1N1LA

Crystal structure of hcv ns3 protease domain:ns4a peptide complex with covalently bound inhibitor (gw472467x)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
180
structure length
180
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVTKAVDFIPVENLETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolidine-5,5-trans-lactams. 2. The use of X-ray Crystal Structure Data in the Optimisation of P3 and P4 Substituents
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
molecule keywords HCV NS3 SERINE PROTEASE
total genus 40
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n1lA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1n1lA01
2C3SA 4WH8A 2P94A 3SO3A 2ZZUH 4NZQA 1EKBB 3AASA 3M3SA 2FLRH 2GCTC 3NPSA 1QFKH 2ALPA 3VXEH 1MQ5A 2ANYA 3LH1A 2PV9B 4X1RU 1IQIA 3ZVGA 2OP9A 1DX5M 3T25A 3V13A 5EXMA 2TIOA 1KTSB 1P2IA 2UWLA 2JH6D 2FX6A 3A7YA 1TNGA 2A2QH 1ZMNA 3RUOA 3S9CA 1GCDA 2BY8X 1SGFG 3UWJH 1YPLH 1ORFA 1GBKA 2UWPA 3FAOA 3HK3B 2EA3A 1IQJA 5AHGH 1GJ9B 2A7JA 3OU0A 4TYDA 1FY4A 3H09A 1C5VA 2BD4A 1X7AC 1EX3A 4DW2U 1SGEE 1CO7E 1XVOA 3K9XB 3QN7A 3STIA 1BTPA 3OYPA 4X6NA 3RXSA 2FO9A 1NO9H 2ODQA 4MG3A 2ZA5A 1RFNA 2AYWA 2BVSH 1C2MA 2JETB 2R3YA 3F9EA 4AB9A 2FPZA 3CS7A 4O9VA 1SMFE 4FUDA 3T5FH 4MPXA 8GCHG 4KGAA 5F8ZA 1IQMA 1GL1A 4FXGH 1G30B 1LHGH 1XUKA 2SGPE 4ABGA 1L1NA 3KQEA 3A7ZA 3SJKA 4NSYA 1JBUH 1SGDE 4NZLA 4BAMB 1HLTH 1O2YA 1RD3B 5JBAS 1LPZB 1K22H 1XUGA 1AZ8A 1PQAA 1W8BH 4YO9A 3D65E 3KCGH 3HKJB 2HALA 3L6PA 1MD8A 3GYLB 2XYAA 1FXYA 4YM9A 2GX4A 1J9CH 2FOCA 1ZPZA 1KXFA 2XCFA 1GBJA 2OQUA 4ABAA 1H9LB 1SGCA 1NFXA 4K69A 3KEEA 1QHRB 3PV2A 1NFUA 1TLDA 1O3CA 3A89A 1KY9A 1GI9B 3VXFH 2QY0B 3ATLA 2ESTE 1VGCC 4X2WA 3RXUA 3PMAB 4I32A 1P2QA 1TQ7B 2WYJA 2XCNA 1C1TA 1YCPK 3M7QA 3Q76A 5DP6A 2STAE 1Z71A 2ZNKH 1WCZA 4MPWA 2FS8A 5EG4A 1GBCA 3TH3H 1GBTA 3MOCA 5C5OA 1ELCA 1O5FH 1EJMA 3M35A 1ZTLA 1ELFA 4XBBA 1MKWH 4B2CA 1QA0A 2FX4A 1DXPA 1WYKA 4Q7XA 3LGYA 1MTUA 3KGPA 1O5BB 3LIWA 3R3GB 4U2WA 1NESE 4X8SH 2JETC 5L2ZH 2VWOA 4D76A 1AVXA 1XXDA 3SU1A 5ABWA 1FI8A 4F49A 1QJ6B 2CHAC 2ZCKP 2BYAX 4UD9H 1QBOA 2A5AA 3R0FA 3ZZBA 1Q31A 1C2LA 1O32A 4FUJA 1IQFA 3MMGA 2VIQA 4Q7ZA 2XWAA 3LT3A 1ZRKA 1CT4E 1TMBH 1QBNA 1C1NA 2GP9B 1LPGB 3E1XB 3URDA 2H5DA 3QTOH 4RKOB 1GMCF 5ESTE 3MH6A 1A61H 1EB1H 1LKBA 1O3IA 1MAXA 3SU2A 4CRFA 1TRMA 4BTTB 1TGCA 2ZDVH 5CHAC 1O2UA 3V0XA 3SZEA 2ZHDA 1T7CA 1ZHPA 1NTPA 2W5EA 1P04A 5JB8S 2Z9JA 1GI0A 1GJBB 1L4DA 1OXGA 4XSKU 2VWLA 1INCA 2Z7FE 2QXJA 1GJ8B 4YT6H 1Z1IA 3SW2B 5IYTA 1WQSA 1PPZA 3MU5A 4E7RG 4WVPE 1UVUH 1Q3XA 3UOUA 3TGJE 1WU1A 1HJ9A 2AFQB 4I8HA 3S7HB 1KXBA 1P2NA 3Q3KA 1ZZZA 4INKA 4U01A 1T32A 2B7DH 3V12A 1Y5UT 1P09A 3T28A 1TGSZ 1P05A 2VIVA 4NFEA 1C2HA 1THSH 2F3CE 4LXBH 2VINA 3A7XA 1TNHA 3SYJA 2FP7B 3A8BA 1O5EH 1UTKA 2VGCC 1N8OC 3TGIE 4AGKA 3TJNA 2EC9H 3OX7U 4YOGA 2P3FH 1ABJH 1CGIE 1FONA 4OGXA 4X0WU 5JYIA 1DXWA 1GMDF 4LOYH 2H5CA 3UUZA 1ARBA 4AG1A 1Z8RA 2BDBA 2O8WA 3A86A 3U69H 2AGIX 1C1RA 1ZR0A 1K21H 1P03A 1P01A 2BXTH 2FYQA 3SQHE 2XRCA 1FPCH 4GLYA 1AKSB 2FXRA 9LPRA 3BEIB 5E2PA 1TX6A 2TBSA 1GHYH 1P12E 1XKBC 1IHSH 1UTPA 1VR1H 3G01A 1Z6EA 4BAHB 5G4BA 2A4GA 1OOKB 3EE0B 3GCNA 1A5IA 2GCHG 3RC4A 2A0QB 2A7CA 4J1YA 1SLWB 2ZKSA 2VIDA 3PWBA 4CHAB 1BBRE 1EJNA 1P3EA 2VNTA 1GDNA 1E35B 1BRCE 1LQEA 2UUKB 2BD5A 3M61U 3I77A 5GXPA 2ZPQA 5B6LA 3MI4A 1CT2E 4A1VA 2RCEA 4UFEH 2ZGJA 3SNDA 1DUAA 4KTUA 3H7OA 1AB9B 2YOLA 1GHBF 4CHAC 1A2CH 1NRSH 4KTSA 1SGFA 1P10A 2Z3EA 5BPEA 4Y76A 4MTBA 1FAXA 4ISHH 2HLCA 4WF8A 3SV9A 1NRRH 2CMYA 1LCYA 5K0HA 4Y7AA 2J95A 1NM6A 3SHCH 3P6ZB 1OWIA 1FN6A 3L33A 4UFDH 1LVMA 5I46H 2CJIA 4YTAA 1EOLA 2P8OB 4JCNA 4FUIA 4JMYA 1DSUA 1TGBA 4ASHA 1ZGIA 1NC6A 4B6EA 2P95A 1OYQA 1OX1A 1K1NA 1C5WB 1SQAA 3BTWE 3UPEA 1ZTJA 1DY9A 2G81E 1K1MA 1O3MA 1FY8E 3BEUA 1YLCA 3PO1C 1V2VT 1P8VC 3TNTA 4AYYB 2W7SA 3SNAA 1GMHG 4FUHA 1G2LA 1LVOA 1Z6JH 1FIWA 1TNLA 1K1IA 1H8DH 2OD3B 1O2WA 3ATIA 1O34A 1AWHB 3E6PH 1C4V2 1Z1JA 9ESTA 2P16A 2FM2A 3U9AH 4E7NA 3C1KA 2FOAA 1EOJA 5HMAA 1L1GA 1MQ6A 1XX9A 2BMGB 1K1LA 3MNXA 4CRDA 3SJ9A 4DCDA 4GSOA 3ZZ4A 3TITA 2VWNA 5HXFA 4DG4A 1TPSA 4HGCA 2YNBA 3ZYEA 1VZQH 3ATKA 3PB1E 2FYRA 1HBTH 1O2VA 1ZYOA 2NU3E 2ZU4A 1RRKA 2ZDKA 1GPZA 1C4Y2 1UK4A 3SNEA 1AB9C 3A83A 4HZHA 4K60A 4DOQA 1DDJA 1DICA 1W7XH 2HWLB 4I31A 3T62A 1DITH 1C5PA 1CT0E 1TONA 1W13U 5DP5A 4A6LA 1C2DA 1TPPA 2AS9A 3RXAA 1UVTH 2PLXA 2ZO3H 2PKAB 1C5ZB 1C5YB 3GY8A 1LPKB 2TGDA 4YESB 2FZZA 1DWCH 5AVDA 5A8XA 2BLQA 1NY22 1BIOA 1MTVA 5C2ZA 3S9AA 5EW1H 3QUMP 1PPFE 1DWBH 1O39A 4XBCA 2KAIB 2WPMS 5E0JA 2TGPZ 5A8ZA 3BV9B 1GHAF 1NU9A 1QB9A 3TU7H 4Y10E 3WY8A 2WZQA 1Y3VA 4CBNA 2A5KA 5DPAA 3GY5A 1HAOH 2SGQE 3T2NA 1C1PA 1TMUH 3TVJB 1V2LT 1A0JA 1QBVH 3GCTF 3BTFE 2ZHFH 3GY4A 4AB8A 5TCCA 2B5TB 3RXEA 2FEQH 5DK1A 3UNQA 1MUEB 1UCYE 5EPYA 1PPGE 1TPOA 1P2OA 4JYTA 1U6QA 2ZGHA 2QA9E 4X1SU 4OS1A 3RXOA 1QQUA 2C8YB 2FTLE 1NS3A 2ASUB 1TALA 3BIUH 3HGPA 2GV6A 4K1SA 2V6NA 1DOJA 1C1UH 1IQGA 2GZ8A 1T4VH 1BMLA 1HB0B 2GTBA 1ELAA 2BX4A 3UR9A 1L1JA 3FP6E 4FU9A 4E05H 1Y5AT 2QAAA 2ZGBH 1SOZA 1G3EA 2PUXB 1QQ4A 4UDWH 4M7GA 1J16A 1EAXA 1DUEA 1OWJA 1YPKH 2O8MA 4FU8A 4Y11E 3A7TA 2D8WA 3TH2H 5A2MH 1GHAG 3Q3YA 1OWHA 3UIRA 3AVZA 5EXNA 1YCPM 2RG3A 4AGJA 4Z0KA 3FP7E 8LPRA 1XUIA 1HJAB 3BTGE 5FBIA 2FI3E 3I29A 1YGCH 3P92A 4ZUHA 2FWWA 1JMOH 3SUDA 3LONA 2F9OA 4ZROA 4O3TA 4HI3A 1TBZH 1W7GH 2FOGA 1PPBH 1MCVA 1EAUA 1HAVB 2BD2A 1D6WA 3LC5A 1P0SH 2C93B 2A32A 5LGOA 4K3JA 4FU7A 1BJUA 1P2MA 1FMGA 3MFJA 1TRNA 1LTOA 2QC2A 1ANEA 3MHWU 2HPQH 1SGYE 3S7KB 1LKAA 1N1LA 1O3HA 1OWDA 1P57B 8KME2 3OTPA 1GBAA 1G37A 4X1NU 2IOTA 1O2LA 5E0GA 2BQ7B 2F4LA 3ZZDA 3K2UA 4B1TA 1QY6A 2CN0H 3RU4T 2XTTB 3M7UA 4ABDA 2QF3A 3NK8A 3SUEA 7GCHG 2ULLA 1QB1A 3UFAA 5EQSA 1O5DH 1HGTH 2XBXA 1FY3A 3VPKA 3PMBB 2ZP0H 3FP8E 3ZV8A 2GKVE 3FZDA 1FY5A 1JIRA 2OC8A 2CV3A 2PGBB 2ZDNA 4B2AA 2VVUA 2AERH 5DP9A 1YPJH 1O3GA 4ZHMU 1UTNA 2ANKH 1QL9A 3MH5A 1OP2A 2OQ5A 5GWZA 2NU0E 1FJSA 1YM0A 1O2HA 2AMPA 3M3VA 1RTFB 1SFIA 2ZPRA 1LHCH 1C2FA 2EI6A 1ESAA 4U30A 3RXDA 1ABIH 4A92A 4H6TA 1DE7H 1CHOG 1Z8GA 3EA7A 2OC1A 4OGYA 1GI5A 1GI6A 2F9VA 4GAWA 3PROA 5HM9A 4O03A 2WPLS 3GCTG 3RU4D 1OSSA 1EQ9A 1OKXA 5C67A 2XC4A 3RXCA 5T6DA 2M5TA 1DLEA 1BMMH 3DD2H 1DSTA 3SU4A 1AY6H 4TY6A 1GG6C 1GHWH 2LPRA 5AFYH 1SG8B 1GJ6A 1GVLA 1DS2E 3MU8A 5GPIB 4NIXA 1KSNA 1QRWA 1MKWK 3OY6U 1C5UA 1SGIB 1HFDA 4WMEA 5HM2A 3UNSA 3T27A 3BTHE 2BDIA 1F7ZA 1GI3A 1OS8A 1NFYA 1GWAA 3SV7A 3ZZ3A 1W0YH 4NA8A 1K1OA 1ELEE 4DT7B 2TGTA 3B23B 1O2SA 2BY7X 4ABFA 3QGJA 2VGCB 1RIWC 2OC7A 3LGIA 4X2VA 3W95A 1CBWC 1F0UA 3U8RH 2BLVA 3D62A 2V3HH 1V2MT 1ANBA 3QZRA 5AF9H 2R2MB 3URCA 3ZZ5A 1TGNA 4B2BA 1BCUH 1VITH 1AUTC 2PSXA 2GMTC 1GG6B 1MBMA 1BTHH 1HAVA 1O5GH 3GOVB 2CHAB 4MNYA 3QO6A 1SBWA 3QK1A 1JOUB 4CRGA 3E0NB 1GL0E 3ELAH 2GMTB 2XW9A 1KDQA 3TJVA 4JK5A 2AGGX 1D6RA 3Q3XA 4Y8XA 2ZTZA 4AG2A 5A09A 2AIQA 4BNRA 1AE8H 2PHBA 2G4TA 3LJJA 4VGCB 1IHTH 1Y8TA 3O8BA 1G3DA 5H4IB 3RXJA 1F5KU 1C2EA 4ABJA 5GIBA 1G3CA 2O8LA 1C5MD 5CHAB 1ESTA 1GI8B 4YT7H 4AFSA 1TNIA 1O2ZA 1ESBA 4XOJA 1ID5H 2VB0A 2F83A 3GY7A 4DURA 1C1QA 1O2KA 2ZGCA 1DY8A 3HGNA 1UK3A 2ZCLP 4CR9A 1UK2A 1BBRH 5EQQA 2G5VA 1XUHA 4ZKOU 1SL3A 2IJOB 1VITG 1ZTKA 3SU5A 1UTLM 3RMOH 2SGFE 5DP7A 1PQ5A 4HFPB 1G3BA 1O3LA 3BN9A 5LPFA 5FPTA 4DGJA 1EP6A 1TRYA 3AW0A 1LHDH 3M5MA 4SGAE 2Z94A 4JZFH 3RXKA 3PV5A 1BTUA 3F9FA 3VB5A 4ABIA 2DE9A 1EPTC 3A7VA 1UVOA 2EI7A 2Q6GA 3ZYDA 1O33A 2BY5X 1W12U 3TK9A 2BVRH 1QR3E 1O38A 1V2OT 2HPPH 1AFEH 1KLIH 4WMFA 3TK5A 1D9IA 3A84A 4PROA 1NRQH 4LK4A 2ALVA 3SORA 2J4IA 1TFXA 2F91A 3NZIA 1S81A 4Q80A 1KXEA 3E0PB 1TAWA 3UQOA 2SGAA 4ZAEA 1AMHA 1YPGH 1BDAA 3TJOA 1UO6A 4YOJA 1O2XA 3PWCA 1B0FA 4MNVA 3BTQE 1QRZA 1C2IA 1GBIA 1O3FA 1N8OB 1DWEH 1KXAA 2OBOA 5GNDA 4IGDA 1WSSH 4B71A 3M5LA 1GJ4H 1F0SA 1T8NA 4B73A 1A4WH 1WQVH 1WAYB 2HGTH 5B6OA 3PTNA 3QGNB 2ZU5A 4BAKB 4B75A 1OWKA 1WTGH 3F1SB 3EYDA 4RKJB 1BTXA 2SNVA 3RXLA 5L30H 1AO5A 4U32A 3BTME 4A5TS 4ISLA 4BAQB 1P02A 1SVPA 7LPRA 2BD8A 2BVXH 5JB9S 1VITF 1RS0A 4B74A 1A1RA 1EATA 1ZMJA 3O8DA 3SNBA 1JWTA 1NN6A 2BY6X 1GCTB 2WV5A 2W7UA 3T26A 1HPGA 1O3PB 2FODA 4M9FA 5C20A 4NA9H 1HAYB 2QCYA 1CU1A 3TNSA 1GVZA 3EAJA 4B6FA 2ZPSA 3P8OA 3BTKE 4UFGH 1AD8H 2ZF0H 3M5OA 2OINA 5DP8A 1QJ1B 1SR5C 2D26C 2KAIA 5GDSH 2FOFA 1J15A 4BXSA 5A0BA 1EAIA 1BQYA 1SLVB 3TPIZ 4H6SB 2VWMA 3JZ1B 2VBCA 4I8GA 3DFLA 1MZAA 1BMAA 2V35A 1UVPA 1GJDB 1QL8A 1FQ3A 4YZUA 2G52A 1GBDA 3RXPA 3A87A 1TPAE 1XMNB 2ODPA 1TYNA 2Y7ZA 2ZDLA 5JDUB 5FXLA 1GBLA 1UCYH 1BZXE 1GMDG 2GGVB 4ZMAH 4A1TA 3VGCC 3ZV9A 3S9BA 3SU0A 1HYLA 1Q2WA 5PTPA 2JH5D 2C4FH 3BTDE 2H9EH 1PPEE 1S0QA 2R3UA 3BEFB 1V2JT 2TGAA 3LKWA 3LGTA 2A4OA 1GHVH 4BTUB 2VJ1A 1K28D 1MTNC 3MNSA 4AYVB 1A0HB 5BRRE 4K8YA 1HDTH 2ZC9H 2RDLA 4AOQA 3UY9A 4KELA 4DY7B 2O8TA 2A2XH 1UVSH 1TBRH 4JYUH 4LZ1H 1BITA 1O36A 1F5RA 4UFFH 1XUFA 3U8TH 3STJA 1TQ0B 1UCYK 1TOCB 2WYGA 1GBEA 1MBQA 1TE0A 3SJ8A 4IN2A 4XBDA 2QXHA 1YYY1 1DANH 1S5SA 2XXLA 1AVWA 1V2KT 1SQOA 1SI5H 2R9PA 2PTNA 4X8VH 3UWIA 1OPHB 1AN1E 1HJAC 5C1XA 4CRBA 2CF8H 1MD7A 3U1IB 3P95A 6ESTA 1KLJH 3E16B 6GCHF 1C2KA 3KIDU 1W14U 1NZQH 1BUIA 1G32B 1W2KH 1V2RT 3HK6B 5GCHG 4GPGA 4BXWA 3UTUH 1D3DB 1GI2A 5JBBS 3PV4A 1GHZA 2F9PA 1CA8B 3AW1A 4Y6DA 1SLUB 3GY2A 1C9TA 3MNCA 3CENA 1AE5A 3AAUA 3MO6A 4NA7A 3U98H 1D4PB 4ISIH 3D23A 5DP4A 5TJXA 1V2TT 1FUJA 2R0LA 3MU0A 1EPTB 1TGTA 2EEKA 3SU3A 4UE7H 4KP0A 1Y59T 2A31A 1C1MA 1YPMH 1HIAA 2Y81A 3RXTA 3MO3A 1A5GH 4O97A 7KMEH 3ZVCA 1WV7H 4NIYA 1GMCG 3DT0H 1GMHF 3KHVA 3PLKA 2HNTE 1ZLRA 1MTWA 1MU6B 5T6GA 2OLGA 3PYHA 2FOBA 1V2WT 5FHTA 1GDQA 2ZFTA 1S82A 1ZJDA 3ATWA 2IPHA 1G2MA 2Z3CA 4FUEA 1G9IE 5E0HA 4AN7A 2VVCA 4ZHLU 3B9FH 4TPIZ 1O2PA 3HATH 3ZVDA 3ENSB 4WMDA 1FAKH 4CH8B 2Y6TA 5E2OA 3NXPA 4GCHF 3RXHA 1AIXH 3CS0A 1TX7A 4MQAA 1C5NH 2G8TA 4JZDH 2QIQA 2NU2E 1E0FD 2ZEBA 3BSQA 4NFFA 3QDZB 4IW4E 2PUQH 1UJ1A 3A85A 3ATMA 2O8UA 3QTVH 4ABHA 1TA2A 1FY1A 2ZWLH 5FPYA 3SU6A 2ZHWH 3O8RA 4WXVA 4MNWA 1K1JA 3BF6H 2IN2A 1E37B 3SN8A 2F9BH 4CR5A 3P8NA 5T1VA 2OTVA 1JRSA 3MH7A 2Y7XA 3L3TA 4I33A 1T8LA 1ETRH 1VGCB 5ESBA 3T29A 2J38A 1TNJA 4FUBA 3DA9B 3PLBA 4ISOA 1O2JA 1WUNH 3DFJA 1ZSKA 4D7GA 1W0ZU 4NGAH 1UTJA 1SHYA 2H2ZA 2ZI2H 1P11E 3LGVA 5DP3A 4Q7YA 2ZGXH 1C5TA 2ZU2A 1ETTH 3SI4H 3BG8A 3U8OH 1AFQC 2ZFFH 1TABE 3GCHB 2Y5FA 1FNIA 3A8AA 2STBE 1KLTA 2ZHQH 5HYOA 2G55A 1NRPH 2A1DB 2GT7A 1TIOA 3PMJA 4MVNA 3SV8A 1PFXC 3RXMA 1H9IE 4YOIA 2BOHB 2BDGA 4NG9H 2SNWA 1F0TA 2PKAA 3IG6B 4CRAA 3LOXA 1O5AB 2A4RA 3RXQA 1BRBE 1SGPE 4HTCH 1Z8JB 1NFWA 2OBQA 2BDCA 2QXGA 3A80A 3UNRA 5DJ7A 1O2QA 2ZDAH 1LO6A 3ODFA 2OC0A 1VJAU 3MYWA 1ZGVA 1S0RA 3ZZ8A 6CHAC 1C5QA 2ZECA 1FN8A 1S6FA 2J94A 2VH6A 3S0NA 3VB3A 5J4QA 2C8ZB 1PPCE 1UHBA 4ABBA 1ETSH 1C2JA 1NT1A 5DO4H 1CBWB 2UUFB 1GGDC 4D9QA 5EW2H 2Z6BD 2BDAA 3RXFA 2G4UA 2P8OC 2VVVA 1LDTT 3ZVAA 1AHTH 1VCWA 2Y80A 4ESTE 1BB0B 3GCHC 5LH8A 1FLEE 1OP8A 2QV1A 1ZSJA 3ZZCA 2ZTXA 2GDEH 4IS5A 3EA8A 2GV7A 1ELTA 1NRNH 4Q2KA 1P9SA 2A45B 4GVUA 1KDQB 4INHA 1HAHH 1YBWA 1E38B 3BIVH 2THFB 1QGFA 4QT8C 1MMJN 4ZXYH 3RU4E 3SV6A 2H9TH 3DHKH 2OXSA 3KL6A 1H1BA 2ZQ2A 4ZXXH 1RIWB 4XE4A 1P3CA 5K7RA 3SHAH 4FUFA 2D1JA 3PO1B 4Y8YA 4D7FA 4OS6A 4AX9H 1MTNB 1O5CB 1K2I1 4K1EA 2OUAA 1HAXB 1W3CA 3OTJE 2G00A 1BJVA 4NSVA 2IJD1 1GGDB 2O9QA 1ZJKA 1KXDA 1PQ8A 4CRCA 3A82A 1C5SA 2FI4E 2W3KA 2J34A 4B76A 1QCPA 2Z3DA 1AWFH 1QURH 4TY7A 4KKDA 1AVGH 2FOMB 3BTTE 2AIPA 2GT8A 2ZCHP 3W94A 4ABEA 1GI4A 2ZFQH 1ZOMA 1SC8U 3EA9A 2DUCA 4RI0A 5F8TA 4JZ1A 4NIWA 5FX5A 2K1QA 2WPIS 4BAOB 2F9NA 1O3KA 1CA0C 1TX8A 2BOKA 1EASA 1F2SE 1SGQE 2QXIA 1GCTC 1GHBG 3SGQE 1CQQA 1WXRA 3VB4A 2C8WB 5FCKA 3PM3A 3S69A 1THRH 1D3TB 1AKSA 1TNKA 4DJZB 3RC6A 4OS7A 3U1JB 2VU8E 5GJ4B 2TRMA 1VCPA 2FOEA 3H7TA 1MKXH 2WINI 1QRXA 5JBTA 1TA6A 3KQBA 4ZKNU 5J4SA 3RLWH 1HIAB 7ESTE 2V0BA 5LPRA 1ACBE 2ZDMA 8GCHF 1PJPA 2FMJA 4Y8ZA 3RXBA 4OS5A 1CE5A 1ELGA 2Z9GA 4ZHAA 1GI1A 2AH4X 2F9UA 2FTMA 2Z9LA 4X6PA 1IQHA 2ZQ1A 2GZ9A 1UTMA 2AMQA 5FPSA 4AFUA 1O3OA 1ZHMA 1EZSC 4MPUA 2HVXA 1C5OH 4E06H 1CGJE 2H9HA 3LU9B 1HXFH 3MTYA 1GI7B 1T31A 1PYTC 1S6HA 1AFQB 3RXRA 3IITA 4X6OA 5A0AE 3NCLA 3RM0H 1OP0A 3TH4H 3SUFA 4IC5A 2P3UB 3UREA 3AK5A 4R8TB 4FUCA 1CHGA 4VGCC 3SZNA 3TK6A 2PFEA 4X2YA 3TIUA 1HAGE 4AORA 1GJAB 4XDEA 1PYTD 3MO9A 2H6MA 1V2UT 5FAHA 1S85A 2TPIZ 1DT2A 1AU8A 5C3NA 1NPMA 1SOTA 1PPHE 3LJOA 1IOEA 3N7OA 4CREA 3QX5H 5EODA 1QL7A 2BXUH 1LVBA 4JK6A 2J2UA 1EZUC 4AFQA 3A8DA 2PR3A 2SGDE 2P3TB 1TOMH 2HOBA 2CXVA 2XNIA 1B0EA 1MCTA 3ZZ7A 3LH3A 1RTKA 3MNBA 1ANDA 1ELDE 3LGUA 4ISNA 4DIIH 2EI8A 2BD7A 1C5RA 4K1TA 3RMMH 2B9LA 3E91A 5EQRA 3RXIA 1IQNA 1GJ7B 3A81A 1MZDA 4NWLA 1QA7A 1BBRK 1SSXA 3TLOA 4RSPA 3O8CA 1MTSA 2Q6DA 3GYMA 1JXPA 6GCHG 2P93A 1GBHA 3M3TA 4IN1A 4BTIB 3LPRA 3UQVA 2WUCA 4CH2B 1EZQA 1LVYA 1QTFA 2Y82A 1EXFA 2RA3A 1C1OA 2VIOA 2GDDA 1P06A 5C1YA 3TGKE 2V3OH 4F4OC 5AFZH 1FZZA 2GCHF 1B7XB 4FVBA 1UHBB 4I8JA 1DWDH 2PKSB 3DUXH 2UWOA 5I25A 5EPNA 2ZFPH 4WWYA 1SGNE 2PTCE 1ELVA 2YNAA 5T3HA 1HUTH 3PLPA 1LQDB 1QJ7B 2WV4A 1NROH 3KQCA 3QZQA 4FVDA 5C5NA 5CMXH 1DM4B 4BOHA 3VGCB 1YPEH 2XBYA 1IAUA 2R2WU 3I78A 1C1SA 4ZKSU 1DFPA 1KTTB 2BDHA 4I8LA 4MLFB 2G51A 3C27B 3D49H 1G36A 1EPTA 1L4ZA 5L2YH 4AFZA 4Y0ZE 1Y5BT 3JZ2B 2AGEX 3RMNH 2PGQB 3SBKA 1AI8H 3ZZAA 1PQ7A 1BRUP 1TWXB 3FZZA 3SQEE 1WOFA 1FDPA 4R0IA 1O2TA 1XVMA 1O3EA 4XFQA 2CGAA 4X8UH 1T8MA 3RXVA 1HCGA 3SGAE 1BMNH 5F8XA 1QB6A 2B0FA 2XC5A 3SOSA 1O3JA 2QGRA 5CE1A 1ELBA 1L0ZA 3K65B 3ZVEA 1MH0A 4I7YH 1HV7A 1MAYA 2C90B 4UEHH 2BZAA 3B8JA 2PW8H 1BTZA 1J14A 3LDXH 3OSYA 2WPHS 4X8TH 1O3BA 4X2XA 1F92A 1SHHB 1N6YA 4GUXA 1A46H 1N6XA 4A1XA 5FCRA 5FBEA 1EP5A 3M7TA 1A0LA 3ZVBA 3GICB 1V2ST 5L6NH 3K6ZA 3BG4B 1GVKB 2PKSC 1ZPCA 1ARCA 3VB6A 1V2PT 5DKMA 2RA0A 3PMHB 1TBQH 4NIVA 2HNTC 4IMZA 1YKTA 1C9PA 5JBCS 1J8AA 1YC0A 1A3BH 3CP7A 3MU1A 1T8OA 5EXLA 1XXFA 1ANCA 4KTCA 1W11U 1AQ7A 2QYIA 3SV2H 1Y3UA 3GDVA 4WH6A 2WPKS 2ZTYA 1S84A 2I6SA 3F9GA 5E8EH 5A0CA 1H9HE 2JH0D 4ZH8A 1SQTA 1EB2A 3ODDA 1Y3XA 4DIHH 4GCHG 1AUJA 1XKAC 1H4WA 3GY6A 3MH4A 1UMAH 5DG6A 1O3DA 1JIMA 1EAWA 4JZEH 1BHXF 2A4QA 2BZ6H 2XWBI 4J2YB 3VFEA 4Z6AH 3A7WA 1OYTH 1O3AA 1HNEE 1UTOA 5EU8A 4Y0YE 1UTQA 2VH0A 2GD4B 3F9HA 3H5CB 1SGTA 4OS2A 3P8GA 1CVWH 4LZ4B 5T6FA 1GJ5H 1O2NA 2GZ7A 1C5LH 2VIWA 4TWWA 1HAZB 1XUJA 3FANA 2BQ6B 5DGJA 2XBVA 2SGEE 3GCOA 1S83A 4IC6A 2J92A 2ZU3A 4RN6A 1A3EH 2FI5E 2ZG0H 1EJAA 4D8NA 2R0KA 1FIZA 1BA8B 3ITIA 4NWKA 1E36B 2BHGA 2GVFA 3FVFB 4JZIA 1LHFH 5EGMA 2ZIQH 2BDYA 1VJ9U 4CBOA 1BHXB 3NKKA 2ZFRH 1GBBA 2QN5T 4Y7BA 3SNCA 1C1WH 3E8LA 4H42U 1D3QB 4K8BA 1A5HA 1FPHH 2B8OH 1IQKA 2HNTF 2ZU1A 3OY5U 1A7SA 1O2GH 1FV9A 1C2GA 1OWEA 1BTYA 2NWNA 4MNXA 4A7IB 1BOQA 1ZSLA 1AZZA 1YLDA 3BG4C 4IMQA 1V2NT 4DVAU 2A5IA 1GHXH 3SJIA 1WBGB 2NU4E 3LC3A 4NCYA 1SB1H 6CHAB 1HAPH 2D2DA 2DE8A 2FESH 1O37A 1ZHRA 4BANB 1D3PB 3RMLH 3M36A 1HAIH 1DVAH 5IDKA 1YF4A 1F5LA 2ANWA 5LPEA 3ZVFA 2G5NA 3MU4A 3BTEE 2Q1JA 5TCAA 4WXIA 5FX6A 1P2KA 1C1VH 1LMWB 1MKXK 1CGHA 3F68H 1K1PA 3EDXB 4WJG2 1YPHC 1GDUA 1KXCA 3UOPA 3HPTB 1RXPA 5F6MA 1YCPH 2SFAA 6LPRA 5GCHF 1DLKB 1HJ8A 3RLYH 4AZ2B 1C4U2 2BX3A 2Q6FA 3P70B 4K5ZA 2W3IA 1LHEH 1KIGH 3K6YA 2OK5A 2FDAA 5F03A 2AMDA 1TB6H 2H1UA 1GBMA 1GBFA 1O31A 3KQDA 3V7TA 1O2IA 2BB4A 4GHQA 5HGGA 2Y5GA 1E34B 4UONA 1O2RA 2FS9A 5A8YA 1K9OE 3QWCH 1H8IH 5C1UA 4K2YA 1RJXB 2NU1E 1Y3YA 1TMTH 3VEQB 3QLPH 4THNH 4SGBE 2FOHA 2ZFSA 1CHOF 3Q77A 1BRAA 2JKHA 4MDSA 1Y3WA 2A7HA 4YLQH 1BTWA 1SLXB 3SGBE 3F6UH 2P59A 2HRVA 5ETXA 2FIRH 2AEIH 2BM2A 1V2QT 4X1QU 2BTCE 3NWUA 1BT7A 1GJCB 1THPB 2XBWA 3EGKH 2CF9H 1DPOA 3TJUA 3Q00A 4TWYA 3HKIB 4Y71A 1O30A 3GDSA 1EZXC 3GDUA 1SFQB 2PWXA 3ZZ6A 2Z9KA 2BLWA 4GHTA 3IWMA 3MWIU 3SI3H 1RTLA 2ZHEH 3V3MA 3P17H 3RP2A 3SJOA 1JRTA 2BY9X 1L2EA 3GY3A 3M37A 4WY3A 1O2OA 1C5XB 1KYNA 1SGRE 3KN2A 1O0DH 3PTBA 1CSOE 1M9UA 2BQWB 2ILNA 1P9UA 3E90B 3LGWA 3KNXA 2ANMH 1EUFA 1AGJA 2I6QA 1IQLA 2LNCA 2UUYA 1QNJA 1V3XA 4MPVA 1B5GH 1Z7KA 1VCQA 8ESTE 1SPJA 4I8KA 3FFGA 1YPHE 4X1PU 7GCHF 1J17T 2Y5HA 2Z9IA 3P8FA 2ODYB 1Z8IB 3RDZA 3E3TA 3M5NA 4INLA 3ESTA 2BLOA 4TPYA 1ZPBA 1MU8B 2PSYA 5SGAE 1QIXB 3RM2H 2W26A 4Y79A 2J9NA 3VB7A 2VIPA 2GCTB 1P2JA 4D9RA 2FLBH 4YLUA 3RC5A 1YP9A 1CA0B 3A8CA 1HXEH 1O35A 4O3UA 1T4UH 3SUGA 2WHXA 2XC0A 1ZMLA 3AAVA 1W10U 4OM9A 1IQEA 3UR6A 1WTHD 4IBLH 2BD3A 3EQ0H 2WUBA 1XM1A 1NU7B 3RXGA 4FUGA 2OCVB 1O2MA 4ZKRU 1HRTH 1RGQA 2C8XB 1F0RA 1ZRBA 4JYVH 2WPJS 5EOKA 4OS4A 3GISB 2BD9A 4X6MA 1O3NA 3KF2A 3NUMA 2QF0A 2UUJB 1V6DA 5JPMH 2WV9A 3A88A 4H4FA 3ZZ9A
chains in the Genus database with same CATH superfamily
2C3SA 4WH8A 2P94A 3SO3A 3OEHD 2ZZUH 4NZQA 1EKBB 3AASA 3M3SA 2FLRH 2GCTC 3NPSA 1QFKH 2ALPA 3VXEH 1MQ5A 2ANYA 3LH1A 2PV9B 4X1RU 1IQIA 3ZVGA 2OP9A 1DX5M 3T25A 3V13A 5EXMA 2TIOA 1KTSB 1P2IA 2UWLA 2JH6D 2YMSD 2FX6A 3A7YA 1TNGA 2A2QH 1ZMNA 3RUOA 3S9CA 1GCDA 2BY8X 1SGFG 3UWJH 1YPLH 1ORFA 1GBKA 2UWPA 3FAOA 3HK3B 2EA3A 1IQJA 5AHGH 1GJ9B 2A7JA 3OU0A 3H09A 1FY4A 4TYDA 1C5VA 2BD4A 1X7AC 1EX3A 4DW2U 1SGEE 1CO7E 1XVOA 3K9XB 5C0TA 3QN7A 3STIA 1BTPA 3OYPA 4X6NA 3RXSA 2FO9A 2GJGA 1NO9H 2ODQA 4MG3A 2ZA5A 1RFNA 2AYWA 2BVSH 1C2MA 2JETB 2R3YA 3F9EA 4AB9A 2FPZA 3CS7A 4O9VA 1SMFE 4FUDA 3T5FH 4MPXA 8GCHG 4KGAA 5F8ZA 1IQMA 1GL1A 4FXGH 1G30B 1LHGH 1XUKA 2SGPE 4ABGA 1L1NA 3KQEA 3A7ZA 3SJKA 4NSYA 1JBUH 1SGDE 4NZLA 4BAMB 1HLTH 1O2YA 1RD3B 5JBAS 1LPZB 1K22H 1XUGA 1AZ8A 1PQAA 1W8BH 4YO9A 3D65E 3KCGH 3HKJB 2HALA 3L6PA 1MD8A 3GYLB 2XYAA 1FXYA 4YM9A 2GX4A 1J9CH 2FOCA 1ZPZA 1KXFA 2XCFA 1GBJA 2OQUA 4ABAA 1H9LB 2KCPA 1SGCA 1NFXA 4K69A 3KEEA 1QHRB 3PV2A 1NFUA 1TLDA 1O3CA 3A89A 1KY9A 1GI9B 3VXFH 2QY0B 3ATLA 2ESTE 1VGCC 4X2WA 3RXUA 3PMAB 4I32A 1P2QA 1TQ7B 2WYJA 2XCNA 1C1TA 1YCPK 3M7QA 3Q76A 5DP6A 2STAE 1Z71A 2ZNKH 1WCZA 4MPWA 2FS8A 5EG4A 1GBCA 3TH3H 1GBTA 3MOCA 5C5OA 1ELCA 1O5FH 1EJMA 3M35A 2KZ4A 1ZTLA 1ELFA 4XBBA 1MKWH 4B2CA 1QA0A 2FX4A 1DXPA 1WYKA 4Q7XA 3LGYA 1MTUA 3KGPA 1O5BB 3LIWA 3R3GB 4U2WA 1NESE 4X8SH 2JETC 5L2ZH 2VWOA 4D76A 1AVXA 1XXDA 3SU1A 5ABWA 1FI8A 4F49A 1QJ6B 2CHAC 2ZCKP 2BYAX 4UD9H 1QBOA 2A5AA 3R0FA 3ZZBA 1Q31A 1C2LA 3U28C 1O32A 4FUJA 1IQFA 3MMGA 2VIQA 4Q7ZA 2XWAA 3LT3A 1ZRKA 2JIZD 1CT4E 1TMBH 1QBNA 1C1NA 2GP9B 2W6JD 4ASUD 1LPGB 3E1XB 3URDA 2H5DA 3QTOH 4RKOB 1GMCF 5ESTE 3MH6A 1A61H 1EB1H 1LKBA 1O3IA 1MAXA 3SU2A 4CRFA 1TRMA 4BTTB 1TGCA 2ZDVH 5CHAC 1O2UA 3V0XA 3SZEA 2ZHDA 1T7CA 1ZHPA 2K8IA 1NTPA 2W5EA 1P04A 5JB8S 2Z9JA 1GI0A 1GJBB 1L4DA 1OXGA 4XSKU 2VWLA 1INCA 2Z7FE 2QXJA 1GJ8B 4YT6H 1Z1IA 3SW2B 5IYTA 1WQSA 1PPZA 3MU5A 4E7RG 4WVPE 1UVUH 1Q3XA 3UOUA 3TGJE 1WU1A 1HJ9A 2AFQB 2J98B 4I8HA 3S7HB 1KXBA 1P2NA 3Q3KA 1ZZZA 4INKA 4U01A 1T32A 2B7DH 3V12A 1Y5UT 1P09A 3T28A 1TGSZ 1P05A 2VIVA 4NFEA 1C2HA 1THSH 2F3CE 4LXBH 2VINA 3A7XA 1TNHA 3SYJA 2FP7B 3A8BA 1O5EH 1UTKA 2VGCC 4F48B 1N8OC 3TGIE 4AGKA 3TJNA 2EC9H 3OX7U 4YOGA 2P3FH 1ABJH 1CGIE 1FONA 4OGXA 4X0WU 5JYIA 1DXWA 1GMDF 4LOYH 2H5CA 3UUZA 1ARBA 2V7QD 3ZIAD 4AG1A 1Z8RA 2BDBA 2O8WA 3A86A 3U69H 2AGIX 1C1RA 1ZR0A 1K21H 1P03A 1P01A 2BXTH 2FYQA 3SQHE 2XRCA 1FPCH 4GLYA 1AKSB 2FXRA 9LPRA 3BEIB 5E2PA 1TX6A 2TBSA 1GHYH 1P12E 1XKBC 1IHSH 1UTPA 1VR1H 3G01A 1Z6EA 4BAHB 5G4BA 2A4GA 1OOKB 3EE0B 3GCNA 1A5IA 2GCHG 3RC4A 2A0QB 2A7CA 4J1YA 1SLWB 2ZKSA 2VIDA 3PWBA 4CHAB 1BBRE 1EJNA 1P3EA 2VNTA 1GDNA 1E35B 1BRCE 1LQEA 2UUKB 2BD5A 3M61U 3I77A 5GXPA 2ZPQA 5B6LA 3MI4A 1CT2E 3OAAD 4A1VA 2RCEA 4UFEH 2ZGJA 3SNDA 1DUAA 4KTUA 3H7OA 1AB9B 2YOLA 1GHBF 4CHAC 1A2CH 1NRSH 4KTSA 1VKYA 1SGFA 1P10A 2Z3EA 5BPEA 4Y76A 4MTBA 1FAXA 4ISHH 2HLCA 4WF8A 3SV9A 1NRRH 2CMYA 1LCYA 5K0HA 4Y7AA 2J95A 1NM6A 3SHCH 3P6ZB 1OWIA 1FN6A 3EE7A 1S6LA 3L33A 4UFDH 1LVMA 5I46H 2CJIA 4YTAA 1EOLA 2P8OB 4JCNA 4FUIA 2YMSB 2HLDD 3OE7D 4JMYA 1DSUA 1TGBA 4ASHA 1ZGIA 1NC6A 4B6EA 2P95A 1OYQA 1OX1A 1K1NA 1C5WB 1SQAA 3BTWE 3UPEA 1ZTJA 1DY9A 2G81E 1K1MA 1O3MA 1FY8E 3BEUA 1YLCA 3PO1C 1V2VT 3NRLA 1P8VC 3TNTA 4AYYB 2W7SA 3SNAA 1GMHG 4FUHA 1G2LA 1LVOA 1Z6JH 1FIWA 1TNLA 1K1IA 1H8DH 2OD3B 1O2WA 3ATIA 1O34A 1AWHB 3E6PH 1C4V2 1Z1JA 9ESTA 2P16A 2FM2A 3U9AH 4E7NA 3C1KA 2FOAA 1EOJA 5HMAA 1L1GA 1MQ6A 1XX9A 2BMGB 1K1LA 3MNXA 4CRDA 3SJ9A 4DCDA 4GSOA 3ZZ4A 3TITA 2VWNA 5HXFA 1SQRA 4DG4A 1TPSA 4HGCA 2YNBA 3ZYEA 1VZQH 3ATKA 3PB1E 2FYRA 2W6ID 1HBTH 1O2VA 1ZYOA 2NU3E 2RDEA 2ZU4A 1RRKA 5IK2D 2ZDKA 1GPZA 1C4Y2 2J5UA 1UK4A 3SNEA 1AB9C 3A83A 4HZHA 4K60A 4DOQA 1DDJA 1DICA 1W7XH 2HWLB 4I31A 3T62A 1DITH 1C5PA 1CT0E 1TONA 3PRBA 1W13U 5DP5A 4A6LA 1C2DA 1TPPA 2AS9A 3RXAA 1UVTH 2PLXA 5CDFE 2ZO3H 2PKAB 1C5ZB 1C5YB 3GY8A 1LPKB 2TGDA 4YESB 2FZZA 1DWCH 5AVDA 2HVYB 5A8XA 2BLQA 1NY22 1BIOA 1MTVA 2LP6A 5C2ZA 3S9AA 5EW1H 3QUMP 1PPFE 1DWBH 1O39A 4XBCA 2KAIB 2WPMS 5E0JA 2TGPZ 5A8ZA 3BV9B 1MABB 1GHAF 1NU9A 1QB9A 3TU7H 4Y10E 3WY8A 2WZQA 1Y3VA 4CBNA 2A5KA 3N7DA 5DPAA 3GY5A 5HIZA 1HAOH 2SGQE 3T2NA 1C1PA 1TMUH 3TVJB 1V2LT 1A0JA 1QBVH 3GCTF 3BTFE 2ZHFH 3GY4A 4AB8A 5TCCA 2B5TB 3RXEA 2FEQH 5DK1A 3UNQA 1MUEB 1UCYE 5EPYA 1PPGE 1TPOA 1P2OA 4JYTA 1U6QA 2ZGHA 2QA9E 4X1SU 4OS1A 3RXOA 1QQUA 3UB0A 2C8YB 2FTLE 1NS3A 2ASUB 1TALA 2IPQX 3BIUH 3HGPA 2GV6A 4K1SA 2V6NA 1DOJA 1C1UH 1IQGA 2GZ8A 1T4VH 1BMLA 1HB0B 5C0UA 2GTBA 1ELAA 2BX4A 3UR9A 1L1JA 3FP6E 4FU9A 4E05H 1Y5AT 2QAAA 2ZGBH 1SOZA 1G3EA 2PUXB 1QQ4A 4UDWH 4M7GA 1J16A 1EAXA 1DUEA 1OWJA 1YPKH 2O8MA 4FU8A 4Y11E 3A7TA 2D8WA 3TH2H 5A2MH 1GHAG 3Q3YA 1OWHA 3UIRA 3AVZA 3F2FA 1YCPM 5EXNA 4Z1MD 2RG3A 4AGJA 4Z0KA 3FP7E 8LPRA 4RT1A 1XUIA 1HJAB 3BTGE 5FBIA 2FI3E 3I29A 1YGCH 3P92A 4ZUHA 2FWWA 1JMOH 3SUDA 3LONA 2F9OA 4ZROA 4O3TA 4HI3A 1TBZH 1W7GH 5EJ1A 2FOGA 1PPBH 1MCVA 1EAUA 1HAVB 3N7EA 2BD2A 1D6WA 3LC5A 1P0SH 2C93B 2A32A 5LGOA 4K3JA 4FETA 1OHHD 4FU7A 1BJUA 1P2MA 1FMGA 3MFJA 1TRNA 1LTOA 2RFKC 1KMHB 2QC2A 1ANEA 3MHWU 2HPQH 1SGYE 3S7KB 1LKAA 1N1LA 1O3HA 1OWDA 5KECA 1P57B 8KME2 3OTPA 1GBAA 1G37A 4X1NU 2IOTA 1O2LA 5E0GA 2BQ7B 2F4LA 3ZZDA 3DSGA 3K2UA 4B1TA 3PRDA 1QY6A 2CN0H 3RU4T 2XTTB 3M7UA 4RT0A 4ABDA 2QF3A 3NK8A 3SUEA 7GCHG 2ULLA 1QB1A 3UFAA 5EQSA 2JJ1D 1O5DH 5C17A 1HGTH 2XBXA 1FY3A 3VPKA 3PMBB 2ZP0H 3FP8E 2K0QA 3ZV8A 2GKVE 3FZDA 1FY5A 1JIRA 2OC8A 2CV3A 2PGBB 2ZDNA 4B2AA 2VVUA 2AERH 5DP9A 1YPJH 1O3GA 4ZHMU 1UTNA 2ANKH 1QL9A 3MH5A 1OP2A 2OQ5A 5GWZA 2NU0E 1FJSA 1YM0A 1O2HA 2AMPA 3M3VA 1RTFB 1SFIA 2ZPRA 1LHCH 4ACBA 1C2FA 2EI6A 1ESAA 4U30A 1YLNA 3RXDA 1ABIH 4A92A 4H6TA 1DE7H 1CHOG 1Z8GA 3EA7A 2OC1A 4OGYA 1GI5A 1GI6A 2F9VA 4GAWA 3PROA 5HM9A 4O03A 2WPLS 3GCTG 3RU4D 1OSSA 1EQ9A 1OKXA 5C67A 2XC4A 3RXCA 3MQKC 5T6DA 2M5TA 1DLEA 1BMMH 3DD2H 1DSTA 3SU4A 1AY6H 4TY6A 1GG6C 2LPRA 1GHWH 5AFYH 1SG8B 1GJ6A 1GVLA 3KYGA 1DS2E 3MU8A 5GPIB 4NIXA 1KSNA 1QRWA 1MKWK 3OY6U 1C5UA 1SGIB 1HFDA 4WMEA 5HM2A 3UNSA 3DSOA 3T27A 3BTHE 2BDIA 1F7ZA 1GI3A 1OS8A 1NFYA 1GWAA 3SV7A 3ZZ3A 1W0YH 4NA8A 1K1OA 1ELEE 4DT7B 2TGTA 3B23B 1O2SA 2BY7X 4ABFA 3QGJA 4Q4LA 2VGCB 1RIWC 2OC7A 3LGIA 4X2VA 3W95A 1CBWC 1F0UA 3U8RH 2BLVA 3D62A 2V3HH 1V2MT 1ANBA 3QZRA 5AF9H 2R2MB 3URCA 3ZZ5A 1TGNA 4B2BA 1BCUH 1VITH 1AUTC 2PSXA 2GMTC 1GG6B 1MBMA 1BTHH 1HAVA 1O5GH 3GOVB 2CHAB 4MNYA 3QO6A 1SBWA 3QK1A 1JOUB 4CRGA 3E0NB 1GL0E 3ELAH 2GMTB 2XW9A 1KDQA 3TJVA 4JK5A 2AGGX 3OEED 1D6RA 3Q3XA 4Y8XA 2ZTZA 4AG2A 5A09A 2AIQA 4BNRA 1AE8H 2PHBA 2G4TA 3LJJA 4VGCB 2L6OA 1IHTH 1Y8TA 3O8BA 1G3DA 5H4IB 3RXJA 1F5KU 1C2EA 4ABJA 5GIBA 1G3CA 2O8LA 1C5MD 5CHAB 1UW7A 1ESTA 1GI8B 4YT7H 4AFSA 5F53A 1TNIA 1O2ZA 1ESBA 4XOJA 1ID5H 2VB0A 2F83A 3GY7A 4DURA 1C1QA 1O2KA 2ZGCA 1DY8A 3HGNA 1UK3A 2ZCLP 4CR9A 1UK2A 1BBRH 5EQQA 2G5VA 1XUHA 4ZKOU 1SL3A 2IJOB 1VITG 1ZTKA 2QE7D 3SU5A 1UTLM 3RMOH 2SGFE 5DP7A 1PQ5A 4HFPB 1G3BA 1O3LA 3BN9A 5LPFA 5FPTA 4DGJA 1EP6A 1TRYA 3AW0A 1LHDH 3M5MA 4I86A 4SGAE 2Z94A 4JZFH 3PV5A 3RXKA 1BTUA 3F9FA 3VB5A 4ABIA 2DE9A 1EPTC 3A7VA 1UVOA 2EI7A 2Q6GA 3ZYDA 1O33A 2BY5X 1W12U 3TK9A 2BVRH 1QR3E 1O38A 1V2OT 2HPPH 1AFEH 1KLIH 4WMFA 3TK5A 1D9IA 3A84A 4PROA 1NRQH 4LK4A 2ALVA 3SORA 2J4IA 1TFXA 2F91A 3NZIA 1S81A 4Q80A 1KXEA 3E0PB 1TAWA 3UQOA 2SGAA 4ZAEA 1AMHA 2KCOA 1YPGH 2JJ2D 1BDAA 3TJOA 1UO6A 4YOJA 1O2XA 3PWCA 1B0FA 4MNVA 3BTQE 1QRZA 1C2IA 1GBIA 1O3FA 1N8OB 1DWEH 1KXAA 2OBOA 5GNDA 4IGDA 1WSSH 4B71A 3M5LA 1GJ4H 1F0SA 1T8NA 4B73A 1A4WH 1WQVH 1WAYB 2HGTH 5B6OA 3PTNA 3QGNB 2ZU5A 4BAKB 4B75A 1OWKA 1WTGH 3F1SB 3EYDA 4RKJB 1BTXA 2SNVA 3RXLA 5L30H 1AO5A 4U32A 3BTME 4A5TS 4ISLA 4BAQB 1P02A 1SVPA 7LPRA 2BD8A 2BVXH 5JB9S 1VITF 1RS0A 4B74A 1A1RA 1EATA 1ZMJA 3O8DA 3SNBA 1JWTA 1NN6A 2BY6X 1GCTB 2W7UA 2WV5A 3T26A 1HPGA 1O3PB 2FODA 4M9FA 5C94A 5C20A 4NA9H 1HAYB 2QCYA 1CU1A 3TNSA 1GVZA 3EAJA 4B6FA 2ZPSA 3P8OA 3BTKE 4UFGH 1AD8H 2ZF0H 3M5OA 2OINA 5DP8A 1QJ1B 1SR5C 2D26C 2KAIA 5GDSH 1E1QD 1J15A 2FOFA 4BXSA 5A0BA 1EAIA 1BQYA 1SLVB 3TPIZ 4H6SB 2VWMA 3JZ1B 2VBCA 4I8GA 3DFLA 1MZAA 1BMAA 2V35A 1UVPA 1GJDB 1QL8A 1FQ3A 4YZUA 2G52A 3F2HA 1GBDA 3RXPA 3A87A 1TPAE 1XMNB 2ODPA 1TYNA 2Y7ZA 2ZDLA 5JDUB 5FXLA 1GBLA 1UCYH 1BZXE 1GMDG 2GGVB 4ZMAH 4A1TA 3VGCC 3ZV9A 3S9BA 3SU0A 1HYLA 1Q2WA 5PTPA 2JH5D 2C4FH 3BTDE 2H9EH 1PPEE 2PP6A 1S0QA 2R3UA 2XNDD 3BEFB 1V2JT 2TGAA 3LKWA 3LGTA 2A4OA 1GHVH 4BTUB 2VJ1A 1K28D 1MTNC 3MNSA 4AYVB 1A0HB 5BRRE 4K8YA 1HDTH 2ZC9H 3FN8A 2RDLA 4AOQA 3UY9A 4KELA 4DT4A 2O8TA 4DY7B 2A2XH 1UVSH 1TBRH 4JYUH 4LZ1H 1BITA 1O36A 1F5RA 4UFFH 1XUFA 3U8TH 3STJA 1TQ0B 3N99A 1UCYK 1TOCB 2WYGA 1GBEA 1MBQA 1TE0A 2KFWA 4IN2A 4XBDA 3SJ8A 2QXHA 1YYY1 1DANH 1S5SA 2XXLA 1AVWA 1V2KT 1SQOA 1SI5H 2R9PA 2QF5A 2PTNA 4X8VH 3UWIA 1OPHB 1AN1E 1HJAC 5C1XA 4CRBA 2CF8H 1MD7A 3U1IB 3P95A 6ESTA 1KLJH 3E16B 6GCHF 1C2KA 3KIDU 1W14U 1NZQH 1BUIA 1G32B 1SKYE 1W2KH 1V2RT 3HK6B 5GCHG 4GPGA 4BXWA 3UTUH 1D3DB 1GI2A 5JBBS 3PV4A 1GHZA 2F9PA 1CA8B 3AW1A 4Y6DA 1SLUB 3GY2A 1C9TA 3MNCA 3CENA 1AE5A 3AAUA 3MO6A 4NA7A 3U98H 1D4PB 4ISIH 3D23A 5DP4A 5TJXA 1V2TT 1QZ8A 1FUJA 2R0LA 3MU0A 1EPTB 1TGTA 2WSSD 2EEKA 3SU3A 4UE7H 2LELA 4KP0A 1Y59T 2A31A 2JDID 5KEDA 1C1MA 1YPMH 1HIAA 2Y81A 3RXTA 3MO3A 1A5GH 4O97A 1COWD 7KMEH 3ZVCA 1WV7H 4NIYA 1GMCG 3DT0H 1GMHF 3KHVA 3PLKA 4ZCNA 2HNTE 1ZLRA 1MTWA 1MU6B 2KCYA 5T6GA 2OLGA 3PYHA 2FOBA 1V2WT 5FHTA 1GDQA 2ZFTA 1S82A 1ZJDA 3ATWA 2IPHA 1G2MA 2Z3CA 4FUEA 1G9IE 5E0HA 4AN7A 2VVCA 4ZHLU 3B9FH 4TPIZ 1O2PA 3HATH 3ZVDA 3ENSB 4WMDA 1FAKH 4CH8B 2Y6TA 5E2OA 3NXPA 4GCHF 3RXHA 1AIXH 3CS0A 1K0HA 1TX7A 4MQAA 1C5NH 2G8TA 5CHBA 4JZDH 2QIQA 2NU2E 1E0FD 2ZEBA 3BSQA 4NFFA 3QDZB 4P00A 4IW4E 2PUQH 1UJ1A 3A85A 2F43B 3ATMA 2O8UA 3QTVH 4ABHA 1TA2A 1FY1A 2ZWLH 5FPYA 3SU6A 2ZHWH 3O8RA 4WXVA 4MNWA 1K1JA 3BF6H 2IN2A 1E37B 4TT3D 3SN8A 1E79D 2F9BH 4CR5A 3P8NA 5T1VA 2OTVA 1JRSA 3MH7A 2Y7XA 3L3TA 4I33A 1T8LA 1ETRH 1VGCB 5ESBA 3T29A 2J38A 1TNJA 4FUBA 3DA9B 3PLBA 4ISOA 1O2JA 1WUNH 3DFJA 1ZSKA 4D7GA 1W0ZU 4NGAH 1UTJA 1SHYA 2H2ZA 2ZI2H 1P11E 2AHME 3LGVA 2M2AA 5DP3A 4Q7YA 2ZGXH 1C5TA 2ZU2A 1ETTH 3SI4H 3BG8A 3U8OH 1AFQC 2ZFFH 1TABE 3GCHB 2Y5FA 1FNIA 3A8AA 2STBE 1KLTA 2ZHQH 5HYOA 2G55A 1NRPH 2A1DB 2GT7A 1TIOA 3PMJA 4MVNA 3SV8A 1PFXC 3RXMA 1H9IE 4YOIA 2BOHB 2BDGA 4NG9H 2SNWA 1F0TA 2PKAA 3IG6B 4CRAA 3LOXA 1H8HD 1O5AB 2A4RA 3RXQA 2KCAA 1BRBE 3CNRA 1SGPE 4HTCH 1Z8JB 1NFWA 2OBQA 2BDCA 2QXGA 3A80A 3UNRA 5DJ7A 1O2QA 2ZDAH 1LO6A 3ODFA 2OC0A 1VJAU 3MYWA 1ZGVA 1S0RA 3ZZ8A 6CHAC 1C5QA 2ZECA 1FN8A 1S6FA 2J94A 2VH6A 3S0NA 3VB3A 5J4QA 2C8ZB 1PPCE 1UHBA 4ABBA 1ETSH 1C2JA 1NT1A 5DO4H 1CBWB 4P02A 2UUFB 1GGDC 4D9QA 5EW2H 2Z6BD 2BDAA 3RXFA 2G4UA 2P8OC 2VVVA 1LDTT 3ZVAA 1AHTH 1VCWA 2Y80A 4ESTE 1BB0B 3GCHC 5LH8A 1FLEE 1OP8A 2QV1A 1ZSJA 3ZZCA 2ZTXA 2GDEH 4IS5A 2YMSC 3EA8A 2GV7A 1ELTA 1NRNH 4Q2KA 1P9SA 2A45B 1FX0B 4GVUA 1KDQB 4INHA 1HAHH 1YBWA 1E38B 3BIVH 3OFND 2THFB 1QGFA 4QT8C 1MMJN 4ZXYH 3RU4E 3SV6A 2H9TH 3DHKH 2OXSA 3KL6A 1H1BA 2ZQ2A 4ZXXH 1RIWB 4XE4A 2WPDD 1P3CA 5K7RA 3SHAH 4FUFA 2D1JA 1NBME 3PO1B 4Y8YA 3KQ5A 4D7FA 4OS6A 4AX9H 1MTNB 1O5CB 1K2I1 4K1EA 2OUAA 1HAXB 1W3CA 3OTJE 2G00A 1BJVA 1W0JD 4NSVA 2IJD1 1GGDB 2O9QA 1ZJKA 2KX4A 1KXDA 1PQ8A 4CRCA 3A82A 1C5SA 2FI4E 2W3KA 2J34A 4B76A 1QCPA 2Z3DA 1AWFH 1QURH 4TY7A 4KKDA 1AVGH 2FOMB 3BTTE 2AIPA 2GT8A 2ZCHP 3W94A 4ABEA 1GI4A 2ZFQH 1ZOMA 1SC8U 3EA9A 2DUCA 4RI0A 5F8TA 4JZ1A 4NIWA 5FX5A 2K1QA 2WPIS 4BAOB 2F9NA 1O3KA 1CA0C 1TX8A 2BOKA 1EASA 5HKKD 1F2SE 1SGQE 2QXIA 1GCTC 1GHBG 3SGQE 1CQQA 1WXRA 3VB4A 2C8WB 5FCKA 3PM3A 3S69A 1THRH 1D3TB 1AKSA 1TNKA 4DJZB 3RC6A 4OS7A 3U1JB 2VU8E 5GJ4B 2TRMA 1VCPA 2FOEA 3H7TA 2V3MA 1MKXH 2WINI 1QRXA 5JBTA 1TA6A 3KQBA 4ZKNU 5J4SA 5DN6D 3RLWH 1HIAB 7ESTE 2V0BA 5LPRA 1W0KD 1ACBE 2ZDMA 8GCHF 1PJPA 2FMJA 4Y8ZA 3RXBA 4OS5A 1CE5A 1ELGA 2Z9GA 4ZHAA 1GI1A 2AH4X 2F9UA 2FTMA 2Z9LA 4X6PA 1IQHA 2ZQ1A 2GZ9A 5FL7D 1UTMA 2AMQA 5FPSA 4AFUA 1O3OA 1ZHMA 1EZSC 4MPUA 2HVXA 1C5OH 4E06H 1CGJE 2H9HA 3LU9B 1HXFH 3MTYA 1GI7B 1T31A 1PYTC 1S6HA 1AFQB 3RXRA 3IITA 4X6OA 5A0AE 3NCLA 1BMFD 1OP0A 4FOUC 3RM0H 3TH4H 3SUFA 4IC5A 2P3UB 3UREA 3AK5A 4R8TB 4FUCA 1YWUA 3FO8D 1CHGA 4VGCC 3SZNA 3TK6A 2PFEA 4HG6A 4X2YA 3TIUA 1HAGE 4AORA 1GJAB 4XDEA 1PYTD 3MO9A 2H6MA 1E1RD 1V2UT 5FAHA 1S85A 2TPIZ 1DT2A 1AU8A 5C3NA 1NPMA 1SOTA 1PPHE 3LJOA 1IOEA 3N7OA 4CREA 3QX5H 5EODA 1QL7A 2BXUH 1LVBA 4JK6A 2J2UA 1EZUC 4AFQA 3A8DA 2PR3A 2QF4A 2SGDE 2P3TB 1TOMH 2HOBA 3WWBA 2CXVA 2XNIA 1B0EA 1MCTA 3ZZ7A 3LH3A 1RTKA 3MNBA 1ANDA 1ELDE 3LGUA 4ISNA 4DIIH 2EI8A 5DSFA 2BD7A 1C5RA 4K1TA 3RMMH 2B9LA 3E91A 5EQRA 3RXIA 1IQNA 1GJ7B 3A81A 1MZDA 4NWLA 1QA7A 1BBRK 1SSXA 3TLOA 4RSPA 3O8CA 1MTSA 2Q6DA 3GYMA 1JXPA 6GCHG 2P93A 1GBHA 3M3TA 4IN1A 4BTIB 5HIYA 3LPRA 3UQVA 2WUCA 4CH2B 1EZQA 1LVYA 1QTFA 2Y82A 3F2GA 1EXFA 5KGOA 2RA3A 1C1OA 2VIOA 2GDDA 1P06A 5C1YA 3TGKE 2V3OH 4F4OC 5AFZH 1FZZA 2GCHF 1B7XB 4FVBA 1UHBB 4I8JA 1DWDH 2PKSB 3DUXH 2UWOA 5I25A 5EPNA 2ZFPH 4WWYA 1SGNE 2PTCE 1ELVA 2YNAA 5T3HA 1HUTH 3PLPA 1LQDB 1QJ7B 3FOAA 2WV4A 1NROH 3KQCA 3QZQA 4FVDA 5C5NA 5CMXH 1DM4B 4BOHA 3VGCB 1YPEH 2XBYA 1IAUA 2R2WU 3I78A 1C1SA 4ZKSU 1DFPA 1KTTB 2BDHA 4I8LA 4MLFB 2G51A 3C27B 3D49H 1G36A 1EPTA 1L4ZA 5L2YH 4AFZA 4Y0ZE 1Y5BT 3JZ2B 2AGEX 3RMNH 2PGQB 3SBKA 1AI8H 3ZZAA 1PQ7A 3GS9A 4XD7D 1BRUP 1TWXB 3FZZA 3SQEE 1WOFA 4YXWD 1NBMD 2L74A 1FDPA 4R0IA 1O2TA 1XVMA 1O3EA 4XFQA 2CGAA 4X8UH 1T8MA 3RXVA 1HCGA 3SGAE 1BMNH 5F8XA 1QB6A 2B0FA 2XC5A 3SOSA 1O3JA 2QGRA 5CE1A 1ELBA 1L0ZA 3K65B 3ZVEA 1MH0A 4I7YH 1HV7A 1MAYA 2C90B 4UEHH 2BZAA 3B8JA 2PW8H 1BTZA 1J14A 3LDXH 3OSYA 2WPHS 4X8TH 1O3BA 4X2XA 1F92A 1SHHB 1N6YA 3WWFA 4GUXA 1A46H 1N6XA 4A1XA 3WW7A 5FCRA 5FBEA 1EP5A 3M7TA 1A0LA 3ZVBA 3GICB 1V2ST 5L6NH 3K6ZA 3BG4B 1GVKB 2PKSC 1ZPCA 1ARCA 3F0OA 3VB6A 1V2PT 5DKMA 2RA0A 3PMHB 1TBQH 4NIVA 2HNTC 4IMZA 1YKTA 1C9PA 5JBCS 1J8AA 1YC0A 1A3BH 3CP7A 3MU1A 1T8OA 5EXLA 1XXFA 1ANCA 2EY4C 4KTCA 1W11U 1AQ7A 2QYIA 3SV2H 1Y3UA 3GDVA 4WH6A 2WPKS 2ZTYA 1S84A 2I6SA 3F9GA 5E8EH 5A0CA 1H9HE 2JH0D 4ZH8A 1SQTA 1EB2A 3ODDA 1Y3XA 4DIHH 4GCHG 1AUJA 1XKAC 1H4WA 3GY6A 3MH4A 1UMAH 5DG6A 1O3DA 1JIMA 1EAWA 4JZEH 1BHXF 2A4QA 2BZ6H 2XWBI 4J2YB 3VFEA 4Z6AH 3A7WA 1OYTH 1O3AA 1H8ED 1HNEE 1UTOA 5EU8A 5EIYA 4Y0YE 1UTQA 2VH0A 2GD4B 3F9HA 3H5CB 1SGTA 4OS2A 3P8GA 1CVWH 4LZ4B 5T6FA 1GJ5H 1O2NA 2GZ7A 1C5LH 2VIWA 4TWWA 1HAZB 1XUJA 1YY3A 3FANA 2BQ6B 5DGJA 2XBVA 2SGEE 3GCOA 1S83A 4IC6A 2J92A 4TSFD 2ZU3A 4RN6A 1A3EH 2FI5E 2ZG0H 5EJZA 1EJAA 4D8NA 2R0KA 1FIZA 1BA8B 3ITIA 4NWKA 1E36B 2BHGA 2GVFA 3FVFB 4JZIA 1LHFH 5EGMA 2ZIQH 2BDYA 1VJ9U 4CBOA 3VG8A 1BHXB 3NKKA 2ZFRH 1GBBA 2QN5T 4Y7BA 3SNCA 1C1WH 3E8LA 4H42U 1D3QB 4K8BA 1A5HA 1FPHH 3W1EA 2J98A 2B8OH 1IQKA 2HNTF 2ZU1A 3OY5U 1A7SA 1O2GH 1FV9A 1C2GA 1OWEA 1BTYA 2NWNA 4MNXA 4A7IB 1BOQA 1ZSLA 1AZZA 1YLDA 3BG4C 4IMQA 1V2NT 4DVAU 2A5IA 1GHXH 3SJIA 1WBGB 2NU4E 3LC3A 4NCYA 1SB1H 6CHAB 1HAPH 2D2DA 2DE8A 2FESH 1O37A 1ZHRA 4BANB 1D3PB 3RMLH 3M36A 1HAIH 1DVAH 5IDKA 1YF4A 1F5LA 2ANWA 5LPEA 3ZVFA 2G5NA 3MU4A 3BTEE 2Q1JA 5TCAA 4WXIA 5FX6A 1P2KA 1C1VH 1LMWB 1MKXK 1CGHA 3F68H 1K1PA 3EDXB 4WJG2 1YPHC 1GDUA 1KXCA 3UOPA 3HPTB 1RXPA 5F6MA 1YCPH 2SFAA 6LPRA 5GCHF 1DLKB 1HJ8A 3KYFA 3RLYH 4AZ2B 1C4U2 2BX3A 2Q6FA 3P70B 4K5ZA 2W3IA 1LHEH 1KIGH 3K6YA 2OK5A 2FDAA 5F03A 2AMDA 1TB6H 2H1UA 1GBMA 1GBFA 1O31A 3KQDA 3V7TA 4ACAA 1O2IA 2BB4A 4GHQA 5HGGA 2Y5GA 1E34B 4UONA 1O2RA 2FS9A 5A8YA 1K9OE 3QWCH 1H8IH 2CK3D 5C1UA 4K2YA 1RJXB 2NU1E 1Y3YA 1TMTH 3VEQB 2EQNA 3QLPH 4THNH 4SGBE 1WDIA 2FOHA 5EJLA 2ZFSA 1CHOF 3Q77A 1BRAA 2JKHA 4MDSA 1Y3WA 2A7HA 4YLQH 1BTWA 1SLXB 3F0PA 3SGBE 3F6UH 2P59A 2HRVA 5ETXA 2FIRH 2AEIH 2BM2A 1V2QT 4X1QU 2BTCE 2KR7A 3NWUA 1BT7A 1GJCB 1THPB 2XBWA 2J97A 3DCLA 3EGKH 2CF9H 1DPOA 3TJUA 3Q00A 4TWYA 3HKIB 4Y71A 1O30A 3GDSA 1EZXC 3GDUA 1SFQB 2PWXA 3ZZ6A 2Z9KA 2BLWA 4GHTA 3IWMA 3MWIU 3SI3H 1RTLA 2ZHEH 3V3MA 4Q63A 3P17H 3RP2A 3SJOA 1JRTA 2BY9X 1L2EA 3GY3A 3M37A 4WY3A 1O2OA 1C5XB 1KYNA 1SGRE 3KN2A 1O0DH 3PTBA 1CSOE 1EFRD 1M9UA 2BQWB 2ILNA 1P9UA 3E90B 3LGWA 3KNXA 2ANMH 1EUFA 1AGJA 2I6QA 1IQLA 2LNCA 2UUYA 1QNJA 1V3XA 4MPVA 1B5GH 1Z7KA 1VCQA 8ESTE 1SPJA 4I8KA 3FFGA 1YPHE 4X1PU 7GCHF 1J17T 2Y5HA 2Z9IA 3P8FA 2ODYB 1Z8IB 3RDZA 3E3TA 3M5NA 4INLA 3ESTA 2BLOA 4TPYA 4XRNA 1ZPBA 3FKSD 1MU8B 2PSYA 3DSPA 3F3BA 5SGAE 1QIXB 3RM2H 2XOKD 2W26A 4Y79A 2J9NA 3VB7A 2VIPA 2GCTB 1P2JA 4D9RA 2FLBH 4YLUA 3RC5A 1YP9A 4F55A 1CA0B 3A8CA 1HXEH 1O35A 4O3UA 1T4UH 3SUGA 2WHXA 2XC0A 1ZMLA 3AAVA 1W10U 4OM9A 1IQEA 3UR6A 1WTHD 4IBLH 2BD3A 3EQ0H 2KM0A 2WUBA 1XM1A 1NU7B 3RXGA 4FUGA 2OCVB 1O2MA 4ZKRU 1HRTH 1RGQA 2C8XB 1F0RA 4AC9A 1ZRBA 4JYVH 3UAIC 2WPJS 5EOKA 4OS4A 3GISB 2BD9A 4X6MA 1O3NA 3KF2A 3NUMA 2QF0A 2UUJB 1V6DA 5JPMH 2WV9A 3A88A 4H4FA 3ZZ9A
chains in the Genus database with same CATH topology
2C3SA 4WH8A 2P94A 3SO3A 3OEHD 2ZZUH 4NZQA 1EKBB 3AASA 3M3SA 2FLRH 2GCTC 3NPSA 1QFKH 2ALPA 3VXEH 1MQ5A 2ANYA 3LH1A 2PV9B 4X1RU 1IQIA 3ZVGA 2OP9A 1DX5M 3T25A 3V13A 5EXMA 2TIOA 1KTSB 1P2IA 2UWLA 2JH6D 2YMSD 2FX6A 3A7YA 1TNGA 2A2QH 1ZMNA 3RUOA 3S9CA 1GCDA 2BY8X 1SGFG 3UWJH 1YPLH 1ORFA 1GBKA 2UWPA 3FAOA 3HK3B 2EA3A 1IQJA 5AHGH 1GJ9B 2A7JA 3OU0A 4TYDA 1FY4A 3H09A 1C5VA 2BD4A 1X7AC 1EX3A 4DW2U 1SGEE 1CO7E 1XVOA 3K9XB 5C0TA 3QN7A 3STIA 1BTPA 3OYPA 4X6NA 3RXSA 2FO9A 1NO9H 2ODQA 4MG3A 2ZA5A 1RFNA 2AYWA 2BVSH 1C2MA 2JETB 2R3YA 3F9EA 4AB9A 2FPZA 3CS7A 4O9VA 1SMFE 4FUDA 3T5FH 4MPXA 8GCHG 4KGAA 5F8ZA 1IQMA 1GL1A 4FXGH 1G30B 1LHGH 1XUKA 2SGPE 4ABGA 1L1NA 3KQEA 3A7ZA 3SJKA 4NSYA 1JBUH 1SGDE 4NZLA 4BAMB 1HLTH 1O2YA 1RD3B 5JBAS 1LPZB 1K22H 1XUGA 1AZ8A 1PQAA 1W8BH 4YO9A 3D65E 3KCGH 3HKJB 2HALA 3L6PA 1MD8A 3GYLB 2XYAA 1FXYA 4YM9A 2GX4A 1J9CH 2FOCA 1ZPZA 1KXFA 2XCFA 1GBJA 2OQUA 4ABAA 1H9LB 2KCPA 1SGCA 1NFXA 4K69A 3KEEA 1QHRB 3PV2A 1NFUA 1TLDA 1O3CA 3A89A 1KY9A 1GI9B 3VXFH 2QY0B 3ATLA 2ESTE 1VGCC 4X2WA 3RXUA 3PMAB 4I32A 1P2QA 1TQ7B 2WYJA 2XCNA 1C1TA 1YCPK 3M7QA 3Q76A 5DP6A 2STAE 1Z71A 2ZNKH 1WCZA 4MPWA 2FS8A 5EG4A 1GBCA 3TH3H 1GBTA 3MOCA 5C5OA 1ELCA 1O5FH 1EJMA 3M35A 2KZ4A 1ZTLA 1ELFA 4XBBA 1MKWH 4B2CA 1QA0A 2FX4A 1DXPA 1WYKA 4Q7XA 3LGYA 1MTUA 3KGPA 1O5BB 3LIWA 3R3GB 4U2WA 1NESE 4X8SH 2JETC 5L2ZH 2VWOA 4D76A 1AVXA 1XXDA 3SU1A 5ABWA 1FI8A 4F49A 1QJ6B 2CHAC 2ZCKP 2BYAX 4UD9H 1QBOA 2A5AA 3R0FA 3ZZBA 1Q31A 1C2LA 1O32A 4FUJA 1IQFA 3MMGA 2VIQA 4Q7ZA 2XWAA 3LT3A 1ZRKA 2JIZD 1CT4E 1TMBH 1QBNA 1C1NA 2GP9B 2W6JD 4ASUD 1LPGB 3E1XB 3URDA 2H5DA 3QTOH 4RKOB 1GMCF 5ESTE 3MH6A 1A61H 1EB1H 1LKBA 1O3IA 1MAXA 3SU2A 4CRFA 1TRMA 4BTTB 1TGCA 2ZDVH 5CHAC 1O2UA 3V0XA 3SZEA 2ZHDA 1T7CA 1ZHPA 2K8IA 1NTPA 2W5EA 1P04A 5JB8S 2Z9JA 1GI0A 1GJBB 1L4DA 1OXGA 4XSKU 2VWLA 1INCA 2Z7FE 2QXJA 1GJ8B 4YT6H 1Z1IA 3SW2B 5IYTA 1WQSA 1PPZA 3MU5A 4E7RG 4WVPE 1UVUH 1Q3XA 3UOUA 3TGJE 1WU1A 1HJ9A 2AFQB 4I8HA 3S7HB 1KXBA 1P2NA 3Q3KA 1ZZZA 4INKA 4U01A 1T32A 2B7DH 3V12A 1Y5UT 1P09A 3T28A 1TGSZ 1P05A 2VIVA 4NFEA 1C2HA 1THSH 2F3CE 4LXBH 2VINA 3A7XA 1TNHA 3SYJA 2FP7B 3A8BA 1O5EH 1UTKA 2VGCC 1N8OC 3TGIE 4AGKA 3TJNA 2EC9H 3OX7U 4YOGA 2P3FH 1ABJH 1CGIE 1FONA 4OGXA 4X0WU 5JYIA 1DXWA 1GMDF 4LOYH 2H5CA 3UUZA 1ARBA 2V7QD 3ZIAD 4AG1A 1Z8RA 2BDBA 2O8WA 3A86A 3U69H 2AGIX 1C1RA 1ZR0A 1K21H 1P03A 1P01A 2BXTH 2FYQA 3SQHE 2XRCA 1FPCH 4GLYA 1AKSB 2FXRA 9LPRA 3BEIB 5E2PA 1TX6A 2TBSA 1GHYH 1P12E 1XKBC 1IHSH 1UTPA 1VR1H 3G01A 1Z6EA 4BAHB 5G4BA 2A4GA 1OOKB 3EE0B 3GCNA 1A5IA 2GCHG 3RC4A 2A0QB 2A7CA 4J1YA 1SLWB 2ZKSA 2VIDA 3PWBA 4CHAB 1BBRE 1EJNA 1P3EA 2VNTA 1GDNA 1E35B 1BRCE 1LQEA 2UUKB 2BD5A 3M61U 3I77A 5GXPA 2ZPQA 5B6LA 3MI4A 1CT2E 3OAAD 4A1VA 2RCEA 4UFEH 2ZGJA 3SNDA 1DUAA 4KTUA 3H7OA 1AB9B 2YOLA 1GHBF 4CHAC 1A2CH 1NRSH 4KTSA 1SGFA 1P10A 2Z3EA 5BPEA 4Y76A 4MTBA 1FAXA 4ISHH 2HLCA 4WF8A 3SV9A 1NRRH 2CMYA 1LCYA 5K0HA 4Y7AA 2J95A 1NM6A 3SHCH 3P6ZB 1OWIA 1FN6A 1S6LA 3L33A 4UFDH 1LVMA 5I46H 2CJIA 4YTAA 1EOLA 2P8OB 4JCNA 4FUIA 2YMSB 2HLDD 3OE7D 4JMYA 1DSUA 1TGBA 4ASHA 1ZGIA 1NC6A 4B6EA 2P95A 1OYQA 1OX1A 1K1NA 1C5WB 1SQAA 3BTWE 3UPEA 1ZTJA 1DY9A 2G81E 1K1MA 1O3MA 1FY8E 3BEUA 1YLCA 3PO1C 1V2VT 3NRLA 1P8VC 3TNTA 4AYYB 2W7SA 3SNAA 1GMHG 4FUHA 1G2LA 1LVOA 1Z6JH 1FIWA 1TNLA 1K1IA 1H8DH 2OD3B 1O2WA 3ATIA 1O34A 1AWHB 3E6PH 1C4V2 1Z1JA 9ESTA 2P16A 2FM2A 3U9AH 4E7NA 3C1KA 2FOAA 1EOJA 5HMAA 1L1GA 1MQ6A 1XX9A 2BMGB 1K1LA 3MNXA 4CRDA 3SJ9A 4DCDA 4GSOA 3ZZ4A 3TITA 2VWNA 5HXFA 4DG4A 1TPSA 4HGCA 2YNBA 3ZYEA 1VZQH 3ATKA 3PB1E 2FYRA 2W6ID 1HBTH 1O2VA 1ZYOA 2NU3E 2ZU4A 1RRKA 5IK2D 2ZDKA 1GPZA 1C4Y2 2J5UA 1UK4A 3SNEA 1AB9C 3A83A 4HZHA 4K60A 4DOQA 1DDJA 1DICA 1W7XH 2HWLB 4I31A 3T62A 1DITH 1C5PA 1CT0E 1TONA 3PRBA 1W13U 5DP5A 4A6LA 1C2DA 1TPPA 2AS9A 3RXAA 1UVTH 2PLXA 5CDFE 2ZO3H 2PKAB 1C5ZB 1C5YB 3GY8A 1LPKB 2TGDA 4YESB 2FZZA 1DWCH 5AVDA 5A8XA 2BLQA 1NY22 1BIOA 1MTVA 5C2ZA 3S9AA 5EW1H 3QUMP 1PPFE 1DWBH 1O39A 4XBCA 2KAIB 2WPMS 5E0JA 2TGPZ 5A8ZA 3BV9B 1MABB 1GHAF 1NU9A 1QB9A 3TU7H 4Y10E 3WY8A 2WZQA 1Y3VA 4CBNA 2A5KA 5DPAA 3N7DA 3GY5A 1HAOH 2SGQE 3T2NA 1C1PA 1TMUH 3TVJB 1V2LT 1A0JA 1QBVH 3GCTF 3BTFE 2ZHFH 3GY4A 4AB8A 5TCCA 2B5TB 3RXEA 2FEQH 5DK1A 3UNQA 1MUEB 1UCYE 5EPYA 1PPGE 1TPOA 1P2OA 4JYTA 1U6QA 2ZGHA 2QA9E 4X1SU 4OS1A 3RXOA 1QQUA 3UB0A 2C8YB 2FTLE 1NS3A 2ASUB 1TALA 3BIUH 3HGPA 2GV6A 4K1SA 2V6NA 1DOJA 1C1UH 1IQGA 2GZ8A 1T4VH 1BMLA 1HB0B 5C0UA 2GTBA 1ELAA 2BX4A 3UR9A 1L1JA 3FP6E 4FU9A 4E05H 1Y5AT 2QAAA 2ZGBH 1SOZA 1G3EA 2PUXB 1QQ4A 4UDWH 4M7GA 1J16A 1EAXA 1DUEA 1OWJA 1YPKH 2O8MA 4FU8A 4Y11E 3A7TA 2D8WA 3TH2H 5A2MH 1GHAG 3Q3YA 1OWHA 3UIRA 3AVZA 5EXNA 1YCPM 3F2FA 4Z1MD 2RG3A 4AGJA 4Z0KA 3FP7E 8LPRA 1XUIA 1HJAB 3BTGE 5FBIA 2FI3E 3I29A 1YGCH 3P92A 4ZUHA 2FWWA 1JMOH 3SUDA 3LONA 2F9OA 4ZROA 4O3TA 4HI3A 1TBZH 1W7GH 2FOGA 1PPBH 1MCVA 1EAUA 1HAVB 3N7EA 2BD2A 1D6WA 3LC5A 1P0SH 2C93B 2A32A 5LGOA 4K3JA 4FETA 1OHHD 4FU7A 1BJUA 1P2MA 1FMGA 3MFJA 1TRNA 1LTOA 2QC2A 1KMHB 1ANEA 3MHWU 2HPQH 1SGYE 3S7KB 1LKAA 1N1LA 1O3HA 1OWDA 1P57B 8KME2 3OTPA 1GBAA 1G37A 4X1NU 2IOTA 1O2LA 5E0GA 2BQ7B 2F4LA 3ZZDA 3K2UA 4B1TA 3PRDA 1QY6A 2CN0H 3RU4T 2XTTB 3M7UA 4ABDA 2QF3A 3NK8A 3SUEA 7GCHG 2ULLA 1QB1A 3UFAA 5EQSA 2JJ1D 1O5DH 5C17A 1HGTH 2XBXA 1FY3A 3VPKA 3PMBB 2ZP0H 3FP8E 3ZV8A 2K0QA 2GKVE 3FZDA 1FY5A 1JIRA 2OC8A 2CV3A 2PGBB 2ZDNA 4B2AA 2VVUA 2AERH 5DP9A 1YPJH 1O3GA 4ZHMU 1UTNA 2ANKH 1QL9A 3MH5A 1OP2A 2OQ5A 5GWZA 2NU0E 1FJSA 1YM0A 1O2HA 2AMPA 3M3VA 1RTFB 1SFIA 2ZPRA 1LHCH 1C2FA 2EI6A 1ESAA 4U30A 3RXDA 1ABIH 4A92A 4H6TA 1DE7H 1CHOG 1Z8GA 3EA7A 2OC1A 4OGYA 1GI5A 1GI6A 2F9VA 4GAWA 3PROA 5HM9A 4O03A 2WPLS 3GCTG 3RU4D 1OSSA 1EQ9A 1OKXA 5C67A 2XC4A 3RXCA 5T6DA 2M5TA 1DLEA 1BMMH 3DD2H 1DSTA 3SU4A 1AY6H 4TY6A 1GG6C 1GHWH 2LPRA 5AFYH 1SG8B 1GJ6A 1GVLA 1DS2E 3MU8A 5GPIB 4NIXA 1KSNA 1QRWA 1MKWK 3OY6U 1C5UA 1SGIB 1HFDA 4WMEA 5HM2A 3UNSA 3DSOA 3T27A 3BTHE 2BDIA 1F7ZA 1GI3A 1OS8A 1NFYA 1GWAA 3SV7A 3ZZ3A 1W0YH 4NA8A 1K1OA 1ELEE 4DT7B 2TGTA 3B23B 1O2SA 2BY7X 4ABFA 3QGJA 4Q4LA 2VGCB 1RIWC 2OC7A 3LGIA 4X2VA 3W95A 1CBWC 1F0UA 3U8RH 2BLVA 3D62A 2V3HH 1V2MT 1ANBA 3QZRA 5AF9H 2R2MB 3URCA 3ZZ5A 1TGNA 4B2BA 1BCUH 1VITH 1AUTC 2PSXA 2GMTC 1GG6B 1MBMA 1BTHH 1HAVA 1O5GH 3GOVB 2CHAB 4MNYA 3QO6A 1SBWA 3QK1A 1JOUB 4CRGA 3E0NB 1GL0E 3ELAH 2GMTB 2XW9A 1KDQA 3TJVA 4JK5A 2AGGX 3OEED 1D6RA 3Q3XA 4Y8XA 2ZTZA 4AG2A 5A09A 2AIQA 4BNRA 1AE8H 2PHBA 2G4TA 3LJJA 4VGCB 2L6OA 1IHTH 1Y8TA 3O8BA 1G3DA 5H4IB 3RXJA 1F5KU 1C2EA 4ABJA 5GIBA 1G3CA 2O8LA 1C5MD 5CHAB 1ESTA 1GI8B 4YT7H 4AFSA 5F53A 1TNIA 1O2ZA 1ESBA 4XOJA 1ID5H 2VB0A 2F83A 3GY7A 4DURA 1C1QA 1O2KA 2ZGCA 1DY8A 3HGNA 1UK3A 2ZCLP 4CR9A 1UK2A 1BBRH 5EQQA 2G5VA 1XUHA 4ZKOU 1SL3A 2IJOB 1VITG 1ZTKA 3SU5A 2QE7D 1UTLM 3RMOH 2SGFE 5DP7A 1PQ5A 4HFPB 1G3BA 1O3LA 3BN9A 5LPFA 5FPTA 4DGJA 1EP6A 1TRYA 3AW0A 1LHDH 3M5MA 4SGAE 2Z94A 4JZFH 3RXKA 3PV5A 1BTUA 3F9FA 3VB5A 4ABIA 2DE9A 1EPTC 3A7VA 1UVOA 2EI7A 2Q6GA 3ZYDA 1O33A 2BY5X 1W12U 3TK9A 2BVRH 1QR3E 1O38A 1V2OT 2HPPH 1AFEH 1KLIH 4WMFA 3TK5A 1D9IA 3A84A 4PROA 1NRQH 4LK4A 2ALVA 3SORA 2J4IA 1TFXA 2F91A 3NZIA 1S81A 4Q80A 1KXEA 3E0PB 1TAWA 3UQOA 2SGAA 4ZAEA 1AMHA 2KCOA 1YPGH 2JJ2D 1BDAA 3TJOA 1UO6A 4YOJA 1O2XA 3PWCA 1B0FA 4MNVA 3BTQE 1QRZA 1C2IA 1GBIA 1O3FA 1N8OB 1DWEH 1KXAA 2OBOA 5GNDA 4IGDA 1WSSH 4B71A 3M5LA 1GJ4H 1F0SA 1T8NA 4B73A 1A4WH 1WQVH 1WAYB 2HGTH 5B6OA 3PTNA 3QGNB 2ZU5A 4BAKB 4B75A 1OWKA 1WTGH 3F1SB 3EYDA 4RKJB 1BTXA 2SNVA 3RXLA 5L30H 1AO5A 4U32A 3BTME 4A5TS 4ISLA 4BAQB 1P02A 1SVPA 7LPRA 2BD8A 2BVXH 5JB9S 1VITF 1RS0A 4B74A 1A1RA 1EATA 1ZMJA 3O8DA 3SNBA 1JWTA 1NN6A 2BY6X 1GCTB 2WV5A 2W7UA 3T26A 1HPGA 1O3PB 2FODA 4M9FA 5C20A 4NA9H 1HAYB 2QCYA 1CU1A 3TNSA 1GVZA 3EAJA 4B6FA 2ZPSA 3P8OA 3BTKE 4UFGH 1AD8H