3RXAA

Crystal structure of trypsin complexed with cycloheptanamine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxaA02
2FESH 1SHYA 1O2HA 3SHCH 1T8NA 3GOVB 2VWOA 2A5AA 4LZ1H 1P2QA 4ZKNU 2AYWA 1T31A 4Y0YE 1YLCA 2GCTC 1S6FA 3BTTE 1OS8A 4OS2A 5ETXA 5DP5A 2V6NA 1FPHH 2RA3A 1RGQA 3A86A 3M36A 3T2NA 4AGKA 4BAHB 5DKMA 4RN6A 4YOJA 2SGDE 3P8NA 1GWAA 4VGCB 3G01A 1MCTA 4X1RU 1P09A 1ELBA 1XUJA 1A5HA 1TA2A 2FI5E 2FI4E 1O34A 4AG2A 1GBBA 3S7KB 1YPLH 1BTXA 5LPRA 1T8LA 2OD3B 1H8DH 1DLEA 3SJ9A 4INHA 5HM9A 1ESBA 1NZQH 6GCHF 2GD4B 1WUNH 1SQTA 1ETRH 4BAMB 3MU0A 1NTPA 2PR3A 2XNIA 2ZFRH 4AFSA 3RXEA 1CU1A 3UPEA 5CHAC 1GMCG 2XWAA 2ZPQA 1HJ9A 1ACBE 3WY8A 4UFDH 4K5ZA 2B8OH 3RXLA 2BXTH 1C2KA 1H4WA 3F68H 2F9OA 1VITF 3S9AA 1GCDA 1ID5H 1ZZZA 1TGNA 3GY4A 3M7QA 1PQ8A 1KLJH 1HCGA 3V3MA 1ANDA 3P92A 5IYTA 4I8JA 5GPIB 1C5MD 1DVAH 1W2KH 1LKAA 1AMHA 3OSYA 4MLFB 1AI8H 5A8ZA 2A7CA 4U2WA 2PLXA 4FVBA 3MH4A 1B7XB 1L1JA 1E37B 5H4IB 3GY8A 2D2DA 1ZGIA 2OBQA 2WYGA 2D8WA 2VGCB 3A8DA 5C1XA 4X2YA 5L2YH 3SORA 3FVFB 1MKXK 4IN1A 3SJIA 3ESTA 4I32A 1LHDH 2ZA5A 1VCQA 4YOGA 1THSH 2QF3A 1JXPA 3LKWA 1KLIH 1NS3A 1OSSA 3S69A 9ESTA 2QAAA 4CBNA 1P06A 2ZCHP 1O3FA 3GDVA 1AU8A 2VIWA 1TA6A 2R3UA 4A7IB 4CRGA 1HJAB 4LOYH 1IHTH 4GSOA 1RXPA 1GHXH 1NRSH 4E7RG 2A4GA 1K1JA 2ODPA 1ETSH 1O2VA 1QGFA 2YNAA 4DJZB 3SNAA 3RU4T 1LVYA 1C5SA 2PSYA 5G4BA 2GMTB 1KYNA 4J2YB 1TBZH 3LOXA 1TONA 3GYLB 3KQBA 1DITH 1P8VC 1BZXE 3RLYH 1FI8A 1UK2A 3SN8A 5L2ZH 4CRCA 4WMDA 1DXPA 5DP9A 1THRH 1C5UA 5EPNA 1O38A 1RIWB 2GT7A 1BBRK 2Z94A 3K6ZA 1TIOA 2G5NA 1UTJA 3SI3H 2FWWA 1F7ZA 1PQAA 1EZSC 5A09A 1ZJDA 1XXDA 1YPHC 5DP3A 3MFJA 2BVSH 4ZH8A 5JYIA 1AKSB 1BITA 2GZ9A 2B9LA 2Y6TA 1EPTB 1M9UA 4I8LA 4WF8A 4ZHMU 1XUFA 1AIXH 1YCPM 4UDWH 1MQ5A 2BD8A 2F83A 1EJMA 2B5TB 2R0LA 2R9PA 1TWXB 1C1WH 2W5EA 1NT1A 3NUMA 4KP0A 1ESAA 1TMBH 1GMDF 2ZHFH 1NY22 2WPLS 4K8BA 1EAWA 1AUTC 1TAWA 1P03A 3UR6A 1D6RA 2V0BA 4MNVA 1O2XA 1Y3UA 3CS7A 2ZKSA 2P8OB 1HIAB 3RXQA 4AGJA 1SMFE 2VIQA 4ISIH 3LJJA 2F9VA 1INCA 1PPHE 1BJVA 1EP5A 1YLDA 3BEUA 5BRRE 1TABE 5AFZH 1GMHG 1C2JA 1TQ0B 2FYRA 3GY2A 2XRCA 5A2MH 4JK5A 4DW2U 1L0ZA 1TRYA 1ZMJA 2ZTYA 3P95A 5GCHG 1O3LA 4GCHG 2ZDLA 1PQ5A 2ZQ2A 3SJOA 1ELAA 4AYVB 5IDKA 3ZVAA 3SI4H 1N1LA 2I6SA 3P8OA 4NFEA 4J1YA 2QY0B 4NFFA 1O5GH 2JETC 4NIYA 2J94A 4CRDA 4AG1A 1XKBC 3A7ZA 4O97A 4TPIZ 1UTOA 1EXFA 1BTZA 4BXSA 2ALVA 2GZ7A 3T25A 3VPKA 1P2NA 3TJOA 1O36A 1LKBA 1V2PT 3I78A 3P8FA 1O3NA 3ZVBA 4I8HA 3TITA 3IWMA 4X8VH 1SB1H 1O2QA 3BTGE 1O3DA 5F8ZA 3UQVA 1WBGB 2UWOA 4IS5A 1O3CA 3GY6A 1C1UH 1J16A 5EW2H 1GI5A 2Y5GA 4I33A 2WPMS 3KQEA 4WH8A 4UONA 4FUDA 1BJUA 1GBAA 5F8TA 3M35A 2XBYA 1GHYH 1GPZA 1SFQB 2PKAB 2AS9A 4NZQA 4UFGH 1SOZA 2KAIB 1ZSLA 1Y3XA 2ZG0H 2ANMH 3SV9A 1QJ1B 1GI9B 1A0JA 2F91A 3URCA 2ZDVH 1G3BA 1GI6A 1GI2A 2EEKA 2QXGA 4BTIB 1QJ7B 3FP7E 1YF4A 2ZNKH 1OYTH 2R3YA 4X6NA 2QF0A 3SU3A 3HK3B 1J15A 2HWLB 1MU6B 3SGBE 4X8TH 1NRNH 2P59A 3LGYA 1V2VT 1O3BA 3O8RA 1GBHA 1UCYH 2BXUH 1YCPK 2W3KA 1P2OA 3TPIZ 2VWNA 3ENSB 1C1RA 1GL0E 1MD7A 1TBRH 4ABAA 2ZP0H 5ESTE 1GCTC 4JZ1A 1C2MA 1E0FD 1Z6EA 1LDTT 2F9PA 1O2GH 2K1QA 4B2AA 1O3HA 2LPRA 3RDZA 1NRRH 1C4V2 4XBDA 1D3QB 4K69A 5TCCA 1CA0B 4XBCA 1GHZA 5A0CA 8ESTE 1PPEE 1NC6A 1YYY1 2EI8A 4X1PU 3F9HA 5EQQA 2ZGCA 2ZIQH 4MQAA 3VB3A 4YO9A 1LPZB 1SGDE 2RA0A 3LJOA 1G3DA 2C8YB 2STAE 3TLOA 2A2XH 7GCHG 1MTNB 1SLXB 1T7CA 1MCVA 3ZZ7A 5EG4A 3ATWA 1Y3YA 3GDSA 2ZWLH 3BTKE 1G30B 4ZKSU 1DWBH 2TRMA 2ZGJA 1H9LB 1A7SA 3BF6H 3VFEA 3ATLA 4JYUH 1ELEE 4CREA 2SGPE 4TWYA 3D62A 4Q7YA 1AZ8A 4CR5A 1QRWA 1TX8A 5LGOA 1FNIA 4AOQA 5EW1H 4NSYA 5FPYA 4DOQA 3U8OH 1LPGB 2ZI2H 3BTWE 4Y7AA 2AEIH 2SGFE 2QN5T 1EASA 2P3UB 3QUMP 3PLPA 4YLUA 2GCTB 2CF9H 1HBTH 1TGBA 4F4OC 4NA9H 2QXJA 1HV7A 3PLBA 1SBWA 2B0FA 1ZHMA 3QWCH 1CGJE 4OS7A 7KMEH 4B71A 3V12A 1AFEH 1HAGE 3AW0A 3S7HB 5E2PA 6CHAC 2F3CE 3ZVFA 1XXFA 1IQFA 3TH4H 3GISB 1AFQC 5AHGH 1ZOMA 1FZZA 4NA8A 1F5LA 1HAYB 2GZ8A 1TMTH 3B23B 3A7XA 2CJIA 4ASHA 1G2LA 3PO1B 1MBMA 1UCYE 2OCVB 2Q1JA 1OWDA 3LU9B 4XOJA 1W0ZU 2R2MB 1A61H 4GAWA 3SU6A 3TH3H 2J95A 2P95A 1TQ7B 4MVNA 1DLKB 1NROH 3A84A 5C5NA 3ZZBA 2PKSC 1V2WT 1Y5UT 1O0DH 2O8TA 5FCKA 1B0FA 2Z9GA 4Y0ZE 4O03A 4D9QA 2XYAA 3PLKA 5T6FA 4WVPE 1S85A 2HLCA 3MO9A 1GDNA 5GWZA 3RXCA 1V2KT 4O9VA 4Y11E 1JRSA 3M3VA 1DFPA 3EGKH 2ZCLP 3ZZ8A 1ZTKA 1BHXF 1EAXA 1CSOE 1N6YA 1RTFB 2FLRH 4CHAC 2A0QB 1SGFA 1PPZA 1Q31A 3ZYEA 5JBBS 1G32B 1YP9A 1OWHA 4CR9A 5DP7A 4K3JA 1AZZA 2FOGA 3S0NA 2IOTA 5FPSA 2BQ7B 3SNBA 4B1TA 1E35B 1L1GA 3SU2A 1YBWA 4AFZA 1GJ5H 4UFEH 1HAOH 1HXFH 1SLUB 4BAKB 2ZFFH 2TGDA 1N6XA 1W8BH 2SNVA 4Y79A 1AWHB 3JZ2B 1XVMA 4NG9H 4ZXYH 8KME2 2BY8X 2ZTZA 3ZVDA 8LPRA 2RDLA 1SGQE 4NSVA 2P94A 3M7UA 3MO6A 3OTJE 4Q2KA 3Q76A 2Z9KA 3CS0A 2TPIZ 4Y71A 4GPGA 3UOUA 1GHVH 1K1NA 3MTYA 2F9UA 1C1QA 1YPGH 2BY6X 3A8BA 3DA9B 1IQHA 3ODDA 1A0HB 3P17H 1EKBB 3RP2A 5JBTA 3GYMA 1IQEA 1UHBA 3A83A 1XUHA 2VH0A 4I31A 4IC5A 4FUGA 1F5RA 1OXGA 3UNQA 1ARBA 2AFQB 2QA9E 1BDAA 3UY9A 1E38B 4TYDA 2CGAA 2OC8A 4BXWA 1MQ6A 2BD5A 2NU1E 4LZ4B 2BY5X 4OS6A 4FU8A 3SBKA 1V6DA 1G2MA 2PHBA 3GCTG 4MDSA 1SVPA 1L2EA 2O8UA 5PTPA 1QR3E 4OS5A 3E0PB 1VCWA 2G51A 2NWNA 3AAUA 4AFUA 1EZXC 3MWIU 1CHOF 3UFAA 1P01A 3FAOA 3ZZDA 4JK6A 1S82A 2H9HA 3E6PH 4NIVA 3LGVA 1RS0A 1NM6A 5AVDA 1G36A 4DIIH 3KHVA 1F0SA 4BAQB 5FX6A 1C5LH 1BTHH 3SQEE 2Z3EA 4Z6AH 3MI4A 2BQ6B 1NN6A 1O3AA 2ZCKP 1BRCE 1FY8E 3MU8A 1GBDA 3BTFE 3MMGA 4DG4A 4UD9H 3SUGA 1SSXA 4ZMAH 1WAYB 2A5KA 1OOKB 6ESTA 4YT6H 4ABGA 1P04A 3FZDA 4E05H 3TGJE 5C67A 1H9HE 2BM2A 1IQIA 2XTTB 1J8AA 3M37A 5GIBA 4Y6DA 4CRBA 1HFDA 1O5FH 2ZFQH 1SQAA 2ZHQH 3DFLA 1HAPH 1MTUA 4DURA 1E36B 1OP8A 2JH6D 3RU4E 1O2YA 1DPOA 5FAHA 1G9IE 5JB8S 2DUCA 3BEIB 1B5GH 3PB1E 3ELAH 1KDQB 3A89A 5L30H 3BSQA 4R8TB 2CHAC 1PJPA 2BTCE 1AWFH 3FANA 2PGQB 2R0KA 1QRZA 2JETB 1LVOA 2ZDKA 3GDUA 3LGTA 2OP9A 1YPMH 2O8WA 4GHTA 1DWCH 4B2CA 2VVUA 4K1TA 1GL1A 3ZZ6A 3HK6B 5GXPA 3A85A 2C8XB 2XCNA 2VVCA 1C1TA 2Y80A 2AGIX 1V2ST 3UWIA 2G81E 3OY5U 5EQSA 8GCHG 1NRQH 2YNBA 1BUIA 1MTVA 2Z3CA 3ZV8A 1LHGH 2BDGA 2ANKH 1ZGVA 4HGCA 3Q77A 3T62A 1KXEA 2A1DB 2QC2A 1P57B 5EPYA 3GCHC 1EOJA 3NK8A 2GV7A 2VVVA 1A0LA 2ASUB 3EAJA 4ISLA 1W10U 4H6TA 1HRTH 3MNCA 1S5SA 3RXPA 1AVWA 2D1JA 2AERH 5A0AE 2ZFSA 1GG6C 1BQYA 4F49A 3VGCC 1O3JA 4MG3A 1IQKA 4X1QU 3RXOA 1UO6A 1UK3A 1KLTA 3E0NB 3HATH 1EP6A 3IITA 1KXAA 1QL7A 3TJNA 1L1NA 5JBAS 4OGYA 4INKA 1QJ6B 1ELFA 1HAHH 4GVUA 3CP7A 1DDJA 1FJSA 1O2IA 1TRNA 2A2QH 3UOPA 1CA8B 4K8YA 4WWYA 1DSUA 1Y3WA 1A3BH 2HPPH 2SGEE 1QIXB 5DPAA 3DFJA 2BHGA 4H4FA 5AFYH 1GDQA 1QBOA 1MAXA 3SGQE 2Y81A 3MNSA 4ZHLU 1GMCF 1WYKA 2ZHDA 3M61U 4A1XA 2SGQE 1IQNA 3L3TA 1U6QA 1MZDA 1QA7A 2W7SA 1DY8A 1CO7E 1D6WA 2TBSA 4AB8A 3SNDA 1DY9A 1YPJH 2Z7FE 1Z8IB 3MYWA 1O35A 2AGGX 1UTKA 4NCYA 2ANWA 1CT4E 1K22H 1AQ7A 2A7HA 4MNYA 3LDXH 4MNWA 1NRPH 1SI5H 3HGPA 2GTBA 4FVDA 5EXNA 2ZU2A 4YLQH 5GJ4B 2UUFB 1C5NH 1KXCA 3RXHA 2CMYA 1KTTB 3O8DA 2G5VA 1WOFA 2ZQ1A 3MH6A 3DUXH 1OX1A 4I7YH 1QBVH 2G55A 3QLPH 3VB5A 3AAVA 1AUJA 3KL6A 3EE0B 2BDBA 2VWMA 1O30A 4UEHH 3SU4A 1BMMH 1VITH 2W7UA 3QZRA 3U1JB 3EQ0H 4NGAH 3T26A 1WQVH 1V2NT 3LGIA 1GHBG 3UWJH 1BTYA 5I46H 1XUGA 3ODFA 1FXYA 1VGCC 1NFXA 3TK6A 1BHXB 3QO6A 3LIWA 1KTSB 2FOFA 3SV8A 1XKAC 2OUAA 3U1IB 1Z7KA 4X8SH 6CHAB 3SU5A 1CVWH 3TVJB 1PFXC 1BMAA 3TNSA 4NWKA 3RXIA 1KXFA 5L6NH 1A5IA 5EQRA 1GJAB 1AFQB 3CENA 5JBCS 1JIMA 3A8AA 4LK4A 3A81A 2DE8A 3BN9A 3LGWA 4JCNA 1TB6H 2ZPRA 3GCNA 3JZ1B 5T6DA 1FV9A 1GHAG 1C1VH 1A4WH 2GCHG 4X2WA 2OINA 1H9IE 2BY7X 1NFUA 2J9NA 3SNEA 1KDQA 1FUJA 1TNLA 4UE7H 2FP7B 1W7XH 2G8TA 4RKOB 1FY4A 3UREA 4BOHA 1FY3A 1UJ1A 1ZMLA 3MU4A 2BB4A 2ODQA 3A80A 2PKSB 1MKWH 1YPKH 1P2KA 2GKVE 3MU1A 3SV7A 3N7OA 5JDUB 1A5GH 1GJ9B 3PMHB 4YM9A 1C5ZB 2UWPA 5J4SA 4BTUB 3T27A 4THNH 4UFFH 4FUBA 2ZPSA 3D23A 3OY6U 2FLBH 3VXFH 1BBRE 1C1NA 1HXEH 2A7JA 3K65B 1FPCH 4ISHH 2ANYA 3LONA 4CHAB 2TGAA 1O39A 2ZECA 3PMJA 1WU1A 5C3NA 4A92A 1OP2A 1O3EA 4B74A 2UUJB 2ZGXH 1SPJA 1C1MA 1GVLA 1THPB 4QT8C 1ZRBA 1NFYA 2C3SA 1ZSJA 2FOMB 5LPEA 1RJXB 1TALA 2ZGHA 2FX4A 1MU8B 3E91A 1P3CA 4HTCH 2AH4X 3F6UH 3M5NA 2Z6BD 5JB9S 1XM1A 1HJ8A 1C2IA 2BLVA 3RXKA 1QB6A 2HNTC 4XBBA 5SGAE 1DE7H 3ZZ4A 1P3EA 4Y8ZA 4MNXA 1O2KA 3RU4D 2SNWA 2O8MA 1HJAC 1DM4B 1TNJA 2FOBA 4WXVA 3C27B 3W94A 2R2WU 5EXLA 4Q7ZA 1V2OT 1S0RA 1AD8H 1UHBB 1GMHF 1AHTH 1UCYK 2VIOA 2V3HH 2PTCE 3RMOH 4DY7B 5E2OA 4B75A 5C1UA 1QFKH 5DG6A 5CE1A 1YKTA 1PYTC 1FIWA 5E8EH 4PROA 1TLDA 1V2RT 1YC0A 1ELVA 1P9UA 1N8OC 1ELCA 2GMTC 3PWCA 5GCHF 2C90B 4GCHF 1BT7A 1Y5AT 1PPBH 2QYIA 3SU1A 2XC5A 4A5TS 2HGTH 3TIUA 1GI4A 3IG6B 1H8IH 3PROA 1ZHRA 1HGTH 2XBWA 3H7OA 1QCPA 1RIWC 1MAYA 4ABBA 5E0GA 2P3FH 2H2ZA 5GDSH 1K2I1 1C2EA 1GBFA 1C5OH 1AE5A 3P8GA 3KIDU 4DT7B 3RM2H 2AMPA 4MPVA 1K1MA 3U8TH 1Z1JA 4X2VA 5T6GA 4FU7A 1C5XB 4KTCA 3TGIE 2ZF0H 3ZYDA 1VCPA 1C9PA 2HNTF 1EPTC 3DHKH 1O2NA 1UVOA 3EA8A 3KCGH 3A88A 1ZTLA 4IW4E 4IMQA 1ZRKA 3VEQB 1UVPA 2XXLA 3VB7A 1HNEE 3ZV9A 4A1VA 3K9XB 1LVMA 3RXGA 1GGDC 2H1UA 2GT8A 3VB6A 2BLQA 1IQJA 1ZTJA 2WV5A 4GLYA 2FXRA 1QBNA 1AY6H 2EC9H 1AB9C 2PGBB 3LGUA 1QB9A 1LCYA 3ZVGA 2BMGB 2PW8H 1EAUA 1LMWB 2B7DH 2ZFTA 1LHCH 2ZO3H 2HRVA 3O8CA 4Z0KA 2QCYA 4X2XA 1O3OA 2Q6GA 4D9RA 1C5QA 1KY9A 1VR1H 5CHAB 1FN8A 1O5DH 3ZZ9A 3LC3A 4O3UA 2HPQH 5ESBA 2A5IA 2CHAB 2FZZA 3RC4A 1XMNB 1W11U 1ABJH 5F6MA 1F0RA 4Y10E 3S9CA 1CT2E 1BTUA 2RG3A 3KN2A 3P70B 2FOAA 2GGVB 1QQ4A 1L4DA 1CGHA 1NPMA 1EB2A 3FFGA 2STBE 2BD2A 5DO4H 2AIPA 2Y7ZA 2A45B 4ZKRU 1C5PA 4RSPA 4ZUHA 1C5RA 2BYAX 2ZZUH 3P6ZB 4CRFA 1TOMH 2IN2A 1B0EA 1HAZB 1ABIH 1GJ8B 1HLTH 3RXRA 1HAVB 1V2JT 2OBOA 3URDA 3NPSA 7GCHF 1VJAU 3T5FH 1GI7B 5EXMA 7LPRA 3UIRA 3E1XB 2FOHA 1DUEA 2ESTE 3M3SA 1GBJA 1O2SA 1JOUB 2FTMA 1JMOH 2ZU5A 1C9TA 3BG8A 1Z1IA 9LPRA 1C4Y2 3SU0A 3FP8E 1BA8B 2OC1A 4NIXA 1SHHB 4CBOA 1MTSA 3VB4A 1DS2E 1H1BA 1OWIA 1YPHE 1C2DA 3VGCB 1WSSH 2BOHB 2XWBI 3AVZA 3STJA 1A46H 2ZDAH 3A8CA 3SZNA 3B8JA 1L4ZA 4JZEH 4SGAE 1QRXA 1TGCA 3I77A 2D26C 1VZQH 4YT7H 2SFAA 5E0HA 1S81A 6GCHG 1RRKA 2W3IA 4HZHA 1UTMA 1D3DB 3PTNA 2V3OH 3UTUH 3KEEA 1IOEA 1D4PB 1T8MA 1C2FA 2BZ6H 1VITG 1QNJA 3OYPA 2OXSA 4FUJA 4DIHH 1DWDH 4JZIA 2TGPZ 2WINI 5CMXH 2FI3E 2V35A 4YZUA 3SV2H 1C1SA 2NU4E 3M7TA 1LHFH 3I29A 3ATMA 1XUKA 1NFWA 4IGDA 1LHEH 1O3IA 3L33A 1F5KU 1ZYOA 1Z6JH 1CA0C 2BD7A 3U9AH 1O2RA 1IQGA 1CE5A 5A0BA 4CH8B 4KGAA 4MPWA 5FBIA 2G4UA 2ODYB 1SQOA 5E0JA 3MH7A 1Y3VA 4AB9A 2BD9A 2FX6A 1V3XA 1O2ZA 2BVXH 2CXVA 3RXMA 1O2OA 3GY5A 1XUIA 2ZFPH 1K1LA 5B6OA 3SJ8A 2A4QA 2ZU3A 1ZR0A 2GVFA 2BY9X 4FXGH 3UNSA 2J2UA 3HPTB 2OLGA 1ZJKA 1TYNA 2FOEA 2QIQA 1IAUA 5JPMH 1GI8B 3ATKA 1VGCB 2OC0A 1DICA 1GBIA 1CBWC 1K21H 2J34A 1P11E 4KELA 3U69H 3RXBA 1Y59T 5F8XA 1BRAA 2BD4A 2XBVA 3NXPA 4K60A 2VINA 1D3TB 2FIRH 3R0FA 2OQUA 2AMQA 1ELTA 1QQUA 1BIOA 1HAXB 1FQ3A 4ZAEA 1JWTA 1O5CB 1O5BB 1ZMNA 1OPHB 4Y76A 1AE8H 4MPUA 3SJKA 1GJ7B 1DSTA 1SGIB 1WTHD 2BD3A 4ISNA 3RXJA 4ABJA 3LPRA 1ZSKA 5J4QA 4O3TA 2I6QA 1O5EH 1WTGH 1C5WB 1TNKA 1X7AC 1SGCA 4OS1A 1SLVB 1QURH 2PUQH 3A7YA 4K1EA 1GBLA 3QGJA 5K7RA 4ABHA 3PO1C 4U01A 3F9GA 1GI0A 2HNTE 3BV9B 5I25A 3RXVA 1S84A 3SNCA 4AFQA 2FS8A 4Q80A 4FUIA 3DD2H 2J92A 2YOLA 3E90B 3DT0H 3TJVA 3GCTF 1P02A 3BG4C 1HAVA 1V2MT 2G52A 3LC5A 1C2LA 4AYYB 3UR9A 3SHAH 1MKXH 1GMDG 4WMFA 1TGSZ 3QZQA 2GDDA 2QV1A 3PTBA 2GDEH 2Z9JA 6LPRA 1TNHA 1TOCB 1W3CA 4D76A 3RXFA 2ZEBA 4MTBA 1GVKB 2WUBA 2FPZA 1BCUH 1W14U 3ITIA 4ABIA 2J4IA 4LXBH 2H5DA 1O32A 1JIRA 4INLA 3TNTA 2Y7XA 2FODA 3RMNH 2CF8H 4D8NA 1C5VA 1D3PB 2VH6A 1FAXA 1GHWH 3LH3A 3GY7A 4XFQA 3OU0A 3SO3A 2F9NA 1ARCA 1EZUC 2WYJA 4WMEA 4CRAA 3S9BA 2UWLA 4NIWA 3BIVH 1BB0B 1UTPA 3RC6A 5FBEA 1TMUH 4ZROA 1GCTB 4WJG2 3F1SB 3QN7A 1CHGA 1C1OA 5HYOA 3TK9A 1TPSA 1HB0B 2BX3A 1CGIE 5F03A 1N8OB 3NZIA 3B9FH 1SL3A 3UQOA 2BLWA 3LT3A 4JZFH 2XC0A 1GJCB 5DJ7A 1NU9A 2Q6FA 2ZU1A 1YPEH 3MOCA 1GBEA 1DOJA 1BBRH 1WQSA 1A2CH 2PUXB 5LPFA 3BIUH 1C1PA 1EJNA 1TPPA 3MH5A 5HXFA 2Y5FA 2ALPA 1O2MA 2ZDMA 1FY5A 3EYDA 3BEFB 3TGKE 1W13U 3KQCA 1O37A 3M3TA 3SUFA 1K28D 4TY7A 4GUXA 1ELDE 2Z3DA 5EODA 4YOIA 2NU3E 1Z8RA 3Q00A 4ZHAA 3Q3YA 2BDAA 1P10A 8GCHF 1EUFA 3A87A 1UVTH 1O2LA 3RC5A 4NA7A 3QTVH 3A7WA 3BTQE 4NZLA 4TWWA 4JYTA 3R3GB 1PQ7A 2EA3A 1HUTH 1LTOA 4D7FA 1SOTA 4RKJB 2A31A 2WV4A 1EX3A 3NKKA 1O2WA 1GGDB 2FS9A 2A4RA 1P0SH 4JYVH 1UVSH 4DVAU 1O33A 4FUHA 4B73A 1C4U2 5DP4A 1WV7H 1YM0A 4BNRA 4BAOB 1FMGA 1AB9B 3SV6A 1AVXA 4VGCC 2A32A 3RLWH 3ZVEA 4XDEA 3QDZB 2THFB 1K1IA 4FU9A 2EI6A 2VIDA 4K2YA 3A7TA 2XCFA 4AZ2B 3TK5A 5A8XA 1EJAA 2QXHA 1C5YB 1NU7B 3QX5H 1DXWA 1MD8A 1O2JA 4WH6A 3ZVCA 4DGJA 3BTHE 2O9QA 4WXIA 1LPKB 3AASA 4JMYA 2TIOA 3BTEE 1O3PB 1W12U 4E7NA 4H42U 4TY6A 3BTME 1BMNH 1DUAA 2VJ1A 3RMMH 2M5TA 4ZXXH 4ABDA 3HKIB 4KTUA 1OKXA 1V2TT 4A6LA 1ZLRA 2P16A 4TPYA 2WPJS 1EZQA 1MKWK 3F9EA 2WPIS 1P2JA 1FLEE 7ESTE 1HYLA 3HGNA 1E34B 3A7VA 1TE0A 1S0QA 4U32A 2SGAA 2ZTXA 1DWEH 3RXUA 5DK1A 5EU8A 3RXDA 2ZHEH 2FO9A 2GV6A 2UUYA 3Q3KA 3D65E 3RXSA 1Y8TA 1D9IA 2VGCC 1RFNA 2C4FH 3QK1A 3UUZA 5A8YA 1ESTA 1SGTA 1ANCA 2NU2E 4IMZA 1K1OA 1TNGA 1IQLA 1AGJA 1XX9A 4BTTB 2FDAA 4JZDH 4XE4A 2GP9B 1OP0A 3W95A 1GBTA 5AF9H 1ZPBA 1QL8A 3RUOA 1GHBF 3RMLH 1QY6A 1F2SE 1ZHPA 2BDHA 3PYHA 2J38A 1DANH 1EAIA 4IBLH 3EA7A 2IJOB 2HALA 1GBKA 1WCZA 1KIGH 3EDXB 2Y82A 1UTNA 1W0YH 1GJ4H 5TJXA 1BTPA 1F92A 3M5LA 3PV4A 1YCPH 3KGPA 1ZPCA 1Z8JB 2H9TH 5C1YA 4DCDA 1GJDB 2P3TB 4IN2A 1TPOA 1BMLA 1NESE 2ZDNA 1Q3XA 2QGRA 4OS4A 1VJ9U 3BTDE 1TFXA 2JH5D 3TU7H 1KXDA 1MZAA 2UUKB 1FIZA 1RD3B 1GHAF 2FM2A 2GCHF 2VIVA 5C5OA 1GVZA 2WPKS 3SUDA 2A4OA 2QXIA 3MNBA 4I8KA 2TGTA 3ZZCA 4X6MA 1FAKH 2VWLA 2BQWB 3H7TA 2XC4A 1P05A 1KSNA 1J14A 1KXBA 2VU8E 1PYTD 1O3GA 1TX6A 2C8WB 1MH0A 1F0UA 2GX4A 2H6MA 2C8ZB 2VB0A 2HOBA 3HKJB 3RXTA 2ZGBH 1SGEE 1TPAE 2BDIA 5C20A 3ZZ3A 2PSXA 2BX4A 3U8RH 1ORFA 1A3EH 1FY1A 1YGCH 3ZZ5A 2ZHWH 1UK4A 4NWLA 1T8OA 3M5OA 5ABWA 2EI7A 1JBUH 3F9FA 3QGNB 4X1SU 1FDPA 4ABFA 1AVGH 1AKSA 3PMBB 2BVRH 4ABEA 2F9BH 2Y5HA 4X6PA 5FXLA 3NCLA 1SR5C 1OWJA 1EPTA 1UTLM 3MO3A 3RXAA 1TNIA 2XW9A 3K2UA 1FN6A 3A82A 2H9EH 1V2LT 3FZZA 1JRTA 1GBMA 1RTLA 1T4UH 2P93A 1CBWB 3SUEA 3TJUA 3H5CB 2P8OC 2Z9IA 1LQDB 1GI3A 1QA0A 2ULLA 1BOQA 1DX5M 1GDUA 4M7GA 3Q3XA 4YESB 4BANB 2RCEA 1UVUH 2FEQH 1HIAA 2PTNA 3C1KA 3T28A 1EQ9A 5K0HA 4K1SA 1V2UT 1V2QT 1C2HA 1ELGA 4KTSA 5C2ZA 3KQDA 1NO9H 1QHRB 2G00A 2ZC9H 5DP6A 3SOSA 3E8LA 2ZU4A 1J17T 1O2TA 2VIPA 3SQHE 4Q7XA 1LQEA 1A1RA 1F0TA 3STIA 1SGFG 3AW1A 3D49H 3PMAB 3MU5A 4X6OA 4YTAA 3MNXA 1G37A 1G3CA 4H6SB 4AORA 1SFIA 1O31A 2AGEX 3SW2B 1SLWB 4B2BA 1SGYE 5EOKA 3V0XA 4X1NU 2FMJA 2OC7A 1QTFA 1EB1H 2AMDA 2CN0H 2PFEA 5DP8A 2BZAA 3OX7U 1O3KA 1GJBB 1SG8B 1W7GH 4CH2B 1EOLA 1HAIH 3RM0H 1K1PA 4IC6A 5HMAA 1C5TA 1Z71A 1CHOG 4SGBE 1SGRE 1C2GA 5HM2A 3PWBA 1G3EA 3BG4B 2BDCA 4ZKOU 2H5CA 3GCHB 1ANBA 2C93B 3L6PA 4ISOA 2OTVA 1P9SA 1GJ6A 2NU0E 5FPTA 5HGGA 3ZZAA 1AO5A 4B76A 1OWKA 3ATIA 1GI1A 4R0IA 4Y8YA 1GBCA 4GHQA 3PM3A 2PV9B 1P12E 2BDYA 1GG6B 1BTWA 2IPHA 5FX5A 4WY3A 1HDTH 1O2PA 3EA9A 1OWEA 1RTKA 2JKHA 4Y8XA 3GY3A 1XVOA 1PPFE 1DT2A 2OQ5A 5TCAA 2DE9A 1IHSH 1FONA 2G4TA 2PWXA 5T3HA 2PKAA 3QTOH 1P2MA 2LNCA 2WPHS 2FOCA 2KAIA 1UTQA 2FYQA 3KNXA 4X0WU 1O5AB 4AN7A 2XBXA 1SGNE 1SGPE 1CQQA 4AX9H 1J9CH 2HVXA 1IQMA 1PPCE 1QL9A 4X8UH 3E16B 1T4VH 1O3MA 5BPEA 3NWUA 3GICB 3T29A 3K6YA 5EGMA 4FUCA 2W26A 3MHWU 1LO6A 1BRBE 5DGJA 1ZPZA 3U98H 1LVBA 3FP6E 1TBQH 2CV3A 4D7GA 3UNRA 4A1TA 3LH1A 4MPXA 2Z9LA 3TH2H 3VXEH 5FCRA 1Z8GA 4KKDA 3SGAE 2Q6DA 4OGXA 3M5MA 1ETTH 1TGTA 1TRMA 2BOKA 1S6HA 1K9OE 4ESTE 1CT0E 1QB1A 1ANEA 2WUCA 1UMAH 1EATA 2BLOA 1BRUP 1Q2WA 4XSKU 3O8BA 5LH8A 1MTNC 1S83A 4FUEA 4FUFA 4Y7BA 2ILNA 1O2UA 4U30A 1P2IA 2O8LA 1MUEB 1SC8U 1MTWA 1MBQA 2AIQA 1PPGE 1AN1E 2FTLE 2JH0D 3V7TA 4HFPB 1OYQA 3E3TA 1Y5BT 3V13A 4I8GA 2VNTA 1T32A 5FHTA 3GCOA 4E06H 3KF2A 1MMJN 4HI3A 1TX7A 1HPGA
chains in the Genus database with same CATH superfamily
2FESH 1SHYA 1O2HA 3SHCH 1T8NA 3GOVB 2VWOA 2A5AA 4LZ1H 1P2QA 4ZKNU 2AYWA 1T31A 4Y0YE 1YLCA 2GCTC 1S6FA 3BTTE 1OS8A 4OS2A 5ETXA 5DP5A 2V6NA 1FPHH 2RA3A 1RGQA 3A86A 3M36A 3T2NA 4AGKA 4BAHB 5DKMA 4RN6A 4YOJA 2SGDE 3P8NA 1GWAA 4VGCB 3G01A 1MCTA 4X1RU 1P09A 1ELBA 1XUJA 1A5HA 5B6LA 1TA2A 2FI5E 2FI4E 1O34A 4AG2A 1GBBA 3S7KB 1YPLH 1BTXA 5LPRA 1T8LA 2OD3B 1H8DH 1DLEA 3SJ9A 4INHA 5HM9A 1ESBA 1NZQH 6GCHF 2GD4B 1WUNH 1SQTA 1ETRH 4BAMB 3KQ5A 3MU0A 1NTPA 2PR3A 2XNIA 2ZFRH 4AFSA 3RXEA 1CU1A 3UPEA 5CHAC 1GMCG 2XWAA 2ZPQA 1HJ9A 1ACBE 3OTPA 3WY8A 4UFDH 4K5ZA 2B8OH 3RXLA 2BXTH 1C2KA 1H4WA 3F68H 2F9OA 1VITF 3S9AA 1GCDA 1ID5H 1ZZZA 1TGNA 3GY4A 3M7QA 1PQ8A 1KLJH 1HCGA 3V3MA 1ANDA 3P92A 5IYTA 4I8JA 5GPIB 1C5MD 1DVAH 1E79D 2QF4A 1W2KH 1LKAA 1AMHA 3OSYA 4MLFB 1AI8H 5A8ZA 2A7CA 4U2WA 2PLXA 4FVBA 3MH4A 1B7XB 1L1JA 1E37B 5H4IB 3GY8A 2D2DA 1ZGIA 2OBQA 2WYGA 2D8WA 2VGCB 3A8DA 5C1XA 1S6LA 4X2YA 5L2YH 3SORA 3FVFB 1MKXK 4IN1A 3SJIA 3ESTA 4I32A 1LHDH 2ZA5A 1VCQA 4YOGA 1THSH 2QF3A 1JXPA 3LKWA 1KLIH 1NS3A 1OSSA 3S69A 9ESTA 2QAAA 4CBNA 1P06A 2ZCHP 3OE7D 1O3FA 3GDVA 1AU8A 2VIWA 1TA6A 2R3UA 4A7IB 4CRGA 1HJAB 4LOYH 1IHTH 4GSOA 1RXPA 1GHXH 1NRSH 4E7RG 2A4GA 1K1JA 2JJ2D 2ODPA 1ETSH 1O2VA 1QGFA 2YNAA 4DJZB 3SNAA 3RU4T 1LVYA 1C5SA 2PSYA 5G4BA 2GMTB 1KYNA 4J2YB 1TBZH 3LOXA 1TONA 2W6JD 3GYLB 3KQBA 1DITH 1P8VC 1BZXE 3RLYH 1FI8A 1UK2A 3SN8A 5L2ZH 2LP6A 4CRCA 4WMDA 1DXPA 5DP9A 1THRH 1C5UA 5EPNA 5F53A 1O38A 1RIWB 2GT7A 1BBRK 2Z94A 3K6ZA 1TIOA 5EJLA 2G5NA 1UTJA 3SI3H 2FWWA 1F7ZA 1PQAA 1EZSC 5A09A 1ZJDA 1XXDA 1YPHC 5DP3A 3MFJA 2BVSH 4ZH8A 5JYIA 1AKSB 1BITA 2GZ9A 2B9LA 1UW7A 2Y6TA 1EPTB 1M9UA 4I8LA 4WF8A 4ZHMU 1XUFA 1AIXH 1YCPM 4UDWH 1MQ5A 2BD8A 2F83A 1EJMA 2B5TB 2R0LA 2R9PA 1TWXB 1C1WH 2W5EA 1NT1A 3NUMA 4KP0A 1ESAA 1TMBH 1GMDF 2ZHFH 1NY22 3KYFA 2WPLS 4K8BA 1EAWA 1AUTC 1TAWA 3FOAA 1P03A 3UR6A 1D6RA 2V0BA 4MNVA 1O2XA 1Y3UA 3CS7A 2ZKSA 2P8OB 1HIAB 3RXQA 4AGJA 1SMFE 2VIQA 4ISIH 3LJJA 2F9VA 1INCA 1PPHE 1BJVA 1EP5A 1YLDA 3BEUA 5BRRE 1TABE 5AFZH 1GMHG 1C2JA 1TQ0B 2FYRA 3GY2A 2XRCA 5A2MH 4JK5A 1SKYE 4DW2U 1L0ZA 1TRYA 1ZMJA 2ZTYA 3P95A 5GCHG 1O3LA 4GCHG 2ZDLA 4ACBA 1PQ5A 2ZQ2A 3SJOA 1ELAA 4AYVB 5IDKA 3ZVAA 3SI4H 1N1LA 2I6SA 5EJ1A 3P8OA 4DT4A 4NFEA 4J1YA 2QY0B 4NFFA 1O5GH 2JETC 4NIYA 2J94A 4CRDA 4AG1A 1XKBC 3A7ZA 4O97A 4TPIZ 1UTOA 1EXFA 1BTZA 4BXSA 2ALVA 2GZ7A 3T25A 3VPKA 1P2NA 3TJOA 1O36A 1LKBA 1V2PT 3I78A 3P8FA 1O3NA 3ZVBA 4I8HA 3TITA 2RFKC 4Q4LA 4P00A 3IWMA 4X8VH 1SB1H 1O2QA 3BTGE 1O3DA 2EY4C 5F8ZA 3UQVA 1WBGB 2UWOA 4IS5A 4P02A 1O3CA 3GY6A 1C1UH 1J16A 5EW2H 1GI5A 2Y5GA 4I33A 2WPMS 3KQEA 4WH8A 4UONA 4FUDA 1BJUA 1GBAA 1H8ED 5F8TA 3M35A 2XBYA 1GHYH 3PV5A 1GPZA 1SFQB 2PKAB 2AS9A 4NZQA 4UFGH 1SOZA 2KAIB 1ZSLA 1Y3XA 5IK2D 2ZG0H 2ANMH 3SV9A 1QJ1B 1GI9B 1A0JA 3MQKC 2F91A 3URCA 2ZDVH 1G3BA 1GI6A 1COWD 1GI2A 2EEKA 2QXGA 4BTIB 1QJ7B 3FP7E 1YF4A 2ZNKH 1OYTH 2R3YA 2VBCA 4X6NA 2QF0A 3SU3A 3HK3B 1J15A 2HWLB 1MU6B 3SGBE 4X8TH 1NRNH 2P59A 3LGYA 1V2VT 1O3BA 3O8RA 1GBHA 1UCYH 2BXUH 1YCPK 2W3KA 1P2OA 3TPIZ 2VWNA 3ENSB 1C1RA 1GL0E 1MD7A 1TBRH 4ABAA 2ZP0H 5ESTE 1GCTC 4JZ1A 1C2MA 1E0FD 1Z6EA 1LDTT 2F9PA 1O2GH 2K1QA 4B2AA 1O3HA 2LPRA 3RDZA 1NRRH 1C4V2 4XBDA 1D3QB 4K69A 5TCCA 1CA0B 4XBCA 1GHZA 5A0CA 8ESTE 1PPEE 1NC6A 1YYY1 2EI8A 4X1PU 3F9HA 5EQQA 2ZGCA 2ZIQH 4MQAA 3VB3A 4YO9A 1LPZB 1SGDE 2RA0A 3LJOA 2M2AA 1G3DA 2C8YB 2STAE 3TLOA 1SQRA 2A2XH 7GCHG 1MTNB 1SLXB 1T7CA 1MCVA 3ZZ7A 5EG4A 3ATWA 1Y3YA 3GDSA 2ZWLH 3BTKE 1G30B 4ZKSU 1DWBH 2TRMA 2ZGJA 1H9LB 1A7SA 3BF6H 3VFEA 3ATLA 4JYUH 1ELEE 4CREA 2SGPE 4TWYA 3D62A 4Q7YA 1AZ8A 4CR5A 1QRWA 1TX8A 5LGOA 1FNIA 4AOQA 5EW1H 4NSYA 5FPYA 4DOQA 3U8OH 1LPGB 2ZI2H 3BTWE 4Y7AA 2AEIH 2SGFE 2QN5T 1EASA 2P3UB 3QUMP 3PLPA 4YLUA 2GCTB 2CF9H 1HBTH 1TGBA 4F4OC 2HLDD 4RT0A 4NA9H 2QXJA 1HV7A 3PLBA 1SBWA 2B0FA 1ZHMA 3QWCH 1CGJE 4OS7A 3PRBA 7KMEH 4B71A 3V12A 1AFEH 1HAGE 3AW0A 3S7HB 2L6OA 5E2PA 6CHAC 2F3CE 3ZVFA 1XXFA 1IQFA 3TH4H 3GISB 1AFQC 1YLNA 5AHGH 1ZOMA 1FZZA 4NA8A 1F5LA 1HAYB 2GZ8A 1TMTH 3B23B 3A7XA 2CJIA 4ASHA 1G2LA 3PO1B 1MBMA 1UCYE 2OCVB 2Q1JA 1OWDA 3LU9B 4XOJA 1W0ZU 5KECA 2R2MB 1A61H 4GAWA 3SU6A 3TH3H 5CHBA 2J95A 3PRDA 2P95A 3VG8A 1TQ7B 3WW7A 4MVNA 1DLKB 1NROH 3A84A 5C5NA 3ZZBA 2PKSC 1YWUA 1V2WT 1Y5UT 1O0DH 3ZIAD 2O8TA 5FCKA 1B0FA 2Z9GA 4Y0ZE 4O03A 4D9QA 2XYAA 3PLKA 5T6FA 4WVPE 1S85A 2HLCA 3MO9A 1GDNA 5GWZA 3RXCA 1V2KT 4O9VA 4Y11E 2LELA 1JRSA 3M3VA 1DFPA 3EGKH 2ZCLP 3ZZ8A 1ZTKA 1BHXF 3NRLA 4FOUC 1EAXA 1CSOE 1N6YA 1QZ8A 1RTFB 2FLRH 4CHAC 2A0QB 1SGFA 1PPZA 1Q31A 3ZYEA 5JBBS 1G32B 1YP9A 1OWHA 2L74A 4CR9A 5DP7A 4K3JA 1AZZA 2FOGA 3S0NA 2IOTA 5FPSA 2BQ7B 3SNBA 4B1TA 1E35B 1L1GA 3SU2A 1YBWA 4AFZA 1GJ5H 4UFEH 1HAOH 1HXFH 1SLUB 4BAKB 2ZFFH 2TGDA 1N6XA 1W8BH 2SNVA 4Y79A 1AWHB 3JZ2B 1XVMA 4NG9H 4ZXYH 8KME2 2BY8X 2ZTZA 3FKSD 3ZVDA 2JDID 8LPRA 2RDLA 1SGQE 4NSVA 3SYJA 2P94A 3M7UA 3MO6A 3OTJE 4Q2KA 3Q76A 2Z9KA 3CS0A 2TPIZ 2KCYA 4AC9A 4Y71A 4GPGA 5GNDA 2KCOA 3UOUA 1GHVH 1K1NA 3MTYA 2F9UA 1C1QA 1YPGH 2BY6X 5KGOA 3A8BA 3DA9B 1IQHA 3ODDA 1A0HB 1VKYA 2W6ID 3P17H 1EKBB 3RP2A 5JBTA 3GYMA 1IQEA 1UHBA 3A83A 1XUHA 2VH0A 4I31A 4IC5A 4FUGA 1F5RA 1OXGA 3UNQA 1ARBA 2AFQB 2QA9E 1BDAA 3UY9A 1E38B 4TYDA 2CGAA 2OC8A 4BXWA 1MQ6A 2QE7D 2BD5A 2NU1E 2RDEA 4LZ4B 2BY5X 4OS6A 4FU8A 3SBKA 1V6DA 1G2MA 2PHBA 3GCTG 4MDSA 1SVPA 1L2EA 2O8UA 5PTPA 1QR3E 4OS5A 3E0PB 1VCWA 2G51A 2NWNA 3AAUA 4AFUA 1EZXC 3MWIU 1CHOF 3UFAA 1P01A 3FAOA 3ZZDA 4JK6A 1S82A 2H9HA 3E6PH 4NIVA 3LGVA 1RS0A 1NM6A 5AVDA 1G36A 4DIIH 3KHVA 1F0SA 4BAQB 5FX6A 1C5LH 3OFND 1BTHH 3SQEE 2Z3EA 3F2HA 4Z6AH 3MI4A 3U28C 2BQ6B 1NN6A 1O3AA 2ZCKP 1BRCE 1FY8E 3MU8A 1GBDA 3BTFE 3MMGA 4DG4A 4UD9H 3SUGA 1SSXA 4ZMAH 1WAYB 2A5KA 1OOKB 6ESTA 4YT6H 4ABGA 1P04A 3FZDA 2JIZD 4E05H 5C67A 3TGJE 1H9HE 2BM2A 1IQIA 2XTTB 5C17A 1J8AA 4B6EA 3M37A 5GIBA 4Y6DA 4CRBA 1HFDA 1O5FH 2IJD1 4XRNA 2ZFQH 1SQAA 2ZHQH 3DFLA 1HAPH 1MTUA 1NBME 4DURA 1E36B 1OP8A 2JH6D 3RU4E 1O2YA 1DPOA 5FAHA 1G9IE 5JB8S 2DUCA 3BEIB 1B5GH 3PB1E 3ELAH 3DSPA 1KDQB 3A89A 5L30H 3BSQA 4R8TB 2CHAC 1PJPA 2BTCE 1AWFH 3FANA 2PGQB 2R0KA 1QRZA 2JETB 1LVOA 2ZDKA 3GDUA 3LGTA 2OP9A 1YPMH 2O8WA 4GHTA 1DWCH 4B2CA 2VVUA 4K1TA 1GL1A 3ZZ6A 3HK6B 5GXPA 3A85A 2C8XB 2XCNA 2VVCA 1C1TA 2Y80A 2AGIX 1V2ST 3UWIA 2G81E 1H8HD 3OY5U 5EQSA 8GCHG 1NRQH 2YNBA 1BUIA 1MTVA 2Z3CA 3ZV8A 1LHGH 2BDGA 3OEED 2ANKH 1ZGVA 4HGCA 3Q77A 3T62A 1KXEA 2A1DB 5DSFA 2QC2A 1P57B 2V3MA 5EPYA 3GCHC 1EOJA 3NK8A 2GV7A 2VVVA 1A0LA 2ASUB 3EAJA 4ISLA 1W10U 4H6TA 1HRTH 3MNCA 1S5SA 3N7EA 3RXPA 1AVWA 2D1JA 2AERH 5A0AE 2ZFSA 3F0PA 1GG6C 1BQYA 2AHME 4F49A 3VGCC 1O3JA 4MG3A 1IQKA 2F4LA 2YMSC 4X1QU 3RXOA 1UO6A 1UK3A 1KLTA 2XOKD 3E0NB 4ASUD 3HATH 1EP6A 3IITA 1KXAA 1QL7A 3TJNA 1L1NA 3GS9A 5JBAS 4OGYA 4INKA 1QJ6B 1ELFA 1HAHH 4GVUA 3CP7A 1DDJA 1FJSA 1O2IA 1TRNA 4FETA 2A2QH 3UOPA 1CA8B 4K8YA 4WWYA 1DSUA 1Y3WA 1A3BH 2HPPH 2SGEE 1QIXB 5DPAA 3DFJA 2BHGA 4H4FA 5AFYH 1GDQA 1QBOA 1MAXA 3SGQE 2Y81A 3MNSA 4ZHLU 1GMCF 1WYKA 2ZHDA 3M61U 4A1XA 2SGQE 1IQNA 3L3TA 1U6QA 1MZDA 1QA7A 2W7SA 1DY8A 3EE7A 1CO7E 1D6WA 2TBSA 4AB8A 3SNDA 1DY9A 1YPJH 2Z7FE 1Z8IB 3MYWA 1O35A 2AGGX 1UTKA 4NCYA 2ANWA 1CT4E 1K22H 1AQ7A 2A7HA 4MNYA 3LDXH 4MNWA 1NRPH 1SI5H 3HGPA 2GTBA 4FVDA 5EXNA 2ZU2A 4YLQH 5GJ4B 2UUFB 1C5NH 1KXCA 3RXHA 2CMYA 1KTTB 3F2FA 3O8DA 2G5VA 1WOFA 2ZQ1A 3MH6A 3DUXH 1OX1A 4I7YH 1QBVH 2G55A 3QLPH 3VB5A 3AAVA 1AUJA 3KL6A 3EE0B 2BDBA 2KM0A 2VWMA 1O30A 4UEHH 3SU4A 1BMMH 1VITH 2J97A 2W7UA 3QZRA 3U1JB 3EQ0H 4NGAH 3T26A 1WQVH 1V2NT 3LGIA 1GHBG 3UWJH 1BTYA 5I46H 1XUGA 3ODFA 1FXYA 1VGCC 1NFXA 3TK6A 1BHXB 3QO6A 3LIWA 1KTSB 2FOFA 3SV8A 1XKAC 2OUAA 3U1IB 1Z7KA 4X8SH 6CHAB 3SU5A 1CVWH 3TVJB 1PFXC 1BMAA 3TNSA 4NWKA 3RXIA 1KXFA 5L6NH 1A5IA 5EQRA 1GJAB 1AFQB 3CENA 5C0TA 5JBCS 1JIMA 3A8AA 2KCAA 3A81A 4LK4A 2DE8A 3BN9A 3LGWA 4JCNA 1TB6H 2ZPRA 3GCNA 3JZ1B 5T6DA 1FV9A 1GHAG 1C1VH 1A4WH 2GCHG 4X2WA 2XNDD 1H9IE 2BY7X 2OINA 1NFUA 2J9NA 3SNEA 1KDQA 1FUJA 1TNLA 4UE7H 2FP7B 1W7XH 2G8TA 4RKOB 1FY4A 3UREA 4BOHA 1FY3A 1UJ1A 1ZMLA 3MU4A 2BB4A 2ODQA 3A80A 2PKSB 1MKWH 1YPKH 1WXRA 1P2KA 2GKVE 3MU1A 3SV7A 3N7OA 5JDUB 1A5GH 1GJ9B 3PMHB 5C94A 4YM9A 1C5ZB 2UWPA 5J4SA 4BTUB 3T27A 4THNH 4UFFH 4FUBA 2ZPSA 3D23A 3OY6U 2FLBH 3VXFH 1BBRE 1C1NA 1HXEH 2A7JA 4B6FA 3K65B 1FPCH 4ISHH 2ANYA 3LONA 4CHAB 2TGAA 1O39A 2ZECA 3PMJA 1WU1A 5C3NA 4A92A 1OP2A 1O3EA 4B74A 2UUJB 2ZGXH 1SPJA 1FX0B 1C1MA 1GVLA 1THPB 3WWBA 4QT8C 1ZRBA 1NFYA 2C3SA 1ZSJA 2FOMB 5LPEA 1RJXB 1TALA 2ZGHA 2FX4A 1MU8B 3E91A 1P3CA 4HTCH 2AH4X 3F6UH 3M5NA 2Z6BD 5JB9S 1XM1A 1HJ8A 1C2IA 2BLVA 3RXKA 1QB6A 1NBMD 2HNTC 4XBBA 5SGAE 1DE7H 3ZZ4A 1P3EA 4Y8ZA 4MNXA 1O2KA 3RU4D 2SNWA 2O8MA 1HJAC 1DM4B 1TNJA 2FOBA 4WXVA 3C27B 3W94A 3KYGA 2R2WU 5EXLA 4Q7ZA 1V2OT 1S0RA 1AD8H 1UHBB 1GMHF 1AHTH 1UCYK 2VIOA 2V3HH 2PTCE 3RMOH 4DY7B 5E2OA 4B75A 5C1UA 1QFKH 5DG6A 5CE1A 1YKTA 1PYTC 1FIWA 5E8EH 4PROA 1TLDA 1V2RT 3F3BA 1YC0A 2KFWA 1ELVA 1P9UA 1N8OC 1ELCA 2GMTC 3PWCA 5GCHF 3OEHD 2C90B 4GCHF 1BT7A 1Y5AT 1PPBH 2QYIA 3H09A 3SU1A 2XC5A 4A5TS 2HGTH 3TIUA 1GI4A 2PP6A 3IG6B 1H8IH 3PROA 1ZHRA 1HGTH 2XBWA 3H7OA 1QCPA 1RIWC 1MAYA 4ABBA 5E0GA 2P3FH 2H2ZA 5GDSH 3UAIC 1K2I1 1C2EA 4RI0A 1GBFA 1C5OH 1AE5A 3P8GA 3KIDU 2OK5A 5HIZA 4DT7B 3RM2H 2AMPA 4MPVA 1K1MA 3U8TH 1Z1JA 4X2VA 5T6GA 4FU7A 1C5XB 4KTCA 3TGIE 2ZF0H 3ZYDA 1VCPA 1C9PA 2HNTF 1EPTC 3DHKH 1O2NA 1UVOA 3EA8A 3KCGH 3A88A 1ZTLA 4IW4E 2WPDD 4IMQA 1ZRKA 3VEQB 1UVPA 2XXLA 3VB7A 1HNEE 3ZV9A 1YY3A 4A1VA 3K9XB 1LVMA 2F43B 3RXGA 1GGDC 2H1UA 2GT8A 3VB6A 2BLQA 1IQJA 1ZTJA 2WV5A 4GLYA 2FXRA 1QBNA 1AY6H 4ZCNA 5HKKD 2EC9H 1AB9C 2PGBB 3LGUA 1QB9A 1LCYA 3ZVGA 2BMGB 2PW8H 1EAUA 1LMWB 2B7DH 2ZFTA 1LHCH 2ZO3H 2HRVA 3O8CA 4Z0KA 2QCYA 4X2XA 1O3OA 2Q6GA 4D9RA 1C5QA 1KY9A 3OAAD 1VR1H 5CHAB 1FN8A 4F48B 1O5DH 3ZZ9A 3LC3A 4O3UA 2HPQH 4Q63A 5ESBA 2A5IA 3N99A 2CHAB 2FZZA 3RC4A 1XMNB 1W11U 1ABJH 5F6MA 1F0RA 4Y10E 3S9CA 1CT2E 1BTUA 2RG3A 3KN2A 3P70B 2FOAA 3UB0A 2GGVB 1QQ4A 1L4DA 1CGHA 1NPMA 1EB2A 3FFGA 2STBE 2BD2A 4HG6A 5DO4H 2AIPA 2Y7ZA 2A45B 4ZKRU 1C5PA 4RSPA 4ZUHA 1C5RA 2BYAX 2ZZUH 3P6ZB 4CRFA 1TOMH 2IN2A 1B0EA 1HAZB 1ABIH 1GJ8B 1HLTH 2KZ4A 1HAVB 3RXRA 1V2JT 2OBOA 3URDA 3NPSA 7GCHF 1VJAU 3T5FH 1GI7B 5EXMA 7LPRA 3UIRA 3E1XB 2FOHA 1DUEA 2ESTE 2KCPA 3M3SA 1GBJA 1O2SA 1JOUB 2FTMA 1JMOH 2ZU5A 1C9TA 3BG8A 1Z1IA 9LPRA 1C4Y2 3SU0A 3FP8E 1BA8B 2OC1A 4NIXA 1SHHB 2J5UA 4CBOA 1MTSA 4OM9A 1DS2E 3VB4A 1H1BA 1OWIA 1YPHE 1C2DA 3VGCB 1WSSH 2BOHB 2XWBI 2YMSB 3AVZA 3STJA 1A46H 2ZDAH 3A8CA 3SZNA 3B8JA 1L4ZA 1MABB 4JZEH 1QRXA 2WSSD 4SGAE 1TGCA 3I77A 1KMHB 2D26C 1VZQH 4YT7H 2SFAA 5E0HA 1S81A 6GCHG 1RRKA 2W3IA 4HZHA 1UTMA 1D3DB 3PTNA 1OHHD 2V3OH 3UTUH 3KEEA 1IOEA 1D4PB 1T8MA 1C2FA 2BZ6H 1VITG 1QNJA 5KEDA 3OYPA 2OXSA 4FUJA 4DIHH 1DWDH 4JZIA 2TGPZ 2WINI 5CMXH 2FI3E 2V35A 4YZUA 3SV2H 1C1SA 2NU4E 3M7TA 1LHFH 3I29A 3ATMA 1XUKA 3FN8A 1NFWA 4IGDA 1LHEH 1O3IA 3L33A 1F5KU 1ZYOA 1Z6JH 1CA0C 2BD7A 3U9AH 1O2RA 1IQGA 1CE5A 5A0BA 4CH8B 4KGAA 4MPWA 5FBIA 2G4UA 2ODYB 1SQOA 5E0JA 3MH7A 1Y3VA 4AB9A 2BD9A 2FX6A 1V3XA 1O2ZA 2BVXH 2CXVA 3RXMA 1O2OA 3GY5A 1XUIA 2ZFPH 1K1LA 3DSGA 5B6OA 3SJ8A 2A4QA 2ZU3A 1ZR0A 2GVFA 2BY9X 4FXGH 3UNSA 2J2UA 3HPTB 2OLGA 1ZJKA 1TYNA 2FOEA 2QIQA 1IAUA 5JPMH 1GI8B 3ATKA 1VGCB 2OC0A 1DICA 1GBIA 1CBWC 1K21H 2J34A 2V7QD 1P11E 4KELA 3U69H 3RXBA 1Y59T 5F8XA 1BRAA 2BD4A 2XBVA 3NXPA 4K60A 2VINA 1D3TB 2FIRH 2QF5A 3R0FA 2OQUA 2AMQA 1ELTA 1QQUA 5EIYA 1BIOA 1HAXB 1FQ3A 2IPQX 4ZAEA 1JWTA 1O5CB 1O5BB 1ZMNA 1OPHB 4Y76A 1AE8H 4I86A 4MPUA 3SJKA 1GJ7B 4M9FA 1DSTA 1SGIB 1WTHD 2BD3A 4ISNA 3RXJA 4ABJA 3LPRA 1ZSKA 5J4QA 4O3TA 2I6QA 1O5EH 1WTGH 1C5WB 1TNKA 1X7AC 1SGCA 4OS1A 1SLVB 1QURH 2PUQH 1EFRD 3A7YA 4K1EA 1GBLA 3QGJA 5K7RA 4ABHA 3PO1C 4U01A 3F9GA 1GI0A 2HNTE 3BV9B 5I25A 3RXVA 1S84A 3SNCA 4AFQA 2FS8A 2J98A 4Q80A 4FUIA 3DD2H 2J92A 2YOLA 1WDIA 3E90B 3DT0H 3TJVA 4ACAA 3GCTF 1P02A 3BG4C 1HAVA 1V2MT 2G52A 3LC5A 1C2LA 4AYYB 3UR9A 3SHAH 1MKXH 1GMDG 4WMFA 1TGSZ 3QZQA 2GDDA 2QV1A 3PTBA 2GDEH 2Z9JA 4TSFD 6LPRA 1TNHA 1TOCB 1W3CA 4D76A 3RXFA 2ZEBA 4MTBA 5HIYA 1GVKB 2WUBA 2FPZA 1BCUH 1W14U 3ITIA 4ABIA 2J4IA 4LXBH 2H5DA 1O32A 1JIRA 4INLA 3TNTA 2Y7XA 2FODA 3RMNH 2CF8H 4D8NA 1C5VA 1D3PB 2VH6A 1FAXA 1GHWH 3LH3A 3GY7A 4XFQA 3OU0A 3SO3A 2F9NA 1ARCA 1EZUC 2WYJA 4WMEA 4CRAA 3S9BA 2UWLA 4NIWA 3BIVH 1BB0B 1UTPA 3RC6A 5FBEA 1TMUH 4ZROA 1GCTB 4WJG2 3F1SB 3QN7A 1CHGA 1C1OA 2YMSD 5HYOA 3TK9A 1TPSA 1HB0B 2BX3A 1CGIE 5F03A 1N8OB 3NZIA 3B9FH 1SL3A 3UQOA 2BLWA 3LT3A 4JZFH 2XC0A 1GJCB 5DJ7A 1NU9A 2Q6FA 2ZU1A 1YPEH 3MOCA 1GBEA 1DOJA 1BBRH 1WQSA 1A2CH 2PUXB 5LPFA 3BIUH 1C1PA 1EJNA 1TPPA 1BMFD 3MH5A 5HXFA 2Y5FA 2ALPA 1O2MA 2ZDMA 1FY5A 3EYDA 3BEFB 3TGKE 1W13U 3KQCA 1O37A 3M3TA 3SUFA 1K28D 4TY7A 4GUXA 1ELDE 3F0OA 2Z3DA 5EODA 4YOIA 2NU3E 1Z8RA 3Q00A 4ZHAA 3Q3YA 2BDAA 1P10A 8GCHF 1EUFA 3A87A 1UVTH 1O2LA 3RC5A 1W0KD 4NA7A 3QTVH 3A7WA 3BTQE 2CK3D 4NZLA 4F55A 4TWWA 4JYTA 3R3GB 1PQ7A 2EA3A 1HUTH 1LTOA 4D7FA 1SOTA 4RKJB 2A31A 2WV4A 1EX3A 3NKKA 1O2WA 1GGDB 2FS9A 2A4RA 1P0SH 4JYVH 1UVSH 4DVAU 1O33A 4FUHA 4B73A 1C4U2 5DP4A 1WV7H 1YM0A 4BNRA 4BAOB 1FMGA 1AB9B 3SV6A 1AVXA 4VGCC 2A32A 3RLWH 3ZVEA 4XDEA 3QDZB 2THFB 1K1IA 4FU9A 2EI6A 2VIDA 4K2YA 3A7TA 2XCFA 4AZ2B 3TK5A 5A8XA 1EJAA 2QXHA 1C5YB 1NU7B 2K0QA 3QX5H 1DXWA 1MD8A 1O2JA 4WH6A 3ZVCA 4DGJA 3BTHE 2O9QA 4WXIA 1LPKB 3AASA 4JMYA 2TIOA 3BTEE 5T1VA 1O3PB 5FL7D 1W12U 4E7NA 4H42U 4TY6A 3BTME 1BMNH 1DUAA 2VJ1A 3RMMH 2M5TA 4ZXXH 4ABDA 3HKIB 4KTUA 1OKXA 2K8IA 1V2TT 4A6LA 1ZLRA 2P16A 4TPYA 2WPJS 1EZQA 1MKWK 3F9EA 2WPIS 1P2JA 1FLEE 3PV2A 7ESTE 1HYLA 3SZEA 3HGNA 1E34B 1W0JD 3A7VA 1TE0A 1S0QA 4U32A 2SGAA 2ZTXA 1DWEH 3RXUA 4RT1A 5DK1A 5EU8A 3RXDA 2ZHEH 2FO9A 2GV6A 2UUYA 3Q3KA 3D65E 3RXSA 1Y8TA 1D9IA 2VGCC 1RFNA 2C4FH 3QK1A 3UUZA 5A8YA 1ESTA 1SGTA 1ANCA 2NU2E 4IMZA 1K1OA 2HVYB 1TNGA 1IQLA 1AGJA 1XX9A 4BTTB 2FDAA 4JZDH 4XE4A 2GP9B 1OP0A 3W95A 1GBTA 5AF9H 1ZPBA 1QL8A 3RUOA 2WHXA 1GHBF 3RMLH 1QY6A 1F2SE 1ZHPA 2BDHA 3PYHA 2J38A 1DANH 1EAIA 4IBLH 3EA7A 2IJOB 2HALA 1GBKA 1WCZA 1KIGH 3EDXB 2Y82A 1UTNA 1W0YH 1GJ4H 5TJXA 5C0UA 1BTPA 1F92A 3M5LA 3PV4A 1YCPH 3KGPA 1ZPCA 1Z8JB 2H9TH 5C1YA 4DCDA 1GJDB 2P3TB 4IN2A 1TPOA 1BMLA 1NESE 2ZDNA 1Q3XA 2QGRA 4OS4A 1VJ9U 3BTDE 1TFXA 2JH5D 3TU7H 1KXDA 1MZAA 2UUKB 1FIZA 1RD3B 1GHAF 2FM2A 2GCHF 2VIVA 5C5OA 1GVZA 2WPKS 3SUDA 2A4OA 2QXIA 1K0HA 3MNBA 4I8KA 2TGTA 3ZZCA 4X6MA 1FAKH 2VWLA 2BQWB 3H7TA 2XC4A 3DCLA 3DSOA 1P05A 1KSNA 1J14A 1KXBA 2VU8E 1PYTD 1O3GA 1TX6A 2H6MA 2C8WB 1MH0A 1F0UA 2GX4A 2C8ZB 2VB0A 2HOBA 3HKJB 3RXTA 2EQNA 2ZGBH 4TT3D 1SGEE 1TPAE 2BDIA 5C20A 3ZZ3A 2PSXA 2BX4A 3U8RH 1ORFA 1A3EH 1FY1A 1YGCH 3ZZ5A 2ZHWH 1UK4A 4NWLA 1T8OA 3M5OA 5ABWA 2EI7A 1JBUH 3F9FA 3QGNB 4X1SU 1FDPA 4ABFA 1AVGH 1AKSA 3PMBB 5DN6D 2BVRH 4ABEA 2F9BH 2Y5HA 4X6PA 5FXLA 3NCLA 1SR5C 1OWJA 1EPTA 1UTLM 3MO3A 3RXAA 4Z1MD 1TNIA 2XW9A 3K2UA 1FN6A 3A82A 2H9EH 3CNRA 1V2LT 3FZZA 1JRTA 1GBMA 1RTLA 1T4UH 2P93A 1CBWB 3SUEA 3TJUA 3H5CB 2P8OC 2Z9IA 1LQDB 1GI3A 1QA0A 2ULLA 1BOQA 1DX5M 1GDUA 4M7GA 3Q3XA 4YESB 4BANB 2RCEA 3W1EA 1UVUH 2FEQH 1HIAA 2PTNA 3C1KA 3T28A 1EQ9A 5K0HA 1E1RD 4K1SA 1V2UT 1V2QT 1C2HA 1ELGA 4KTSA 5C2ZA 3KQDA 1NO9H 1QHRB 2G00A 2ZC9H 5DP6A 3SOSA 3E8LA 2ZU4A 1J17T 1O2TA 2VIPA 2GJGA 4Q7XA 3SQHE 1LQEA 1A1RA 1F0TA 3STIA 1SGFG 3AW1A 3D49H 3PMAB 3MU5A 4X6OA 4YTAA 3MNXA 1G37A 1G3CA 4H6SB 4AORA 1SFIA 1O31A 2AGEX 3SW2B 1SLWB 2J98B 4B2BA 1SGYE 5EOKA 3V0XA 4X1NU 2FMJA 2OC7A 1QTFA 1EB1H 2AMDA 2CN0H 2PFEA 5DP8A 2BZAA 3OX7U 1O3KA 1GJBB 1SG8B 1W7GH 4CH2B 1EOLA 1HAIH 3RM0H 1K1PA 4IC6A 4XD7D 5HMAA 1C5TA 1Z71A 1CHOG 4SGBE 3FO8D 1SGRE 5CDFE 1C2GA 5HM2A 3PWBA 1G3EA 3BG4B 2BDCA 4ZKOU 2H5CA 3GCHB 1ANBA 2C93B 3L6PA 4ISOA 1P9SA 2OTVA 1GJ6A 2NU0E 5FPTA 5HGGA 3ZZAA 1AO5A 4B76A 1OWKA 3ATIA 1GI1A 4R0IA 4Y8YA 1GBCA 4GHQA 3PM3A 2PV9B 1E1QD 1P12E 2BDYA 3AK5A 1GG6B 1BTWA 2IPHA 5FX5A 4WY3A 1HDTH 1O2PA 3EA9A 2WZQA 1OWEA 1RTKA 2JKHA 4Y8XA 3GY3A 1XVOA 1PPFE 1DT2A 2OQ5A 5TCAA 2DE9A 1IHSH 1FONA 2G4TA 2PWXA 5T3HA 2PKAA 3QTOH 1P2MA 2LNCA 2WPHS 2FOCA 2KAIA 1UTQA 2FYQA 3KNXA 4X0WU 1O5AB 4AN7A 2XBXA 1SGNE 1SGPE 1CQQA 4AX9H 1J9CH 2HVXA 1IQMA 1PPCE 1QL9A 4X8UH 3E16B 1T4VH 1O3MA 5BPEA 3NWUA 3GICB 3T29A 3K6YA 5EGMA 4FUCA 2W26A 3MHWU 1LO6A 3F2GA 1BRBE 5DGJA 1ZPZA 3U98H 1LVBA 3FP6E 1TBQH 2CV3A 4D7GA 3UNRA 4A1TA 3LH1A 4MPXA 4YXWD 2Z9LA 3TH2H 3VXEH 5FCRA 1Z8GA 4KKDA 3SGAE 2Q6DA 4OGXA 2KX4A 3WWFA 3M5MA 1ETTH 1TGTA 1TRMA 2BOKA 1S6HA 2WV9A 1K9OE 4ESTE 1CT0E 1QB1A 1ANEA 2WUCA 1UMAH 1EATA 2JJ1D 2BLOA 1BRUP 1Q2WA 4XSKU 3O8BA 5LH8A 1MTNC 1S83A 4FUEA 4FUFA 4Y7BA 2ILNA 1O2UA 4U30A 1P2IA 2O8LA 1MUEB 1SC8U 2KR7A 1MTWA 1MBQA 2AIQA 1PPGE 1AN1E 2FTLE 2JH0D 3N7DA 3V7TA 4HFPB 1OYQA 3E3TA 1Y5BT 3V13A 4I8GA 2VNTA 1T32A 5FHTA 3GCOA 4E06H 3KF2A 1MMJN 5EJZA 4HI3A 1TX7A 1HPGA
chains in the Genus database with same CATH topology
2FESH 1SHYA 1O2HA 3SHCH 1T8NA 3GOVB 2VWOA 2A5AA 4LZ1H 1P2QA 4ZKNU 2AYWA 1T31A 4Y0YE 1YLCA 2GCTC 1S6FA 3BTTE 1OS8A 4OS2A 5ETXA 5DP5A 2V6NA 1FPHH 2RA3A 1RGQA 3A86A 3M36A 3T2NA 4AGKA 4BAHB 5DKMA 4RN6A 4YOJA 2SGDE 3P8NA 1GWAA 4VGCB 3G01A 1MCTA 4X1RU 1P09A 1ELBA 1XUJA 1A5HA 1TA2A 2FI5E 2FI4E 1O34A 4AG2A 1GBBA 3S7KB 1YPLH 1BTXA 5LPRA 1T8LA 2OD3B 1H8DH 1DLEA 3SJ9A 4INHA 5HM9A 1ESBA 1NZQH 6GCHF 2GD4B 1WUNH 1SQTA 1ETRH 4BAMB 3MU0A 1NTPA 2PR3A 2XNIA 2ZFRH 4AFSA 3RXEA 1CU1A 3UPEA 5CHAC 1GMCG 2XWAA 2ZPQA 1HJ9A 1ACBE 3WY8A 4UFDH 4K5ZA 2B8OH 3RXLA 2BXTH 1C2KA 1H4WA 3F68H 2F9OA 1VITF 3S9AA 1GCDA 1ID5H 1ZZZA 1TGNA 3GY4A 3M7QA 1PQ8A 1KLJH 1HCGA 3V3MA 1ANDA 3P92A 5IYTA 4I8JA 5GPIB 1C5MD 1DVAH 1W2KH 1LKAA 1AMHA 3OSYA 4MLFB 1AI8H 5A8ZA 2A7CA 4U2WA 2PLXA 4FVBA 3MH4A 1B7XB 1L1JA 1E37B 5H4IB 3GY8A 2D2DA 1ZGIA 2OBQA 2WYGA 2D8WA 2VGCB 3A8DA 5C1XA 4X2YA 5L2YH 3SORA 3FVFB 1MKXK 4IN1A 3SJIA 3ESTA 4I32A 1LHDH 2ZA5A 1VCQA 4YOGA 1THSH 2QF3A 1JXPA 3LKWA 1KLIH 1NS3A 1OSSA 3S69A 9ESTA 2QAAA 4CBNA 1P06A 2ZCHP 1O3FA 3GDVA 1AU8A 2VIWA 1TA6A 2R3UA 4A7IB 4CRGA 1HJAB 4LOYH 1IHTH 4GSOA 1RXPA 1GHXH 1NRSH 4E7RG 2A4GA 1K1JA 2ODPA 1ETSH 1O2VA 1QGFA 2YNAA 4DJZB 3SNAA 3RU4T 1LVYA 1C5SA 2PSYA 5G4BA 2GMTB 1KYNA 4J2YB 1TBZH 3LOXA 1TONA 3GYLB 3KQBA 1DITH 1P8VC 1BZXE 3RLYH 1FI8A 1UK2A 3SN8A 5L2ZH 4CRCA 4WMDA 1DXPA 5DP9A 1THRH 1C5UA 5EPNA 1O38A 1RIWB 2GT7A 1BBRK 2Z94A 3K6ZA 1TIOA 2G5NA 1UTJA 3SI3H 2FWWA 1F7ZA 1PQAA 1EZSC 5A09A 1ZJDA 1XXDA 1YPHC 5DP3A 3MFJA 2BVSH 4ZH8A 5JYIA 1AKSB 1BITA 2GZ9A 2B9LA 2Y6TA 1EPTB 1M9UA 4I8LA 4WF8A 4ZHMU 1XUFA 1AIXH 1YCPM 4UDWH 1MQ5A 2BD8A 2F83A 1EJMA 2B5TB 2R0LA 2R9PA 1TWXB 1C1WH 2W5EA 1NT1A 3NUMA 4KP0A 1ESAA 1TMBH 1GMDF 2ZHFH 1NY22 2WPLS 4K8BA 1EAWA 1AUTC 1TAWA 1P03A 3UR6A 1D6RA 2V0BA 4MNVA 1O2XA 1Y3UA 3CS7A 2ZKSA 2P8OB 1HIAB 3RXQA 4AGJA 1SMFE 2VIQA 4ISIH 3LJJA 2F9VA 1INCA 1PPHE 1BJVA 1EP5A 1YLDA 3BEUA 5BRRE 1TABE 5AFZH 1GMHG 1C2JA 1TQ0B 2FYRA 3GY2A 2XRCA 5A2MH 4JK5A 4DW2U 1L0ZA 1TRYA 1ZMJA 2ZTYA 3P95A 5GCHG 1O3LA 4GCHG 2ZDLA 1PQ5A 2ZQ2A 3SJOA 1ELAA 4AYVB 5IDKA 3ZVAA 3SI4H 1N1LA 2I6SA 3P8OA 4NFEA 4J1YA 2QY0B 4NFFA 1O5GH 2JETC 4NIYA 2J94A 4CRDA 4AG1A 1XKBC 3A7ZA 4O97A 4TPIZ 1UTOA 1EXFA 1BTZA 4BXSA 2ALVA 2GZ7A 3T25A 3VPKA 1P2NA 3TJOA 1O36A 1LKBA 1V2PT 3I78A 3P8FA 1O3NA 3ZVBA 4I8HA 3TITA 3IWMA 4X8VH 1SB1H 1O2QA 3BTGE 1O3DA 5F8ZA 3UQVA 1WBGB 2UWOA 4IS5A 1O3CA 3GY6A 1C1UH 1J16A 5EW2H 1GI5A 2Y5GA 4I33A 2WPMS 3KQEA 4WH8A 4UONA 4FUDA 1BJUA 1GBAA 5F8TA 3M35A 2XBYA 1GHYH 1GPZA 1SFQB 2PKAB 2AS9A 4NZQA 4UFGH 1SOZA 2KAIB 1ZSLA 1Y3XA 2ZG0H 2ANMH 3SV9A 1QJ1B 1GI9B 1A0JA 2F91A 3URCA 2ZDVH 1G3BA 1GI6A 1GI2A 2EEKA 2QXGA 4BTIB 1QJ7B 3FP7E 1YF4A 2ZNKH 1OYTH 2R3YA 4X6NA 2QF0A 3SU3A 3HK3B 1J15A 2HWLB 1MU6B 3SGBE 4X8TH 1NRNH 2P59A 3LGYA 1V2VT 1O3BA 3O8RA 1GBHA 1UCYH 2BXUH 1YCPK 2W3KA 1P2OA 3TPIZ 2VWNA 3ENSB 1C1RA 1GL0E 1MD7A 1TBRH 4ABAA 2ZP0H 5ESTE 1GCTC 4JZ1A 1C2MA 1E0FD 1Z6EA 1LDTT 2F9PA 1O2GH 2K1QA 4B2AA 1O3HA 2LPRA 3RDZA 1NRRH 1C4V2 4XBDA 1D3QB 4K69A 5TCCA 1CA0B 4XBCA 1GHZA 5A0CA 8ESTE 1PPEE 1NC6A 1YYY1 2EI8A 4X1PU 3F9HA 5EQQA 2ZGCA 2ZIQH 4MQAA 3VB3A 4YO9A 1LPZB 1SGDE 2RA0A 3LJOA 1G3DA 2C8YB 2STAE 3TLOA 2A2XH 7GCHG 1MTNB 1SLXB 1T7CA 1MCVA 3ZZ7A 5EG4A 3ATWA 1Y3YA 3GDSA 2ZWLH 3BTKE 1G30B 4ZKSU 1DWBH 2TRMA 2ZGJA 1H9LB 1A7SA 3BF6H 3VFEA 3ATLA 4JYUH 1ELEE 4CREA 2SGPE 4TWYA 3D62A 4Q7YA 1AZ8A 4CR5A 1QRWA 1TX8A 5LGOA 1FNIA 4AOQA 5EW1H 4NSYA 5FPYA 4DOQA 3U8OH 1LPGB 2ZI2H 3BTWE 4Y7AA 2AEIH 2SGFE 2QN5T 1EASA 2P3UB 3QUMP 3PLPA 4YLUA 2GCTB 2CF9H 1HBTH 1TGBA 4F4OC 4NA9H 2QXJA 1HV7A 3PLBA 1SBWA 2B0FA 1ZHMA 3QWCH 1CGJE 4OS7A 7KMEH 4B71A 3V12A 1AFEH 1HAGE 3AW0A 3S7HB 5E2PA 6CHAC 2F3CE 3ZVFA 1XXFA 1IQFA 3TH4H 3GISB 1AFQC 5AHGH 1ZOMA 1FZZA 4NA8A 1F5LA 1HAYB 2GZ8A 1TMTH 3B23B 3A7XA 2CJIA 4ASHA 1G2LA 3PO1B 1MBMA 1UCYE 2OCVB 2Q1JA 1OWDA 3LU9B 4XOJA 1W0ZU 2R2MB 1A61H 4GAWA 3SU6A 3TH3H 2J95A 2P95A 1TQ7B 4MVNA 1DLKB 1NROH 3A84A 5C5NA 3ZZBA 2PKSC 1V2WT 1Y5UT 1O0DH 2O8TA 5FCKA 1B0FA 2Z9GA 4Y0ZE 4O03A 4D9QA 2XYAA 3PLKA 5T6FA 4WVPE 1S85A 2HLCA 3MO9A 1GDNA 5GWZA 3RXCA 1V2KT 4O9VA 4Y11E 1JRSA 3M3VA 1DFPA 3EGKH 2ZCLP 3ZZ8A 1ZTKA 1BHXF 1EAXA 1CSOE 1N6YA 1RTFB 2FLRH 4CHAC 2A0QB 1SGFA 1PPZA 1Q31A 3ZYEA 5JBBS 1G32B 1YP9A 1OWHA 4CR9A 5DP7A 4K3JA 1AZZA 2FOGA 3S0NA 2IOTA 5FPSA 2BQ7B 3SNBA 4B1TA 1E35B 1L1GA 3SU2A 1YBWA 4AFZA 1GJ5H 4UFEH 1HAOH 1HXFH 1SLUB 4BAKB 2ZFFH 2TGDA 1N6XA 1W8BH 2SNVA 4Y79A 1AWHB 3JZ2B 1XVMA 4NG9H 4ZXYH 8KME2 2BY8X 2ZTZA 3ZVDA 8LPRA 2RDLA 1SGQE 4NSVA 2P94A 3M7UA 3MO6A 3OTJE 4Q2KA 3Q76A 2Z9KA 3CS0A 2TPIZ 4Y71A 4GPGA 3UOUA 1GHVH 1K1NA 3MTYA 2F9UA 1C1QA 1YPGH 2BY6X 3A8BA 3DA9B 1IQHA 3ODDA 1A0HB 3P17H 1EKBB 3RP2A 5JBTA 3GYMA 1IQEA 1UHBA 3A83A 1XUHA 2VH0A 4I31A 4IC5A 4FUGA 1F5RA 1OXGA 3UNQA 1ARBA 2AFQB 2QA9E 1BDAA 3UY9A 1E38B 4TYDA 2CGAA 2OC8A 4BXWA 1MQ6A 2BD5A 2NU1E 4LZ4B 2BY5X 4OS6A 4FU8A 3SBKA 1V6DA 1G2MA 2PHBA 3GCTG 4MDSA 1SVPA 1L2EA 2O8UA 5PTPA 1QR3E 4OS5A 3E0PB 1VCWA 2G51A 2NWNA 3AAUA 4AFUA 1EZXC 3MWIU 1CHOF 3UFAA 1P01A 3FAOA 3ZZDA 4JK6A 1S82A 2H9HA 3E6PH 4NIVA 3LGVA 1RS0A 1NM6A 5AVDA 1G36A 4DIIH 3KHVA 1F0SA 4BAQB 5FX6A 1C5LH 1BTHH 3SQEE 2Z3EA 4Z6AH 3MI4A 2BQ6B 1NN6A 1O3AA 2ZCKP 1BRCE 1FY8E 3MU8A 1GBDA 3BTFE 3MMGA 4DG4A 4UD9H 3SUGA 1SSXA 4ZMAH 1WAYB 2A5KA 1OOKB 6ESTA 4YT6H 4ABGA 1P04A 3FZDA 4E05H 3TGJE 5C67A 1H9HE 2BM2A 1IQIA 2XTTB 1J8AA 3M37A 5GIBA 4Y6DA 4CRBA 1HFDA 1O5FH 2ZFQH 1SQAA 2ZHQH 3DFLA 1HAPH 1MTUA 4DURA 1E36B 1OP8A 2JH6D 3RU4E 1O2YA 1DPOA 5FAHA 1G9IE 5JB8S 2DUCA 3BEIB 1B5GH 3PB1E 3ELAH 1KDQB 3A89A 5L30H 3BSQA 4R8TB 2CHAC 1PJPA 2BTCE 1AWFH 3FANA 2PGQB 2R0KA 1QRZA 2JETB 1LVOA 2ZDKA 3GDUA 3LGTA 2OP9A 1YPMH 2O8WA 4GHTA 1DWCH 4B2CA 2VVUA 4K1TA 1GL1A 3ZZ6A 3HK6B 5GXPA 3A85A 2C8XB 2XCNA 2VVCA 1C1TA 2Y80A 2AGIX 1V2ST 3UWIA 2G81E 3OY5U 5EQSA 8GCHG 1NRQH 2YNBA 1BUIA 1MTVA 2Z3CA 3ZV8A 1LHGH 2BDGA 2ANKH 1ZGVA 4HGCA 3Q77A 3T62A 1KXEA 2A1DB 2QC2A 1P57B 5EPYA 3GCHC 1EOJA 3NK8A 2GV7A 2VVVA 1A0LA 2ASUB 3EAJA 4ISLA 1W10U 4H6TA 1HRTH 3MNCA 1S5SA 3RXPA 1AVWA 2D1JA 2AERH 5A0AE 2ZFSA 1GG6C 1BQYA 4F49A 3VGCC 1O3JA 4MG3A 1IQKA 4X1QU 3RXOA 1UO6A 1UK3A 1KLTA 3E0NB 3HATH 1EP6A 3IITA 1KXAA 1QL7A 3TJNA 1L1NA 5JBAS 4OGYA 4INKA 1QJ6B 1ELFA 1HAHH 4GVUA 3CP7A 1DDJA 1FJSA 1O2IA 1TRNA 2A2QH 3UOPA 1CA8B 4K8YA 4WWYA 1DSUA 1Y3WA 1A3BH 2HPPH 2SGEE 1QIXB 5DPAA 3DFJA 2BHGA 4H4FA 5AFYH 1GDQA 1QBOA 1MAXA 3SGQE 2Y81A 3MNSA 4ZHLU 1GMCF 1WYKA 2ZHDA 3M61U 4A1XA 2SGQE 1IQNA 3L3TA 1U6QA 1MZDA 1QA7A 2W7SA 1DY8A 1CO7E 1D6WA 2TBSA 4AB8A 3SNDA 1DY9A 1YPJH 2Z7FE 1Z8IB 3MYWA 1O35A 2AGGX 1UTKA 4NCYA 2ANWA 1CT4E 1K22H 1AQ7A 2A7HA 4MNYA 3LDXH 4MNWA 1NRPH 1SI5H 3HGPA 2GTBA 4FVDA 5EXNA 2ZU2A 4YLQH 5GJ4B 2UUFB 1C5NH 1KXCA 3RXHA 2CMYA 1KTTB 3O8DA 2G5VA 1WOFA 2ZQ1A 3MH6A 3DUXH 1OX1A 4I7YH 1QBVH 2G55A 3QLPH 3VB5A 3AAVA 1AUJA 3KL6A 3EE0B 2BDBA 2VWMA 1O30A 4UEHH 3SU4A 1BMMH 1VITH 2W7UA 3QZRA 3U1JB 3EQ0H 4NGAH 3T26A 1WQVH 1V2NT 3LGIA 1GHBG 3UWJH 1BTYA 5I46H 1XUGA 3ODFA 1FXYA 1VGCC 1NFXA 3TK6A 1BHXB 3QO6A 3LIWA 1KTSB 2FOFA 3SV8A 1XKAC 2OUAA 3U1IB 1Z7KA 4X8SH 6CHAB 3SU5A 1CVWH 3TVJB 1PFXC 1BMAA 3TNSA 4NWKA 3RXIA 1KXFA 5L6NH 1A5IA 5EQRA 1GJAB 1AFQB 3CENA 5JBCS 1JIMA 3A8AA 4LK4A 3A81A 2DE8A 3BN9A 3LGWA 4JCNA 1TB6H 2ZPRA 3GCNA 3JZ1B 5T6DA 1FV9A 1GHAG 1C1VH 1A4WH 2GCHG 4X2WA 2OINA 1H9IE 2BY7X 1NFUA 2J9NA 3SNEA 1KDQA 1FUJA 1TNLA 4UE7H 2FP7B 1W7XH 2G8TA 4RKOB 1FY4A 3UREA 4BOHA 1FY3A 1UJ1A 1ZMLA 3MU4A 2BB4A 2ODQA 3A80A 2PKSB 1MKWH 1YPKH 1P2KA 2GKVE 3MU1A 3SV7A 3N7OA 5JDUB 1A5GH 1GJ9B 3PMHB 4YM9A 1C5ZB 2UWPA 5J4SA 4BTUB 3T27A 4THNH 4UFFH 4FUBA 2ZPSA 3D23A 3OY6U 2FLBH 3VXFH 1BBRE 1C1NA 1HXEH 2A7JA 3K65B 1FPCH 4ISHH 2ANYA 3LONA 4CHAB 2TGAA 1O39A 2ZECA 3PMJA 1WU1A 5C3NA 4A92A 1OP2A 1O3EA 4B74A 2UUJB 2ZGXH 1SPJA 1C1MA 1GVLA 1THPB 4QT8C 1ZRBA 1NFYA 2C3SA 1ZSJA 2FOMB 5LPEA 1RJXB 1TALA 2ZGHA 2FX4A 1MU8B 3E91A 1P3CA 4HTCH 2AH4X 3F6UH 3M5NA 2Z6BD 5JB9S 1XM1A 1HJ8A 1C2IA 2BLVA 3RXKA 1QB6A 2HNTC 4XBBA