 3KCGH 5HYOA 4Z1MD 4TPYA 1E34B 3BEFB 5EW1H 3N7DA 5CE1A 2EI8A 2BDAA 1NM6A 3BTTE 2XCNA 2H6MA 4ABGA 1A3EH 1ZSKA 1MBMA 3KYFA 2PTNA 2O8TA 3IG6B 1N8OB 1QJ6B 3HATH 1TWXB 5K0HA 4NCYA 3RC6A 4AYVB 4MNYA 2ZIQH 1AE5A 5GDSH 1BA8B 2YNAA 2QCYA 2HNTF 2ZTXA 1DITH 3UR9A 1EUFA 3MU8A 3F68H 4X2XA 2G4UA 3S0NA 3SV6A 1O2MA 1GI6A 4NFEA 2Q6FA 4AYYB 1SC8U 2B7DH 1YPLH 1NRQH 4Y8XA 4LOYH 1XKAC 1JRSA 1NU9A 3I29A 3A86A 4JYUH 1F2SE 2OXSA 2G5VA 1RD3B 4ABIA 3LGWA 2W3KA 1BJVA 3HGNA 3ZZBA 2WZQA 3SNAA 2ZDKA 1TOMH 2Z3EA 4INLA 2BB4A 2H5CA 3LC3A 1KXFA 4A92A 1GJDB 1MD7A 2BDYA 3UIRA 3A7ZA 1YPKH 1ZTLA 3VGCC 8GCHG 1H8IH 2F43B 2WUBA 1DY8A 1VJAU 2VU8E 4JK6A 3PO1B 1A61H 2UUJB 1IQFA 1DUAA 2Z9JA 2VINA 1ZMLA 2O8WA 2HOBA 1ZHRA 1SBWA 1ELDE 1YY3A 7KMEH 1YBWA 3RXLA 5C5NA 1RTFB 3GY5A 2ZEBA 3ZVEA 2J94A 2Y7XA 3RXVA 1AWFH 5DK1A 2GDDA 5DKMA 4B6EA 1EJAA 4AFUA 1OHHD 2QXIA 3A8AA 3TK9A 5F53A 3ZVCA 2GX4A 3KQDA 2OLGA 1DANH 2CF8H 3MHWU 4ZKOU 2VIVA 2AHME 5C0TA 2XXLA 5C67A 3TVJB 1WV7H 3CS0A 1OS8A 3PLBA 3BG4C 3F0OA 1O2PA 4KTCA 3TH4H 4ISHH 1KTTB 3QO6A 4CH2B 2CN0H 1QZ8A 3CP7A 4YOGA 4RI0A 2W7UA 1IQLA 3SJKA 1WXRA 1AKSA 3D23A 4BAQB 1CA0B 5FPSA 1XM1A 3U8RH 1C1OA 3SHCH 5AF9H 2BX3A 4HI3A 3VB3A 3L33A 5JPMH 3F9GA 3PTNA 2SNWA 4OM9A 3NXPA 4J1YA 1S6HA 1E1QD 1ZOMA 2OCVB 2Z94A 1S82A 1QY6A 5DP6A 1W8BH 1D9IA 1SGPE 1SVPA 3MO3A 4WH6A 4GCHF 1LVBA 2NU0E 1QJ7B 1N6XA 2W6JD 1BT7A 1C2KA 3RDZA 4ZAEA 1GMHG 1O2HA 2BY6X 7ESTE 3ZV9A 1YLDA 1IQMA 3D49H 1SGTA 2H9EH 1LPZB 1HLTH 3ZVBA 5A0BA 1Z7KA 2Y5HA 4HFPB 3M5LA 1K1JA 3MO6A 3GY4A 2ANWA 2VIWA 4Y76A 2P94A 3SV7A 1HFDA 2QAAA 3R0FA 2FIRH 1EFRD 2H9TH 5F6MA 2WINI 3W94A 1MUEB 1H4WA 4X1NU 3LGUA 3PRDA 1KXEA 2BVSH 4IS5A 1C1WH 2A2QH 2BM2A 5G4BA 3F1SB 2HALA 3LGYA 3PB1E 3SQEE 3UNQA 1K22H 2CXVA 3ZZDA 4ZUHA 1GHXH 1SGQE 4O3UA 3PTBA 2FDAA 1E35B 1EAIA 2ZFFH 2BY5X 2VIDA 2FM2A 4FXGH 4CRDA 1NS3A 3BTME 1HGTH 4I8JA 1H9LB 2XNIA 3F3BA 3QZRA 1ARCA 1AVXA 3K6YA 2SFAA 3A80A 2AGGX 1Q31A 2NU3E 1FY3A 1SGCA 1YYY1 3DFLA 1O3JA 2BQ6B 2J98A 2C93B 4UE7H 2ZTZA 4BXWA 2Y7ZA 3O8RA 1GMDF 4JYTA 3M3VA 3PROA 4MLFB 2M5TA 1TABE 3OEHD 3RM2H 2G51A 2VIPA 1QIXB 3M5NA 3RXJA 1W11U 4NG9H 1KLIH 1V2OT 1W10U 1Z6EA 3M7QA 1HIAB 1O31A 2BXTH 3UQVA 1NTPA 4P02A 1P8VC 3Q3KA 3SUFA 1NC6A 2RDLA 3EA8A 1OXGA 3WWFA 3SO3A 4JZEH 1EJMA 1TPPA 1ETRH 5JYIA 1DFPA 3GDUA 4ZXYH 3LGTA 1OP2A 1C5ZB 3PV5A 2PV9B 1C5UA 1KXDA 1P10A 4F55A 5GIBA 3SU6A 1O5AB 5JBCS 3A7VA 1TNGA 1YPMH 1GI1A 3U8TH 1UHBA 1C1TA 1YCPK 4DGJA 2G55A 3HK3B 1C2DA 2VH0A 4WWYA 1LDTT 2ZQ1A 5LPFA 1SFQB 3RU4T 1UTOA 2BD9A 2GDEH 4DJZB 3VG8A 1MKXH 7GCHG 1C5VA 1IQGA 1V2MT 2W3IA 3U8OH 4HZHA 4AC9A 1G32B 3U98H 3KQBA 5CHAC 4WY3A 4INHA 3A81A 2GGVB 1WTGH 4BXSA 2BHGA 3BTDE 5AFYH 3MNSA 3RU4D 1GJ8B 4FVDA 1FQ3A 3HKIB 2OC8A 5KGOA 3QK1A 5DP4A 3FKSD 2BD2A 3A87A 1AGJA 5L2ZH 5FPYA 1KY9A 1H8HD 3UFAA 1UVSH 3O8DA 5FL7D 1RRKA 4K69A 5EXNA 3F2FA 3ZVDA 1OWEA 1O2JA 2Q6GA 4XOJA 3QLPH 1LCYA 1DS2E 3OY5U 1DE7H 4MNVA 1MAXA 3KGPA 4ZKNU 1MABB 2BOHB 4UD9H 1THRH 2C90B 4DT7B 1ZPZA 1J15A 3GY3A 1K9OE 1TA2A 2V6NA 3VFEA 3FO8D 1GHBF 4CHAB 1AN1E 4UEHH 4TPIZ 1D3QB 3OTJE 5TCAA 1CGJE 2F91A 2PGQB 2BOKA 2P3UB 4X1SU 2AMQA 4YOJA 3UR6A 2P95A 4GVUA 2GV7A 4LXBH 1W3CA 1V2JT 4TWYA 1XKBC 5LH8A 1GVKB 1JRTA 1Z8GA 3V7TA 4A6LA 4ZCNA 3MH7A 1GBBA 2A32A 1WBGB 1IOEA 1V2UT 2FOMB 2ALVA 2GV6A 5DP5A 3Q3YA 1F92A 2Q6DA 5B6LA 2OTVA 2P8OB 2FX6A 4Y6DA 1KXBA 1UTKA 1GBCA 3RMMH 4BAKB 2C8YB 3TK5A 2F4LA 2G52A 3SZNA 1TBZH 1YLCA 5BRRE 1FNIA 3Q77A 2FXRA 2OUAA 4ESTE 1CQQA 3MH4A 1CT2E 1LKBA 2V3HH 2F83A 1BMLA 5DN6D 1W7XH 1U6QA 2FMJA 1FDPA 1IQNA 3KQEA 1W0KD 3UUZA 1P11E 1S6FA 3SGBE 1MTSA 3S9CA 1H9HE 5EIYA 4XE4A 2Y82A 2QF5A 3RXPA 4D9QA 1PQ7A 4X6OA 5C0UA 1OWDA 4A1XA 2B0FA 2OD3B 3C1KA 3QZQA 2WPJS 3B8JA 4ABJA 1Z1JA 1KDQB 5DP8A 1TONA 1YPGH 2ZF0H 1BMNH 4BTIB 4AN7A 2H1UA 1UTJA 4X0WU 3DA9B 3K9XB 1A5IA 3N7EA 5T1VA 1A5HA 1EOLA 2KCPA 5HKKD 1G37A 1GI3A 2BLWA 3K65B 5J4SA 1UTPA 2TBSA 1GBFA 4ABDA 1RXPA 1J14A 4HGCA 3SNDA 1CO7E 4Y8ZA 3GCTG 1NFYA 2AEIH 3SI3H 1BRCE 1O3NA 5FX6A 2QXJA 1TYNA 5GPIB 2GMTB 2PP6A 1UCYE 1MZDA 1Z8JB 1FIWA 4JZ1A 1O2LA 4U01A 5DG6A 2STAE 1SR5C 1GJ5H 1T32A 1NN6A 3RXQA 2QE7D 3BF6H 2FI3E 2JETC 4XD7D 2FI5E 1PFXC 1QRXA 3A88A 1ZLRA 4X6MA 2YOLA 3SJOA 4AFSA 2UWPA 1GBKA 4FUFA 3ESTA 3D62A 2XC4A 1P9UA 3GS9A 2XBWA 1HJAC 1Y3YA 1BCUH 1NY22 4ACBA 1TGBA 3RXIA 4TY6A 4OS5A 4AGJA 1V2PT 1RTKA 4IC6A 3QX5H 5C17A 1HAVA 2GCTC 2CJIA 3SUDA 2ZFQH 1TE0A 3NCLA 1QB1A 1KTSB 1GGDB 2VWOA 2ZFRH 3W95A 1HXFH 1LQEA 1MKWH 2BZAA 3KHVA 2QGRA 3KQ5A 4VGCB 2C3SA 4Y11E 2C8WB 2Y80A 3P8NA 1P2QA 4FETA 6LPRA 2TPIZ 2ANMH 4I32A 4F48B 3GDVA 3SU3A 3V3MA 2FOCA 1SKYE 5CHBA 4ASUD 1SLVB 2XBXA 3A84A 5HIYA 2JIZD 1YPEH 3UAIC 1VCWA 4BOHA 4RT0A 1A3BH 3N99A 3QUMP 2YMSC 3A7XA 3M3TA 2ZDAH 4MNWA 1NZQH 1ZPCA 1KLTA 1O2KA 4Q80A 1ESBA 3T5FH 2QXHA 1P2OA 4WMDA 1PYTC 2GVFA 1FY8E 1KLJH 4WXIA 2QN5T 1QR3E 1YF4A 2M2AA 3PM3A 3H5CB 3PMBB 4Y79A 1HDTH 3PWBA 1TBRH 3PLPA 3BIVH 3L3TA 1OYTH 2VGCC 2OK5A 3T25A 3W1EA 1TNIA 1KXAA 3OTPA 5JB9S 2SGPE 1O5FH 1P03A 1EPTA 3SI4H 2XC5A 2FI4E 1YPJH 3I78A 1A1RA 3MYWA 3WWBA 4FUEA 2FEQH 4MPWA 1O3CA 5A8ZA 4HG6A 4D76A 4I8LA 1QL7A 1AKSB 4KGAA 4RKOB 2B8OH 2RFKC 2ZHEH 2P16A 4B2AA 1AFQB 2ZGJA 3PYHA 1ESAA 1UO6A 1SI5H 1BBRE 1PPBH 1GCTC 1GL0E 4NA7A 1T8OA 2R3UA 4TSFD 1SLXB 5EGMA 5JB8S 2D26C 2NWNA 1CE5A 4O3TA 8LPRA 1G36A 1GHVH 3GY6A 1JWTA 1OP0A 2GCHF 2R2WU 3DD2H 2I6SA 2FYQA 1ETSH 1TQ0B 5A2MH 1L2EA 1SGFA 1ZSLA 4WXVA 3GYLB 4J2YB 1BMAA 2PGBB 2UWOA 3QTVH 4XDEA 3GDSA 1A7SA 5HXFA 1SQAA 2Y5FA 1N1LA 3RXRA 1SOTA 2A5IA 4CRGA 1FV9A 5E0JA 2O9QA 1AFEH 1O2ZA 2AFQB 1GI9B 1O3IA 2A5KA 1SQRA 3A83A 4U2WA 2OQUA 6CHAB 1RGQA 3GCHB 1VGCC 1WAYB 5KECA 1UVPA 1ZHMA 1Y3VA 1O38A 4X8SH 1MTNC 2XCFA 3MH5A 1K1PA 3M3SA 1SHYA 1QFKH 1VITG 1QL9A 2VJ1A 1SGYE 4JCNA 1O36A 1D3TB 2GZ7A 1ANCA 4IBLH 4AFQA 2AERH 1O3PB 3STJA 4UFGH 1PJPA 3TNSA 1ABJH 3LIWA 2J4IA 4BNRA 3LC5A 3RLYH 4HTCH 2W6ID 1GBLA 1O34A 1BTXA 3ATMA 3URCA 2PKSB 5ETXA 2QC2A 3SN8A 1SB1H 1DUEA 4Z0KA 1NT1A 2F9NA 1TQ7B 2IOTA 3O8BA 5E0GA 3MNXA 3LGVA 1TBQH 1BRAA 5EJ1A 4B73A 1MAYA 4GSOA 4ABFA 3SQHE 1XVOA 1MD8A 1CGHA 4NSVA 4E06H 5JDUB 5I46H 1QTFA 1BOQA 2FESH 1CT4E 3M61U 3PV2A 3CNRA 2VWMA 3TNTA 2VNTA 4OS2A 1K21H 3HPTB 3BTGE 1O2VA 1TGNA 2HGTH 2ZFSA 3OE7D 1EATA 1P3CA 1C1SA 2J98B 4KELA 3WW7A 1C5NH 7LPRA 2CHAB 1D6WA 1DWBH 2KCYA 3FP7E 2A7JA 4ISIH 1O3FA 8ESTE 4CR5A 3M7TA 1RTLA 1FAXA 3ZIAD 5ESBA 2GTBA 3MI4A 2J2UA 1H1BA 4I8KA 3BTEE 3RMOH 1EP6A 1N6YA 2WV5A 2ZNKH 3ZZ9A 1NBMD 4X1QU 2WPKS 3P6ZB 4FUIA 2EQNA 2LELA 1GBHA 4LZ1H 3BEUA 1GHYH 2VVVA 1DDJA 3RMNH 4TY7A 3UNRA 1DVAH 3SNEA 3UY9A 3VPKA 4FUBA 5FHTA 1TMUH 3U9AH 1QA7A 4GAWA 5A0CA 1UCYH 4B71A 1TB6H 1JIRA 1FZZA 1MTWA 1JMOH 4WJG2 3OAAD 2J95A 2OBQA 3DUXH 1C2IA 4K3JA 1SGIB 4SGAE 1O5CB 1IQHA 2WPMS 5HMAA 1AZZA 2PHBA 4OGYA 1C5XB 3RXMA 1CGIE 3ZZ3A 3LJJA 3PRBA 1GJ9B 1UHBB 5DP9A 3ZZ8A 4TT3D 4BANB 4OS6A 4DT4A 1G3CA 1LHGH 3MMGA 1S81A 4I33A 4UFFH 1EQ9A 4ZKSU 1UVUH 1O2QA 1J17T 1Y3XA 3AW0A 1RFNA 1FN6A 3NKKA 4XBDA 2XWBI 2QXGA 3SU5A 1GBIA 3P92A 2ZWLH 1P09A 3ZZAA 1Y59T 1O37A 2XC0A 3E16B 5FPTA 4ZHLU 3A8BA 1W0YH 1XUGA 3GY8A 1TOCB 2FLBH 2VB0A 3ZYEA 2V3OH 3SW2B 2EC9H 1NRRH 3GICB 1NESE 1BHXF 1CBWC 5F8TA 1E38B 1XX9A 5PTPA 2TRMA 1VJ9U 2OC7A 2ZG0H 1TNJA 1WQSA 5EQQA 1C5LH 1RIWB 1GG6C 2KAIB 2PW8H 4FUJA 3SGQE 3SNCA 1W7GH 2PKAA 2A4QA 2O8LA 3TJVA 1DICA 2QF4A 2FTMA 1ELAA 4GHTA 1K1MA 1C4V2 1B0EA 2QF3A 3LKWA 3WY8A 2HVYB 5C20A 4Y7AA 3AW1A 3EE7A 1GDUA 2TGDA 1Y8TA 1ELTA 4Y0YE 1C1UH 4A7IB 2EA3A 2J5UA 4MQAA 1AB9B 1A0LA 1DOJA 2FODA 4RKJB 1C5SA 2P59A 3N7OA 5EQSA 2K1QA 2BQWB 1O3KA 3RXFA 2SGEE 4O03A 2D1JA 1ZTKA 3T28A 2Z3DA 3ATLA 3M35A 2GZ8A 1TAWA 3ZVAA 4B2BA 2FS8A 5DP3A 5A0AE 2FTLE 2ZGHA 4KTSA 4UFDH 1B5GH 1TA6A 1V3XA 1C2GA 5A8YA 2ZFPH 4NZQA 5LPRA 1GBEA 4JZFH 5EPNA 1UMAH 3T29A 1TIOA 1Z1IA 2B9LA 1SLUB 6GCHF 5EJZA 2BD7A 4MTBA 5T6GA 2F9OA 1AY6H 1Q2WA 3LH1A 1PPEE 2BTCE 3K2UA 1PQ8A 1N8OC 4X6NA 3U28C 3SJIA 2YNBA 4YM9A 2Y5GA 1BBRH 1EP5A 1XVMA 4ACAA 2FOEA 4H4FA 1HAOH 1TALA 5GWZA 1DLEA 1ZR0A 4TWWA 1V2KT 2ZECA 4I7YH 1TMTH 5T6FA 4NIYA 1GMCF 3ZZ6A 5E8EH 2HPQH 2SGDE 4B76A 2LP6A 9LPRA 1FI8A 4H6TA 4YESB 2J97A 4AG2A 3HK6B 1TX6A 4NIVA 1ELVA 3OFND 4NWLA 1C1QA 6ESTA 4F4OC 3CS7A 4MVNA 1E0FD 1UVOA 5GJ4B 2BVXH 3RP2A 3H09A 3QGNB 1CU1A 3RU4E 2J9NA 1AVGH 1PPGE 2H5DA 3BTFE 4UFEH 1MBQA 1LPKB 4BAMB 4TYDA 3PO1C 4AB8A 1EXFA 1GI8B 3MNCA 1SG8B 1T4UH 1F7ZA 1TPOA 1GWAA 1IHTH 1INCA 3I77A 1IAUA 1A4WH 3E0PB 1S5SA 3DSOA 3ODFA 1S6LA 4A1TA 4B2CA 2K8IA 5GCHF 1SGFG 2XWAA 4UONA 2ZC9H 2FZZA 1BTUA 2G4TA 5C2ZA 2HVXA 3ZZ4A 1OKXA 5TCCA 4DCDA 3E1XB 4JZDH 4WMEA 3BSQA 3ZZCA 3E90B 3SU2A 1UK3A 3ATWA 1MZAA 1SGEE 2Q1JA 5EW2H 1S85A 3FP8E 1UK2A 4KKDA 1XXDA 1FY5A 3F6UH 2KM0A 2A4GA 4CRAA 1O2WA 1TGTA 1YP9A 4FUDA 4KTUA 2ZHQH 1UVTH 2NU4E 5FCRA 1BUIA 3RXKA 1CA0C 2FOBA 3ZYDA 1MQ5A 1FY4A 1YGCH 1B7XB 4XBBA 3VXEH 3MU4A 3M7UA 3NUMA 3UQOA 1GI4A 4WMFA 1TRMA 2ZGXH 4Q7ZA 5C1XA 3B9FH 5ESTE 2QIQA 3RXAA 3GCNA 4MNXA 2J38A 2BVRH 4YLUA 5DP7A 3BIUH 3KIDU 3H7TA 1D3PB 1QQ4A 3V13A 3SJ8A 3VB6A 1A46H 2UWLA 4NIWA 2BX4A 1K28D 4MPUA 2ZFTA 2F9VA 4E7NA 3UOUA 2QV1A 1LHEH
chains in the Genus database with same CATH topology
1CHOF 3T27A 2FO9A 1LHFH 3MNBA 1C9PA 4JYVH 1V6DA 1EZUC 1QURH 1NRSH 1K1NA 3P17H 2R9PA 1O2TA 1EPTB 3PV4A 4MDSA 1GHAF 4RN6A 1ZRBA 5AFZH 2WPLS 3VB4A 1GJBB 3STIA 1GL1A 1GVZA 3LU9B 2BLQA 1ID5H 4O97A 4X8VH 1TPSA 1OOKB 1L1JA 4D8NA 1O3OA 1O2UA 2B5TB 4WVPE 3E6PH 4ZHMU 1GI5A 2JH6D 3RXDA 3SUEA 3GISB 5IYTA 1QB9A 1GI7B 2Z9LA 1B0FA 1MU8B 1SGDE 3KN2A 1C5MD 2H9HA 1FPHH 2J92A 1G3DA 1W0ZU 4FUGA 3S69A 4CBOA 1A5GH 2FWWA 2RG3A 4XSKU 3S7HB 4B75A 2CMYA 4WH8A 4A5TS 3KEEA 2EEKA 2Z6BD 3Q00A 1SGNE 1P0SH 3DT0H 3A85A 1IQKA 1MQ6A 1HAPH 1WTHD 2BDGA 2R0LA 1J9CH 1V2LT 1GCDA 2BY7X 1TX8A 2LPRA 1AIXH 1HAXB 1OX1A 3BTQE 1FXYA 2BLVA 2SGFE 1GMDG 1O3BA 1L1NA 3TH3H 3FFGA 1EAXA 1FUJA 8GCHF 2VVUA 2WYGA 1FONA 1L0ZA 1VR1H 2OC0A 1EJNA 1VCPA 4X2YA 3VGCB 1GI2A 2BD4A 2UUFB 2ZU1A 1D6RA 3HGPA 4H6SB 1QCPA 1MH0A 4IMZA 2FS9A 2ZHWH 2ILNA 3PMHB 2F3CE 4MPVA 1HJ8A 5C3NA 1O2GH 1O33A 3EYDA 4FUHA 1YCPM 1EB2A 5CMXH 2JH5D 3M37A 1BQYA 1C5TA 1SL3A 1D4PB 3KNXA 1EZQA 1FJSA 5DGJA 1C2FA 2AIQA 1NU7B 1QGFA 2A2XH 1GJAB 2QF0A 1V2RT 4YZUA 4YO9A 1BHXB 3BEIB 2SNVA 3BTKE 2CF9H 3LGIA 1ELBA 1JXPA 2AGIX 2BXUH 1XXFA 2ZCKP 2IN2A 3MU1A 1NFXA 1P57B 4IN2A 1P02A 2GT8A 2PR3A 3BG4B 1GVLA 3RMLH 4AX9H 5K7RA 3LDXH 1GBJA 1FAKH 2RA0A 5H4IB 4B1TA 2VIQA 5HGGA 2SGAA 2BDBA 1GJCB 1CHGA 2ZO3H 4FU8A 1C5YB 1DT2A 1FN8A 1HB0B 2I6QA 5C1YA 2Z9IA 3E8LA 3ATIA 1C4Y2 1FLEE 1HAYB 1DSTA 3TGIE 1DPOA 2GT7A 1ZMNA 5DPAA 1EASA 3EDXB 3TIUA 4R0IA 2G00A 1G3EA 1TRYA 3OY6U 3KF2A 1P01A 1FMGA 1GMHF 1QL8A 1QRWA 1AE8H 4Y0ZE 3UTUH 1WUNH 2XBYA 4CHAC 3LPRA 2VVCA 1A0HB 3UOPA 5IDKA 1P2JA 1WSSH 1GHBG 4K1TA 3V12A 1BTZA 3ELAH 1W13U 1YCPH 4D9RA 4OS7A 1YKTA 3TH2H 3UWIA 1V2VT 2ZPSA 1AO5A 1OPHB 4IN1A 1ZGIA 1QHRB 4ZMAH 1E36B 1W12U 2BDIA 1GDQA 4FUCA 1FPCH 4X2WA 1AMHA 2ZU4A 3EA7A 2P8OC 4XFQA 1BIOA 2VIOA 1DWCH 3TLOA 4FU9A 1A0JA 2Z9GA 4E7RG 2A4OA 4AFZA 2ZGCA 2W5EA 5A8XA 1WYKA 4MPXA 4ISLA 1YM0A 4X1RU 4NA8A 1PPZA 1KDQA 1PYTD 3TU7H 1HAZB 3BN9A 2G81E 4AG1A 1P12E 2PKAB 1G9IE 2IPHA 1HYLA 3F9FA 3SV9A 4DIHH 1C2LA 2BDCA 1C2JA 3UNSA 2GD4B 3PMJA 2ODQA 1ZYOA 5E0HA 2ZU5A 3SORA 1PPHE 4ABBA 1BTPA 2JH0D 3L6PA 2ZA5A 4YT6H 3AASA 3RXEA 1WU1A 2PWXA 4NIXA 2ZHFH 1MKXK 1VITH 3SU0A 2UUYA 3EAJA 1DY9A 1XUJA 3MTYA 3TGJE 4MG3A 5FX5A 2JKHA 1HUTH 3Q76A 1SSXA 5SGAE 2BZ6H 2WPIS 4NWKA 1ARBA 1TLDA 1TNHA 2BQ7B 2ESTE 3CENA 2BYAX 1K1LA 5EQRA 4JMYA 1AVWA 2H2ZA 5FCKA 2GMTC 2TGAA 5EOKA 1DXPA 2FLRH 3FVFB 1EX3A 4NFFA 1AUJA 1BTYA 3EA9A 2R3YA 1ZSJA 1TPAE 1PPFE 1E37B 2ZHDA 3ENSB 1GDNA 3PMAB 4X8TH 1WOFA 1OP8A 4LZ4B 3O8CA 4ABAA 3U1IB 1SQTA 1C1PA 2BY9X 1AUTC 1LMWB 4BTUB 4Y8YA 3EGKH 3SJ9A 2RA3A 1ZJKA 2G5NA 1T4VH 1O39A 1NFWA 1QBOA 3DHKH 4K1EA 3FZZA 4X1PU 2OC1A 2HRVA 2ZU2A 3QN7A 1QJ1B 1Y5BT 1V2NT 7GCHF 1O2XA 2RCEA 1LHDH 2WUCA 1QBVH 3GYMA 3SBKA 1O2SA 1GGDC 3BV9B 1QB6A 1V2WT 1ETTH 4K60A 1GHZA 1EAUA 2QA9E 1Z71A 4VGCC 3LH3A 5CHAB 2AMDA 4ZH8A 2R0KA 4D7GA 3GY7A 1BJUA 2AMPA 5FBIA 2O8UA 2VWLA 4YTAA 3V0XA 1O0DH 1C5OH 1P3EA 2A1DB 1C2EA 1TFXA 3A8DA 1EAWA 2AYWA 2ZU3A 2ZZUH 5HM2A 2BMGB 2XBVA 2XYAA 4CREA 1CSOE 1TGCA 4F49A 4RSPA 1MTUA 1P06A 3SNBA 3ZZ5A 4YOIA 1UJ1A 2PSXA 1LVYA 1HV7A 1QA0A 2OINA 1F5RA 5I25A 1XUHA 2HWLB 3VB5A 2UUKB 1C5WB 5FAHA 1SOZA 2P3TB 4D7FA 3LJOA 1DWDH 2ZDMA 3A7WA 1P2KA 3BTHE 5FXLA 1ZJDA 3MO9A 1X7AC 1BRUP 1O2OA 3RM0H 2D2DA 3RLWH 1YC0A 1C5PA 2AGEX 3RXSA 4DG4A 2BD8A 1PQAA 1AZ8A 1SHHB 4UDWH 1V2TT 5TJXA 1F0SA 1ZZZA 1O3GA 2GKVE 1T8LA 1XUIA 3VXFH 1CT0E 2F9PA 1ELCA 1H9IE 3OYPA 1LVOA 3RXGA 1MCTA 2FPZA 1K1IA 1SQOA 2A0QB 2ZTYA 1AFQC 1ELEE 2Y6TA 2DE8A 3TJUA 1LKAA 1O5BB 1HCGA 3ZV8A 1C1RA 1S84A 2ZDLA 4BTTB 1MCVA 2SGQE 1O3EA 3A7YA 2PFEA 4ZXXH 1JIMA 1L1GA 3LONA 1BMMH 4K2YA 1DM4B 1ESTA 1G30B 2GCHG 2W26A 2A5AA 1TMBH 1EZSC 1F0UA 4Q7YA 1ANEA 6CHAC 1NFUA 2FYRA 1DLKB 1XMNB 3GCHC 3PWCA 3MH6A 1HAGE 4IC5A 2TGTA 1MKWK 5FBEA 3SHAH 1C2HA 1CVWH 4THNH 1HAHH 3URDA 3ATKA 3E0NB 3SU4A 1W14U 3GCTF 1MMJN 2J34A 2FP7B 4I8GA 4AZ2B 4Q7XA 4NGAH 4NSYA 3GCOA 1NPMA 4O9VA 2OBOA 3KL6A 1O2YA 1ZPBA 1XUKA 3JZ1B 4JK5A 1Y5UT 2PKSC 1LO6A 1AQ7A 1NROH 4IW4E 1F0TA 1O2RA 1O3DA 1C1MA 2STBE 2JETB 1T8MA 4YLQH 3T2NA 1TRNA 3B23B 4K8YA 1BTHH 2P93A 5JBBS 4CRFA 1QQUA 4M7GA 4X8UH 1UTLM 3T26A 3JZ2B 5LPEA 1TNKA 1HJAB 1FY1A 4I31A 2HLCA 1PQ5A 5AHGH 3F9EA 1LQDB 3SV8A 5A09A 1J8AA 1UTQA 1LTOA 2TIOA 2CHAC 1SPJA 2XRCA 4ZKRU 2GCTB 3U1JB 1HRTH 3A7TA 2PUXB 2PSYA 3UWJH 1AD8H 3D65E 3RXUA 1ABIH 4YT7H 1F5LA 3NWUA 5EXLA 3IWMA 3ITIA 1QBNA 4BAHB 5L2YH 2FOFA 4SGBE 1OSSA 5JBTA 1M9UA 1DXWA 1C9TA 2WV4A 3NZIA 1P2IA 8KME2 4ZHAA 1KXCA 1GPZA 3Q3XA 5E2PA 3BTWE 1UTNA 4Y10E 1F5KU 3RC5A 1T7CA 1HAVB 2FOHA 3NPSA 5LGOA 1ELFA 3VEQB 2FOAA 3SOSA 5J4QA 3RC4A 1OYQA 2CV3A 3ZVFA 1W2KH 1VZQH 3EQ0H 2A7CA 4NZLA 2WPHS 1Z6JH 1MTVA 3RXTA 3P70B 1Y3UA 2ZQ2A 2ZCLP 2ZCHP 1C5QA 4ZROA 3R3GB 3H7OA 5T6DA 2ALPA 2ODPA 2VGCB 2F9BH 2KAIA 4WF8A 3C27B 2C8XB 3MFJA 1O3HA 1C2MA 2F9UA 3ZZ7A 5EG4A 1WCZA 3RXBA 4ABEA 1GBTA 3TPIZ 2A4RA 1KSNA 1HPGA 4R8TB 1EKBB 2ZI2H 4E05H 5EPYA 4GCHG 4INKA 2NU2E 2V35A 1GBDA 1HBTH 1Z8RA 2WYJA 2ODYB 2ZDNA 3DFJA 4CRCA 1BITA 2W7SA 1TX7A 1RIWC 1O5GH 1GCTB 1O30A 4LK4A 2ZDVH 1OWHA 1P2NA 1S0QA 1KYNA 1ZRKA 3P8FA 2OP9A 1MU6B 1VCQA 4B74A 2FOGA 1O2IA 1Q3XA 1SLWB 2PTCE 3QTOH 2OQ5A 5T3HA 4X6PA 2TGPZ 3RUOA 4FVBA 2NU1E 2D8WA 3LOXA 1ZHPA 3FZDA 4NA9H 1IQIA 1AB9C 1HNEE 3A82A 4ISNA 1BDAA 1V2QT 4X2VA 1OWJA 1TNLA 4GPGA 1BZXE 4I8HA 1EZXC 5L6NH 2QYIA 1WQVH 5C1UA 1LHCH 2ZKSA 2HPPH 1VGCB 1ACBE 1VITF 4GLYA 4U30A 2P3FH 3M5OA 3SV2H 3P8OA 1ZTJA 1MTNB 1SMFE 1IHSH 5ABWA 5AVDA 1V2ST 1QNJA 1GI0A 3S9BA 1ANBA 3OU0A 4CRBA 2C8ZB 1ORFA 2ZPQA 4ISOA 1IQJA 1EOJA 1TGSZ 5GXPA 3NK8A 4AGKA 3ZVGA 4CR9A 2ULLA 4DIIH 1AU8A 1HIAA 1UCYK 3E91A 5L30H 2DUCA 3E3TA 3MOCA 6GCHG 4QT8C 1ELGA 2GP9B 2V0BA 3GOVB 4DW2U 4FU7A 4GUXA 1O3AA 1P04A 2BY8X 3QDZB 1QRZA 3FANA 1O2NA 1OWKA 1NRNH 2LNCA 1GHWH 1J16A 1AI8H 1A2CH 4GHQA 1EB1H 1RS0A 3A89A 2AIPA 1P05A 4CBNA 3QGJA 1G2MA 4AB9A 1OWIA 4XBCA 5EXMA 2ANKH 2PLXA 3U69H 2ZGBH 2XW9A 3AAUA 2VWNA 2R2MB 1O5DH 1S83A 1DX5M 2O8MA 3HKJB 4Y7BA 1C1NA 4DOQA 1S0RA 2C4FH 1GMCG 3BG8A 1Z8IB 4K5ZA 2FX4A 4Y71A 2Z3CA 4BAOB 3TJNA 3QWCH 3P8GA 5BPEA 4OS4A 1G3BA 1SFIA 3K6ZA 4H42U 1ZMJA 5DJ7A 1DWEH 3ODDA 3LT3A 2ASUB 2XTTB 1AWHB 1T8NA 1LPGB 3AAVA 2IJOB 2A31A 2Y81A 4Z6AH 3SUGA 2DE9A 1F0RA 5C5OA 1O3MA 2ZPRA 2G8TA 3RXOA 4CH8B 4ASHA 2EI7A 4ABHA 4K8BA 1UK4A 5JBAS 1THSH 2CGAA 3SGAE 3M36A 1GJ7B 1C4U2 1P2MA 2ANYA 2VH6A 1L4DA 5DO4H 1SGRE 3T62A 4IMQA 3MWIU 1L4ZA 5GCHG 1HXEH 3MU0A 3KQCA 4DY7B 3F9HA 2Z9KA 3GY2A 1G2LA 4U32A 5F8XA 2A7HA 1JOUB 1CA8B 2BD5A 1DSUA 4A1VA 3TK6A 1C1VH 1XUFA 3TGKE 3FP6E 4IGDA 4KP0A 3RXHA 2BDHA 1HAIH 2AS9A 1H8DH 4JZIA 2GZ9A 4Q2KA 2A45B 4AOQA 3S9AA 1AHTH 1D3DB 2PUQH 1K2I1 1THPB 1O35A 1LVMA 3P95A 1GBMA 1KIGH 1NRPH 4OS1A 1CBWB 2EI6A 3UREA 1PPCE 2THFB 3M5MA 1BBRK 2AH4X 1BRBE 3UPEA 3AVZA 1GG6B 2BLOA 4AORA 1YPHC 9ESTA 1P9SA 1GJ6A 1ANDA 1GJ4H 4DURA 4OGXA 2ZP0H 3A8CA 1GBAA 5EU8A 1O3LA 3TITA 3OSYA 2BD3A 2Z7FE 1Y5AT 2HNTC 3FAOA 1IQEA 3RXCA 3S7KB 3TJOA 5B6OA 1JBUH 3G01A 5E2OA 1YPHE 1NO9H 1T31A 3SU1A 5F03A 4K1SA 3IITA 1BTWA 1C5RA 1K1OA 1UTMA 1CHOG 3VB7A 2HNTE 3PLKA 5F8ZA 1EPTC 5EODA 1BB0B 3EE0B 3MU5A 1FIZA 1HJ9A 2QY0B 1ZGVA 4PROA 3OX7U 1O5EH 4DVAU 1GHAG 1O32A 1RJXB 1Y3WA 5HM9A 3KCGH 5HYOA 4TPYA 1E34B 3BEFB 5EW1H 5CE1A 2EI8A 2BDAA 1NM6A 3BTTE 2XCNA 2H6MA 4ABGA 1A3EH 1ZSKA 1MBMA 2PTNA 2O8TA 3IG6B 1N8OB 1QJ6B 3HATH 1TWXB 5K0HA 4NCYA 3RC6A 4AYVB 4MNYA 2ZIQH 1AE5A 5GDSH 1BA8B 2YNAA 2QCYA 2HNTF 2ZTXA 1DITH 3UR9A 1EUFA 3MU8A 3F68H 4X2XA 2G4UA 3S0NA 3SV6A 1O2MA 1GI6A 4NFEA 2Q6FA 4AYYB 1SC8U 2B7DH 1YPLH 1NRQH 4Y8XA 4LOYH 1XKAC 1JRSA 1NU9A 3I29A 3A86A 4JYUH 1F2SE 2OXSA 2G5VA 1RD3B 4ABIA 3LGWA 2W3KA 1BJVA 3HGNA 3ZZBA 3SNAA 2ZDKA 1TOMH 2Z3EA 4INLA 2BB4A 2H5CA 3LC3A 1KXFA 4A92A 1GJDB 1MD7A 2BDYA 3UIRA 3A7ZA 1YPKH 1ZTLA 3VGCC 8GCHG 1H8IH 2WUBA 1DY8A 1VJAU 2VU8E 4JK6A 3PO1B 1A61H 2UUJB 1IQFA 1DUAA 2Z9JA 2VINA 1ZMLA 2O8WA 2HOBA 1ZHRA 1SBWA 1ELDE 7KMEH 1YBWA 3RXLA 5C5NA 1RTFB 3GY5A 2ZEBA 3ZVEA 2J94A