1TIOA

High packing density form of bovine beta-trypsin in cyclohexane
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (BETA-TRYPSIN)
publication title X-ray studies on two forms of bovine beta-trypsin crystals in neat cyclohexane.
pubmed doi rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tioA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tioA02
2F3CE 1D6RA 1AZ8A 2JH5D 4SGBE 1UVTH 1O5AB 1C5PA 1S81A 2PTNA 1O3LA 2ZDLA 2ULLA 2A7JA 3ODDA 2ZU1A 3VXFH 5FX5A 1DY9A 4I8HA 3DFLA 1O2NA 4INKA 1TX8A 3RLWH 3GCNA 3KIDU 3K6YA 2SGAA 1W11U 1NFYA 2JETC 2GT7A 3KNXA 3ZZ3A 2V3HH 1GL0E 4XBBA 5BRRE 3N7OA 2R3UA 2Z6BD 3V0XA 4ZROA 2FIRH 3PWBA 5JB9S 4HGCA 3PMHB 2VNTA 3SU6A 1TPSA 3DFJA 1NESE 1P2OA 1BHXF 4JYVH 4DCDA 1SFIA 2BD9A 3QUMP 3QZRA 2BY5X 1ANCA 4NA7A 1BHXB 2OBQA 5CMXH 1GBLA 1ZRBA 4UD9H 4R0IA 1SG8B 1QCPA 1SL3A 2TIOA 1XXDA 1TRYA 2VVUA 1T7CA 1VR1H 3A84A 1IQKA 4MNXA 2VWNA 3URDA 2J38A 1CQQA 1KXFA 1SGDE 1EX3A 1FY8E 1QRZA 1CE5A 3SU0A 1HXFH 3S7KB 3MOCA 4SGAE 1Z7KA 2P93A 1KXAA 1DUEA 1A3BH 1BCUH 4I8JA 1XUIA 3D65E 2SNWA 1GJDB 1KDQA 2G4TA 4MNWA 4WMDA 1RTLA 1O3OA 3SW2B 4NFEA 2BDBA 3U69H 2FLRH 3BIUH 3M5NA 1V2RT 2BDGA 4BTUB 2G8TA 3U9AH 3RXTA 3LGTA 2F9VA 1FJSA 4ABDA 3KEEA 1ZSKA 2I6QA 2UUKB 5DGJA 4K60A 4B2BA 4CREA 1PPHE 2BD4A 2OCVB 3DD2H 3O8CA 1HLTH 1V2KT 2F9BH 1AO5A 3V12A 3HK3B 2WPHS 3RXFA 1C1SA 3QWCH 4RKJB 5F8ZA 3CS7A 3BTDE 3DHKH 1HRTH 3T62A 4ZAEA 1GHWH 1GHBF 3NCLA 3B8JA 4I8GA 1HIAB 3T27A 2F9PA 2BZ6H 1CGIE 3E0NB 2G5NA 1Z6EA 3VB3A 1GJ7B 1K1IA 1NRPH 1G3CA 4OS5A 1BRUP 4AG2A 1DPOA 2BDHA 3UPEA 1GMCG 1O2YA 2FO9A 1FY4A 3ELAH 1C5TA 2C8XB 3A80A 3SNDA 1TIOA 1KDQB 3AW1A 1BB0B 1RJXB 1SBWA 1ELDE 4HZHA 1ZHPA 4ZH8A 4YLQH 2FOBA 3L3TA 2H5DA 5E2PA 2VIOA 1LVMA 1WOFA 1ELVA 1AE5A 3M37A 5A0AE 4Y11E 1VJAU 1O2GH 2QYIA 4YLUA 5JYIA 1ZYOA 1Y3UA 1EJMA 3UREA 2GKVE 2ZHDA 1P9SA 1W0ZU 3L33A 3MU8A 4A1TA 1MMJN 2FP7B 2FPZA 1O3GA 1OXGA 1SGEE 1HJAC 4WH8A 5E0GA 3A8BA 1FY3A 3SU4A 1DXPA 3M5MA 3GCHC 2WPMS 3P8FA 3P17H 4Z6AH 2CV3A 9ESTA 1HDTH 1C1RA 1MBQA 1WBGB 1O2PA 5GCHF 2Y7ZA 1QTFA 1DWEH 4WJG2 1P2QA 5GPIB 1O2LA 2OINA 3BG4B 1YF4A 3GOVB 2AFQB 1KSNA 1TA2A 2K1QA 3HPTB 3MO6A 3T28A 1C4U2 2Q6DA 1C1WH 4YESB 1LCYA 1ZMJA 3IITA 3UQOA 1FNIA 1TNHA 3K9XB 4O3UA 3SNCA 3Q3KA 2OQ5A 1HYLA 3S9AA 2I6SA 3RP2A 5GWZA 3PMJA 5JBAS 1G3EA 1KY9A 5EW2H 1W0YH 3EQ0H 2O8MA 4BXWA 3QN7A 3BEFB 4UFFH 1P3CA 2TRMA 1FIWA 4NSVA 1GCDA 3DUXH 1T4UH 2V6NA 4Y8YA 3ZVDA 2O8TA 1DM4B 3UTUH 2CHAB 5SGAE 3KQDA 4Q2KA 3RXCA 1K28D 1V2VT 4CR9A 2Q6FA 3QLPH 1SMFE 3SJOA 2FLBH 3SV8A 5T3HA 1Z8IB 1PPBH 1LVYA 2ZDAH 1J15A 2FM2A 4ISNA 1GMDF 1FDPA 1P2IA 2BD3A 3MH5A 1IHTH 1PYTD 1ZPZA 4MPXA 3W94A 3KF2A 3F68H 1NRNH 1KYNA 1SLWB 4B2AA 5IYTA 2PTCE 2QIQA 4D7FA 1TNGA 3EYDA 2P3FH 5FPYA 3I77A 2R2WU 1GGDC 2JKHA 4X8SH 1AGJA 1ZMLA 2GX4A 3TGJE 1MAXA 1DWCH 4IN1A 5EXNA 1BTYA 2GMTB 2HNTE 1EP6A 1YPLH 4WY3A 1L2EA 3D49H 3A7VA 1Z1IA 2PKAB 4B75A 1ETSH 2KAIA 4IBLH 1GI4A 4TPYA 1DSTA 2EI8A 1HAYB 1C1MA 1O31A 2ZCLP 1JIMA 3HKJB 5A8XA 1J9CH 3RMMH 1Z71A 3BG4C 3GY4A 2GZ7A 1ID5H 1SQAA 3FFGA 2FEQH 5HM2A 2GD4B 3PLPA 1GBDA 3I29A 3OX7U 1A0LA 1L1JA 1QY6A 3PTBA 4UEHH 2Z7FE 1O3FA 3KHVA 2O8LA 1SGFG 1O2OA 1TPAE 2PSYA 1W14U 3PV4A 5DP8A 2GCTB 3UR9A 2OBOA 1TALA 2PW8H 4X2YA 1C2FA 1O2ZA 1V2UT 2A5KA 1W7XH 3P8NA 2ZHQH 5FPTA 3RMOH 4CH8B 4GHQA 4BAKB 3RU4T 2CHAC 1INCA 1MCVA 3M61U 2ALPA 4OS6A 4FUFA 4U2WA 2CMYA 1GMCF 3P70B 4H6TA 1QL7A 5EOKA 1Y3VA 4CBOA 1RD3B 1GG6B 2FODA 2PSXA 1HAVB 3ZZDA 1ZPBA 2BD2A 2BQ6B 3SHAH 1YLDA 1Y5UT 1BZXE 1GJ9B 2A5AA 1TRMA 4I33A 1FZZA 1BITA 2ODYB 4Y0YE 3NXPA 2OQUA 2NU1E 3QK1A 1XX9A 1UTLM 2HOBA 1C5UA 3EGKH 2BVSH 1U6QA 2C3SA 4OGYA 1MTNB 1DY8A 2VIPA 1QB6A 1EB1H 2HPPH 1FPCH 4CHAC 1SLVB 5DK1A 2GV6A 2D1JA 2ZFQH 2ZQ1A 3GCTF 3MNSA 5DPAA 2VVVA 1C5ZB 1EJNA 1SQOA 1PQ5A 2NU4E 1OSSA 4E06H 2NWNA 4R8TB 5DP5A 3M5LA 1EPTB 1K1LA 1K1OA 3FP7E 3KQCA 3UNQA 3VB4A 1GWAA 1AFEH 4ZXYH 2V35A 3A85A 4FU9A 1P2MA 3LC5A 2ZTZA 1VITH 1C5VA 1UCYK 3BF6H 3CP7A 1BRCE 1UCYH 2HWLB 3MO3A 1D3QB 3E91A 2ZIQH 5A0BA 3LIWA 3ZYEA 1HGTH 4YOJA 3EA8A 3RU4E 2UWOA 1DANH 3BTKE 1NT1A 3FVFB 1C1UH 1V2WT 5DG6A 1OP8A 4DURA 2D8WA 2O8WA 1TMTH 1P2JA 1LQDB 1G3BA 2Y82A 1DFPA 1IQJA 1VGCB 1VCQA 3EDXB 1ZSJA 4K1EA 2EI7A 1HB0B 2F91A 3U8OH 2OC1A 5JB8S 1O2UA 3TLOA 3UUZA 4J2YB 1O3JA 2AGIX 1OWKA 2CGAA 1GG6C 3VGCC 1OWIA 1ZHRA 1HPGA 1Y8TA 3KCGH 2VIDA 1BMLA 3PROA 3C1KA 3SGQE 4FVBA 2PR3A 1MKWK 3MYWA 2ALVA 1MKWH 1EXFA 2A45B 5EU8A 1ANBA 2ODPA 1GVZA 4I8LA 3VB5A 5LGOA 2QA9E 4CRGA 3ATLA 2WUBA 2J2UA 1GI8B 4GLYA 4IS5A 3O8BA 1MTNC 4IMQA 2PHBA 1SGFA 1ELAA 4JZIA 1WV7H 2A7CA 4BANB 4Y71A 2SFAA 1C1QA 2BDCA 7KMEH 1OWEA 2ZQ2A 3ZZBA 2PWXA 2G4UA 1GHAG 3RMNH 2F83A 3MNXA 3GDVA 3MNCA 2C8YB 2GCHF 3LGUA 1C1TA 1SLUB 3LGYA 5T6DA 1W8BH 3BN9A 1EPTC 1T32A 3EE0B 1C5WB 4YOIA 3LH3A 2G52A 1BT7A 1BTPA 4A7IB 2TGAA 1GBIA 1BMNH 1WYKA 1O3DA 2XNIA 3BIVH 3CENA 1BA8B 2ZFSA 2BVXH 2JH0D 3QDZB 1C2IA 4JYTA 1O2RA 2GTBA 2FXRA 1IQEA 1JRSA 5CE1A 1FQ3A 2FOMB 1A5GH 4O03A 1DLEA 1O3KA 3RMLH 1UTKA 3RC5A 1L1GA 1AUTC 8ESTE 3K2UA 1NPMA 1F0UA 2EA3A 4BTIB 1DOJA 1YPMH 1HAHH 1F5RA 5C20A 1EOLA 2XC5A 1DE7H 1EJAA 1YLCA 2Z3EA 1F0RA 4ABGA 1RTKA 1PYTC 2D26C 1NN6A 3ZZ5A 1H1BA 1HNEE 1KTSB 4OGXA 3E6PH 4WH6A 1AKSA 1LHGH 2CN0H 1P8VC 3RM2H 3A88A 3EA7A 3SV2H 1S0QA 1GVKB 1K21H 4FUDA 1LPZB 1O3BA 1FV9A 3RC4A 2ZDVH 4AYVB 3BTFE 4MPUA 6CHAB 1C4Y2 3ZVCA 1O37A 1EAXA 2ANKH 2ZEBA 4MPWA 5J4SA 1KLIH 2SGQE 1NRRH 1HAOH 1DX5M 1UVPA 4GSOA 4OS2A 5LPEA 2AMPA 2VWMA 3RXOA 5HYOA 1O3IA 3SNEA 1QFKH 4I32A 1O3HA 6ESTA 2RA0A 1QL9A 2XCNA 5GCHG 1GBEA 4Q80A 5DP7A 1WQVH 1SFQB 3BTQE 1TNJA 8GCHF 1L4DA 4U32A 2A4GA 1SPJA 1O3PB 4FUBA 4CBNA 3M7QA 3T2NA 3SJIA 4Y76A 2UUFB 5DP4A 1UK3A 2ZNKH 1ANEA 2H6MA 2FDAA 1TBRH 3PMBB 4ISHH 3GY2A 4I31A 1GI9B 4DVAU 1P9UA 1DSUA 1E34B 2IJOB 1XVMA 2QGRA 1MH0A 4FU8A 1ZSLA 2G5VA 3C27B 4GUXA 5A09A 2P3UB 2STAE 3GDSA 2W26A 4LK4A 1AKSB 3ITIA 1YYY1 2BHGA 1BJUA 1E36B 4XOJA 2ZP0H 3KQEA 1ESBA 1AY6H 1TX7A 3TU7H 1A46H 1LHCH 1UTMA 2PUXB 2ZGJA 3SV9A 2AGGX 1PPCE 1F5LA 3NWUA 1BRBE 4UFDH 1GBBA 1GMDG 2ILNA 5FBIA 4OS1A 2PFEA 1TGCA 1MZAA 3WY8A 1VJ9U 2ZF0H 1HIAA 2XBVA 4NFFA 2GDEH 2A2QH 3EAJA 1ESAA 4NIVA 4NWLA 3ESTA 2ZU4A 4KELA 1GDNA 1O2HA 1WQSA 1WCZA 6CHAC 1Q2WA 1NRQH 3AW0A 3RXBA 3MMGA 3LPRA 4ABJA 1MKXK 2QY0B 3PLBA 3DT0H 2FOFA 2W3KA 1GI2A 2R0LA 1HJ9A 4UDWH 1QQ4A 1OS8A 3JZ1B 1O2WA 1ORFA 4CRAA 5T6GA 1UTJA 1A1RA 1QA0A 4THNH 4WWYA 1HJAB 1SOZA 1TMUH 2TGDA 3TH4H 2FOEA 1E37B 1AB9C 4GPGA 3STIA 1C1NA 1ZLRA 1UHBB 2ZC9H 3GCHB 1NFXA 1AD8H 4K1SA 3Q76A 1P3EA 2LNCA 4TWYA 2ZU3A 5F8TA 1O30A 3NZIA 1IQFA 1E35B 1ELBA 1GHAF 1S83A 1AVGH 1D3TB 2FX6A 4ISOA 1GBAA 2R2MB 5F03A 2GZ9A 1SHHB 1UK2A 2BD7A 2FYQA 1FY1A 1IQMA 3TJUA 1ZJKA 3RXDA 1C1PA 4VGCB 4D8NA 2B0FA 5A2MH 1GI5A 4F49A 1S6FA 2G00A 4DG4A 2P94A 4Y10E 1UVUH 2Y5HA 1P2KA 1BTWA 1FIZA 1J16A 2XBYA 1V2MT 2UUYA 1Z6JH 3VB6A 3UR6A 1O0DH 1LPKB 1FY5A 1UTOA 2ZFFH 4JZDH 1TPPA 4CRFA 4IC6A 4O3TA 2XW9A 3FZDA 1TBZH 4LOYH 1VITG 1P11E 2BM2A 2WPJS 2P16A 2J9NA 4Y0ZE 1BDAA 2QXIA 4AYYB 3V7TA 4IC5A 3T29A 1Y3XA 4IGDA 1QB1A 2GDDA 4X6PA 3GDUA 2VIWA 1KLJH 5ETXA 4K8BA 1D3PB 1BTHH 3P95A 4AB8A 2VH6A 1GBKA 3QGJA 3GCTG 1TX6A 2XC4A 2W7UA 2ZHWH 3BTTE 3ZV8A 4X8TH 1GBJA 1Z8GA 1SR5C 2ZDMA 1GGDB 2V3OH 4RSPA 2FESH 3GCOA 3MH4A 5JDUB 3GISB 1SGYE 1RFNA 2AIQA 1F92A 1P09A 1QA7A 3OY5U 3S0NA 1BQYA 1F5KU 5T6FA 2BDIA 1UJ1A 3F6UH 4PROA 1QBVH 5ESBA 1YCPK 2FI3E 2ZDKA 2QXGA 4BNRA 1UTNA 1AE8H 1TB6H 3RXGA 2VVCA 4BAQB 4Z0KA 1OPHB 2BOHB 1QBNA 1QL8A 4VGCC 1IQHA 1HCGA 4YTAA 2VH0A 4WXIA 2HGTH 1V3XA 3KQBA 4NA9H 3RXQA 2ZECA 1GDUA 1S6HA 2PKAA 1SGTA 3TITA 1HUTH 3F9FA 3PB1E 2O8UA 4WMEA 1MD8A 1Y59T 1YPHC 4LZ1H 1EKBB 1O2JA 1XKBC 1C5YB 1THSH 3LOXA 2XBXA 1GI7B 4NA8A 3O8RA 4AX9H 4D9QA 1NM6A 3ATMA 3MU5A 4NZLA 2STBE 4DW2U 3BSQA 1AWHB 3LH1A 1G2MA 3TK5A 1ELTA 4ZKOU 2DE9A 1ETRH 4Y79A 4MDSA 4K69A 5FX6A 1YM0A 1XM1A 1C5MD 1J14A 3ZZ8A 2B7DH 3VFEA 5H4IB 2DE8A 4NZQA 1V2NT 5EQRA 3SU3A 8KME2 2SGPE 2A2XH 4NWKA 1UMAH 2F9OA 4IN2A 2B5TB 3A7TA 3E0PB 2PUQH 3BTME 2AH4X 1TGSZ 1FMGA 5JPMH 1TPOA 2ZPQA 2GCHG 1F0SA 1O5CB 2ANYA 1QQUA 1XUJA 2A32A 2WPIS 3M3SA 4XDEA 2HVXA 4CHAB 3PWCA 4KTUA 1TYNA 4Y7AA 4Q7XA 4X6NA 3TJNA 1A5IA 1CGHA 1ZGIA 2H1UA 2VB0A 1HAVA 1AWFH 3SU1A 1ABJH 1MTVA 2P3TB 1D4PB 5EW1H 3BTGE 2A31A 1TLDA 1BBRK 1JBUH 2UWPA 3L6PA 4QT8C 4A92A 1BBRH 5EXLA 3QO6A 5HGGA 1S82A 2BLWA 2BX4A 3SOSA 4ABAA 1ACBE 1RIWC 5LH8A 3IWMA 1OWDA 1K9OE 3SJ8A 1IQIA 1KXDA 3A86A 1F0TA 2BD8A 3FAOA 5DP3A 4Q7YA 1KXBA 5C1YA 4MQAA 1AUJA 1OOKB 1CVWH 1TAWA 3QX5H 1BMMH 1XVOA 1ZTLA 1L4ZA 2DUCA 2XBWA 2PGQB 4NCYA 3D62A 1EPTA 3PYHA 2QN5T 4FUHA 1HAXB 2SGEE 3NUMA 3TGKE 2OP9A 5L6NH 3UIRA 4MNVA 3PM3A 5GXPA 1DWDH 1GBFA 2CF9H 3MWIU 2ZGBH 1RXPA 1VITF 1HFDA 4ZXXH 1ELFA 1N8OB 4AGKA 3VGCB 1OWHA 1C2DA 1SB1H 5C1UA 1GI3A 1ARCA 2GP9B 4ASHA 1FUJA 1Y5AT 4Y7BA 2FTMA 2FOGA 3MH6A 2BXUH 4JZFH 4H6SB 1FI8A 1GHXH 4X1QU 1P12E 1UO6A 1KLTA 5L2YH 1B0FA 8GCHG 2BY8X 4AGJA 3Q3YA 4FVDA 5A8YA 3MU0A 1NFWA 3ODFA 1C1VH 1P57B 1GL1A 4ZHMU 4NGAH 4X2WA 2G55A 1WUNH 4FUJA 2FOCA 4JK5A 4AG1A 2ZA5A 2H9EH 2J92A 1JRTA 4X6MA 4HI3A 1O34A 3S7HB 3T25A 2QXHA 1C2KA 1FAXA 4A6LA 2P59A 1IAUA 1YCPM 1DXWA 1DICA 2ZO3H 1K1MA 1DS2E 1HV7A 3O8DA 3RXPA 3TGIE 3S69A 5EQQA 1SGIB 4OS7A 3ZVEA 4ABBA 3RXKA 1O2QA 3ZVFA 3R0FA 1QB9A 3GY7A 3OY6U 4JZEH 3RC6A 1XMNB 1QBOA 5TJXA 3ZV9A 1YC0A 1O33A 3RXVA 4X8VH 1C2LA 3HGNA 2ANMH 2RA3A 3KGPA 3RXHA 4KTSA 1EASA 1NRSH 4CRCA 1TFXA 3RXUA 2XXLA 4ESTE 1PJPA 1GBTA 1C2JA 2Y81A 2BY6X 1ETTH 1TOCB 3M7TA 4K2YA 5JBBS 3PMAB 5LPRA 1HJ8A 1ZPCA 2R3YA 1X7AC 1Y3WA 1H8DH 4DIHH 1LPGB 1LHEH 1HAPH 1WTGH 3MH7A 5J4QA 1FLEE 1T4VH 1TABE 3QGNB 1FONA 3RM0H 1ZTJA 3FP8E 5EODA 1MBMA 5DP6A 3ZZ9A 1O5FH 3M3TA 1BTUA 3VXEH 2BY9X 1N8OC 1SQTA 4DOQA 1O2KA 1O36A 4LXBH 4AB9A 2H9HA 3S9CA 1T31A 1CHOG 4HTCH 2FWWA 1V2LT 2OXSA 5DP9A 2W3IA 5A0CA 1HAIH 5TCAA 1Y5BT 2G51A 1FXYA 1TBQH 1QJ1B 3M7UA 3TPIZ 3ZZ6A 1EZUC 3OSYA 3A89A 3H7TA 3SUFA 1N1LA 4XBDA 1HXEH 4LZ4B 1WAYB 1W10U 2A5IA 1OP2A 4IMZA 1H9HE 3H7OA 5FCRA 4ZKNU 1T8OA 1S0RA 1DWBH 2ZFRH 1RTFB 2G81E 1HAGE 2WV5A 3PO1B 2F9NA 2JH6D 4NSYA 1BOQA 2GV7A 8LPRA 1EZXC 3OTJE 4H42U 2VIQA 1NTPA 1MU8B 1WU1A 1DT2A 2W7SA 1GPZA 2C4FH 1C2MA 6GCHF 1QR3E 4ZUHA 1D3DB 3ZVBA 5E2OA 2PKSB 2ZHEH 3SO3A 5L2ZH 5FPSA 4FUGA 2IPHA 1A4WH 1LTOA 5AHGH 3H5CB 4GAWA 1E38B 3UWIA 1GJBB 1XUGA 1AMHA 1EAWA 4YT7H 3RU4D 3T26A 3U98H 1FAKH 4ABFA 4K1TA 2C93B 3GY8A 1ELEE 5AVDA 4AFQA 1AZZA 2WPLS 2TBSA 3UY9A 4JMYA 4DJZB 2BZAA 1K1JA 1RRKA 1W12U 1DITH 3LU9B 1KTTB 1SGNE 2HLCA 2XCFA 4YT6H 3HATH 3RDZA 1OYQA 4Y8ZA 3A82A 1TA6A 1OWJA 4ZKSU 3ATWA 1TGTA 2FTLE 4BXSA 2ZGHA 1H8IH 3AAVA 1NU7B 2FX4A 3LC3A 1C5XB 1GJ4H 5CHAB 1BJVA 1P01A 1W3CA 3A8CA 2BLOA 1A61H 4UFEH 3W95A 2YNAA 2TGPZ 1LMWB 4JK6A 2VWOA 2IOTA 3RXMA 2ZTYA 1SC8U 2ZI2H 1XUFA 4RN6A 1AB9B 2ESTE 1BIOA 1YPEH 3QZQA 3B23B 4XE4A 4ISIH 1G37A 5I46H 1IHSH 3VB7A 1YP9A 2XTTB 3PO1C 1MZDA 2CXVA 2AMDA 2P95A 3F1SB 2XWBI 1K1PA 3URCA 4B1TA 2Z3CA 5B6OA 3BG8A 1TNKA 4GCHF 1QNJA 1P10A 1ARBA 2ZFTA 4FU7A 1EUFA 1A0HB 5GJ4B 1Q31A 1UTPA 2PKSC 5HXFA 4I7YH 4BAMB 1YPGH 2VGCC 1XUHA 2RCEA 3RLYH 1O2IA 1C1OA 4M7GA 3SV6A 1UHBA 1EP5A 1SHYA 1RS0A 3BV9B 3TVJB 4E05H 3SGBE 1EOJA 1V2ST 3LKWA 1MTUA 1C5SA 3TNTA 4UONA 1A5HA 1GCTB 2R9PA 1ESTA 5TCCA 1MTWA 2OC8A 1GHYH 4BAHB 3SZNA 1ZJDA 2VU8E 5HM9A 1BRAA 4ABEA 4MPVA 3IG6B 1TMBH 5JBTA 4ISLA 1Q3XA 2FOHA 5C1XA 1EATA 1FPHH 1O2MA 2QXJA 3QTVH 3GY5A 4KP0A 1KXCA 3ZZ7A 4AN7A 3SUDA 1AIXH 4RKOB 5CHAC 2FS9A 1MKXH 3KL6A 1PPFE 1AN1E 1CGJE 1LVOA 4O97A 5C5OA 1GBCA 1SGRE 1CHOF 1WSSH 3OYPA 1PPEE 1V2QT 2HNTC 1V2JT 1P0SH 1FN8A 2C8ZB 1KXEA 2HRVA 1JOUB 1XUKA 3SNAA 1K2I1 1S5SA 2PV9B 1PQAA 3RXEA 1MQ5A 1UCYE 1LHDH 1GMHG 1IQGA 4K8YA 1F7ZA 3DA9B 3NKKA 3P8GA 1HBTH 1CU1A 1QHRB 3A7ZA 3TIUA 3HGPA 1P02A 1Y3YA 3E8LA 2Z94A 2FYRA 1TWXB 4MNYA 3RXLA 1B5GH 2A7HA 2SNVA 2ZU2A 4BOHA 4AFUA 3MU4A 4MTBA 1OX1A 1QJ7B 4NIWA 3SI3H 5FXLA 3S9BA 1JXPA 4FUCA 1C2GA 1D9IA 1TQ7B 4NG9H 2Z9GA 1GCTC 1QURH 2VJ1A 3G01A 4IW4E 2BB4A 2OC7A 3F9EA 2OD3B 1O35A 3BEUA 1FN6A 3M3VA 2WINI 2HALA 2R0KA 4Y8XA 2A4RA 1RGQA 1T8MA 1J17T 1KIGH 5LPFA 2ANWA 7LPRA 3F9GA 5E0HA 4KKDA 1XKAC 3M5OA 5DO4H 1CHGA 3UNSA 4BTTB 3V3MA 2VIVA 4WXVA 2WYJA 2GGVB 1LO6A 3A87A 7ESTE 2BLQA 5FCKA 1TGBA 2ZPRA 3MTYA 2Y5GA 1O2XA 3U1IB 2BDAA 1GHZA 1PPGE 1CSOE 2IN2A 4B71A 3Q77A 3LONA 2C8WB 2NU2E 2Z9JA 1ELCA 7GCHF 3NK8A 1L0ZA 4X1RU 1NC6A 1P06A 4MVNA 5G4BA 1YCPH 2B8OH 3A81A 3FP6E 3LJJA 1O5DH 4Q7ZA 1B0EA 3E16B 4TYDA 2A0QB 4TY7A 3SN8A 3UNRA 1AVXA 3SGAE 5E8EH 3P6ZB 3RXIA 1RIWB 1CA8B 1BTZA 4XFQA 2ZU5A 4FUIA 1VZQH 1MTSA 2BQ7B 2ZDNA 2AEIH 2QV1A 3TJVA 2QAAA 4B2CA 2ZCKP 5I25A 4YZUA 3PLKA 2J34A 3Q00A 3LDXH 4J1YA 4KGAA 4ZKRU 4CR5A 4X0WU 1LKBA 2A4OA 4INLA 4D9RA 5K7RA 1LQEA 1THRH 1P03A 2QCYA 3EA9A 4XBCA 2B9LA 2ZGXH 2LPRA 1JIRA 1A7SA 1TNLA 5C3NA 1YKTA 4BAOB 4X1NU 1O5GH 1CA0B 2Q1JA 3UQVA 4DY7B 2Z3DA 2WV4A 5GIBA 1C5RA 3SBKA 2VWLA 2XWAA 2AERH 2CJIA 4FUEA 4WMFA 3RXRA 4D76A 3V13A 1TONA 3UOPA 2XYAA 3TJOA 1GJCB 2BOKA 2CF8H 1MU6B 2QC2A 3UOUA 1EAUA 1CT2E 2EEKA 1O3NA 3STJA 4K5ZA 2GT8A 2ZWLH 4GHTA 2A1DB 3QTOH 3SQEE 1OKXA 1QRWA 1O2TA 1AHTH 1Z8JB 2D2DA 1GJ5H 3E90B 2EI6A 2M5TA 4A1XA 1OP0A 5AFYH 1ZZZA 3OU0A 2FZZA 2H2ZA 2Z9KA 1ZR0A 1W2KH 4NIXA 5EGMA 6GCHG 1ZMNA 3JZ2B 3MFJA 2TGTA 2J4IA 5L30H 5C2ZA 3ATKA 1O2SA 1IQNA 1AI8H 3MHWU 5EG4A 5F8XA 2OUAA 3F9HA 1DLKB 1GMHF 5JBCS 1ABIH 3SJKA 3SJ9A 1G36A 2AMQA 2ZHFH 2F9UA 3B9FH 3T5FH 2FI5E 3RXAA 3A83A 2ZKSA 1G3DA 3UWJH 4JYUH 1THPB 3TK6A 5FAHA 1C9TA 1A0JA 1TRNA 1M9UA 1C4V2 4NIYA 1NZQH 5AFZH 4AFZA 1ZRKA 3I78A 2BQWB 4X8UH 2NU3E 2P8OB 1AQ7A 1BMAA 2WYGA 2NU0E 3HK6B 3GYMA 1ZGVA 2WUCA 1QGFA 4A1VA 4YM9A 3R3GB 4YOGA 1BUIA 2ZG0H 3BTWE 1LVBA 1C2EA 4B74A 1G2LA 1CA0C 1H4WA 1N6XA 1SVPA 2FS8A 1O32A 1VCWA 4KTCA 4ZHLU 4E7NA 1E0FD 1MUEB 1P2NA 3P92A 4TY6A 2FI4E 1CBWB 1Z8RA 3E1XB 1WTHD 3A8DA 4CRDA 1DDJA 1EAIA 2Q6GA 1K1NA 2ZFPH 2GVFA 2AS9A 1PQ8A 1UK4A 1GJAB 5F6MA 1T8LA 3ZZCA 1MAYA 4MLFB 1SGPE 4OS4A 9LPRA 1SI5H 2OTVA 3KN2A 1C5NH 2XC0A 3SUEA 2KAIB 1XXFA 1AU8A 4TPIZ 4K3JA 1NU9A 1MQ6A 2O9QA 3BTEE 2BLVA 2Y6TA 1QJ6B 3U1JB 3TK9A 4GCHG 4AFSA 4FXGH 6LPRA 4AOQA 4X6OA 1ELGA 4X1PU 3ZZ4A 4UE7H 1TOMH 1GI0A 3M35A 4YO9A 3MI4A 3ZYDA 1TQ0B 3VEQB 3K65B 1T8NA 2GMTC 1NFUA 5PTPA 3SNBA 1JWTA 4AORA 1TE0A 1C5LH 4ABHA 1SGCA 1O3EA 3SV7A 3PTNA 5BPEA 5EXMA 2AIPA 1ZTKA 2Z9IA 3P8OA 5HMAA 4B76A 1CT4E 3Q3XA 5EPNA 3K6ZA 3ATIA 4CRBA 2WPKS 1P04A 1O38A 3SHCH 2ZCHP 1O5BB 4I8KA 1W13U 3LGIA 4XSKU 1EZQA 3ZZAA 5DKMA 4D7GA 3A8AA 4TWWA 1JMOH 2QF0A 2P8OC 1F2SE 1GJ8B 3LGVA 3D23A 3SI4H 4AZ2B 1TGNA 1P05A 3FZZA 5DJ7A 1H9IE 1A3EH 2FMJA 2GCTC 3RXJA 1D6WA 3VPKA 2GZ8A 2UWLA 4INHA 3AAUA 3CS0A 1DVAH 2QF3A 2AGEX 1CBWC 2W5EA 4CH2B 1NY22 1GHVH 1YPHE 3FANA 2BYAX 1YGCH 5AF9H 1H9LB 5E0JA 4X2XA 2VINA 1OYTH 1NROH 1O5EH 2C90B 4UFGH 2FOAA 4DIIH 1EQ9A 3A7YA 1BTXA 4B73A 4DT7B 3LJOA 3SU5A 2BX3A 3GY6A 4U30A 2EC9H 1Z1JA 1G30B 1AFQB 2SGDE 1PQ7A 3E3TA 4GVUA 3A7WA 1YPJH 3ENSB 1UVSH 2THFB 3U8RH 4ZMAH 1N6YA 2H5CA 2ODQA 1V2PT 2A4QA 2XRCA 1S84A 4ABIA 1ZHMA 1LKAA 1IQLA 2TPIZ 1NO9H 2BXTH 3TH3H 3LT3A 2ZPSA 2BTCE 1YPKH 1EB2A 3SUGA 1O3CA 5EPYA 1G9IE 2YOLA 4U01A 3RUOA 3MU1A 4O9VA 1VCPA 3A7XA 1GBMA 5GDSH 3MO9A 1DUAA 2VGCB 1SSXA 3SQHE 1O39A 5ABWA 2BY7X 2AYWA 1SOTA 1C9PA 3NPSA 2Y7XA 1GHBG 3U8TH 4X2VA 2OLGA 5C5NA 3TNSA 1V6DA 5C67A 3GY3A 1PFXC 1GI1A 2UUJB 2V0BA 1CT0E 2JETB 1S85A 4ZHAA 1C5QA 5FBEA 3TH2H 2PGBB 1MCTA 5A8ZA 3HKIB 1O2VA 1EZSC 2ASUB 1QIXB 4JCNA 2BDYA 2ZGCA 3BEIB 1UVOA 1SGQE 2HPQH 1MD7A 1O3AA 2OC0A 1B7XB 2RG3A 3LGWA 4HFPB 4WF8A 3ZVAA 1J8AA 1NS3A 2ZTXA 1UTQA 1G32B 1GDQA 1V2TT 1V2OT 2J94A 1PPZA 2Z9LA 3AVZA 3M36A 1O3MA 3ZVGA 1SLXB 3SU2A 5EQSA 1VGCC 1C2HA 4JZ1A 4MG3A 1LDTT 4X1SU 2BMGB 1W7GH 2ZZUH 1C5OH 7GCHG 1GI6A 2HNTF 4DGJA 1IOEA 1HAZB 2Y5FA 1K22H 1A2CH 1AVWA 3GICB 1LHFH 1YBWA 1GJ6A 3GYLB 4E7RG 5FHTA 2YNBA 2SGFE 5ESTE 1AFQC 2PLXA 1BBRE 5IDKA 4WVPE 4A5TS 1GBHA 1CO7E 5K0HA 3SORA 4F4OC 2Y80A 2BVRH 1L1NA 1QRXA 3UFAA 1ANDA 1ZOMA 1GVLA 2BD5A 2J95A 4H4FA 2RDLA 3RXSA 3BTHE 3MNBA 3AASA 1TNIA 2H9TH 4Y6DA
chains in the Genus database with same CATH superfamily
2F3CE 4AC9A 1D6RA 1AZ8A 2JH5D 4SGBE 1UVTH 1O5AB 1C5PA 1S81A 2PTNA 1O3LA 2ZDLA 2ULLA 2A7JA 3ODDA 2ZU1A 3VXFH 5FX5A 1DY9A 2J5UA 4I8HA 3DFLA 1O2NA 4INKA 1TX8A 3RLWH 3GCNA 3KIDU 3K6YA 2SGAA 1W11U 1NFYA 2JETC 2GT7A 3KNXA 3ZZ3A 2V3HH 1GL0E 4XBBA 5BRRE 3N7OA 2R3UA 2Z6BD 3V0XA 4ZROA 2FIRH 3PWBA 4RT1A 2QF4A 4TT3D 5JB9S 1YWUA 4HGCA 3PMHB 2VNTA 3SU6A 1TPSA 3DFJA 2AHME 1NESE 1P2OA 1BHXF 2LP6A 4JYVH 4DCDA 1SFIA 2BD9A 2PP6A 3QUMP 3QZRA 2BY5X 1ANCA 4NA7A 1H8ED 1BHXB 2OBQA 5CMXH 2HVYB 1GBLA 1ZRBA 4UD9H 4Q63A 4R0IA 1SG8B 1QCPA 1SL3A 2TIOA 1XXDA 1TRYA 2VVUA 1T7CA 1VR1H 3A84A 3KYFA 1IQKA 4MNXA 2VWNA 3URDA 2J38A 1CQQA 1KXFA 1SGDE 1EX3A 1FY8E 1QRZA 1CE5A 3SU0A 1HXFH 3S7KB 3KYGA 3MOCA 4SGAE 1Z7KA 2P93A 1KXAA 2GJGA 1DUEA 1A3BH 1BCUH 4I8JA 1XUIA 3D65E 2SNWA 1GJDB 1KDQA 2G4TA 4MNWA 4WMDA 1RTLA 1O3OA 3SW2B 4NFEA 2BDBA 3U69H 2FLRH 3BIUH 3M5NA 1V2RT 2BDGA 5FL7D 4BTUB 2G8TA 3U9AH 3RXTA 4Q4LA 3LGTA 2F9VA 1FJSA 4ABDA 3KEEA 1ZSKA 2I6QA 2UUKB 5DGJA 4K60A 4B2BA 4CREA 1PPHE 2BD4A 2OCVB 3DD2H 3O8CA 1HLTH 1V2KT 2F9BH 1AO5A 2KR7A 3HK3B 3V12A 2WPHS 3RXFA 1C1SA 3QWCH 4RKJB 5F8ZA 3CS7A 3BTDE 3DHKH 1HRTH 3T62A 4ZAEA 1GHWH 1GHBF 3NCLA 3B8JA 4I8GA 1HIAB 3T27A 2F9PA 2BZ6H 1CGIE 3E0NB 2G5NA 1Z6EA 3VB3A 2V7QD 1GJ7B 1K1IA 1NRPH 1G3CA 4OS5A 1BRUP 4AG2A 1DPOA 2BDHA 3UPEA 1GMCG 1O2YA 2FO9A 1FY4A 3ELAH 1C5TA 2C8XB 3A80A 3SNDA 1TIOA 1KDQB 3AW1A 1BB0B 3CNRA 1RJXB 1SBWA 1ELDE 4HZHA 1ZHPA 4ZH8A 3H09A 2FOBA 4YLQH 1FX0B 3L3TA 2H5DA 5E2PA 2VIOA 1LVMA 1WOFA 4RI0A 2VBCA 1ELVA 1AE5A 3M37A 5A0AE 4Y11E 1VJAU 2V3MA 1O2GH 2QYIA 4YLUA 5JYIA 1ZYOA 1Y3UA 1EJMA 3UB0A 3UREA 2GKVE 2ZHDA 1P9SA 1W0ZU 3L33A 3MU8A 4A1TA 1MMJN 2FP7B 2FPZA 1O3GA 1OXGA 1SGEE 1HJAC 4WH8A 5E0GA 3A8BA 1FY3A 3SU4A 1DXPA 3M5MA 3GCHC 2WPMS 3P8FA 3P17H 4Z6AH 2CV3A 9ESTA 1HDTH 1C1RA 1MBQA 3OFND 1K0HA 1WBGB 1O2PA 5GCHF 2Y7ZA 2JJ1D 1QTFA 1DWEH 4WJG2 1P2QA 5GPIB 1O2LA 2OINA 3BG4B 1YF4A 3GOVB 1COWD 2AFQB 1KSNA 1TA2A 2K1QA 3HPTB 3MO6A 3T28A 1C4U2 2Q6DA 1C1WH 4YESB 1LCYA 1ZMJA 3IITA 3UQOA 1FNIA 1TNHA 3K9XB 4O3UA 3SNCA 3Q3KA 2OQ5A 1HYLA 3S9AA 1EFRD 2I6SA 3RP2A 5GWZA 3PMJA 1YY3A 5JBAS 1G3EA 1KY9A 5EW2H 1W0YH 3EQ0H 2O8MA 4BXWA 3QN7A 3BEFB 5EIYA 4UFFH 1P3CA 2TRMA 1FIWA 2IPQX 4NSVA 1GCDA 3DUXH 1T4UH 2V6NA 4Y8YA 3ZVDA 2O8TA 1DM4B 4ACBA 3UTUH 2CHAB 5SGAE 3KQDA 4YXWD 4Q2KA 3RXCA 1K28D 1V2VT 4CR9A 2Q6FA 3QLPH 1SMFE 3SJOA 1NBME 2FLBH 3SV8A 5T3HA 1Z8IB 1PPBH 1LVYA 2ZDAH 5GNDA 1J15A 2FM2A 4ISNA 1GMDF 1FDPA 1P2IA 2BD3A 3MH5A 1IHTH 1PYTD 1ZPZA 4MPXA 3W94A 3KF2A 3F68H 1NRNH 2QE7D 1KYNA 1SLWB 4B2AA 5IYTA 2PTCE 2QIQA 4D7FA 1TNGA 3EYDA 2P3FH 5FPYA 3I77A 2R2WU 1GGDC 2JKHA 4X8SH 1AGJA 1ZMLA 2GX4A 3TGJE 2KCAA 1MAXA 1DWCH 4IN1A 5EXNA 1BTYA 4F55A 2GMTB 1MABB 2HNTE 1EP6A 1YPLH 4WY3A 1L2EA 3D49H 3A7VA 1Z1IA 2PKAB 4B75A 1ETSH 2KAIA 4IBLH 1GI4A 4TPYA 1DSTA 2EI8A 1HAYB 1C1MA 1O31A 2ZCLP 1JIMA 3HKJB 4M9FA 5A8XA 1J9CH 3RMMH 1Z71A 3BG4C 3GY4A 2GZ7A 1ID5H 1SQAA 3FFGA 2FEQH 5HM2A 2GD4B 3PLPA 3F2HA 1GBDA 3I29A 3OX7U 3KQ5A 1E1QD 1A0LA 1L1JA 1QY6A 3PTBA 4UEHH 2Z7FE 1O3FA 3KHVA 2O8LA 1SGFG 1O2OA 1TPAE 2PSYA 1W14U 3PV4A 4ACAA 5DP8A 5DSFA 2GCTB 3UR9A 2OBOA 3OEHD 1TALA 2PW8H 4X2YA 1C2FA 1O2ZA 1V2UT 2A5KA 3SZEA 1W7XH 3P8NA 2ZHQH 5FPTA 3AK5A 3RMOH 4CH8B 4GHQA 4BAKB 3RU4T 2CHAC 1INCA 1MCVA 3M61U 2ALPA 3N7DA 4OS6A 4FUFA 3OAAD 2CMYA 4U2WA 1GMCF 3P70B 4H6TA 1QL7A 5EOKA 1Y3VA 4CBOA 1RD3B 1GG6B 2FODA 2PSXA 1HAVB 3ZZDA 1ZPBA 2BD2A 2BQ6B 3SHAH 1YLDA 1Y5UT 1BZXE 1GJ9B 2A5AA 1TRMA 4I33A 1FZZA 1BITA 2ODYB 4Y0YE 3NXPA 2OQUA 2NU1E 3QK1A 1XX9A 1UTLM 2HOBA 3U28C 1C5UA 3EGKH 2BVSH 1U6QA 2C3SA 4OGYA 1MTNB 1DY8A 2VIPA 1QB6A 1EB1H 2HPPH 4Z1MD 1FPCH 4CHAC 1SLVB 5DK1A 2GV6A 3EE7A 2D1JA 2ZFQH 2ZQ1A 3GCTF 3MNSA 5DPAA 2VVVA 1C5ZB 1EJNA 1SQOA 2CK3D 1PQ5A 2NU4E 1OSSA 4E06H 5CHBA 2NWNA 4R8TB 5DP5A 3M5LA 1EPTB 1K1LA 1K1OA 3FP7E 3KQCA 3UNQA 3VB4A 1GWAA 1AFEH 1E1RD 4ZXYH 2V35A 2RFKC 3A85A 4FU9A 1P2MA 3LC5A 2ZTZA 1VITH 1C5VA 1UCYK 3BF6H 3CP7A 1BRCE 1UCYH 2HWLB 3MO3A 1D3QB 3E91A 2ZIQH 5HIYA 5A0BA 3LIWA 3ZYEA 1HGTH 4YOJA 3EA8A 3RU4E 2UWOA 1DANH 3BTKE 1NT1A 3FVFB 1C1UH 1V2WT 5DG6A 1OP8A 4DURA 2D8WA 2O8WA 1TMTH 1P2JA 1LQDB 1G3BA 2Y82A 1DFPA 1IQJA 1VGCB 1VCQA 3EDXB 1ZSJA 4K1EA 2EI7A 1HB0B 2EY4C 2F91A 3U8OH 2OC1A 5JB8S 1O2UA 3TLOA 3UUZA 4J2YB 1O3JA 2AGIX 1OWKA 2CGAA 1GG6C 3VGCC 1OWIA 1ZHRA 1HPGA 1Y8TA 3KCGH 2VIDA 1BMLA 3PROA 3C1KA 3SGQE 4FVBA 2PR3A 1MKWK 3MYWA 2ALVA 1MKWH 1EXFA 2A45B 5EU8A 1ANBA 4ZCNA 2ODPA 1GVZA 4I8LA 3VB5A 5LGOA 2QA9E 4CRGA 3ATLA 2WUBA 2J2UA 1GI8B 4GLYA 4IS5A 3O8BA 1MTNC 4IMQA 2PHBA 2HLDD 1SGFA 1ELAA 4JZIA 1WV7H 2A7CA 4BANB 4Y71A 2SFAA 1C1QA 2BDCA 7KMEH 3PRBA 1OWEA 2ZQ2A 3ZZBA 2PWXA 2G4UA 1GHAG 3RMNH 2F83A 3MNXA 3GDVA 3MNCA 2C8YB 2GCHF 3LGUA 1C1TA 1SLUB 3LGYA 5T6DA 1W8BH 3BN9A 1EPTC 1T32A 3EE0B 1C5WB 4YOIA 3LH3A 2G52A 1BT7A 1BTPA 4A7IB 2TGAA 1GBIA 1BMNH 1WYKA 1O3DA 2XNIA 3BIVH 3CENA 1BA8B 2ZFSA 2BVXH 2JH0D 3QDZB 5EJLA 1C2IA 4JYTA 1O2RA 2GTBA 2FXRA 1IQEA 1JRSA 5CE1A 1FQ3A 2FOMB 1A5GH 4O03A 1DLEA 1O3KA 3RMLH 1UTKA 3RC5A 1L1GA 1AUTC 8ESTE 2WHXA 3K2UA 1NPMA 1F0UA 2EA3A 4BTIB 1DOJA 1YPMH 1HAHH 1F5RA 5C20A 1EOLA 2XC5A 3F2GA 1DE7H 5IK2D 1EJAA 1YLCA 2Z3EA 1F0RA 4ABGA 1RTKA 1PYTC 2D26C 1NN6A 3ZZ5A 1H1BA 1HNEE 1KTSB 4OGXA 3E6PH 4WH6A 1AKSA 1LHGH 2CN0H 1P8VC 3RM2H 3A88A 3EA7A 3SV2H 1S0QA 1GVKB 1K21H 2M2AA 1LPZB 1O3BA 1FV9A 4FUDA 3RC4A 2ZDVH 4AYVB 3BTFE 4MPUA 6CHAB 1C4Y2 3ZVCA 1O37A 1EAXA 2ANKH 2ZEBA 4MPWA 5J4SA 1KLIH 2SGQE 1NRRH 1HAOH 1DX5M 1UVPA 4GSOA 4OS2A 5LPEA 2AMPA 2VWMA 3RXOA 5HYOA 1O3IA 3SNEA 1QFKH 4I32A 1O3HA 6ESTA 2RA0A 1QL9A 2XCNA 5GCHG 1GBEA 4Q80A 5DP7A 1WQVH 1SFQB 3BTQE 1TNJA 8GCHF 1L4DA 4U32A 2A4GA 1SPJA 1O3PB 4FUBA 4CBNA 3M7QA 3T2NA 3SJIA 4Y76A 2UUFB 5DP4A 1UK3A 2ZNKH 2QF5A 1ANEA 2H6MA 2FDAA 1TBRH 3PMBB 4ISHH 3GY2A 4I31A 1GI9B 4DVAU 1P9UA 1DSUA 1E34B 2IJOB 1XVMA 2QGRA 1MH0A 4FU8A 1ZSLA 2G5VA 3C27B 4GUXA 5A09A 2P3UB 2STAE 3GDSA 2W26A 4LK4A 1AKSB 3ITIA 1YYY1 2BHGA 1BJUA 1E36B 4XOJA 2ZP0H 3KQEA 1ESBA 5KEDA 1VKYA 1AY6H 1TX7A 3TU7H 1A46H 1LHCH 1UTMA 2PUXB 2ZGJA 3SV9A 2AGGX 1PPCE 1F5LA 3NWUA 1BRBE 4UFDH 1GBBA 1GMDG 2ILNA 5FBIA 4OS1A 2PFEA 1TGCA 1MZAA 3WY8A 1VJ9U 2ZF0H 1HIAA 2XBVA 4NFFA 2GDEH 2A2QH 3EAJA 1ESAA 2YMSD 4NIVA 4NWLA 2W6ID 3ESTA 2ZU4A 4KELA 1GDNA 1O2HA 1WQSA 3FOAA 1WCZA 6CHAC 1Q2WA 1NRQH 3AW0A 4DT4A 3RXBA 3MMGA 3LPRA 4ABJA 1MKXK 2QY0B 3PLBA 3DT0H 2FOFA 2W3KA 1GI2A 2R0LA 1HJ9A 4UDWH 1QQ4A 1OS8A 3JZ1B 1O2WA 1ORFA 4CRAA 5T6GA 1UTJA 3PRDA 1A1RA 1QA0A 4THNH 4WWYA 1HJAB 1SOZA 1TMUH 2TGDA 3TH4H 2FOEA 1E37B 1AB9C 4GPGA 3STIA 1C1NA 1ZLRA 1UHBB 2ZC9H 3GCHB 1NFXA 1AD8H 2IJD1 4K1SA 4B6EA 3Q76A 1P3EA 2LNCA 4TWYA 2ZU3A 5F8TA 1O30A 3NZIA 1IQFA 1E35B 1ELBA 1GHAF 1S83A 1AVGH 1D3TB 5KGOA 2FX6A 4ISOA 1GBAA 2R2MB 5F03A 2GZ9A 1SHHB 1UK2A 2BD7A 2FYQA 1FY1A 1IQMA 3TJUA 1ZJKA 3RXDA 1C1PA 4VGCB 4D8NA 2B0FA 5A2MH 1GI5A 4F49A 1S6FA 2G00A 4DG4A 2P94A 4Y10E 1UVUH 2Y5HA 1P2KA 1BTWA 1FIZA 1J16A 2XBYA 1V2MT 2UUYA 1Z6JH 3VB6A 3UR6A 2JIZD 1O0DH 1LPKB 1FY5A 1UTOA 2ZFFH 4JZDH 1TPPA 4CRFA 4IC6A 4O3TA 2XW9A 3FZDA 1TBZH 4LOYH 1VITG 1P11E 2BM2A 2WPJS 2P16A 2J9NA 4Y0ZE 1BDAA 2QXIA 4AYYB 3V7TA 4IC5A 3T29A 1Y3XA 4IGDA 1QB1A 2GDDA 4X6PA 3GDUA 2VIWA 1KLJH 5ETXA 4FETA 4K8BA 1D3PB 1BTHH 3P95A 4AB8A 2VH6A 1GBKA 3QGJA 3GCTG 1TX6A 2XC4A 2XNDD 2W7UA 2ZHWH 3BTTE 3ZV8A 4X8TH 1GBJA 1Z8GA 1SR5C 2ZDMA 1GGDB 2V3OH 4RSPA 2FESH 3GCOA 3MH4A 5JDUB 3GISB 1SGYE 1RFNA 2AIQA 1F92A 1P09A 1QA7A 3OY5U 3S0NA 1BQYA 1F5KU 5T6FA 2BDIA 1UJ1A 3F6UH 4PROA 1QBVH 5ESBA 1YCPK 4F48B 2FI3E 2KCYA 2ZDKA 2QXGA 4BNRA 1UTNA 2WPDD 1AE8H 1TB6H 3RXGA 2VVCA 4BAQB 4Z0KA 1OPHB 2BOHB 5T1VA 1QBNA 1QL8A 4VGCC 1IQHA 1HCGA 4YTAA 2VH0A 4WXIA 2HGTH 1V3XA 3KQBA 4NA9H 3RXQA 2ZECA 1GDUA 1S6HA 5CDFE 2PKAA 1SGTA 3TITA 1HUTH 2JJ2D 3F9FA 3PB1E 2O8UA 4WMEA 1MD8A 1Y59T 1YPHC 4LZ1H 1EKBB 1O2JA 1XKBC 1C5YB 1THSH 2F43B 3LOXA 4TSFD 2XBXA 1GI7B 4NA8A 3O8RA 4AX9H 4D9QA 1NM6A 3ATMA 3MU5A 4NZLA 2STBE 4DW2U 3BSQA 1AWHB 3LH1A 1G2MA 3TK5A 2L74A 1ELTA 4ZKOU 2WV9A 2DE9A 1ETRH 4Y79A 4MDSA 4K69A 5FX6A 1YM0A 1XM1A 1C5MD 1J14A 3ZZ8A 5C0TA 2B7DH 3VFEA 5H4IB 2DE8A 4NZQA 1YLNA 1V2NT 5EQRA 3SU3A 8KME2 2SGPE 2A2XH 4NWKA 1UMAH 2F9OA 4IN2A 2B5TB 3A7TA 3E0PB 2PUQH 3BTME 2AH4X 1TGSZ 1FMGA 5JPMH 1TPOA 2ZPQA 2GCHG 1F0SA 1O5CB 2ANYA 1QQUA 1XUJA 2A32A 2WPIS 3M3SA 4XDEA 2HVXA 4CHAB 3PWCA 4KTUA 1TYNA 4Y7AA 4Q7XA 4X6NA 3TJNA 1A5IA 1CGHA 1ZGIA 2H1UA 2VB0A 1HAVA 1AWFH 3SU1A 1ABJH 1MTVA 2P3TB 1D4PB 5EW1H 3BTGE 2A31A 1TLDA 1BBRK 1JBUH 2UWPA 3L6PA 4QT8C 4A92A 1BBRH 5EXLA 3QO6A 5HGGA 1S82A 2BLWA 2BX4A 3SOSA 1W0JD 3OTPA 4ABAA 1ACBE 2KX4A 1RIWC 5LH8A 3IWMA 1OWDA 1K9OE 3SJ8A 1IQIA 1KXDA 3A86A 1F0TA 2BD8A 3FAOA 5DP3A 4Q7YA 1KXBA 5C1YA 4MQAA 1AUJA 1OOKB 1CVWH 1TAWA 3QX5H 1BMMH 1XVOA 1ZTLA 1L4ZA 2DUCA 2XBWA 2PGQB 3FN8A 4NCYA 3D62A 1EPTA 1BMFD 3PYHA 2QN5T 4FUHA 1HAXB 2SGEE 3NUMA 3TGKE 2OP9A 5L6NH 3UIRA 4MNVA 2YMSC 3PM3A 5GXPA 1DWDH 1GBFA 2CF9H 3MWIU 3N7EA 2ZGBH 1RXPA 1VITF 1HFDA 4ZXXH 1ELFA 1N8OB 1NBMD 4AGKA 3VGCB 1OWHA 1C2DA 1SB1H 5C1UA 1GI3A 1ARCA 2GP9B 4ASHA 1FUJA 1Y5AT 4Y7BA 2FTMA 2FOGA 3MH6A 2BXUH 4JZFH 4H6SB 1FI8A 1GHXH 4X1QU 2XOKD 1P12E 1UO6A 1SKYE 1KLTA 5L2YH 1B0FA 8GCHG 2BY8X 4AGJA 3Q3YA 4FVDA 5A8YA 3MU0A 1NFWA 3ODFA 1C1VH 1P57B 1GL1A 4ZHMU 4NGAH 4X2WA 2G55A 1WUNH 4FUJA 2FOCA 4JK5A 4AG1A 2ZA5A 2H9EH 2J92A 1JRTA 4X6MA 4HI3A 1O34A 3OEED 3S7HB 3T25A 2QXHA 1C2KA 1FAXA 2K8IA 4A6LA 3VG8A 2P59A 1IAUA 1YCPM 1DXWA 1DICA 2ZO3H 1K1MA 1DS2E 1HV7A 3O8DA 3RXPA 3TGIE 1WDIA 3S69A 5EQQA 1SGIB 4OS7A 3ZVEA 4ABBA 3RXKA 1O2QA 3ZVFA 3R0FA 1QB9A 3GY7A 3OY6U 4JZEH 3RC6A 1XMNB 1QBOA 5TJXA 3ZV9A 1YC0A 1O33A 5C0UA 3RXVA 4X8VH 1C2LA 3HGNA 2ANMH 2RA3A 3KGPA 5C94A 3RXHA 3NRLA 4KTSA 1EASA 1NRSH 4CRCA 1TFXA 3RXUA 2XXLA 4ESTE 1PJPA 1GBTA 1C2JA 2Y81A 2BY6X 1ETTH 1TOCB 3M7TA 4K2YA 5JBBS 3PMAB 5LPRA 1HJ8A 1ZPCA 2R3YA 1X7AC 1Y3WA 1H8DH 4DIHH 1LPGB 1LHEH 1HAPH 1WTGH 5C17A 3MH7A 5J4QA 1FLEE 1T4VH 1TABE 3QGNB 1FONA 3RM0H 1ZTJA 3FP8E 5EODA 1MBMA 5DP6A 3ZZ9A 1O5FH 3M3TA 1BTUA 3VXEH 2BY9X 1N8OC 1SQTA 4DOQA 1O2KA 1O36A 4LXBH 4AB9A 2H9HA 3S9CA 1H8HD 3SYJA 1T31A 1CHOG 4HTCH 2FWWA 1V2LT 2OXSA 5DP9A 2W3IA 5A0CA 1HAIH 5TCAA 1Y5BT 2G51A 1FXYA 1TBQH 1QJ1B 3M7UA 3TPIZ 3ZZ6A 1EZUC 3FKSD 3OSYA 3A89A 3H7TA 3SUFA 1N1LA 4XBDA 1HXEH 4LZ4B 1WAYB 1W10U 2A5IA 3F0OA 1OP2A 2OK5A 4IMZA 1H9HE 3H7OA 5FCRA 4ZKNU 1T8OA 1S0RA 1DWBH 3WW7A 2ZFRH 1RTFB 2G81E 1HAGE 2WV5A 3PO1B 2F9NA 2JH6D 4NSYA 1BOQA 2GV7A 8LPRA 1EZXC 3OTJE 4H42U 2VIQA 1NTPA 1MU8B 1WU1A 1DT2A 2W7SA 1GPZA 2C4FH 1C2MA 6GCHF 1QR3E 4ZUHA 2KM0A 1D3DB 3ZVBA 5E2OA 2PKSB 2ZHEH 3SO3A 5L2ZH 5FPSA 3DSPA 4FUGA 2IPHA 1A4WH 1LTOA 5AHGH 2L6OA 3H5CB 4GAWA 1E38B 3UWIA 1GJBB 1XUGA 1AMHA 1EAWA 4YT7H 3RU4D 3T26A 3U98H 1FAKH 4ABFA 4K1TA 2C93B 2J98B 3GY8A 1ELEE 5AVDA 4AFQA 1AZZA 2WPLS 2TBSA 3UY9A 1KMHB 4JMYA 4DJZB 2BZAA 1K1JA 1RRKA 1W12U 1DITH 3LU9B 1KTTB 1SGNE 2HLCA 2XCFA 3FO8D 4YT6H 3HATH 3RDZA 1OYQA 4Y8ZA 3A82A 1TA6A 1OWJA 4ZKSU 3ATWA 1TGTA 2FTLE 4BXSA 2ZGHA 1H8IH 3AAVA 1NU7B 4XRNA 2FX4A 3LC3A 1C5XB 1GJ4H 5CHAB 1BJVA 1P01A 1W3CA 3A8CA 2BLOA 1A61H 4UFEH 3W95A 2YNAA 2TGPZ 1LMWB 4JK6A 2VWOA 2IOTA 3RXMA 2ZTYA 1SC8U 2ZI2H 1XUFA 4RN6A 1AB9B 2ESTE 1BIOA 1YPEH 3QZQA 3B23B 4XE4A 4ISIH 1G37A 5I46H 1IHSH 3VB7A 1YP9A 2XTTB 3PO1C 1MZDA 2CXVA 2AMDA 2P95A 3F1SB 2XWBI 1K1PA 3URCA 4B1TA 2Z3CA 5B6OA 3BG8A 1TNKA 4GCHF 1QNJA 1P10A 1ARBA 2ZFTA 4FU7A 1EUFA 2W6JD 4P00A 1A0HB 5GJ4B 1Q31A 1UTPA 2PKSC 5HXFA 4I7YH 4BAMB 1YPGH 2VGCC 3WWBA 1XUHA 2RCEA 3RLYH 1O2IA 1C1OA 4M7GA 3SV6A 1UHBA 1EP5A 1SHYA 1RS0A 3BV9B 3TVJB 4E05H 3SGBE 1EOJA 1V2ST 3LKWA 1MTUA 1C5SA 3TNTA 4UONA 1A5HA 1GCTB 2R9PA 1OHHD 1ESTA 5TCCA 1MTWA 2OC8A 1GHYH 4BAHB 3SZNA 1ZJDA 2VU8E 5HM9A 1BRAA 3WWFA 4ABEA 4MPVA 3IG6B 1TMBH 5JBTA 4ISLA 1Q3XA 2FOHA 5C1XA 1EATA 1FPHH 1O2MA 2QXJA 3QTVH 3GY5A 4KP0A 3ZIAD 1KXCA 3ZZ7A 4AN7A 3SUDA 1AIXH 4RKOB 5CHAC 2FS9A 1MKXH 3KL6A 1PPFE 1AN1E 1CGJE 1LVOA 4O97A 5C5OA 1GBCA 1SGRE 1CHOF 1WSSH 3OYPA 1PPEE 1V2QT 2HNTC 1V2JT 1P0SH 1FN8A 2C8ZB 1KXEA 2HRVA 1JOUB 1XUKA 3SNAA 1K2I1 1UW7A 1S5SA 2PV9B 1PQAA 3RXEA 1MQ5A 1UCYE 1LHDH 1GMHG 1IQGA 4K8YA 1F7ZA 3DA9B 3NKKA 3P8GA 1HBTH 1CU1A 1QHRB 3A7ZA 3TIUA 3HGPA 1P02A 1Y3YA 3E8LA 5KECA 2Z94A 1S6LA 2FYRA 1TWXB 4MNYA 3RXLA 1B5GH 2A7HA 2SNVA 2ZU2A 4BOHA 4AFUA 3MU4A 4MTBA 1OX1A 1QJ7B 4NIWA 3SI3H 5FXLA 3S9BA 1JXPA 4FUCA 1C2GA 1D9IA 1TQ7B 4NG9H 2Z9GA 1GCTC 1QURH 2VJ1A 3G01A 4IW4E 2BB4A 2OC7A 3F9EA 1O35A 2OD3B 2EQNA 3BEUA 1FN6A 3M3VA 2WINI 2HALA 2R0KA 4Y8XA 2A4RA 1RGQA 1T8MA 1J17T 1KIGH 5LPFA 2ANWA 7LPRA 3F9GA 5E0HA 4KKDA 1XKAC 3M5OA 5DO4H 1CHGA 3UNSA 4BTTB 3V3MA 2VIVA 2WSSD 4WXVA 2WYJA 2GGVB 1LO6A 3A87A 7ESTE 2BLQA 5FCKA 1TGBA 2ZPRA 3N99A 3MTYA 2Y5GA 1O2XA 3PV5A 3U1IB 2BDAA 1GHZA 1PPGE 1CSOE 2IN2A 4B71A 3Q77A 3LONA 2C8WB 2NU2E 2Z9JA 1ELCA 7GCHF 1E79D 3NK8A 1L0ZA 3GS9A 4X1RU 1NC6A 1P06A 4MVNA 5G4BA 1YCPH 2B8OH 3A81A 3FP6E 3LJJA 1O5DH 4Q7ZA 1B0EA 3E16B 4TYDA 2A0QB 4TY7A 3SN8A 3UNRA 1AVXA 3SGAE 5E8EH 3P6ZB 3RXIA 1RIWB 1CA8B 1BTZA 4XFQA 2ZU5A 4FUIA 1VZQH 1MTSA 2BQ7B 2ZDNA 2AEIH 2QV1A 3TJVA 2QAAA 4B2CA 2ZCKP 5I25A 4YZUA 3PLKA 2J34A 3Q00A 3LDXH 4J1YA 4KGAA 4XD7D 4ZKRU 4CR5A 3DSGA 4X0WU 1LKBA 2A4OA 4INLA 4D9RA 5K7RA 1LQEA 1THRH 1P03A 2QCYA 3EA9A 5DN6D 4XBCA 2B9LA 2ZGXH 2LPRA 1JIRA 2YMSB 1A7SA 1TNLA 5C3NA 1YKTA 4BAOB 5EJZA 4X1NU 1O5GH 1CA0B 2Q1JA 3UQVA 4DY7B 2Z3DA 2WV4A 5GIBA 1C5RA 3SBKA 2VWLA 2XWAA 2AERH 2CJIA 4FUEA 4WMFA 3RXRA 4D76A 2J97A 3V13A 1TONA 3UOPA 2XYAA 3TJOA 1GJCB 2BOKA 2CF8H 1MU6B 2QC2A 3UOUA 1EAUA 1CT2E 2EEKA 1O3NA 3STJA 4K5ZA 2GT8A 2ZWLH 3DSOA 4GHTA 2A1DB 3QTOH 3SQEE 1OKXA 1QRWA 1O2TA 1AHTH 1Z8JB 2D2DA 1GJ5H 3E90B 2EI6A 2M5TA 1SQRA 4A1XA 1OP0A 5AFYH 1ZZZA 3OU0A 2FZZA 2H2ZA 2Z9KA 1ZR0A 1W2KH 4NIXA 5EGMA 6GCHG 1ZMNA 3JZ2B 3MFJA 2TGTA 2J4IA 5L30H 2KZ4A 5C2ZA 3ATKA 1O2SA 1IQNA 1AI8H 3MHWU 5EG4A 5F8XA 2OUAA 3F9HA 1DLKB 1GMHF 5JBCS 1ABIH 3SJKA 3SJ9A 5HKKD 1G36A 2AMQA 2ZHFH 2F9UA 3B9FH 3DCLA 3T5FH 3W1EA 2FI5E 3RXAA 3A83A 2ZKSA 1G3DA 3UWJH 4JYUH 1THPB 3TK6A 5FAHA 1C9TA 1A0JA 1TRNA 1M9UA 1C4V2 4NIYA 1NZQH 5AFZH 4AFZA 1ZRKA 3I78A 2BQWB 4X8UH 2NU3E 1AQ7A 2P8OB 1BMAA 2WYGA 2NU0E 3HK6B 3GYMA 1ZGVA 2WUCA 1QGFA 4A1VA 4YM9A 3R3GB 4YOGA 1BUIA 2ZG0H 2LELA 3BTWE 1LVBA 1C2EA 4B74A 1G2LA 1CA0C 1H4WA 1N6XA 1SVPA 2FS8A 1O32A 1VCWA 3OE7D 4KTCA 4ZHLU 4E7NA 1E0FD 1MUEB 1P2NA 3P92A 4TY6A 2FI4E 1CBWB 1Z8RA 3E1XB 1WTHD 3A8DA 4CRDA 1DDJA 1EAIA 2Q6GA 1QZ8A 1K1NA 2ZFPH 2GVFA 2AS9A 1PQ8A 1UK4A 4I86A 1GJAB 5F6MA 1T8LA 3ZZCA 2K0QA 5HIZA 1MAYA 4MLFB 1SGPE 4OS4A 9LPRA 1SI5H 2OTVA 3KN2A 4FOUC 1C5NH 2XC0A 1WXRA 3SUEA 2KAIB 1XXFA 1AU8A 4TPIZ 4K3JA 1NU9A 1MQ6A 2O9QA 3BTEE 2BLVA 2Y6TA 1QJ6B 3U1JB 3TK9A 4GCHG 4AFSA 4FXGH 6LPRA 4AOQA 4X6OA 1ELGA 4X1PU 3ZZ4A 4UE7H 2RDEA 1TOMH 1GI0A 3M35A 4YO9A 3MI4A 3ZYDA 1TQ0B 3VEQB 1W0KD 3K65B 1T8NA 2GMTC 1NFUA 5PTPA 3SNBA 1JWTA 4AORA 1TE0A 1C5LH 4ABHA 1SGCA 1O3EA 3SV7A 3PTNA 5BPEA 5EXMA 2AIPA 1ZTKA 2Z9IA 3P8OA 5HMAA 4B76A 1CT4E 3Q3XA 4OM9A 5EPNA 3K6ZA 3ATIA 4CRBA 2WPKS 1P04A 1O38A 3SHCH 2ZCHP 1O5BB 4I8KA 1W13U 3LGIA 4XSKU 1EZQA 3F3BA 3ZZAA 5DKMA 4D7GA 3A8AA 4TWWA 1JMOH 2QF0A 2P8OC 1F2SE 1GJ8B 3LGVA 3D23A 3SI4H 4ASUD 4AZ2B 1TGNA 1P05A 3FZZA 5DJ7A 1H9IE 1A3EH 2FMJA 2GCTC 2WZQA 3RXJA 1D6WA 3VPKA 4HG6A 2GZ8A 2UWLA 4INHA 3AAUA 3CS0A 1DVAH 2QF3A 2AGEX 1CBWC 2W5EA 4CH2B 1NY22 1GHVH 1YPHE 3FANA 2BYAX 1YGCH 5AF9H 1H9LB 5E0JA 4X2XA 2VINA 1OYTH 1NROH 2J98A 1O5EH 2C90B 4UFGH 2FOAA 4DIIH 1EQ9A 3A7YA 1BTXA 4B73A 4B6FA 4DT7B 3LJOA 3SU5A 2BX3A 3GY6A 4U30A 2EC9H 1Z1JA 1G30B 1AFQB 2SGDE 1PQ7A 3E3TA 4GVUA 3A7WA 1YPJH 3ENSB 1UVSH 2THFB 3U8RH 4ZMAH 1N6YA 2H5CA 2ODQA 1V2PT 2A4QA 2XRCA 1S84A 4ABIA 1ZHMA 1LKAA 1IQLA 2TPIZ 1NO9H 2BXTH 3TH3H 3LT3A 2ZPSA 2BTCE 1YPKH 1EB2A 3SUGA 1O3CA 5EPYA 1G9IE 2YOLA 4P02A 3F0PA 4U01A 3RUOA 3MU1A 4O9VA 1VCPA 3A7XA 1GBMA 5GDSH 3MO9A 1DUAA 2VGCB 1SSXA 3SQHE 1O39A 5ABWA 3F2FA 2BY7X 2AYWA 1SOTA 1C9PA 3NPSA 2Y7XA 1GHBG 3U8TH 4X2VA 2OLGA 5C5NA 3TNSA 2KCPA 1V6DA 3UAIC 5C67A 3GY3A 1PFXC 1GI1A 2UUJB 2V0BA 1CT0E 2JETB 1S85A 4ZHAA 1C5QA 2KCOA 5FBEA 3TH2H 2PGBB 1MCTA 5A8ZA 3HKIB 1O2VA 1EZSC 2ASUB 1QIXB 2JDID 4JCNA 2BDYA 2ZGCA 3BEIB 1UVOA 1SGQE 2HPQH 1MD7A 1O3AA 2OC0A 1B7XB 2RG3A 3LGWA 4HFPB 4WF8A 3ZVAA 1J8AA 1NS3A 2ZTXA 1UTQA 1G32B 1GDQA 1V2TT 1V2OT 2J94A 1PPZA 2Z9LA 3AVZA 3M36A 3PV2A 5B6LA 1O3MA 3ZVGA 1SLXB 3SU2A 5EQSA 1VGCC 1C2HA 4JZ1A 4MG3A 1LDTT 4X1SU 2BMGB 1W7GH 2ZZUH 1C5OH 7GCHG 1GI6A 2HNTF 2KFWA 4DGJA 1IOEA 1HAZB 2Y5FA 1K22H 1A2CH 1AVWA 3GICB 1LHFH 5EJ1A 1YBWA 1GJ6A 2F4LA 3GYLB 4RT0A 4E7RG 5FHTA 2YNBA 2SGFE 5ESTE 1AFQC 2PLXA 1BBRE 5IDKA 3MQKC 4WVPE 4A5TS 1GBHA 5F53A 1CO7E 5K0HA 3SORA 4F4OC 2Y80A 2BVRH 1L1NA 1QRXA 3UFAA 1ANDA 1ZOMA 1GVLA 2BD5A 2J95A 4H4FA 2RDLA 3RXSA 3BTHE 3MNBA 3AASA 1TNIA 2H9TH 4Y6DA
chains in the Genus database with same CATH topology
2F3CE 1D6RA 1AZ8A 2JH5D 4SGBE 1UVTH 1O5AB 1C5PA 1S81A 2PTNA 1O3LA 2ZDLA 2ULLA 2A7JA 3ODDA 2ZU1A 3VXFH 5FX5A 1DY9A 4I8HA 3DFLA 1O2NA 4INKA 1TX8A 3RLWH 3GCNA 3KIDU 3K6YA 2SGAA 1W11U 1NFYA 2JETC 2GT7A 3KNXA 3ZZ3A 2V3HH 1GL0E 4XBBA 5BRRE 3N7OA 2R3UA 2Z6BD 3V0XA 4ZROA 2FIRH 3PWBA 5JB9S 4HGCA 3PMHB 2VNTA 3SU6A 1TPSA 3DFJA 1NESE 1P2OA 1BHXF 4JYVH 4DCDA 1SFIA 2BD9A 3QUMP 3QZRA 2BY5X 1ANCA 4NA7A 1BHXB 2OBQA 5CMXH 1GBLA 1ZRBA 4UD9H 4R0IA 1SG8B 1QCPA 1SL3A 2TIOA 1XXDA 1TRYA 2VVUA 1T7CA 1VR1H 3A84A 1IQKA 4MNXA 2VWNA 3URDA 2J38A 1CQQA 1KXFA 1SGDE 1EX3A 1FY8E 1QRZA 1CE5A 3SU0A 1HXFH 3S7KB 3MOCA 4SGAE 1Z7KA 2P93A 1KXAA 1DUEA 1A3BH 1BCUH 4I8JA 1XUIA 3D65E 2SNWA 1GJDB 1KDQA 2G4TA 4MNWA 4WMDA 1RTLA 1O3OA 3SW2B 4NFEA 2BDBA 3U69H 2FLRH 3BIUH 3M5NA 1V2RT 2BDGA 4BTUB 2G8TA 3U9AH 3RXTA 3LGTA 2F9VA 1FJSA 4ABDA 3KEEA 1ZSKA 2I6QA 2UUKB 5DGJA 4K60A 4B2BA 4CREA 1PPHE 2BD4A 2OCVB 3DD2H 3O8CA 1HLTH 1V2KT 2F9BH 1AO5A 3V12A 3HK3B 2WPHS 3RXFA 1C1SA 3QWCH 4RKJB 5F8ZA 3CS7A 3BTDE 3DHKH 1HRTH 3T62A 4ZAEA 1GHWH 1GHBF 3NCLA 3B8JA 4I8GA 1HIAB 3T27A 2F9PA 2BZ6H 1CGIE 3E0NB 2G5NA 1Z6EA 3VB3A 1GJ7B 1K1IA 1NRPH 1G3CA 4OS5A 1BRUP 4AG2A 1DPOA 2BDHA 3UPEA 1GMCG 1O2YA 2FO9A 1FY4A 3ELAH 1C5TA 2C8XB 3A80A 3SNDA 1TIOA 1KDQB 3AW1A 1BB0B 1RJXB 1SBWA 1ELDE 4HZHA 1ZHPA 4ZH8A 4YLQH 2FOBA 3L3TA 2H5DA 5E2PA 2VIOA 1LVMA 1WOFA 1ELVA 1AE5A 3M37A 5A0AE 4Y11E 1VJAU 1O2GH 2QYIA 4YLUA 5JYIA 1ZYOA 1Y3UA 1EJMA 3UREA 2GKVE 2ZHDA 1P9SA 1W0ZU 3L33A 3MU8A 4A1TA 1MMJN 2FP7B 2FPZA 1O3GA 1OXGA 1SGEE 1HJAC 4WH8A 5E0GA 3A8BA 1FY3A 3SU4A 1DXPA 3M5MA 3GCHC 2WPMS 3P8FA 3P17H 4Z6AH 2CV3A 9ESTA 1HDTH 1C1RA 1MBQA 1WBGB 1O2PA 5GCHF 2Y7ZA 1QTFA 1DWEH 4WJG2 1P2QA 5GPIB 1O2LA 2OINA 3BG4B 1YF4A 3GOVB 2AFQB 1KSNA 1TA2A 2K1QA 3HPTB 3MO6A 3T28A 1C4U2 2Q6DA 1C1WH 4YESB 1LCYA 1ZMJA 3IITA 3UQOA 1FNIA 1TNHA 3K9XB 4O3UA 3SNCA 3Q3KA 2OQ5A 1HYLA 3S9AA 2I6SA 3RP2A 5GWZA 3PMJA 5JBAS 1G3EA 1KY9A 5EW2H 1W0YH 3EQ0H 2O8MA 4BXWA 3QN7A 3BEFB 4UFFH 1P3CA 2TRMA 1FIWA 4NSVA 1GCDA 3DUXH 1T4UH 2V6NA 4Y8YA 3ZVDA 2O8TA 1DM4B 3UTUH 2CHAB 5SGAE 3KQDA 4Q2KA 3RXCA 1K28D 1V2VT 4CR9A 2Q6FA 3QLPH 1SMFE 3SJOA 2FLBH 3SV8A 5T3HA 1Z8IB 1PPBH 1LVYA 2ZDAH 1J15A 2FM2A 4ISNA 1GMDF 1FDPA 1P2IA 2BD3A 3MH5A 1IHTH 1PYTD 1ZPZA 4MPXA 3W94A 3KF2A 3F68H 1NRNH 1KYNA 1SLWB 4B2AA 5IYTA 2PTCE 2QIQA 4D7FA 1TNGA 3EYDA 2P3FH 5FPYA 3I77A 2R2WU 1GGDC 2JKHA 4X8SH 1AGJA 1ZMLA 2GX4A 3TGJE 1MAXA 1DWCH 4IN1A 5EXNA 1BTYA 2GMTB 2HNTE 1EP6A 1YPLH 4WY3A 1L2EA 3D49H 3A7VA 1Z1IA 2PKAB 4B75A 1ETSH 2KAIA 4IBLH 1GI4A 4TPYA 1DSTA 2EI8A 1HAYB 1C1MA 1O31A 2ZCLP 1JIMA 3HKJB 5A8XA 1J9CH 3RMMH 1Z71A 3BG4C 3GY4A 2GZ7A 1ID5H 1SQAA 3FFGA 2FEQH 5HM2A 2GD4B 3PLPA 1GBDA 3I29A 3OX7U 1A0LA 1L1JA 1QY6A 3PTBA 4UEHH 2Z7FE 1O3FA 3KHVA 2O8LA 1SGFG 1O2OA 1TPAE 2PSYA 1W14U 3PV4A 5DP8A 2GCTB 3UR9A 2OBOA 1TALA 2PW8H 4X2YA 1C2FA 1O2ZA 1V2UT 2A5KA 1W7XH 3P8NA 2ZHQH 5FPTA 3RMOH 4CH8B 4GHQA 4BAKB 3RU4T 2CHAC 1INCA 1MCVA 3M61U 2ALPA 4OS6A 4FUFA 4U2WA 2CMYA 1GMCF 3P70B 4H6TA 1QL7A 5EOKA 1Y3VA 4CBOA 1RD3B 1GG6B 2FODA 2PSXA 1HAVB 3ZZDA 1ZPBA 2BD2A 2BQ6B 3SHAH 1YLDA 1Y5UT 1BZXE 1GJ9B 2A5AA 1TRMA 4I33A 1FZZA 1BITA 2ODYB 4Y0YE 3NXPA 2OQUA 2NU1E 3QK1A 1XX9A 1UTLM 2HOBA 1C5UA 3EGKH 2BVSH 1U6QA 2C3SA 4OGYA 1MTNB 1DY8A 2VIPA 1QB6A 1EB1H 2HPPH 1FPCH 4CHAC 1SLVB 5DK1A 2GV6A 2D1JA 2ZFQH 2ZQ1A 3GCTF 3MNSA 5DPAA 2VVVA 1C5ZB 1EJNA 1SQOA 1PQ5A 2NU4E 1OSSA 4E06H 2NWNA 4R8TB 5DP5A 3M5LA 1EPTB 1K1LA 1K1OA 3FP7E 3KQCA 3UNQA 3VB4A 1GWAA 1AFEH 4ZXYH 2V35A 3A85A 4FU9A 1P2MA 3LC5A 2ZTZA 1VITH 1C5VA 1UCYK 3BF6H 3CP7A 1BRCE 1UCYH 2HWLB 3MO3A 1D3QB 3E91A 2ZIQH 5A0BA 3LIWA 3ZYEA 1HGTH 4YOJA 3EA8A 3RU4E 2UWOA 1DANH 3BTKE 1NT1A 3FVFB 1C1UH 1V2WT 5DG6A 1OP8A 4DURA 2D8WA 2O8WA 1TMTH 1P2JA 1LQDB 1G3BA 2Y82A 1DFPA 1IQJA 1VGCB 1VCQA 3EDXB 1ZSJA 4K1EA 2EI7A 1HB0B 2F91A 3U8OH 2OC1A 5JB8S 1O2UA 3TLOA 3UUZA 4J2YB 1O3JA 2AGIX 1OWKA 2CGAA 1GG6C 3VGCC 1OWIA 1ZHRA 1HPGA 1Y8TA 3KCGH 2VIDA 1BMLA 3PROA 3C1KA 3SGQE 4FVBA 2PR3A 1MKWK 3MYWA 2ALVA 1MKWH 1EXFA 2A45B 5EU8A 1ANBA 2ODPA 1GVZA 4I8LA 3VB5A 5LGOA 2QA9E 4CRGA 3ATLA 2WUBA 2J2UA 1GI8B 4GLYA 4IS5A 3O8BA 1MTNC 4IMQA 2PHBA 1SGFA 1ELAA 4JZIA 1WV7H 2A7CA 4BANB 4Y71A 2SFAA 1C1QA 2BDCA 7KMEH 1OWEA 2ZQ2A 3ZZBA 2PWXA 2G4UA 1GHAG 3RMNH 2F83A 3MNXA 3GDVA 3MNCA 2C8YB 2GCHF 3LGUA 1C1TA 1SLUB 3LGYA 5T6DA 1W8BH 3BN9A 1EPTC 1T32A 3EE0B 1C5WB 4YOIA 3LH3A 2G52A 1BT7A 1BTPA 4A7IB 2TGAA 1GBIA 1BMNH 1WYKA 1O3DA 2XNIA 3BIVH 3CENA 1BA8B 2ZFSA 2BVXH 2JH0D 3QDZB 1C2IA 4JYTA 1O2RA 2GTBA 2FXRA 1IQEA 1JRSA 5CE1A 1FQ3A 2FOMB 1A5GH 4O03A 1DLEA 1O3KA 3RMLH 1UTKA 3RC5A 1L1GA 1AUTC 8ESTE 3K2UA 1NPMA 1F0UA 2EA3A 4BTIB 1DOJA 1YPMH 1HAHH 1F5RA 5C20A 1EOLA 2XC5A 1DE7H 1EJAA 1YLCA 2Z3EA 1F0RA 4ABGA 1RTKA 1PYTC 2D26C 1NN6A 3ZZ5A 1H1BA 1HNEE 1KTSB 4OGXA 3E6PH 4WH6A 1AKSA 1LHGH 2CN0H 1P8VC 3RM2H 3A88A 3EA7A 3SV2H 1S0QA 1GVKB 1K21H 4FUDA 1LPZB 1O3BA 1FV9A 3RC4A 2ZDVH 4AYVB 3BTFE 4MPUA 6CHAB 1C4Y2 3ZVCA 1O37A 1EAXA 2ANKH 2ZEBA 4MPWA 5J4SA 1KLIH 2SGQE 1NRRH 1HAOH 1DX5M 1UVPA 4GSOA 4OS2A 5LPEA 2AMPA 2VWMA 3RXOA 5HYOA 1O3IA 3SNEA 1QFKH 4I32A 1O3HA 6ESTA 2RA0A 1QL9A 2XCNA 5GCHG 1GBEA 4Q80A 5DP7A 1WQVH 1SFQB 3BTQE 1TNJA 8GCHF 1L4DA 4U32A 2A4GA 1SPJA 1O3PB 4FUBA 4CBNA 3M7QA 3T2NA 3SJIA 4Y76A 2UUFB 5DP4A 1UK3A 2ZNKH 1ANEA 2H6MA 2FDAA 1TBRH 3PMBB 4ISHH 3GY2A 4I31A 1GI9B 4DVAU 1P9UA 1DSUA 1E34B 2IJOB 1XVMA 2QGRA 1MH0A 4FU8A 1ZSLA 2G5VA 3C27B 4GUXA 5A09A 2P3UB 2STAE 3GDSA 2W26A 4LK4A 1AKSB 3ITIA 1YYY1 2BHGA 1BJUA 1E36B 4XOJA 2ZP0H 3KQEA 1ESBA 1AY6H 1TX7A 3TU7H 1A46H 1LHCH 1UTMA 2PUXB 2ZGJA 3SV9A 2AGGX 1PPCE 1F5LA 3NWUA 1BRBE 4UFDH 1GBBA 1GMDG 2ILNA 5FBIA 4OS1A 2PFEA 1TGCA 1MZAA 3WY8A 1VJ9U 2ZF0H 1HIAA 2XBVA 4NFFA 2GDEH 2A2QH 3EAJA 1ESAA 4NIVA 4NWLA 3ESTA 2ZU4A 4KELA 1GDNA 1O2HA 1WQSA 1WCZA 6CHAC 1Q2WA 1NRQH 3AW0A 3RXBA 3MMGA 3LPRA 4ABJA 1MKXK 2QY0B 3PLBA 3DT0H 2FOFA 2W3KA 1GI2A 2R0LA 1HJ9A 4UDWH 1QQ4A 1OS8A 3JZ1B 1O2WA 1ORFA 4CRAA 5T6GA 1UTJA 1A1RA 1QA0A 4THNH 4WWYA 1HJAB 1SOZA 1TMUH 2TGDA 3TH4H 2FOEA 1E37B 1AB9C 4GPGA 3STIA 1C1NA 1ZLRA 1UHBB 2ZC9H 3GCHB 1NFXA 1AD8H 4K1SA 3Q76A 1P3EA 2LNCA 4TWYA 2ZU3A 5F8TA 1O30A 3NZIA 1IQFA 1E35B 1ELBA 1GHAF 1S83A 1AVGH 1D3TB 2FX6A 4ISOA 1GBAA 2R2MB 5F03A 2GZ9A 1SHHB 1UK2A 2BD7A 2FYQA 1FY1A 1IQMA 3TJUA 1ZJKA 3RXDA 1C1PA 4VGCB 4D8NA 2B0FA 5A2MH 1GI5A 4F49A 1S6FA 2G00A 4DG4A 2P94A 4Y10E 1UVUH 2Y5HA 1P2KA 1BTWA 1FIZA 1J16A 2XBYA 1V2MT 2UUYA 1Z6JH 3VB6A 3UR6A 1O0DH 1LPKB 1FY5A 1UTOA 2ZFFH 4JZDH 1TPPA 4CRFA 4IC6A 4O3TA 2XW9A 3FZDA 1TBZH 4LOYH 1VITG 1P11E 2BM2A 2WPJS 2P16A 2J9NA 4Y0ZE 1BDAA 2QXIA 4AYYB 3V7TA 4IC5A 3T29A 1Y3XA 4IGDA 1QB1A 2GDDA 4X6PA 3GDUA 2VIWA 1KLJH 5ETXA 4K8BA 1D3PB 1BTHH 3P95A 4AB8A 2VH6A 1GBKA 3QGJA 3GCTG 1TX6A 2XC4A 2W7UA 2ZHWH 3BTTE 3ZV8A 4X8TH 1GBJA 1Z8GA 1SR5C 2ZDMA 1GGDB 2V3OH 4RSPA 2FESH 3GCOA 3MH4A 5JDUB 3GISB 1SGYE 1RFNA 2AIQA 1F92A 1P09A 1QA7A 3OY5U 3S0NA 1BQYA 1F5KU 5T6FA 2BDIA 1UJ1A 3F6UH 4PROA 1QBVH 5ESBA 1YCPK 2FI3E 2ZDKA 2QXGA 4BNRA 1UTNA 1AE8H 1TB6H 3RXGA 2VVCA 4BAQB 4Z0KA 1OPHB 2BOHB 1QBNA 1QL8A 4VGCC 1IQHA 1HCGA 4YTAA 2VH0A 4WXIA 2HGTH 1V3XA 3KQBA 4NA9H 3RXQA 2ZECA 1GDUA 1S6HA 2PKAA 1SGTA 3TITA 1HUTH 3F9FA 3PB1E 2O8UA 4WMEA 1MD8A 1Y59T 1YPHC 4LZ1H 1EKBB 1O2JA 1XKBC 1C5YB 1THSH 3LOXA 2XBXA 1GI7B 4NA8A 3O8RA 4AX9H 4D9QA 1NM6A 3ATMA 3MU5A 4NZLA 2STBE 4DW2U 3BSQA 1AWHB 3LH1A 1G2MA 3TK5A 1ELTA 4ZKOU 2DE9A 1ETRH 4Y79A 4MDSA 4K69A 5FX6A 1YM0A 1XM1A 1C5MD 1J14A 3ZZ8A 2B7DH 3VFEA 5H4IB 2DE8A 4NZQA 1V2NT 5EQRA 3SU3A 8KME2 2SGPE 2A2XH 4NWKA 1UMAH 2F9OA 4IN2A 2B5TB 3A7TA 3E0PB 2PUQH 3BTME 2AH4X 1TGSZ 1FMGA 5JPMH 1TPOA 2ZPQA 2GCHG 1F0SA 1O5CB 2ANYA 1QQUA 1XUJA 2A32A 2WPIS 3M3SA 4XDEA 2HVXA 4CHAB 3PWCA 4KTUA 1TYNA 4Y7AA 4Q7XA 4X6NA 3TJNA 1A5IA 1CGHA 1ZGIA 2H1UA 2VB0A 1HAVA 1AWFH 3SU1A 1ABJH 1MTVA 2P3TB 1D4PB 5EW1H 3BTGE 2A31A 1TLDA 1BBRK 1JBUH 2UWPA 3L6PA 4QT8C 4A92A 1BBRH 5EXLA 3QO6A 5HGGA 1S82A 2BLWA 2BX4A 3SOSA 4ABAA 1ACBE 1RIWC 5LH8A