1W11U

Urokinase type plasminogen activator
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w11U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w11U01
2BZ6H 4MPXA 1ZTLA 2BDCA 1FN6A 1DE7H 1IAUA 3OU0A 4QT8C 1B0EA 4JCNA 1BRBE 4U2WA 3SQHE 1C1SA 1DLEA 2BD5A 2QGRA 3BSQA 1SGNE 2ZO3H 1SVPA 1MTUA 2GX4A 4CR9A 2Y6TA 3PYHA 2Z3EA 2ZGBH 1TNJA 3MU0A 2O8TA 4AB9A 4GCHF 2VIDA 1LHDH 2XWBI 2LNCA 1ZGVA 2QXGA 3F9EA 1ZHPA 1XUKA 3H7TA 1WSSH 3B9FH 1GBEA 3RXEA 5K0HA 4IMQA 3URDA 4E7NA 5DP7A 7GCHG 2VVUA 4Y8ZA 2H2ZA 3MHWU 1P3EA 4O9VA 2OCVB 3FFGA 1G3DA 4D9RA 2I6SA 2ZIQH 3E6PH 1ZHRA 3S0NA 2WYJA 1V2RT 1EAXA 4KTUA 3SN8A 3CP7A 3LU9B 1D3PB 1AHTH 2Z9IA 3PWBA 1RIWB 1C2FA 1F5KU 1LCYA 1UCYH 3ODFA 4K5ZA 5L2ZH 1EPTC 3ZZ7A 5T3HA 3KQBA 1O3KA 1S81A 3FP8E 3HKJB 2SGFE 4I8JA 1AB9B 1GJBB 3UPEA 1HAGE 3GYLB 3LJOA 3ZVGA 2H5CA 1TNGA 1C5SA 1O3GA 2FYRA 4BAQB 1N8OC 2GCHF 4ASHA 4NA8A 1LVOA 4Y10E 5DP6A 3RXOA 3A82A 3M61U 3M36A 1EJAA 2HVXA 1P2OA 1DSUA 1DFPA 1BMAA 1DANH 4CRBA 3KF2A 1HDTH 1O34A 1SHHB 1E35B 1QRWA 4IN1A 1MD8A 1A3EH 1GHZA 1CBWC 1OP8A 4J1YA 3MU5A 1EXFA 1P02A 2R9PA 3C27B 3SUEA 4UONA 2W7SA 4D7FA 1QJ1B 4TPIZ 4NWLA 3GY3A 3UFAA 3GDVA 4O97A 1Z7KA 3LC5A 1AFQC 1GJ8B 4ISIH 2Y5HA 3SW2B 3ZVEA 2W26A 4AFZA 1PPBH 2K1QA 1CA0B 3KNXA 3ESTA 1YPHC 2G4UA 3P8OA 4A1VA 3VB3A 3LT3A 1O3NA 3T25A 2TBSA 3KHVA 4DW2U 1JXPA 3OY5U 1SGTA 4X6PA 1C1OA 3PMBB 3UTUH 2KAIA 2OC1A 1GCDA 2OLGA 2ZU3A 4K69A 4TWYA 1F0SA 4ZH8A 6LPRA 1GMDG 1CE5A 2A2XH 1A5IA 3RDZA 3UOUA 2ZDVH 5E0JA 5FAHA 1C5OH 2BMGB 2FOAA 3MO9A 1J15A 2QY0B 2VINA 4YLUA 4JYUH 2VWMA 4ABBA 1WQVH 3CENA 5F8TA 1PQ8A 1UVUH 1LTOA 2BM2A 1N6XA 3BIVH 1NFXA 3PB1E 3RXDA 4NZQA 4YO9A 2A2QH 1YPHE 5AFYH 2FP7B 1P12E 5K7RA 2OP9A 1FN8A 2C8ZB 2JETC 1SL3A 1TALA 2QXJA 3SU1A 3BTDE 1BMLA 2VGCB 3JZ2B 2W3IA 1DM4B 3T29A 1GI6A 1CHGA 1GI0A 1P9UA 2AIPA 3LJJA 3MO3A 1TAWA 3SV8A 5HYOA 3ZV9A 2XWAA 4D8NA 1O35A 1UTMA 1SGFA 4ZKSU 1UCYK 2BQ7B 3IG6B 1S82A 3QZRA 3PTBA 4UFFH 2C4FH 1YPKH 2J38A 2ZGHA 4GLYA 3P95A 1AVXA 4FVDA 1MH0A 5FPYA 1H9IE 1C5XB 3FZZA 3MO6A 3LH3A 2AGGX 2PKAA 2ZU1A 2D26C 4Q80A 1T32A 1WTGH 1NROH 2BOKA 3M7UA 1ANBA 3MNSA 3LOXA 3TNTA 1F0RA 4Y0YE 5HM2A 1P2QA 3B23B 1AVGH 1FI8A 3RLWH 3SOSA 4AOQA 1TQ0B 1MAXA 4ABAA 5JBBS 1YLCA 1O3AA 3RXPA 4WWYA 4BOHA 1GJDB 1QGFA 1XM1A 1LHEH 2F9NA 3K6ZA 1C5LH 3GY6A 4TY6A 1C2LA 1XKBC 2ZC9H 4UFEH 1ETRH 1TGTA 2BVSH 4CHAB 2FOBA 1CT2E 2GDEH 2VIPA 2WPKS 3TLOA 1MUEB 4HFPB 1IQMA 4MLFB 1G3BA 1TRYA 6GCHF 1JRTA 1ANDA 4YT6H 2A45B 1D4PB 1BRUP 2FZZA 3DD2H 1LPKB 2V3OH 5E8EH 3A83A 3GCOA 1KLTA 1RRKA 1YPMH 1K9OE 2Q6FA 4ZHLU 1HRTH 1O2MA 2ULLA 3MNBA 3LC3A 1TRNA 2ODPA 3LKWA 1P8VC 3QDZB 1TNLA 1GBCA 2FOGA 3SNCA 1XMNB 1C1NA 2VWOA 3SJ9A 1WTHD 5HMAA 1AZ8A 3DA9B 4X0WU 3ZZ9A 1XXFA 1NO9H 1GBMA 5A0BA 3T28A 3CS0A 3Q3XA 1VITH 3BTTE 3EDXB 2P59A 8ESTE 5AVDA 3NCLA 3MH6A 1HYLA 1NRPH 1XUGA 5L6NH 3F9HA 1TE0A 2G52A 3P8FA 4INLA 3H7OA 1BQYA 8LPRA 3RLYH 3W95A 1OYQA 4Y7AA 4I33A 1DITH 2Y7XA 1C5TA 2ZQ1A 1L4ZA 1O30A 2OC0A 4FUHA 4I8HA 1ZPZA 1YCPK 1SLXB 3SV6A 1HAZB 1UTKA 2ALPA 1S6HA 1G30B 4DJZB 3ZZAA 1WBGB 2CN0H 4ABGA 1ZPBA 2PSXA 3L3TA 1QIXB 1AN1E 1Z1IA 1AWHB 4ISOA 1S0QA 5FBEA 1AWFH 1W8BH 2Z3CA 2BY5X 2A1DB 3RXIA 3RXJA 1GBTA 3NPSA 2ZHEH 3BTQE 1W10U 1ZRKA 1ELFA 2FTMA 3TH2H 4IGDA 2J9NA 1GMCF 2P93A 3T5FH 2VVVA 4OS2A 2DE8A 3PTNA 5BPEA 2XBVA 3QN7A 3TPIZ 5E2OA 2BDIA 3C1KA 2VH6A 2GTBA 4NIYA 3SU6A 3RXRA 1BCUH 2QCYA 1JWTA 3TK9A 1TNHA 1O5DH 3D65E 1OSSA 2ZNKH 4K1EA 1CA8B 4MNXA 4RN6A 2R3YA 2JH6D 1VGCC 1W0ZU 3SGAE 1ZSKA 4Y8YA 5LGOA 1K28D 2R2MB 2ODQA 2ZTXA 2GCTC 4WF8A 1TGBA 4XFQA 3ZZDA 1P01A 1HJ9A 1WV7H 2GZ9A 1YF4A 2BDAA 5T6DA 1QQ4A 5CHAC 3TGKE 2SNVA 1O2WA 4Q2KA 2UUYA 3P6ZB 1A5GH 2FM2A 3TJNA 1NRQH 1EB1H 4TWWA 3Q76A 3NZIA 5L2YH 2QA9E 4KKDA 3NKKA 1P2MA 1GDNA 5FX5A 5HXFA 5DP5A 1PPZA 1UK4A 5C1YA 4CH8B 1O3MA 2IPHA 1W0YH 3P8GA 1T31A 1MBMA 5GCHG 2WINI 1K1LA 1SI5H 4RKJB 5JBCS 1P06A 1D3DB 2WPMS 1HAIH 3RXLA 4LXBH 4MNVA 5EPNA 4ABIA 4NWKA 5J4QA 5HM9A 3SV9A 3TIUA 1D3TB 1FZZA 1MTNB 1UVSH 2WUCA 3MU8A 1C5UA 2G81E 1NRNH 8KME2 4DIHH 1YC0A 2ZGCA 1V2TT 3PO1C 1THPB 1C1UH 1WCZA 3EA8A 2CHAB 1TGSZ 3LGTA 4XDEA 1ELDE 2EC9H 1GG6B 4I32A 1ESBA 1NFWA 2PTNA 2A5AA 3ATLA 1BRAA 3NUMA 4VGCB 4X2WA 3L6PA 8GCHF 4WXVA 1KIGH 1NM6A 1J8AA 1UTJA 5TCAA 4UFDH 1F5LA 1RIWC 1V2PT 1Y8TA 2GCHG 3TJUA 4X8SH 1C5PA 1Q31A 4NA7A 1QB6A 5C3NA 4X6NA 1BTXA 4NIWA 1NS3A 2KAIB 1AI8H 1EAWA 1QJ6B 1ZYOA 4OS5A 2ZFRH 1O36A 2Y82A 1ETSH 1W3CA 3EGKH 1EQ9A 2C8WB 4X1NU 1L0ZA 1G3CA 1BZXE 4IW4E 1O2LA 1QBVH 3PLKA 4H4FA 1ZTJA 3GDSA 3A86A 1C2KA 1GJAB 1K1OA 4O3TA 3RMNH 4UE7H 4CRAA 4MPUA 1T4VH 1IOEA 4H6TA 1OP2A 3O8DA 2Q6GA 1V2WT 3SNEA 1VJAU 1TMUH 1CQQA 5EXLA 1SBWA 1ARCA 3KEEA 3VGCB 4H6SB 4Z6AH 1QFKH 2STAE 3Q77A 1GI4A 1EP6A 4YTAA 4ZUHA 2AGEX 3TITA 1EPTA 2UUKB 1HLTH 2Y81A 4CR5A 1AE8H 1EASA 2ZHFH 4NA9H 1B0FA 3SU2A 4IC6A 1J17T 1QRXA 3SUGA 3KQDA 1PQAA 3S7HB 1EAIA 4KELA 1MTWA 2WPIS 2ANWA 3SI4H 2XCNA 4KTCA 1L1GA 3TJVA 3T26A 1O39A 1MD7A 4K3JA 4ESTE 4X8TH 1IQLA 1D3QB 2IN2A 2ZZUH 2P95A 2TPIZ 2OUAA 1THSH 4FUFA 2PKAB 1EZQA 1O2ZA 1OOKB 3A81A 4MG3A 3UIRA 4AG1A 3DFJA 4BXWA 2FIRH 1KDQA 5T6GA 2BD3A 4BAMB 5DPAA 3IITA 3VB7A 4AYVB 4YOIA 5L30H 2AMPA 2JKHA 1AQ7A 1O2KA 2HWLB 4JZIA 5ETXA 1J16A 1O5GH 5DG6A 3BG4C 2FLRH 2NU2E 2HRVA 3I77A 4ABDA 3A80A 3A8CA 2ZU2A 2PKSB 3BTHE 3RC4A 4CRDA 1V2LT 3A84A 1Z8GA 5H4IB 4A6LA 3A8BA 1A61H 4Y71A 3SU3A 2FS9A 1BBRH 1O2YA 1HAHH 1FV9A 1WAYB 1JIMA 3E0NB 3U9AH 3RU4T 4HI3A 3TH4H 1EJMA 3S7KB 3JZ1B 3QUMP 3KCGH 1CVWH 5CMXH 3M5MA 1L2EA 1SGRE 2BD8A 3ZVCA 4CBOA 4ZMAH 4IS5A 5JB9S 2XC0A 2XW9A 5GCHF 3V3MA 5B6OA 1OS8A 2EI8A 3ZZ6A 4GHTA 3FZDA 1C2MA 4A1XA 3BEIB 1LPGB 1C5RA 1QJ7B 2RCEA 1V2VT 2C8YB 2ZTYA 1RFNA 1BIOA 1DDJA 1QL9A 4ZKRU 2AYWA 2FOFA 1K2I1 4OGYA 1QURH 1AGJA 1TPPA 1B5GH 1C2DA 1GJ5H 4ZHAA 3Q3KA 4O3UA 3SGQE 1BRCE 2AIQA 4KTSA 3S69A 2W3KA 1U6QA 2P8OB 4B2BA 1UO6A 2FTLE 1IQEA 1P2NA 3MMGA 2C3SA 3GY2A 3ZZCA 2OBQA 3RMLH 1BJUA 1QB1A 2J2UA 3GDUA 6GCHG 1UVOA 1BT7A 1O2HA 4LZ1H 4AFSA 1NFYA 1AZZA 3BEUA 2HPPH 2R2WU 4ISLA 3VFEA 3RXVA 5A8XA 1FXYA 4Y8XA 4KGAA 3KN2A 1C1MA 3FP6E 3SJOA 3MOCA 3TGIE 1QQUA 2QF0A 1FMGA 3A7VA 1SLWB 3M5LA 1IHTH 3MU4A 5FPTA 1F0UA 1M9UA 1TYNA 4X1SU 5EQSA 4DT7B 1Y3WA 1W12U 1S83A 1PFXC 3EYDA 2VWNA 3RXQA 3QK1A 1SGYE 5DK1A 1OWKA 2ILNA 3SUDA 2Z94A 1AKSA 1PYTD 1E38B 1IQIA 4ZROA 3SV2H 2JH5D 2BQWB 1EZUC 1ZPCA 3OY6U 1TOCB 2ZDKA 1JOUB 1OPHB 2V0BA 3GCNA 3AW1A 4LK4A 1C4Y2 3KQCA 1EJNA 3RXCA 1ESTA 1MKXH 2ZPRA 2FOEA 1O2GH 4INKA 2FX4A 4UDWH 4Y6DA 3RXSA 2GDDA 1P04A 2H5DA 1T8LA 1EX3A 2B8OH 5A0AE 1OXGA 1YKTA 1P0SH 4SGAE 1GI3A 2Y5GA 1HGTH 2BD9A 2BD4A 1GL0E 3SZNA 2CJIA 1KY9A 1FY1A 2FI3E 3ATIA 3S9BA 1W2KH 2EI6A 5DO4H 1GMCG 1BBRK 1HFDA 2G8TA 2QF3A 1UVPA 2SGDE 3TNSA 3M3SA 1DXPA 2ZCLP 4HGCA 3AVZA 1K22H 2F9VA 4ISNA 5EU8A 1BHXB 1EOJA 1S84A 1MU8B 1GCTC 3M7QA 5AHGH 4ABHA 1P10A 4NSYA 1ELAA 3SHCH 1ACBE 1NU7B 3S9AA 2NU0E 1YCPH 3MH4A 3VB5A 3BTKE 4DVAU 1O5AB 1GJCB 1MAYA 2WV5A 3ZZ8A 1GDQA 3M37A 4D7GA 1HJAC 4IBLH 5FPSA 4ZXYH 4XE4A 7ESTE 3CS7A 1CT4E 4Q7YA 5GWZA 3U8TH 1TBQH 5DP9A 3GCHB 1PPGE 3RC6A 1DUAA 4A7IB 2BDBA 2PGQB 2GKVE 4AG2A 2BLOA 2H6MA 2V6NA 1UTPA 3EAJA 3RM2H 1OWJA 2SGQE 1Q3XA 3MH5A 4NFFA 1YPEH 1SB1H 2FS8A 1O3LA 1O2JA 2IJOB 1TMBH 1JRSA 1ZRBA 4CH2B 1BUIA 1GHYH 1FAKH 1HAVB 1H9LB 1ZJDA 1ZHMA 3RMMH 2QXIA 4UEHH 5EG4A 2A4GA 4THNH 1HCGA 1MTSA 3TU7H 1XUFA 1CSOE 1FY5A 1BITA 4K8YA 2LPRA 1GMHF 2HGTH 2Y7ZA 1MCTA 4X8VH 3BTME 1MMJN 1Y3UA 1O3FA 1QBOA 3MYWA 5F03A 2WPLS 1VZQH 2F83A 1SGIB 1SHYA 3KGPA 1NFUA 2ZDAH 4JZDH 2ANMH 2D8WA 4NIVA 2ZGJA 4JZEH 1YCPM 1LKAA 8GCHG 4NZLA 1GVKB 1KXBA 1DLKB 1SFIA 4MPWA 1MKXK 1EPTB 2G55A 3LGYA 4R8TB 5ABWA 4ZHMU 1TGNA 4WMFA 1C5YB 1W11U 4ZAEA 2B0FA 5FHTA 2ZQ2A 2FOMB 3F9FA 1T8OA 1P3CA 2O8LA 2HOBA 4A1TA 1GI9B 1K21H 1KSNA 2GV6A 4FUCA 3K9XB 9LPRA 4WY3A 4JYVH 3P17H 1A0LA 3Q3YA 3QZQA 4X2XA 1BTZA 1C1RA 1CGIE 3G01A 5BRRE 3PM3A 1DXWA 1F7ZA 1ZMLA 2Z9KA 1F2SE 2VWLA 5JB8S 1OKXA 3LGWA 1BTPA 3URCA 2BDHA 5GXPA 2BDGA 1C4U2 1LHGH 1TOMH 2H1UA 4NG9H 4K8BA 3ATWA 2Z6BD 2TIOA 2ZHWH 4MQAA 1CBWB 1P2IA 1MZAA 3A7ZA 1OWIA 4MVNA 3QWCH 1K1MA 2Z7FE 3QGNB 4OS4A 1V2ST 2B9LA 1KDQB 2DE9A 1O3PB 1C5NH 1UK2A 1O3CA 2PUQH 1LVMA 1AFQB 1OWEA 3VGCC 4NCYA 3VEQB 6CHAC 1C5MD 3PWCA 3UQVA 4Y0ZE 1V2MT 3E3TA 3BTWE 4FUDA 4J2YB 4B2CA 1HIAA 1GGDC 2ZP0H 4WXIA 4X1PU 2AMQA 2AH4X 1UTNA 2GMTC 1T8NA 1CHOG 4UFGH 3BN9A 1T4UH 1MZDA 3A7WA 1TPOA 2PFEA 1DY8A 4TYDA 2ZF0H 1ETTH 2GT7A 4OGXA 4GAWA 4XBCA 1DWDH 1VCPA 3HKIB 1SMFE 2NU4E 1GVZA 2PLXA 1HUTH 1HXEH 2F3CE 2ZDMA 2ALVA 5AFZH 4ABFA 2EEKA 4Y7BA 3RM0H 4JZFH 2FOCA 2FPZA 1SFQB 1Z8JB 3BTGE 1OWHA 2BY9X 3A7YA 2ZI2H 2CXVA 3SNAA 3SHAH 2WPJS 5ESTE 1UCYE 1O38A 2BY6X 1C1QA 3ELAH 2ZA5A 3PMJA 2A0QB 1WQSA 4XBBA 2JETB 3PMAB 3SGBE 4E7RG 3RU4D 2ZFPH 1G3EA 2FI5E 5JBTA 3ZVFA 4CRGA 5LPRA 2PR3A 4HTCH 3A89A 4UD9H 1C4V2 2UWPA 3U1JB 1TWXB 3ZYEA 2CF9H 3PMHB 2YOLA 4DURA 4JZ1A 2ZHDA 5C67A 1V2QT 1KXEA 1NRRH 2BYAX 2ZKSA 3VB6A 3GICB 2J92A 4X1RU 2Q6DA 2TGTA 1LVYA 2EI7A 2CF8H 1GHAG 1ELBA 1GBKA 2WV4A 1F5RA 1O3IA 1WU1A 2ZU5A 1ELCA 3ZVAA 4AX9H 2O9QA 1KXCA 2ANKH 2ODYB 3A87A 2THFB 2BD2A 1XUHA 2STBE 1FNIA 3BG8A 1SPJA 2RA3A 3NWUA 1HAOH 1GJ7B 1TABE 3KQEA 4AGKA 4LOYH 2BD7A 2BDYA 2OD3B 1AUTC 2GV7A 1O3EA 1NESE 1GPZA 1O2TA 2PW8H 1OYTH 2YNAA 3SI3H 1FJSA 1XVMA 1AKSB 3UNQA 1L1NA 2F91A 2V35A 3ZVDA 1FQ3A 1OWDA 5GIBA 2ZG0H 1Q2WA 4F49A 1O2RA 3ZZ3A 2P3TB 1UTLM 1LQEA 5E0GA 1QB9A 3HATH 4MDSA 1O5CB 1NZQH 1A1RA 3SUFA 5J4SA 2PHBA 1QBNA 1YPJH 1O2IA 2UUFB 1AB9C 1C1TA 2VIOA 1HAVA 2HNTF 1JMOH 4Q7XA 1QL7A 3QX5H 5A8ZA 2SGEE 5E0HA 1DUEA 3LONA 1C9PA 1GHBF 1MQ5A 2J4IA 4IMZA 3M5NA 3E1XB 2XCFA 3ZYDA 4FUEA 3P8NA 1IQKA 2HLCA 4Z0KA 1HV7A 5EW1H 2BHGA 1V2UT 3MH7A 1IQFA 1SLUB 1TBRH 4AZ2B 3VXFH 4FU7A 2FESH 1EB2A 1RTKA 4X8UH 3RXBA 3FAOA 2PGBB 1O37A 1NT1A 2A5IA 2D1JA 1AO5A 3GY4A 4INHA 4X2YA 2FI4E 3GISB 1KXAA 2XRCA 1GHVH 1D9IA 4WJG2 2XNIA 1EATA 1QHRB 5DP4A 2BXTH 4B75A 2CMYA 2Z9LA 1KYNA 1NU9A 3I29A 1RS0A 3UUZA 4ISHH 4MTBA 1CA0C 1VCWA 1BB0B 2ZU4A 4FU8A 1O2OA 1BTHH 1A0HB 1HAYB 7KMEH 2TGDA 3E8LA 5EODA 2QAAA 3K2UA 4FUBA 1FDPA 2FX6A 2A4QA 4HZHA 4D9QA 1CHOF 1PPCE 1YPGH 2Q1JA 1KXDA 3N7OA 3U98H 3UY9A 3QGJA 3V7TA 2SGAA 2GP9B 2P94A 4MNWA 4R0IA 2F9UA 1E0FD 3SQEE 1TX8A 1OP0A 3P92A 5F8ZA 4I31A 2BLVA 1SGCA 3OSYA 1XVOA 3MWIU 1ANEA 1IHSH 2VH0A 2AMDA 2P3UB 5A8YA 5I25A 4BXSA 2RA0A 5JYIA 1DOJA 1FY4A 1BOQA 2OQ5A 4PROA 4GSOA 1VGCB 1GWAA 2H9HA 1P9SA 2I6QA 1BTUA 5A0CA 1LPZB 1CO7E 1HPGA 3R3GB 5HGGA 3LH1A 3NXPA 1CT0E 3KIDU 1P2JA 1O2UA 2GCTB 1H8IH 1HNEE 1GVLA 2VGCC 3UR6A 4BANB 1RTLA 2AEIH 5CHAB 1YLDA 1V2OT 2A31A 1O3OA 1LHFH 2C8XB 2AS9A 1Y5BT 1GBHA 4Y76A 4A92A 1BTYA 3ZZ5A 1AFEH 1Y3YA 2VU8E 1QL8A 1TX7A 3R0FA 2Z3DA 1EUFA 1WYKA 2FYQA 2P3FH 3UQOA 3HGPA 4SGBE 1AU8A 2BXUH 2OC8A 1GHAF 1FAXA 1EZXC 2A4RA 3PLPA 2ZWLH 1GBJA 1A0JA 3M5OA 4DY7B 1ZR0A 1CGJE 1GMHG 1YP9A 4X6OA 4LZ4B 5IDKA 1TRMA 1KTSB 1MBQA 4YOJA 2OTVA 3QLPH 2ZCKP 3U69H 3A7XA 3T27A 1ELGA 1J14A 3LGVA 1BMMH 3K65B 3UWJH 3DUXH 2ZGXH 1O3JA 1GJ9B 3PO1B 5EPYA 1TX6A 1B7XB 1L4DA 3E91A 1O3DA 3GCTF 1O2NA 1YGCH 2XBYA 4CHAC 2ZPQA 1TNKA 2ESTE 4OS6A 3P70B 1T8MA 2RDLA 2HNTC 2HALA 3U8RH 1SR5C 1UVTH 1V3XA 2QV1A 5ESBA 4IC5A 2SGPE 1BMNH 1DSTA 2IOTA 5FXLA 1K1JA 1O32A 4CRCA 3Q00A 3TH3H 3TJOA 1HIAB 1EOLA 5C5OA 4NIXA 3STIA 1O2QA 2ZCHP 3F68H 1AY6H 1DPOA 1SG8B 5EQQA 3RC5A 4DCDA 1LVBA 1BTWA 4JK5A 1MCVA 2GZ8A 1UHBB 1QRZA 1Y3XA 1ZLRA 3SU4A 3GY8A 2UUJB 1PPHE 1VR1H 2SNWA 5C20A 2H9EH 2F9PA 2BX3A 3TK6A 2Y5FA 5I46H 1K1IA 2D2DA 1ORFA 2O8UA 2WYGA 4U32A 1QR3E 4B76A 2ZEBA 1H1BA 2GT8A 3A8DA 3MFJA 4FU9A 1ANCA 1FPCH 1P57B 2ZFQH 3SO3A 3H5CB 1TA6A 2P16A 2HNTE 4AFUA 4CREA 3BTFE 3RXGA 1TBZH 2VJ1A 1GI7B 2JH0D 3A88A 1QTFA 2ZECA 1BA8B 3DFLA 4B1TA 4JMYA 9ESTA 2ZPSA 4XOJA 1O5BB 1BJVA 1AD8H 1TPAE 4IN2A 1ELVA 4E05H 1D6RA 2QIQA 1IQJA 1RTFB 3TK5A 4ZKOU 4ZKNU 1ID5H 2ZTZA 4A5TS 3PROA 1DWEH 1XXDA 2PUXB 1C2JA 2A7HA 2QN5T 3GY7A 2GVFA 3SJ8A 1W7GH 1C2GA 5A09A 4U01A 4FUIA 2BVRH 1P11E 4YESB 5LPFA 1DY9A 2VIWA 1SOTA 2VNTA 2O8MA 3FP7E 4B73A 3S9CA 4H42U 3A7TA 1VITG 2AFQB 4YOGA 2XBWA 3DHKH 1XUJA 4BTIB 4XBDA 3VPKA 4BAHB 1GBBA 1WOFA 3UOPA 2F9OA 2M5TA 1SGDE 2VIVA 2G5NA 2V3HH 4B71A 1C2IA 4FUJA 2FWWA 1IQGA 3ZVBA 1O2XA 1A46H 1PJPA 1HBTH 3BG4B 1ABIH 5CE1A 1DICA 3UNSA 1VJ9U 1T7CA 1C5ZB 1A3BH 3O8BA 4KP0A 3D49H 1V2JT 1CU1A 1ZSJA 3PLBA 1HAXB 2OXSA 1UTQA 1DWCH 1K1PA 4O03A 3RU4E 3MTYA 1H8DH 2XBXA 1HB0B 3ATKA 1NC6A 3HPTB 1Z6JH 5C2ZA 1K1NA 2OINA 3SNDA 4AB8A 5JPMH 2R0KA 2AGIX 4YZUA 4Y11E 3RXUA 1AVWA 2BZAA 2ZDNA 3GOVB 5DJ7A 4YLQH 5DGJA 2BVXH 4GHQA 2VB0A 1FY8E 1P2KA 5A2MH 1LKBA 1FLEE 4ABEA 1QY6A 1MTNC 2XYAA 2A5KA 4BNRA 4FVBA 1H9HE 3GYMA 3LDXH 2ZFFH 1QCPA 7GCHF 1C2EA 1AMHA 3BIUH 5C1XA 2CHAC 1LHCH 4DG4A 1Z71A 3V13A 1C5WB 1GG6C 3MI4A 4B74A 1GI5A 1LMWB 4GUXA 2WUBA 4VGCC 5EXMA 1FY3A 5FCRA 1TNIA 1C1VH 1O33A 3I78A 3WY8A 1DS2E 4DIIH 1KXFA 2BB4A 1TA2A 2BQ6B 1N8OB 1GHBG 2FXRA 3GY5A 1C9TA 4FXGH 5AF9H 2A7CA 3UNRA 3O8CA 1G9IE 2BX4A 4CRFA 1S5SA 4DOQA 1G37A 1F92A 3K6YA 1KTTB 3LIWA 4K2YA 4Q7ZA 2ASUB 1QNJA 1C1PA 5C5NA 1GBLA 2YNBA 4FUGA 2NU3E 3KL6A 1V6DA 1ZMJA 4TPYA 3NK8A 3ZV8A 1CGHA 1SGPE 3HK6B 2QXHA 2XXLA 2BTCE 1A5HA 1O2VA 5DP8A 3SBKA 5EOKA 3VB4A 4MPVA 3M35A 3ODDA 1PQ7A 2Z9JA 4RKOB 1S6FA 1Z8IB 3M3TA 1BBRE 1MU6B 1O5FH 1WUNH 5C1UA 1FIWA 1J9CH 1C1WH 1GJ6A 1JBUH 3AASA 1NN6A 1FPHH 1TGCA 2PSYA 1GBAA 3TVJB 1UHBA 4JK6A 1GI1A 3D23A 1D6WA 5IYTA 1EZSC 1O2PA 3RUOA 2ZFTA 3E0PB 3RMOH 3F1SB 1E36B 2NU1E 1ZOMA 3RP2A 1NY22 1GBDA 4OS1A 3EE0B 2ZFSA 2FODA 3RXMA 4BAOB 4U30A 2G4TA 1G2LA 2J34A 3M3VA 5FX6A 1SOZA 2GD4B 3MNXA 3RXAA 3ENSB 4WVPE 2B7DH 2XC5A 4GVUA 2FEQH 1GMDF 1ESAA 2TGPZ 5E2PA 3QTVH 1GI2A 1NPMA 1UTOA 3ZZBA 1GCTB 1S0RA 2NWNA 1VITF 2C93B 3MU1A 1JIRA 2VIQA 3QO6A 2QC2A 1BHXF 2VVCA 4MNYA 4WMEA 1GBIA 3STJA 1OX1A 1EAUA 1Y5AT 2A7JA 1TFXA 2CGAA 1UJ1A 4K1TA 1DT2A 2R0LA 1HJAB 5GJ4B 1O31A 5TJXA 4BTUB 1V2NT 1G32B 2BLQA 3EA9A 1MTVA 1YPLH 4NSVA 1KLJH 2PKSC 4NGAH 5LH8A 5EXNA 1C5QA 1MKWH 1O3BA 2GZ7A 4I8LA 3SORA 3RXKA 4TY7A 4YT7H 3F6UH 3BEFB 3HK3B 5JDUB 1SGEE 1EP5A 2RG3A 1TPSA 2ZDLA 4X2VA 3LPRA 3RXHA 5SGAE 3O8RA 4I8GA 1ZSLA 4K60A 1PPEE 3PV4A 1TIOA 3U1IB 2BOHB 3OX7U 1N1LA 1VCQA 4OS7A 3ZZ4A 1FUJA 3B8JA 1S85A 1A4WH 3ITIA 3SU5A 5FBIA 1SGQE 1UMAH 2ZHQH 1XKAC 1GHXH 4GCHG 1ZGIA 1ZMNA 2PV9B 4WH8A 4AORA 3TGJE 3AAUA 1ELTA 2Y80A 1GL1A 1Y3VA 3A8AA 2P8OC 1TB6H 1O0DH 2HPQH 3GCTG 2SFAA 3SJIA 1SSXA 5EGMA 2BY8X 5EW2H 4YM9A 2AERH 3RXFA 3EQ0H 4AFQA 1E34B 1TLDA 1DX5M 1NTPA 1Y5UT 1ABJH 4F4OC 2WPHS 4RSPA 3F9GA 1BDAA 1NRSH 5DP3A 3BTEE 1MQ6A 1XX9A 3ATMA 2CV3A 3FVFB 1PYTC 3SV7A 1PQ5A 1P05A 1XUIA 2ANYA 2TGAA 1O2SA 3EA7A 1TMTH 5DKMA 1O3HA 3U8OH 3T62A 2FLBH 1IQNA 3BF6H 4WH6A 2BY7X 5TCCA 1ARBA 2W5EA 5JBAS 1DWBH 1HXFH 4K1SA 1P09A 2XTTB 1F0TA 1PPFE 1SLVB 2GGVB 4X6MA 4Y79A 5G4BA 6ESTA 2OC7A 3OTJE 3V0XA 2FO9A 4ABJA 4DGJA 1AIXH 1IQHA 2Z9GA 5EQRA 1UK3A 4I8KA 5F8XA 1GHWH 4NFEA 4ZXXH 1E37B 2J94A 3UR9A 3UWIA 4I7YH 3M7TA 3W94A 1G2MA 1GJ4H 4AYYB 3BV9B 4GPGA 3FANA 1AUJA 2PTCE 1ELEE 1L1JA 5FCKA 2DUCA 1N6YA 1LO6A 1ZZZA 2FMJA 1Z8RA 4X1QU 5GDSH 1HJ8A 1GI8B 1RJXB 5PTPA 5F6MA 2B5TB 1W14U 1SC8U 2OQUA 1INCA 2A32A 3SU0A 1HAPH 1ZTKA 6CHAB 3AW0A 1Z1JA 1H4WA 3QTOH 2QYIA 2J95A 1RXPA 1GGDB 1A2CH 1W7XH 1A7SA 1GBFA 4XSKU 2GMTB 1TQ7B 4CBNA 1G36A 1MKWK 3E16B 2EA3A 3IWMA 1V2KT 3VXEH 2UWLA 2UWOA 4AGJA 2W7UA 1O5EH 3LGUA 2C90B 1RD3B 1KLIH 1QA0A 1SQTA 5T6FA 2F9BH 1SGFG 1X7AC 1AE5A 1DVAH 1C2HA 1FIZA 2BLWA 4E06H 1EKBB 1Y59T 4AN7A 1TONA 2H9TH 3LGIA 3D62A 2FDAA 2A4OA 3V12A 1RGQA 3SJKA 2TRMA 1FONA 1P03A 2G00A 1SQOA 5GPIB 1C5VA 2R3UA 1LDTT 3UREA 4BAKB 2G51A 4B2AA 3OYPA 1W13U 1ZJKA 2G5VA 3RXTA 3SNBA 2OBOA 3E90B 3L33A 3DT0H 5LPEA 2O8WA 4WMDA 3MNCA 2XC4A 4D76A 3HGNA 3AAVA 1GDUA 1YBWA 1YM0A 1QA7A 1LQDB 4BTTB 3GCHC 3A85A 4M7GA 1Z6EA 4JYTA 3T2NA 2PWXA 1SQAA 7LPRA 2FOHA 1THRH 1YYY1
chains in the Genus database with same CATH superfamily
2BZ6H 4MPXA 1ZTLA 2LELA 2BDCA 1FN6A 1DE7H 1IAUA 3OU0A 4QT8C 1B0EA 4JCNA 1BRBE 4U2WA 3SQHE 1C1SA 1DLEA 2BD5A 2QGRA 3BSQA 1SGNE 4ACAA 2ZO3H 1SVPA 1MTUA 2GX4A 4CR9A 2Y6TA 3PYHA 2Z3EA 2ZGBH 1TNJA 3MU0A 2O8TA 3WW7A 4GCHF 2VIDA 1LHDH 2XWBI 2LNCA 1ZGVA 2QXGA 3F9EA 1ZHPA 1XUKA 3H7TA 1WSSH 3B9FH 1GBEA 3RXEA 5K0HA 4IMQA 3URDA 4M9FA 4E7NA 5DP7A 7GCHG 2VVUA 4Y8ZA 2WZQA 2H2ZA 3MHWU 1P3EA 4O9VA 5GNDA 2OCVB 3FFGA 1G3DA 4D9RA 2I6SA 2ZIQH 1NBME 3E6PH 1ZHRA 3S0NA 2WYJA 1V2RT 2J5UA 1EAXA 4KTUA 3SN8A 3CP7A 3LU9B 1D3PB 1AHTH 2Z9IA 3PWBA 1RIWB 1C2FA 1F5KU 1LCYA 1UCYH 3ODFA 4K5ZA 5L2ZH 1EPTC 3ZZ7A 5T3HA 3KQBA 1O3KA 1S81A 3FP8E 3HKJB 2SGFE 4I8JA 1AB9B 1GJBB 3UPEA 1HAGE 3GYLB 3LJOA 3ZVGA 2H5CA 1TNGA 1C5SA 1O3GA 2KFWA 2FYRA 4BAQB 1N8OC 2GCHF 4ASHA 2W6ID 1FX0B 4NA8A 1LVOA 4Y10E 5DP6A 3RXOA 3A82A 3M61U 3M36A 2V3MA 1EJAA 2HVXA 1P2OA 1DSUA 1DFPA 1BMAA 1DANH 4CRBA 3KF2A 1HDTH 1O34A 1SHHB 1E35B 1QRWA 4IN1A 1MD8A 3CNRA 1A3EH 1GHZA 1CBWC 1OP8A 4J1YA 3MU5A 1EXFA 1P02A 2R9PA 3C27B 3SUEA 4UONA 2W7SA 4D7FA 1QJ1B 4TPIZ 2HVYB 4NWLA 3GY3A 3UFAA 3GDVA 4O97A 1Z7KA 3LC5A 1AFQC 1GJ8B 4ISIH 2Y5HA 3SW2B 3ZVEA 2W26A 2RFKC 4AFZA 1PPBH 2K1QA 1CA0B 3KNXA 3ESTA 1YPHC 2G4UA 3P8OA 4A1VA 2PP6A 3VB3A 3LT3A 1O3NA 3T25A 2TBSA 5B6LA 3KHVA 4DW2U 1JXPA 3OY5U 4P02A 1SGTA 4X6PA 1C1OA 3PMBB 3UTUH 2KAIA 2OC1A 1GCDA 1COWD 2YMSC 2OLGA 2ZU3A 4K69A 4TWYA 1F0SA 4ZH8A 6LPRA 1GMDG 1CE5A 2A2XH 1A5IA 3RDZA 3UOUA 2ZDVH 5E0JA 5FAHA 1C5OH 2BMGB 2FOAA 3MO9A 1J15A 2QY0B 2VINA 4YLUA 4JYUH 2VWMA 4ABBA 3PRDA 1WQVH 3CENA 5F8TA 1PQ8A 1UVUH 5CHBA 1LTOA 2BM2A 1N6XA 3BIVH 1NFXA 3PB1E 3RXDA 4NZQA 4YO9A 2A2QH 1YPHE 5AFYH 2FP7B 1P12E 5K7RA 5HIZA 2OP9A 1FN8A 2C8ZB 2JETC 1SL3A 1TALA 2QXJA 3SU1A 3BTDE 1BMLA 2VGCB 3JZ2B 2W3IA 1DM4B 3T29A 1GI6A 1CHGA 1GI0A 1P9UA 2AIPA 5KGOA 3LJJA 3MO3A 1TAWA 3SV8A 5HYOA 3FO8D 3ZV9A 2XWAA 4D8NA 1O35A 1UTMA 1SGFA 4ZKSU 1UCYK 3FOAA 2BQ7B 3IG6B 1S82A 3QZRA 3PTBA 4UFFH 3F0OA 2C4FH 1YPKH 2J38A 2ZGHA 4GLYA 3P95A 1AVXA 4FVDA 1MH0A 5FPYA 1H9IE 1C5XB 3FZZA 3MO6A 3LH3A 2AGGX 2PKAA 2ZU1A 2KR7A 2D26C 4ACBA 4Q80A 1T32A 1WTGH 1NROH 2BOKA 3M7UA 1ANBA 3MNSA 3PV2A 3LOXA 3TNTA 1F0RA 4Y0YE 5HM2A 1P2QA 3B23B 1AVGH 1FI8A 3RLWH 3SOSA 4AOQA 1TQ0B 1MAXA 4Q63A 5JBBS 4ABAA 1YLCA 1O3AA 3RXPA 4WWYA 4BOHA 1GJDB 1QGFA 1XM1A 1LHEH 2F9NA 3K6ZA 1C5LH 4I86A 3GY6A 4TY6A 1C2LA 1XKBC 2ZC9H 4UFEH 1ETRH 1S6LA 1TGTA 2BVSH 4CHAB 2FOBA 1CT2E 2GDEH 2VIPA 2WPKS 3TLOA 1MUEB 4HFPB 1IQMA 4MLFB 1G3BA 1TRYA 6GCHF 1JRTA 1ANDA 3F2HA 4YT6H 4FETA 2A45B 1D4PB 1BRUP 2FZZA 3DSGA 3DD2H 1LPKB 2V3OH 5E8EH 3A83A 3GCOA 1KLTA 1RRKA 1YPMH 1K9OE 2Q6FA 4ZHLU 1HRTH 1O2MA 2ULLA 3MNBA 3LC3A 1TRNA 2ODPA 3KYGA 3LKWA 1P8VC 3QDZB 1TNLA 1GBCA 2FOGA 3SNCA 1XMNB 1C1NA 2VWOA 3SJ9A 1WTHD 5HMAA 1AZ8A 3DA9B 4X0WU 3ZZ9A 1XXFA 1NO9H 1GBMA 5A0BA 3T28A 4AB9A 3CS0A 3Q3XA 1VITH 3BTTE 3EDXB 2P59A 8ESTE 5AVDA 3NCLA 3MH6A 1HYLA 1NRPH 1XUGA 5L6NH 3F9HA 1TE0A 2G52A 3P8FA 4INLA 3H7OA 1BQYA 8LPRA 3RLYH 3W95A 2XOKD 1OYQA 4Y7AA 4I33A 1DITH 2Y7XA 1C5TA 2ZQ1A 1YWUA 1L4ZA 1O30A 2OC0A 4FUHA 4I8HA 1ZPZA 1YCPK 1SLXB 3SV6A 1HAZB 3AK5A 1UTKA 2ALPA 1S6HA 1G30B 4DJZB 3ZZAA 1WBGB 2CN0H 3DSPA 4ABGA 1ZPBA 2PSXA 3L3TA 1QIXB 1AN1E 1Z1IA 1AWHB 4ISOA 3WWBA 1S0QA 5FBEA 1AWFH 1W8BH 2Z3CA 2BY5X 2A1DB 3RXIA 3RXJA 1GBTA 3NPSA 2ZHEH 3BTQE 1W10U 1ZRKA 1ELFA 2FTMA 3TH2H 4IGDA 2J9NA 1GMCF 2P93A 3T5FH 3MQKC 2VVVA 4OS2A 3OE7D 2DE8A 3PTNA 5BPEA 2XBVA 3QN7A 3TPIZ 5E2OA 2BDIA 3C1KA 2VH6A 2KCAA 4DT4A 2GTBA 4NIYA 3SU6A 3RXRA 1BCUH 2QCYA 1JWTA 3TK9A 1TNHA 5C0UA 1K0HA 1O5DH 3D65E 1OSSA 1E79D 2ZNKH 4K1EA 1CA8B 4MNXA 4RN6A 2R3YA 2JH6D 1VGCC 1W0ZU 3SGAE 1ZSKA 4Y8YA 5LGOA 1K28D 2R2MB 2ODQA 2ZTXA 2GCTC 4WF8A 1TGBA 4XFQA 3ZZDA 1P01A 4P00A 1HJ9A 1WV7H 2GZ9A 1YF4A 2BDAA 1QZ8A 5T6DA 1QQ4A 5DN6D 5CHAC 3TGKE 2SNVA 1O2WA 4Q2KA 2UUYA 3P6ZB 1A5GH 2FM2A 3TJNA 1NRQH 3F2FA 1EB1H 4TWWA 3Q76A 3NZIA 5L2YH 2QA9E 4KKDA 3NKKA 1P2MA 1GDNA 5FX5A 5HXFA 5DP5A 1PPZA 1UK4A 5C1YA 4CH8B 1O3MA 2IPHA 1W0YH 3P8GA 1T31A 1MBMA 2KCYA 5GCHG 2WINI 1K1LA 1SI5H 4RKJB 5JBCS 1P06A 1D3DB 2WPMS 1HAIH 3RXLA 4LXBH 4MNVA 2L74A 5EPNA 3GS9A 4ABIA 4NWKA 5J4QA 1H8ED 5HM9A 3SV9A 3TIUA 1D3TB 1FZZA 1MTNB 1UVSH 2WUCA 5HKKD 3MU8A 1C5UA 2G81E 1NRNH 8KME2 4DIHH 3KQ5A 1YC0A 2ZGCA 1V2TT 2VBCA 3PO1C 1THPB 1C1UH 1WCZA 3EA8A 2CHAB 1TGSZ 3LGTA 4XDEA 1ELDE 2EC9H 1GG6B 4I32A 1ESBA 2QF4A 1NFWA 2V7QD 2PTNA 2A5AA 3ATLA 1BRAA 3NUMA 4VGCB 4X2WA 3L6PA 8GCHF 4WXVA 1KIGH 1NM6A 1J8AA 1UTJA 5TCAA 4UFDH 1F5LA 1RIWC 1V2PT 1Y8TA 2GCHG 3TJUA 3VG8A 4X8SH 1C5PA 1Q31A 4NA7A 1QB6A 5C3NA 4X6NA 1BTXA 4NIWA 1NS3A 2KAIB 1AI8H 1EAWA 1QJ6B 1ZYOA 4OS5A 4RT0A 2ZFRH 1O36A 2Y82A 1ETSH 1W3CA 3EGKH 1EQ9A 2C8WB 4X1NU 1L0ZA 1G3CA 1BZXE 4IW4E 1O2LA 1QBVH 3PLKA 4H4FA 1ZTJA 3GDSA 3A86A 1C2KA 1GJAB 1K1OA 4O3TA 3RMNH 4UE7H 4CRAA 4MPUA 1T4VH 2AHME 1IOEA 4H6TA 1OP2A 3O8DA 2Q6GA 1V2WT 3SNEA 1VJAU 1TMUH 1CQQA 5EXLA 1SBWA 1ARCA 3KEEA 3VGCB 4H6SB 4Z6AH 1QFKH 2STAE 3Q77A 1GI4A 1EP6A 5CDFE 4YTAA 4ZUHA 2AGEX 3TITA 1EPTA 2UUKB 1HLTH 2Y81A 4CR5A 1AE8H 1EASA 2ZHFH 4NA9H 1B0FA 3SU2A 4IC6A 1J17T 1QRXA 3SUGA 3KQDA 1PQAA 3S7HB 1EAIA 4KELA 1MTWA 2WPIS 2ANWA 3SI4H 2XCNA 4KTCA 1L1GA 3TJVA 4RI0A 3T26A 1O39A 1MD7A 4K3JA 4ESTE 4X8TH 1IQLA 1D3QB 2IN2A 2ZZUH 2P95A 2TPIZ 2OUAA 1THSH 4FUFA 2PKAB 1EZQA 1O2ZA 3PV5A 3UAIC 1OOKB 3A81A 4MG3A 3UIRA 4AG1A 3DFJA 4BXWA 2FIRH 1KDQA 5T6GA 2BD3A 4BAMB 5DPAA 3IITA 5F53A 3VB7A 4AYVB 4YOIA 5T1VA 5L30H 2AMPA 2JKHA 1AQ7A 1O2KA 2HWLB 4JZIA 5ETXA 1J16A 1O5GH 5DG6A 3BG4C 2FLRH 2NU2E 2HRVA 3I77A 4ABDA 3A80A 3A8CA 2ZU2A 2PKSB 3BTHE 3RC4A 4CRDA 1V2LT 3A84A 1Z8GA 5H4IB 4A6LA 3A8BA 1A61H 4Y71A 3SU3A 2FS9A 1BBRH 1O2YA 1HAHH 1FV9A 1WAYB 1JIMA 3E0NB 3U9AH 3RU4T 4HI3A 3TH4H 1EJMA 3S7KB 3JZ1B 3QUMP 3KCGH 1CVWH 5CMXH 3M5MA 1L2EA 3EE7A 1SGRE 2BD8A 2EQNA 3ZVCA 4CBOA 4ZMAH 4IS5A 5JB9S 3SZEA 2XC0A 2XW9A 3OEHD 5GCHF 3V3MA 5B6OA 1OS8A 2EI8A 3ZZ6A 4GHTA 3FZDA 1C2MA 4A1XA 3BEIB 1LPGB 1C5RA 1QJ7B 2RCEA 1V2VT 2C8YB 2ZTYA 1RFNA 1YLNA 1BIOA 1DDJA 1QL9A 4ZKRU 2AYWA 2FOFA 1K2I1 4RT1A 4OGYA 1QURH 1AGJA 1TPPA 1B5GH 2GJGA 1C2DA 1GJ5H 4ZHAA 3Q3KA 4O3UA 3SGQE 1BRCE 2AIQA 4KTSA 3S69A 2W3KA 1U6QA 2P8OB 4B2BA 4F55A 1UO6A 2FTLE 1IQEA 1P2NA 3MMGA 2C3SA 3GY2A 3ZZCA 2OBQA 3RMLH 3F2GA 1BJUA 1QB1A 2J2UA 3GDUA 6GCHG 1UVOA 1BT7A 1O2HA 4LZ1H 4AFSA 1NFYA 1AZZA 3BEUA 2HPPH 2R2WU 4ISLA 3VFEA 3RXVA 5A8XA 1FXYA 3F0PA 4Y8XA 4KGAA 3KN2A 1C1MA 3FP6E 3SJOA 3MOCA 3TGIE 1QQUA 2QF0A 1FMGA 2WSSD 3A7VA 1SLWB 3M5LA 1IHTH 3MU4A 5FPTA 1F0UA 1M9UA 1TYNA 4X1SU 5EQSA 2WV9A 4DT7B 1Y3WA 1W12U 1S83A 1PFXC 3EYDA 2VWNA 3RXQA 3QK1A 1SGYE 5DK1A 1OWKA 2ILNA 4HG6A 3SUDA 2Z94A 1AKSA 1PYTD 1E38B 1IQIA 4ZROA 3SV2H 2JH5D 2BQWB 4OM9A 1EZUC 1E1QD 1ZPCA 3OY6U 1TOCB 2ZDKA 1JOUB 1OPHB 2V0BA 3GCNA 3AW1A 4LK4A 1C4Y2 3KQCA 1EJNA 3RXCA 1ESTA 1MKXH 2ZPRA 2FOEA 1O2GH 4INKA 2FX4A 4UDWH 4Y6DA 3RXSA 2F43B 2GDDA 1P04A 2H5DA 1T8LA 1EX3A 2B8OH 5A0AE 1OXGA 1YKTA 1P0SH 4SGAE 3SYJA 1GI3A 2Y5GA 1HGTH 2BD9A 2BD4A 1GL0E 3SZNA 2CJIA 1KY9A 1FY1A 2FI3E 3ATIA 3S9BA 1W2KH 2EI6A 5DO4H 1GMCG 1BBRK 1HFDA 2G8TA 2QF3A 1UVPA 2SGDE 3TNSA 3M3SA 1DXPA 2ZCLP 4HGCA 3AVZA 1K22H 2F9VA 4ISNA 5EU8A 1BHXB 1EOJA 1S84A 1MU8B 1GCTC 3M7QA 5AHGH 4ABHA 1P10A 4NSYA 1ELAA 3SHCH 1ACBE 3FKSD 1NU7B 3S9AA 1VKYA 2NU0E 1YCPH 3MH4A 3VB5A 3BTKE 4DVAU 1O5AB 1GJCB 1MAYA 2WV5A 3ZZ8A 1GDQA 3M37A 4D7GA 1HJAC 4IBLH 5FPSA 4ZXYH 4XE4A 7ESTE 3CS7A 1CT4E 4Q7YA 5GWZA 4YXWD 3U8TH 1TBQH 5DP9A 3GCHB 1PPGE 3RC6A 1DUAA 4A7IB 2BDBA 2PGQB 3F3BA 2GKVE 4AG2A 2BLOA 2H6MA 2V6NA 1UTPA 3EAJA 3RM2H 1OWJA 2SGQE 1Q3XA 3MH5A 4NFFA 1YPEH 1SB1H 2FS8A 1O3LA 1O2JA 2IJOB 1TMBH 1JRSA 1ZRBA 4CH2B 1BUIA 1GHYH 1FAKH 1HAVB 1H9LB 1ZJDA 1ZHMA 3RMMH 2QXIA 4UEHH 5EG4A 2A4GA 4THNH 1HCGA 1MTSA 3TU7H 1XUFA 1CSOE 1FY5A 1BITA 4K8YA 1GMHF 2LPRA 2HGTH 2Y7ZA 1MCTA 4X8VH 3BTME 1MMJN 1Y3UA 1NBMD 1O3FA 1QBOA 3MYWA 3DSOA 5F03A 2WPLS 1VZQH 2F83A 1SGIB 1SHYA 3KGPA 1NFUA 2ZDAH 4JZDH 2ANMH 2D8WA 4NIVA 2RDEA 2ZGJA 4JZEH 1YCPM 1LKAA 8GCHG 4NZLA 1GVKB 1KXBA 1DLKB 1SFIA 2XNDD 4MPWA 1MKXK 1EPTB 2G55A 3LGYA 3N99A 4R8TB 5ABWA 4ZHMU 1TGNA 4WMFA 1C5YB 1W11U 4ZAEA 2B0FA 5FHTA 2ZQ2A 1EFRD 2FOMB 3F9FA 1T8OA 1P3CA 2O8LA 2HOBA 4A1TA 1GI9B 1K21H 1KSNA 2GV6A 4FUCA 3K9XB 9LPRA 4WY3A 4JYVH 3P17H 1A0LA 3Q3YA 3QZQA 4X2XA 1BTZA 1C1RA 1CGIE 3G01A 5BRRE 3PM3A 1DXWA 1F7ZA 1ZMLA 2Z9KA 1F2SE 2VWLA 5JB8S 1OKXA 3LGWA 1BTPA 3URCA 2BDHA 5GXPA 2BDGA 1C4U2 1LHGH 1TOMH 2H1UA 4NG9H 4K8BA 3ATWA 2Z6BD 1H8HD 2TIOA 2ZHWH 4MQAA 1CBWB 1P2IA 1MZAA 3A7ZA 1OWIA 4MVNA 3QWCH 1K1MA 2Z7FE 3QGNB 4OS4A 1V2ST 2B9LA 1KDQB 2J98A 2DE9A 1O3PB 1C5NH 2JIZD 1UK2A 1O3CA 2PUQH 1LVMA 1AFQB 1OWEA 3VGCC 4NCYA 3VEQB 6CHAC 1C5MD 3PWCA 3UQVA 4Y0ZE 1V2MT 3E3TA 3BTWE 4FUDA 4J2YB 5KEDA 2QF5A 4B2CA 1HIAA 1GGDC 2ZP0H 4WXIA 4X1PU 2AMQA 2AH4X 1UTNA 2GMTC 1T8NA 1CHOG 4UFGH 3BN9A 1T4UH 1MZDA 3A7WA 1TPOA 4B6FA 2PFEA 1DY8A 4TYDA 2ZF0H 1ETTH 2GT7A 4OGXA 2YMSB 4GAWA 4XBCA 1DWDH 1VCPA 3HKIB 1SMFE 2NU4E 1GVZA 2PLXA 1HUTH 1HXEH 3H09A 2F3CE 5HIYA 2ZDMA 2ALVA 5AFZH 4ABFA 2EEKA 4Y7BA 3RM0H 4JZFH 2FOCA 2FPZA 1SFQB 1Z8JB 3BTGE 1OWHA 2BY9X 3A7YA 2ZI2H 2CXVA 3SNAA 3SHAH 2WPJS 5ESTE 1UCYE 1O38A 2BY6X 5C0TA 1C1QA 3ELAH 1WDIA 2ZA5A 3PMJA 2A0QB 1WQSA 4XBBA 2JETB 3PMAB 3SGBE 4E7RG 3RU4D 2ZFPH 1G3EA 2W6JD 2YMSD 2FI5E 5JBTA 3ZVFA 4CRGA 5LPRA 2PR3A 4HTCH 3A89A 4UD9H 1C4V2 2UWPA 3U1JB 1TWXB 3ZYEA 2CF9H 3PMHB 2YOLA 4DURA 4JZ1A 2ZHDA 5C67A 1V2QT 1KXEA 1KMHB 1NRRH 2BYAX 2ZKSA 2WPDD 3VB6A 3GICB 2J92A 4X1RU 2Q6DA 2TGTA 1LVYA 2EI7A 1WXRA 2CF8H 1GHAG 1ELBA 1GBKA 2WV4A 1F5RA 1O3IA 1WU1A 2ZU5A 1ELCA 3ZVAA 4AX9H 1UW7A 2IJD1 2O9QA 1KXCA 2ANKH 2ODYB 3A87A 2THFB 2BD2A 1XUHA 2STBE 1FNIA 3BG8A 1SPJA 2RA3A 3NWUA 1HAOH 1GJ7B 1TABE 3KQEA 4AGKA 4LOYH 2BD7A 2K0QA 2BDYA 2OD3B 1AUTC 2GV7A 1O3EA 4ASUD 1NESE 1GPZA 1O2TA 2PW8H 1OYTH 2YNAA 3SI3H 1FJSA 1XVMA 1AKSB 3UNQA 1L1NA 2F91A 2V35A 3ZVDA 1FQ3A 1OWDA 5GIBA 2ZG0H 1Q2WA 4F49A 1O2RA 3ZZ3A 2P3TB 1UTLM 1LQEA 5E0GA 1QB9A 3HATH 4MDSA 1O5CB 1NZQH 1A1RA 3SUFA 5J4SA 2PHBA 1QBNA 1YPJH 1O2IA 2UUFB 1AB9C 1C1TA 2VIOA 1W0JD 1HAVA 2HNTF 1JMOH 4Q7XA 1QL7A 3QX5H 5A8ZA 2SGEE 5E0HA 1DUEA 3LONA 1C9PA 1GHBF 1MQ5A 2J4IA 4IMZA 3M5NA 3E1XB 2XCFA 3ZYDA 4FUEA 3P8NA 1IQKA 2HLCA 4Z0KA 1HV7A 5EW1H 2BHGA 1V2UT 3MH7A 1IQFA 1SLUB 1TBRH 4AZ2B 3VXFH 4FU7A 2FESH 3DCLA 1EB2A 1RTKA 4X8UH 3RXBA 3FAOA 2PGBB 1O37A 1NT1A 2A5IA 2D1JA 1AO5A 3GY4A 4INHA 4X2YA 2FI4E 3GISB 1KXAA 2XRCA 2K8IA 1GHVH 1D9IA 4WJG2 2XNIA 1EATA 1QHRB 5DP4A 2BXTH 4B75A 2CMYA 2Z9LA 1KYNA 1NU9A 3I29A 1RS0A 3UUZA 4ISHH 4MTBA 1CA0C 1VCWA 1BB0B 2ZU4A 4FU8A 1O2OA 1BTHH 1A0HB 1HAYB 3UB0A 7KMEH 2TGDA 3E8LA 5EODA 2QAAA 3K2UA 4FUBA 1FDPA 2FX6A 2A4QA 4HZHA 4D9QA 1CHOF 1PPCE 1YPGH 2Q1JA 1KXDA 3N7OA 3U98H 3UY9A 3QGJA 3V7TA 2SGAA 2GP9B 2P94A 4MNWA 4R0IA 2F9UA 1E0FD 3SQEE 5KECA 1TX8A 1OP0A 3P92A 1SQRA 5F8ZA 4I31A 2BLVA 1SGCA 3OSYA 1XVOA 3MWIU 1ANEA 1IHSH 2VH0A 2AMDA 4B6EA 2P3UB 2JDID 5A8YA 5I25A 4BXSA 2RA0A 5JYIA 1DOJA 3OEED 1FY4A 1BOQA 2OQ5A 4PROA 4GSOA 1VGCB 1GWAA 2H9HA 1P9SA 2I6QA 1BTUA 5A0CA 1LPZB 1CO7E 1HPGA 3R3GB 5HGGA 3LH1A 3NXPA 1CT0E 3KIDU 1P2JA 1O2UA 5FL7D 2GCTB 1H8IH 1HNEE 2CK3D 1GVLA 2VGCC 3UR6A 4BANB 1RTLA 2AEIH 5CHAB 1YLDA 1V2OT 2A31A 1O3OA 1LHFH 2C8XB 2AS9A 1Y5BT 1GBHA 4Y76A 4A92A 1BTYA 3ZZ5A 1AFEH 1Y3YA 1BMFD 2VU8E 5DSFA 1QL8A 1TX7A 3R0FA 5C94A 2EY4C 2Z3DA 1EUFA 1WYKA 2FYQA 2P3FH 3UQOA 3HGPA 4SGBE 2BXUH 1AU8A 2OC8A 1GHAF 1FAXA 1EZXC 2A4RA 3PLPA 2ZWLH 1GBJA 1A0JA 3M5OA 3N7EA 4DY7B 1ZR0A 1CGJE 1GMHG 1YP9A 4X6OA 4LZ4B 1W0KD 5IDKA 1TRMA 1KTSB 1MBQA 4YOJA 2OTVA 3QLPH 2ZCKP 3U69H 3A7XA 3T27A 1ELGA 1J14A 3LGVA 1BMMH 3K65B 5EJ1A 3UWJH 3DUXH 2ZGXH 1O3JA 1GJ9B 3PO1B 5EPYA 1TX6A 1B7XB 1L4DA 3E91A 1O3DA 3GCTF 1O2NA 2J98B 1YGCH 2XBYA 4CHAC 2ZPQA 1TNKA 4ZCNA 2ESTE 4OS6A 3P70B 1T8MA 2RDLA 2HNTC 2HALA 3U8RH 1SR5C 1UVTH 1V3XA 2QV1A 3U28C 5ESBA 4IC5A 2SGPE 1BMNH 1DSTA 2IOTA 5FXLA 1K1JA 5EIYA 1O32A 4CRCA 3Q00A 3TH3H 3TJOA 1HIAB 1EOLA 5C5OA 4NIXA 4FOUC 1O2QA 3STIA 2ZCHP 3F68H 1AY6H 1DPOA 1SG8B 5EQQA 3RC5A 4DCDA 1LVBA 1BTWA 4JK5A 1MCVA 2GZ8A 1UHBB 1QRZA 1Y3XA 1ZLRA 3SU4A 3GY8A 2UUJB 1PPHE 1VR1H 2SNWA 5C20A 2H9EH 2F9PA 2BX3A 3TK6A 2Y5FA 5I46H 1K1IA 2D2DA 1ORFA 2O8UA 2WYGA 2JJ1D 4U32A 1QR3E 4B76A 2ZEBA 1H1BA 2GT8A 3A8DA 3MFJA 4FU9A 1ANCA 1FPCH 1P57B 2ZFQH 3SO3A 3H5CB 1TA6A 2P16A 2HNTE 4AFUA 2J97A 4CREA 3BTFE 3RXGA 1TBZH 2VJ1A 1GI7B 2JH0D 3A88A 1QTFA 2ZECA 1BA8B 3DFLA 4B1TA 4JMYA 9ESTA 2ZPSA 4XOJA 1O5BB 1BJVA 1AD8H 1TPAE 4IN2A 1ELVA 4E05H 1D6RA 2QIQA 1IQJA 1RTFB 2KX4A 3TK5A 4ZKOU 4ZKNU 1ID5H 2ZTZA 4A5TS 3PROA 1DWEH 1XXDA 2PUXB 1C2JA 2A7HA 2QN5T 3GY7A 2GVFA 3ZIAD 3SJ8A 1W7GH 1C2GA 5A09A 4U01A 4TSFD 4FUIA 2BVRH 1P11E 4YESB 5LPFA 1DY9A 2VIWA 1SOTA 3OFND 2VNTA 2O8MA 3FP7E 4B73A 3S9CA 4H42U 3A7TA 3NRLA 1VITG 2AFQB 4YOGA 2XBWA 3DHKH 1XUJA 4BTIB 4XBDA 3VPKA 4BAHB 1GBBA 1WOFA 3UOPA 2F9OA 1MABB 2M5TA 1SGDE 2VIVA 2G5NA 2V3HH 4B71A 3WWFA 1C2IA 2KM0A 4FUJA 2FWWA 1IQGA 3ZVBA 3KYFA 4AC9A 1O2XA 1A46H 1PJPA 1HBTH 3BG4B 1ABIH 5CE1A 1DICA 2QE7D 3UNSA 1VJ9U 1T7CA 1C5ZB 1A3BH 3O8BA 4KP0A 3D49H 1V2JT 1CU1A 1ZSJA 3PLBA 1HAXB 2OXSA 1UTQA 1DWCH 1K1PA 4O03A 3RU4E 3MTYA 1H8DH 2XBXA 1HB0B 3ATKA 1NC6A 3HPTB 1Z6JH 5C2ZA 5C17A 1K1NA 2OINA 2KCPA 3SNDA 4AB8A 5JPMH 2R0KA 2AGIX 2L6OA 4YZUA 4Y11E 3RXUA 1AVWA 2BZAA 2M2AA 2ZDNA 3GOVB 5DJ7A 4YLQH 5DGJA 2BVXH 4GHQA 2VB0A 1FY8E 1P2KA 5A2MH 1LKBA 1FLEE 4ABEA 1QY6A 1MTNC 2XYAA 2A5KA 4BNRA 4FVBA 1H9HE 3GYMA 3LDXH 2ZFFH 1QCPA 7GCHF 1C2EA 2F4LA 1AMHA 3BIUH 5C1XA 2CHAC 1LHCH 4DG4A 1Z71A 3V13A 1C5WB 1GG6C 3MI4A 4B74A 1GI5A 2HLDD 1LMWB 4GUXA 2WUBA 4XD7D 4Z1MD 4VGCC 5EXMA 1FY3A 5FCRA 1TNIA 1C1VH 4TT3D 1O33A 3I78A 3WY8A 1DS2E 4DIIH 1KXFA 2BB4A 1TA2A 2BQ6B 1N8OB 1GHBG 2FXRA 3GY5A 1C9TA 4FXGH 5AF9H 2A7CA 3PRBA 3UNRA 3O8CA 1G9IE 2BX4A 4CRFA 1S5SA 4DOQA 1G37A 2OK5A 1F92A 5EJLA 3K6YA 1KTTB 3LIWA 4K2YA 4Q7ZA 2ASUB 1QNJA 1SKYE 1C1PA 5C5NA 1GBLA 2YNBA 4FUGA 2NU3E 3KL6A 1V6DA 1ZMJA 4Q4LA 3NK8A 4TPYA 3ZV8A 1CGHA 1SGPE 3HK6B 2QXHA 2XXLA 2BTCE 1A5HA 1O2VA 5DP8A 3SBKA 5EOKA 3VB4A 4MPVA 3M35A 3ODDA 1PQ7A 2Z9JA 4RKOB 1S6FA 1Z8IB 3M3TA 1BBRE 1MU6B 1O5FH 1WUNH 5C1UA 1FIWA 1J9CH 1C1WH 1GJ6A 1JBUH 3AASA 3N7DA 1NN6A 1FPHH 1TGCA 2PSYA 1GBAA 3TVJB 1UHBA 4JK6A 1GI1A 3D23A 1D6WA 5IYTA 1EZSC 1O2PA 3RUOA 2ZFTA 3E0PB 3RMOH 3F1SB 1E36B 2NU1E 1ZOMA 3RP2A 1NY22 1GBDA 4OS1A 3EE0B 2ZFSA 2FODA 3RXMA 4BAOB 4U30A 2G4TA 1G2LA 2J34A 3M3VA 5FX6A 1SOZA 2GD4B 3MNXA 3RXAA 3ENSB 4WVPE 2B7DH 2XC5A 4GVUA 2FEQH 1GMDF 1ESAA 2TGPZ 5E2PA 3QTVH 1GI2A 1NPMA 1UTOA 3ZZBA 1GCTB 1S0RA 2NWNA 1VITF 2C93B 3OTPA 3MU1A 2IPQX 1JIRA 2VIQA 3QO6A 2QC2A 1BHXF 2VVCA 4MNYA 4WMEA 1GBIA 3STJA 1OX1A 2KZ4A 1EAUA 1Y5AT 2A7JA 1TFXA 2CGAA 1UJ1A 4K1TA 1DT2A 2R0LA 1HJAB 5GJ4B 1O31A 5TJXA 4BTUB 1V2NT 1G32B 2BLQA 3EA9A 4F48B 1MTVA 2LP6A 1YPLH 4NSVA 1KLJH 2PKSC 4NGAH 3W1EA 5LH8A 5IK2D 5EXNA 1C5QA 1MKWH 1O3BA 2GZ7A 4I8LA 3SORA 3RXKA 2JJ2D 4TY7A 4YT7H 3F6UH 4XRNA 3BEFB 3HK3B 5JDUB 1SGEE 1EP5A 2KCOA 2RG3A 1TPSA 2ZDLA 4X2VA 3LPRA 3RXHA 5SGAE 3FN8A 3O8RA 4I8GA 1ZSLA 4K60A 1PPEE 3PV4A 1TIOA 3U1IB 2BOHB 3OX7U 1N1LA 1VCQA 4OS7A 3ZZ4A 1FUJA 3B8JA 1S85A 1A4WH 3ITIA 3SU5A 5FBIA 1SGQE 1UMAH 2ZHQH 1XKAC 1GHXH 4GCHG 1ZGIA 1ZMNA 2PV9B 4WH8A 4AORA 3TGJE 3AAUA 1ELTA 2Y80A 1GL1A 1Y3VA 3A8AA 2P8OC 1TB6H 1O0DH 2HPQH 3GCTG 2SFAA 3SJIA 1SSXA 5EGMA 2BY8X 5EW2H 4YM9A 2AERH 3RXFA 3EQ0H 4AFQA 5EJZA 1E34B 1TLDA 1DX5M 1NTPA 1Y5UT 1ABJH 4F4OC 2WPHS 4RSPA 3F9GA 1BDAA 1NRSH 5DP3A 3BTEE 1MQ6A 1XX9A 3ATMA 2CV3A 3FVFB 1PYTC 3SV7A 1PQ5A 1P05A 1XUIA 2ANYA 2TGAA 1O2SA 3EA7A 1TMTH 5DKMA 1O3HA 3U8OH 3T62A 2FLBH 1IQNA 3BF6H 4WH6A 2BY7X 5TCCA 1ARBA 2W5EA 5JBAS 1DWBH 1HXFH 4K1SA 1P09A 2XTTB 1F0TA 1PPFE 1SLVB 1YY3A 2GGVB 4X6MA 4Y79A 5G4BA 6ESTA 2OC7A 3OTJE 1OHHD 3V0XA 2FO9A 4ABJA 4DGJA 1AIXH 1IQHA 2Z9GA 5EQRA 1UK3A 4I8KA 5F8XA 1GHWH 4NFEA 4ZXXH 1E37B 2J94A 3UR9A 3UWIA 4I7YH 3M7TA 3W94A 1G2MA 1GJ4H 4AYYB 3BV9B 4GPGA 3FANA 1AUJA 2PTCE 1ELEE 1L1JA 5FCKA 2DUCA 1N6YA 1LO6A 1ZZZA 2FMJA 1Z8RA 4X1QU 5GDSH 1HJ8A 1GI8B 2WHXA 1RJXB 5PTPA 5F6MA 2B5TB 1W14U 1SC8U 2OQUA 1INCA 2A32A 3SU0A 1HAPH 1ZTKA 6CHAB 3AW0A 1Z1JA 1H4WA 3QTOH 2QYIA 2J95A 1RXPA 1GGDB 1A2CH 1W7XH 1A7SA 1GBFA 3OAAD 4XSKU 2GMTB 1TQ7B 4CBNA 1G36A 1MKWK 3E16B 2EA3A 3IWMA 1V2KT 3VXEH 2UWLA 2UWOA 4AGJA 2W7UA 1O5EH 3LGUA 2C90B 1RD3B 1KLIH 1QA0A 1SQTA 5T6FA 2F9BH 1SGFG 1X7AC 1AE5A 1DVAH 1C2HA 1FIZA 2BLWA 4E06H 1EKBB 1Y59T 4AN7A 1TONA 2H9TH 3LGIA 3D62A 2FDAA 2A4OA 3V12A 1RGQA 3SJKA 2TRMA 1FONA 1P03A 1E1RD 2G00A 1SQOA 5GPIB 1C5VA 2R3UA 1LDTT 3UREA 4BAKB 2G51A 4B2AA 3OYPA 1W13U 1ZJKA 2G5VA 3RXTA 3SNBA 2OBOA 3E90B 3L33A 3DT0H 5LPEA 2O8WA 4WMDA 3MNCA 2XC4A 4D76A 3HGNA 3AAVA 1GDUA 1YBWA 1YM0A 1QA7A 1LQDB 4BTTB 3GCHC 3A85A 4M7GA 1Z6EA 4JYTA 3T2NA 2PWXA 1SQAA 7LPRA 2FOHA 1THRH 1YYY1
chains in the Genus database with same CATH topology
2BZ6H 4MPXA 1ZTLA 2BDCA 1FN6A 1DE7H 1IAUA 3OU0A 4QT8C 1B0EA 4JCNA 1BRBE 4U2WA 3SQHE 1C1SA 1DLEA 2BD5A 2QGRA 3BSQA 1SGNE 2ZO3H 1SVPA 1MTUA 2GX4A 4CR9A 2Y6TA 3PYHA 2Z3EA 2ZGBH 1TNJA 3MU0A 2O8TA 4AB9A 4GCHF 2VIDA 1LHDH 2XWBI 2LNCA 1ZGVA 2QXGA 3F9EA 1ZHPA 1XUKA 3H7TA 1WSSH 3B9FH 1GBEA 3RXEA 5K0HA 4IMQA 3URDA 4E7NA 5DP7A 7GCHG 2VVUA 4Y8ZA 2H2ZA 3MHWU 1P3EA 4O9VA 2OCVB 3FFGA 1G3DA 4D9RA 2I6SA 2ZIQH 3E6PH 1ZHRA 3S0NA 2WYJA 1V2RT 1EAXA 4KTUA 3SN8A 3CP7A 3LU9B 1D3PB 1AHTH 2Z9IA 3PWBA 1RIWB 1C2FA 1F5KU 1LCYA 1UCYH 3ODFA 4K5ZA 5L2ZH 1EPTC 3ZZ7A 5T3HA 3KQBA 1O3KA 1S81A 3FP8E 3HKJB 2SGFE 4I8JA 1AB9B 1GJBB 3UPEA 1HAGE 3GYLB 3LJOA 3ZVGA 2H5CA 1TNGA 1C5SA 1O3GA 2FYRA 4BAQB 1N8OC 2GCHF 4ASHA 4NA8A 1LVOA 4Y10E 5DP6A 3RXOA 3A82A 3M61U 3M36A 1EJAA 2HVXA 1P2OA 1DSUA 1DFPA 1BMAA 1DANH 4CRBA 3KF2A 1HDTH 1O34A 1SHHB 1E35B 1QRWA 4IN1A 1MD8A 1A3EH 1GHZA 1CBWC 1OP8A 4J1YA 3MU5A 1EXFA 1P02A 2R9PA 3C27B 3SUEA 4UONA 2W7SA 4D7FA 1QJ1B 4TPIZ 4NWLA 3GY3A 3UFAA 3GDVA 4O97A 1Z7KA 3LC5A 1AFQC 1GJ8B 4ISIH 2Y5HA 3SW2B 3ZVEA 2W26A 4AFZA 1PPBH 2K1QA 1CA0B 3KNXA 3ESTA 1YPHC 2G4UA 3P8OA 4A1VA 3VB3A 3LT3A 1O3NA 3T25A 2TBSA 3KHVA 4DW2U 1JXPA 3OY5U 1SGTA 4X6PA 1C1OA 3PMBB 3UTUH 2KAIA 2OC1A 1GCDA 2OLGA 2ZU3A 4K69A 4TWYA 1F0SA 4ZH8A 6LPRA 1GMDG 1CE5A 2A2XH 1A5IA 3RDZA 3UOUA 2ZDVH 5E0JA 5FAHA 1C5OH 2BMGB 2FOAA 3MO9A 1J15A 2QY0B 2VINA 4YLUA 4JYUH 2VWMA 4ABBA 1WQVH 3CENA 5F8TA 1PQ8A 1UVUH 1LTOA 2BM2A 1N6XA 3BIVH 1NFXA 3PB1E 3RXDA 4NZQA 4YO9A 2A2QH 1YPHE 5AFYH 2FP7B 1P12E 5K7RA 2OP9A 1FN8A 2C8ZB 2JETC 1SL3A 1TALA 2QXJA 3SU1A 3BTDE 1BMLA 2VGCB 3JZ2B 2W3IA 1DM4B 3T29A 1GI6A 1CHGA 1GI0A 1P9UA 2AIPA 3LJJA 3MO3A 1TAWA 3SV8A 5HYOA 3ZV9A 2XWAA 4D8NA 1O35A 1UTMA 1SGFA 4ZKSU 1UCYK 2BQ7B 3IG6B 1S82A 3QZRA 3PTBA 4UFFH 2C4FH 1YPKH 2J38A 2ZGHA 4GLYA 3P95A 1AVXA 4FVDA 1MH0A 5FPYA 1H9IE 1C5XB 3FZZA 3MO6A 3LH3A 2AGGX 2PKAA 2ZU1A 2D26C 4Q80A 1T32A 1WTGH 1NROH 2BOKA 3M7UA 1ANBA 3MNSA 3LOXA 3TNTA 1F0RA 4Y0YE 5HM2A 1P2QA 3B23B 1AVGH 1FI8A 3RLWH 3SOSA 4AOQA 1TQ0B 1MAXA 4ABAA 5JBBS 1YLCA 1O3AA 3RXPA 4WWYA 4BOHA 1GJDB 1QGFA 1XM1A 1LHEH 2F9NA 3K6ZA 1C5LH 3GY6A 4TY6A 1C2LA 1XKBC 2ZC9H 4UFEH 1ETRH 1TGTA 2BVSH 4CHAB 2FOBA 1CT2E 2GDEH 2VIPA 2WPKS 3TLOA 1MUEB 4HFPB 1IQMA 4MLFB 1G3BA 1TRYA 6GCHF 1JRTA 1ANDA 4YT6H 2A45B 1D4PB 1BRUP 2FZZA 3DD2H 1LPKB 2V3OH 5E8EH 3A83A 3GCOA 1KLTA 1RRKA 1YPMH 1K9OE 2Q6FA 4ZHLU 1HRTH 1O2MA 2ULLA 3MNBA 3LC3A 1TRNA 2ODPA 3LKWA 1P8VC 3QDZB 1TNLA 1GBCA 2FOGA 3SNCA 1XMNB 1C1NA 2VWOA 3SJ9A 1WTHD 5HMAA 1AZ8A 3DA9B 4X0WU 3ZZ9A 1XXFA 1NO9H 1GBMA 5A0BA 3T28A 3CS0A 3Q3XA 1VITH 3BTTE 3EDXB 2P59A 8ESTE 5AVDA 3NCLA 3MH6A 1HYLA 1NRPH 1XUGA 5L6NH 3F9HA 1TE0A 2G52A 3P8FA 4INLA 3H7OA 1BQYA 8LPRA 3RLYH 3W95A 1OYQA 4Y7AA 4I33A 1DITH 2Y7XA 1C5TA 2ZQ1A 1L4ZA 1O30A 2OC0A 4FUHA 4I8HA 1ZPZA 1YCPK 1SLXB 3SV6A 1HAZB 1UTKA 2ALPA 1S6HA 1G30B 4DJZB 3ZZAA 1WBGB 2CN0H 4ABGA 1ZPBA 2PSXA 3L3TA 1QIXB 1AN1E 1Z1IA 1AWHB 4ISOA 1S0QA 5FBEA 1AWFH 1W8BH 2Z3CA 2BY5X 2A1DB 3RXIA 3RXJA 1GBTA 3NPSA 2ZHEH 3BTQE 1W10U 1ZRKA 1ELFA 2FTMA 3TH2H 4IGDA 2J9NA 1GMCF 2P93A 3T5FH 2VVVA 4OS2A 2DE8A 3PTNA 5BPEA 2XBVA 3QN7A 3TPIZ 5E2OA 2BDIA 3C1KA 2VH6A 2GTBA 4NIYA 3SU6A 3RXRA 1BCUH 2QCYA 1JWTA 3TK9A 1TNHA 1O5DH 3D65E 1OSSA 2ZNKH 4K1EA 1CA8B 4MNXA 4RN6A 2R3YA 2JH6D 1VGCC 1W0ZU 3SGAE 1ZSKA 4Y8YA 5LGOA 1K28D 2R2MB 2ODQA 2ZTXA 2GCTC 4WF8A 1TGBA 4XFQA 3ZZDA 1P01A 1HJ9A 1WV7H 2GZ9A 1YF4A 2BDAA 5T6DA 1QQ4A 5CHAC 3TGKE 2SNVA 1O2WA 4Q2KA 2UUYA 3P6ZB 1A5GH 2FM2A 3TJNA 1NRQH 1EB1H 4TWWA 3Q76A 3NZIA 5L2YH 2QA9E 4KKDA 3NKKA 1P2MA 1GDNA 5FX5A 5HXFA 5DP5A 1PPZA 1UK4A 5C1YA 4CH8B 1O3MA 2IPHA 1W0YH 3P8GA 1T31A 1MBMA 5GCHG 2WINI 1K1LA 1SI5H 4RKJB 5JBCS 1P06A 1D3DB 2WPMS 1HAIH 3RXLA 4LXBH 4MNVA 5EPNA 4ABIA 4NWKA 5J4QA 5HM9A 3SV9A 3TIUA 1D3TB 1FZZA 1MTNB 1UVSH 2WUCA 3MU8A 1C5UA 2G81E 1NRNH 8KME2 4DIHH 1YC0A 2ZGCA 1V2TT 3PO1C 1THPB 1C1UH 1WCZA 3EA8A 2CHAB 1TGSZ 3LGTA 4XDEA 1ELDE 2EC9H 1GG6B 4I32A 1ESBA 1NFWA 2PTNA 2A5AA 3ATLA 1BRAA 3NUMA 4VGCB 4X2WA 3L6PA 8GCHF 4WXVA 1KIGH 1NM6A 1J8AA 1UTJA 5TCAA 4UFDH 1F5LA 1RIWC 1V2PT 1Y8TA 2GCHG 3TJUA 4X8SH 1C5PA 1Q31A 4NA7A 1QB6A 5C3NA 4X6NA 1BTXA 4NIWA 1NS3A 2KAIB 1AI8H 1EAWA 1QJ6B 1ZYOA 4OS5A 2ZFRH 1O36A 2Y82A 1ETSH 1W3CA 3EGKH 1EQ9A 2C8WB 4X1NU 1L0ZA 1G3CA 1BZXE 4IW4E 1O2LA 1QBVH 3PLKA 4H4FA 1ZTJA 3GDSA 3A86A 1C2KA 1GJAB 1K1OA 4O3TA 3RMNH 4UE7H 4CRAA 4MPUA 1T4VH 1IOEA 4H6TA 1OP2A 3O8DA 2Q6GA 1V2WT 3SNEA 1VJAU 1TMUH 1CQQA 5EXLA 1SBWA 1ARCA 3KEEA 3VGCB 4H6SB 4Z6AH 1QFKH 2STAE 3Q77A 1GI4A 1EP6A 4YTAA 4ZUHA 2AGEX 3TITA 1EPTA 2UUKB 1HLTH 2Y81A 4CR5A 1AE8H 1EASA 2ZHFH 4NA9H 1B0FA 3SU2A 4IC6A 1J17T 1QRXA 3SUGA 3KQDA 1PQAA 3S7HB 1EAIA 4KELA 1MTWA 2WPIS 2ANWA 3SI4H 2XCNA 4KTCA 1L1GA 3TJVA 3T26A 1O39A 1MD7A 4K3JA 4ESTE 4X8TH 1IQLA 1D3QB 2IN2A 2ZZUH 2P95A 2TPIZ 2OUAA 1THSH 4FUFA 2PKAB 1EZQA 1O2ZA 1OOKB 3A81A 4MG3A 3UIRA 4AG1A 3DFJA 4BXWA 2FIRH 1KDQA 5T6GA 2BD3A 4BAMB 5DPAA 3IITA 3VB7A 4AYVB 4YOIA 5L30H 2AMPA 2JKHA 1AQ7A 1O2KA 2HWLB 4JZIA 5ETXA 1J16A 1O5GH 5DG6A 3BG4C 2FLRH 2NU2E 2HRVA 3I77A 4ABDA 3A80A 3A8CA 2ZU2A 2PKSB 3BTHE 3RC4A 4CRDA 1V2LT 3A84A 1Z8GA 5H4IB 4A6LA 3A8BA 1A61H 4Y71A 3SU3A 2FS9A 1BBRH 1O2YA 1HAHH 1FV9A 1WAYB 1JIMA 3E0NB 3U9AH 3RU4T 4HI3A 3TH4H 1EJMA 3S7KB 3JZ1B 3QUMP 3KCGH 1CVWH 5CMXH 3M5MA 1L2EA 1SGRE 2BD8A 3ZVCA 4CBOA 4ZMAH 4IS5A 5JB9S 2XC0A 2XW9A 5GCHF 3V3MA 5B6OA 1OS8A 2EI8A 3ZZ6A 4GHTA 3FZDA 1C2MA 4A1XA 3BEIB 1LPGB 1C5RA 1QJ7B 2RCEA 1V2VT 2C8YB 2ZTYA 1RFNA 1BIOA 1DDJA 1QL9A 4ZKRU 2AYWA 2FOFA 1K2I1 4OGYA 1QURH 1AGJA 1TPPA 1B5GH 1C2DA 1GJ5H 4ZHAA 3Q3KA 4O3UA 3SGQE 1BRCE 2AIQA 4KTSA 3S69A 2W3KA 1U6QA 2P8OB 4B2BA 1UO6A 2FTLE 1IQEA 1P2NA 3MMGA 2C3SA 3GY2A 3ZZCA 2OBQA 3RMLH 1BJUA 1QB1A 2J2UA 3GDUA 6GCHG 1UVOA 1BT7A 1O2HA 4LZ1H 4AFSA 1NFYA 1AZZA 3BEUA 2HPPH 2R2WU 4ISLA 3VFEA 3RXVA 5A8XA 1FXYA 4Y8XA 4KGAA 3KN2A 1C1MA 3FP6E 3SJOA 3MOCA 3TGIE 1QQUA 2QF0A 1FMGA 3A7VA 1SLWB 3M5LA 1IHTH 3MU4A 5FPTA 1F0UA 1M9UA 1TYNA 4X1SU 5EQSA 4DT7B 1Y3WA 1W12U 1S83A 1PFXC 3EYDA 2VWNA 3RXQA 3QK1A 1SGYE 5DK1A 1OWKA 2ILNA 3SUDA 2Z94A 1AKSA 1PYTD 1E38B 1IQIA 4ZROA 3SV2H 2JH5D 2BQWB 1EZUC 1ZPCA 3OY6U 1TOCB 2ZDKA 1JOUB 1OPHB 2V0BA 3GCNA 3AW1A 4LK4A 1C4Y2 3KQCA 1EJNA 3RXCA 1ESTA 1MKXH 2ZPRA 2FOEA 1O2GH 4INKA 2FX4A 4UDWH 4Y6DA 3RXSA 2GDDA 1P04A 2H5DA 1T8LA 1EX3A 2B8OH 5A0AE 1OXGA 1YKTA 1P0SH 4SGAE 1GI3A 2Y5GA 1HGTH 2BD9A 2BD4A 1GL0E 3SZNA 2CJIA 1KY9A 1FY1A 2FI3E 3ATIA 3S9BA 1W2KH 2EI6A 5DO4H 1GMCG 1BBRK 1HFDA 2G8TA 2QF3A 1UVPA 2SGDE 3TNSA 3M3SA 1DXPA 2ZCLP 4HGCA 3AVZA 1K22H 2F9VA 4ISNA 5EU8A 1BHXB 1EOJA 1S84A 1MU8B 1GCTC 3M7QA 5AHGH 4ABHA 1P10A 4NSYA 1ELAA 3SHCH 1ACBE 1NU7B 3S9AA 2NU0E 1YCPH 3MH4A 3VB5A 3BTKE 4DVAU 1O5AB 1GJCB 1MAYA 2WV5A 3ZZ8A 1GDQA 3M37A 4D7GA 1HJAC 4IBLH 5FPSA 4ZXYH 4XE4A 7ESTE 3CS7A 1CT4E 4Q7YA 5GWZA 3U8TH 1TBQH 5DP9A 3GCHB 1PPGE 3RC6A 1DUAA 4A7IB 2BDBA 2PGQB 2GKVE 4AG2A 2BLOA 2H6MA 2V6NA 1UTPA 3EAJA 3RM2H 1OWJA 2SGQE 1Q3XA 3MH5A 4NFFA 1YPEH 1SB1H 2FS8A 1O3LA 1O2JA 2IJOB 1TMBH 1JRSA 1ZRBA 4CH2B 1BUIA 1GHYH 1FAKH 1HAVB 1H9LB 1ZJDA 1ZHMA 3RMMH 2QXIA 4UEHH 5EG4A 2A4GA 4THNH 1HCGA 1MTSA 3TU7H 1XUFA 1CSOE 1FY5A 1BITA 4K8YA 2LPRA 1GMHF 2HGTH 2Y7ZA 1MCTA 4X8VH 3BTME 1MMJN 1Y3UA 1O3FA 1QBOA 3MYWA 5F03A 2WPLS 1VZQH 2F83A 1SGIB 1SHYA 3KGPA 1NFUA 2ZDAH 4JZDH 2ANMH 2D8WA 4NIVA 2ZGJA 4JZEH 1YCPM 1LKAA 8GCHG 4NZLA 1GVKB 1KXBA 1DLKB 1SFIA 4MPWA 1MKXK 1EPTB 2G55A 3LGYA 4R8TB 5ABWA 4ZHMU 1TGNA 4WMFA 1C5YB 1W11U 4ZAEA 2B0FA 5FHTA 2ZQ2A 2FOMB 3F9FA 1T8OA 1P3CA 2O8LA 2HOBA 4A1TA 1GI9B 1K21H 1KSNA 2GV6A 4FUCA 3K9XB 9LPRA 4WY3A 4JYVH 3P17H 1A0LA 3Q3YA 3QZQA 4X2XA 1BTZA 1C1RA 1CGIE 3G01A 5BRRE 3PM3A 1DXWA 1F7ZA 1ZMLA 2Z9KA 1F2SE 2VWLA 5JB8S 1OKXA 3LGWA 1BTPA 3URCA 2BDHA 5GXPA 2BDGA 1C4U2 1LHGH 1TOMH 2H1UA 4NG9H 4K8BA 3ATWA 2Z6BD 2TIOA 2ZHWH 4MQAA 1CBWB 1P2IA 1MZAA 3A7ZA 1OWIA 4MVNA 3QWCH 1K1MA 2Z7FE 3QGNB 4OS4A 1V2ST 2B9LA 1KDQB 2DE9A 1O3PB 1C5NH 1UK2A 1O3CA