1N1LA

Crystal structure of hcv ns3 protease domain:ns4a peptide complex with covalently bound inhibitor (gw472467x)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
180
structure length
180
Chain Sequence
b'APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVTKAVDFIPVENLETTMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV NS3 SERINE PROTEASE
publication title Pyrrolidine-5,5-trans-lactams. 2. The use of X-ray Crystal Structure Data in the Optimisation of P3 and P4 Substituents
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 40
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n1lA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1n1lA01
1GBFA 1C1VH 2ZC9H 1KXFA 4I7YH 3MU5A 4Q7ZA 5JBAS 1A61H 3ZZ4A 1DY9A 2A5AA 3KNXA 1H9IE 1BITA 1CBWB 2BVRH 2XBXA 4X8SH 2F83A 1BHXB 2QV1A 4ISIH 1UTOA 2BHGA 1YCPH 3BG8A 2GX4A 5DPAA 1SG8B 4JK6A 1IQMA 4B6FA 2VWMA 1YPGH 4WY3A 2FOGA 2GKVE 1C1TA 5LPEA 4Z6AH 2VGCC 3M36A 1ANDA 3MWIU 4NWKA 1GVLA 1ELBA 1NO9H 3SNDA 4GSOA 1TPSA 1JMOH 2F9PA 1FJSA 1NPMA 5HGGA 1IQIA 4K1EA 1TOMH 2FX6A 1WYKA 2ZDKA 1O2MA 2B5TB 3KN2A 4MPVA 2PTNA 1NS3A 1S0RA 2A5KA 8KME2 4X2WA 3PM3A 3TGKE 1O5AB 2WINI 5HM9A 3GYMA 1K1JA 4MPUA 1C4Y2 3VXEH 2ILNA 2Z3CA 3F68H 7ESTE 1QA7A 3OTJE 3AW1A 1C2DA 2TGPZ 3CS0A 4D7FA 4CBNA 1O31A 2TBSA 3M61U 1A3BH 3V12A 1ELCA 2Y5HA 1VITG 3L33A 1GBAA 4D7GA 1QJ6B 2C8WB 2UWLA 3MHWU 1Q2WA 2OD3B 4LZ4B 2FOAA 2ZFTA 3BV9B 4DJZB 2JETB 3VEQB 1LQDB 3A81A 5AFYH 1NRRH 1O3AA 2G55A 4KTUA 3TJVA 3SU1A 1VGCB 1C1PA 5F8XA 3A8DA 1K22H 1L1NA 1V2PT 1AZ8A 3STJA 3A82A 1BTXA 1OXGA 1C1QA 5FX5A 3BG4C 4LZ1H 1LVOA 1S85A 3G01A 1PYTC 1QURH 2EA3A 1MTNC 1EZSC 4ABGA 4Y0YE 3VB5A 4ABHA 3SQEE 1C5ZB 1TNHA 1SMFE 2VWOA 1QTFA 3M3SA 3PROA 3HK3B 4X6OA 1DLEA 1O2YA 1MZAA 3FANA 2ZDVH 1BDAA 3TLOA 2IPHA 1CA8B 1DICA 1QBNA 3ZZAA 1ESBA 3KEEA 4BANB 2VIPA 1LHGH 2BY6X 4JZ1A 3TJOA 3RXPA 1GBBA 5L30H 1K9OE 1C1RA 1HUTH 3O8DA 5FPYA 2QIQA 5FHTA 1TBRH 3ODDA 1NRQH 2W7UA 3ZZBA 1O2JA 1BBRK 1Y8TA 3BIUH 4BAKB 1P04A 4ZHLU 3R0FA 2PSYA 1RS0A 1UVUH 5DG6A 2TGAA 1XM1A 1BTWA 2A7JA 4Y79A 3EAJA 1HCGA 1KLIH 3SU3A 1FUJA 2NU2E 1OYTH 5FXLA 2CF8H 1UCYK 1DOJA 4XBDA 4JZDH 5HM2A 1A0JA 4JYTA 3SU0A 2P3TB 4E7NA 3H7TA 4YLUA 2VH6A 1L4ZA 4BNRA 3Q76A 4ISLA 2Y82A 2CHAB 1SHYA 1GPZA 2GCHG 1BUIA 1T8MA 3W95A 3SBKA 5K7RA 4X6NA 2JETC 3SJOA 1UMAH 2ZGJA 2W5EA 1IAUA 2F9OA 1MD8A 3O8BA 3KQEA 2HNTE 2BDIA 3TPIZ 1ZMLA 4E05H 1UTMA 2BZ6H 3GY4A 4O97A 5CMXH 2Q1JA 2XC0A 5FBEA 1NM6A 4J2YB 1YKTA 4Y0ZE 2SGAA 1E0FD 4CBOA 1QBOA 3L6PA 1TRMA 5JPMH 4CRDA 1K1NA 2FLRH 4K3JA 1CHOF 1HIAA 3HKJB 1V2JT 1UVSH 3A7XA 2Z94A 1C5YB 3RXJA 5F6MA 5AVDA 3GY6A 1KXAA 3RMOH 1P2IA 3E90B 3E6PH 1TLDA 3F1SB 3UR9A 1PPCE 2BYAX 1E34B 1GI3A 1O3KA 1AO5A 3P17H 5CE1A 5C1UA 1V2ST 2O8WA 2H9HA 3GY8A 1XUFA 1BJUA 2ZFSA 1GJBB 3GDSA 3QDZB 2ZFRH 2FTLE 2CF9H 3C27B 4BTIB 3QWCH 4IBLH 4X0WU 5F8ZA 4MTBA 1LVBA 1MCTA 3H09A 1GHAG 1YPJH 3S9AA 2XW9A 3TK5A 1BIOA 2OLGA 4U30A 5E0HA 3TIUA 2VIQA 3A80A 2ZHWH 1O2OA 1G37A 2FLBH 1WV7H 2A31A 1SGPE 2SGPE 1C1SA 1BRBE 3OY6U 3U8OH 2FEQH 2AFQB 2DE9A 1O5CB 1P2QA 3RXIA 1IQHA 1BT7A 4WH8A 3A8BA 3GCNA 3M3VA 1G2LA 1XKBC 1MBQA 3RXCA 1D4PB 3QK1A 3VPKA 4NFEA 2W3IA 3GISB 3OU0A 2BD7A 1TMBH 2CHAC 3ZV9A 1V2TT 1ZSKA 1MTVA 4Y7BA 1Y5AT 3ZZDA 1ANBA 1SB1H 1W13U 4WVPE 1K1IA 2TGTA 3UPEA 5H4IB 4O9VA 2ZI2H 1P2KA 4K8BA 3SV2H 4B76A 1G9IE 2DUCA 1GBDA 2QGRA 2Z9LA 1Z71A 1HAOH 3RM2H 2V3OH 1CO7E 1EOLA 2A0QB 1GI4A 3GCTF 4FUJA 2BDAA 1HJ8A 1Z8RA 4CRCA 1F92A 3EDXB 2ODPA 1D6RA 1IQGA 1JXPA 4F4OC 3FAOA 1H9HE 2Q6GA 1Y3XA 1V2UT 5JBTA 1AE8H 1GL1A 3OX7U 1GHXH 3A85A 3VFEA 1MKWH 5A2MH 4J1YA 4IC6A 3U98H 1WAYB 3QTOH 1C1MA 5DO4H 1B7XB 4UD9H 1TGNA 1OWDA 3K65B 2STAE 3RXDA 4AN7A 1GI6A 1S84A 3AAVA 1AWHB 1TALA 2ANMH 1QR3E 3Q3XA 1D3DB 1EAWA 3RXRA 5L6NH 3D62A 1LPGB 2A7HA 2V3HH 2VIOA 4BAHB 1GJ9B 2OC1A 4DVAU 2VIDA 1C5MD 1RGQA 1BTHH 3SU2A 1OP0A 2PV9B 4Q2KA 1C9TA 1LTOA 3T29A 2XCNA 4UFEH 1O2LA 1O2QA 1EJAA 2ZU3A 1PPZA 1Q31A 5DP4A 1DWBH 2J4IA 1O3LA 3ATKA 1W14U 4Y11E 1QNJA 2VWLA 2Y81A 3P70B 1A5HA 1SL3A 3LDXH 1GMCG 3BSQA 1HJAB 3LONA 4M7GA 1L2EA 3RC5A 1SHHB 1KDQA 1Y5BT 1GBHA 2PGBB 1C2IA 1FZZA 3FP7E 2A2QH 1T8NA 3AW0A 5A0CA 5C1YA 3Q77A 1SGEE 2FODA 1GI9B 3RU4E 1CA0C 2FOBA 3U69H 1O2KA 1OWIA 1W11U 1P11E 4DOQA 3EYDA 3MNCA 2NU3E 1TQ0B 3K6ZA 1DUAA 1O2IA 4AFZA 3MH5A 4D9RA 4NIVA 2R0KA 3V13A 5FCKA 4HZHA 3W94A 4SGBE 2THFB 3GCOA 4TWYA 2FOEA 1C2LA 3D49H 4AG1A 2WHXA 1A46H 1LCYA 1VJ9U 3RMLH 3SJ8A 4X1SU 3SGBE 1YF4A 1CE5A 1L1GA 1NZQH 2FDAA 2QN5T 4A92A 4R0IA 2PKAA 5JB8S 1NC6A 1JWTA 1CGIE 1TGSZ 4TPIZ 1EX3A 1GHWH 1GDNA 4BAQB 2BVSH 1MUEB 2ZHDA 2OXSA 3MMGA 1UK4A 1PPEE 1Q3XA 1ZJDA 3GDUA 4A5TS 2HOBA 5J4QA 3SU5A 2VWNA 3SU6A 2FIRH 1O3IA 1AWFH 3DT0H 1O3BA 2GV6A 2SGFE 1DDJA 2V0BA 3PLBA 2M5TA 4K5ZA 4M9FA 3RXMA 1NESE 1P03A 1O2NA 1EJNA 5C20A 3MO6A 3MNSA 5GWZA 1SGFA 4BOHA 2PTCE 1AFEH 3F9EA 1QRXA 2HLCA 1IQFA 1GGDB 1GI8B 1C4U2 1WTGH 1ANCA 1F5LA 1MCVA 2A4OA 3RUOA 1IHTH 1AY6H 1GWAA 2ZQ2A 1AFQB 1YPLH 2FTMA 2P95A 3LGWA 3OY5U 1V2QT 2Y5FA 7KMEH 1TX6A 1O30A 1UTQA 3PYHA 4ZUHA 1GI7B 1FLEE 3B8JA 4CR9A 2PUQH 1O2HA 1JIMA 2OBOA 2OQ5A 2P16A 3RXUA 2HNTF 1O2GH 2RG3A 4B1TA 1TX8A 1AD8H 1YPMH 3A88A 2NU1E 3SV8A 1AE5A 2HPQH 2QAAA 3SV9A 1HDTH 3UR6A 1X7AC 4MPWA 1EZUC 5TJXA 3P95A 1O3DA 3GY2A 3O8CA 1W0YH 2BD9A 2QC2A 1S0QA 2YOLA 3RXLA 1EKBB 4NSYA 1JRSA 1PJPA 4OM9A 3DD2H 1GG6B 4XE4A 4X2YA 3V3MA 1XVOA 1G2MA 2NWNA 1O2UA 3MNXA 2GT8A 1MBMA 1HAPH 4AFQA 2TGDA 5A8YA 3KL6A 5E2PA 5FX6A 5A8XA 1MD7A 9ESTA 1ZSLA 2ZEBA 1DS2E 1O3EA 1YPEH 3LH3A 5I25A 1UK3A 2BMGB 1XUGA 4FUFA 3NCLA 2WPMS 1O3GA 1FAXA 1CHGA 2YNAA 2D26C 1AN1E 2B9LA 2FOFA 1MTWA 4AYYB 4TPYA 2B7DH 1G30B 2FOHA 1P9SA 2GCTB 1XVMA 2QA9E 2ZF0H 1GGDC 4GLYA 4U01A 1KLJH 3U8RH 1T8OA 1SGTA 1TPPA 3F9HA 1UVPA 4ZKNU 3EE0B 1XUJA 1CT2E 1YYY1 1SVPA 3GCHC 1DWEH 7LPRA 3T27A 2NU0E 1DXWA 3PLKA 1BMLA 1Z8GA 3M7TA 5AFZH 1NT1A 4OGXA 1HAZB 4GAWA 4OS5A 3O8RA 1MU8B 2ZU1A 1T32A 1W7GH 1KXEA 5EODA 1ELFA 1C2EA 2WYJA 3BTFE 1GDQA 1OP8A 4KELA 5E2OA 3SZNA 2ALPA 1V6DA 1O2VA 2ASUB 2XCFA 1CHOG 1C5OH 3UFAA 1AIXH 1ZPBA 3RU4D 2QXJA 3BG4B 1Y3VA 1G3DA 2CXVA 5DP8A 1TFXA 4BAMB 1MTNB 4CH2B 3TGIE 2CN0H 1WXRA 1F0TA 3ESTA 1C5LH 5DP6A 2UUYA 3RM0H 1SBWA 2A2XH 2UWPA 7GCHF 5J4SA 1C5SA 3TK9A 1O2ZA 1EZQA 2PUXB 5E0GA 1Y59T 3H5CB 2LNCA 4B73A 1GG6C 1EPTC 1GJ4H 4HGCA 2BY5X 2VINA 1O33A 3HATH 1PQ5A 3SN8A 1GHBF 1TRNA 1FMGA 4H6SB 3RXEA 2FS9A 1GI0A 3GY7A 1KLTA 1SQOA 2RCEA 2ZTYA 1THRH 2W3KA 1CVWH 1O3JA 1U6QA 5EQQA 4NIXA 1K1PA 1ZRBA 1GBEA 1O36A 4FVBA 2VB0A 3PWBA 2BM2A 4PROA 2GCTC 2HGTH 1C5NH 2FP7B 1SGDE 2GTBA 1O35A 3V7TA 1WCZA 1XX9A 2I6SA 1MKXK 1GCTC 2Y80A 1ARBA 5DP5A 4RKOB 5C5OA 2AMDA 2BY9X 2D1JA 1QFKH 4K2YA 1O34A 2ANYA 3UQVA 5C2ZA 3IG6B 3FZDA 2BZAA 3RXVA 1CGHA 3GCTG 1SLVB 4A7IB 1V2RT 1NFXA 4JZEH 2C8ZB 1J16A 3RXQA 2H5DA 2JH5D 1EZXC 1AKSA 2PW8H 2KAIA 1AHTH 2I6QA 3Q3KA 1GI1A 2FX4A 5E8EH 1C2HA 5AF9H 1HAIH 3RXOA 3PB1E 2J2UA 5C1XA 3AAUA 2ZWLH 4IC5A 2UUJB 1D3TB 1MMJN 1BBRH 4XOJA 1RD3B 5C3NA 4MLFB 3M7QA 4Y76A 4LXBH 2C93B 1Z6EA 2IN2A 2P8OC 3S69A 4YESB 2TRMA 4KGAA 2F9BH 4ZMAH 2ZCKP 3LJJA 1UCYH 1P0SH 5TCAA 1F5RA 1V2OT 1O5FH 3CP7A 2F9VA 1SFQB 2SNVA 2ZHEH 1F0UA 3MYWA 2ZECA 1TNJA 4IS5A 3ZVGA 5EOKA 1GJ7B 2C90B 3UY9A 5CHAB 2ZTZA 3RXFA 2IOTA 3GDVA 4YOIA 2R9PA 1NFWA 3HGPA 1CSOE 1HXEH 3SV6A 1QB9A 5C5NA 1P2MA 1QJ1B 2ZG0H 3RMMH 2Q6DA 1VZQH 2FWWA 2H6MA 3P8OA 4IMZA 1UVOA 2A45B 1YM0A 3JZ2B 3I77A 1GMHF 1VJAU 4NCYA 4NIWA 2JKHA 1SLUB 1O32A 1RFNA 2ZGCA 1LDTT 2HNTC 1O37A 1YPKH 4H42U 2ZIQH 3H7OA 3VB7A 2Q6FA 1T4UH 1QL7A 1TQ7B 2G4UA 5SGAE 4TYDA 3PMHB 3A7WA 4Y6DA 1J15A 1YLDA 3SORA 1FIWA 1C2FA 3A7TA 5GPIB 1GBJA 1QBVH 6GCHF 2FM2A 2CMYA 4TWWA 1TWXB 2XBYA 1UTNA 1LKAA 1V2WT 4GCHF 2ZFFH 1XXDA 1LHCH 1GHYH 2Z7FE 1KSNA 2H2ZA 3A7VA 2XBWA 1GJAB 2WV4A 1C1WH 5DP3A 3S9BA 2ULLA 5FPTA 3RXHA 3SUGA 3MH4A 1K1MA 3LGVA 2ZNKH 1TNGA 2DE8A 3A7ZA 3U1IB 1ZRKA 2AGEX 1OSSA 2WV9A 2W7SA 1O39A 1QB6A 4OS7A 2CJIA 4ZXXH 4MNWA 4I33A 5HYOA 4Y71A 1GBMA 1KXDA 1Z6JH 3P6ZB 1OYQA 1SLWB 4OS1A 2EI6A 1BZXE 2GD4B 4IN1A 5JDUB 2ZHQH 1AVGH 2ALVA 4WH6A 1MH0A 3EA9A 2FPZA 1KIGH 3TH4H 1LHFH 1P3CA 2WV5A 1N6XA 5CHAC 1NN6A 1EB2A 3VGCB 2LPRA 3RDZA 2CV3A 1TONA 2RA0A 2Z3EA 1SPJA 1HLTH 2C4FH 1D9IA 3SHAH 1DFPA 1S82A 2ANWA 3EQ0H 1DY8A 2A7CA 2XWAA 2BB4A 1DSUA 4IW4E 3SGQE 1YPHE 4DT7B 1WBGB 5TCCA 1LPKB 4I31A 3RMNH 3URDA 1GI5A 3PMAB 3K2UA 2OINA 2WPKS 1C5QA 5DP9A 3QGJA 1O3NA 2JH0D 4K1SA 5F03A 4A1TA 1GHVH 1K28D 4BTTB 1FPCH 1KTTB 3QN7A 3AK5A 1FY3A 5EU8A 3SUEA 3TNTA 1CQQA 2BDYA 1CA0B 1SOZA 1ANEA 1UTLM 5ETXA 4MNVA 1RTFB 1N6YA 3LGYA 1GBTA 2F9UA 1D3PB 4WWYA 3M5OA 4LK4A 4X1PU 3DFJA 2QF0A 1ACBE 1WTHD 2J9NA 1P10A 3BTQE 1W7XH 4MVNA 2XYAA 1GBIA 1SGNE 1TX7A 1OPHB 4Y8XA 2SGDE 1DWDH 4CH8B 1ZTKA 2ZDMA 3LGUA 4XFQA 1GJ5H 3F9GA 4OS6A 2ZP0H 2HPPH 1Z8IB 1W3CA 4FVDA 3UNQA 1SLXB 4D9QA 6CHAB 2AH4X 1O3PB 4ZKOU 1O2XA 3ZYDA 3N7OA 1W8BH 2O9QA 2PLXA 4IN2A 2ZDAH 2ESTE 1BQYA 1HAVB 4GHTA 2RDLA 1IQKA 2ZZUH 1MAXA 1ZHMA 3T28A 3RLWH 2R0LA 4DCDA 1KXBA 4ZHAA 3SQHE 1A1RA 3UIRA 4YTAA 2P3FH 2PSXA 1DPOA 3A8AA 1FY4A 3VGCC 4X8TH 1MZDA 1ZR0A 3FP6E 2J34A 4AFSA 1WQVH 2BX4A 1BB0B 3UWJH 1SGYE 3HK6B 2TPIZ 5EQSA 2H1UA 4RSPA 1QGFA 1OWHA 3LGIA 1O3FA 3PTNA 3M5MA 1EAXA 4YOGA 1PYTD 2HVXA 3A83A 4XBBA 4AGJA 1TAWA 2GT7A 1THPB 3VB4A 4O03A 3R3GB 1Z1JA 1EP6A 3P92A 2XBVA 4YT7H 2PR3A 1ZHRA 1VCWA 4WXIA 2FZZA 2ZCLP 4I32A 5A8ZA 2FMJA 4UDWH 1LPZB 1SR5C 2D8WA 2WYGA 1KDQB 2GZ8A 4WJG2 1P8VC 7GCHG 1G3EA 3NK8A 2Z9KA 3B23B 1ZHPA 1S81A 1A7SA 3F6UH 1IQNA 4JMYA 1QJ7B 3CENA 2AERH 1IQEA 1GHBG 3NWUA 4NA9H 2XWBI 1YC0A 3SYJA 4WMDA 5ESTE 2J94A 3SJIA 1HGTH 4XDEA 3GY5A 1LO6A 1DXPA 4NZLA 4ZROA 3RP2A 2PFEA 1NFUA 4ABDA 2QF3A 3PWCA 6CHAC 2XTTB 3E8LA 3SI3H 1GJ8B 1PPHE 3T25A 5HXFA 1MU6B 3D23A 1BTPA 1NFYA 1BOQA 4Q7YA 4AOQA 2G52A 1GJCB 4X1RU 4UEHH 1TOCB 1A3EH 1N8OB 3SNEA 4AYVB 1HJ9A 1GL0E 2BD8A 2FYQA 1NU7B 3SZEA 2F91A 2QYIA 4LOYH 2WPIS 1BHXF 3E1XB 1UVTH 2OP9A 1S6FA 1PQAA 4MNXA 1V2MT 1A4WH 1Y3UA 3HKIB 3EGKH 4YLQH 4I8HA 2UUKB 3GCHB 4K60A 2P3UB 2GMTB 3ZZ8A 1O3MA 1PFXC 5K0HA 1ZGVA 2ZU5A 1UHBB 5GNDA 1RRKA 1TPAE 3PO1B 4FXGH 4CHAC 4GVUA 3KCGH 8GCHF 1GBKA 2BLOA 2WZQA 2BTCE 3TITA 2O8TA 1F0RA 3RC6A 4DY7B 1SGQE 2FXRA 1TGTA 4WMFA 4K8YA 1C2KA 1SI5H 5BRRE 3TH3H 4JK5A 1N1LA 3TGJE 4YO9A 2R2MB 1DT2A 3SNCA 1C1NA 3UOUA 5JB9S 6ESTA 3KQDA 2G51A 4A1VA 1DLKB 1L4DA 4FUBA 3PMJA 5JBBS 3GY3A 1TNIA 2FOCA 4X2VA 1A0HB 4THNH 2XNIA 1QIXB 3RU4T 2PKSB 1ZTJA 3DFLA 1EPTB 3LGTA 2QXHA 3ZYEA 2BVXH 4Y10E 2A4QA 3SW2B 4ABIA 4JYUH 4B75A 1CGJE 4AB8A 1DWCH 1BRUP 3ODFA 1E35B 4Z0KA 2HRVA 1C5TA 1P12E 2Y5GA 4X8UH 2BOKA 4CR5A 1GMHG 3MU4A 1ABJH 1L0ZA 5EPYA 3S7KB 2C3SA 4NGAH 4ABBA 4YZUA 3FZZA 1P57B 3A87A 1N8OC 4OGYA 1TNLA 5LGOA 1WUNH 2ZGBH 2RA3A 3SUDA 3ATIA 2SFAA 3KGPA 2F9NA 3S0NA 2ZDNA 1UTPA 1W2KH 3ZVAA 3BIVH 4X6MA 2AGIX 1C5XB 5DGJA 6GCHG 2ZPSA 4ZH8A 2EEKA 4AZ2B 3BTHE 5LPFA 3CS7A 3ATLA 4D76A 4ZKRU 3SU4A 1FAKH 1GCTB 4GCHG 5ESBA 3SHCH 2GMTC 1EQ9A 1C2JA 4GHQA 2PWXA 3ITIA 2AYWA 1A5GH 2PHBA 3QUMP 3PO1C 1ETTH 4RKJB 1O3OA 2VBCA 3P8GA 1S5SA 2SGQE 3MH7A 1O5DH 5L2YH 1SOTA 4RN6A 2Z9IA 2K1QA 2WPJS 2G5VA 4Y7AA 2BDCA 2XC4A 1B5GH 2H9TH 2BDGA 3QZRA 4I8KA 1LMWB 1VR1H 4GUXA 1UTKA 2VIVA 3UNSA 2FI5E 2BY8X 8ESTE 1RTLA 3RXSA 1NRSH 1EOJA 1FONA 1HAXB 4MQAA 2FS8A 3KIDU 8LPRA 1C2GA 4X1NU 1V2VT 2P8OB 2ZDLA 4NZQA 4AORA 3E16B 3VXFH 1FDPA 1YLCA 3LOXA 2PKSC 3QO6A 4UFFH 3FVFB 3ZVDA 2A4GA 4ZXYH 1BTYA 3BTGE 2FO9A 1OKXA 1MKXH 1O2PA 3MFJA 5F8TA 1THSH 1TA2A 1DANH 5T1VA 4X8VH 3URCA 2VH0A 3BTWE 2BD2A 3VB6A 5EXMA 2A4RA 2FI3E 1MTSA 5I46H 1HAHH 2OC8A 3NPSA 2JH6D 3QTVH 2WUCA 1O2RA 1BRCE 3A86A 1JOUB 1DSTA 4BAOB 2WUBA 5JBCS 2ZKSA 1C1UH 1LHEH 5GJ4B 3GICB 1FPHH 1ELDE 1UTJA 2G5NA 3EA8A 2GP9B 3DUXH 1SGFG 1K2I1 4BTUB 3QLPH 4NFFA 5DP7A 4ABFA 3NXPA 4X6PA 3UQOA 2VVVA 1XKAC 1DVAH 1TA6A 1YCPK 3NKKA 1O5EH 3UNRA 5EQRA 3ZVEA 2J38A 1G32B 1NROH 3LT3A 5FPSA 2HWLB 4E06H 3A89A 1BRAA 3MTYA 3SJ9A 1SGIB 2ZFPH 3MU1A 4F49A 1ORFA 1ETRH 2BQWB 1QQUA 1ETSH 1AKSB 1CT0E 4ABEA 1HYLA 2C8XB 2KAIB 5GCHF 4KTCA 1ID5H 4JYVH 2AMQA 1G36A 1SQAA 9LPRA 2HALA 3E3TA 5ABWA 1ZYOA 1FV9A 3BF6H 2VVUA 2ODYB 1HAYB 1Z8JB 4VGCC 3IITA 3Q3YA 2F4LA 4DIHH 4FUIA 1LQEA 2BLVA 1GBLA 2G4TA 1ARCA 5T6DA 1CBWC 1GJDB 4FUEA 4CRGA 3TK6A 4I8LA 1ELAA 1F0SA 5DJ7A 1FQ3A 2O8LA 4UE7H 3PLPA 1ZZZA 1QA0A 2EC9H 4FU7A 4AFUA 1FXYA 1G3CA 1DUEA 1PQ8A 5BPEA 2P59A 4OS2A 5B6OA 2OBQA 4B2CA 2GDDA 4CREA 1TPOA 5EW2H 2AS9A 4X1QU 1TB6H 1QB1A 1BMNH 1LKBA 2ZPRA 4E7RG 1VITH 3ZV8A 1D6WA 3LU9B 3GYLB 1Z1IA 2F3CE 1MQ5A 1XXFA 2QXIA 4YM9A 2BD4A 5EGMA 1MAYA 1LVYA 1GMDF 3U9AH 1QRZA 3UREA 4CRAA 5JYIA 4NIYA 1O0DH 1F5KU 1H8DH 2BOHB 3HPTB 4AG2A 3ATMA 1OX1A 1EP5A 4R8TB 1YP9A 4DGJA 1A2CH 1FY1A 4XSKU 2Z9GA 1J17T 1AI8H 4NSVA 3BTDE 4Y8YA 1AUJA 2A32A 1P2OA 4QT8C 1XUHA 3PV5A 1SFIA 1HFDA 2OTVA 5T6GA 3D65E 1O3CA 4DW2U 2WPLS 2BLQA 4NA7A 3OTPA 1B0FA 3QZQA 5L2ZH 3T62A 1WSSH 2H5CA 3T2NA 3Q00A 3T5FH 1XMNB 1VGCC 5DK1A 4DURA 4JZIA 3AASA 1ZPCA 1HAGE 1HIAB 3STIA 3RC4A 3PV2A 2VVCA 2ZHFH 4K1TA 1O2WA 5G4BA 1IQJA 1EAUA 2O8MA 1DM4B 1YPHC 1V2LT 1C5PA 4O3TA 1CU1A 1EUFA 3S7HB 2VU8E 4U2WA 1PQ7A 4H6TA 2J95A 1H8IH 1ZOMA 2H9EH 2VIWA 5HMAA 2Z9JA 2O8UA 2ANKH 2BLWA 4D8NA 2BY7X 3BEUA 1JBUH 1SSXA 3KQBA 3UUZA 2OC7A 3VB3A 1TMUH 2ZU4A 3TU7H 1O38A 4ABJA 1BMAA 3ZVBA 5IDKA 1ELGA 1IOEA 4Q7XA 1YCPM 1C5VA 4HTCH 3S9CA 1QQ4A 2IJOB 8GCHG 2J92A 4CRBA 4IMQA 4X2XA 1OWKA 1ZTLA 5B6LA 2D2DA 1LVMA 1FY8E 1J9CH 1WOFA 4JCNA 1VCQA 1YGCH 3M35A 1FN6A 1GI2A 1Y3YA 2ZGHA 3SOSA 1C9PA 1GVZA 1BTZA 1K1LA 1TGBA 1OWEA 3MNBA 2AEIH 1RXPA 1GVKB 4B6EA 1DX5M 3MO3A 1ELTA 3NZIA 3MH6A 4I8GA 1TNKA 3MU0A 2W26A 1E36B 1P2NA 3SO3A 3ELAH 3LC3A 3A8CA 1FNIA 2Z6BD 1EATA 4CRFA 1TMTH 2BD5A 3BN9A 3BTEE 4GPGA 2FYRA 3A7YA 1Y3WA 2Y6TA 2AGGX 3E0PB 1ZJKA 4WF8A 3E0NB 4U32A 2XRCA 1EB1H 4DG4A 1UK2A 1VITF 3BTTE 1C5RA 2GDEH 1KXCA 1WU1A 3SNBA 3M7UA 2A5IA 1P02A 1JRTA 5C67A 1V3XA 1OS8A 2G81E 1O2TA 2GZ9A 2IJD1 1W0ZU 2NU4E 3SUFA 2BDBA 3QGNB 3BEIB 2Z3DA 1IHSH 1ZGIA 1T31A 4MPXA 1P01A 1AUTC 1JIRA 2QXGA 4JZFH 1P05A 1GJ6A 1BJVA 1VCPA 2BD3A 5EXNA 3KHVA 3IWMA 2OC0A 2BX3A 2V35A 4Y8ZA 1E38B 2B0FA 4TY6A 1ELEE 1S83A 4FUDA 1SC8U 4FUCA 5A0AE 1K1OA 1TBQH 3GOVB 1HAVA 1RIWB 2R2WU 3P8NA 3EA7A 4XBCA 1UJ1A 5PTPA 4MNYA 1P3EA 1ZMNA 4A1XA 1GBCA 3ZZ9A 2WPHS 4INLA 5IYTA 1AU8A 2XXLA 1HPGA 1O3HA 4MDSA 3DHKH 3ENSB 5FAHA 3UWIA 4TY7A 3U1JB 1E37B 4CHAB 3SJKA 2OK5A 2FESH 2GVFA 1FI8A 3LC5A 1HNEE 1TRYA 2ZQ1A 4HI3A 5FCRA 1MKWK 4FU8A 2CGAA 2SNWA 1O5BB 4ABAA 1EJMA 2ZCHP 3FP8E 1QHRB 2ZU2A 3RXBA 3K6YA 1C5WB 4YT6H 1A0LA 4INKA 4B2BA 4ESTE 4UONA 3SV7A 1AGJA 1KY9A 1EXFA 2ZGXH 4NA8A 4AX9H 2B8OH 1V2KT 2A1DB 3LH1A 1ESTA 2OUAA 2ZA5A 1O2SA 2AMPA 4K69A 1UO6A 1ZSJA 3ZVFA 3MU8A 1ESAA 1Z7KA 1T4VH 1AZZA 3ZVCA 2PKAB 3B9FH 2GCHF 1GDUA 4ZKSU 1QY6A 2VJ1A 1RTKA 5GDSH 1XUIA 1SGCA 3RXTA 3RXAA 5T3HA 1ZLRA 2ZO3H 1F2SE 3RXKA 1H1BA 3ZZCA 1P2JA 3E91A 4Q80A 3L3TA 1TYNA 1T8LA 1P06A 3TVJB 4ZHMU 3MI4A 1RIWC 3OSYA 4H4FA 3ZZ3A 3SGAE 1J14A 3I29A 4INHA 1NTPA 2ZFQH 3PV4A 5DKMA 1BA8B 5A09A 1G3BA 2OCVB 1QCPA 4WMEA 4KP0A 1P9UA 3K9XB 1AQ7A 3NUMA 1TGCA 1PPGE 2PGQB 1O5GH 1F7ZA 3PTBA 4HFPB 3AVZA 3TNSA 5GCHG 1SQTA 3ZZ7A 3UTUH 4NWLA 1B0EA 1EAIA 3M5LA 2STBE 2ZTXA 3BEFB 1J8AA 1PPBH 4FUHA 1UHBA 1GHZA 1GHAF 3UOPA 1HJAC 2YNBA 2R3UA 1AB9B 3ZZ6A 1MQ6A 3M37A 3C1KA 2SGEE 1KYNA 4BXWA 2G8TA 4A6LA 4B2AA 1H9LB 1HB0B 4ISOA 2BQ6B 1FN8A 4UFGH 5EG4A 1C4V2 1P09A 4KTSA 3U8TH 1TIOA 1AVWA 1HBTH 3KF2A 2G00A 1C1OA 2UUFB 1D3QB 3DA9B 3ATWA 2EI7A 3M3TA 6LPRA 3T26A 4BXSA 2UWOA 1K21H 1HXFH 1FY5A 3MO9A 5EXLA 4B71A 1EPTA 4ISHH 1OWJA 4I8JA 2ZPQA 2BDHA 4MG3A 1PPFE 4ZAEA 1FIZA 1WQSA 4NG9H 1BTUA 2VGCB 2Y7XA 1XUKA 5GXPA 1ZMJA 1BCUH 3LJOA 5LPRA 4RI0A 3M5NA 4AGKA 4O3UA 2P94A 3A84A 2BQ7B 3FFGA 3LIWA 1OOKB 2BXTH 4YOJA 3PMBB 1GMDG 1NY22 2AIQA 5E0JA 3BTKE 1DE7H 1HV7A 4ISNA 2V6NA 1M9UA 5EPNA 5GIBA 2ODQA 1H4WA 3RXGA 1L1JA 1QL9A 1DITH 1W10U 1NRPH 1INCA 1MTUA 1C2MA 3HGNA 5A0BA 1SGRE 4KKDA 1TABE 3MOCA 1ZPZA 5EW1H 3OYPA 4SGAE 3QX5H 1KTSB 3SNAA 1BBRE 1NRNH 3ZZ5A 1QRWA 5LH8A 1AVXA 2TIOA 1T7CA 1OP2A 3KQCA 2AIPA 1TE0A 3TJUA 2QCYA 1V2NT 2GZ7A 2VNTA 3F9FA 3SI4H 3JZ1B 3V0XA 3WY8A 4FUGA 1AFQC 3P8FA 5AHGH 1GCDA 2R3YA 1W12U 1S6HA 1TBZH 5T6FA 1A5IA 1UCYE 1QL8A 2GGVB 2QY0B 2Y7ZA 3BTME 1AB9C 4AB9A 1AMHA 2FOMB 1C5UA 4IGDA 1BMMH 1EASA 4OS4A 1YBWA 2GV7A 4ASHA 2XC5A 2P93A 2EI8A 3I78A 2BXUH 1ABIH 1NU9A 1GMCF 4WXVA 3RLYH 1CT4E 1RJXB 4UFDH 3TJNA 2C8YB 3LPRA 1IQLA 4VGCB 1HRTH 3LKWA 5FBIA 3TH2H 1ELVA 4B74A 4DIIH 1Y5UT 1LHDH 2FI4E 4FU9A 2OQUA
chains in the Genus database with same CATH superfamily
1GBFA 1C1VH 2ZC9H 1KXFA 4I7YH 3MU5A 4Q7ZA 5JBAS 1A61H 3ZZ4A 1DY9A 2A5AA 3KNXA 1H9IE 1BITA 1CBWB 2BVRH 2XBXA 4X8SH 2F83A 1BHXB 2QV1A 4ISIH 1UTOA 2BHGA 1YCPH 3BG8A 2GX4A 5DPAA 1SG8B 4JK6A 1IQMA 1SKYE 4B6FA 2VWMA 1YPGH 4WY3A 4YXWD 2FOGA 2GKVE 1C1TA 5LPEA 4Z6AH 2VGCC 3M36A 1ANDA 3MWIU 4NWKA 1GVLA 1ELBA 1NO9H 3SNDA 4GSOA 1TPSA 1JMOH 2F9PA 1FJSA 1NPMA 5HGGA 1IQIA 4K1EA 1TOMH 2FX6A 1WYKA 2ZDKA 1O2MA 2B5TB 3KN2A 4MPVA 2PTNA 2KM0A 1NS3A 2J98B 2QF4A 1S0RA 2A5KA 8KME2 4X2WA 3PM3A 3TGKE 1O5AB 2WINI 3F0OA 5HM9A 3GYMA 1K1JA 4MPUA 1C4Y2 3VXEH 2ILNA 2Z3CA 3F68H 7ESTE 1QA7A 3OTJE 3AW1A 1C2DA 2TGPZ 3CS0A 4D7FA 4CBNA 1O31A 2TBSA 3M61U 1A3BH 3V12A 1ELCA 2Y5HA 1VITG 3L33A 1GBAA 4D7GA 1QJ6B 2C8WB 4F55A 2UWLA 3MHWU 1Q2WA 2OD3B 4FETA 4LZ4B 2FOAA 2ZFTA 3BV9B 4DJZB 2JETB 3VEQB 1LQDB 3A81A 5AFYH 1NRRH 1O3AA 2G55A 4KTUA 3TJVA 3SU1A 1VGCB 1C1PA 5F8XA 3A8DA 1K22H 1L1NA 1V2PT 1AZ8A 3STJA 3A82A 2RFKC 1BTXA 1OXGA 1C1QA 5FX5A 3BG4C 4LZ1H 1LVOA 1S85A 3G01A 3PRBA 1PYTC 1QURH 2EA3A 1MTNC 1EZSC 4ABGA 4Y0YE 3VB5A 4ABHA 3SQEE 1C5ZB 1TNHA 1SMFE 2VWOA 1QTFA 3M3SA 3PROA 2KCPA 3HK3B 4X6OA 1DLEA 1O2YA 1MZAA 3FANA 2ZDVH 1BDAA 3TLOA 2IPHA 1CA8B 1DICA 1QBNA 3ZZAA 1ESBA 3KEEA 4BANB 2VIPA 1LHGH 2BY6X 4JZ1A 3TJOA 3RXPA 1GBBA 5L30H 1K9OE 1C1RA 1HUTH 3O8DA 5FPYA 2QIQA 5CHBA 5FHTA 1TBRH 3ODDA 1NRQH 2W7UA 3ZZBA 1O2JA 1BBRK 1Y8TA 3BIUH 4BAKB 1P04A 4ZHLU 3R0FA 2PSYA 1RS0A 1UVUH 5DG6A 2TGAA 1XM1A 1BTWA 2A7JA 3N99A 4Y79A 3EAJA 1HCGA 1KLIH 3SU3A 1FUJA 2NU2E 1OYTH 5FXLA 2CF8H 1UCYK 1DOJA 4XBDA 4JZDH 5HM2A 5F53A 1A0JA 4JYTA 3SU0A 2P3TB 4E7NA 3H7TA 4YLUA 2VH6A 1L4ZA 4BNRA 3Q76A 4ISLA 2Y82A 2CHAB 5EJLA 1SHYA 1GPZA 4ACAA 2GCHG 1BUIA 1T8MA 3KYFA 3W95A 3SBKA 5K7RA 4X6NA 2JETC 3SJOA 1UMAH 2ZGJA 2W5EA 1IAUA 2F9OA 2L74A 1MD8A 3O8BA 3KQEA 2HNTE 2BDIA 3TPIZ 1ZMLA 4E05H 1UTMA 2HLDD 2BZ6H 3GY4A 4O97A 5CMXH 2Q1JA 4I86A 2XC0A 5FBEA 1NM6A 4J2YB 1YKTA 4Y0ZE 2SGAA 1E0FD 4CBOA 1QBOA 3L6PA 1TRMA 5JPMH 4CRDA 1K1NA 2FLRH 4K3JA 1CHOF 1HIAA 1NBME 3HKJB 1V2JT 1UVSH 3A7XA 2Z94A 1C5YB 3RXJA 5F6MA 5AVDA 3GY6A 1KXAA 3RMOH 1P2IA 3E90B 3E6PH 1TLDA 3F1SB 3UR9A 1PPCE 2BYAX 1E34B 1GI3A 1O3KA 1AO5A 3P17H 5CE1A 3F2FA 5C1UA 1V2ST 2O8WA 2H9HA 3GY8A 1XUFA 1BJUA 2ZFSA 1GJBB 3GDSA 3QDZB 2ZFRH 2FTLE 2CF9H 3C27B 4BTIB 3QWCH 4IBLH 1E79D 4X0WU 5F8ZA 4MTBA 1LVBA 1MCTA 3H09A 1GHAG 1YPJH 3S9AA 2XW9A 3TK5A 1BIOA 2OLGA 4U30A 5E0HA 3TIUA 2VIQA 3A80A 2ZHWH 1O2OA 1G37A 2FLBH 1WV7H 2A31A 1SGPE 2SGPE 1C1SA 1BRBE 3OY6U 3U8OH 2FEQH 2AFQB 2DE9A 1O5CB 1P2QA 3KYGA 1IQHA 3RXIA 3MQKC 1BT7A 4WH8A 3A8BA 3GCNA 3M3VA 1G2LA 1XKBC 1MBQA 3RXCA 1D4PB 3QK1A 5C0TA 3VPKA 4NFEA 2W3IA 3GISB 3OU0A 2BD7A 1TMBH 2CHAC 3ZV9A 1V2TT 1ZSKA 1MTVA 4Y7BA 1Y5AT 3ZZDA 1ANBA 1SB1H 1W13U 4WVPE 2RDEA 1K1IA 2TGTA 3UPEA 5H4IB 4O9VA 2ZI2H 1P2KA 4K8BA 3SV2H 4B76A 1G9IE 2DUCA 1GBDA 2QGRA 2Z9LA 1Z71A 1HAOH 3RM2H 2V3OH 1CO7E 1EOLA 2A0QB 1GI4A 3GCTF 4FUJA 2BDAA 1HJ8A 1Z8RA 4CRCA 1F92A 3EDXB 2ODPA 1D6RA 1IQGA 1JXPA 4F4OC 3FAOA 1H9HE 2Q6GA 1Y3XA 1V2UT 5JBTA 1AE8H 1GL1A 3OX7U 1GHXH 3A85A 3VFEA 1MKWH 5A2MH 4J1YA 4IC6A 3U98H 1WAYB 3QTOH 1C1MA 1VKYA 5DO4H 1B7XB 4UD9H 1TGNA 1OWDA 3K65B 1E1RD 2STAE 3RXDA 4AN7A 1GI6A 1S84A 2M2AA 3AAVA 1AWHB 1TALA 2ANMH 1QR3E 3PRDA 3Q3XA 1D3DB 1EAWA 3RXRA 5L6NH 3D62A 1LPGB 2A7HA 2V3HH 2VIOA 4BAHB 1GJ9B 2OC1A 4DVAU 2VIDA 1C5MD 1RGQA 1BTHH 3SU2A 1OP0A 2PV9B 4Q2KA 1C9TA 1LTOA 2QF5A 3T29A 2XCNA 4UFEH 1O2LA 1O2QA 1EJAA 2ZU3A 1PPZA 1Q31A 5DP4A 1DWBH 5KECA 2J4IA 1O3LA 3ATKA 1W14U 4Y11E 1QNJA 2VWLA 2Y81A 3P70B 1A5HA 1SL3A 3F2HA 3LDXH 1GMCG 3BSQA 1HJAB 3LONA 4M7GA 1L2EA 3RC5A 1SHHB 1KDQA 1Y5BT 1GBHA 2PGBB 1C2IA 1MABB 1FZZA 4RT1A 3FP7E 2A2QH 1T8NA 3AW0A 5A0CA 5C1YA 3Q77A 1SGEE 2FODA 1GI9B 3RU4E 1CA0C 2FOBA 3U69H 1O2KA 1OWIA 5EIYA 1W11U 1P11E 4DOQA 3EYDA 3MNCA 2NU3E 1TQ0B 3K6ZA 1DUAA 1O2IA 4AFZA 3MH5A 4D9RA 4NIVA 2R0KA 3V13A 5FCKA 4HZHA 3W94A 4SGBE 2THFB 3GCOA 4TWYA 2FOEA 1C2LA 3D49H 2WHXA 4AG1A 1A46H 1LCYA 1VJ9U 3RMLH 3SJ8A 4X1SU 3SGBE 1YF4A 1CE5A 1L1GA 1NZQH 2FDAA 2QN5T 4A92A 4R0IA 2PKAA 3UAIC 5JB8S 1NC6A 1JWTA 1NBMD 1CGIE 1TGSZ 4TPIZ 1EX3A 1GHWH 1GDNA 4BAQB 2BVSH 3U28C 1MUEB 2ZHDA 2OXSA 3MMGA 1UK4A 1PPEE 1Q3XA 1ZJDA 3GDUA 4A5TS 2HOBA 5J4QA 3SU5A 2VWNA 3SU6A 2FIRH 1O3IA 1AWFH 3DT0H 1O3BA 2GV6A 2SGFE 1DDJA 2EY4C 2V0BA 3PLBA 2M5TA 4K5ZA 4M9FA 3RXMA 1NESE 1P03A 1O2NA 1EJNA 5C20A 3MO6A 3MNSA 5GWZA 1SGFA 4BOHA 2PTCE 1AFEH 3F9EA 1W0JD 1QRXA 2HLCA 1IQFA 1GGDB 1GI8B 1C4U2 1WTGH 1ANCA 1F5LA 1MCVA 2A4OA 3RUOA 1IHTH 1AY6H 1GWAA 2ZQ2A 1AFQB 1YPLH 2FTMA 2P95A 3LGWA 3OY5U 2K8IA 1V2QT 2Y5FA 7KMEH 1TX6A 1O30A 3CNRA 1UTQA 3PYHA 4ZUHA 1GI7B 1FLEE 3B8JA 4CR9A 2PUQH 1O2HA 1JIMA 2OBOA 2OQ5A 2P16A 5HIYA 3RXUA 2HNTF 1O2GH 2RG3A 4B1TA 1TX8A 1AD8H 1YY3A 1YPMH 3A88A 2NU1E 3SV8A 1AE5A 2HPQH 2QAAA 3SV9A 1HDTH 3UR6A 1X7AC 4MPWA 1EZUC 5TJXA 4TT3D 3P95A 1O3DA 3GY2A 3O8CA 1W0YH 2BD9A 2QC2A 1S0QA 2YOLA 3RXLA 1EKBB 4NSYA 1JRSA 1PJPA 4OM9A 3DD2H 1GG6B 4XE4A 4X2YA 2XNDD 3V3MA 1XVOA 1G2MA 2NWNA 1O2UA 3MNXA 2GT8A 1MBMA 1HAPH 4AFQA 2TGDA 5A8YA 3KL6A 5E2PA 5FX6A 5A8XA 1MD7A 2KCYA 9ESTA 1ZSLA 2ZEBA 1DS2E 1O3EA 1YPEH 3LH3A 5I25A 1UK3A 2BMGB 1BMFD 1XUGA 4FUFA 3NCLA 2WPMS 1O3GA 1FAXA 1CHGA 2YNAA 2D26C 1AN1E 2B9LA 2FOFA 1MTWA 4AYYB 4TPYA 2B7DH 1G30B 2FOHA 1P9SA 2GCTB 1XVMA 2AHME 2QA9E 1WDIA 2ZF0H 2V7QD 1GGDC 4GLYA 4U01A 1KLJH 3U8RH 1T8OA 1SGTA 2CK3D 1TPPA 3F9HA 1UVPA 4ZKNU 3EE0B 1XUJA 1CT2E 1YYY1 1SVPA 2WSSD 3GCHC 1DWEH 7LPRA 3T27A 2JJ1D 2NU0E 3GS9A 2GJGA 3PLKA 1DXWA 1BMLA 1Z8GA 3M7TA 5AFZH 1NT1A 4OGXA 1HAZB 4GAWA 4OS5A 3O8RA 1MU8B 2ZU1A 1T32A 1W7GH 1KXEA 5EODA 1ELFA 1C2EA 2WYJA 3BTFE 1GDQA 1OP8A 4KELA 5E2OA 3SZNA 2ALPA 1V6DA 1O2VA 2ASUB 2XCFA 1CHOG 1C5OH 3UFAA 1AIXH 1ZPBA 3RU4D 2QXJA 3BG4B 1Y3VA 1G3DA 2CXVA 5DP8A 1TFXA 4BAMB 1MTNB 4CH2B 3TGIE 2CN0H 1WXRA 1F0TA 3ESTA 1C5LH 5DP6A 2UUYA 3RM0H 1SBWA 2A2XH 2UWPA 7GCHF 5J4SA 1C5SA 3TK9A 1O2ZA 1EZQA 2PUXB 5FL7D 5E0GA 1Y59T 3H5CB 2LNCA 4B73A 1GG6C 1EPTC 1GJ4H 4HGCA 2BY5X 2VINA 1O33A 3HATH 1PQ5A 3SN8A 1GHBF 2KCOA 1TRNA 1FMGA 4H6SB 3RXEA 2FS9A 1GI0A 3GY7A 1KLTA 1SQOA 2RCEA 2ZTYA 1THRH 2W3KA 1CVWH 1O3JA 1U6QA 5EQQA 4NIXA 1K1PA 1ZRBA 1GBEA 1O36A 4FVBA 2VB0A 3PWBA 2BM2A 4PROA 2GCTC 2HGTH 1C5NH 2FP7B 1SGDE 2GTBA 1O35A 3V7TA 1WCZA 1XX9A 2I6SA 1MKXK 1GCTC 2Y80A 1ARBA 5DP5A 4RKOB 5C5OA 2AMDA 2BY9X 2D1JA 1QFKH 4K2YA 1O34A 2ANYA 3UQVA 5C2ZA 3IG6B 3FZDA 2BZAA 3RXVA 1CGHA 3GCTG 1SLVB 4A7IB 1V2RT 1NFXA 4JZEH 2C8ZB 1J16A 3RXQA 2H5DA 2JH5D 1EZXC 1AKSA 2PW8H 2KAIA 1AHTH 2I6QA 3Q3KA 1GI1A 2FX4A 5E8EH 1C2HA 5AF9H 1HAIH 3RXOA 3PB1E 2J2UA 5C1XA 3AAUA 2ZWLH 4IC5A 2UUJB 1D3TB 1MMJN 1BBRH 4XOJA 1RD3B 2YMSD 1UW7A 2KCAA 5C3NA 4MLFB 3M7QA 4Y76A 4LXBH 2C93B 1Z6EA 3EE7A 2IN2A 2P8OC 3S69A 4YESB 2TRMA 4KGAA 2F9BH 4ZMAH 2ZCKP 3LJJA 1UCYH 4XD7D 5C17A 1P0SH 5TCAA 1F5RA 1V2OT 1O5FH 3CP7A 2F9VA 1SFQB 2SNVA 2ZHEH 1F0UA 3MYWA 2ZECA 1TNJA 4IS5A 3ZVGA 5EOKA 1GJ7B 2C90B 3UY9A 5CHAB 2ZTZA 3RXFA 2IOTA 3GDVA 4YOIA 2R9PA 1NFWA 3HGPA 1CSOE 1HXEH 3SV6A 1QB9A 5C5NA 1P2MA 1QJ1B 2ZG0H 3RMMH 2Q6DA 1VZQH 2FWWA 2H6MA 3P8OA 4IMZA 1UVOA 2A45B 1YM0A 3JZ2B 3I77A 1GMHF 1VJAU 4NCYA 4NIWA 3DSOA 2JKHA 1SLUB 1O32A 1RFNA 2ZGCA 1LDTT 2HNTC 1O37A 1YPKH 4H42U 2ZIQH 3H7OA 3VB7A 2Q6FA 1T4UH 1QL7A 1TQ7B 2G4UA 2JJ2D 5SGAE 4TYDA 3PMHB 3A7WA 4Y6DA 1J15A 1YLDA 3SORA 1FIWA 1C2FA 3A7TA 5GPIB 1GBJA 1QBVH 6GCHF 2FM2A 2CMYA 4TWWA 1TWXB 2XBYA 1UTNA 1LKAA 1V2WT 4GCHF 2ZFFH 1XXDA 1LHCH 1GHYH 2Z7FE 1KSNA 2H2ZA 3A7VA 2XBWA 1GJAB 2WV4A 1C1WH 5DP3A 3S9BA 2ULLA 5FPTA 3RXHA 3SUGA 3MH4A 1K1MA 3LGVA 2ZNKH 1TNGA 2DE8A 3A7ZA 3U1IB 1ZRKA 2AGEX 1OSSA 2WV9A 5EJ1A 2W7SA 1O39A 1QB6A 4OS7A 2CJIA 4ZXXH 4MNWA 4I33A 5HYOA 4Y71A 1GBMA 1KXDA 1Z6JH 3P6ZB 1OYQA 1SLWB 4OS1A 2EI6A 1BZXE 2GD4B 4IN1A 5JDUB 2ZHQH 1AVGH 2ALVA 4WH6A 1MH0A 3EA9A 2FPZA 1KIGH 3TH4H 1LHFH 1P3CA 2WV5A 1N6XA 5CHAC 5HIZA 1NN6A 1EB2A 3VGCB 2LPRA 3RDZA 2CV3A 1TONA 2RA0A 2Z3EA 1SPJA 3FN8A 1HLTH 2C4FH 1D9IA 3SHAH 1DFPA 1S82A 3FKSD 2ANWA 3EQ0H 1DY8A 2A7CA 2XWAA 2BB4A 1DSUA 4IW4E 3SGQE 1YPHE 4DT7B 1WBGB 5TCCA 1LPKB 4I31A 3RMNH 3URDA 1GI5A 3PMAB 3K2UA 2OINA 2WPKS 5KEDA 1C5QA 5DP9A 2EQNA 3QGJA 1O3NA 2JH0D 4K1SA 5F03A 4A1TA 1GHVH 1K28D 4BTTB 1FPCH 1KTTB 3QN7A 3AK5A 1FY3A 2LELA 3DCLA 5EU8A 3SUEA 3TNTA 1CQQA 1K0HA 2BDYA 1CA0B 1SOZA 1ANEA 1UTLM 3UB0A 5ETXA 4MNVA 1RTFB 1N6YA 3LGYA 1GBTA 2F9UA 1D3PB 4WWYA 3M5OA 3OAAD 4LK4A 4X1PU 3DFJA 2QF0A 1ACBE 1COWD 1WTHD 2J9NA 1P10A 3BTQE 1W7XH 4MVNA 2XYAA 1GBIA 1SGNE 1TX7A 1OPHB 4Y8XA 2SGDE 1DWDH 4CH8B 1ZTKA 2ZDMA 3LGUA 4XFQA 1GJ5H 3F9GA 4OS6A 2ZP0H 2HPPH 1Z8IB 1W3CA 4FVDA 3UNQA 1SLXB 4D9QA 6CHAB 2AH4X 1O3PB 4ZKOU 1O2XA 3ZYDA 3N7OA 1W8BH 2O9QA 2PLXA 4IN2A 2ZDAH 2ESTE 1BQYA 1HAVB 4GHTA 2RDLA 1IQKA 2ZZUH 1MAXA 1ZHMA 3T28A 3RLWH 2R0LA 4DCDA 1KXBA 4ZHAA 3SQHE 1A1RA 3UIRA 4YTAA 2P3FH 2PSXA 1DPOA 3A8AA 1FY4A 2W6ID 3VGCC 4X8TH 1MZDA 1ZR0A 3FP6E 2J34A 4AFSA 1WQVH 2BX4A 1BB0B 3UWJH 1SGYE 3HK6B 2TPIZ 5EQSA 2H1UA 4RSPA 1QGFA 1OWHA 3LGIA 1O3FA 3PTNA 3M5MA 1EAXA 4YOGA 1PYTD 2HVXA 3A83A 4XBBA 4AGJA 1TAWA 2GT7A 1THPB 3VB4A 4O03A 3R3GB 1Z1JA 1EP6A 3P92A 2J5UA 2XBVA 4YT7H 2PR3A 1ZHRA 1VCWA 4WXIA 2FZZA 2ZCLP 4I32A 5A8ZA 2FMJA 4UDWH 4TSFD 1LPZB 1SR5C 2D8WA 2WYGA 1KDQB 2GZ8A 4WJG2 1P8VC 7GCHG 1E1QD 1G3EA 3NK8A 2Z9KA 3B23B 4ACBA 1ZHPA 1S81A 1A7SA 3F6UH 1IQNA 4JMYA 1QJ7B 3CENA 2AERH 1IQEA 1GHBG 3NWUA 4NA9H 2XWBI 1YC0A 3SYJA 4WMDA 5ESTE 2J94A 3SJIA 4ASUD 1HGTH 4XDEA 3GY5A 1LO6A 1DXPA 4NZLA 4ZROA 3RP2A 2PFEA 1NFUA 4ABDA 2QF3A 3PWCA 6CHAC 2XTTB 3E8LA 3SI3H 1GJ8B 1PPHE 3T25A 5HXFA 1MU6B 3D23A 1BTPA 1NFYA 1BOQA 4Q7YA 4AOQA 2G52A 1GJCB 4X1RU 4UEHH 1TOCB 1A3EH 1N8OB 3SNEA 4AYVB 1HJ9A 1GL0E 2BD8A 2FYQA 1NU7B 2JDID 3SZEA 2KR7A 2F91A 2QYIA 4LOYH 2WPIS 1BHXF 3E1XB 1UVTH 2OP9A 1S6FA 3N7EA 1PQAA 4MNXA 1V2MT 1A4WH 1Y3UA 3HKIB 3EGKH 2IPQX 4YLQH 4I8HA 2UUKB 3GCHB 4K60A 2P3UB 2GMTB 3ZZ8A 1O3MA 1PFXC 5K0HA 1ZGVA 2ZU5A 1UHBB 5GNDA 1RRKA 1TPAE 3PO1B 2PP6A 4FXGH 4CHAC 3KQ5A 5EJZA 4GVUA 3KCGH 8GCHF 1GBKA 2XOKD 2BLOA 2WZQA 2BTCE 3TITA 2O8TA 1F0RA 3RC6A 4DY7B 1SGQE 2FXRA 1TGTA 4WMFA 4K8YA 1C2KA 1SI5H 5BRRE 3TH3H 4JK5A 1N1LA 3TGJE 4YO9A 2R2MB 4DT4A 1DT2A 3SNCA 1C1NA 3UOUA 5JB9S 6ESTA 3KQDA 2G51A 4A1VA 1DLKB 1L4DA 4FUBA 3PMJA 5JBBS 3GY3A 1TNIA 1SQRA 2FOCA 4X2VA 1A0HB 3OE7D 4THNH 2XNIA 1QIXB 3RU4T 2PKSB 3DSGA 1ZTJA 3DFLA 1EPTB 3LGTA 2QXHA 3ZYEA 1H8ED 2BVXH 2A4QA 4Y10E 3SW2B 4ABIA 4JYUH 4B75A 1CGJE 4AB8A 1DWCH 1BRUP 3ODFA 1E35B 4Z0KA 3F2GA 2HRVA 1C5TA 1P12E 2Y5GA 4X8UH 2BOKA 4CR5A 1GMHG 3MU4A 1ABJH 1L0ZA 5EPYA 3S7KB 2C3SA 4NGAH 4ABBA 4YZUA 3FZZA 1P57B 3A87A 1N8OC 4OGYA 1TNLA 5LGOA 1WUNH 2ZGBH 2RA3A 3SUDA 3ATIA 2SFAA 3KGPA 2F9NA 3S0NA 2KZ4A 2ZDNA 1UTPA 1W2KH 3ZVAA 3OEED 3BIVH 4X6MA 2AGIX 1C5XB 5DGJA 6GCHG 2ZPSA 4ZH8A 2EEKA 4AZ2B 3BTHE 5LPFA 3CS7A 3ATLA 4D76A 4ZKRU 3SU4A 1FAKH 1GCTB 4GCHG 5ESBA 3SHCH 4ZCNA 2GMTC 2LP6A 1EQ9A 1C2JA 4GHQA 2PWXA 3ITIA 2AYWA 1A5GH 2PHBA 3QUMP 3PO1C 1ETTH 4RKJB 1O3OA 4Q63A 2VBCA 3P8GA 1S5SA 2SGQE 1S6LA 3MH7A 1O5DH 5L2YH 1SOTA 4RN6A 2Z9IA 2K1QA 2WPJS 2G5VA 4Y7AA 2BDCA 2XC4A 1B5GH 2H9TH 2BDGA 3QZRA 4I8KA 1LMWB 1VR1H 4GUXA 1UTKA 2VIVA 3UNSA 2FI5E 2BY8X 8ESTE 1RTLA 3RXSA 1NRSH 1EOJA 1FONA 1HAXB 4MQAA 2FS8A 3KIDU 8LPRA 1C2GA 4X1NU 1V2VT 2P8OB 2ZDLA 4NZQA 4AORA 3E16B 5CDFE 1YLNA 3VXFH 3OFND 1FDPA 1YLCA 3LOXA 2PKSC 3QO6A 4UFFH 3FVFB 3ZVDA 2A4GA 4ZXYH 1BTYA 3BTGE 2FO9A 3FO8D 1OKXA 1MKXH 1O2PA 3MFJA 5F8TA 1THSH 1TA2A 1DANH 5T1VA 4X8VH 3URCA 2VH0A 3BTWE 2BD2A 3VB6A 5EXMA 2A4RA 2FI3E 1MTSA 5I46H 1YWUA 1HAHH 2OC8A 3VG8A 3NPSA 2JH6D 2K0QA 3QTVH 2WUCA 1O2RA 1BRCE 3A86A 1JOUB 1DSTA 4BAOB 2WUBA 5JBCS 4AC9A 2ZKSA 1C1UH 1LHEH 5GJ4B 3GICB 1FPHH 1ELDE 2J98A 1UTJA 2G5NA 2QE7D 2GP9B 3EA8A 4Z1MD 3DUXH 3WWFA 1SGFG 2L6OA 1K2I1 4BTUB 3QLPH 4NFFA 5DP7A 4ABFA 3NXPA 4X6PA 3UQOA 2VVVA 1XKAC 1DVAH 1TA6A 1YCPK 3NKKA 1O5EH 3UNRA 5EQRA 3ZVEA 2J38A 1G32B 1NROH 3LT3A 5FPSA 2HWLB 4E06H 3A89A 1BRAA 3MTYA 3SJ9A 1SGIB 2ZFPH 3MU1A 4F49A 1ORFA 1ETRH 2BQWB 1QQUA 1ETSH 1AKSB 1CT0E 4ABEA 1HYLA 2C8XB 2KAIB 5GCHF 4KTCA 1ID5H 4JYVH 2AMQA 1G36A 1SQAA 9LPRA 2HALA 3E3TA 5ABWA 1ZYOA 1FV9A 3BF6H 2VVUA 2ODYB 1HAYB 5C0UA 1Z8JB 4VGCC 3IITA 3Q3YA 2F4LA 4DIHH 4FUIA 1LQEA 2BLVA 1GBLA 2G4TA 1ARCA 5T6DA 1CBWC 1GJDB 1OHHD 4FUEA 4CRGA 3TK6A 1QZ8A 1ELAA 4I8LA 1F0SA 5DJ7A 1FQ3A 2O8LA 4UE7H 3PLPA 4F48B 1ZZZA 1QA0A 2EC9H 4FU7A 4AFUA 1FXYA 5DSFA 1G3CA 1DUEA 1PQ8A 4FOUC 5BPEA 2P59A 4OS2A 5B6OA 2OBQA 4B2CA 2GDDA 4CREA 1TPOA 5EW2H 2AS9A 4X1QU 1TB6H 1QB1A 1BMNH 1LKBA 2ZPRA 4E7RG 1VITH 3ZV8A 1D6WA 3LU9B 3GYLB 1Z1IA 2F3CE 1MQ5A 1XXFA 2QXIA 4YM9A 1H8HD 2BD4A 5EGMA 1MAYA 1LVYA 1GMDF 3U9AH 1QRZA 3UREA 4CRAA 5JYIA 4NIYA 1O0DH 1F5KU 1H8DH 2BOHB 3HPTB 4AG2A 5IK2D 3ATMA 1OX1A 1EP5A 4R8TB 4P00A 1YP9A 4DGJA 1A2CH 1FY1A 4XSKU 2Z9GA 1J17T 1AI8H 4NSVA 3BTDE 4Y8YA 1AUJA 2A32A 1P2OA 4QT8C 1XUHA 3PV5A 1SFIA 1HFDA 2OTVA 5T6GA 3D65E 1O3CA 4DW2U 2WPLS 3OEHD 2BLQA 4NA7A 3ZIAD 3OTPA 1B0FA 3QZQA 5L2ZH 3T62A 1WSSH 2H5CA 3T2NA 3Q00A 3T5FH 1XMNB 1VGCC 5DK1A 4DURA 4JZIA 3AASA 1ZPCA 1HAGE 1HIAB 1KMHB 4XRNA 1EFRD 3RC4A 3PV2A 3STIA 2VVCA 2ZHFH 4K1TA 1O2WA 5G4BA 1IQJA 1EAUA 2HVYB 2O8MA 1DM4B 1YPHC 1V2LT 2F43B 1C5PA 4O3TA 1CU1A 1EUFA 3S7HB 2VU8E 4U2WA 1PQ7A 4H6TA 2J95A 1H8IH 1ZOMA 2H9EH 2VIWA 5HMAA 2Z9JA 2O8UA 2ANKH 2BLWA 3DSPA 2BY7X 2J97A 4D8NA 3BEUA 1JBUH 1SSXA 3KQBA 3UUZA 2OC7A 3F0PA 3VB3A 1TMUH 2ZU4A 3TU7H 1O38A 4ABJA 1BMAA 3ZVBA 5IDKA 1ELGA 1IOEA 4Q7XA 1YCPM 1C5VA 4HTCH 3S9CA 1QQ4A 2IJOB 8GCHG 2J92A 4CRBA 4IMQA 2KFWA 4X2XA 1OWKA 1ZTLA 5B6LA 2D2DA 1LVMA 1FY8E 1J9CH 1WOFA 4JCNA 1VCQA 5C94A 1YGCH 3M35A 1FN6A 1GI2A 1Y3YA 2ZGHA 3SOSA 1C9PA 1GVZA 1BTZA 1K1LA 1TGBA 1OWEA 3MNBA 2AEIH 1RXPA 1GVKB 4B6EA 5DN6D 1DX5M 3MO3A 1ELTA 3NZIA 3MH6A 4I8GA 1TNKA 3MU0A 2W26A 1E36B 1P2NA 3SO3A 3ELAH 3LC3A 3A8CA 1FNIA 2Z6BD 1EATA 4CRFA 1TMTH 2BD5A 3BN9A 3BTEE 4GPGA 2FYRA 3A7YA 1Y3WA 2Y6TA 2AGGX 3E0PB 1ZJKA 4WF8A 3E0NB 4U32A 2XRCA 1EB1H 4DG4A 1UK2A 1VITF 3BTTE 1C5RA 2GDEH 1KXCA 1WU1A 3SNBA 3M7UA 2A5IA 1P02A 1JRTA 5C67A 1V3XA 1OS8A 2G81E 5KGOA 1O2TA 2GZ9A 2IJD1 1W0ZU 2NU4E 3SUFA 2BDBA 3QGNB 3BEIB 2Z3DA 1IHSH 3WWBA 1ZGIA 1T31A 3NRLA 4MPXA 1P01A 1AUTC 1JIRA 2QXGA 1FX0B 4JZFH 1P05A 1GJ6A 1BJVA 1VCPA 2BD3A 5EXNA 3KHVA 3IWMA 2OC0A 2BX3A 2V35A 4Y8ZA 1E38B 2B0FA 4TY6A 1ELEE 1S83A 4FUDA 1SC8U 4FUCA 5A0AE 1K1OA 1TBQH 3GOVB 4HG6A 1HAVA 1RIWB 2R2WU 3P8NA 3EA7A 4XBCA 1UJ1A 5PTPA 4MNYA 1P3EA 1ZMNA 4A1XA 1GBCA 3ZZ9A 2WPHS 4INLA 5IYTA 1AU8A 2XXLA 2YMSB 1HPGA 1O3HA 4MDSA 3DHKH 3ENSB 5FAHA 3UWIA 4TY7A 3U1JB 1E37B 4CHAB 3SJKA 2OK5A 2FESH 2GVFA 1FI8A 3LC5A 1HNEE 1TRYA 2ZQ1A 4HI3A 5FCRA 1MKWK 4FU8A 2CGAA 4P02A 2SNWA 1O5BB 4ABAA 1EJMA 2ZCHP 3FP8E 1QHRB 2ZU2A 3RXBA 1W0KD 3K6YA 1C5WB 4YT6H 1A0LA 4INKA 4B2BA 4ESTE 2KX4A 2W6JD 4UONA 3SV7A 1AGJA 1KY9A 4RT0A 1EXFA 2ZGXH 4NA8A 4AX9H 2B8OH 1V2KT 2A1DB 3LH1A 1ESTA 2OUAA 2ZA5A 2JIZD 1O2SA 2AMPA 4K69A 1UO6A 1ZSJA 3ZVFA 3MU8A 1ESAA 1Z7KA 1T4VH 1AZZA 3ZVCA 2PKAB 3B9FH 2GCHF 1GDUA 4ZKSU 1QY6A 2VJ1A 1RTKA 5GDSH 1XUIA 2WPDD 3FOAA 1SGCA 3RXTA 3RXAA 5T3HA 1ZLRA 2ZO3H 4Q4LA 1F2SE 3RXKA 1H1BA 3ZZCA 1P2JA 3E91A 4Q80A 3L3TA 1TYNA 1T8LA 1P06A 3TVJB 4ZHMU 3MI4A 1RIWC 3OSYA 4H4FA 3ZZ3A 3SGAE 1J14A 3I29A 4INHA 1NTPA 2ZFQH 3F3BA 3PV4A 5DKMA 1BA8B 5A09A 1G3BA 2OCVB 1QCPA 4WMEA 4KP0A 1P9UA 3K9XB 1AQ7A 3NUMA 1TGCA 1PPGE 2YMSC 2PGQB 1O5GH 1F7ZA 3PTBA 4HFPB 3AVZA 3TNSA 5GCHG 1SQTA 3ZZ7A 3UTUH 4NWLA 1B0EA 1EAIA 3M5LA 2STBE 2ZTXA 3N7DA 3BEFB 1J8AA 1PPBH 4FUHA 1UHBA 1GHZA 3WW7A 1GHAF 3UOPA 1HJAC 2YNBA 2R3UA 1AB9B 3ZZ6A 1MQ6A 3M37A 3C1KA 2SGEE 1KYNA 4BXWA 2G8TA 4A6LA 4B2AA 1H9LB 1HB0B 4ISOA 2BQ6B 1FN8A 4UFGH 5EG4A 3W1EA 1C4V2 1P09A 4KTSA 3U8TH 1TIOA 1AVWA 1HBTH 3KF2A 2G00A 1C1OA 2UUFB 1D3QB 3DA9B 3ATWA 2EI7A 3M3TA 6LPRA 3T26A 4BXSA 2UWOA 1K21H 1HXFH 1FY5A 3MO9A 5EXLA 4B71A 1EPTA 4ISHH 1OWJA 4I8JA 2ZPQA 2BDHA 4MG3A 1PPFE 4ZAEA 1FIZA 1WQSA 4NG9H 1BTUA 2VGCB 2Y7XA 1XUKA 5GXPA 1ZMJA 1BCUH 3LJOA 5LPRA 4RI0A 3M5NA 4AGKA 4O3UA 2P94A 3A84A 2BQ7B 3FFGA 3LIWA 2V3MA 1OOKB 2BXTH 4YOJA 3PMBB 1GMDG 1NY22 2AIQA 5E0JA 3BTKE 1DE7H 1HV7A 4ISNA 2V6NA 1M9UA 5EPNA 5GIBA 2ODQA 1H4WA 3RXGA 1L1JA 1QL9A 1DITH 1W10U 1NRPH 1INCA 1MTUA 1C2MA 3HGNA 5A0BA 1SGRE 4KKDA 1TABE 3MOCA 1ZPZA 5EW1H 3OYPA 4SGAE 3QX5H 1KTSB 3SNAA 1BBRE 1NRNH 3ZZ5A 1QRWA 5HKKD 5LH8A 1AVXA 2TIOA 1T7CA 1OP2A 3KQCA 2AIPA 1TE0A 3TJUA 2QCYA 1V2NT 2GZ7A 2VNTA 3F9FA 3SI4H 3JZ1B 3V0XA 3WY8A 4FUGA 1AFQC 3P8FA 5AHGH 1GCDA 2R3YA 1W12U 1S6HA 1TBZH 5T6FA 1A5IA 1UCYE 1QL8A 2GGVB 2QY0B 2Y7ZA 3BTME 1AB9C 4AB9A 1AMHA 2FOMB 1C5UA 4IGDA 1BMMH 1EASA 4OS4A 1YBWA 2GV7A 4ASHA 2XC5A 2P93A 2EI8A 3I78A 2BXUH 1ABIH 1NU9A 1GMCF 4WXVA 3RLYH 1CT4E 1RJXB 4UFDH 3TJNA 2C8YB 3LPRA 1IQLA 4VGCB 1HRTH 3LKWA 5FBIA 3TH2H 1ELVA 4B74A 4DIIH 1Y5UT 1LHDH 2FI4E 4FU9A 2OQUA
chains in the Genus database with same CATH topology
1GBFA 1C1VH 2ZC9H 1KXFA 4I7YH 3MU5A 4Q7ZA 5JBAS 1A61H 3ZZ4A 1DY9A 2A5AA 3KNXA 1H9IE 1BITA 1CBWB 2BVRH 2XBXA 4X8SH 2F83A 1BHXB 2QV1A 4ISIH 1UTOA 2BHGA 1YCPH 3BG8A 2GX4A 5DPAA 1SG8B 4JK6A 1IQMA 1SKYE 4B6FA 2VWMA 1YPGH 4WY3A 4YXWD 2FOGA 2GKVE 1C1TA 5LPEA 4Z6AH 2VGCC 3M36A 1ANDA 3MWIU 4NWKA 1GVLA 1ELBA 1NO9H 3SNDA 4GSOA 1TPSA 1JMOH 2F9PA 1FJSA 1NPMA 5HGGA 1IQIA 4K1EA 1TOMH 2FX6A 1WYKA 2ZDKA 1O2MA 2B5TB 3KN2A 4MPVA 2PTNA 2KM0A 1NS3A 2QF4A 1S0RA 2A5KA 8KME2 4X2WA 3PM3A 3TGKE 1O5AB 2WINI 3F0OA 5HM9A 3GYMA 1K1JA 4MPUA 1C4Y2 3VXEH 2ILNA 2Z3CA 3F68H 7ESTE 1QA7A 3OTJE 3AW1A 1C2DA 2TGPZ 3CS0A 4D7FA 4CBNA 1O31A 2TBSA 3M61U 1A3BH 3V12A 1ELCA 2Y5HA 1VITG 3L33A 1GBAA 4D7GA 1QJ6B 2C8WB 4F55A 2UWLA 3MHWU 1Q2WA 2OD3B 4LZ4B 4FETA 2FOAA 2ZFTA 3BV9B 4DJZB 2JETB 3VEQB 1LQDB 3A81A 5AFYH 1NRRH 1O3AA 2G55A 4KTUA 3TJVA 3SU1A 1VGCB 1C1PA 5F8XA 3A8DA 1K22H 1L1NA 1V2PT 1AZ8A 3STJA 3A82A 1BTXA 1OXGA 1C1QA 5FX5A 3BG4C 4LZ1H 1LVOA 1S85A 3G01A 3PRBA 1PYTC 1QURH 2EA3A 1MTNC 1EZSC 4ABGA 4Y0YE 3VB5A 4ABHA 3SQEE 1C5ZB 1TNHA 1SMFE 2VWOA 1QTFA 3M3SA 3PROA 2KCPA 3HK3B 4X6OA 1DLEA 1O2YA 1MZAA 3FANA 2ZDVH 1BDAA 3TLOA 2IPHA 1CA8B 1DICA 1QBNA 3ZZAA 1ESBA 3KEEA 4BANB 2VIPA 1LHGH 2BY6X 4JZ1A 3TJOA 3RXPA 1GBBA 5L30H 1K9OE 1C1RA 1HUTH 3O8DA 5FPYA 2QIQA 5CHBA 5FHTA 1TBRH 3ODDA 1NRQH 2W7UA 3ZZBA 1O2JA 1BBRK 1Y8TA 3BIUH 4BAKB 1P04A 4ZHLU 3R0FA 2PSYA 1RS0A 1UVUH 5DG6A 2TGAA 1XM1A 1BTWA 2A7JA 3N99A 4Y79A 3EAJA 1HCGA 1KLIH 3SU3A 1FUJA 2NU2E 1OYTH 5FXLA 2CF8H 1UCYK 1DOJA 4XBDA 4JZDH 5HM2A 5F53A 1A0JA 4JYTA 3SU0A 2P3TB 4E7NA 3H7TA 4YLUA 2VH6A 1L4ZA 4BNRA 3Q76A 4ISLA 2Y82A 2CHAB 1SHYA 1GPZA 2GCHG 1BUIA 1T8MA 3W95A 3SBKA 5K7RA 4X6NA 2JETC 3SJOA 1UMAH 2ZGJA 2W5EA 1IAUA 2F9OA 1MD8A 3O8BA 3KQEA 2HNTE 2BDIA 3TPIZ 1ZMLA 4E05H 1UTMA 2HLDD 2BZ6H 3GY4A 4O97A 5CMXH 2Q1JA 2XC0A 5FBEA 1NM6A 4J2YB 1YKTA 4Y0ZE 2SGAA 1E0FD 4CBOA 1QBOA 3L6PA 1TRMA 5JPMH 4CRDA 1K1NA 2FLRH 4K3JA 1CHOF 1HIAA 1NBME 3HKJB 1V2JT 1UVSH 3A7XA 2Z94A 1C5YB 3RXJA 5F6MA 5AVDA 3GY6A 1KXAA 3RMOH 1P2IA 3E90B 3E6PH 1TLDA 3F1SB 3UR9A 1PPCE 2BYAX 1E34B 1GI3A 1O3KA 1AO5A 3P17H 5CE1A 3F2FA 5C1UA 1V2ST 2O8WA 2H9HA 3GY8A 1XUFA 1BJUA 2ZFSA 1GJBB 3GDSA 3QDZB 2ZFRH 2FTLE 2CF9H 3C27B 4BTIB 3QWCH 4IBLH 1E79D 4X0WU 5F8ZA 4MTBA 1LVBA 1MCTA 3H09A 1GHAG 1YPJH 3S9AA 2XW9A 3TK5A 1BIOA 2OLGA 4U30A 5E0HA 3TIUA 2VIQA 3A80A 2ZHWH 1O2OA 1G37A 2FLBH 1WV7H 2A31A 1SGPE 2SGPE 1C1SA 1BRBE 3OY6U 3U8OH 2FEQH 2AFQB 2DE9A 1O5CB 1P2QA 3RXIA 1IQHA 1BT7A 4WH8A 3A8BA 3GCNA 3M3VA 1G2LA 1XKBC 1MBQA 3RXCA 1D4PB 3QK1A 5C0TA 3VPKA 4NFEA 2W3IA 3GISB 3OU0A 2BD7A 1TMBH 2CHAC 3ZV9A 1V2TT 1ZSKA 1MTVA 4Y7BA 1Y5AT 3ZZDA 1ANBA 1SB1H 1W13U 4WVPE 1K1IA 2TGTA 3UPEA 5H4IB 4O9VA 2ZI2H 1P2KA 4K8BA 3SV2H 4B76A 1G9IE 2DUCA 1GBDA 2QGRA 2Z9LA 1Z71A 1HAOH 3RM2H 2V3OH 1CO7E 1EOLA 2A0QB 1GI4A 3GCTF 4FUJA 2BDAA 1HJ8A 1Z8RA 4CRCA 1F92A 3EDXB 2ODPA 1D6RA 1IQGA 1JXPA 4F4OC 3FAOA 1H9HE 2Q6GA 1Y3XA 1V2UT 5JBTA 1AE8H 1GL1A 3OX7U 1GHXH 3A85A 3VFEA 1MKWH 5A2MH 4J1YA 4IC6A 3U98H 1WAYB 3QTOH 1C1MA 5DO4H 1B7XB 4UD9H 1TGNA 1OWDA 3K65B 2STAE 1E1RD 3RXDA 4AN7A 1GI6A 1S84A 2M2AA 3AAVA 1AWHB 1TALA 2ANMH 1QR3E 3PRDA 3Q3XA 1D3DB 1EAWA 3RXRA 5L6NH 3D62A 1LPGB 2A7HA 2V3HH 2VIOA 4BAHB 1GJ9B 2OC1A 4DVAU 2VIDA 1C5MD 1RGQA 1BTHH 3SU2A 1OP0A 2PV9B 4Q2KA 1C9TA 1LTOA 2QF5A 3T29A 2XCNA 4UFEH 1O2LA 1O2QA 1EJAA 2ZU3A 1PPZA 1Q31A 5DP4A 1DWBH 2J4IA 1O3LA 3ATKA 1W14U 4Y11E 1QNJA 2VWLA 2Y81A 3P70B 1A5HA 1SL3A 3F2HA 3LDXH 1GMCG 3BSQA 1HJAB 3LONA 4M7GA 1L2EA 3RC5A 1SHHB 1KDQA 1Y5BT 1GBHA 2PGBB 1C2IA 1MABB 1FZZA 3FP7E 2A2QH 1T8NA 3AW0A 5A0CA 5C1YA 3Q77A 1SGEE 2FODA 1GI9B 3RU4E 1CA0C 2FOBA 3U69H 1O2KA 1OWIA 1W11U 1P11E 4DOQA 3EYDA 3MNCA 2NU3E 1TQ0B 3K6ZA 1DUAA 1O2IA 4AFZA 3MH5A 4D9RA 4NIVA 2R0KA 3V13A 5FCKA 4HZHA 3W94A 4SGBE 2THFB 3GCOA 4TWYA 2FOEA 1C2LA 3D49H 4AG1A 2WHXA 1A46H 1LCYA 1VJ9U 3RMLH 3SJ8A 4X1SU 3SGBE 1YF4A 1CE5A 1L1GA 1NZQH 2FDAA 2QN5T 4A92A 4R0IA 2PKAA 5JB8S 1NC6A 1JWTA 1NBMD 1CGIE 1TGSZ 4TPIZ 1EX3A 1GHWH 1GDNA 4BAQB 2BVSH 1MUEB 2ZHDA 2OXSA 3MMGA 1UK4A 1PPEE 1Q3XA 1ZJDA 3GDUA 4A5TS 2HOBA 5J4QA 3SU5A 2VWNA 3SU6A 2FIRH 1O3IA 1AWFH 3DT0H 1O3BA 2GV6A 2SGFE 1DDJA 2V0BA 3PLBA 2M5TA 4K5ZA 4M9FA 3RXMA 1NESE 1P03A 1O2NA 1EJNA 5C20A 3MO6A 3MNSA 5GWZA 1SGFA 4BOHA 2PTCE 1AFEH 3F9EA 1W0JD 1QRXA 2HLCA 1IQFA 1GGDB 1GI8B 1C4U2 1WTGH 1ANCA 1F5LA 1MCVA 2A4OA 3RUOA 1IHTH 1AY6H 1GWAA 2ZQ2A 1AFQB 1YPLH 2FTMA 2P95A 3LGWA 3OY5U 2K8IA 1V2QT 2Y5FA 7KMEH 1TX6A 1O30A 1UTQA 3PYHA 4ZUHA 1GI7B 1FLEE 3B8JA 4CR9A 2PUQH 1O2HA 1JIMA 2OBOA 2OQ5A 2P16A 3RXUA 2HNTF 1O2GH 2RG3A 4B1TA 1TX8A 1AD8H 1YPMH 3A88A 2NU1E 3SV8A 1AE5A 2HPQH 2QAAA 3SV9A 1HDTH 3UR6A 1X7AC 4MPWA 1EZUC 5TJXA 4TT3D 3P95A 1O3DA 3GY2A 3O8CA 1W0YH 2BD9A 2QC2A 1S0QA 2YOLA 3RXLA 1EKBB 4NSYA 1JRSA 1PJPA 4OM9A 3DD2H 1GG6B 4XE4A 4X2YA 2XNDD 3V3MA 1XVOA 1G2MA 2NWNA 1O2UA 3MNXA 2GT8A 1MBMA 1HAPH 4AFQA 2TGDA 5A8YA 3KL6A 5E2PA 5FX6A 5A8XA 1MD7A 2KCYA 9ESTA 1ZSLA 2ZEBA 1DS2E 1O3EA 1YPEH 3LH3A 5I25A 1UK3A 2BMGB 1BMFD 1XUGA 4FUFA 3NCLA 2WPMS 1O3GA 1FAXA 1CHGA 2YNAA 2D26C 1AN1E 2B9LA 2FOFA 1MTWA 4AYYB 4TPYA 2B7DH 1G30B 2FOHA 1P9SA 2GCTB 1XVMA 2AHME 2QA9E 2ZF0H 2V7QD 1GGDC 4GLYA 4U01A 1KLJH 3U8RH 1T8OA 1SGTA 2CK3D 1TPPA 3F9HA 1UVPA 4ZKNU 3EE0B 1XUJA 1CT2E 1YYY1 1SVPA 3GCHC 2WSSD 1DWEH 7LPRA 3T27A 2JJ1D 2NU0E 1DXWA 3PLKA 3GS9A 1BMLA 1Z8GA 3M7TA 5AFZH 1NT1A 4OGXA 1HAZB 4GAWA 4OS5A 3O8RA 1MU8B 2ZU1A 1T32A 1W7GH 1KXEA 5EODA 1ELFA 1C2EA 2WYJA 3BTFE 1GDQA 1OP8A 4KELA 5E2OA 3SZNA 2ALPA 1V6DA 1O2VA 2ASUB 2XCFA 1CHOG 1C5OH 3UFAA 1AIXH 1ZPBA 3RU4D 2QXJA 3BG4B 1Y3VA 1G3DA 2CXVA 5DP8A 1TFXA 4BAMB 1MTNB 4CH2B 3TGIE 2CN0H 1WXRA 1F0TA 3ESTA 1C5LH 5DP6A 2UUYA 3RM0H 1SBWA 2A2XH 2UWPA 7GCHF 5J4SA 1C5SA 3TK9A 1O2ZA 1EZQA 2PUXB 5FL7D 5E0GA 1Y59T 3H5CB 2LNCA 4B73A 1GG6C 1EPTC 1GJ4H 4HGCA 2BY5X 2VINA 1O33A 3HATH 1PQ5A 3SN8A 1GHBF 2KCOA 1TRNA 1FMGA 4H6SB 3RXEA 2FS9A 1GI0A 3GY7A 1KLTA 1SQOA 2RCEA 2ZTYA 1THRH 2W3KA 1CVWH 1O3JA 1U6QA 5EQQA 4NIXA 1K1PA 1ZRBA 1GBEA 1O36A 4FVBA 2VB0A 3PWBA 2BM2A 4PROA 2GCTC 2HGTH 1C5NH 2FP7B 1SGDE 2GTBA 1O35A 3V7TA 1WCZA 1XX9A 2I6SA 1MKXK 1GCTC 2Y80A 1ARBA 5DP5A 4RKOB 5C5OA 2AMDA 2BY9X 2D1JA 1QFKH 4K2YA 1O34A 2ANYA 3UQVA 5C2ZA 3IG6B 3FZDA 2BZAA 3RXVA 1CGHA 3GCTG 1SLVB 4A7IB 1V2RT 1NFXA 4JZEH 2C8ZB 1J16A 3RXQA 2H5DA 2JH5D 1EZXC 1AKSA 2PW8H 2KAIA 1AHTH 2I6QA 3Q3KA 1GI1A 2FX4A 5E8EH 1C2HA 5AF9H 1HAIH 3RXOA 3PB1E 2J2UA 5C1XA 3AAUA 2ZWLH 4IC5A 2UUJB 1D3TB 1MMJN 1BBRH 4XOJA 1RD3B 2YMSD 2KCAA 5C3NA 4MLFB 3M7QA 4Y76A 4LXBH 2C93B 1Z6EA 2IN2A 2P8OC 3S69A 4YESB 2TRMA 4KGAA 2F9BH 4ZMAH 2ZCKP 3LJJA 1UCYH 4XD7D 5C17A 1P0SH 5TCAA 1F5RA 1V2OT 1O5FH 3CP7A 2F9VA 1SFQB 2SNVA 2ZHEH 1F0UA 3MYWA 2ZECA 1TNJA 4IS5A 3ZVGA 5EOKA 1GJ7B 2C90B 3UY9A 5CHAB 2ZTZA 3RXFA 2IOTA 3GDVA 4YOIA 2R9PA 1NFWA 3HGPA 1CSOE 1HXEH 3SV6A 1QB9A 5C5NA 1P2MA 1QJ1B 2ZG0H 3RMMH 2Q6DA 1VZQH 2FWWA 2H6MA 3P8OA 4IMZA 1UVOA 2A45B 1YM0A 3JZ2B 3I77A 1GMHF 1VJAU 4NCYA 4NIWA 3DSOA 2JKHA 1SLUB 1O32A 1RFNA 2ZGCA 1LDTT 2HNTC 1O37A 1YPKH 4H42U 2ZIQH 3H7OA 3VB7A 2Q6FA 1T4UH 1QL7A 1TQ7B 2G4UA 5SGAE 2JJ2D 4TYDA 3PMHB 3A7WA 4Y6DA 1J15A 1YLDA 3SORA 1FIWA 1C2FA 3A7TA 5GPIB 1GBJA 1QBVH 6GCHF 2FM2A 2CMYA 4TWWA 1TWXB 2XBYA 1UTNA 1LKAA 1V2WT 4GCHF 2ZFFH 1XXDA 1LHCH 1GHYH 2Z7FE 1KSNA 2H2ZA 3A7VA 2XBWA 1GJAB 2WV4A 1C1WH 5DP3A 3S9BA 2ULLA 5FPTA 3RXHA 3SUGA 3MH4A 1K1MA 3LGVA 2ZNKH 1TNGA 2DE8A 3A7ZA 3U1IB 1ZRKA 2AGEX 1OSSA 2WV9A 2W7SA 1O39A 1QB6A 4OS7A 2CJIA 4ZXXH 4MNWA 4I33A 5HYOA 4Y71A 1GBMA 1KXDA 1Z6JH 3P6ZB 1OYQA 1SLWB 4OS1A 2EI6A 1BZXE 2GD4B 4IN1A 5JDUB 2ZHQH 1AVGH 2ALVA 4WH6A 1MH0A 3EA9A 2FPZA 1KIGH 3TH4H 1LHFH 1P3CA 2WV5A 1N6XA 5CHAC 1NN6A 1EB2A 3VGCB 2LPRA 3RDZA 2CV3A 1TONA 2RA0A 2Z3EA 1SPJA 3FN8A 1HLTH 2C4FH 1D9IA 3SHAH 1DFPA 1S82A