1N1LA

Crystal structure of hcv ns3 protease domain:ns4a peptide complex with covalently bound inhibitor (gw472467x)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
180
structure length
180
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVTKAVDFIPVENLETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HCV NS3 SERINE PROTEASE
publication title Pyrrolidine-5,5-trans-lactams. 2. The use of X-ray Crystal Structure Data in the Optimisation of P3 and P4 Substituents
pubmed doi rcsb
source organism Hepatitis c virus
total genus 40
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n1lA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1n1lA01
2JH0D 3TIUA 2FX4A 2B8OH 2WPJS 1B7XB 3ZZ6A 1JMOH 5E0HA 4YZUA 2XRCA 1K22H 1A46H 1ZSLA 1XM1A 1C2GA 4X6OA 1X7AC 1HAYB 1DLEA 2BY9X 1FMGA 4AB9A 1UTQA 5TCAA 1BJUA 3FP8E 3UY9A 1O3NA 4YM9A 2Z9KA 1CGHA 1AB9B 1HJAB 4NA9H 3QWCH 3ATIA 4XBDA 4DG4A 1P04A 3TITA 1FIWA 1C5ZB 2C8ZB 1O2YA 1GBEA 1HIAB 1SLXB 1TYNA 3SOSA 3U69H 4SGBE 1UVUH 3Q3XA 2VIPA 1W0ZU 5DK1A 1ELEE 1O30A 4JYUH 1YPEH 2FOBA 4OGXA 4OS1A 4IBLH 3ODFA 3NKKA 3RXCA 5K7RA 9LPRA 3P17H 4X1PU 4NIVA 3RC4A 3E1XB 3ODDA 5JBAS 1TPOA 3GICB 5EXMA 1GHBG 2AMDA 1TGTA 1DY8A 4Y8YA 1JIRA 2Y80A 2AFQB 3A82A 2TGPZ 4NZLA 4AFZA 1CE5A 3ATLA 2PSYA 4GSOA 2ZFTA 4FVBA 1OKXA 2GVFA 2A32A 1NFUA 1SGRE 4KTSA 2XBWA 4X8TH 4A1VA 2VBCA 4FUCA 1GGDB 1L4ZA 1AO5A 4OS2A 3ELAH 1GBKA 1O3JA 1PYTC 1AE5A 3MU8A 2C3SA 1SPJA 3EA7A 2G5NA 3E8LA 3RXOA 3L6PA 2EI8A 1GBBA 2PUXB 2HNTC 1KLJH 2BDYA 2O8TA 1FN6A 1EZSC 2ZPQA 3FZDA 3DD2H 4CBOA 4Y0YE 3NZIA 1ACBE 3ZVEA 5F8TA 1CO7E 1UTLM 3DFJA 4Y8XA 3SJ9A 1ABIH 1F2SE 2TRMA 3TJVA 4H4FA 5C1UA 1O2OA 2VVUA 2FXRA 5JB8S 4XOJA 1GI1A 4GHTA 2ZZUH 1TPPA 2DE8A 1W10U 4BAOB 2AIQA 1O3EA 5G4BA 2IPHA 5EG4A 3UREA 1GBAA 2P3UB 1ELAA 1C4U2 1PQ8A 1V2NT 1FV9A 1KXDA 4JK6A 1BHXF 3MH5A 1DSTA 1GMDG 1EUFA 1Y5BT 2FOAA 4U30A 4ISLA 2Z9JA 2P95A 1TNLA 1QFKH 2Z9LA 1C4Y2 4U32A 3IITA 1O2HA 1TPSA 1V2UT 1WAYB 3M5LA 2ZDAH 3OTJE 4X1QU 1ANCA 4OS6A 1UVSH 1QBOA 3ZZBA 1O2TA 1H8IH 4DOQA 2YOLA 3F9HA 2BD2A 4TY6A 1QL7A 3S9CA 1NO9H 1BTPA 1ZHRA 2GP9B 4A1TA 4DJZB 2GTBA 1ZGIA 5A09A 2O8UA 3VB7A 2ZF0H 4YOIA 1W11U 1TBQH 4H42U 4TYDA 3BEUA 2VIWA 3E91A 6ESTA 5T1VA 3ZV8A 1SGEE 4TPIZ 5GCHF 3URDA 2NU4E 4A1XA 1O3LA 3BTHE 3QGNB 2FOMB 1KTSB 1L1GA 2AERH 4BTIB 4GCHF 1A5IA 1S82A 2ZA5A 3T2NA 5LH8A 1IHTH 1HB0B 2VWOA 1MZDA 3LDXH 1D6RA 4YT6H 3S7HB 4RKOB 5C2ZA 4A92A 2Y5HA 2OCVB 1GJ6A 2XW9A 1O5CB 1CHOF 3N7OA 3A83A 4BAHB 3O8BA 1EJMA 1AMHA 2VJ1A 3PV2A 4A6LA 3QK1A 4F4OC 2ZECA 4CRFA 1ID5H 1CGIE 1TNIA 1Z71A 4B71A 2D8WA 2CXVA 1LVOA 1O2KA 2B7DH 1ZYOA 2XBYA 4JZIA 1DLKB 1LQDB 1D3PB 1S85A 4YESB 1MD7A 2PR3A 4X2WA 2ZHFH 2VWLA 4NGAH 7LPRA 2HRVA 4ZKRU 2FM2A 1HAIH 2G00A 4MDSA 3HKJB 3UR6A 1BHXB 2V0BA 3H7TA 1NRPH 4CHAB 3GYLB 1MAXA 5EOKA 2RCEA 3C27B 2VIVA 2IJD1 1FAKH 2P94A 5A8XA 2FIRH 3T5FH 3GY6A 1ZZZA 1P3CA 1EZQA 3LGUA 3M7UA 4NIYA 1Z7KA 2ASUB 3BTGE 1O3FA 1SR5C 2BDHA 1ESBA 1GBJA 1IQGA 4IC6A 1SFQB 3W94A 2FOEA 2YNBA 1BRUP 1G3DA 5J4QA 5GNDA 3BG4C 1SGPE 1LDTT 2D2DA 3F9GA 4UE7H 1SOZA 3BTTE 4X1NU 5DP9A 3L3TA 2C4FH 2JETC 2Z94A 3H09A 1OP0A 3S9AA 3NPSA 3K65B 1EAWA 2ZC9H 3R3GB 4K3JA 4D8NA 6GCHG 1HAVB 1CT2E 1VCPA 2ZPRA 2BQWB 1WTHD 4UFFH 3SJIA 1IQLA 1ELBA 3U98H 2KAIB 1LHDH 3H5CB 1BITA 1GBFA 2ZTXA 1H8DH 1QURH 3I29A 3A8BA 3ZZ8A 4NSVA 1MTUA 1AWHB 1GDNA 1OWEA 2GCTC 3Q3KA 4WH8A 2ZTYA 2GCHG 2BD7A 1C5RA 4B2AA 1IQEA 1DDJA 4DY7B 3RXQA 4KTUA 8ESTE 1AZ8A 1O5EH 3BTFE 2UUKB 4GVUA 1AUTC 2SGFE 1E38B 3FANA 3A8AA 3SUFA 1N8OB 2CV3A 5DO4H 1ZMLA 1CA0C 2RA3A 4KKDA 4XDEA 1ABJH 1J15A 1OWJA 5A0BA 1XUHA 3MO9A 1V2JT 1ZMJA 1TOMH 1F0RA 1SOTA 1W3CA 2ZGXH 3MU1A 1P11E 1D6WA 1BBRK 2GD4B 2OC1A 1MH0A 4MPXA 2ZP0H 3LGYA 3F6UH 5C20A 1O3PB 1TNHA 4ABJA 1EPTB 2F9OA 3E6PH 1F5LA 2Y7XA 4MNYA 2Q6GA 1G9IE 2BD8A 1ZPCA 1TWXB 3ATKA 1GHAF 3AAVA 1MKWK 4X2YA 3SNCA 3TH2H 1DOJA 2ZQ1A 1O3HA 2TGDA 4GHQA 1UTOA 1XUIA 1ZRKA 4K69A 3VFEA 1EZXC 1E36B 4THNH 3U8RH 3GCHB 1GVZA 1AKSA 2BHGA 1NT1A 1T8NA 1AWFH 4AFUA 2D1JA 1QB1A 3EYDA 3VB5A 2AGIX 3BTME 1GJDB 3MNSA 3QO6A 1P02A 1CQQA 5EPNA 1TGCA 5FHTA 2GZ7A 5BRRE 1Y5AT 2V3HH 3KEEA 3RXBA 4MPWA 3ZZAA 5GPIB 2GV6A 3A7YA 2FMJA 3M3SA 3RU4E 3SUGA 5DPAA 1SFIA 3MNCA 1YCPH 1WV7H 2ZU4A 1PPZA 2EEKA 5DP7A 1OS8A 2GX4A 3MWIU 4OS5A 1A0HB 1BOQA 1GJCB 1FZZA 2SGAA 1P2OA 4O03A 1GJ9B 3TK6A 2PGQB 1S6HA 3EGKH 2BDCA 3JZ2B 3NUMA 4ZMAH 2V35A 2A4GA 1B0FA 2GZ9A 1A3EH 3SV7A 4INLA 3STJA 3ZVFA 2ANWA 2Z6BD 1RRKA 3HPTB 1FONA 1V3XA 2QXHA 2XC4A 1S6FA 1RD3B 1ZLRA 1C2HA 2G81E 2PSXA 2F9PA 2BMGB 4BTUB 2GMTB 3AK5A 3MH4A 2PV9B 2FWWA 1U6QA 2JH5D 2VIQA 1AVXA 4XSKU 1A2CH 4X8UH 3ZVBA 1PPCE 1BMLA 1FJSA 1JBUH 1TGSZ 3AW1A 1QRWA 4Q2KA 3HK3B 1BTUA 3W95A 2G52A 2A7HA 2ZI2H 1EAUA 1YPHE 1C5WB 4YLUA 4D9RA 2R3YA 5FX5A 3LH1A 1MZAA 4AOQA 3T62A 2YNAA 1ORFA 4UONA 3PB1E 1FPHH 4ZHMU 3TH3H 2C90B 5EPYA 1O2VA 4I8HA 1TNKA 2A4RA 3PM3A 4WVPE 3SU1A 3P8GA 3FZZA 2PWXA 3FFGA 3VB4A 2PLXA 2BDGA 1Q2WA 1YGCH 2OP9A 2BY8X 4BXWA 2QN5T 1S0QA 1YKTA 1H9HE 2STAE 4FUDA 3Q00A 4CRGA 1C9TA 3RM2H 1OWHA 2ZFQH 2EI7A 1UCYE 3MU0A 4AZ2B 3A86A 2ZWLH 5FBEA 1HAHH 1BCUH 1GBIA 1J9CH 2F9NA 1QQ4A 3PTBA 4CRCA 2WPHS 2WZQA 1EAIA 1O3MA 3HATH 3GOVB 3OSYA 5DG6A 4ABAA 1UHBA 5E0GA 4LXBH 1WQSA 4ISHH 1MQ6A 1YM0A 3UNQA 1J16A 4AYVB 1IQJA 3P92A 1RTLA 2OC7A 3KHVA 1AZZA 5C1XA 1Z8JB 1KXCA 4CRDA 1VITG 1O3DA 1MKXH 1O32A 1ELCA 2DE9A 1TMTH 2VVVA 2WYJA 1SQTA 4AG2A 3MFJA 2O8LA 1O0DH 4BAMB 4AB8A 2V6NA 1BBRH 1HFDA 1O33A 3SGAE 1MCVA 1EOLA 1AD8H 1K21H 2F83A 1QY6A 1DT2A 3ZZ9A 1O2ZA 2PTCE 2WV4A 3UTUH 1CT0E 2BD5A 4RI0A 1LTOA 5EQQA 4XFQA 5JBBS 1FUJA 3TNSA 1OOKB 3TGKE 2WYGA 2CHAC 2I6SA 1A61H 2GDEH 4O3TA 4NFFA 1BT7A 1QJ1B 1Y3UA 2H1UA 2Z9IA 2F3CE 1SLUB 2H2ZA 4WF8A 7GCHF 3QDZB 2F9UA 3QGJA 3PV5A 3KNXA 2BLQA 1C1SA 4RSPA 1N6XA 1PQ7A 2XC0A 1GG6C 1H9IE 3P70B 3F68H 2W7UA 4BANB 1UO6A 3SZEA 2J95A 5FX6A 3SU5A 3AW0A 1O5DH 3D65E 1V2WT 1NFYA 1E37B 3BIVH 1VITH 4R8TB 3T28A 4X2VA 1NU7B 1THRH 2XC5A 2BQ6B 4NIXA 4VGCC 2UWPA 3SBKA 3ZV9A 1GVKB 3ZVCA 1LVYA 3SU2A 4NSYA 3UQVA 1QR3E 1T4UH 2PUQH 3KIDU 2HNTF 5E0JA 1VCWA 4B6EA 2IOTA 3KCGH 1DXPA 3OTPA 5HM9A 1XMNB 1TQ0B 5GDSH 2WUCA 5T6GA 2XXLA 1AHTH 2BLWA 1C1VH 1RTFB 4JYVH 1C1RA 2F9VA 4UFGH 4E7RG 3GDVA 2RG3A 3D23A 2UWLA 1ZPZA 4ABHA 1WXRA 1C5NH 1MTNC 2VVCA 3SUDA 1NPMA 1SQOA 1SI5H 1GMCF 1ARBA 4Y7AA 2A2XH 2A1DB 1K1OA 8KME2 1DFPA 1QTFA 4FXGH 2QXGA 3BEIB 1C5PA 3GDUA 1YPJH 2NU0E 1LPZB 3LONA 5JB9S 2ZHWH 1ARCA 1WTGH 4B1TA 5C5NA 2BY5X 1HYLA 4NFEA 4ESTE 1DY9A 2FESH 2ODYB 2BM2A 1GMHF 2THFB 2B9LA 5DKMA 3ATWA 3LH3A 3LC3A 2P93A 1V2QT 2J38A 5FXLA 1SGTA 2FTMA 3PMBB 2QA9E 5BPEA 3K2UA 3SGBE 1IOEA 4SGAE 2ZKSA 1AFQC 1YLDA 1GHXH 4M9FA 2ZFPH 1J8AA 1AFQB 3NWUA 1UTMA 4A7IB 1Y3VA 2VINA 3ZZ5A 2QIQA 3RXHA 3LIWA 1EZUC 4NWKA 2WUBA 1XUFA 2ULLA 2C93B 1Q31A 3GCTF 1C1MA 2BXTH 9ESTA 2CF9H 5L2ZH 2WV5A 1ZOMA 2GV7A 1C1OA 2PKSC 1N1LA 3A7ZA 3RMOH 1OYTH 2OTVA 2VWNA 1DWBH 2BD3A 1HAOH 1QBVH 5DJ7A 5HXFA 3TH4H 1TAWA 2ZDNA 1V2PT 1T4VH 2ZO3H 4JZFH 3LGIA 1O5GH 1HGTH 1FI8A 1F0TA 1GI9B 2ZGJA 1O5AB 3U8TH 1F7ZA 1C5OH 3TJOA 3RXGA 2A5KA 3CS0A 4WWYA 1ETSH 1GCDA 1GI4A 1ZTLA 4ISIH 1O2NA 1TB6H 1GI6A 1XXDA 4Q80A 4MNVA 2GT8A 3SYJA 5CHAC 2R0KA 3QN7A 1GBMA 3TNTA 3SNDA 3A7WA 3GY4A 4PROA 1O3AA 4ZH8A 1EJNA 3V0XA 2VIOA 3E0NB 3OY5U 2Q6FA 5ABWA 3GCNA 2HWLB 1MMJN 3ZVAA 1QL8A 5A8YA 1SB1H 1DUAA 1EAXA 5E2OA 1IQFA 1GHBF 1GHYH 4Z6AH 2NWNA 5L2YH 1MTSA 1PJPA 3TU7H 4ZHAA 1AVGH 4XBBA 1TOCB 1C1QA 3OU0A 3A81A 1O34A 1C2EA 2R0LA 3UWIA 1TLDA 2DUCA 4CREA 1YCPK 3T29A 2BVRH 2ZTZA 2ZDMA 1BRAA 4NZQA 3IWMA 2QF0A 1VGCC 2FO9A 3AASA 3NK8A 1ANEA 1P2IA 1VGCB 1CSOE 3ITIA 1PQAA 2F9BH 2A7JA 1PYTD 1XXFA 4JMYA 3LU9B 3V13A 4CH8B 1KYNA 3T25A 4D9QA 4DIHH 3R0FA 5K0HA 1GI2A 1ELDE 1O3BA 1RS0A 4FU9A 3B8JA 3KQCA 4TWWA 1LCYA 5F03A 1P9SA 4J1YA 4INHA 1TA6A 1OXGA 1GBTA 1P12E 1SLVB 6LPRA 1L1JA 1YLCA 1O38A 2M5TA 2QXJA 1OP8A 1C1TA 1TONA 3DFLA 1DWDH 4ABIA 3MOCA 1NRRH 3D62A 4OS4A 5E2PA 2CJIA 3HGNA 3EDXB 5HYOA 2BVSH 1O2RA 3RXUA 1LHEH 3F9FA 1GI3A 2Z3CA 2ZG0H 1NESE 1KY9A 1JWTA 2UUFB 1ELTA 5AHGH 6CHAC 3M3VA 3RXRA 3M61U 1DUEA 3M37A 3RXSA 3VB6A 4Y0ZE 3M35A 2ZNKH 1TMUH 3RXDA 3MH7A 3EQ0H 1G3EA 2A7CA 3BTDE 3RMNH 1GBDA 1NFWA 4MNXA 2XWBI 1GJ4H 1M9UA 2H9HA 3FP7E 4GUXA 1DX5M 2JKHA 1FN8A 1EP5A 1FPCH 1TGBA 1OSSA 2PKAB 2XTTB 3M7TA 3S69A 2J94A 1SGDE 1B0EA 3BG4B 3GDSA 1V2TT 4FUIA 1C5TA 1TX6A 4HGCA 4WMFA 1O3GA 3SHAH 3I78A 2JETB 3ZZCA 3OX7U 4UEHH 1UHBB 3KN2A 1KDQA 2HOBA 3L33A 4I32A 2BDBA 5JYIA 2Y7ZA 4WXIA 1O39A 4ZXXH 3BSQA 1O2SA 4Q7XA 4AGJA 1YPHC 1O2QA 2FI4E 2TBSA 2OBOA 1QQUA 1FY4A 4K1EA 1QB6A 3QUMP 1B5GH 2O8WA 1JRSA 4K5ZA 1EX3A 4R0IA 4BAKB 1V6DA 4U2WA 3QZQA 2FOHA 1O2MA 4MPVA 5FPTA 1QB9A 1W2KH 2F4LA 2GCTB 3UOPA 3KF2A 1PPGE 5F8XA 1AFEH 1ZTJA 5T3HA 1TNJA 5A0AE 3ESTA 4AFSA 2H6MA 3NCLA 2C8WB 1J14A 3V3MA 3T26A 2AGGX 3GCOA 3I77A 2ANYA 1KXFA 3JZ1B 1CA0B 1UK4A 4I8LA 1TX8A 1MKXK 1Z1JA 1DWEH 2PHBA 3URCA 1C5YB 2Q1JA 2D26C 5EXNA 1CT4E 3MTYA 4UD9H 3LJJA 1HNEE 3RU4D 1JIMA 1GVLA 2QV1A 3VXFH 4WMEA 1T8MA 2Y5FA 1SL3A 1CBWC 4Q7ZA 1ZHMA 1GJAB 4FUGA 3SW2B 1KXAA 1S83A 1CBWB 2Z3DA 3SGQE 4ASHA 2WPIS 2FODA 2BZ6H 4ZROA 3QTVH 1EQ9A 2ZHDA 1HJ8A 2B5TB 1SG8B 4FUFA 1YBWA 3U1JB 1DWCH 3RXLA 1XUKA 5ESBA 3ATMA 1RTKA 1INCA 4ZAEA 1KXEA 2FLRH 3MO3A 3VEQB 1P3EA 3E3TA 3T27A 2ZDVH 1CHGA 1LO6A 2ANKH 4B2BA 2BLVA 2J92A 4JZDH 1AN1E 3BTEE 2EI6A 1RIWC 3QZRA 2G4TA 4Q7YA 1RIWB 4Y10E 2JH6D 2WPMS 1G36A 4X6PA 1G3CA 1T32A 1T31A 1QIXB 4RN6A 3UR9A 2ZFSA 2OQUA 1V2MT 1K1JA 2QGRA 1O2IA 5AVDA 1E0FD 1TX7A 3SU4A 2HPQH 1OWDA 3OYPA 2WINI 2ZFRH 1P2JA 1ZSJA 2OD3B 1BTHH 3V12A 1EATA 4X1SU 1P05A 4XE4A 1C1UH 4KTCA 5DP5A 3MH6A 1LVBA 3LT3A 1XVMA 4CBNA 4E06H 2GKVE 3BG8A 2P8OC 2AH4X 4CRAA 2GCHF 2AS9A 2P8OB 2ZCLP 1MCTA 2O9QA 1TQ7B 1HDTH 1QRXA 3GYMA 2C8XB 1Z6JH 4GAWA 1DS2E 1E34B 1FQ3A 1HUTH 2H9EH 1AU8A 1HJ9A 4DCDA 1FLEE 5ESTE 5JBCS 1BTXA 3VGCC 2G8TA 1ZRBA 4DIIH 1YCPM 5HMAA 4K1SA 2UWOA 1HAGE 1WCZA 1HXFH 1A7SA 2A4QA 2OC8A 1DE7H 3PLPA 2CF8H 4FU8A 1ANDA 2OK5A 3K6ZA 5SGAE 2BY6X 2J34A 8LPRA 1J17T 1UTJA 2HPPH 1PPEE 1WOFA 1QNJA 2H5DA 1C2KA 2FZZA 2ZU2A 1K2I1 4UFDH 4UFEH 1L1NA 4FUEA 3TPIZ 3U1IB 5DP8A 3KQBA 1H1BA 1TA2A 4WH6A 1ZSKA 1K1IA 1Z8RA 2ZGBH 4FUJA 2BVXH 4B75A 2UUJB 4YOJA 4ABFA 4JZEH 4K2YA 4B74A 4YLQH 1A0LA 4ABDA 3S0NA 1QCPA 1BIOA 1Y3YA 1BTZA 3SJOA 4CRBA 5I46H 1EKBB 4AGKA 2GZ8A 2XCNA 2ZEBA 1Y3WA 1Y3XA 3S9BA 1CA8B 1VZQH 2BLOA 2XBXA 5LPEA 3PWBA 1NROH 1O2UA 1GBHA 1O3OA 1K1MA 1IQKA 4QT8C 3B9FH 4XBCA 1C5SA 2FOGA 2RDLA 2FP7B 3M36A 3E16B 3VXEH 1FY3A 1W0YH 1T8OA 1K1NA 1DXWA 3O8RA 3RU4T 3ZVDA 1A5GH 2GGVB 1L0ZA 2BQ7B 1GCTC 1SBWA 1NRNH 1PQ5A 3MO6A 1A4WH 4HZHA 1V2VT 1YPKH 2J9NA 3D49H 1GDQA 2HALA 2QXIA 1EOJA 1YPLH 4YOGA 1JRTA 1GHZA 2TIOA 3O8DA 3M5NA 3Q76A 3TGJE 1C1NA 1GL1A 4F49A 1FXYA 1HAVA 1UK3A 2TGTA 1IQIA 1XX9A 1C2IA 1QRZA 3CP7A 4Y6DA 2QCYA 1UK2A 2Z9GA 2ZU5A 2Y6TA 1OYQA 3ZZ7A 3FAOA 1WBGB 4B73A 3UOUA 4ZKNU 2OC0A 1KXBA 1P9UA 4K60A 1ZMNA 2NU3E 2Y5GA 2CHAB 1CU1A 2VIDA 4AFQA 2ZPSA 2I6QA 3LPRA 2SNVA 1OPHB 1UTPA 1XKBC 5A8ZA 1D9IA 3E0PB 4WY3A 1FNIA 1L2EA 1MUEB 2QAAA 1BTYA 2O8MA 1BMAA 1SLWB 1GDUA 1LKAA 1UCYK 2P3FH 1GG6B 1D3DB 5IYTA 1IQMA 1C4V2 3UIRA 3DUXH 1TBRH 1BTWA 1UVOA 1MD8A 2R2MB 1Z8IB 1GJBB 1O31A 4I8JA 3RLWH 4WMDA 3A88A 4IW4E 1FDPA 3A7VA 3U8OH 2P16A 1PFXC 4Y11E 3UWJH 3E90B 4VGCB 1EPTA 1ETRH 1O2PA 2OLGA 1HXEH 2ZHEH 1EJAA 1NN6A 3GY2A 4D7FA 5IDKA 1C5VA 1OWIA 2HGTH 3HGPA 1BB0B 3A84A 3KGPA 5DGJA 1GI8B 1P2QA 3RLYH 1ZPBA 3LGTA 4IMZA 3GY7A 1C2JA 1MBMA 4X8SH 4YO9A 1XUGA 4BAQB 1S84A 1NFXA 3RP2A 1GJ7B 2ZGHA 3TJUA 1P06A 1QGFA 3SV6A 5F8ZA 1BMMH 1HV7A 3SU6A 1LKBA 1TPAE 1MTNB 1TGNA 2Y82A 3RXEA 1FY1A 2FI3E 1VITF 4U01A 2HVXA 3PLBA 1KDQB 2CGAA 1BZXE 1THPB 5LPRA 1AB9C 1HJAC 1WQVH 3LKWA 1NC6A 1P2MA 3FP6E 3RXMA 1AE8H 4B6FA 1G2LA 2OINA 1SGFG 3F1SB 4HI3A 3PLKA 1WSSH 4DVAU 2VU8E 2V3OH 3MU5A 3EA9A 4X6MA 3RXVA 1F0UA 3UUZA 5L30H 4IC5A 2ZFFH 1IQHA 1PPBH 1NRSH 4KELA 2IJOB 4ABBA 4E05H 2WPLS 4OM9A 2RA0A 1BMNH 3SN8A 3BTWE 1MU6B 4OGYA 1E35B 2ZU3A 4BOHA 3SO3A 1ESTA 3ENSB 2FYQA 2OXSA 4OS7A 2ILNA 5C3NA 2QF3A 2ALVA 5AFZH 1ZHPA 3EAJA 2R2WU 2HLCA 5GCHG 3SQHE 3UNSA 2FOFA 1P57B 4AORA 1OWKA 1S81A 1BQYA 1C1PA 2FTLE 8GCHF 5J4SA 4RKJB 4ZHLU 1O2LA 4HFPB 3V7TA 4GCHG 4GPGA 1CVWH 1GGDC 2NU1E 3P8FA 2PKSB 5F6MA 2XCFA 1ANBA 1W14U 1W12U 1O35A 2BD4A 5JPMH 3TLOA 2BX3A 1CHOG 1C2FA 4J2YB 4NIWA 1QL9A 2STBE 4MTBA 4D7GA 5ETXA 2OQ5A 1AKSB 2OUAA 4TWYA 5EW2H 2FLBH 2Y81A 2VB0A 4ZXYH 5B6LA 1DSUA 4IGDA 1C5LH 1MBQA 1QA7A 1P10A 2C8YB 3ZZ4A 2BY7X 3A85A 5T6FA 5LGOA 2B0FA 1ESAA 1A3BH 3SZNA 3SHCH 1SVPA 1LHGH 2ANMH 2P3TB 1H4WA 4LOYH 1HCGA 3CENA 7ESTE 3MYWA 4ABGA 3PV4A 1VCQA 3NXPA 1Y8TA 5CHAB 7KMEH 4JYTA 1F0SA 4MPUA 3A87A 5TJXA 1C2DA 2J2UA 3RXJA 1DM4B 1O36A 1MU8B 2VGCC 2ODQA 1C2MA 4Y7BA 4Y8ZA 2VGCB 4E7NA 4B76A 4CR9A 1C5UA 3ZYDA 1Z6EA 4MQAA 3AAUA 1T7CA 1TMBH 3A80A 3DHKH 5PTPA 2NU2E 2BDIA 1P09A 1LPKB 1UMAH 1ELGA 2ZDLA 5EXLA 1GBCA 1ZR0A 2OBQA 3SJKA 1O2WA 2ZIQH 1P03A 1F5KU 5GWZA 1T8LA 2SGQE 2W5EA 1V2LT 3K6YA 1LHCH 5AFYH 4ABEA 1UCYH 4H6TA 1TBZH 1MTVA 3P95A 4YT7H 2ODPA 3PTNA 1O5BB 3KQEA 3WY8A 1TRMA 5C5OA 1BJVA 1HAZB 4NCYA 2GDDA 2Z7FE 1O5FH 4NA7A 4AN7A 5CE1A 1DITH 5GIBA 1HAXB 1SGNE 3MI4A 3SU0A 2FS9A 3LC5A 4A5TS 1EASA 2EA3A 2AGEX 5C1YA 4KGAA 4NG9H 5DP6A 3SNEA 4NA8A 1UVTH 5H4IB 3SV9A 2PTNA 1ETTH 1NY22 1O37A 1HAPH 4IMQA 2R9PA 4Y76A 2LNCA 4BTTB 2SGDE 2ZCHP 3LGVA 3HK6B 1NM6A 1TALA 1O2GH 1Z8GA 2FEQH 3STIA 1AQ7A 2BX4A 3VB3A 3FVFB 2VWMA 3IG6B 1G2MA 2FYRA 3LGWA 3GISB 1TFXA 1LHFH 6CHAB 1NRQH 3SI3H 4K8BA 5JBTA 1GMDF 2XBVA 1D3QB 3S7KB 1AI8H 4GLYA 1C9PA 1YYY1 3QX5H 2A2QH 3UQOA 1UTKA 4BXSA 4CHAC 1GHAG 1TABE 2QY0B 2AMPA 2AMQA 1SGYE 3O8CA 2H9TH 1TIOA 2VNTA 2PW8H 2VH0A 2LPRA 1BUIA 2BXUH 4YTAA 4O97A 3TK9A 1EP6A 1VR1H 1KSNA 3RC5A 5EW1H 1BBRE 4X6NA 1SHYA 1YPMH 2XYAA 4LZ1H 2A31A 1S0RA 1BDAA 1GI7B 4H6SB 4JCNA 4CH2B 2A5IA 5FBIA 3P8OA 4ISNA 3MMGA 4ZUHA 1LQEA 3BF6H 3HKIB 2W26A 1UVPA 1P01A 4MNWA 5CMXH 3AVZA 1S5SA 1DICA 1SC8U 2HNTE 1HIAA 1SGCA 1XKAC 3GY5A 3ZYEA 3C1KA 3MNBA 5DP4A 1ZJDA 2A45B 4DGJA 3PMAB 1GL0E 4IN2A 4ISOA 3TGIE 5AF9H 1RJXB 3MNXA 1NZQH 2TGAA 2BOHB 3PROA 1MTWA 2XNIA 3UPEA 1CGJE 2ZGCA 1EB1H 1P2KA 1PPHE 2G5VA 1ZTKA 1DVAH 4DURA 1P8VC 3SJ8A 1H9LB 1Y59T 3EE0B 3KL6A 1QA0A 1TNGA 1A5HA 3TK5A 1N8OC 1WUNH 1ZGVA 2BTCE 3RXPA 1VJAU 4ZKSU 3RXFA 3SV2H 2WV9A 3RXTA 4ZKOU 1W8BH 3SORA 3TJNA 1SSXA 5EODA 2K1QA 3K9XB 4MLFB 1AGJA 5FPYA 5FPSA 3BV9B 3QLPH 1MQ5A 3QTOH 4Y71A 1EPTC 4M7GA 1P2NA 2ZDKA 3BTQE 1GPZA 3RMMH 3PWCA 3SNBA 4B2CA 4DT7B 3ZZDA 1TE0A 5E8EH 1KIGH 3BIUH 2W7SA 4X0WU 1V2ST 1HPGA 3DA9B 1FAXA 1SMFE 2G51A 2A5AA 1O2JA 3GCHC 4AG1A 2ZCKP 4MG3A 3RXAA 5C67A 2CN0H 1A0JA 3RXIA 6GCHF 3MU4A 1A1RA 3SU3A 2PFEA 1C5MD 1EXFA 3P6ZB 3RM0H 2BZAA 2SNWA 2W3IA 4TY7A 1UJ1A 3UFAA 2QYIA 1O2XA 2FS8A 2WHXA 1V2OT 3M5MA 1W7GH 5EU8A 4IS5A 3GY8A 1LMWB 1N6YA 3SV8A 1V2KT 3Q77A 1D4PB 3BTKE 2BOKA 1O3KA 4Y79A 1GI0A 4O9VA 2F91A 1AIXH 4AYYB 1Y5UT 4UDWH 4WXVA 3RXKA 1YP9A 1VJ9U 4BNRA 3BN9A 4LK4A 5GXPA 1ELFA 1K28D 1ELVA 1TRNA 3VGCB 3PMJA 4NWLA 1D3TB 1NS3A 4DW2U 1NU9A 2SGPE 2R3UA 3LJOA 1BRBE 3U9AH 3SNAA 1GHVH 1NTPA 3P8NA 4CR5A 1F92A 1GJ8B 1JXPA 1RGQA 3SI4H 2PGBB 3M5OA 2GMTC 4K1TA 5B6OA 1K9OE 1Q3XA 2XWAA 4MVNA 1UTNA 1L4DA 3SUEA 1DANH 4D76A 1WYKA 1IAUA 3M3TA 5JDUB 1O3CA 1C5QA 5GJ4B 4X1RU 1O3IA 1Z1IA 1XVOA 2H5CA 3ZZ3A 1C2LA 2G55A 1BA8B 3A7TA 7GCHG 1SHHB 2ZQ2A 3A89A 2AYWA 1PPFE 2EC9H 1BRCE 1ZJKA 1QJ6B 3A8DA 2SGEE 2BB4A 2WPKS 4K8YA 5FCKA 5A0CA 1FIZA 1OP2A 1GHWH 1P0SH 1SGFA 1JOUB 2Q6DA 3G01A 1G3BA 1V2RT 3OY6U 4X8VH 4INKA 1LVMA 1GBLA 1KLIH 2BYAX 1SGQE 1YPGH 2FI5E 2IN2A 3RMLH 2A0QB 4JK5A 1IQNA 2ALPA 1KTTB 5FAHA 2FOCA 5EGMA 1THSH 1QHRB 2BD9A 1GWAA 1IHSH 3TVJB 3M7QA 1GCTB 5TCCA 3SQEE 2P59A 4Z0KA 2PKAA 1MAYA 4LZ4B 1FY8E 2AIPA 3CS7A 1OX1A 2ZU1A 4FU7A 1SQAA 5HM2A 1EB2A 3DT0H 2GT7A 1C1WH 4TPYA 3GY3A 2CMYA 4JZ1A 1AVWA 4FUBA 1G30B 5DP3A 2FX6A 3MHWU 2KAIA 3H7OA 4HTCH 4I8KA 1GMCG 5A2MH 1G37A 3A7XA 5L6NH 3Q3YA 1KLTA 1TRYA 5HGGA 5LPFA 1K1PA 1AUJA 1YC0A 1W13U 3LOXA 2FDAA 1QBNA 2W3KA 4O3UA 3ZVGA 3RUOA 1QJ7B 4WJG2 2J4IA 4I8GA 1G32B 1DPOA 3BEFB 3EA8A 2Z3EA 5FCRA 4FUHA 4X2XA 1HRTH 1MKWH 1GI5A 1HLTH 2FPZA 1RXPA 1GMHG 5EQRA 2A4OA 3PYHA 1SGIB 2UUYA 1FY5A 2G4UA 1W7XH 5EQSA 4I7YH 4AX9H 3RDZA 3KQDA 2QC2A 1F5RA 1LPGB 4I31A 1AY6H 1RFNA 3B23B 3UNRA 2ZHQH 2ESTE 2AEIH 4IN1A 1HBTH 1GJ5H 3A8CA 1K1LA 3RC6A 5T6DA 1WU1A 4FVDA 3PO1C 4KP0A 3PO1B 1YF4A 3GCTG 8GCHG 1XUJA 2TPIZ 5I25A 2BDAA 2VH6A 3F9EA 1C5XB 2SFAA 3VPKA 3PMHB 4I33A
chains in the Genus database with same CATH superfamily
2JH0D 3TIUA 2FX4A 2B8OH 3GS9A 2WPJS 1B7XB 3ZZ6A 1JMOH 5E0HA 4YZUA 2XRCA 1K22H 1A46H 1ZSLA 5EJLA 1XM1A 1C2GA 4X6OA 1X7AC 1HAYB 1DLEA 3FN8A 5HKKD 2BY9X 1FMGA 4AB9A 1UTQA 5TCAA 1BJUA 3FP8E 3UY9A 1O3NA 4YM9A 2Z9KA 1CGHA 1AB9B 1H8HD 1HJAB 4NA9H 3QWCH 3ATIA 4XBDA 4DG4A 1P04A 3UAIC 3TITA 1FIWA 1C5ZB 2C8ZB 1O2YA 1GBEA 1HIAB 1SLXB 1TYNA 3SOSA 3U69H 4SGBE 1UVUH 2K0QA 3Q3XA 2VIPA 1W0ZU 1SQRA 1VKYA 5DK1A 1ELEE 1O30A 4JYUH 1YPEH 5EIYA 2FOBA 4OGXA 4OS1A 4IBLH 3ODFA 3NKKA 2WPDD 3RXCA 5K7RA 9LPRA 3P17H 4X1PU 4NIVA 3RC4A 3E1XB 3ODDA 5JBAS 1TPOA 3GICB 5EXMA 1GHBG 2AMDA 1TGTA 1DY8A 4Y8YA 1JIRA 2Y80A 2AFQB 3A82A 2TGPZ 4NZLA 4AFZA 2AHME 1CE5A 3ATLA 2PSYA 2EY4C 4GSOA 2ZFTA 4FVBA 1OKXA 2GVFA 2A32A 3U28C 1NFUA 1SGRE 4KTSA 2XBWA 4X8TH 4FETA 4A1VA 2VBCA 4FUCA 1GGDB 1L4ZA 1AO5A 4OS2A 3ELAH 1GBKA 1O3JA 1PYTC 1AE5A 3MU8A 2C3SA 5FL7D 1SPJA 3EA7A 2G5NA 3E8LA 3RXOA 3L6PA 2EI8A 1GBBA 2PUXB 2HNTC 1KLJH 3F0OA 2BDYA 2O8TA 1FN6A 1EZSC 2ZPQA 3FZDA 3DD2H 4CBOA 4Y0YE 3NZIA 1ACBE 3ZVEA 5F8TA 1CO7E 1UTLM 3DFJA 4Y8XA 3SJ9A 1ABIH 1F2SE 2TRMA 3TJVA 4H4FA 5C1UA 1O2OA 2VVUA 2FXRA 5JB8S 4XOJA 1GI1A 3FO8D 4GHTA 2ZZUH 1TPPA 2DE8A 1W10U 4BAOB 2AIQA 1O3EA 5G4BA 2IPHA 5EG4A 3UREA 1GBAA 2P3UB 1ELAA 1C4U2 1PQ8A 1V2NT 1FV9A 1KXDA 4JK6A 1BHXF 3MH5A 1DSTA 1GMDG 1EUFA 1Y5BT 2FOAA 4U30A 4ISLA 2Z9JA 2P95A 1TNLA 1QFKH 2Z9LA 1C4Y2 4U32A 3IITA 3F3BA 1O2HA 1TPSA 1V2UT 1WAYB 3M5LA 2ZDAH 3OTJE 4X1QU 1ANCA 4OS6A 1UVSH 1QBOA 3ZZBA 1O2TA 1H8IH 4DOQA 2YOLA 3F9HA 2BD2A 4TY6A 4F48B 1QL7A 3S9CA 1NO9H 1BTPA 1ZHRA 2GP9B 4A1TA 4DJZB 2GTBA 1ZGIA 5A09A 5KECA 2O8UA 3VB7A 2ZF0H 4YOIA 1W11U 1TBQH 2JJ2D 4H42U 4TYDA 3BEUA 2VIWA 3E91A 6ESTA 5T1VA 2F43B 3ZV8A 1SGEE 4TPIZ 5GCHF 3URDA 2NU4E 4A1XA 1O3LA 3BTHE 3N7DA 3QGNB 2FOMB 1KTSB 1L1GA 2AERH 4BTIB 4GCHF 1A5IA 1W0JD 1S82A 1YLNA 2ZA5A 3T2NA 5LH8A 1IHTH 1HB0B 2VWOA 1MZDA 3LDXH 1D6RA 4YT6H 3S7HB 4RKOB 5C2ZA 4A92A 2Y5HA 2OCVB 1GJ6A 2XW9A 1O5CB 1CHOF 3N7OA 3A83A 4BAHB 3O8BA 1EJMA 1AMHA 2VJ1A 3PV2A 4A6LA 3QK1A 4F4OC 2PP6A 2ZECA 1ID5H 4CRFA 1CGIE 3DCLA 1TNIA 1Z71A 4B71A 2D8WA 2K8IA 2CXVA 1LVOA 1O2KA 2B7DH 1ZYOA 2XBYA 4JZIA 1DLKB 1LQDB 1D3PB 1S85A 4YESB 1MD7A 2PR3A 4X2WA 2ZHFH 2VWLA 1MABB 4NGAH 7LPRA 2HRVA 4ZKRU 2FM2A 1HAIH 2G00A 4MDSA 3HKJB 3UR6A 1BHXB 2V0BA 3H7TA 1NRPH 4CHAB 2RDEA 3GYLB 1MAXA 5EOKA 2RCEA 3C27B 2VIVA 2IJD1 1FAKH 2P94A 5A8XA 2FIRH 2JJ1D 3T5FH 3GY6A 1ZZZA 1P3CA 1EZQA 3LGUA 3M7UA 4NIYA 1Z7KA 2ASUB 3BTGE 1O3FA 1SR5C 2BDHA 1ESBA 1GBJA 5CHBA 1IQGA 4IC6A 1SFQB 3W94A 2FOEA 2YNBA 1BRUP 1G3DA 2W6JD 5J4QA 5GNDA 3BG4C 1SGPE 1LDTT 2D2DA 3F9GA 4UE7H 1SOZA 3BTTE 4X1NU 5DP9A 3L3TA 2C4FH 2JETC 2Z94A 3H09A 1OP0A 2L74A 3NPSA 3S9AA 3K65B 1EAWA 2ZC9H 3R3GB 4K3JA 4D8NA 6GCHG 1HAVB 4F55A 1CT2E 1VCPA 2ZPRA 2BQWB 3WW7A 1WTHD 4UFFH 3SJIA 1IQLA 1ELBA 2WSSD 3U98H 2KAIB 1LHDH 3H5CB 1BITA 1GBFA 2ZTXA 1H8DH 1QURH 3I29A 3A8BA 3ZZ8A 4NSVA 1MTUA 1AWHB 1GDNA 1OWEA 2GCTC 3Q3KA 4WH8A 2ZTYA 2GCHG 2BD7A 1C5RA 4B2AA 1IQEA 1DDJA 4DY7B 3RXQA 4KTUA 8ESTE 1AZ8A 1O5EH 3BTFE 2UUKB 4GVUA 1AUTC 2SGFE 1E38B 3FANA 3A8AA 3SUFA 1N8OB 2CV3A 5DO4H 1ZMLA 1CA0C 2RA3A 4KKDA 1FX0B 4XDEA 1ABJH 1J15A 1OWJA 5A0BA 1XUHA 3MO9A 1V2JT 1ZMJA 1TOMH 1F0RA 2M2AA 1SOTA 1W3CA 2ZGXH 3MU1A 1P11E 1D6WA 1BBRK 2GD4B 2OC1A 1MH0A 4MPXA 2ZP0H 3LGYA 3F6UH 5C20A 1O3PB 1TNHA 4ABJA 1EPTB 2F9OA 3E6PH 1F5LA 2Y7XA 4MNYA 2Q6GA 1G9IE 2BD8A 1ZPCA 1TWXB 3ATKA 1GHAF 3AAVA 1MKWK 4X2YA 3SNCA 3TH2H 1DOJA 2ZQ1A 1O3HA 2TGDA 4GHQA 1UTOA 1XUIA 1ZRKA 4K69A 3VFEA 1EZXC 1E36B 2JDID 4THNH 3U8RH 3GCHB 1GVZA 1AKSA 2BHGA 1NT1A 1T8NA 1AWFH 4AFUA 2D1JA 1QB1A 3EYDA 3VB5A 2AGIX 2KCOA 3BTME 1GJDB 3MNSA 3QO6A 1P02A 1CQQA 5EPNA 1TGCA 5FHTA 2GZ7A 5BRRE 1Y5AT 2V3HH 3KEEA 3RXBA 4MPWA 3ZZAA 5GPIB 2GV6A 3A7YA 2FMJA 3M3SA 3RU4E 3SUGA 5DPAA 1SFIA 3MNCA 1YCPH 1WV7H 2ZU4A 2RFKC 3FKSD 1PPZA 2EEKA 5DP7A 1OS8A 2GX4A 3MWIU 4OS5A 1A0HB 1BOQA 1GJCB 1FZZA 2SGAA 1P2OA 4O03A 1GJ9B 3TK6A 1S6HA 2PGQB 3EGKH 2BDCA 3JZ2B 3NUMA 4ZMAH 2V35A 2A4GA 1B0FA 2GZ9A 1A3EH 3SV7A 4INLA 3STJA 2XNDD 3ZVFA 2ANWA 2Z6BD 1RRKA 3HPTB 1FONA 1V3XA 2L6OA 2QXHA 2XC4A 1S6FA 1RD3B 1ZLRA 1C2HA 2G81E 2PSXA 2F9PA 2BMGB 4BTUB 2GMTB 3AK5A 3MH4A 2PV9B 2FWWA 1U6QA 1YWUA 2JH5D 2VIQA 1AVXA 4XSKU 1E1RD 1A2CH 4X8UH 3ZVBA 1PPCE 1BMLA 1FJSA 1JBUH 1TGSZ 3AW1A 1QRWA 4Q2KA 3HK3B 1BTUA 3W95A 4I33A 2G52A 2A7HA 2ZI2H 1EAUA 1YPHE 1C5WB 4YLUA 4D9RA 2R3YA 5FX5A 3LH1A 1MZAA 4AOQA 3T62A 2YNAA 1ORFA 4UONA 3PB1E 1FPHH 3ZIAD 4ZHMU 3TH3H 2C90B 5EPYA 1O2VA 4I8HA 1TNKA 2A4RA 3PM3A 4WVPE 3SU1A 3P8GA 3FZZA 2PWXA 3FFGA 3VB4A 2PLXA 2BDGA 1Q2WA 1YGCH 2OP9A 2BY8X 4BXWA 2QN5T 1S0QA 1YKTA 1H9HE 2STAE 4FUDA 2J98B 3Q00A 4CRGA 1C9TA 3RM2H 1OWHA 2ZFQH 2EI7A 1UCYE 3MU0A 3PRBA 4AZ2B 3A86A 2ZWLH 5FBEA 2KCYA 1HAHH 1BCUH 1GBIA 1J9CH 2F9NA 1QQ4A 3PTBA 4CRCA 2WPHS 2WZQA 1EAIA 1O3MA 3HATH 3GOVB 3OSYA 5DG6A 4ABAA 1UHBA 5E0GA 4LXBH 1WQSA 4ISHH 1MQ6A 1YM0A 3UNQA 1J16A 4AYVB 1W0KD 4YXWD 1IQJA 3P92A 1RTLA 2OC7A 3KHVA 1AZZA 5C1XA 1Z8JB 1KXCA 4CRDA 1VITG 1O3DA 1MKXH 1O32A 1ELCA 2DE9A 1TMTH 2VVVA 2WYJA 1SQTA 4AG2A 3MFJA 2O8LA 3CNRA 1O0DH 4BAMB 4AB8A 2V6NA 1BBRH 1HFDA 1O33A 3SGAE 1MCVA 1EOLA 1AD8H 1K21H 2F83A 1QY6A 1DT2A 3ZZ9A 1O2ZA 2PTCE 2WV4A 3UTUH 1CT0E 2BD5A 4RI0A 1LTOA 5EQQA 4XFQA 5JBBS 1FUJA 3TNSA 1OOKB 3TGKE 2WYGA 2CHAC 2I6SA 1A61H 2GDEH 4O3TA 4NFFA 1BT7A 1QJ1B 1Y3UA 2H1UA 2Z9IA 2F3CE 1SLUB 2H2ZA 4WF8A 7GCHF 3QDZB 2F9UA 3QGJA 3PV5A 3KNXA 2BLQA 1C1SA 4RSPA 1N6XA 1PQ7A 2XC0A 1GG6C 1H9IE 3P70B 3F68H 2W7UA 4BANB 1UO6A 3SZEA 2J95A 5FX6A 3SU5A 3AW0A 5EJ1A 1O5DH 3D65E 1V2WT 1NFYA 1E37B 3BIVH 1VITH 4R8TB 3T28A 4X2VA 1NU7B 1THRH 2XC5A 2BQ6B 4NIXA 4VGCC 2UWPA 3SBKA 3ZV9A 1GVKB 3ZVCA 1LVYA 3SU2A 4RT1A 4NSYA 3UQVA 1QR3E 1T4UH 2PUQH 3KIDU 2HNTF 5E0JA 1VCWA 4B6EA 2IOTA 3KCGH 1NBMD 1DXPA 3OTPA 5HM9A 1XMNB 1TQ0B 2LELA 2QF4A 2WUCA 5GDSH 5T6GA 2XXLA 1AHTH 2BLWA 1C1VH 1RTFB 4JYVH 1C1RA 2F9VA 4UFGH 4E7RG 3GDVA 2RG3A 3D23A 2UWLA 1ZPZA 4ABHA 1WXRA 1C5NH 1MTNC 2VVCA 3SUDA 1NPMA 1SQOA 1SI5H 1GMCF 1ARBA 4Y7AA 2A2XH 2A1DB 1K1OA 8KME2 2KCAA 1DFPA 1QTFA 4FXGH 2QXGA 3BEIB 1C5PA 3GDUA 1YPJH 3OAAD 2NU0E 1LPZB 3LONA 5JB9S 1BMFD 1ARCA 1WTGH 2ZHWH 4B1TA 5C5NA 2BY5X 1HYLA 4NFEA 4ESTE 1DY9A 3VG8A 5DSFA 2FESH 2ODYB 2BM2A 1GMHF 2THFB 2B9LA 5DKMA 3ATWA 3LH3A 3LC3A 2P93A 1V2QT 2J38A 5FXLA 1SGTA 2FTMA 3PMBB 2QA9E 5BPEA 3K2UA 3SGBE 1IOEA 4P00A 4SGAE 2ZKSA 1AFQC 1YLDA 1GHXH 4M9FA 2ZFPH 1J8AA 1AFQB 3NWUA 1UTMA 4A7IB 1Y3VA 2VINA 3ZZ5A 5C17A 2QIQA 3RXHA 3LIWA 1EZUC 4NWKA 2WUBA 1XUFA 2ULLA 2C93B 1Q31A 5F53A 3GCTF 1C1MA 2BXTH 9ESTA 2CF9H 5L2ZH 2WV5A 1ZOMA 2GV7A 1C1OA 2PKSC 1N1LA 3A7ZA 3RMOH 1OYTH 2OTVA 2VWNA 1DWBH 2BD3A 1HAOH 1QBVH 5DJ7A 5HXFA 3TH4H 1TAWA 2ZDNA 1V2PT 1T4VH 2ZO3H 4JZFH 5C94A 3LGIA 1O5GH 1HGTH 1FI8A 1F0TA 1GI9B 2ZGJA 1O5AB 3U8TH 1F7ZA 1C5OH 3TJOA 3RXGA 2A5KA 3CS0A 4WWYA 1ETSH 1GCDA 1GI4A 1ZTLA 4ISIH 1O2NA 1TB6H 1GI6A 1XXDA 2J5UA 4Q80A 4MNVA 2GT8A 3SYJA 5CHAC 2R0KA 3QN7A 1GBMA 3TNTA 3SNDA 3A7WA 3GY4A 4PROA 1O3AA 4ZH8A 1EJNA 3V0XA 2VIOA 3E0NB 3OY5U 2Q6FA 5ABWA 3OEED 4HG6A 3GCNA 2HWLB 1MMJN 3ZVAA 4ACAA 1QL8A 5A8YA 1SB1H 1DUAA 1EAXA 5E2OA 1IQFA 4ACBA 1GHBF 1GHYH 4Z6AH 2NWNA 5L2YH 1MTSA 1PJPA 3TU7H 4ZHAA 1AVGH 4XBBA 1TOCB 1C1QA 3OU0A 3A81A 1O34A 1C2EA 2R0LA 3UWIA 1TLDA 2DUCA 4CREA 1YCPK 3T29A 2BVRH 2ZTZA 2ZDMA 1BRAA 4NZQA 3IWMA 2QF0A 1VGCC 2FO9A 1KMHB 3AASA 3F2HA 1ANEA 3NK8A 1P2IA 1VGCB 1CSOE 3ITIA 1PQAA 2F9BH 2A7JA 1PYTD 1XXFA 4JMYA 3LU9B 3V13A 4CH8B 1KYNA 3T25A 4D9QA 4DIHH 3R0FA 5K0HA 1GI2A 1ELDE 1O3BA 1RS0A 4FU9A 3B8JA 3KQCA 4TWWA 1LCYA 5F03A 1P9SA 4J1YA 4INHA 1TA6A 1OXGA 1GBTA 2J97A 1P12E 1SLVB 6LPRA 1L1JA 1YLCA 1O38A 2M5TA 2QXJA 1OP8A 1C1TA 1TONA 3DFLA 1DWDH 4ABIA 3MOCA 1NRRH 3D62A 4OS4A 5E2PA 2LP6A 2CJIA 3HGNA 3EDXB 5HYOA 2BVSH 1O2RA 3RXUA 1LHEH 3F9FA 1GI3A 2Z3CA 2ZG0H 1NESE 1KY9A 1JWTA 2UUFB 1ELTA 5AHGH 6CHAC 3M3VA 3RXRA 3M61U 1DUEA 3M37A 3RXSA 3VB6A 4Y0ZE 3M35A 2ZNKH 1TMUH 3RXDA 3MH7A 3EQ0H 1G3EA 2A7CA 3BTDE 3RMNH 1GBDA 3DSOA 1NFWA 4MNXA 2XWBI 1GJ4H 1M9UA 2H9HA 3FP7E 4GUXA 1DX5M 2JKHA 1FN8A 2EQNA 1EP5A 1FPCH 1TGBA 3EE7A 1OSSA 2PKAB 2XTTB 3M7TA 3S69A 2J94A 1SGDE 1B0EA 3BG4B 3GDSA 1V2TT 4FUIA 3FOAA 1C5TA 1TX6A 4HGCA 4WMFA 5HIYA 1O3GA 3SHAH 3I78A 2JETB 3ZZCA 3OX7U 4UEHH 1UHBB 3KN2A 1KDQA 2HOBA 3L33A 4I32A 2BDBA 5JYIA 2Y7ZA 4WXIA 1O39A 4ZXXH 3BSQA 1O2SA 4Q7XA 4AGJA 1YPHC 1O2QA 2FI4E 2TBSA 2OBOA 1QQUA 1FY4A 4K1EA 1QB6A 3QUMP 1B5GH 2O8WA 1JRSA 4K5ZA 1EX3A 4R0IA 4BAKB 1V6DA 4U2WA 5IK2D 3QZQA 2FOHA 1O2MA 4MPVA 5FPTA 1QB9A 1W2KH 2F4LA 2GCTB 3UOPA 3KF2A 1PPGE 5F8XA 1AFEH 1ZTJA 5T3HA 3F2GA 1TNJA 5A0AE 3ESTA 4AFSA 2H6MA 3NCLA 2C8WB 1J14A 3V3MA 3NRLA 2W6ID 3T26A 2AGGX 3GCOA 3I77A 2ANYA 1KXFA 3JZ1B 1CA0B 1UK4A 4I8LA 1TX8A 1MKXK 5KEDA 1Z1JA 1DWEH 2PHBA 3URCA 1C5YB 2Q1JA 2D26C 5EXNA 1CT4E 3MTYA 4UD9H 3LJJA 1HNEE 3RU4D 1JIMA 1GVLA 2QV1A 3VXFH 4WMEA 1T8MA 2Y5FA 1SL3A 1CBWC 4Q7ZA 1ZHMA 1GJAB 4FUGA 3SW2B 1KXAA 1S83A 1CBWB 2Z3DA 3SGQE 2HLDD 2WPIS 4ASHA 2FODA 2BZ6H 4ZROA 3QTVH 1EQ9A 2ZHDA 1HJ8A 2B5TB 1SG8B 4FUFA 1YBWA 3U1JB 1DWCH 3RXLA 1XUKA 5ESBA 3ATMA 1RTKA 1INCA 4ZAEA 1KXEA 2FLRH 3MO3A 3VEQB 1P3EA 3E3TA 3T27A 2ZDVH 1CHGA 1LO6A 2ANKH 4B2BA 2BLVA 2J92A 4FOUC 4JZDH 1AN1E 3BTEE 2EI6A 1RIWC 3QZRA 2G4TA 4Q7YA 2KZ4A 1RIWB 4Y10E 2JH6D 2WPMS 5HIZA 1G36A 4X6PA 1G3CA 3OEHD 1T32A 1T31A 1QIXB 4RN6A 3UR9A 2ZFSA 2OQUA 1V2MT 1K1JA 2QGRA 1O2IA 5AVDA 1E0FD 1TX7A 3SU4A 2HPQH 1OWDA 3OYPA 2WINI 2ZFRH 1P2JA 1ZSJA 2OD3B 1BTHH 3OFND 3V12A 1EATA 4X1SU 1P05A 4XE4A 1C1UH 4KTCA 5DP5A 3MH6A 1LVBA 3LT3A 1XVMA 4CBNA 4E06H 2GKVE 3BG8A 2P8OC 2AH4X 4CRAA 2GCHF 2AS9A 2P8OB 2ZCLP 1MCTA 2O9QA 1TQ7B 1HDTH 1QRXA 3GYMA 4DT4A 5C0UA 2C8XB 4TSFD 1Z6JH 4GAWA 1DS2E 1E34B 1FQ3A 1HUTH 2H9EH 1AU8A 1HJ9A 2XOKD 4DCDA 1FLEE 5ESTE 5JBCS 1BTXA 3VGCC 2G8TA 1ZRBA 4DIIH 1YCPM 5HMAA 4K1SA 2KCPA 1HAGE 1WCZA 1HXFH 2UWOA 1A7SA 2A4QA 2OC8A 1DE7H 3PLPA 2CF8H 4FU8A 1ANDA 2OK5A 3K6ZA 5SGAE 2BY6X 2J34A 8LPRA 1J17T 1UTJA 2HPPH 1PPEE 1WOFA 1QNJA 2H5DA 1C2KA 2FZZA 2V3MA 2ZU2A 1K2I1 3PRDA 4UFDH 4UFEH 1L1NA 4FUEA 3TPIZ 3U1IB 5DP8A 1QZ8A 3KQBA 1H1BA 1TA2A 4WH6A 1ZSKA 1K1IA 1Z8RA 2ZGBH 4FUJA 2BVXH 4B75A 2UUJB 4YOJA 4ABFA 4JZEH 4K2YA 4B74A 4YLQH 1A0LA 4ABDA 3S0NA 1QCPA 1BIOA 1Y3YA 1BTZA 3SJOA 4CRBA 5I46H 1EKBB 4AGKA 2GZ8A 2XCNA 2ZEBA 1Y3WA 1Y3XA 3S9BA 1CA8B 1VZQH 2BLOA 2XBXA 5LPEA 3PWBA 1NROH 1O2UA 1GBHA 1O3OA 1K1MA 1IQKA 4QT8C 3B9FH 4XBCA 1C5SA 2FOGA 2RDLA 2FP7B 3M36A 3E16B 3VXEH 1FY3A 1W0YH 1T8OA 1K1NA 1DXWA 3O8RA 3RU4T 3ZVDA 1A5GH 2GGVB 1L0ZA 2BQ7B 1GCTC 1SBWA 3DSPA 1NRNH 1PQ5A 3MO6A 1A4WH 4HZHA 1V2VT 1YPKH 2J9NA 3D49H 1GDQA 2HALA 2QXIA 1EOJA 1YPLH 4YOGA 1JRTA 1GHZA 2TIOA 3O8DA 3M5NA 1WDIA 3Q76A 3TGJE 1C1NA 1GL1A 4F49A 1FXYA 1HAVA 1UK3A 2TGTA 1IQIA 1XX9A 1C2IA 1QRZA 3CP7A 4Y6DA 2QCYA 1UK2A 2Z9GA 2ZU5A 2Y6TA 1OYQA 3ZZ7A 3FAOA 1WBGB 4B73A 3UOUA 4ZKNU 2OC0A 1KXBA 1P9UA 4K60A 1ZMNA 2NU3E 2Y5GA 2CHAB 1CU1A 2VIDA 4AFQA 2ZPSA 2I6QA 3LPRA 2SNVA 1OPHB 1UTPA 1XKBC 5A8ZA 1D9IA 3E0PB 4WY3A 1FNIA 1L2EA 1MUEB 2QAAA 1BTYA 2O8MA 1BMAA 1SLWB 1GDUA 1LKAA 1UCYK 2P3FH 1GG6B 1D3DB 5IYTA 1IQMA 1C4V2 3UIRA 3DUXH 1TBRH 1BTWA 1UVOA 1MD8A 4Z1MD 2R2MB 1Z8IB 1GJBB 1O31A 4I8JA 3RLWH 4WMDA 3A88A 4IW4E 1YY3A 1FDPA 3A7VA 3U8OH 2P16A 1PFXC 4Y11E 3UWJH 3E90B 4VGCB 1EPTA 1ETRH 1O2PA 2OLGA 3W1EA 1HXEH 2ZHEH 1EJAA 1NN6A 3GY2A 4D7FA 5IDKA 1C5VA 1OWIA 2HGTH 3HGPA 1BB0B 3A84A 3KGPA 5DGJA 1GI8B 1P2QA 2YMSC 3RLYH 1ZPBA 3LGTA 4IMZA 3GY7A 1C2JA 1MBMA 4X8SH 4YO9A 1XUGA 4BAQB 1S84A 1NFXA 2HVYB 3RP2A 1GJ7B 2ZGHA 3TJUA 1P06A 1QGFA 3SV6A 5F8ZA 1BMMH 1HV7A 3SU6A 4Q63A 1LKBA 1TPAE 1MTNB 1TGNA 2Y82A 3RXEA 1FY1A 2FI3E 1VITF 4U01A 2HVXA 3PLBA 1KDQB 2CGAA 1BZXE 3OE7D 1THPB 5LPRA 1AB9C 1HJAC 1WQVH 3LKWA 1NC6A 1P2MA 3FP6E 3RXMA 1AE8H 4B6FA 1G2LA 2OINA 1SGFG 3F1SB 4HI3A 2V7QD 3PLKA 1WSSH 4DVAU 2VU8E 2V3OH 3MU5A 3EA9A 4X6MA 3RXVA 1F0UA 3UUZA 5L30H 4IC5A 2KFWA 2ZFFH 1IQHA 1PPBH 1NRSH 1S6LA 5DN6D 4KELA 2IJOB 4ABBA 4E05H 2WPLS 4OM9A 2RA0A 1BMNH 3SN8A 3BTWE 1MU6B 4OGYA 1E35B 3WWBA 2ZU3A 4BOHA 3SO3A 1ESTA 3ENSB 2FYQA 2OXSA 4OS7A 2ILNA 5C3NA 2QF3A 2ALVA 5AFZH 1ZHPA 3EAJA 2R2WU 2HLCA 5GCHG 3SQHE 3UNSA 2FOFA 1NBME 1P57B 4AORA 1OWKA 1S81A 1BQYA 1C1PA 2FTLE 8GCHF 5J4SA 4RKJB 4ZHLU 1O2LA 4HFPB 3V7TA 4GCHG 4GPGA 1CVWH 1GGDC 2NU1E 3P8FA 2PKSB 5F6MA 2XCFA 1ANBA 1W14U 1W12U 1O35A 2BD4A 5JPMH 3TLOA 2BX3A 1CHOG 1C2FA 4J2YB 4NIWA 1QL9A 2STBE 4MTBA 4D7GA 5ETXA 2OQ5A 1AKSB 2OUAA 4TWYA 5EW2H 2FLBH 2Y81A 2VB0A 4ZXYH 5B6LA 1DSUA 4IGDA 1C5LH 1MBQA 1QA7A 1P10A 2C8YB 3ZZ4A 2BY7X 2YMSD 3A85A 5T6FA 5LGOA 2B0FA 1ESAA 1A3BH 3SZNA 3SHCH 1SVPA 1LHGH 2ANMH 2P3TB 1H4WA 4LOYH 1HCGA 3CENA 7ESTE 1UW7A 3MYWA 4ABGA 3PV4A 1VCQA 3N7EA 3NXPA 1Y8TA 5CHAB 7KMEH 4JYTA 1F0SA 4MPUA 3A87A 5TJXA 1C2DA 2J2UA 3RXJA 1DM4B 1O36A 1MU8B 2J98A 2VGCC 2ODQA 1C2MA 4Y7BA 4Y8ZA 2VGCB 4E7NA 4B76A 4CR9A 1C5UA 3ZYDA 1Z6EA 4MQAA 3AAUA 1T7CA 1TMBH 3A80A 2CK3D 3DHKH 5PTPA 2NU2E 2BDIA 1P09A 1LPKB 1UMAH 1ELGA 2ZDLA 5EXLA 1GBCA 1ZR0A 2OBQA 3SJKA 1O2WA 2ZIQH 1P03A 1F5KU 5GWZA 1T8LA 2SGQE 2W5EA 1V2LT 3K6YA 1LHCH 5AFYH 4ABEA 1UCYH 4H6TA 1TBZH 1MTVA 3P95A 4YT7H 2ODPA 3PTNA 1O5BB 3KQEA 3WY8A 1TRMA 5C5OA 1BJVA 1HAZB 4NCYA 2GDDA 2Z7FE 4RT0A 1O5FH 4NA7A 4AN7A 5CE1A 1E1QD 1DITH 5GIBA 1HAXB 1SGNE 3MI4A 3SU0A 2FS9A 3LC5A 4A5TS 1K0HA 1EASA 2EA3A 2AGEX 5C1YA 4KGAA 4NG9H 5DP6A 3SNEA 4NA8A 1UVTH 5H4IB 3SV9A 2PTNA 1ETTH 1NY22 1O37A 1HAPH 4IMQA 2R9PA 4Y76A 2LNCA 2GJGA 4BTTB 2SGDE 2ZCHP 3LGVA 3HK6B 1OHHD 1NM6A 1TALA 1O2GH 1Z8GA 2FEQH 3STIA 1AQ7A 4I86A 2BX4A 3VB3A 3FVFB 2VWMA 3IG6B 1G2MA 4TT3D 2FYRA 3LGWA 3GISB 1TFXA 1LHFH 6CHAB 1NRQH 3SI3H 4K8BA 5JBTA 1GMDF 2XBVA 1D3QB 3S7KB 1AI8H 4GLYA 1C9PA 1YYY1 3QX5H 2A2QH 3UQOA 1UTKA 4BXSA 4CHAC 1GHAG 1TABE 2QY0B 2AMPA 2AMQA 1SGYE 3O8CA 2H9TH 1TIOA 2VNTA 2PW8H 2VH0A 2LPRA 1BUIA 2BXUH 4YTAA 4O97A 3TK9A 1EP6A 1VR1H 1KSNA 3RC5A 5EW1H 1BBRE 4X6NA 1SHYA 1YPMH 2XYAA 4LZ1H 2A31A 1S0RA 1BDAA 1GI7B 4H6SB 5C0TA 4JCNA 4CH2B 2A5IA 5FBIA 3P8OA 4ISNA 3MMGA 4ZUHA 1LQEA 3BF6H 3HKIB 2W26A 1UVPA 1P01A 4MNWA 5CMXH 3AVZA 1S5SA 1DICA 1SC8U 2HNTE 1HIAA 1SGCA 1XKAC 3GY5A 1EFRD 3C1KA 3ZYEA 3MNBA 5DP4A 1ZJDA 2A45B 4DGJA 3PMAB 1GL0E 4IN2A 4ISOA 3TGIE 5AF9H 1RJXB 3MNXA 1NZQH 2TGAA 2BOHB 3PROA 1MTWA 2XNIA 3UPEA 1CGJE 2ZGCA 1EB1H 1P2KA 1PPHE 2G5VA 1ZTKA 1DVAH 4DURA 1P8VC 4XRNA 3SJ8A 1H9LB 1Y59T 3EE0B 3KL6A 1QA0A 1TNGA 1A5HA 3TK5A 1N8OC 1WUNH 1ZGVA 2BTCE 3RXPA 1VJAU 4ZKSU 3RXFA 3SV2H 2WV9A 3RXTA 4ZKOU 1W8BH 3SORA 3TJNA 1SSXA 5EODA 2K1QA 3K9XB 4MLFB 1AGJA 5FPYA 5FPSA 3BV9B 3QLPH 1MQ5A 3QTOH 4Y71A 1EPTC 4M7GA 1P2NA 2ZDKA 3BTQE 1GPZA 3RMMH 3PWCA 3SNBA 4B2CA 4DT7B 3ZZDA 1TE0A 5E8EH 1KIGH 3BIUH 3N99A 2W7SA 4X0WU 1V2ST 1HPGA 3DA9B 1FAXA 1SMFE 2G51A 2A5AA 1O2JA 3GCHC 4AG1A 2ZCKP 4MG3A 3RXAA 5C67A 2CN0H 1A0JA 3RXIA 3WWFA 6GCHF 3MU4A 1A1RA 3SU3A 3UB0A 2PFEA 1C5MD 1EXFA 3P6ZB 2JIZD 3RM0H 2BZAA 2SNWA 2W3IA 4TY7A 1UJ1A 3UFAA 2QE7D 2QYIA 1O2XA 2FS8A 2WHXA 1V2OT 3M5MA 1W7GH 5EU8A 4IS5A 4XD7D 3GY8A 1LMWB 1N6YA 3SV8A 1V2KT 3Q77A 1D4PB 3BTKE 2BOKA 1O3KA 4Y79A 1GI0A 4O9VA 2F91A 1AIXH 4AYYB 1Y5UT 2KM0A 3KYFA 4UDWH 4WXVA 4AC9A 3RXKA 1YP9A 1VJ9U 1E79D 4BNRA 3BN9A 4LK4A 5GXPA 1ELFA 1K28D 1ELVA 1TRNA 3VGCB 3PMJA 4NWLA 1D3TB 1NS3A 4DW2U 1NU9A 2SGPE 2R3UA 3LJOA 1BRBE 3U9AH 3SNAA 1GHVH 1NTPA 4P02A 3P8NA 4CR5A 1F92A 1GJ8B 1JXPA 1RGQA 3SI4H 2PGBB 3M5OA 2GMTC 4K1TA 5B6OA 1K9OE 1Q3XA 2XWAA 4MVNA 1UTNA 1L4DA 3SUEA 1DANH 4D76A 1WYKA 1IAUA 3M3TA 5JDUB 1O3CA 1C5QA 5GJ4B 4X1RU 1O3IA 1Z1IA 1XVOA 2H5CA 3ZZ3A 1C2LA 3DSGA 2G55A 1BA8B 3A7TA 7GCHG 1SHHB 2ZQ2A 3A89A 2AYWA 1PPFE 2KX4A 2EC9H 1BRCE 1ZJKA 3F2FA 1QJ6B 3A8DA 2SGEE 2BB4A 2WPKS 4K8YA 5FCKA 5A0CA 1FIZA 1OP2A 1GHWH 1P0SH 1SGFA 1JOUB 2Q6DA 3G01A 1G3BA 1V2RT 3OY6U 4X8VH 4INKA 1LVMA 1GBLA 1KLIH 2BYAX 1SGQE 1YPGH 2FI5E 2IN2A 3RMLH 4ZCNA 2A0QB 4JK5A 1IQNA 2ALPA 1KTTB 5FAHA 2FOCA 5EGMA 5EJZA 1THSH 2IPQX 1QHRB 2BD9A 1GWAA 1IHSH 3TVJB 3M7QA 1GCTB 5TCCA 3SQEE 2P59A 4Z0KA 2PKAA 4ASUD 1MAYA 4LZ4B 1FY8E 2AIPA 3CS7A 1OX1A 2ZU1A 4FU7A 1SQAA 1COWD 1EB2A 5HM2A 3DT0H 2GT7A 1C1WH 4TPYA 3GY3A 3MQKC 2CMYA 4JZ1A 1AVWA 4FUBA 1G30B 5DP3A 2FX6A 3MHWU 2QF5A 2KAIA 3H7OA 4HTCH 4I8KA 1GMCG 5A2MH 1G37A 3A7XA 1SKYE 5L6NH 3Q3YA 1KLTA 1TRYA 5HGGA 5LPFA 1K1PA 1AUJA 1YC0A 1W13U 3LOXA 2FDAA 1QBNA 2W3KA 4O3UA 3ZVGA 3RUOA 1QJ7B 4WJG2 2J4IA 4I8GA 1G32B 1DPOA 3BEFB 3EA8A 4Q4LA 2Z3EA 5FCRA 4FUHA 4X2XA 1HRTH 1MKWH 1H8ED 1GI5A 1HLTH 2FPZA 5KGOA 1RXPA 1GMHG 5EQRA 2A4OA 3PYHA 1SGIB 2UUYA 3F0PA 1FY5A 2G4UA 1W7XH 3KYGA 5EQSA 4I7YH 4AX9H 3RDZA 3KQDA 2QC2A 1F5RA 1LPGB 4I31A 1AY6H 1RFNA 2KR7A 3B23B 3UNRA 2ZHQH 2ESTE 2AEIH 4IN1A 1HBTH 1GJ5H 3A8CA 1K1LA 3RC6A 5T6DA 1WU1A 4FVDA 3PO1C 4KP0A 3KQ5A 3PO1B 1YF4A 3GCTG 8GCHG 1XUJA 2TPIZ 5I25A 2BDAA 2VH6A 3F9EA 1C5XB 2SFAA 3VPKA 5CDFE 3PMHB 2YMSB
chains in the Genus database with same CATH topology
2JH0D 3TIUA 2FX4A 2B8OH 3GS9A 2WPJS 1B7XB 3ZZ6A 1JMOH 5E0HA 4YZUA 2XRCA 1K22H 1A46H 1ZSLA 1XM1A 1C2GA 4X6OA 1X7AC 1HAYB 1DLEA 3FN8A 5HKKD 2BY9X 1FMGA 4AB9A 1UTQA 5TCAA 1BJUA 3FP8E 3UY9A 1O3NA 4YM9A 2Z9KA 1CGHA 1AB9B 1HJAB 4NA9H 1H8HD 3QWCH 3ATIA 4XBDA 4DG4A 1P04A 3TITA 1FIWA 1C5ZB 2C8ZB 1O2YA 1GBEA 1HIAB 1SLXB 1TYNA 3SOSA 3U69H 4SGBE 1UVUH 2K0QA 3Q3XA 2VIPA 1W0ZU 5DK1A 1ELEE 1O30A 4JYUH 1YPEH 2FOBA 4OGXA 4OS1A 4IBLH 3ODFA 3NKKA 2WPDD 3RXCA 5K7RA 9LPRA 3P17H 4X1PU 4NIVA 3RC4A 3E1XB 3ODDA 5JBAS 1TPOA 3GICB 5EXMA 1GHBG 2AMDA 1TGTA 1DY8A 4Y8YA 1JIRA 2Y80A 2AFQB 3A82A 2TGPZ 4NZLA 4AFZA 2AHME 1CE5A 3ATLA 2PSYA 4GSOA 2ZFTA 4FVBA 1OKXA 2GVFA 2A32A 1NFUA 1SGRE 4KTSA 2XBWA 4X8TH 4FETA 4A1VA 2VBCA 4FUCA 1GGDB 1L4ZA 1AO5A 4OS2A 3ELAH 1GBKA 1O3JA 1PYTC 1AE5A 3MU8A 2C3SA 5FL7D 1SPJA 3EA7A 2G5NA 3E8LA 3RXOA 3L6PA 2EI8A 1GBBA 2PUXB 2HNTC 1KLJH 3F0OA 2BDYA 2O8TA 1FN6A 1EZSC 2ZPQA 3FZDA 3DD2H 4CBOA 4Y0YE 3NZIA 2YMSB 1ACBE 3ZVEA 5F8TA 1CO7E 1UTLM 3DFJA 4Y8XA 3SJ9A 1ABIH 1F2SE 2TRMA 3TJVA 4H4FA 5C1UA 1O2OA 2VVUA 2FXRA 5JB8S 4XOJA 1GI1A 4GHTA 3FO8D 2ZZUH 1TPPA 2DE8A 1W10U 4BAOB 2AIQA 1O3EA 5G4BA 2IPHA 5EG4A 3UREA 1GBAA 2P3UB 1ELAA 1C4U2 1PQ8A 1V2NT 1FV9A 1KXDA 4JK6A 1BHXF 3MH5A 1DSTA 1GMDG 1EUFA 1Y5BT 2FOAA 4U30A 4ISLA 2Z9JA 2P95A 1TNLA 1QFKH 2Z9LA 1C4Y2 4U32A 3IITA 3F3BA 1O2HA 1TPSA 1V2UT 1WAYB 3M5LA 2ZDAH 3OTJE 4X1QU 1ANCA 4OS6A 1UVSH 1QBOA 3ZZBA 1O2TA 1H8IH 4DOQA 2YOLA 3F9HA 2BD2A 4TY6A 1QL7A 3S9CA 1NO9H 1BTPA 1ZHRA 2GP9B 4A1TA 4DJZB 2GTBA 1ZGIA 5A09A 2O8UA 3VB7A 2ZF0H 4YOIA 1W11U 1TBQH 4H42U 2JJ2D 4TYDA 3BEUA 2VIWA 3E91A 6ESTA 5T1VA 2F43B 3ZV8A 1SGEE 4TPIZ 5GCHF 3URDA 2NU4E 4A1XA 1O3LA 3BTHE 3N7DA 3QGNB 2FOMB 1KTSB 1L1GA 2AERH 4BTIB 4GCHF 1A5IA 1W0JD 1S82A 2ZA5A 3T2NA 5LH8A 1IHTH 1HB0B 2VWOA 1MZDA 3LDXH 1D6RA 4YT6H 3S7HB 4RKOB 5C2ZA 4A92A 2Y5HA 2OCVB 1GJ6A 2XW9A 1O5CB 1CHOF 3N7OA 3A83A 4BAHB 3O8BA 1EJMA 1AMHA 2VJ1A 3PV2A 4A6LA 3QK1A 4F4OC 2ZECA 4CRFA 1ID5H 1CGIE 3DCLA 1TNIA 1Z71A 4B71A 2D8WA 2K8IA 2CXVA 1LVOA 1O2KA 2B7DH 1ZYOA 2XBYA 4JZIA 1DLKB 1LQDB 1D3PB 1S85A 4YESB 1MD7A 2PR3A 4X2WA 2ZHFH 2VWLA 4NGAH 7LPRA 1MABB 2HRVA 4ZKRU 2FM2A 1HAIH 2G00A 4MDSA 3HKJB 3UR6A 1BHXB 2V0BA 3H7TA 1NRPH 4CHAB 3GYLB 1MAXA 5EOKA 2RCEA 3C27B 2VIVA 2IJD1 1FAKH 2P94A 5A8XA 2FIRH 2JJ1D 3T5FH 3GY6A 1ZZZA 1P3CA 1EZQA 3LGUA 3M7UA 4NIYA 1Z7KA 2ASUB 3BTGE 1O3FA 1SR5C 2BDHA 1ESBA 1GBJA 5CHBA 1IQGA 4IC6A 1SFQB 3W94A 2FOEA 2YNBA 1BRUP 1G3DA 2W6JD 5J4QA 5GNDA 3BG4C 1SGPE 1LDTT 2D2DA 3F9GA 4UE7H 1SOZA 3BTTE 4X1NU 5DP9A 3L3TA 2C4FH 2JETC 2Z94A 3H09A 1OP0A 3S9AA 3NPSA 3K65B 1EAWA 2ZC9H 3R3GB 4K3JA 4D8NA 6GCHG 1HAVB 4F55A 1CT2E 1VCPA 2ZPRA 2BQWB 3WW7A 1WTHD 4UFFH 3SJIA 1IQLA 1ELBA 3U98H 2WSSD 2KAIB 1LHDH 3H5CB 1BITA 1GBFA 2ZTXA 1H8DH 1QURH 3I29A 3A8BA 3ZZ8A 4NSVA 1MTUA 1AWHB 1GDNA 1OWEA 2GCTC 3Q3KA 4WH8A 2ZTYA 2GCHG 2BD7A 1C5RA 4B2AA 1IQEA 1DDJA 4DY7B 3RXQA 4KTUA 8ESTE 1AZ8A 1O5EH 3BTFE 2UUKB 4GVUA 1AUTC 2SGFE 1E38B 3FANA 3A8AA 3SUFA 1N8OB 2CV3A 5DO4H 1ZMLA 1CA0C 2RA3A 4KKDA 4XDEA 1FX0B 1ABJH 1J15A 1OWJA 5A0BA 1XUHA 3MO9A 1V2JT 1ZMJA 1TOMH 1F0RA 2M2AA 1SOTA 1W3CA 2ZGXH 3MU1A 1P11E 1D6WA 1BBRK 2GD4B 2OC1A 1MH0A 4MPXA 2ZP0H 3LGYA 3F6UH 5C20A 1O3PB 1TNHA 4ABJA 1EPTB 2F9OA 3E6PH 1F5LA 2Y7XA 4MNYA 2Q6GA 1G9IE 2BD8A 1ZPCA 1TWXB 3ATKA 1GHAF 3AAVA 1MKWK 4X2YA 3SNCA 3TH2H 1DOJA 2ZQ1A 1O3HA 2TGDA 4GHQA 1UTOA 1XUIA 1ZRKA 4K69A 3VFEA 1EZXC 1E36B 2JDID 4THNH 3U8RH 3GCHB 1GVZA 1AKSA 2BHGA 1NT1A 1T8NA 1AWFH 4AFUA 2D1JA 1QB1A 3EYDA 3VB5A 2AGIX 2KCOA 3BTME 1GJDB 3MNSA 3QO6A 1P02A 1CQQA 5EPNA 1TGCA 5FHTA 2GZ7A 5BRRE 1Y5AT 2V3HH 3KEEA 3RXBA 4MPWA 3ZZAA 5GPIB 2GV6A 3A7YA 2FMJA 3M3SA 3RU4E 3SUGA 5DPAA 1SFIA 3MNCA 1YCPH 1WV7H 2ZU4A 3FKSD 1PPZA 2EEKA 5DP7A 1OS8A 2GX4A 3MWIU 4OS5A 1A0HB 1BOQA 1GJCB 1FZZA 2SGAA 1P2OA 4O03A 1GJ9B 3TK6A 2PGQB 1S6HA 3EGKH 2BDCA 3JZ2B 3NUMA 4ZMAH 2V35A 2A4GA 1B0FA 2GZ9A 1A3EH 3SV7A 4INLA 3STJA 2XNDD 3ZVFA 2ANWA 2Z6BD 1RRKA 3HPTB 1FONA 1V3XA 2QXHA 2L6OA 2XC4A 1S6FA 1RD3B 1ZLRA 1C2HA 2G81E 2PSXA 2F9PA 2BMGB 4BTUB 2GMTB 3AK5A 3MH4A 2PV9B 2FWWA 1U6QA 2JH5D 2VIQA 1AVXA 4XSKU 1E1RD 1A2CH 4X8UH 3ZVBA 1PPCE 1BMLA 1FJSA 1JBUH 1TGSZ 3AW1A 1QRWA 4Q2KA 3HK3B 1BTUA 3W95A 2G52A 2A7HA 2ZI2H 1EAUA 1YPHE 1C5WB 4YLUA 4D9RA 2R3YA 5FX5A 3LH1A 1MZAA 4AOQA 3T62A 2YNAA 1ORFA 4UONA 3PB1E 1FPHH 3ZIAD 4ZHMU 3TH3H 2C90B 5EPYA 1O2VA 4I8HA 1TNKA 2A4RA 3PM3A 4WVPE 3SU1A 3P8GA 3FZZA 2PWXA 3FFGA 3VB4A 2PLXA 2BDGA 1Q2WA 1YGCH 2OP9A 2BY8X 4BXWA 2QN5T 1S0QA 1YKTA 1H9HE 2STAE 4FUDA 3Q00A 4CRGA 1C9TA 3RM2H 1OWHA 2ZFQH 2EI7A 1UCYE 3MU0A 4AZ2B 3PRBA 3A86A 2ZWLH 5FBEA 2KCYA 1HAHH 1BCUH 1GBIA 1J9CH 2F9NA 1QQ4A 3PTBA 4CRCA 2WPHS 2WZQA 1EAIA 1O3MA 3HATH 3GOVB 3OSYA 5DG6A 4ABAA 1UHBA 5E0GA 4LXBH 1WQSA 4ISHH 1MQ6A 1YM0A 3UNQA 1J16A 4AYVB 1W0KD 4YXWD 1IQJA 3P92A 1RTLA 2OC7A 3KHVA 1AZZA 5C1XA 1Z8JB 1KXCA 4CRDA 1VITG 1O3DA 1MKXH 1O32A 1ELCA 2DE9A 1TMTH 2VVVA 2WYJA 1SQTA 4AG2A 3MFJA 2O8LA 1O0DH 4BAMB 4AB8A 2V6NA 1BBRH 1HFDA 1O33A 3SGAE 1MCVA 1EOLA 1AD8H 1K21H 2F83A 1QY6A 1DT2A 3ZZ9A 1O2ZA 2PTCE 2WV4A 3UTUH 1CT0E 2BD5A 4RI0A 1LTOA 5EQQA 4XFQA 5JBBS 1FUJA 3TNSA 1OOKB 3TGKE 2WYGA 2CHAC 2I6SA 1A61H 2GDEH 4O3TA 4NFFA 1BT7A 1QJ1B 1Y3UA 2H1UA 2Z9IA 2F3CE 1SLUB 2H2ZA 4WF8A 7GCHF 3QDZB 2F9UA 3QGJA 3PV5A 3KNXA 2BLQA 1C1SA 4RSPA 1N6XA 1PQ7A 2XC0A 1GG6C 1H9IE 3P70B 3F68H 2W7UA 4BANB 1UO6A 3SZEA 2J95A 5FX6A 3SU5A 3AW0A 1O5DH 3D65E 1V2WT 1NFYA 1E37B 3BIVH 1VITH 4R8TB 3T28A 4X2VA 1NU7B 1THRH 2XC5A 2BQ6B 4NIXA 4VGCC 2UWPA 3SBKA 3ZV9A 1GVKB 3ZVCA 1LVYA 3SU2A 4NSYA 3UQVA 1QR3E 1T4UH 2PUQH 3KIDU 2HNTF 5E0JA 1VCWA 4B6EA 2IOTA 3KCGH 1NBMD 1DXPA 3OTPA 5HM9A 1XMNB 1TQ0B 5GDSH 2LELA 2WUCA 5T6GA 2QF4A 2XXLA 1AHTH 2BLWA 1C1VH 1RTFB 4JYVH 1C1RA 2F9VA 4UFGH 4E7RG 3GDVA 2RG3A 3D23A 2UWLA 1ZPZA 4ABHA 1WXRA 1C5NH 1MTNC 2VVCA 3SUDA 1NPMA 1SQOA 1SI5H 1GMCF 1ARBA 4Y7AA 2A2XH 2A1DB 1K1OA 8KME2 2KCAA 1DFPA 1QTFA 4FXGH 2QXGA 3BEIB 1C5PA 3GDUA 1YPJH 3OAAD 2NU0E 1LPZB 3LONA 5JB9S 2ZHWH 1ARCA 1WTGH 1BMFD 4B1TA 5C5NA 2BY5X 1HYLA 4NFEA 4ESTE 1DY9A 3VG8A 5DSFA 2FESH 2ODYB 2BM2A 1GMHF 2THFB 2B9LA 5DKMA 3ATWA 3LH3A 3LC3A 2P93A 1V2QT 2J38A 5FXLA 1SGTA 2FTMA 3PMBB 2QA9E 5BPEA 3K2UA 3SGBE 1IOEA 4SGAE 2ZKSA 1AFQC 1YLDA 1GHXH 4M9FA 2ZFPH 1J8AA 1AFQB 3NWUA 1UTMA 4A7IB 1Y3VA 2VINA 3ZZ5A 5C17A 2QIQA 3RXHA 3LIWA 1EZUC 4NWKA 2WUBA 1XUFA 2ULLA 2C93B 1Q31A 5F53A 3GCTF 1C1MA 2BXTH 9ESTA 2CF9H 5L2ZH 2WV5A 1ZOMA 2GV7A 1C1OA 2PKSC 1N1LA 3A7ZA 3RMOH 1OYTH 2OTVA 2VWNA 1DWBH 2BD3A 1HAOH 1QBVH 5DJ7A 5HXFA 3TH4H 1TAWA 2ZDNA 1V2PT 1T4VH 2ZO3H 4JZFH 3LGIA 1O5GH 1HGTH 1FI8A 1F0TA 1GI9B 2ZGJA 1O5AB 3U8TH 1F7ZA 1C5OH 3TJOA 3RXGA 2A5KA 3CS0A 4WWYA 1ETSH 1GCDA 1GI4A 1ZTLA 4ISIH 1O2NA 1TB6H 1GI6A 1XXDA 2J5UA 4Q80A 4MNVA 2GT8A 3SYJA 5CHAC 2R0KA 3QN7A 1GBMA 3TNTA 3SNDA 3A7WA 3GY4A 4PROA 1O3AA 4ZH8A 1EJNA 3V0XA 2VIOA 3E0NB 3OY5U 2Q6FA 5ABWA 3OEED 3GCNA 2HWLB 1MMJN 3ZVAA 1QL8A 5A8YA 1SB1H 1DUAA 1EAXA 5E2OA 1IQFA 1GHBF 1GHYH 4Z6AH 2NWNA 5L2YH 1MTSA 1PJPA 3TU7H 4ZHAA 1AVGH 4XBBA 1TOCB 1C1QA 3OU0A 3A81A 1O34A 1C2EA 2R0LA 3UWIA 1TLDA 2DUCA 4CREA 1YCPK 3T29A 2BVRH 2ZTZA 2ZDMA 1BRAA 4NZQA 3IWMA 2QF0A 1VGCC 2FO9A 1KMHB 3AASA 3NK8A 1ANEA 3F2HA 1P2IA 1VGCB 1CSOE 3ITIA 1PQAA 2F9BH 2A7JA 1PYTD 1XXFA 4JMYA 3LU9B 3V13A 4CH8B 1KYNA 3T25A 4D9QA 4DIHH 3R0FA 5K0HA 1GI2A 1ELDE 1O3BA 1RS0A 4FU9A 3B8JA 3KQCA 4TWWA 1LCYA 5F03A 1P9SA 4J1YA 4INHA 1TA6A 1OXGA 1GBTA 1P12E 1SLVB 6LPRA 1L1JA 1YLCA 1O38A 2M5TA 2QXJA 1OP8A 1C1TA 1TONA 3DFLA 1DWDH 4ABIA 3MOCA 1NRRH 3D62A 4OS4A 5E2PA 2CJIA 3HGNA 3EDXB 5HYOA 2BVSH 1O2RA 3RXUA 1LHEH 3F9FA 1GI3A 2Z3CA 2ZG0H 1NESE 1KY9A 1JWTA 2UUFB 1ELTA 5AHGH 6CHAC 3M3VA 3RXRA 3M61U 1DUEA 3M37A 3RXSA 3VB6A 4Y0ZE 3M35A 2ZNKH 1TMUH 3RXDA 3MH7A 3EQ0H 1G3EA 2A7CA 3BTDE