3RXAA

Crystal structure of trypsin complexed with cycloheptanamine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxaA02
3V7TA 2NU4E 1C1PA 2FPZA 2BHGA 1MKXH 3Q3XA 1F92A 1IHSH 4MPWA 4XDEA 2ZHEH 6CHAC 1HYLA 4R0IA 1TAWA 2XCNA 1W2KH 5F8XA 5E0HA 2ZNKH 3FFGA 1D3QB 1EKBB 1KXFA 1O2QA 3HK3B 5GCHG 4AGJA 3URDA 1TMUH 2GCHF 3ODFA 2JETC 3RXEA 3RXLA 1FY1A 2BY9X 1NRNH 2NWNA 1XX9A 4TPYA 3RMLH 4K1TA 5L30H 1KXEA 1EJNA 2XXLA 3V13A 2K1QA 2FOAA 5L6NH 1CA0C 2PUXB 1O2PA 1P2IA 2AGGX 1GI0A 3BTWE 4B2BA 3A7VA 3URCA 1W12U 1IQJA 1JXPA 1DE7H 3QGNB 1ZRKA 1O2HA 2UUJB 3RXPA 3F9FA 4UONA 2KAIB 1MAYA 1DXPA 5EPYA 4X8UH 2ZA5A 2GV6A 2OBQA 1K21H 1MU6B 2QCYA 2V6NA 1F0TA 3ATKA 4FU8A 2V3HH 1HAGE 4YO9A 2CF8H 1B7XB 1VCPA 1FY4A 3HATH 1P02A 1MTWA 2BDIA 4ZHAA 4NG9H 2BLWA 2XRCA 3LGUA 1XXDA 1WSSH 2CHAB 3S9AA 3R3GB 1OYQA 2FYRA 2GT8A 3D62A 2FYQA 4X6OA 3TNTA 3A87A 2FOGA 3D65E 1HAVB 1AZ8A 1IQMA 3TPIZ 4I33A 1TPAE 4LXBH 1F7ZA 1SC8U 3SNDA 1H9HE 1NN6A 1FIZA 1BTWA 3GDSA 1CQQA 3GCTG 2WINI 1GMHF 5FCKA 3ZYEA 1PQ8A 1RTKA 1J16A 1WU1A 4ABDA 1JMOH 1O2VA 2BLOA 3ENSB 2P94A 1S6HA 5GCHF 1V2PT 3RXFA 2QGRA 4BNRA 1ZHRA 2IPHA 1YPLH 1LTOA 4X6MA 2JKHA 1FUJA 1YM0A 3HPTB 1ARBA 1G32B 3C1KA 3LH1A 1W0ZU 1O3DA 1GJ4H 2XWAA 3VEQB 1KLJH 5A8ZA 1A3BH 2XC5A 1NO9H 2Z9LA 1DANH 3T27A 1T8MA 1GJBB 1C5SA 1C1TA 1PPGE 1O0DH 1N8OC 2H2ZA 2ZU2A 1SL3A 2D2DA 2GT7A 2ZF0H 4BAMB 1JBUH 1N1LA 4BTTB 3MWIU 2VH6A 1IQEA 1AWFH 1C2HA 2CJIA 2D26C 4OS1A 3BN9A 3UTUH 1GBEA 2BZ6H 2VWLA 2SGAA 5L2YH 4K5ZA 3GY5A 4CRDA 5A09A 1ZSLA 3FVFB 3A80A 1C5QA 3T28A 1OX1A 3M5LA 2P16A 3BV9B 1GPZA 5GWZA 1PQAA 6ESTA 4NSVA 1P2KA 2FIRH 1D6RA 1O2IA 1DUAA 2R3UA 4Q7ZA 1PPZA 1C5NH 1O2WA 3F9GA 2VJ1A 1Y8TA 2Y5FA 1Z6EA 5FCRA 1NFUA 2VVUA 4BXWA 1QRXA 1SLUB 2PFEA 4ABGA 1C5WB 5HGGA 1THRH 3UR9A 3B9FH 1GCTC 2PKSB 2ZZUH 4NZLA 1ZSJA 1K9OE 1H8DH 1OWEA 1BQYA 1YPHC 1UHBA 2R2MB 2AIPA 2A2XH 2VB0A 1BCUH 2OLGA 3M61U 1TNJA 3UNSA 1ZLRA 1C9TA 1O2UA 3EA9A 1RIWC 2G4TA 5SGAE 2UWLA 2YNAA 2ANYA 4FUJA 4FUBA 1FJSA 1ZSKA 3RXMA 3PB1E 3GDUA 4SGBE 1P0SH 3T29A 1FMGA 3MH7A 1C4Y2 3ZZ6A 2F91A 3OSYA 1MBQA 1EUFA 4IMZA 2ZU3A 4WXIA 1WYKA 2O8WA 4XOJA 3Q77A 3SORA 1C5VA 2ZPQA 3KF2A 1LVOA 4GHQA 3SJKA 1T8NA 4ESTE 4DIIH 2FS9A 4OS6A 2F83A 3PMBB 5JB9S 1C5YB 3RXAA 2BVSH 4RN6A 1WV7H 1BDAA 2OTVA 2TGAA 3JZ1B 3HKIB 2XNIA 3ZVGA 1NFXA 3RMMH 1JWTA 1P09A 3SW2B 1CBWB 4E7RG 4INHA 2ODYB 2PW8H 1NRRH 2I6SA 1RGQA 4B1TA 3E91A 1NS3A 3NXPA 4K3JA 1Y3UA 1IQFA 1J15A 1F5RA 1OP2A 4MQAA 3RXOA 1SOZA 4BAQB 3QTOH 3GY8A 1GL0E 2QAAA 1BITA 1QJ7B 2PV9B 2V35A 1PPHE 1MCTA 6CHAB 2C8ZB 1O2OA 1E38B 1AY6H 3P8OA 1KSNA 1GBTA 1GCDA 2WYGA 1IOEA 1LQEA 1QCPA 1OS8A 1JIRA 2JETB 3E0PB 1FLEE 1O33A 3IWMA 4FXGH 2OUAA 4Z0KA 1BJVA 1OWKA 4NWKA 2P95A 1FI8A 1P06A 3GYMA 1GI4A 4GLYA 1OWHA 4YTAA 2JH6D 4A1XA 3SJIA 5DP5A 2AERH 4UFEH 5H4IB 1XKBC 1TA2A 2ZCLP 4UEHH 3RM2H 1S5SA 3PO1C 1DY9A 1IAUA 1UTPA 2QF0A 1V2VT 3I77A 1Y5BT 1EQ9A 1D4PB 2Y80A 2Z3EA 1C5LH 4UFFH 1QJ1B 4Q7XA 1LVMA 2GVFA 2H1UA 2BM2A 5FBEA 1W7GH 2STAE 3SI3H 1J9CH 5LH8A 1ZRBA 4CHAC 1BBRE 1O2NA 1UTOA 3UY9A 1TPSA 1VR1H 1GJ7B 4B73A 2PLXA 3SHAH 1TQ7B 3BTDE 1MTNC 2BOHB 2ZKSA 2QXIA 4JZ1A 5A0BA 2SGPE 1DITH 3IITA 1O3JA 3ZZDA 2IJOB 2KAIA 4Z6AH 1EB1H 3R0FA 1ANDA 1FXYA 2EI8A 3FP8E 3K9XB 2BOKA 2BQ6B 1ZHPA 1DX5M 2RDLA 2CMYA 3LJJA 2A4QA 1K1NA 2R3YA 1O32A 1W0YH 4HI3A 2ZQ1A 2SNWA 4ISNA 5DP3A 3DD2H 3P17H 3SU0A 3O8CA 4B71A 3SUGA 2ULLA 1HAVA 9ESTA 3EGKH 1AWHB 1EAWA 1UVTH 3M5OA 1HAIH 2BY5X 3A88A 3S7KB 3RC5A 1ORFA 1P9SA 1ZMJA 1G37A 1O34A 5HM2A 4JZDH 2ZHWH 2A4GA 3L3TA 1YLDA 2ZU4A 4B2CA 4YOGA 1B5GH 1K1LA 1WOFA 1BMLA 2TIOA 3PWCA 1O2JA 3SI4H 2ZDVH 2P3FH 1L4DA 3A8AA 1F0UA 1QB9A 2GZ7A 2DUCA 1HAOH 4X8VH 2UUYA 2A45B 1S83A 1F5LA 2DE9A 1W8BH 4X1NU 2H5DA 3S69A 1Y59T 2HRVA 3SQEE 5DKMA 1CGJE 1DWEH 1SQOA 3SUEA 1KY9A 2C90B 3EE0B 3F6UH 5EODA 3SU5A 1JRSA 1P2MA 3MHWU 4ZAEA 3AASA 3RXVA 2H6MA 8GCHG 1S85A 4U32A 4HFPB 1XM1A 4LK4A 1O3KA 1DSTA 4Y71A 5EXMA 5A0AE 1KIGH 1F0SA 1DWCH 4UD9H 1UTKA 3BIUH 3FP6E 1LHGH 2F9UA 2FESH 1E34B 3PMAB 4YOJA 3NWUA 1C5MD 3LH3A 1NT1A 4CR5A 1GMDF 1T8LA 1O5DH 1VITG 2VWNA 2BY7X 1CU1A 1S6FA 1MUEB 4OGYA 1WCZA 3F9HA 1TX8A 1YLCA 5ABWA 2ZPRA 3QZRA 3HKJB 1KXAA 1GBKA 1O31A 1H8IH 1B0EA 4AFZA 1PQ5A 5C3NA 1ZTLA 1EZXC 2GCTC 3MTYA 1MQ5A 4CBOA 3TJOA 2B9LA 3LIWA 4X1SU 1W11U 3TNSA 4KTCA 1IQHA 1EZUC 3RM0H 3P95A 4TWWA 1GG6C 3PLBA 1ZYOA 1SG8B 1QBVH 3PWBA 1G2MA 2ZWLH 2H9TH 5FXLA 2Z6BD 1TLDA 1HCGA 2FX4A 1S84A 3RXIA 1KLTA 1YPJH 1V2JT 3GCOA 2Z7FE 2BDCA 3GISB 4AORA 1XUJA 4LZ1H 1HPGA 1ELVA 2BLQA 1GDQA 1KYNA 1SLXB 1KXCA 2VIOA 3LGYA 4FVBA 3A8DA 1AVXA 4D76A 8GCHF 1P12E 2ZTXA 4ISLA 3RXUA 4JZEH 1V2KT 3TIUA 1D6WA 3M3TA 5HXFA 4JK6A 2RA3A 1ACBE 4AFQA 1YP9A 2FX6A 5DO4H 1NC6A 2C93B 3MI4A 1MH0A 5EW1H 4FU7A 2QXGA 3CS7A 2ZTZA 2XW9A 1C2GA 4MPVA 3ZVFA 2VVCA 1QQUA 1BHXF 4WMEA 5JDUB 3QDZB 4BAHB 1A0JA 4MDSA 3EYDA 4KELA 4Y76A 1P03A 3SU1A 1MKXK 3SUFA 3ZVCA 2F3CE 1TRMA 2ZFFH 3RXBA 4AFSA 1ZHMA 3MNBA 1EPTC 1FPCH 2QY0B 1GI9B 4X2WA 4UFGH 2AMPA 2WPKS 3OTJE 1SGYE 1P3CA 2TGTA 2BYAX 1MD8A 1BBRH 4Y10E 4YZUA 3PV4A 4ZKNU 4B2AA 1DWBH 1AHTH 2PSXA 4DIHH 2SGEE 5IYTA 1DLEA 1GMHG 1PFXC 1D3DB 1GBIA 5LPFA 1THPB 1HBTH 1QB6A 2PUQH 1EAXA 1QR3E 5ESTE 4I8LA 1K1IA 2BZAA 2FMJA 1VJ9U 2YOLA 3BG4B 2ZDAH 3UNQA 1BTXA 1KXDA 2A31A 3V12A 1GVLA 2AGEX 3V0XA 5J4QA 2XBXA 1LPGB 4K69A 2R0KA 1V2MT 3U9AH 2SGQE 3VGCC 4ZUHA 1O3PB 2F9BH 3M35A 2FI3E 2A4OA 4DCDA 1C1SA 3RXSA 4NCYA 1TGCA 6GCHG 3QLPH 1ABJH 2AIQA 4ZROA 1QJ6B 4UFDH 3QZQA 3ATLA 1GBMA 1TA6A 2O8TA 1AE5A 1XMNB 2EI6A 3EAJA 1Y3YA 3D49H 1ELTA 1ZPCA 3I29A 3KN2A 3LKWA 1ZPBA 1J14A 4MPXA 1XVMA 2QXHA 2BDBA 3HGNA 3KQCA 3M36A 1C5ZB 1ELGA 3OU0A 3JZ2B 1SI5H 3U8RH 3TK5A 1GHYH 1S0RA 2Z9KA 3OY6U 2R9PA 4TYDA 4AZ2B 1SR5C 5FPYA 3V3MA 3A7TA 2OC0A 2FP7B 3ODDA 4AYVB 4A1VA 1TFXA 2VGCC 1GWAA 1PPFE 3KGPA 4NIYA 1GJ9B 2AFQB 4I32A 3O8RA 2Z3CA 4UE7H 1MKWH 1EB2A 4AFUA 2J4IA 1PPBH 4O03A 3ATMA 1FY8E 2FOEA 4ZKSU 4Y0YE 3GY2A 1AB9B 3M37A 1HJAC 1DWDH 2A4RA 5PTPA 2J95A 2C8XB 1LKBA 3NPSA 1GI7B 1UCYE 1CA8B 1FONA 1YCPM 3GOVB 1P3EA 2HOBA 2ZECA 2AMDA 2GMTC 1UK4A 4O97A 5AVDA 1BRBE 1GI1A 1QA7A 3EQ0H 2ODPA 6GCHF 3BSQA 1EOJA 1OP8A 2V3OH 4XBBA 2EI7A 4NIXA 1YBWA 1EATA 1PYTD 4ZXXH 1O2RA 5GXPA 3VB5A 2TRMA 1YPEH 5GIBA 1P05A 2YNBA 1V2LT 2XTTB 1MU8B 1GBCA 1HAZB 2ZDKA 3F1SB 3RXJA 1T31A 1H9IE 1S0QA 4MTBA 4O3TA 3TVJB 1GBBA 4YT6H 1DDJA 1RTLA 1T7CA 3M7QA 4IN2A 2J92A 1BB0B 2FO9A 5B6OA 3PYHA 2ZFTA 3LU9B 3UNRA 3MYWA 5A0CA 1O3FA 5E2OA 1GI2A 4ZKOU 2HNTE 4Y7AA 3D23A 3DT0H 1V2ST 2FM2A 5C20A 1XVOA 3TJNA 4WWYA 3AW0A 3SU4A 4X8SH 3A8BA 2ZEBA 5JBAS 5FAHA 4INLA 3SNAA 3UFAA 5HM9A 4AN7A 1ZTJA 1OPHB 1YKTA 4Q2KA 2EEKA 2ZGXH 1TMTH 5J4SA 4YOIA 1O3MA 2ZU1A 1YPKH 1BMMH 2IOTA 2G81E 5JBTA 1PPEE 4M7GA 3ZYDA 1SHYA 1P2OA 6LPRA 3SU2A 5A8YA 1SFQB 1LKAA 2ALPA 2VINA 4Y79A 3E8LA 3ZV9A 1BTZA 1MTUA 3M3SA 1GHZA 1HRTH 4AG2A 4NA7A 3EDXB 2QYIA 3NCLA 2W3IA 4DJZB 2GX4A 3RMOH 3SZNA 3ZZBA 1SSXA 3K2UA 4JYTA 1C1NA 1PJPA 1HNEE 1INCA 1L1JA 2ZFSA 2OQUA 4MG3A 3TH2H 3UPEA 1SFIA 1C5RA 1EJAA 2C8WB 4GAWA 1SLWB 1O3CA 5T6FA 4OS5A 4ZXYH 1AFQB 1OWJA 1A7SA 3FP7E 3OX7U 1OP0A 3VPKA 4MLFB 1GJ8B 3WY8A 1L1GA 3VXEH 2B0FA 1OYTH 5JBCS 3ATWA 3MOCA 1P2NA 1YCPH 3UWIA 2Y5GA 3ZZ3A 1O2ZA 2F9NA 2OQ5A 1A5IA 1C1OA 4OS2A 1E35B 2SGDE 2XBWA 1F0RA 2WPMS 1UTMA 4K8YA 2BB4A 1GBFA 1UTJA 3FAOA 5GJ4B 3BTGE 4MNVA 1Z8RA 1P57B 3ZZ5A 3CP7A 2G55A 4HTCH 4AB8A 1HFDA 1ELFA 1K1PA 1W10U 2WV4A 2P8OC 1TB6H 5AHGH 3SNBA 1TX6A 2GZ9A 3BIVH 4FUGA 1VCQA 1FY3A 2BY6X 2VH0A 2VNTA 1BIOA 2ZDMA 4Y0ZE 2WUCA 3NK8A 2ZG0H 4FVDA 4XSKU 4ZHMU 2O8LA 1DOJA 1TNGA 1G36A 1CSOE 1O5BB 1RRKA 1GMCF 1AU8A 1QQ4A 2WPHS 3MNCA 1AE8H 1L2EA 3L6PA 3UREA 3PLKA 2ZC9H 2ZP0H 1XXFA 1C2KA 3RXTA 1O36A 1DPOA 3TK6A 4X2YA 1O3IA 1O2MA 2SGFE 2F9OA 1QNJA 2BQWB 2HPQH 1NPMA 1GI6A 3TU7H 1BTYA 1SBWA 2Z9JA 2Y7XA 1P2JA 2BD5A 2JH5D 1AI8H 5LGOA 2XC4A 3AAVA 1C5OH 2G00A 2P59A 5FX5A 1GDNA 1SQAA 1DLKB 3KQDA 2FOFA 4A7IB 1TGTA 3KIDU 1LO6A 1GI8B 2ZFPH 3U98H 2ZQ2A 4GPGA 3T25A 5E2PA 3U8TH 5CE1A 1CA0B 2ZO3H 1GBAA 2FS8A 1G3CA 3A86A 1TNIA 2CN0H 3VGCB 1GHXH 3MH5A 3OY5U 3SV6A 3LT3A 3SGAE 4F49A 1MMJN 2A2QH 1ELEE 1DUEA 3SGQE 3SV9A 1VGCC 1D9IA 4DY7B 3HGPA 5BRRE 1SMFE 1WUNH 1O39A 1V6DA 3DUXH 3Q00A 4PROA 4U2WA 5TJXA 1K1MA 1UCYH 9LPRA 1JOUB 2FXRA 5LPEA 1C5XB 1AIXH 3BEUA 3QUMP 1ETSH 4Q7YA 4IC6A 3S0NA 3A82A 1NFWA 4ABJA 2D1JA 1CT0E 1TBRH 1FPHH 5C67A 4KP0A 1DT2A 2FOBA 1G3EA 1ANEA 1IQLA 4ABIA 1EZQA 1ESBA 1LPZB 4HGCA 1BT7A 4D7GA 2HPPH 3MO3A 2UUKB 4K1SA 5DP7A 3IG6B 1GGDC 1WTHD 2OC1A 3UWJH 3ZVAA 2BX3A 1LHDH 3C27B 1ELDE 5A2MH 2A7HA 1AVWA 4JZFH 5C2ZA 2G5VA 1LHCH 2HNTF 3QTVH 2FTMA 1MQ6A 2CHAC 5L2ZH 1SGTA 1GL1A 2FOHA 1HJAB 3EA8A 2BY8X 1EAIA 1WQVH 1YPGH 2AMQA 3BTEE 4OGXA 3LGWA 2Z3DA 1CVWH 1GMDG 4ZKRU 1VZQH 3A85A 3B23B 5F6MA 3RXCA 1MTVA 3KCGH 1SGIB 2GMTB 4ZH8A 4WF8A 1SGPE 8LPRA 5DG6A 3GY4A 4I8KA 4R8TB 2A1DB 1N8OB 1SB1H 1LQDB 1SLVB 1YPHE 1KDQB 1ELBA 2LPRA 3KHVA 4IMQA 2O9QA 1W7XH 1O5EH 5DP6A 3A7YA 1V2QT 5CHAC 1HAPH 3PM3A 1O35A 4MPUA 1DFPA 3GY6A 1S82A 3ZZCA 1J8AA 3LC5A 1G2LA 3LJOA 1LDTT 2THFB 1YC0A 4JYUH 1ANCA 4CH2B 4WH6A 4Y8YA 1A4WH 2J34A 3DHKH 3P8GA 1W14U 2B5TB 1FIWA 1L4ZA 3TJUA 1SGEE 4DW2U 4K1EA 4GUXA 1O3AA 2A7CA 4JZIA 4IN1A 3RLWH 2AEIH 1NM6A 3RDZA 2W7SA 1SPJA 5FHTA 5C1YA 2BQ7B 3TH4H 1Z8IB 4YLQH 3SV2H 4NSYA 1O5AB 4DG4A 3BTKE 2PGBB 1SGFA 4TWYA 3LDXH 4ABHA 1GCTB 4A5TS 4CR9A 2VIDA 3BTTE 2BVXH 1KTTB 1N6YA 1WTGH 3GCHC 4WMDA 1GI3A 4LOYH 4NA9H 3RXRA 2QC2A 1MBMA 1FAXA 1E37B 3T5FH 1O3OA 4ISOA 2UWPA 1A61H 4WVPE 1SGRE 1ZJDA 1G9IE 4DURA 3MU5A 1V2UT 1TRNA 4O3UA 1E36B 1RIWB 1THSH 2OCVB 2LNCA 1BRAA 4LZ4B 2QN5T 3P6ZB 1DM4B 1Z71A 2QF3A 1WBGB 3PMHB 2R0LA 1XUFA 2OXSA 1C4U2 2A0QB 2UWOA 1O2LA 1CT4E 1CHOF 1HV7A 2VIQA 5HMAA 4INKA 2ZGJA 1HJ8A 4RKOB 4KTUA 4J2YB 1QL8A 4F4OC 4ISHH 2Q6GA 4RKJB 4OS7A 1C2JA 2AH4X 2H9EH 1UVSH 1P01A 2XYAA 1Z1JA 1QY6A 3I78A 1CO7E 3O8BA 1TIOA 2HLCA 3VB7A 2W26A 3LGTA 1UTLM 4HZHA 5I25A 3UQVA 1SGQE 3P8NA 1GBJA 2P8OB 2VWMA 2EC9H 1RTFB 1HIAB 3GICB 4Y8ZA 1GJAB 1MZAA 2HWLB 2I6QA 2SFAA 2GKVE 3MNXA 1BBRK 1Y3WA 1ZMNA 1GHAG 2EA3A 3A7XA 3UOUA 1QBNA 1Y5UT 2WPIS 1LHFH 3ESTA 5DPAA 1GBLA 1BTPA 2Z9GA 1AN1E 4DT7B 3RUOA 3GDVA 4CREA 1ELAA 1LCYA 2G5NA 3SUDA 1C2EA 4H4FA 2F9PA 2VVVA 3E16B 1QL7A 1ANBA 3MO6A 2Y81A 2G52A 4X0WU 1W13U 4J1YA 5JYIA 3U1JB 1QRWA 2B7DH 1GJDB 1A5GH 3BF6H 3SNCA 2ZHDA 1EP6A 5E0GA 3VB4A 3K6ZA 1O2XA 1TONA 3PTBA 2ZHQH 2C8YB 5JBBS 3A89A 1XUIA 5TCCA 3TGIE 2F9VA 5T3HA 2AS9A 3GCNA 3P8FA 1RFNA 3K65B 1H1BA 2NU2E 2Q1JA 4YT7H 2ILNA 4CRCA 3P92A 5T6DA 4Y11E 2BD4A 1VGCB 1HB0B 1GI5A 1IQNA 1GDUA 1SGDE 1O2TA 1UMAH 3PO1B 3M3VA 4GSOA 3UIRA 2OP9A 2BXTH 3BEFB 1ZOMA 2O8MA 5IDKA 3A83A 3ZZAA 4BXSA 1TRYA 2J94A 1TGNA 2HVXA 4CHAB 3MH6A 1BTHH 3U69H 4NIVA 3M5MA 1CT2E 1GHAF 1G3DA 1L0ZA 1NRPH 4DOQA 4X1PU 4OS4A 1MTNB 4X2VA 4IC5A 8KME2 1QFKH 3SHCH 1EJMA 4BTUB 1C1RA 5C5OA 3BTME 2JH0D 1O3EA 5FBIA 1IQGA 1BMAA 1UVUH 1NTPA 5EGMA 1AD8H 2A5AA 4H6SB 3B8JA 1MKWK 1AGJA 1GGDB 1WAYB 1YF4A 1NRQH 5DP4A 1BMNH 1K22H 3MU4A 2ALVA 8ESTE 1T4VH 4B76A 1FN6A 1GVKB 3RC4A 2ZU5A 4YM9A 1O2GH 1BUIA 1ZGIA 2CV3A 3MU8A 1A3EH 1KLIH 4MVNA 1O3NA 1ZMLA 3GY7A 2Q6DA 2ZGCA 3E1XB 2TBSA 1MCVA 1GHVH 2FTLE 1ZTKA 2DE8A 2GZ8A 3LC3A 2FZZA 3RXHA 1ELCA 4E05H 2Y7ZA 4VGCC 1ESTA 4E06H 1NESE 1O30A 1AO5A 2FI4E 1HAXB 1QHRB 4UDWH 3F68H 1TMBH 2GP9B 3E3TA 1D3TB 2XWBI 3AAUA 2Y6TA 5DP8A 1Q3XA 1EAUA 3SJ9A 3E0NB 3ZVEA 3PMJA 3G01A 1LMWB 1ID5H 1A2CH 1GHWH 1H9LB 1P10A 4H6TA 4BAKB 7GCHG 3NZIA 1F5KU 1EX3A 2ZCKP 4IBLH 1T32A 3SBKA 5CHAB 5BPEA 1EP5A 1MZDA 4FUDA 2QV1A 2GDDA 1Z8JB 3Q3KA 4TY6A 1HJ9A 1UK3A 2PKAB 1ETRH 1MTSA 2Q6FA 1T4UH 3H7OA 4I8JA 2A5KA 4A6LA 2OC7A 3RXKA 3STIA 5EQSA 5EG4A 2OC8A 1FY5A 4BOHA 1KDQA 2BMGB 1FNIA 4XBCA 1C2LA 5C1UA 2C3SA 3SV8A 1PPCE 1K28D 1TNLA 1VCWA 1O2SA 4I31A 1ZR0A 4WH8A 3TJVA 2FEQH 2OINA 1A46H 1TYNA 2PTNA 2ZDLA 1NZQH 2ESTE 2A32A 3ZZ4A 1TBZH 5FPSA 3PLPA 4BTIB 4NFFA 2C4FH 1TALA 3BG8A 4D7FA 4CRGA 1V2OT 2VIVA 3SU3A 3DA9B 4AB9A 4QT8C 5EPNA 1HXEH 1E0FD 2ZI2H 5EW2H 1L1NA 1QA0A 1DVAH 3Q3YA 1EOLA 5F03A 4K2YA 4FU9A 2XCFA 1ESAA 1YPMH 3BTFE 2GGVB 3GCHB 2ZGBH 3GCTF 1QIXB 3SU6A 1C2DA 2P93A 5AFZH 1UVOA 2GCTB 4FUIA 1GMCG 1ZGVA 2BD7A 1C1VH 2G51A 3EA7A 4GHTA 1N6XA 1NU7B 4JK5A 1GG6B 3ATIA 3SGBE 1IQIA 5TCAA 2BLVA 3ELAH 3KQEA 7GCHF 4AGKA 1CHGA 2VIWA 3RU4E 1IHTH 2BDGA 1FQ3A 2TPIZ 4U30A 3BEIB 4XE4A 5FX6A 1AZZA 3P70B 1O3HA 3MU1A 4SGAE 3SJOA 1YCPK 1H4WA 3RMNH 1O37A 1AQ7A 1O5GH 2ANWA 1QGFA 3RXDA 5DK1A 7ESTE 3OYPA 1F2SE 1GBDA 1V2TT 4Y8XA 4BANB 4ABFA 1YGCH 2ODQA 2H9HA 3SQHE 2G4UA 3QO6A 1SGFG 1NY22 3VB6A 1JRTA 1AKSB 1O2YA 3BTQE 1HDTH 1C1WH 4I7YH 1O38A 1NROH 4I8GA 1VJAU 5F8TA 3W95A 1RXPA 2O8UA 2CGAA 3FZZA 3A8CA 4FUFA 4AOQA 1YYY1 1LVYA 5EU8A 2BD9A 3UQOA 5A8XA 1K1OA 2P3UB 2BDAA 1DXWA 1XUGA 3UOPA 2BTCE 1OWIA 1EPTB 1FAKH 1O3BA 1Z6JH 1LHEH 4ASHA 4WJG2 5E0JA 1SGNE 1TOCB 1QB1A 4WY3A 1HIAA 5GDSH 2PWXA 4TPIZ 4GCHG 1OKXA 2TGDA 4NZQA 1SQTA 3TGJE 3O8DA 2Y5HA 4MNXA 3PROA 1BRCE 2BD8A 2UUFB 1QBOA 3L33A 4NWLA 4X2XA 4KGAA 2P3TB 4CRFA 1GVZA 2ZPSA 3LPRA 4D9QA 1AUJA 1O2KA 1W3CA 1WQSA 3SV7A 3TGKE 3AW1A 3KL6A 3TH3H 5E8EH 1BRUP 3LONA 2GD4B 2WV5A 4O9VA 1C5UA 1O3LA 3T2NA 4X1RU 1EZSC 4JMYA 2FOCA 1LPKB 3S9BA 2ZTYA 1AFEH 1UCYK 1GJ6A 2BD3A 4Y6DA 1C1MA 1KXBA 1BJUA 1QRZA 3MNSA 2A5IA 1XUKA 3SJ8A 4X6NA 4DVAU 1HAYB 2J2UA 3SOSA 3VB3A 1DICA 2V0BA 1Y3XA 1LVBA 2SNVA 3QN7A 5HYOA 4MNYA 2BD2A 1P04A 3QX5H 1CGHA 1ETTH 3A84A 1C5PA 3BG4C 1HUTH 4WMFA 1JIMA 3RLYH 1J17T 2VIPA 1TWXB 2W5EA 4BAOB 2OBOA 3MH4A 3E6PH 1AMHA 1PYTC 2BX4A 2OD3B 3CENA 1C4V2 4NGAH 1EXFA 1HAHH 4ABBA 4GVUA 7KMEH 1TPPA 3A81A 1SGCA 1V3XA 2R2WU 1RD3B 4D9RA 1KTSB 3ZVBA 1Q31A 1GJ5H 3BTHE 4A92A 4NFEA 2ZCHP 3FZDA 1T8OA 4GCHF 3ZZ9A 2VGCB 1GJCB 1UK2A 1ZZZA 5K0HA 2WPJS 2AYWA 1TNKA 1M9UA 4IW4E 1FV9A 4X1QU 1UJ1A 5K7RA 3SN8A 5C5NA 5EQQA 4IGDA 2ZDNA 1ABIH 1HLTH 5CMXH 3PTNA 1TABE 2ASUB 4B75A 1BOQA 1TGBA 2A7JA 4X6PA 5ESBA 3RU4D 3GYLB 4A1TA 1FDPA 5ETXA 1SOTA 4VGCB 3ITIA 4NA8A 3M7UA 1TE0A 1UO6A 3SNEA 4CH8B 3MO9A 3H5CB 5G4BA 3H7TA 4X8TH 4U01A 1SVPA 1CE5A 1V2WT 3Q76A 1A0LA 5EOKA 4CBNA 1V2RT 2WPLS 3MFJA 2XBYA 3MU0A 2STBE 1BA8B 2D8WA 1CGIE 4D8NA 1D3PB 1AB9C 5JB8S 3LGVA 2GDEH 1NU9A 4ZHLU 1BHXB 3E90B 1P2QA 3UR6A 1IQKA 3DFJA 1NFYA 3RC6A 1C9PA 3K6YA 5AFYH 2PR3A 1TGSZ 1CHOG 4NIWA 1C2IA 3LOXA 2XBVA 5I46H 1TBQH 1Y5AT 3RXQA 2B8OH 1Q2WA 1GHBG 4JCNA 2QIQA 3NUMA 3QWCH 2G8TA 1K1JA 3STJA 3TLOA 4DGJA 2PKAA 1Z1IA 2FWWA 1PQ7A 2ZHFH 2VU8E 4ISIH 2W3KA 3S7HB 2BDYA 4CRBA 4XBDA 3UUZA 2NU1E 1OSSA 1Z8GA 2BXUH 2GV7A 3CS0A 1C2FA 3A7ZA 2RCEA 2FLBH 1FN8A 1A1RA 2CF9H 1UTQA 3M5NA 5DP9A 3SO3A 3TK9A 3VXFH 2J38A 4FUCA 1X7AC 2ZFQH 4K60A 1RJXB 2Y82A 4THNH 1C1QA 1TNHA 4K8BA 3ZZ8A 4Y7BA 1HGTH 4IS5A 1SHHB 2PSYA 1QL9A 1DY8A 1G30B 3N7OA 4AYYB 4AX9H 1C5TA 3QGJA 4TY7A 4XFQA 3VFEA 1V2NT 4E7NA 1Z7KA 2FDAA 1UHBB 3ZZ7A 3U8OH 3RXGA 1TX7A 4ABAA 1O5CB 1UTNA 4RSPA 2WUBA 2GTBA 2ANMH 2RA0A 3F9EA 3QK1A 1BZXE 4Q80A 4H42U 3U1IB 2PKSC 3GY3A 2IN2A 1K2I1 1QTFA 2VWOA 4FUEA 7LPRA 2H5CA 4JYVH 3HK6B 3KEEA 1OOKB 1XUHA 4ZMAH 5C1XA 5DJ7A 1RS0A 1GHBF 3T26A 1O5FH 1TPOA 2BDHA 2PTCE 3RP2A 1G3BA 2PGQB 4CRAA 1U6QA 2FODA 2NU3E 1O3GA 1P9UA 3ZV8A 5EXLA 5T6GA 2GCHG 5EQRA 3M7TA 4I8HA 2RG3A 3RU4T 1AFQC 1OXGA 3MMGA 3TITA 2CXVA 2HNTC 1AKSA 1HXFH 1TOMH 2Z94A 4KTSA 5FPTA 1EASA 2M5TA 4ABEA 2HALA 1P8VC 2FOMB 3A7WA 2ZFRH 3DFLA 2NU0E 5LPRA 1UVPA 2HGTH 3W94A 1P11E 2Z9IA 2TGPZ 3NKKA 1CBWC 2WYJA 2ZGHA 3KNXA 1S81A 1AVGH 3ZVDA 4YESB 4AG1A 3FANA 1AUTC 1C1UH 2ZIQH 2BVRH 4YLUA 1A5HA 1NRSH 2FI5E 1A0HB 2AGIX 5EXNA 1TQ0B 4B74A 4KKDA 5GPIB 3S9CA 5DGJA 2QXJA 1MD7A 1OWDA 1ZPZA 1QURH 4WXVA 1FZZA 3AVZA 3T62A 1VITF 1EPTA 1GBHA 2PHBA 1DS2E 2XC0A 4FUHA 1DSUA 3LGIA 1C2MA 1MAXA 5JPMH 2J9NA 1B0FA 2FLRH 5F8ZA 1VITH 1Y3VA 3KQBA 2W7UA 1ARCA 1BTUA 5AF9H 1XKAC 4MNWA 2QA9E 2ANKH 1ZJKA
chains in the Genus database with same CATH superfamily
3V7TA 2NU4E 1C1PA 2FPZA 2BHGA 5T1VA 1MKXH 3Q3XA 1F92A 1IHSH 4MPWA 4XDEA 2ZHEH 6CHAC 1HYLA 4R0IA 1TAWA 2XCNA 1W2KH 5F8XA 5E0HA 2ZNKH 3FFGA 1D3QB 1EKBB 1KXFA 1O2QA 3HK3B 5GCHG 4AGJA 3URDA 1TMUH 2GCHF 3ODFA 2JETC 3RXEA 3RXLA 1FY1A 2BY9X 1NRNH 2NWNA 1XX9A 4TPYA 3RMLH 4K1TA 5L30H 1KXEA 1EJNA 1W0KD 2XXLA 3V13A 2IPQX 2K1QA 2FOAA 5L6NH 1CA0C 2PUXB 1O2PA 1P2IA 5CDFE 2AGGX 1GI0A 3BTWE 4B2BA 3A7VA 3URCA 1W12U 1IQJA 1JXPA 1DE7H 3QGNB 1ZRKA 1O2HA 2UUJB 3RXPA 3F9FA 4UONA 2KAIB 1MAYA 1DXPA 5EPYA 4X8UH 2ZA5A 2GV6A 2OBQA 1K21H 1MU6B 2J98A 2QCYA 1F0TA 2V6NA 3ATKA 4FU8A 2V3HH 1HAGE 4YO9A 2CF8H 1B7XB 1VCPA 1FY4A 3HATH 1P02A 1MTWA 2BDIA 4ZHAA 4NG9H 2BLWA 2XRCA 3LGUA 1XXDA 1WSSH 2CHAB 3S9AA 3R3GB 1OYQA 2FYRA 2GT8A 3D62A 2FYQA 4X6OA 3TNTA 3A87A 2FOGA 3D65E 1HAVB 1AZ8A 1IQMA 3TPIZ 4I33A 1TPAE 4LXBH 1F7ZA 1SC8U 3SNDA 1H9HE 1NN6A 1FIZA 1BTWA 3GDSA 3N99A 1CQQA 3GCTG 2WINI 1GMHF 5FCKA 3ZYEA 1PQ8A 1RTKA 2QF5A 1J16A 1WU1A 4ABDA 1JMOH 1O2VA 2BLOA 3ENSB 2P94A 1S6HA 5GCHF 1V2PT 3RXFA 2QGRA 4BNRA 1ZHRA 2IPHA 1YPLH 1LTOA 4X6MA 2JKHA 1FUJA 1YM0A 3HPTB 1ARBA 1G32B 3C1KA 3LH1A 1W0ZU 1O3DA 1GJ4H 2XWAA 3VEQB 1KLJH 5A8ZA 1A3BH 2XC5A 1NO9H 2Z9LA 1DANH 3T27A 1T8MA 1GJBB 1C5SA 1C1TA 1PPGE 1O0DH 1N8OC 4B6EA 2H2ZA 2ZU2A 1SL3A 2D2DA 2GT7A 2ZF0H 4BAMB 1JBUH 1N1LA 4BTTB 2J5UA 3MWIU 2VH6A 1IQEA 1AWFH 1C2HA 2CJIA 1KMHB 2D26C 4OS1A 3BN9A 3UTUH 1GBEA 2BZ6H 2VWLA 2SGAA 5L2YH 4K5ZA 3GY5A 3PV5A 4CRDA 5A09A 5KECA 1ZSLA 3FVFB 3A80A 1C5QA 3T28A 1OX1A 3M5LA 2P16A 3BV9B 1GPZA 5GWZA 1PQAA 6ESTA 4NSVA 1P2KA 2FIRH 1D6RA 1O2IA 1DUAA 2R3UA 4Q7ZA 1PPZA 1C5NH 1O2WA 3F9GA 2VJ1A 1Y8TA 3VG8A 1YLNA 2Y5FA 1Z6EA 5FCRA 1NFUA 2VVUA 4BXWA 1QRXA 1SLUB 2LP6A 2PFEA 4ABGA 1C5WB 5HGGA 1THRH 3UR9A 3B9FH 1GCTC 2PKSB 2ZZUH 4NZLA 1ZSJA 1K9OE 1H8DH 1OWEA 1BQYA 1YPHC 2KCAA 1UHBA 1NBME 2R2MB 2AIPA 2A2XH 2VB0A 1BCUH 2OLGA 3M61U 1TNJA 3UNSA 1ZLRA 1C9TA 1O2UA 3EA9A 1RIWC 2G4TA 5SGAE 2UWLA 2YNAA 2ANYA 4FUJA 4FUBA 1FJSA 1ZSKA 3RXMA 3PB1E 3GDUA 4SGBE 1P0SH 3T29A 1FMGA 3MH7A 1C4Y2 3ZZ6A 2F91A 3OSYA 1MBQA 1EUFA 4IMZA 1UW7A 2ZU3A 4WXIA 1WYKA 2O8WA 4XOJA 3Q77A 3SORA 1C5VA 2ZPQA 3KF2A 1LVOA 4GHQA 3SJKA 1T8NA 4ESTE 4DIIH 4FOUC 2FS9A 4OS6A 2F83A 3PMBB 5KEDA 5JB9S 1C5YB 3RXAA 2BVSH 4RN6A 1WV7H 2V3MA 1BDAA 2OTVA 2TGAA 3JZ1B 3HKIB 2XNIA 3ZVGA 1NFXA 3RMMH 1JWTA 1P09A 3DCLA 3SW2B 1CBWB 4FETA 4E7RG 4INHA 2ODYB 2PW8H 1NRRH 2I6SA 1RGQA 4B1TA 3E91A 5HIYA 1NS3A 1SKYE 3NXPA 4K3JA 1Y3UA 1IQFA 1J15A 1F5RA 1OP2A 4MQAA 3RXOA 1SOZA 4BAQB 3QTOH 2QE7D 3GY8A 1GL0E 2KX4A 2QAAA 1BITA 1QJ7B 2PV9B 2V35A 1PPHE 1MCTA 6CHAB 2C8ZB 1O2OA 1E38B 1AY6H 3P8OA 1KSNA 1GBTA 1GCDA 2WYGA 1IOEA 1LQEA 1QCPA 1OS8A 1JIRA 2JETB 4TSFD 2JDID 3E0PB 1FLEE 1O33A 3IWMA 4FXGH 2OUAA 4Z0KA 1BJVA 1OWKA 4NWKA 2P95A 1FI8A 1P06A 3GYMA 1GI4A 4GLYA 1OWHA 4YTAA 2JH6D 4A1XA 3SJIA 5DP5A 2AERH 4UFEH 5H4IB 1XKBC 1TA2A 2ZCLP 4UEHH 3RM2H 1BMFD 2WSSD 1S5SA 3PO1C 2KCOA 3FO8D 2M2AA 1DY9A 1IAUA 1UTPA 2QF0A 1V2VT 3I77A 1Y5BT 1EQ9A 1D4PB 2Y80A 2HVYB 2Z3EA 1C5LH 4UFFH 1QJ1B 4Q7XA 1LVMA 2GVFA 2H1UA 2BM2A 5FBEA 1W7GH 2STAE 3SI3H 1J9CH 5LH8A 1ZRBA 4CHAC 1BBRE 3SYJA 1O2NA 1UTOA 3UY9A 1TPSA 1VR1H 1GJ7B 2F43B 4B73A 2PLXA 3SHAH 1TQ7B 3BTDE 2OK5A 1MTNC 2BOHB 2ZKSA 2QXIA 4JZ1A 5A0BA 2SGPE 4TT3D 1DITH 3IITA 1O3JA 3ZZDA 2IJOB 2KAIA 4Z6AH 1EB1H 3R0FA 1ANDA 1FXYA 2EI8A 3FP8E 3K9XB 2BOKA 2BQ6B 1ZHPA 5DSFA 1DX5M 2RDLA 2CMYA 3LJJA 2A4QA 1K1NA 2R3YA 1O32A 1W0YH 1NBMD 4HI3A 2ZQ1A 2SNWA 4ISNA 5DP3A 3DD2H 3P17H 3SU0A 3O8CA 4B71A 3SUGA 2ULLA 1HAVA 9ESTA 3EGKH 1AWHB 1EAWA 1UVTH 3M5OA 1HAIH 2BY5X 3A88A 3S7KB 3RC5A 1ORFA 1P9SA 1ZMJA 1G37A 1O34A 5HM2A 4JZDH 5B6LA 2ZHWH 2A4GA 3L3TA 1YLDA 2ZU4A 4B2CA 4YOGA 1B5GH 1K1LA 1WOFA 1BMLA 2TIOA 3PWCA 1O2JA 3SI4H 2ZDVH 2P3FH 1L4DA 3A8AA 1F0UA 1QB9A 2V7QD 2GZ7A 2DUCA 1HAOH 4X8VH 2KFWA 4F55A 2UUYA 2A45B 1COWD 1S83A 1F5LA 5HIZA 2DE9A 1W8BH 4X1NU 2H5DA 3S69A 1Y59T 2HRVA 3SQEE 5DKMA 1CGJE 1DWEH 1SQOA 3SUEA 1KY9A 2C90B 3EE0B 3F6UH 5EODA 2JIZD 3SU5A 1JRSA 1P2MA 3MHWU 4ZAEA 3AASA 3RXVA 2H6MA 8GCHG 1S85A 3FOAA 4U32A 4HFPB 1XM1A 4LK4A 1O3KA 1DSTA 4Y71A 5EXMA 3NRLA 4XRNA 5A0AE 1KIGH 1F0SA 1DWCH 4UD9H 1UTKA 3BIUH 3FP6E 1W0JD 1LHGH 5F53A 2F9UA 3EE7A 2FESH 1E34B 3PMAB 4YOJA 3NWUA 1C5MD 3OAAD 3LH3A 1NT1A 4CR5A 1GMDF 1T8LA 1O5DH 1VITG 2VWNA 3ZIAD 2BY7X 1CU1A 1S6FA 1MUEB 4OGYA 1WCZA 3F9HA 1TX8A 1YLCA 5ABWA 2ZPRA 3QZRA 3HKJB 1KXAA 1GBKA 1O31A 1H8IH 2W6JD 1B0EA 4AFZA 1PQ5A 5C3NA 1ZTLA 1EZXC 2GCTC 3MTYA 1MQ5A 4CBOA 3TJOA 2B9LA 3LIWA 4X1SU 1W11U 3TNSA 4KTCA 1IQHA 1EZUC 3RM0H 3P95A 4TWWA 1YWUA 1GG6C 3PLBA 1ZYOA 1SG8B 1QBVH 3PWBA 1G2MA 2ZWLH 3KYFA 2H9TH 5FXLA 2Z6BD 1TLDA 1HCGA 2FX4A 1S84A 3RXIA 1KLTA 1YPJH 1H8ED 1V2JT 3GCOA 2Z7FE 2BDCA 3GISB 4AORA 1XUJA 4LZ1H 1HPGA 1ELVA 2BLQA 1GDQA 1KYNA 1SLXB 1KXCA 2VIOA 3LGYA 4FVBA 3A8DA 1AVXA 4D76A 8GCHF 1P12E 2ZTXA 4ISLA 3RXUA 4JZEH 1V2KT 3TIUA 1D6WA 3M3TA 5HXFA 4JK6A 2RA3A 1ACBE 4AFQA 1YP9A 2FX6A 5DO4H 1NC6A 2C93B 3MI4A 3UB0A 1MH0A 3CNRA 5EW1H 4FU7A 2QXGA 3CS7A 2ZTZA 2XW9A 1C2GA 4MPVA 3ZVFA 2VVCA 1QQUA 1BHXF 4WMEA 2XOKD 5JDUB 3QDZB 4BAHB 1A0JA 4MDSA 3EYDA 4KELA 4Y76A 1P03A 3SU1A 1MKXK 3SUFA 3ZVCA 2F3CE 1TRMA 2ZFFH 3RXBA 4AFSA 1ZHMA 3MNBA 1EPTC 1FPCH 2QY0B 1GI9B 4X2WA 4UFGH 2AMPA 2WPKS 3OTJE 1SGYE 1P3CA 2TGTA 2BYAX 1MD8A 1BBRH 4Y10E 4YZUA 3N7EA 3PV4A 4ZKNU 4B2AA 1DWBH 1AHTH 2PSXA 4DIHH 2SGEE 5IYTA 1DLEA 1GMHG 1PFXC 1D3DB 1GBIA 4RI0A 5LPFA 1THPB 1HBTH 1QB6A 2PUQH 1EAXA 1QR3E 5ESTE 4I8LA 1K1IA 2BZAA 2FMJA 1VJ9U 2YOLA 3BG4B 2ZDAH 3UNQA 1BTXA 1KXDA 2A31A 3V12A 1GVLA 2AGEX 3V0XA 5J4QA 2XBXA 1LPGB 4K69A 2R0KA 1V2MT 3U9AH 2SGQE 3VGCC 4ZUHA 1O3PB 2F9BH 3M35A 2FI3E 2A4OA 4DCDA 1C1SA 3RXSA 4NCYA 1WXRA 1TGCA 6GCHG 3QLPH 1ABJH 2AIQA 4ZROA 1QJ6B 4UFDH 3QZQA 3ATLA 1GBMA 1TA6A 2O8TA 1AE5A 1XMNB 2EI6A 3EAJA 1Y3YA 3D49H 1ELTA 1ZPCA 3I29A 3KN2A 3LKWA 1ZPBA 1J14A 4MPXA 1XVMA 2QXHA 2BDBA 3HGNA 3KQCA 1H8HD 3M36A 1C5ZB 1ELGA 3OU0A 3JZ2B 1SI5H 3U8RH 3TK5A 1GHYH 1S0RA 2Z9KA 3KQ5A 3OY6U 2R9PA 4TYDA 4AZ2B 1SR5C 5FPYA 4M9FA 3A7TA 3V3MA 2OC0A 2FP7B 3ODDA 4AYVB 4A1VA 1TFXA 2VGCC 1GWAA 1PPFE 3KGPA 4NIYA 1GJ9B 2AFQB 4I32A 3O8RA 2Z3CA 4UE7H 1MKWH 1EB2A 4AFUA 2J4IA 1PPBH 4O03A 3ATMA 1FY8E 2FOEA 4ZKSU 4Y0YE 3GY2A 1AB9B 3M37A 1HJAC 1DWDH 2A4RA 5PTPA 5CHBA 2J95A 2C8XB 1LKBA 3NPSA 1GI7B 1UCYE 1CA8B 1FONA 1YCPM 3GOVB 1P3EA 2HOBA 2ZECA 3WWFA 2AMDA 2GMTC 1UK4A 4O97A 5AVDA 1BRBE 1GI1A 1QA7A 3EQ0H 2ODPA 6GCHF 3BSQA 1EOJA 1OP8A 3FKSD 2V3OH 4XBBA 2EI7A 4NIXA 1YBWA 1EATA 1PYTD 4ZXXH 1O2RA 5GXPA 3VB5A 2TRMA 1YPEH 5GIBA 1P05A 2YNBA 1V2LT 2XTTB 1MU8B 1GBCA 1HAZB 2ZDKA 3F1SB 3RXJA 1T31A 1H9IE 1S0QA 4MTBA 4O3TA 3TVJB 1GBBA 4YT6H 1DDJA 1RTLA 1T7CA 3M7QA 4IN2A 2J92A 1WDIA 1BB0B 2FO9A 5B6OA 3PYHA 2ZFTA 3LU9B 3UNRA 3MYWA 5A0CA 1O3FA 5E2OA 1GI2A 4ZKOU 2HNTE 4Y7AA 3D23A 3DT0H 1V2ST 2FM2A 5C20A 1XVOA 3TJNA 4Q63A 4WWYA 3AW0A 3SU4A 4X8SH 3A8BA 2ZEBA 5JBAS 5FAHA 4INLA 3SNAA 3UFAA 5HM9A 4AN7A 1ZTJA 1OPHB 1YKTA 4Q2KA 2EEKA 2ZGXH 1TMTH 5J4SA 4YOIA 1O3MA 2ZU1A 1YPKH 1BMMH 2IOTA 2G81E 5JBTA 1PPEE 5EJ1A 4M7GA 3ZYDA 1SHYA 1P2OA 6LPRA 3SU2A 5A8YA 1SFQB 2L74A 1LKAA 2ALPA 2VINA 4Y79A 3E8LA 3ZV9A 1BTZA 1MTUA 3M3SA 1GHZA 1HRTH 4AG2A 4NA7A 3EDXB 2QYIA 3NCLA 2W3IA 4DJZB 2GX4A 3RMOH 3SZNA 3ZZBA 1SSXA 3K2UA 4JYTA 1C1NA 1PJPA 1HNEE 1INCA 1L1JA 2ZFSA 2OQUA 4MG3A 3TH2H 3UPEA 1SFIA 1C5RA 1EJAA 2C8WB 4GAWA 1SLWB 1O3CA 5T6FA 4OS5A 4ZXYH 1AFQB 1OWJA 1A7SA 1K0HA 3FP7E 3OX7U 1OP0A 3VPKA 2EY4C 4MLFB 1GJ8B 3WY8A 1L1GA 3VXEH 2B0FA 1OYTH 5JBCS 3ATWA 3MOCA 1P2NA 1YCPH 3UWIA 2Y5GA 3ZZ3A 1O2ZA 2F9NA 2OQ5A 1A5IA 1C1OA 4OS2A 1E35B 2SGDE 2XBWA 1F0RA 2WPMS 1UTMA 4K8YA 2BB4A 1GBFA 1UTJA 3FAOA 5GJ4B 3BTGE 4MNVA 1Z8RA 1P57B 2PP6A 3CP7A 2G55A 4HTCH 3ZZ5A 4AB8A 1HFDA 1ELFA 1K1PA 1W10U 2WV4A 2P8OC 1TB6H 3OTPA 5AHGH 3SNBA 1TX6A 2GZ9A 3BIVH 4FUGA 1VCQA 2KM0A 1FY3A 2BY6X 2VH0A 2VNTA 1BIOA 2ZDMA 4Y0ZE 2WUCA 3NK8A 2ZG0H 4FVDA 4XSKU 4ZHMU 2O8LA 1DOJA 1TNGA 2EQNA 1G36A 1CSOE 1O5BB 1RRKA 1GMCF 1AU8A 1QQ4A 2WPHS 3MNCA 3DSGA 1AE8H 1L2EA 3L6PA 3UREA 3PLKA 2ZC9H 2ZP0H 4P00A 3F2FA 1SQRA 1XXFA 1C2KA 3RXTA 1O36A 1DPOA 3TK6A 4X2YA 1O3IA 1O2MA 2SGFE 2F9OA 1QNJA 2BQWB 2HPQH 1NPMA 1GI6A 3TU7H 1BTYA 1SBWA 2Z9JA 2Y7XA 1P2JA 2BD5A 2JH5D 1AI8H 5LGOA 2XC4A 3AAVA 1C5OH 2G00A 2P59A 5FX5A 1GDNA 1SQAA 1DLKB 3KQDA 2FOFA 4A7IB 1TGTA 3KIDU 1LO6A 1GI8B 2ZFPH 3U98H 2ZQ2A 4GPGA 3T25A 5E2PA 3U8TH 5CE1A 1CA0B 2ZO3H 1GBAA 2FS8A 1G3CA 3A86A 1TNIA 2CN0H 3VGCB 1GHXH 3MH5A 3OY5U 3SV6A 3LT3A 3SGAE 4F49A 1MMJN 2A2QH 1ELEE 1DUEA 3SGQE 2QF4A 3SV9A 1VGCC 1D9IA 4DY7B 3HGPA 5BRRE 1SMFE 1WUNH 1O39A 1V6DA 3DUXH 3Q00A 4PROA 4U2WA 5TJXA 1K1MA 1UCYH 3OEHD 9LPRA 1JOUB 2FXRA 5LPEA 1C5XB 3OFND 1AIXH 3BEUA 3QUMP 1ETSH 4Q7YA 4IC6A 3S0NA 3A82A 1NFWA 4ABJA 2D1JA 1CT0E 1TBRH 1FPHH 5C67A 4KP0A 1DT2A 2FOBA 1G3EA 1ANEA 1IQLA 4ABIA 1EZQA 1ESBA 1LPZB 4HGCA 1BT7A 4D7GA 3WWBA 2HPPH 3MO3A 2UUKB 4K1SA 5DP7A 3IG6B 1GGDC 1WTHD 2OC1A 3UWJH 3ZVAA 2BX3A 1LHDH 3C27B 1E79D 1ELDE 5A2MH 2A7HA 4Z1MD 1AVWA 4JZFH 5C2ZA 2G5VA 1LHCH 2HNTF 3QTVH 2FTMA 1MQ6A 2CHAC 3WW7A 5L2ZH 1SGTA 1GL1A 2FOHA 1HJAB 3EA8A 2BY8X 1EAIA 1WQVH 1YPGH 2AMQA 3BTEE 4OGXA 3LGWA 2Z3DA 4HG6A 2XNDD 1CVWH 1GMDG 4ZKRU 1VZQH 3A85A 3B23B 5F6MA 3RXCA 1MTVA 3KCGH 1SGIB 2GMTB 4ZH8A 4WF8A 1SGPE 8LPRA 5DG6A 5DN6D 3GY4A 4I8KA 2RFKC 4R8TB 2A1DB 1N8OB 1SB1H 1LQDB 1SLVB 1YPHE 1KDQB 1ELBA 2LPRA 3KHVA 5EIYA 4IMQA 2O9QA 1W7XH 1O5EH 5DP6A 3A7YA 1V2QT 5CHAC 1HAPH 3PM3A 1O35A 4MPUA 1DFPA 3GY6A 1S82A 3ZZCA 1J8AA 3LC5A 1S6LA 1G2LA 3LJOA 1LDTT 2THFB 1E1RD 1YC0A 1E1QD 4JYUH 1ANCA 4CH2B 4WH6A 4Y8YA 2W6ID 1A4WH 2J34A 3DHKH 3P8GA 1W14U 2B5TB 1FIWA 2WV9A 1L4ZA 3TJUA 1SGEE 4DW2U 4K1EA 4GUXA 1O3AA 2A7CA 4JZIA 4IN1A 3RLWH 2AEIH 4Q4LA 4RT0A 1NM6A 3RDZA 2W7SA 1SPJA 5FHTA 5C1YA 2BQ7B 3TH4H 1Z8IB 4YLQH 3SV2H 4NSYA 1O5AB 4DG4A 3BTKE 2PGBB 1SGFA 4TWYA 3LDXH 4ABHA 1GCTB 4A5TS 4CR9A 2VIDA 3BTTE 2BVXH 1KTTB 1N6YA 1WTGH 3GCHC 4WMDA 1GI3A 4LOYH 4NA9H 3RXRA 2QC2A 1MBMA 1FAXA 1E37B 1YY3A 3T5FH 1O3OA 4ISOA 2UWPA 1A61H 4WVPE 1SGRE 1ZJDA 1G9IE 4DURA 2K0QA 3MU5A 1V2UT 1TRNA 4O3UA 1E36B 1RIWB 1THSH 2OCVB 2LNCA 1BRAA 4LZ4B 2QN5T 3P6ZB 1DM4B 1Z71A 2QF3A 1WBGB 3PMHB 2R0LA 1XUFA 2OXSA 1C4U2 2A0QB 2UWOA 1O2LA 1CT4E 1CHOF 1HV7A 2VIQA 5HMAA 4INKA 2ZGJA 1HJ8A 4RKOB 4KTUA 2YMSC 4J2YB 1QL8A 4F4OC 4ISHH 2Q6GA 4RKJB 4OS7A 1C2JA 2AH4X 3F0PA 2H9EH 1UVSH 1P01A 2XYAA 4XD7D 3UAIC 1Z1JA 2WHXA 1QY6A 3I78A 1CO7E 3O8BA 1TIOA 2HLCA 3VB7A 2W26A 3LGTA 1UTLM 4HZHA 5I25A 3UQVA 1SGQE 3P8NA 1VKYA 1GBJA 2P8OB 2VWMA 2EC9H 1RTFB 1HIAB 3GICB 4Y8ZA 1GJAB 1MZAA 2HWLB 2I6QA 2SFAA 2GKVE 3MNXA 1BBRK 1Y3WA 1ZMNA 1GHAG 2EA3A 4YXWD 3A7XA 3UOUA 1QBNA 1Y5UT 2WPIS 1LHFH 3ESTA 5DPAA 1GBLA 1BTPA 2Z9GA 1AN1E 4DT7B 3RUOA 2VBCA 3GDVA 4CREA 1ELAA 1LCYA 2G5NA 3SUDA 1C2EA 4H4FA 2F9PA 2VVVA 3E16B 1QL7A 1ANBA 3MO6A 2Y81A 2G52A 4X0WU 1W13U 4J1YA 5JYIA 3U1JB 1QRWA 2B7DH 1GJDB 1A5GH 3BF6H 3SNCA 2ZHDA 1EP6A 5IK2D 5E0GA 3VB4A 3K6ZA 1O2XA 1TONA 3PTBA 2ZHQH 2C8YB 5JBBS 3A89A 1XUIA 5TCCA 3TGIE 2F9VA 3MQKC 5T3HA 2AS9A 3GCNA 1MABB 1RFNA 3K65B 3P8FA 1H1BA 2NU2E 2Q1JA 4YT7H 2ILNA 4CRCA 3P92A 5T6DA 4Y11E 2BD4A 2WZQA 1VGCB 1HB0B 1GI5A 1IQNA 1GDUA 1SGDE 1O2TA 1UMAH 3PO1B 3M3VA 4GSOA 3UIRA 2OP9A 2BXTH 3BEFB 1ZOMA 2O8MA 5IDKA 3A83A 3ZZAA 4BXSA 3PRDA 1TRYA 2J94A 1TGNA 2HVXA 4CHAB 3MH6A 1BTHH 3U69H 4NIVA 3M5MA 1CT2E 1GHAF 1G3DA 1L0ZA 1NRPH 4DOQA 4X1PU 4OS4A 1MTNB 4X2VA 4IC5A 8KME2 1QFKH 3SHCH 1EJMA 4BTUB 1C1RA 5C5OA 3BTME 2JH0D 1O3EA 5FBIA 1IQGA 1BMAA 1UVUH 1NTPA 5EGMA 1AD8H 2A5AA 4H6SB 3B8JA 1MKWK 1AGJA 1GGDB 1WAYB 1YF4A 1NRQH 5DP4A 1BMNH 1K22H 3MU4A 3KYGA 2ALVA 8ESTE 1T4VH 4B76A 1FN6A 1GVKB 3RC4A 2ZU5A 4YM9A 1O2GH 1BUIA 1ZGIA 2CV3A 3MU8A 1A3EH 1KLIH 4MVNA 1O3NA 1ZMLA 3GY7A 2Q6DA 2ZGCA 3E1XB 2TBSA 1MCVA 1GHVH 2FTLE 1ZTKA 2DE8A 2GZ8A 3LC3A 2FZZA 3RXHA 1ELCA 4E05H 2Y7ZA 4VGCC 1ESTA 4E06H 1NESE 1O30A 1AO5A 2FI4E 4ZCNA 1HAXB 1QHRB 4UDWH 3F68H 1TMBH 2GP9B 3E3TA 1D3TB 2XWBI 3AAUA 2Y6TA 5DP8A 1Q3XA 1EAUA 3SJ9A 3E0NB 3ZVEA 2LELA 3PMJA 3G01A 1LMWB 1ID5H 1A2CH 1GHWH 1H9LB 1P10A 4H6TA 4BAKB 7GCHG 3NZIA 1F5KU 1EX3A 2ZCKP 4IBLH 1T32A 3SBKA 5CHAB 5BPEA 1EP5A 1MZDA 4FUDA 2QV1A 2GDDA 1Z8JB 3Q3KA 4TY6A 1HJ9A 1UK3A 2PKAB 1ETRH 1MTSA 3F2GA 2Q6FA 1QZ8A 1T4UH 3H7OA 4I8JA 2A5KA 4A6LA 2OC7A 3RXKA 3STIA 5EQSA 5EG4A 2OC8A 1FY5A 4BOHA 1KDQA 2BMGB 1FNIA 4XBCA 1C2LA 5C1UA 2C3SA 2L6OA 3SV8A 1PPCE 1K28D 1TNLA 1VCWA 1O2SA 4I31A 1ZR0A 4WH8A 3TJVA 2FEQH 2OINA 1A46H 1TYNA 2WPDD 2PTNA 2ZDLA 3FN8A 1NZQH 2ESTE 2A32A 3ZZ4A 1TBZH 5FPSA 3PLPA 4ASUD 4BTIB 4NFFA 2C4FH 1TALA 3BG8A 4D7FA 4CRGA 1V2OT 2VIVA 3SU3A 3DA9B 4AB9A 2JJ1D 4QT8C 5EPNA 1HXEH 1E0FD 2ZI2H 4ACAA 5EW2H 1L1NA 4B6FA 1QA0A 1DVAH 5EJLA 3Q3YA 1EOLA 5F03A 4K2YA 4FU9A 2XCFA 3OEED 1ESAA 1YPMH 3BTFE 2GGVB 3GCHB 2ZGBH 3GCTF 5GNDA 3DSOA 1QIXB 3SU6A 1C2DA 4AC9A 2P93A 5AFZH 1UVOA 2GCTB 4FUIA 1GMCG 1ZGVA 2BD7A 1C1VH 2G51A 3EA7A 4GHTA 3U28C 1N6XA 1NU7B 4JK5A 1GG6B 3ATIA 3SGBE 1IQIA 5TCAA 2BLVA 3ELAH 3KQEA 7GCHF 4AGKA 1CHGA 2VIWA 3RU4E 1IHTH 2BDGA 1FQ3A 2TPIZ 4U30A 3BEIB 4XE4A 5FX6A 1AZZA 3P70B 1O3HA 3MU1A 4SGAE 3SJOA 1YCPK 3PRBA 1H4WA 3RMNH 1O37A 1AQ7A 1O5GH 2ANWA 1QGFA 3RXDA 2YMSB 5DK1A 7ESTE 3OYPA 1F2SE 1GBDA 1V2TT 4Y8XA 4BANB 4ABFA 1YGCH 2ODQA 2H9HA 3SQHE 2G4UA 3QO6A 1SGFG 1NY22 3VB6A 1JRTA 1AKSB 1O2YA 3BTQE 1HDTH 1C1WH 4I7YH 1O38A 1NROH 4I8GA 5HKKD 1VJAU 5F8TA 3W95A 1RXPA 2O8UA 2CGAA 3FZZA 3A8CA 4FUFA 4AOQA 1YYY1 1LVYA 5EU8A 2BD9A 3UQOA 4F48B 5A8XA 1K1OA 2P3UB 2BDAA 1DXWA 4ACBA 1XUGA 3UOPA 2BTCE 1OWIA 1EPTB 2K8IA 1FAKH 1O3BA 1Z6JH 1LHEH 4ASHA 4WJG2 5EJZA 5E0JA 1SGNE 1TOCB 1QB1A 4WY3A 5C0UA 1HIAA 5GDSH 2PWXA 4TPIZ 4GCHG 1OKXA 2TGDA 4NZQA 1SQTA 3TGJE 3DSPA 3O8DA 2Y5HA 4MNXA 3PROA 1BRCE 2BD8A 2UUFB 1QBOA 3L33A 4NWLA 4X2XA 4KGAA 2P3TB 4CRFA 1GVZA 2ZPSA 3LPRA 4D9QA 4RT1A 1AUJA 1O2KA 1W3CA 1WQSA 2GJGA 3SV7A 3TGKE 3AW1A 3KL6A 3TH3H 5E8EH 1BRUP 3LONA 2GD4B 2WV5A 4O9VA 1C5UA 1O3LA 3T2NA 4X1RU 1EZSC 4JMYA 2FOCA 1LPKB 3S9BA 2ZTYA 1AFEH 1UCYK 1GJ6A 2BD3A 4Y6DA 1C1MA 1KXBA 1BJUA 1QRZA 3MNSA 2A5IA 1XUKA 3SJ8A 4X6NA 4DVAU 1EFRD 1HAYB 2YMSD 2J2UA 3SOSA 3OE7D 1DICA 2V0BA 3SZEA 1Y3XA 3VB3A 1LVBA 2SNVA 3QN7A 5HYOA 4MNYA 2BD2A 1P04A 3QX5H 1CGHA 1ETTH 3A84A 1C5PA 3BG4C 1HUTH 4WMFA 1JIMA 3RLYH 1J17T 2J98B 1TWXB 2VIPA 2W5EA 5KGOA 2OBOA 4BAOB 3MH4A 3E6PH 1AMHA 1PYTC 2BX4A 2OD3B 3CENA 1C4V2 4NGAH 2KR7A 1EXFA 1HAHH 4ABBA 4GVUA 7KMEH 1TPPA 3A81A 1SGCA 1V3XA 2KCPA 2R2WU 1RD3B 4D9RA 1KTSB 3ZVBA 1Q31A 1GJ5H 2KCYA 3BTHE 5FL7D 4A92A 4NFEA 2ZCHP 3FZDA 1T8OA 4GCHF 3ZZ9A 2VGCB 1GJCB 1UK2A 1ZZZA 5K0HA 2WPJS 2AYWA 1TNKA 1M9UA 4IW4E 1FV9A 4X1QU 1UJ1A 5K7RA 3SN8A 5C5NA 5EQQA 4IGDA 2ZDNA 1ABIH 1HLTH 5CMXH 3PTNA 1TABE 2ASUB 4B75A 1BOQA 1TGBA 2A7JA 4X6PA 5ESBA 3RU4D 3GYLB 4A1TA 1FDPA 5ETXA 1SOTA 4VGCB 3ITIA 4NA8A 3M7UA 1TE0A 1UO6A 3SNEA 4CH8B 3MO9A 3H5CB 5G4BA 3H7TA 4X8TH 4U01A 1SVPA 1CE5A 1V2WT 2IJD1 3Q76A 1A0LA 5EOKA 4CBNA 1V2RT 2WPLS 3MFJA 2XBYA 3MU0A 2STBE 3F0OA 1BA8B 2D8WA 1CGIE 4D8NA 3H09A 1D3PB 1AB9C 5JB8S 3LGVA 2GDEH 1NU9A 4ZHLU 1BHXB 3E90B 1P2QA 3UR6A 1IQKA 3DFJA 1NFYA 3F3BA 3RC6A 1C9PA 3K6YA 5AFYH 2PR3A 1TGSZ 1CHOG 4NIWA 4P02A 1C2IA 3LOXA 2XBVA 5I46H 1TBQH 1Y5AT 3RXQA 3GS9A 2B8OH 1Q2WA 1GHBG 4JCNA 2QIQA 3NUMA 3QWCH 2G8TA 1K1JA 3STJA 3TLOA 4DGJA 2PKAA 1Z1IA 2FWWA 1PQ7A 2ZHFH 2VU8E 4ISIH 2W3KA 3S7HB 2BDYA 4CRBA 4XBDA 3UUZA 2NU1E 1OSSA 1Z8GA 2BXUH 2GV7A 3CS0A 1C2FA 3F2HA 3A7ZA 2RCEA 2F4LA 2FLBH 1FN8A 1A1RA 2CF9H 1UTQA 3M5NA 3W1EA 5DP9A 3SO3A 3TK9A 3VXFH 2J38A 4FUCA 1X7AC 2ZFQH 4K60A 1RJXB 2Y82A 4THNH 1C1QA 1TNHA 4K8BA 3ZZ8A 4Y7BA 1HGTH 4IS5A 1SHHB 2PSYA 1QL9A 1DY8A 1G30B 3N7OA 4AYYB 4AX9H 1C5TA 3QGJA 4TY7A 4XFQA 3VFEA 1V2NT 4E7NA 1Z7KA 2FDAA 1UHBB 3ZZ7A 3U8OH 3N7DA 3RXGA 1TX7A 4ABAA 1O5CB 1UTNA 4RSPA 2HLDD 2WUBA 2GTBA 2ANMH 2RA0A 3F9EA 3QK1A 1BZXE 4Q80A 4H42U 3AK5A 3U1IB 2PKSC 3GY3A 2IN2A 1OHHD 1K2I1 5C0TA 1QTFA 2VWOA 4FUEA 7LPRA 2H5CA 4JYVH 3HK6B 3KEEA 1OOKB 1XUHA 4ZMAH 5C1XA 2RDEA 5DJ7A 1RS0A 1GHBF 3T26A 1O5FH 1TPOA 2BDHA 2PTCE 4OM9A 3RP2A 1G3BA 2PGQB 4CRAA 5C94A 1U6QA 2FODA 2NU3E 1O3GA 1P9UA 3ZV8A 5EXLA 5T6GA 2GCHG 5EQRA 3M7TA 4I8HA 2RG3A 3RU4T 1AFQC 1OXGA 3MMGA 3TITA 2JJ2D 2CXVA 2HNTC 1AKSA 1HXFH 1TOMH 5C17A 2Z94A 4KTSA 5FPTA 1EASA 2M5TA 4ABEA 2HALA 1P8VC 2FOMB 3A7WA 2ZFRH 3DFLA 2NU0E 5LPRA 1UVPA 2HGTH 3W94A 1P11E 2Z9IA 2TGPZ 3NKKA 1CBWC 2WYJA 2ZGHA 3KNXA 1S81A 1AVGH 3ZVDA 4YESB 4AG1A 4I86A 3FANA 1AUTC 1C1UH 2ZIQH 2BVRH 2AHME 4YLUA 1A5HA 1NRSH 2J97A 2FI5E 1A0HB 2AGIX 3PV2A 1TQ0B 5EXNA 1FX0B 4KKDA 5GPIB 4B74A 3S9CA 5DGJA 2QXJA 2CK3D 1MD7A 1OWDA 1ZPZA 1QURH 4WXVA 1FZZA 3AVZA 3T62A 1VITF 1EPTA 1GBHA 2PHBA 1DS2E 2XC0A 4FUHA 1DSUA 3LGIA 1C2MA 1MAXA 5JPMH 2J9NA 1B0FA 4DT4A 2FLRH 5F8ZA 1VITH 1Y3VA 2KZ4A 3KQBA 2W7UA 1ARCA 1BTUA 5AF9H 1XKAC 4MNWA 2QA9E 2ANKH 1ZJKA
chains in the Genus database with same CATH topology
3V7TA 2NU4E 1C1PA 2FPZA 2BHGA 1MKXH 3Q3XA 1F92A 1IHSH 4MPWA 4XDEA 2ZHEH 6CHAC 1HYLA 4R0IA 1TAWA 2XCNA 1W2KH 5F8XA 5E0HA 2ZNKH 3FFGA 1D3QB 1EKBB 1KXFA 1O2QA 3HK3B 5GCHG 4AGJA 3URDA 1TMUH 2GCHF 3ODFA 2JETC 3RXEA 3RXLA 1FY1A 2BY9X 1NRNH 2NWNA 1XX9A 4TPYA 3RMLH 4K1TA 5L30H 1KXEA 1EJNA 2XXLA 3V13A 2K1QA 2FOAA 5L6NH 1CA0C 2PUXB 1O2PA 1P2IA 2AGGX 1GI0A 3BTWE 4B2BA 3A7VA 3URCA 1W12U 1IQJA 1JXPA 1DE7H 3QGNB 1ZRKA 1O2HA 2UUJB 3RXPA 3F9FA 4UONA 2KAIB 1MAYA 1DXPA 5EPYA 4X8UH 2ZA5A 2GV6A 2OBQA 1K21H 1MU6B 2QCYA 2V6NA 1F0TA 3ATKA 4FU8A 2V3HH 1HAGE 4YO9A 2CF8H 1B7XB 1VCPA 1FY4A 3HATH 1P02A 1MTWA 2BDIA 4ZHAA 4NG9H 2BLWA 2XRCA 3LGUA 1XXDA 1WSSH 2CHAB 3S9AA 3R3GB 1OYQA 2FYRA 2GT8A 3D62A 2FYQA 4X6OA 3TNTA 3A87A 2FOGA 3D65E 1HAVB 1AZ8A 1IQMA 3TPIZ 4I33A 1TPAE 4LXBH 1F7ZA 1SC8U 3SNDA 1H9HE 1NN6A 1FIZA 1BTWA 3GDSA 1CQQA 3GCTG 2WINI 1GMHF 5FCKA 3ZYEA 1PQ8A 1RTKA 1J16A 1WU1A 4ABDA 1JMOH 1O2VA 2BLOA 3ENSB 2P94A 1S6HA 5GCHF 1V2PT 3RXFA 2QGRA 4BNRA 1ZHRA 2IPHA 1YPLH 1LTOA 4X6MA 2JKHA 1FUJA 1YM0A 3HPTB 1ARBA 1G32B 3C1KA 3LH1A 1W0ZU 1O3DA 1GJ4H 2XWAA 3VEQB 1KLJH 5A8ZA 1A3BH 2XC5A 1NO9H 2Z9LA 1DANH 3T27A 1T8MA 1GJBB 1C5SA 1C1TA 1PPGE 1O0DH 1N8OC 2H2ZA 2ZU2A 1SL3A 2D2DA 2GT7A 2ZF0H 4BAMB 1JBUH 1N1LA 4BTTB 3MWIU 2VH6A 1IQEA 1AWFH 1C2HA 2CJIA 2D26C 4OS1A 3BN9A 3UTUH 1GBEA 2BZ6H 2VWLA 2SGAA 5L2YH 4K5ZA 3GY5A 4CRDA 5A09A 1ZSLA 3FVFB 3A80A 1C5QA 3T28A 1OX1A 3M5LA 2P16A 3BV9B 1GPZA 5GWZA 1PQAA 6ESTA 4NSVA 1P2KA 2FIRH 1D6RA 1O2IA 1DUAA 2R3UA 4Q7ZA 1PPZA 1C5NH 1O2WA 3F9GA 2VJ1A 1Y8TA 2Y5FA 1Z6EA 5FCRA 1NFUA 2VVUA 4BXWA 1QRXA 1SLUB 2PFEA 4ABGA 1C5WB 5HGGA 1THRH 3UR9A 3B9FH 1GCTC 2PKSB 2ZZUH 4NZLA 1ZSJA 1K9OE 1H8DH 1OWEA 1BQYA 1YPHC 1UHBA 2R2MB 2AIPA 2A2XH 2VB0A 1BCUH 2OLGA 3M61U 1TNJA 3UNSA 1ZLRA 1C9TA 1O2UA 3EA9A 1RIWC 2G4TA 5SGAE 2UWLA 2YNAA 2ANYA 4FUJA 4FUBA 1FJSA 1ZSKA 3RXMA 3PB1E 3GDUA 4SGBE 1P0SH 3T29A 1FMGA 3MH7A 1C4Y2 3ZZ6A 2F91A 3OSYA 1MBQA 1EUFA 4IMZA 2ZU3A 4WXIA 1WYKA 2O8WA 4XOJA 3Q77A 3SORA 1C5VA 2ZPQA 3KF2A 1LVOA 4GHQA 3SJKA 1T8NA 4ESTE 4DIIH 2FS9A 4OS6A 2F83A 3PMBB 5JB9S 1C5YB 3RXAA 2BVSH 4RN6A 1WV7H 1BDAA 2OTVA 2TGAA 3JZ1B 3HKIB 2XNIA 3ZVGA 1NFXA 3RMMH 1JWTA 1P09A 3SW2B 1CBWB 4E7RG 4INHA 2ODYB 2PW8H 1NRRH 2I6SA 1RGQA 4B1TA 3E91A 1NS3A 3NXPA 4K3JA 1Y3UA 1IQFA 1J15A 1F5RA 1OP2A 4MQAA 3RXOA 1SOZA 4BAQB 3QTOH 3GY8A 1GL0E 2QAAA 1BITA 1QJ7B 2PV9B 2V35A 1PPHE 1MCTA 6CHAB 2C8ZB 1O2OA 1E38B 1AY6H 3P8OA 1KSNA 1GBTA 1GCDA 2WYGA 1IOEA 1LQEA 1QCPA 1OS8A 1JIRA 2JETB 3E0PB 1FLEE 1O33A 3IWMA 4FXGH 2OUAA 4Z0KA 1BJVA 1OWKA 4NWKA 2P95A 1FI8A 1P06A 3GYMA 1GI4A 4GLYA 1OWHA 4YTAA 2JH6D 4A1XA 3SJIA 5DP5A 2AERH 4UFEH 5H4IB 1XKBC 1TA2A 2ZCLP 4UEHH 3RM2H 1S5SA 3PO1C 1DY9A 1IAUA 1UTPA 2QF0A 1V2VT 3I77A 1Y5BT 1EQ9A 1D4PB 2Y80A 2Z3EA 1C5LH 4UFFH 1QJ1B 4Q7XA 1LVMA 2GVFA 2H1UA 2BM2A 5FBEA 1W7GH 2STAE 3SI3H 1J9CH 5LH8A 1ZRBA 4CHAC 1BBRE 1O2NA 1UTOA 3UY9A 1TPSA 1VR1H 1GJ7B 4B73A 2PLXA 3SHAH 1TQ7B 3BTDE 1MTNC 2BOHB 2ZKSA 2QXIA 4JZ1A 5A0BA 2SGPE 1DITH 3IITA 1O3JA 3ZZDA 2IJOB 2KAIA 4Z6AH 1EB1H 3R0FA 1ANDA 1FXYA 2EI8A 3FP8E 3K9XB 2BOKA 2BQ6B 1ZHPA 1DX5M 2RDLA 2CMYA 3LJJA 2A4QA 1K1NA 2R3YA 1O32A 1W0YH 4HI3A 2ZQ1A 2SNWA 4ISNA 5DP3A 3DD2H 3P17H 3SU0A 3O8CA 4B71A 3SUGA 2ULLA 1HAVA 9ESTA 3EGKH 1AWHB 1EAWA 1UVTH 3M5OA 1HAIH 2BY5X 3A88A 3S7KB 3RC5A 1ORFA 1P9SA 1ZMJA 1G37A 1O34A 5HM2A 4JZDH 2ZHWH 2A4GA 3L3TA 1YLDA 2ZU4A 4B2CA 4YOGA 1B5GH 1K1LA 1WOFA 1BMLA 2TIOA 3PWCA 1O2JA 3SI4H 2ZDVH 2P3FH 1L4DA 3A8AA 1F0UA 1QB9A 2GZ7A 2DUCA 1HAOH 4X8VH 2UUYA 2A45B 1S83A 1F5LA 2DE9A 1W8BH 4X1NU 2H5DA 3S69A 1Y59T 2HRVA 3SQEE 5DKMA 1CGJE 1DWEH 1SQOA 3SUEA 1KY9A 2C90B 3EE0B 3F6UH 5EODA 3SU5A 1JRSA 1P2MA 3MHWU 4ZAEA 3AASA 3RXVA 2H6MA 8GCHG 1S85A 4U32A 4HFPB 1XM1A 4LK4A 1O3KA 1DSTA 4Y71A 5EXMA 5A0AE 1KIGH 1F0SA 1DWCH 4UD9H 1UTKA 3BIUH 3FP6E 1LHGH 2F9UA 2FESH 1E34B 3PMAB 4YOJA 3NWUA 1C5MD 3LH3A 1NT1A 4CR5A 1GMDF 1T8LA 1O5DH 1VITG 2VWNA 2BY7X 1CU1A 1S6FA 1MUEB 4OGYA 1WCZA 3F9HA 1TX8A 1YLCA 5ABWA 2ZPRA 3QZRA 3HKJB 1KXAA 1GBKA 1O31A 1H8IH 1B0EA 4AFZA 1PQ5A 5C3NA 1ZTLA 1EZXC 2GCTC 3MTYA 1MQ5A 4CBOA 3TJOA 2B9LA 3LIWA 4X1SU 1W11U 3TNSA 4KTCA 1IQHA 1EZUC 3RM0H 3P95A 4TWWA 1GG6C 3PLBA 1ZYOA 1SG8B 1QBVH 3PWBA 1G2MA 2ZWLH 2H9TH 5FXLA 2Z6BD 1TLDA 1HCGA 2FX4A 1S84A 3RXIA 1KLTA 1YPJH 1V2JT 3GCOA 2Z7FE 2BDCA 3GISB 4AORA 1XUJA 4LZ1H 1HPGA 1ELVA 2BLQA 1GDQA 1KYNA 1SLXB 1KXCA 2VIOA 3LGYA 4FVBA 3A8DA 1AVXA 4D76A 8GCHF 1P12E 2ZTXA 4ISLA 3RXUA 4JZEH 1V2KT 3TIUA 1D6WA 3M3TA 5HXFA 4JK6A 2RA3A 1ACBE 4AFQA 1YP9A 2FX6A 5DO4H 1NC6A 2C93B 3MI4A 1MH0A 5EW1H 4FU7A 2QXGA 3CS7A 2ZTZA 2XW9A 1C2GA 4MPVA 3ZVFA 2VVCA 1QQUA 1BHXF 4WMEA 5JDUB 3QDZB 4BAHB 1A0JA 4MDSA 3EYDA 4KELA 4Y76A 1P03A 3SU1A 1MKXK 3SUFA 3ZVCA 2F3CE 1TRMA 2ZFFH 3RXBA 4AFSA 1ZHMA 3MNBA 1EPTC 1FPCH 2QY0B 1GI9B 4X2WA 4UFGH 2AMPA 2WPKS 3OTJE 1SGYE 1P3CA 2TGTA 2BYAX 1MD8A 1BBRH 4Y10E 4YZUA 3PV4A 4ZKNU 4B2AA 1DWBH 1AHTH 2PSXA 4DIHH 2SGEE 5IYTA 1DLEA 1GMHG 1PFXC 1D3DB 1GBIA 5LPFA 1THPB 1HBTH 1QB6A 2PUQH 1EAXA 1QR3E 5ESTE 4I8LA 1K1IA 2BZAA 2FMJA 1VJ9U 2YOLA 3BG4B 2ZDAH 3UNQA 1BTXA 1KXDA 2A31A 3V12A 1GVLA 2AGEX 3V0XA 5J4QA 2XBXA 1LPGB 4K69A 2R0KA 1V2MT 3U9AH 2SGQE 3VGCC 4ZUHA 1O3PB 2F9BH 3M35A 2FI3E 2A4OA 4DCDA 1C1SA 3RXSA 4NCYA 1TGCA 6GCHG 3QLPH 1ABJH 2AIQA 4ZROA 1QJ6B 4UFDH 3QZQA 3ATLA 1GBMA 1TA6A 2O8TA 1AE5A 1XMNB 2EI6A 3EAJA 1Y3YA 3D49H 1ELTA 1ZPCA 3I29A 3KN2A 3LKWA 1ZPBA 1J14A 4MPXA 1XVMA 2QXHA 2BDBA 3HGNA 3KQCA 3M36A 1C5ZB 1ELGA 3OU0A 3JZ2B 1SI5H 3U8RH 3TK5A 1GHYH 1S0RA 2Z9KA 3OY6U 2R9PA 4TYDA 4AZ2B 1SR5C 5FPYA 3V3MA 3A7TA 2OC0A 2FP7B 3ODDA 4AYVB 4A1VA 1TFXA 2VGCC 1GWAA 1PPFE 3KGPA 4NIYA 1GJ9B 2AFQB 4I32A 3O8RA 2Z3CA 4UE7H 1MKWH 1EB2A 4AFUA 2J4IA 1PPBH 4O03A 3ATMA 1FY8E 2FOEA 4ZKSU 4Y0YE 3GY2A 1AB9B 3M37A 1HJAC 1DWDH 2A4RA 5PTPA 2J95A 2C8XB 1LKBA 3NPSA 1GI7B 1UCYE 1CA8B 1FONA 1YCPM 3GOVB 1P3EA 2HOBA 2ZECA 2AMDA 2GMTC 1UK4A 4O97A 5AVDA 1BRBE 1GI1A 1QA7A 3EQ0H 2ODPA 6GCHF 3BSQA 1EOJA 1OP8A 2V3OH 4XBBA 2EI7A 4NIXA 1YBWA 1EATA 1PYTD 4ZXXH 1O2RA 5GXPA 3VB5A 2TRMA 1YPEH 5GIBA 1P05A 2YNBA 1V2LT 2XTTB 1MU8B 1GBCA 1HAZB 2ZDKA 3F1SB 3RXJA 1T31A 1H9IE 1S0QA 4MTBA 4O3TA 3TVJB 1GBBA 4YT6H 1DDJA 1RTLA 1T7CA 3M7QA 4IN2A 2J92A 1BB0B 2FO9A 5B6OA 3PYHA 2ZFTA 3LU9B 3UNRA 3MYWA 5A0CA 1O3FA 5E2OA 1GI2A 4ZKOU 2HNTE 4Y7AA 3D23A 3DT0H 1V2ST 2FM2A 5C20A 1XVOA 3TJNA 4WWYA 3AW0A 3SU4A 4X8SH 3A8BA 2ZEBA 5JBAS 5FAHA 4INLA 3SNAA 3UFAA 5HM9A 4AN7A 1ZTJA 1OPHB 1YKTA 4Q2KA 2EEKA 2ZGXH 1TMTH 5J4SA 4YOIA 1O3MA 2ZU1A 1YPKH 1BMMH 2IOTA 2G81E 5JBTA 1PPEE 4M7GA 3ZYDA 1SHYA 1P2OA 6LPRA 3SU2A 5A8YA 1SFQB 1LKAA 2ALPA 2VINA 4Y79A 3E8LA 3ZV9A 1BTZA 1MTUA 3M3SA 1GHZA 1HRTH 4AG2A 4NA7A 3EDXB 2QYIA 3NCLA 2W3IA 4DJZB 2GX4A 3RMOH 3SZNA 3ZZBA 1SSXA 3K2UA 4JYTA 1C1NA 1PJPA 1HNEE 1INCA 1L1JA 2ZFSA 2OQUA 4MG3A 3TH2H 3UPEA 1SFIA 1C5RA 1EJAA 2C8WB 4GAWA 1SLWB 1O3CA 5T6FA 4OS5A 4ZXYH 1AFQB 1OWJA 1A7SA 3FP7E 3OX7U 1OP0A 3VPKA 4MLFB 1GJ8B 3WY8A 1L1GA 3VXEH 2B0FA 1OYTH 5JBCS 3ATWA 3MOCA 1P2NA 1YCPH 3UWIA 2Y5GA 3ZZ3A 1O2ZA 2F9NA 2OQ5A 1A5IA 1C1OA 4OS2A 1E35B 2SGDE 2XBWA 1F0RA 2WPMS 1UTMA 4K8YA 2BB4A 1GBFA 1UTJA 3FAOA 5GJ4B 3BTGE 4MNVA 1Z8RA 1P57B 3ZZ5A 3CP7A 2G55A 4HTCH 4AB8A 1HFDA 1ELFA 1K1PA 1W10U 2WV4A 2P8OC 1TB6H 5AHGH 3SNBA 1TX6A 2GZ9A 3BIVH 4FUGA 1VCQA 1FY3A 2BY6X 2VH0A 2VNTA 1BIOA 2ZDMA 4Y0ZE 2WUCA 3NK8A 2ZG0H 4FVDA 4XSKU 4ZHMU 2O8LA 1DOJA 1TNGA 1G36A 1CSOE 1O5BB 1RRKA 1GMCF 1AU8A 1QQ4A 2WPHS 3MNCA 1AE8H 1L2EA 3L6PA 3UREA 3PLKA 2ZC9H 2ZP0H 1XXFA 1C2KA 3RXTA 1O36A 1DPOA 3TK6A 4X2YA 1O3IA 1O2MA 2SGFE 2F9OA 1QNJA 2BQWB 2HPQH 1NPMA 1GI6A 3TU7H 1BTYA 1SBWA 2Z9JA 2Y7XA 1P2JA 2BD5A 2JH5D 1AI8H 5LGOA 2XC4A 3AAVA 1C5OH 2G00A 2P59A 5FX5A 1GDNA 1SQAA 1DLKB 3KQDA 2FOFA 4A7IB 1TGTA 3KIDU 1LO6A 1GI8B 2ZFPH 3U98H 2ZQ2A 4GPGA 3T25A 5E2PA 3U8TH 5CE1A 1CA0B 2ZO3H 1GBAA 2FS8A 1G3CA 3A86A 1TNIA 2CN0H 3VGCB 1GHXH 3MH5A 3OY5U 3SV6A 3LT3A 3SGAE 4F49A 1MMJN 2A2QH 1ELEE 1DUEA 3SGQE 3SV9A 1VGCC 1D9IA 4DY7B