3RXAA

Crystal structure of trypsin complexed with cycloheptanamine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxaA02
3PLKA 3K2UA 4TPIZ 3O8BA 1WQVH 2A5AA 3S0NA 3LH3A 3LGTA 1J8AA 2Q1JA 5L30H 1B5GH 3QGJA 1D3PB 2Z9IA 2FI4E 2ZECA 2PR3A 3ZZ4A 5E0HA 4ABGA 2FOBA 3G01A 3SJOA 2EA3A 2DE8A 4XBCA 3RXGA 1LPZB 1EJNA 2FX6A 4GSOA 4Y8XA 1XUGA 3P95A 3P92A 1D3QB 3K9XB 3M35A 1C5NH 3TITA 1GJ9B 1PPFE 5AFYH 1DUAA 1V2WT 3M3SA 1NO9H 1O2PA 4YTAA 4GPGA 2BLVA 2G00A 3FANA 2ZIQH 4R0IA 4CRCA 1DX5M 1AMHA 4YOIA 1C1OA 4Q7ZA 1ZMLA 1A5IA 3GDUA 3ODDA 5BPEA 1CHOG 3R3GB 3U8TH 3BSQA 1P02A 4I32A 2BVRH 1KTTB 2XBYA 1DT2A 1QJ7B 1UTQA 1GVKB 4K3JA 2G81E 2RG3A 2R0KA 1QBOA 1ORFA 1TX7A 1P8VC 2AMPA 3KGPA 1TNJA 3OTJE 1PQ5A 3GY8A 4H42U 2VWOA 3P70B 1KLTA 2VB0A 3CS0A 1ESTA 3TK9A 1SR5C 2ZGCA 1AD8H 1FY8E 3URCA 4BAQB 2Z6BD 3A88A 1OP8A 2GMTB 1O2QA 4YOGA 2Z9LA 5EXLA 1G3DA 2FOGA 3UQOA 1O30A 2P3FH 2A2QH 1PQ8A 2JETB 3U8OH 2GCTB 3ZV9A 2SGQE 5CHAB 2Y5HA 5F8ZA 1XXFA 2ZFRH 3LDXH 1HAVB 1SQTA 1TX8A 2QF3A 2I6SA 2LNCA 1YPKH 5EQSA 2CMYA 3SNDA 1O2WA 1D9IA 1T7CA 2O8MA 3LGVA 3A7VA 1GBDA 2GP9B 1Q2WA 5K0HA 2V6NA 4INKA 1N6XA 1FN8A 1GCTC 3E8LA 3BTFE 4JYUH 1YPLH 2J94A 1GMHF 3PV4A 2QN5T 4BAOB 1QJ1B 4K8YA 4H6TA 4YT7H 1MU6B 1HXFH 2UWPA 4WVPE 1ELGA 1RIWB 4GUXA 4I7YH 1AZ8A 4AYYB 2CF9H 1WOFA 1WQSA 1J14A 3RXIA 2XBXA 1TRYA 4TY7A 3A80A 2H5CA 2FWWA 4NIVA 3MWIU 5C1UA 1ZPZA 1E0FD 4FUCA 1C4U2 4Y76A 4HGCA 5AVDA 5TCAA 1YPHE 1YM0A 1UTNA 1TGBA 2AMQA 3PYHA 1XXDA 1BJVA 3QZQA 4X1SU 1TABE 1UVSH 3UUZA 1C5UA 1S0RA 1KXFA 4X2YA 2H1UA 2OBQA 2ZI2H 1W2KH 1KXAA 4DVAU 4NA9H 4Q7XA 4RKJB 4MNXA 4E7RG 3Q76A 3LIWA 5AHGH 2G51A 2Y5GA 5GIBA 3A84A 1MTUA 2AYWA 3FP7E 1NFWA 2TGPZ 1A0HB 1ELAA 4AG1A 2ZDAH 4X6OA 4UE7H 2PKSC 4BXWA 2GDDA 3RXMA 4LXBH 1FIZA 3B8JA 4K69A 1TGSZ 1Z6JH 2WPLS 2A0QB 1NROH 1C1PA 1LDTT 4MPVA 4WMEA 3P17H 3T2NA 3GY7A 2DE9A 2C8ZB 2Z3EA 1YF4A 1A7SA 1PPZA 1JRSA 1FAXA 4FUEA 1MCTA 1GVLA 1EKBB 4ABFA 3QK1A 1SBWA 4ZKOU 1AKSB 1T31A 5GCHF 2BX4A 1HAIH 1UK3A 4VGCC 3MO9A 4LZ4B 2A4QA 7GCHG 5DP8A 2XBVA 2XTTB 3RXDA 3UTUH 4ZROA 4J2YB 4X8UH 1V2NT 1QL8A 4FVBA 5T6GA 2J95A 3SU1A 3T28A 5ABWA 1YC0A 4FU7A 1IOEA 4HTCH 3CENA 3SGBE 1SLWB 4NG9H 3D65E 3SV9A 1IAUA 1C5VA 1UVTH 3A7WA 2A32A 1ARCA 2M5TA 1V2RT 1AQ7A 2FM2A 1C5RA 3SUGA 4H4FA 1BT7A 3KF2A 3HKJB 1THPB 1O31A 1T4VH 1EAWA 2AH4X 3QX5H 2ZDNA 2STAE 2BVXH 3RXQA 3P6ZB 2CF8H 3E0PB 2BQ6B 4O03A 4BAHB 2R3UA 1ESBA 1O5GH 2PLXA 1Z8RA 3OY6U 1AFQB 3SGAE 1SLUB 3M5MA 2OC1A 5HMAA 5DPAA 2BDBA 1DLKB 2UUYA 3M5OA 1O3PB 5A0CA 3A7ZA 2VIPA 5BRRE 4Q2KA 3W94A 1ANDA 1C1WH 5F8TA 3M36A 1LCYA 4LK4A 4Y71A 3ATLA 1H8DH 2IOTA 3F6UH 3SUFA 2ZFFH 1PPEE 1P2OA 4Q80A 3NK8A 2ZFQH 2BM2A 1VR1H 2FX4A 6ESTA 2F3CE 3RU4E 1GCTB 1MQ6A 2BQWB 3H7OA 2GZ7A 4E06H 4JZIA 9LPRA 1LVYA 3GY4A 1H4WA 2F83A 2FOMB 1EJMA 4GCHG 4HFPB 1CBWB 3EYDA 4BOHA 3DD2H 2ZGJA 1FUJA 2G4TA 3BTME 1ETRH 1ZLRA 3OSYA 4JK6A 2ZTXA 2GDEH 2BQ7B 3SJ8A 1NRPH 1H1BA 3TH2H 1C5YB 3T29A 4JZ1A 2ZFSA 4OS4A 1O37A 5LPFA 1GGDC 1C5QA 1GJBB 2VJ1A 4YOJA 1NS3A 3SHCH 1ZSKA 4HI3A 1DDJA 1T8OA 1CGJE 1MZDA 2Z9GA 2BXUH 1ELDE 8LPRA 3GYLB 2WUCA 1CHGA 1SGTA 3A7XA 3SN8A 1K1LA 4AN7A 3EA7A 3B23B 1DVAH 1HUTH 2V0BA 1ELTA 3E1XB 3V12A 2OQ5A 1CHOF 2P3UB 4AFQA 4UFEH 3ODFA 4ZAEA 1ACBE 1HB0B 4I8HA 1T32A 2PKSB 3NKKA 1ZZZA 2ZU3A 3QWCH 1SI5H 3NUMA 3UR9A 1GDNA 2G55A 1L1GA 2BD9A 1S85A 3SU4A 2ZPRA 7ESTE 1NRQH 1QRWA 4A92A 1HJAB 1QTFA 4BAMB 2ANKH 3A81A 1O3NA 1QQ4A 5HXFA 1K1PA 2W3KA 1NRRH 1TWXB 1DM4B 3ZZ8A 1JOUB 3QTVH 1L1NA 2Z94A 3ENSB 3D49H 1QURH 1WSSH 4DY7B 1MCVA 3FAOA 4JZFH 5TCCA 3TNTA 1H9HE 1O36A 2QCYA 3ZVAA 3LH1A 2THFB 3QLPH 8GCHG 3VFEA 1VGCC 4X8TH 2Z9KA 1GMCG 1AO5A 3SV6A 1BRAA 3TH3H 3OU0A 3TGJE 2OCVB 1GJAB 4Y0YE 3SV2H 2F9NA 3P8GA 4AFUA 3UNSA 4FVDA 2PTCE 3PLBA 5EQQA 2HALA 3T26A 3CP7A 4KTCA 1FZZA 2PUQH 2P59A 1FI8A 1SGIB 5JBAS 4U2WA 3F9HA 3RUOA 3UOPA 1V2KT 3SV8A 1KY9A 5I46H 2BY5X 1O2NA 1WV7H 3ZZ5A 1OWEA 1FMGA 1GG6C 2QAAA 3BTWE 3NZIA 5DK1A 1FJSA 2XCNA 4X1QU 1INCA 2SNWA 3LGUA 3GDVA 1GHXH 5C5NA 4B74A 4IBLH 2XW9A 4X6MA 1XKBC 1MKXH 1GBCA 4ISHH 1C2GA 3BN9A 1ELVA 1V2OT 3QZRA 4INLA 2O8TA 1C1MA 3VB6A 1BTHH 2CGAA 3BEFB 1Y3XA 2J34A 3RU4T 2FOHA 1O5DH 1QIXB 4DW2U 2PW8H 2W7UA 3LC3A 4X2XA 1GI3A 2BB4A 1BUIA 1GHBG 2P94A 1EPTA 1TMUH 3RXPA 2VU8E 3MFJA 3JZ2B 1YGCH 1F0SA 1O34A 1A5HA 3ZVGA 5JDUB 1UCYE 2J9NA 1C5PA 2WPIS 4MVNA 1L0ZA 2AIPA 4XBDA 3A7TA 4CBNA 1C2DA 4FUIA 1C5XB 1A0LA 1O2JA 5C67A 1FONA 2ZGHA 1GJ7B 1LHGH 1XUIA 2QIQA 2BDCA 2ZGXH 2V35A 1B0FA 1EX3A 1BB0B 2JH5D 2GCHG 1GGDB 2FS9A 1C5TA 1RGQA 3MH7A 2BD8A 2BHGA 4B75A 1UVUH 1BMNH 7GCHF 4SGAE 4Y11E 4DGJA 2W3IA 1ELCA 2BD5A 4B1TA 2FP7B 3K6ZA 1YYY1 4ABDA 1SHHB 2QY0B 4CRFA 5FCKA 3TU7H 1A2CH 1O2HA 6LPRA 1GDQA 1C2HA 2YOLA 1XVOA 2A4GA 3SU2A 3M7TA 1BRCE 1EB1H 2HVXA 3SI3H 4MQAA 3D23A 2G4UA 2QV1A 1SPJA 2BDIA 2KAIA 4HZHA 1O2TA 2A1DB 5TJXA 1GBAA 3D62A 4A1XA 5EODA 1GHYH 1D3TB 1BMMH 1AE5A 3K6YA 3S9BA 2HNTE 4MPWA 3OX7U 2P95A 3DA9B 1GI6A 3MO6A 1TQ0B 2V3HH 5FHTA 4F4OC 1VGCB 2HRVA 3RXRA 3I78A 2ANWA 6GCHG 4IMZA 1O39A 1AN1E 2PGBB 1SOZA 1TLDA 1C5OH 1MBQA 1HAXB 3S69A 1SGEE 2F9UA 2GZ9A 1P2JA 3E90B 3QDZB 4X6NA 1GJDB 2UUFB 2ZQ2A 3PLPA 1T4UH 5C1YA 4WH6A 3MNBA 3M3TA 1KIGH 2D8WA 3BEUA 2PKAA 4KTUA 4CR5A 1PFXC 1K2I1 1J15A 1EP6A 2WPKS 1UHBA 1CT2E 3OYPA 2ZZUH 4WF8A 3TH4H 4GHQA 4Y8ZA 1SFIA 5FXLA 4CREA 1ANCA 1GI7B 5JBTA 2QXJA 4GCHF 3RXEA 3TJUA 1L2EA 4TWWA 5T3HA 4OS5A 1GG6B 1U6QA 3TPIZ 1Y5BT 4B71A 2VWLA 3U69H 1H8IH 1ZOMA 1O5FH 4WXIA 2HLCA 3S9AA 3BF6H 2BD2A 5DG6A 1NY22 4ZMAH 1C1SA 1O32A 1E37B 1HXEH 2FOCA 5K7RA 1P01A 1DY9A 2AS9A 1O3HA 1SGYE 1FY5A 1M9UA 2K1QA 4ABHA 3SZNA 1LTOA 2BOHB 5GWZA 3WY8A 1P12E 1D3DB 4MLFB 1GI4A 1K1NA 2BY7X 2FI5E 2ILNA 2G5VA 1G2MA 1QB9A 3F9FA 4O9VA 5A8YA 2ASUB 1GBKA 2ZU1A 4JCNA 1UK2A 1RD3B 1MKXK 1GBJA 4NSYA 2FESH 4YM9A 2GT7A 1SVPA 1V2JT 3IG6B 3HKIB 3RLWH 4CHAB 1O5CB 2ZDMA 1G37A 1E36B 3RP2A 1OSSA 3VB3A 1UO6A 2H9EH 5FBEA 1HAOH 2XNIA 2FOFA 1AFQC 2XXLA 1HV7A 2Y7ZA 1MMJN 4E7NA 1OWDA 1UMAH 3RM2H 2EC9H 1FLEE 1YPEH 1ZYOA 3AAVA 1QL9A 2AERH 3HK3B 1OP2A 2ZQ1A 3MU8A 4NFFA 4U32A 3SU3A 1YPJH 3NCLA 1GI8B 2AGGX 5LPRA 1CE5A 4X8SH 3MU1A 2OUAA 3LONA 4NWLA 3EGKH 1GBHA 1QBNA 2XRCA 1NN6A 8GCHF 3MNXA 1TMBH 1GMCF 1WU1A 1GJ6A 1TB6H 1LPGB 1PPHE 1VITH 1NFUA 1BIOA 1V2TT 5E2OA 1DANH 1JWTA 1H9LB 1O38A 3RXVA 1CO7E 2BLWA 1ZSLA 1MAYA 4FUHA 2C4FH 2I6QA 4B2BA 1DWDH 1CBWC 1UTPA 4I8LA 3TNSA 4I33A 1OOKB 1BZXE 1VITG 1EJAA 3S9CA 2OC0A 3GY6A 1GL1A 1O2LA 5JB9S 2P16A 1SGNE 3MH5A 1XUKA 4ABJA 8KME2 1A61H 2A4RA 1O3GA 1QB1A 4FUDA 2P93A 4K1EA 1FQ3A 2W5EA 1ZRKA 1OWJA 3RMOH 3SV7A 4CH8B 3RC4A 4D9RA 1AB9C 5EXNA 3F9EA 5DP7A 5B6OA 1C1TA 2F9PA 2ZPSA 3BTDE 1HBTH 3RMLH 1W8BH 4ZXYH 2B5TB 1W3CA 2ZDKA 3O8DA 4BAKB 4A1VA 1DY8A 2ZHFH 1P2MA 1ZPCA 4IS5A 1FDPA 1NRNH 2V3OH 3PMAB 3UIRA 1IHTH 3BTTE 1YLCA 1UVPA 2PUXB 1CA8B 1OP0A 3A83A 4B76A 1SQAA 2WPMS 3K65B 2R2MB 2FOEA 2ZC9H 2ZO3H 1HJAC 3EQ0H 2SGFE 1GI9B 4UEHH 2ODPA 1A4WH 1O2MA 3LJOA 5L2YH 1CGHA 5IDKA 5A8ZA 1ABJH 1KLIH 2CV3A 2FOAA 1P2IA 3BTHE 1C9TA 4OGYA 1DXPA 1OWKA 1N8OC 1KXBA 2YNBA 3LGIA 1JMOH 2Y6TA 4X1PU 2BMGB 2OLGA 1SFQB 3KQDA 5DGJA 4YLUA 3I29A 1BHXF 1IQLA 3H7TA 2GCHF 3LPRA 4K1TA 3SJ9A 2FO9A 2GKVE 1P2KA 1LKAA 3A8DA 4CH2B 3EDXB 4B2AA 1O5BB 1C2KA 5AFZH 1JRTA 1WCZA 3STIA 1L4DA 4WJG2 2FZZA 2VGCC 2ZP0H 3P8OA 1ZTJA 1V2QT 1T8NA 3ZVCA 1ZMNA 2OTVA 1TQ7B 1GBFA 4ABAA 3ESTA 1KXCA 4NGAH 3S7HB 5LPEA 1ETTH 3A89A 2J2UA 1ID5H 2JH6D 3DFLA 1FV9A 3BTGE 2ZU4A 4XSKU 1NTPA 1ANEA 1TNGA 4F49A 4TYDA 2Y82A 3ZZDA 1MU8B 1EOJA 5DP6A 4RN6A 3H5CB 4U30A 1O5AB 2GZ8A 4INHA 3SORA 3SUDA 3NWUA 1MAXA 2XC5A 1LHDH 5HGGA 3RU4D 2PSYA 3E0NB 4CRAA 3Q3XA 1JXPA 4DCDA 4X2VA 3KNXA 2ZHWH 4I31A 4XE4A 1O3CA 1O3OA 2XYAA 1WYKA 1P9SA 3GOVB 3T62A 1LHEH 2J38A 1O3JA 2BX3A 1TA2A 1ZHPA 3KQCA 3U1JB 3FZZA 1C2IA 1GBIA 1D6WA 1LVBA 4AB9A 6GCHF 5DP4A 3GISB 2XWAA 2QC2A 3M5LA 1GJ5H 1C1NA 2FODA 4AG2A 1LHCH 2ODYB 1GVZA 4PROA 1MKWH 1GDUA 2A7CA 1SC8U 4SGBE 5FAHA 1BHXB 1Z1JA 1GL0E 2ALPA 2IPHA 4NSVA 2QF0A 3VXFH 5JYIA 2VVCA 1YPMH 2J4IA 3ZZ7A 1IQIA 2ZGBH 4I8GA 1GHVH 2EEKA 3M5NA 1RFNA 4NZQA 2FLRH 3TVJB 1Z6EA 1HDTH 3GY5A 1C2EA 1YCPH 1A46H 3VB7A 4AFSA 1UVOA 1KYNA 1CGIE 2B8OH 2ZTYA 1KDQA 4X0WU 2BLOA 1P06A 1P2NA 1AB9B 4NIYA 2O8UA 3QUMP 3IITA 5FPTA 1GHWH 5FX6A 2O8WA 5HM2A 1EPTB 1HAYB 1EAIA 1DWBH 3RXCA 3L33A 2A7JA 1S82A 1THSH 5EG4A 1LQDB 2FTMA 2QYIA 4UD9H 4X8VH 1G30B 3O8RA 4R8TB 3TGIE 1EATA 4UFFH 1DOJA 1ZPBA 1MBMA 1ZTLA 3ITIA 3EE0B 4BTTB 1O0DH 1BTZA 2ULLA 1TOCB 1DSUA 1PQ7A 4MNYA 5A09A 1QB6A 2Y80A 1P0SH 2HNTF 1O35A 1XMNB 1CVWH 5F03A 4Y7BA 1IQKA 3GY2A 2A2XH 1N8OB 2VIQA 1IQNA 2SFAA 1TNIA 4ZKRU 1YPGH 2FI3E 4ISLA 1GI2A 2SGPE 1GPZA 3BTQE 1GBEA 2FIRH 1AUJA 2A5IA 5J4SA 2NU1E 3MMGA 1C2JA 3LGWA 4ABEA 1DFPA 5EGMA 3U98H 2PTNA 3M61U 2VGCB 4DIIH 1O2OA 1ZJKA 5CMXH 2ZHQH 4JK5A 1HJ8A 1O2UA 5C20A 1OS8A 5LGOA 3SO3A 4D9QA 2KAIB 4OS7A 2GX4A 1Y3UA 4KGAA 2PGQB 1TYNA 1VITF 4WY3A 1W0YH 1BTYA 1YP9A 5G4BA 1EASA 1OYTH 2VINA 3BG8A 4Q7YA 4YO9A 3MU5A 1O2XA 1V2LT 1IQGA 2TGTA 3KIDU 4ZKSU 1ZHRA 2BXTH 1C5MD 1K28D 2ANMH 1OX1A 1BRBE 5GPIB 4ZXXH 4D7GA 2EI6A 4Z0KA 5EU8A 1YPHC 2CN0H 2GD4B 1TE0A 1BTPA 3AVZA 1RTFB 3DT0H 3E6PH 1G3BA 4A6LA 4FXGH 2WV5A 1DXWA 1UJ1A 1ZMJA 3SJKA 4MPUA 4A7IB 4AORA 1UTMA 3LGYA 3F1SB 1O3BA 5FBIA 3KQBA 3ZVBA 1AY6H 2PKAB 2LPRA 4NWKA 5A0AE 2AEIH 3SNCA 2O8LA 1UHBB 4CRBA 4NZLA 4ZHMU 3UNQA 1HJ9A 4BANB 1A3EH 4TY6A 1GBTA 2GV6A 4CHAC 4MDSA 1HYLA 1QFKH 4UFDH 2EI8A 3GCTG 4RKOB 1ETSH 1XUFA 1BBRE 3SHAH 1C4V2 4BTUB 3Q3KA 4B2CA 1W7XH 4O3UA 2QXHA 2VIVA 3U9AH 2UUKB 4D7FA 1TPOA 1SHYA 1N6YA 2CXVA 1MKWK 3M3VA 2CHAB 3RC6A 1EZSC 3BEIB 1TNKA 1F7ZA 3PMHB 4U01A 4ISIH 1SGCA 2BY8X 1GJCB 1PYTC 1HAGE 1Z7KA 4XOJA 1P10A 4X2WA 1G3CA 1HGTH 2ZHDA 4JMYA 2ZPQA 4GLYA 1O2VA 3A82A 1TMTH 1MQ5A 4KELA 2VIWA 4WWYA 5DP3A 5PTPA 5ETXA 3PB1E 1E34B 2VVUA 2P8OC 1JIMA 3STJA 1F92A 3RMNH 2W7SA 1MTWA 1ZGIA 1W11U 1YCPK 1QNJA 2D1JA 1P03A 1NU7B 5FX5A 3ZYDA 3BV9B 1ZR0A 3PTBA 1FIWA 1KLJH 3W95A 2Z3CA 2STBE 3M7QA 2SGDE 1QCPA 1D6RA 2BLQA 2ZEBA 1UCYH 1FPCH 3TJOA 3V13A 1C4Y2 3RXOA 1F5RA 1GCDA 2B7DH 1F2SE 1XUJA 4WXVA 1PPBH 2PHBA 3F68H 1CT4E 5C1XA 1BBRH 5DP9A 3I77A 2FTLE 1SGPE 2ZNKH 2W26A 3RM0H 4ZHLU 1TX6A 1CQQA 1NESE 1W0ZU 1THRH 3ZV8A 4FU9A 2Y7XA 5A0BA 1J9CH 1A0JA 2F9BH 2ZFPH 2G5NA 3ATWA 1TFXA 3M7UA 1MTSA 1GMDG 1QHRB 1O2KA 2B0FA 2VIDA 2Z9JA 4FUJA 4I8JA 2ESTE 4A1TA 5C3NA 1BA8B 3GICB 4RSPA 3NPSA 1NRSH 4JYTA 4DT7B 2BVSH 1UK4A 2RCEA 5F8XA 5EPYA 3ZVFA 1HAHH 1Z1IA 1Y3YA 4AX9H 1RS0A 1AWHB 1HIAA 4B73A 4NCYA 2OC7A 1C9PA 1GI1A 4IMQA 1P04A 2A7HA 1ZSJA 1V3XA 1ELEE 4LOYH 4YESB 4UDWH 2NWNA 3U1IB 1W7GH 3T5FH 5F6MA 1TNLA 1VJ9U 2CJIA 4IN2A 1Q3XA 1T8LA 2ZCKP 2AMDA 1TOMH 1O33A 4Y79A 1MD7A 1GHAG 3JZ1B 4MG3A 5ESTE 3U8RH 2FMJA 3GYMA 3AASA 3TIUA 2HOBA 4Y0ZE 1C5ZB 4ESTE 5EW1H 1UTOA 5EQRA 1DWEH 2PSXA 3TJNA 1YBWA 3A85A 1MZAA 1W12U 1N1LA 3RXSA 1Y3VA 3PROA 4AGJA 2D26C 1O5EH 1UTJA 4WMFA 3UNRA 5DO4H 1TPPA 5EOKA 1JIRA 1ARBA 2ZTZA 2RA3A 4CRGA 2H9TH 3FVFB 5E2PA 1BJUA 2Q6DA 3N7OA 3SBKA 1LVMA 2A4OA 3UWJH 3MNSA 3HGNA 1BQYA 4ISOA 4Y7AA 4X6PA 1EZUC 4AYVB 1ZJDA 1O2ZA 4JYVH 1YCPM 4CRDA 1C1UH 2ZKSA 4A5TS 2TPIZ 4GVUA 1O2GH 1V2ST 1SLVB 2AFQB 4NA8A 3UOUA 5HYOA 1TIOA 4DG4A 2TGDA 3V0XA 1LMWB 2H9HA 1QGFA 1GI0A 4UONA 1GBMA 1VCPA 2VIOA 4H6SB 7LPRA 2WV4A 2WUBA 3ATKA 1SL3A 1O3FA 1TRNA 2R0LA 4GAWA 5EXMA 2P8OB 1FXYA 2F9OA 4E05H 3A87A 3KEEA 1V2UT 1HAPH 2Y81A 5T6DA 3BTKE 1V6DA 3UQVA 1AU8A 1AFEH 4DOQA 8ESTE 1S6HA 1AGJA 1WBGB 1C2FA 3KN2A 1BMAA 1PQAA 1BRUP 2FYQA 4O97A 3MTYA 2Q6FA 4K1SA 1OXGA 1O3DA 3RXJA 2OC8A 3VGCC 1S0QA 1TGNA 1J16A 1LVOA 2RA0A 3QO6A 3LKWA 4UFGH 4OS2A 3ZZ9A 5ESBA 3SU6A 4NA7A 4XDEA 1EPTC 3MNCA 3SOSA 1TBRH 3VB5A 1UCYK 3GCHC 2XC0A 1W10U 3UY9A 1TPSA 2H6MA 1HLTH 1O3AA 2OINA 2IJOB 1LHFH 2BDHA 2AIQA 3AAUA 3MH6A 1GHBF 2A5KA 1PYTD 3PO1C 1SGDE 1PPGE 2FEQH 3FZDA 1BBRK 3SGQE 4D76A 1BTWA 1QRXA 1P2QA 5HM9A 2QA9E 1RRKA 2SNVA 1BTUA 1LQEA 1S5SA 2OBOA 2DUCA 3MOCA 1DLEA 4CR9A 1AHTH 2BD4A 1XM1A 3E16B 1C5LH 3ATIA 3GCTF 4AFZA 3UREA 3PWBA 4K2YA 1IQJA 1K1IA 3M37A 3PMBB 1OWHA 1D4PB 1TAWA 3BIUH 1Y5UT 2BY9X 1EXFA 4K5ZA 3BIVH 5E0JA 2HWLB 3EA8A 2ZDVH 2RDLA 2ZU2A 1K9OE 1KDQB 3GDSA 3PMJA 5A8XA 3DFJA 1F5KU 1NU9A 4O3TA 5T6FA 1CA0C 1FAKH 5FCRA 5IYTA 2VNTA 3SQEE 3A8BA 3MH4A 1XUHA 3GCNA 4X1NU 1O3EA 2TBSA 1QBVH 1BITA 2ANYA 3UWIA 1P9UA 1NT1A 4OS1A 2TRMA 2G8TA 3C27B 3RXUA 4KTSA 1MH0A 2IN2A 4Y10E 1K1JA 3OY5U 2GV7A 4MNVA 2ZHEH 1HAVA 2YNAA 1Z8GA 2FS8A 5C2ZA 3SNEA 1KXDA 2C8WB 5FPSA 2A31A 2SGAA 4IGDA 3LJJA 4FUGA 3QN7A 2VWMA 1IQHA 2FDAA 2ZCHP 3T25A 3TK6A 3PTNA 3BTEE 1CSOE 3ELAH 4ABIA 2ZA5A 1AI8H 1SMFE 1AWFH 1KTSB 2BZ6H 2BD7A 4KP0A 1HNEE 4MPXA 4NFEA 3RXFA 1SGRE 1S6FA 4Z6AH 4THNH 4GHTA 3KCGH 3MHWU 3RMMH 2AGIX 4WMDA 3RXKA 1SGFA 3SW2B 4DURA 3Q77A 4X1RU 1VCWA 3ZZ3A 2HNTC 4I8KA 1LPKB 1NFXA 1L1JA 3FP6E 4BXSA 4FUFA 3ZYEA 2O9QA 4IW4E 1T8MA 1EUFA 2WYGA 3SNAA 5GDSH 1TPAE 4IN1A 1WUNH 2NU0E 1GBBA 1KSNA 1AVXA 1G9IE 1GMDF 1BOQA 4Y6DA 1ESAA 2NU2E 1AUTC 2ZDLA 1ZRBA 2ZWLH 1DPOA 2GTBA 3E91A 4MNWA 5CE1A 4FU8A 1ABIH 2ZFTA 3B9FH 2XWBI 1AVGH 1MTVA 1MTNC 2FLBH 3AW1A 1S83A 1V2MT 1ZGVA 1EQ9A 1FPHH 3A7YA 3ZVDA 5E8EH 1NFYA 1F5LA 2C90B 1A1RA 2CHAC 3VGCB 3RDZA 2QXGA 1ANBA 1K22H 2UWOA 2VH6A 2FPZA 1SGQE 1Y5AT 4KKDA 1K1MA 1GJ4H 2PV9B 1E35B 2XBWA 5JPMH 1WTHD 1DICA 1OYQA 2QGRA 3L6PA 3V7TA 2PWXA 1EAUA 3DHKH 1XX9A 1GHAF 1A5GH 4ASHA 1DUEA 1J17T 2BZAA 1P3CA 5LH8A 1AKSA 1SGFG 3GCHB 1FY4A 2F9VA 4ABBA 5EW2H 2D2DA 3RXTA 1SOTA 2EI7A 2Z3DA 4MTBA 3PO1B 4M7GA 3E3TA 4J1YA 2R9PA 3LOXA 1QQUA 1DS2E 1ZHMA 2C93B 2HGTH 1UTKA 2A45B 1KXEA 2ZU5A 3R0FA 1QA0A 4ZHAA 1C2MA 6CHAC 2BD3A 3EAJA 1LO6A 2ZCLP 2R3YA 5L2ZH 3BG4C 1O2SA 2G52A 1Y3WA 2XC4A 1Y8TA 1BMLA 1TGCA 5L6NH 3LC5A 1O3LA 2BDGA 3SU5A 1TA6A 2J92A 5AF9H 3HGPA 1S84A 1AVWA 3GCOA 2H2ZA 2VVVA 3TGKE 1IQEA 1CA0B 1V2VT 2HPPH 1NM6A 1DITH 4XFQA 4OGXA 4VGCB 5J4QA 9ESTA 5GXPA 1XVMA 4FUBA 2AGEX 1W13U 5C5OA 4DJZB 3TJVA 1WTGH 3SJIA 1O3IA 1QJ6B 4CBOA 1O3MA 3ATMA 3P8NA 1C1VH 3PM3A 5GJ4B 1QY6A 1NZQH 1QA7A 2UWLA 2FYRA 4AOQA 1MUEB 1O3KA 1EOLA 2NU4E 1O2YA 1GJ8B 1JBUH 2C8XB 1GMHG 5E0GA 3RXHA 2ALVA 5DP5A 3RXBA 3MI4A 3HATH 1UTLM 2Y5FA 4DIHH 1TALA 1EZQA 1EP5A 1BCUH 1B0EA 2OP9A 3TLOA 3KHVA 4BNRA 1NPMA 2OQUA 2BOKA 4NIXA 1YKTA 4K8BA 1GWAA 3QGNB 1IHSH 3F9GA 2Z7FE 3PWCA 3ZZ6A 3L3TA 4QT8C 1Z8JB 7KMEH 1RJXB 3SI4H 3LT3A 3S7KB 1P05A 4OS6A 1EZXC 3VB4A 1FY3A 1SQOA 1ELFA 3UPEA 3V3MA 1AZZA 2GVFA 1MD8A 3ZZCA 3RC5A 3CS7A 3O8CA 1BDAA 3Q00A 1V2PT 2XCFA 3ZVEA 1O2IA 3FFGA 4YT6H 2PFEA 1DE7H 1QRZA 1H9IE 1S81A 3MU4A 2GGVB 2NU3E 3LU9B 2WPHS 2TGAA 1NC6A 2BDAA 2BDYA 4ZH8A 2WINI 5EPNA 1SLXB 1F0RA 2BTCE 1TBZH 4NIWA 1GHZA 1DWCH 3T27A 3A8CA 2R2WU 3MO3A 5DJ7A 5A2MH 3RXLA 1TRMA 1HIAB 2UUJB 1C2LA 1FY1A 2ZF0H 4JZEH 1SG8B 3HPTB 3RXAA 1C5WB 3ZZAA 1QR3E 1VJAU 1MTNB 3SUEA 1L4ZA 1IQFA 2H5DA 1TONA 3ZZBA 1F0TA 4BTIB 3EA9A 1K21H 2JH0D 1XKAC 2GMTC 3P8FA 3URDA 4YLQH 1OKXA 2SGEE 5GCHG 2OXSA 1X7AC 4JZDH 1P11E 1YLDA 1G36A 1SB1H 1RTKA 2JETC 2GCTC 2WPJS 5CHAC 1RTLA 3VXEH 5SGAE 1CT0E 3KL6A 4ZUHA 5FPYA 1SSXA 2C3SA 4IC6A 1VCQA 3C1KA 2VWNA 5I25A 1CU1A 2JKHA 3VEQB 3HK6B 2BY6X 4AZ2B 4ZKNU 3QTOH 3UR6A 3TK5A 1PPCE 4YZUA 4WH8A 1C1RA 4K60A 1OWIA 1AE8H 1QL7A 1ZTKA 4TPYA 1OPHB 3NXPA 3UFAA 1RXPA 2Q6GA 2WYJA 3MYWA 1G2LA 1TNHA 1Z8IB 3FP8E 3KQEA 5JBBS 2F91A 3SNBA 4D8NA 1IQMA 1HFDA 1O2RA 2OD3B 2QXIA 3SU0A 6CHAB 3IWMA 1C5SA 3MU0A 1GBLA 1E38B 1AIXH 3A86A 1BTXA 2ODQA 3BG4B 1TGTA 1A3BH 1HPGA 1Z71A 1RIWC 1HCGA 2TIOA 1HAZB 2FXRA 1Q31A 4ISNA 1K1OA 3VPKA 2C8YB 5JB8S 1PJPA 1VZQH 1G32B 1P09A 1B7XB 1C1QA 2GT8A 3GY3A 1DSTA 3DUXH 1HRTH 1FN6A 3A8AA 4XBBA 4IC5A 1W14U 3AW0A 3Q3YA 1TBQH 4LZ1H 2P3TB 2HPQH 1GI5A 5H4IB 1EAXA 1FNIA 1LKBA 4TWYA 4AB8A 1ELBA 2VH0A 4AGKA 2ZG0H 2B9LA 1EB2A 1F0UA 1WAYB 2BYAX 3RLYH 3SQHE 5DKMA 1Y59T 1P3EA 4Y8YA 5JBCS 1P57B 1G3EA
chains in the Genus database with same CATH superfamily
3PLKA 3K2UA 4TPIZ 3O8BA 1WQVH 2A5AA 3S0NA 3LH3A 3LGTA 1J8AA 2Q1JA 5L30H 1B5GH 3QGJA 1D3PB 2Z9IA 2FI4E 2ZECA 2PR3A 3ZZ4A 5E0HA 4ABGA 2FOBA 3G01A 3SJOA 2EA3A 2DE8A 4XBCA 3RXGA 1LPZB 1EJNA 2FX6A 4GSOA 4Y8XA 1XUGA 3P95A 3P92A 5KECA 1D3QB 3K9XB 3M35A 1C5NH 3TITA 1GJ9B 1PPFE 5AFYH 1DUAA 1V2WT 3M3SA 1NO9H 1O2PA 4YTAA 4GPGA 3F3BA 2BLVA 2G00A 3FANA 2ZIQH 4R0IA 4CRCA 1DX5M 3OE7D 1AMHA 4YOIA 3OAAD 1C1OA 4Q7ZA 1ZMLA 1A5IA 3GDUA 4YXWD 3ODDA 5BPEA 1CHOG 3R3GB 3U8TH 3BSQA 1P02A 4I32A 2BVRH 1KTTB 2XBYA 1DT2A 1QJ7B 1UTQA 1GVKB 4K3JA 2G81E 3F0PA 2RG3A 2R0KA 1QBOA 1ORFA 1TX7A 1P8VC 2AMPA 3KGPA 1TNJA 3OTJE 1PQ5A 3GY8A 4H42U 2VWOA 3P70B 1KLTA 5B6LA 2VB0A 3CS0A 1ESTA 3TK9A 1SR5C 2ZGCA 1AD8H 1FY8E 3URCA 4BAQB 2Z6BD 3A88A 1OP8A 2GMTB 1O2QA 4YOGA 2Z9LA 5EXLA 1G3DA 2FOGA 3UQOA 1O30A 2P3FH 2A2QH 1PQ8A 2JETB 3U8OH 2GCTB 3ZV9A 2SGQE 5CHAB 2Y5HA 5F8ZA 1XXFA 2ZFRH 3LDXH 1HAVB 1SQTA 1TX8A 2QF3A 1S6LA 2I6SA 2LNCA 1YPKH 5EQSA 2CMYA 3SNDA 1O2WA 1D9IA 1T7CA 2O8MA 3LGVA 3A7VA 1GBDA 2WPDD 2GP9B 1Q2WA 5K0HA 5F53A 2V6NA 4INKA 1N6XA 1FN8A 1GCTC 3E8LA 3BTFE 4JYUH 1YPLH 2J94A 1GMHF 3PV4A 2QN5T 4BAOB 1QJ1B 4K8YA 4H6TA 4YT7H 1MU6B 1HXFH 2UWPA 4WVPE 1ELGA 1RIWB 4GUXA 4I7YH 1AZ8A 4AYYB 2CF9H 1WOFA 1WQSA 1J14A 3RXIA 2XBXA 1TRYA 4TY7A 3A80A 2H5CA 2FWWA 4NIVA 3MWIU 5C1UA 1ZPZA 1E0FD 4FUCA 2RFKC 1C4U2 4Y76A 4HGCA 5AVDA 5TCAA 1YPHE 1YM0A 1UTNA 1TGBA 2AMQA 3PYHA 1XXDA 1BJVA 3QZQA 4X1SU 1TABE 1UVSH 3UUZA 1C5UA 1S0RA 1KXFA 4X2YA 2H1UA 2OBQA 2ZI2H 1W2KH 1KXAA 4OM9A 4DVAU 4NA9H 4Q7XA 4RKJB 4MNXA 4E7RG 3Q76A 3LIWA 5AHGH 2G51A 2Y5GA 5GIBA 3A84A 1MTUA 2AYWA 3FP7E 1NFWA 2TGPZ 1A0HB 1ELAA 4AG1A 2ZDAH 4X6OA 4UE7H 2PKSC 4BXWA 2GDDA 3RXMA 4LXBH 1FIZA 3B8JA 4K69A 1TGSZ 1Z6JH 2WPLS 2A0QB 1NROH 1C1PA 1LDTT 4MPVA 4WMEA 3P17H 3T2NA 3GY7A 2DE9A 2C8ZB 2Z3EA 1YF4A 1A7SA 1PPZA 1JRSA 1FAXA 4FUEA 1MCTA 1GVLA 1EKBB 4ABFA 3QK1A 1SBWA 4ZKOU 1AKSB 1T31A 5GCHF 2BX4A 1HAIH 1UK3A 4VGCC 3MO9A 4LZ4B 2A4QA 7GCHG 5DP8A 2XBVA 2XTTB 3RXDA 3UTUH 4ZROA 4J2YB 4X8UH 3U28C 1V2NT 1QL8A 4FVBA 5T6GA 2J95A 3SU1A 3T28A 5ABWA 1YC0A 4FU7A 1IOEA 4HTCH 3CENA 3SGBE 1SLWB 4NG9H 3D65E 3SV9A 1IAUA 1C5VA 1UVTH 3A7WA 2A32A 1ARCA 2M5TA 1V2RT 1AQ7A 2FM2A 1C5RA 3SUGA 4H4FA 1BT7A 3PV2A 3KF2A 3HKJB 5EJLA 1THPB 1O31A 1T4VH 2RDEA 1EAWA 2AH4X 3QX5H 2ZDNA 2STAE 2BVXH 3RXQA 3P6ZB 2CF8H 3E0PB 2BQ6B 4O03A 4BAHB 2R3UA 1ESBA 1O5GH 2PLXA 1Z8RA 3OY6U 1AFQB 3SGAE 1SLUB 3M5MA 2OC1A 5HMAA 5DPAA 2BDBA 1DLKB 2UUYA 3M5OA 1O3PB 5A0CA 2W6ID 3A7ZA 2VIPA 5BRRE 4Q2KA 3W94A 1ANDA 1C1WH 5F8TA 3M36A 1LCYA 4LK4A 4Y71A 2F43B 3ATLA 1H8DH 2IOTA 3F6UH 3SUFA 2ZFFH 1PPEE 1P2OA 4Q80A 3NK8A 2ZFQH 1H8HD 2BM2A 1VR1H 2L74A 2FX4A 6ESTA 2F3CE 3RU4E 1GCTB 1MQ6A 2BQWB 5GNDA 3H7OA 2GZ7A 4E06H 4JZIA 9LPRA 1LVYA 3GY4A 1H4WA 2F83A 2EY4C 1EJMA 2FOMB 4GCHG 1CBWB 3EYDA 4HFPB 4BOHA 3DD2H 2ZGJA 1FUJA 2G4TA 3BTME 1ETRH 5DSFA 1ZLRA 3OSYA 4JK6A 2ZTXA 2GDEH 2BQ7B 3SJ8A 1NRPH 1H1BA 3TH2H 1C5YB 3T29A 4JZ1A 2W6JD 2ZFSA 4OS4A 1O37A 5LPFA 1GGDC 1C5QA 1GJBB 2VJ1A 4YOJA 1NS3A 3ZIAD 3SHCH 1ZSKA 4HI3A 1DDJA 1T8OA 3EE7A 1CGJE 1MZDA 2Z9GA 2BXUH 1ELDE 8LPRA 3GYLB 2WUCA 1CHGA 1SGTA 3A7XA 3SN8A 1K1LA 4AN7A 3EA7A 3B23B 1DVAH 1HUTH 2V0BA 1ELTA 3E1XB 3V12A 2OQ5A 1CHOF 2P3UB 4AFQA 1NBME 4UFEH 3ODFA 4ZAEA 1ACBE 1HB0B 4I8HA 1T32A 2PKSB 3NKKA 1ZZZA 2ZU3A 3QWCH 1SI5H 3NUMA 3UR9A 1GDNA 2G55A 1L1GA 2BD9A 4Q63A 1S85A 3SU4A 2ZPRA 7ESTE 1NRQH 1QRWA 4A92A 1HJAB 1QTFA 4BAMB 2ANKH 3A81A 3KYGA 5C17A 1O3NA 1QQ4A 5HXFA 1K1PA 2W3KA 1NRRH 1TWXB 1DM4B 3ZZ8A 1JOUB 3QTVH 1L1NA 2Z94A 3ENSB 3D49H 1QURH 1WSSH 4DY7B 1MCVA 3FAOA 4JZFH 5TCCA 3TNTA 1H9HE 1O36A 2QCYA 3ZVAA 3LH1A 2THFB 3QLPH 8GCHG 3VFEA 1VGCC 4X8TH 2Z9KA 1GMCG 1AO5A 3SV6A 1BRAA 3TH3H 3OU0A 3TGJE 2OCVB 1GJAB 4Y0YE 3SV2H 2F9NA 3P8GA 4AFUA 3UNSA 4FVDA 2PTCE 3PLBA 5EQQA 2HALA 3T26A 5EJ1A 3CP7A 1MABB 1FZZA 4KTCA 5KGOA 2PUQH 2P59A 1FI8A 1SGIB 5FL7D 5JBAS 4U2WA 3F9HA 3RUOA 3UOPA 1V2KT 3SV8A 1KY9A 3KQ5A 5I46H 2IJD1 2BY5X 1O2NA 1WV7H 3ZZ5A 1OWEA 1FMGA 1GG6C 2LP6A 2QAAA 3BTWE 3NZIA 5DK1A 1FJSA 2XCNA 4X1QU 1INCA 2SNWA 3LGUA 3GDVA 1GHXH 2KZ4A 5C5NA 4B74A 4IBLH 2JDID 2XW9A 4X6MA 1XKBC 1MKXH 1GBCA 4ISHH 1C2GA 3BN9A 2J97A 2XNDD 1ELVA 1V2OT 3PV5A 3QZRA 4INLA 2O8TA 1C1MA 3VB6A 2JIZD 1BTHH 2CGAA 3BEFB 1Y3XA 2J34A 3RU4T 2FOHA 1O5DH 1QIXB 4DW2U 2J98A 2PW8H 2W7UA 3LC3A 4X2XA 1GI3A 2BB4A 1BUIA 1GHBG 2P94A 1EPTA 1TMUH 3RXPA 2VU8E 3MFJA 3JZ2B 1YGCH 1F0SA 1O34A 1A5HA 3ZVGA 5JDUB 2WV9A 1UCYE 2J9NA 2KCOA 5DN6D 1C5PA 2WPIS 4MVNA 1L0ZA 2AIPA 4XBDA 1WXRA 3A7TA 4CBNA 3H09A 1C2DA 4ACBA 4FUIA 1C5XB 1KMHB 1H8ED 1A0LA 1O2JA 2LELA 5C67A 1FONA 2ZGHA 1GJ7B 1LHGH 1XUIA 1OHHD 2L6OA 2BDCA 2QIQA 2ZGXH 3N7EA 2V35A 1B0FA 1EX3A 1BB0B 2JH5D 2GCHG 1GGDB 2FS9A 1C5TA 1RGQA 3MH7A 2BD8A 2BHGA 4B75A 1UVUH 1BMNH 7GCHF 1UW7A 4SGAE 4Y11E 4DGJA 2W3IA 1ELCA 2K0QA 2BD5A 4B1TA 2FP7B 3K6ZA 1YYY1 4ABDA 2KCAA 1SHHB 2QY0B 4CRFA 5FCKA 3TU7H 1A2CH 1O2HA 6LPRA 1GDQA 1C2HA 4Q4LA 2YOLA 1XVOA 2A4GA 3SU2A 3M7TA 2QF4A 1BRCE 1EB1H 2HVXA 3SI3H 2KCYA 4XD7D 4MQAA 3D23A 2G4UA 2QV1A 1SPJA 2BDIA 3DSGA 2KAIA 4HZHA 1O2TA 2A1DB 5TJXA 1GBAA 3D62A 4A1XA 5EODA 1GHYH 1D3TB 1BMMH 1AE5A 3K6YA 3S9BA 2HNTE 4MPWA 3OX7U 2P95A 3DA9B 1GI6A 3MO6A 1TQ0B 2V3HH 5FHTA 4F4OC 1VGCB 2HRVA 3RXRA 3I78A 2ANWA 6GCHG 4IMZA 1O39A 1AN1E 2PGBB 1SOZA 1TLDA 1C5OH 1MBQA 1HAXB 3S69A 1SGEE 2F9UA 2GZ9A 1P2JA 3DCLA 3E90B 3QDZB 4X6NA 1GJDB 2UUFB 2ZQ2A 2EQNA 1T4UH 3PLPA 3WWFA 5C1YA 4WH6A 3MNBA 3M3TA 1KIGH 2D8WA 3BEUA 2PKAA 4KTUA 4CR5A 1PFXC 1K2I1 1J15A 3AK5A 1EP6A 2WPKS 1UHBA 1CT2E 3OYPA 2ZZUH 4WF8A 3TH4H 4GHQA 4Y8ZA 1SFIA 5FXLA 4CREA 1ANCA 1GI7B 5JBTA 2QXJA 4GCHF 3RXEA 4TT3D 3TJUA 1L2EA 4TWWA 5T3HA 4OS5A 1GG6B 1U6QA 3TPIZ 1Y5BT 4B71A 2VWLA 3U69H 1H8IH 1ZOMA 1O5FH 4WXIA 2HLCA 3S9AA 3BF6H 2BD2A 5DG6A 1NY22 4ZMAH 1C1SA 1O32A 1E37B 1HXEH 2FOCA 5K7RA 1P01A 1DY9A 2AS9A 1O3HA 1SGYE 1FY5A 1M9UA 2K1QA 4ABHA 3SZNA 1LTOA 2BOHB 5GWZA 3WY8A 1P12E 1D3DB 4MLFB 1GI4A 1K1NA 2BY7X 5CDFE 2FI5E 2ILNA 4ACAA 2G5VA 1G2MA 1QB9A 3F9FA 2KFWA 4O9VA 5A8YA 2ASUB 1GBKA 2ZU1A 4JCNA 1UK2A 1RD3B 1MKXK 1GBJA 4NSYA 2FESH 2PP6A 4YM9A 2GT7A 1SVPA 1V2JT 3IG6B 3HKIB 3RLWH 4CHAB 1O5CB 2J5UA 2ZDMA 1G37A 1E36B 3RP2A 1OSSA 5CHBA 3VB3A 1UO6A 2H9EH 5FBEA 1HAOH 2XNIA 2FOFA 1AFQC 2XXLA 1HV7A 2Y7ZA 1MMJN 4E7NA 1OWDA 1UMAH 3RM2H 2EC9H 1FLEE 1YPEH 4B6EA 1ZYOA 3AAVA 1QL9A 2AERH 3HK3B 1OP2A 2ZQ1A 3MU8A 4NFFA 4U32A 3SU3A 1YPJH 3NCLA 1GI8B 2AGGX 5LPRA 1CE5A 4X8SH 3MU1A 2OUAA 3LONA 4NWLA 3EGKH 1GBHA 1QBNA 2XRCA 1NN6A 8GCHF 3MNXA 1TMBH 1GMCF 1WU1A 1GJ6A 1TB6H 1LPGB 1PPHE 1VITH 5HKKD 1NFUA 1BIOA 1V2TT 5E2OA 1DANH 1JWTA 1H9LB 1O38A 3RXVA 1CO7E 2BLWA 1ZSLA 1MAYA 4FUHA 2C4FH 2I6QA 4B2BA 1DWDH 1CBWC 1UTPA 4I8LA 3TNSA 1E79D 4I33A 1OOKB 1BZXE 1VITG 4AC9A 1EJAA 3S9CA 2OC0A 3GY6A 2WSSD 1GL1A 1O2LA 4Z1MD 5JB9S 2P16A 1SGNE 3MH5A 1XUKA 4ABJA 8KME2 1A61H 2A4RA 1O3GA 1QB1A 4FUDA 2P93A 4K1EA 1FQ3A 2W5EA 1ZRKA 1OWJA 3RMOH 3SV7A 4CH8B 3RC4A 4D9RA 3OEHD 1AB9C 5EXNA 3F9EA 5DP7A 5B6OA 1C1TA 2F9PA 2ZPSA 3BTDE 1HBTH 3RMLH 1W8BH 4ZXYH 2B5TB 1W3CA 2ZDKA 3O8DA 4BAKB 1COWD 4M9FA 4A1VA 1DY8A 2ZHFH 1P2MA 1ZPCA 4IS5A 1FDPA 1NRNH 2V3OH 3PMAB 3UIRA 1IHTH 2KCPA 3BTTE 1YLCA 1UVPA 2PUXB 4RT0A 1CA8B 1OP0A 3UAIC 3A83A 4B76A 1SQAA 2WPMS 3K65B 2R2MB 2FOEA 4HG6A 2ZC9H 2ZO3H 1HJAC 3EQ0H 2SGFE 1GI9B 4UEHH 2ODPA 1A4WH 1O2MA 3LJOA 5L2YH 1CGHA 5IDKA 1E1RD 5A8ZA 1ABJH 1KLIH 2CV3A 2FOAA 1P2IA 3BTHE 1C9TA 4OGYA 1YLNA 1DXPA 1OWKA 1N8OC 1KXBA 2YNBA 3LGIA 1JMOH 2Y6TA 4X1PU 2BMGB 2OLGA 1SFQB 3KQDA 5DGJA 4YLUA 3I29A 1BHXF 1IQLA 3H7TA 2GCHF 3LPRA 4K1TA 3SJ9A 2FO9A 2GKVE 1P2KA 1LKAA 3A8DA 4CH2B 3EDXB 4B2AA 1O5BB 1C2KA 5AFZH 1JRTA 1WCZA 3STIA 1L4DA 4WJG2 2FZZA 2VGCC 2ZP0H 3P8OA 1ZTJA 1V2QT 1T8NA 3ZVCA 1ZMNA 2OTVA 1TQ7B 1GBFA 4ABAA 1YWUA 3ESTA 1KXCA 4NGAH 4F48B 3S7HB 5LPEA 1ETTH 3A89A 2WHXA 2J2UA 1ID5H 2JH6D 3DFLA 1FV9A 3BTGE 2ZU4A 4XSKU 1NTPA 1ANEA 1TNGA 4F49A 4TYDA 2Y82A 3ZZDA 1MU8B 2JJ1D 1EOJA 5DP6A 4RN6A 3H5CB 4U30A 1O5AB 2GZ8A 4INHA 3SORA 3SUDA 3NWUA 1MAXA 2XC5A 1LHDH 5HGGA 3RU4D 2PSYA 3E0NB 4CRAA 5EIYA 3Q3XA 1JXPA 4DCDA 4X2VA 3KNXA 2ZHWH 4I31A 4FOUC 4XE4A 1O3CA 1O3OA 2XYAA 1WYKA 1P9SA 3GOVB 3T62A 1LHEH 2J38A 1O3JA 2BX3A 1TA2A 1ZHPA 3KQCA 3U1JB 3FZZA 1C2IA 1GBIA 1D6WA 1LVBA 4AB9A 6GCHF 5DP4A 3GISB 2XWAA 2QC2A 3M5LA 1GJ5H 1C1NA 2FODA 4AG2A 1LHCH 2ODYB 1GVZA 4PROA 1MKWH 1GDUA 2A7CA 1SC8U 4SGBE 5FAHA 1BHXB 1Z1JA 1GL0E 2QF5A 2ALPA 2IPHA 4NSVA 2QF0A 3VXFH 3OFND 5JYIA 2VVCA 1YPMH 2J4IA 3ZZ7A 1IQIA 2ZGBH 4I8GA 1GHVH 2EEKA 3M5NA 1RFNA 4NZQA 2FLRH 3TVJB 1Z6EA 1HDTH 3GY5A 1C2EA 1YCPH 1A46H 3VB7A 4AFSA 1UVOA 1KYNA 1CGIE 2B8OH 2ZTYA 1KDQA 4X0WU 2BLOA 1P06A 1P2NA 1AB9B 4NIYA 2O8UA 2J98B 3QUMP 3IITA 5FPTA 1GHWH 5FX6A 2O8WA 5HM2A 1SQRA 1EPTB 1HAYB 1EAIA 1DWBH 3RXCA 3L33A 2A7JA 1S82A 1THSH 5EG4A 1LQDB 2FTMA 2QYIA 4UD9H 4X8VH 1G30B 3O8RA 4R8TB 3TGIE 1EATA 4UFFH 1DOJA 1ZPBA 1MBMA 1ZTLA 3ITIA 3EE0B 1E1QD 5HIZA 4BTTB 1O0DH 1BTZA 2ULLA 1TOCB 1K0HA 1DSUA 1PQ7A 4MNYA 5A09A 1QB6A 2Y80A 1P0SH 2HNTF 1O35A 1XMNB 1CVWH 5F03A 4Y7BA 1IQKA 3GY2A 2A2XH 1N8OB 2VIQA 1IQNA 2SFAA 1TNIA 4ZKRU 1YPGH 4F55A 2FI3E 4ISLA 1GI2A 2SGPE 1GPZA 3BTQE 1GBEA 2FIRH 1AUJA 2A5IA 5J4SA 2NU1E 3MMGA 1C2JA 3LGWA 4ABEA 1DFPA 5EGMA 3U98H 2PTNA 3M61U 1BMFD 2KM0A 2VGCB 4DIIH 1O2OA 1ZJKA 5CMXH 2ZHQH 4JK5A 1HJ8A 1O2UA 5C20A 1OS8A 5LGOA 3SO3A 4D9QA 2KAIB 4OS7A 2GX4A 1Y3UA 4KGAA 2PGQB 1TYNA 1VITF 4WY3A 1W0YH 1BTYA 1YP9A 5G4BA 3VG8A 1EASA 1OYTH 2VINA 3F2FA 3BG8A 4Q7YA 4YO9A 3MU5A 1O2XA 1V2LT 1IQGA 2TGTA 3KIDU 4ZKSU 1ZHRA 2BXTH 1C5MD 1K28D 2ANMH 1OX1A 1BRBE 5GPIB 4ZXXH 4D7GA 2EI6A 4Z0KA 5EU8A 1YPHC 2CN0H 2GD4B 1TE0A 1BTPA 3AVZA 1RTFB 3DT0H 3E6PH 1G3BA 4A6LA 4FXGH 2WV5A 1DXWA 1UJ1A 1ZMJA 3SJKA 2HLDD 4MPUA 4A7IB 4AORA 1UTMA 3LGYA 3F1SB 1O3BA 4TSFD 5FBIA 3KQBA 3ZVBA 1AY6H 2PKAB 2YMSC 5C0TA 2LPRA 4NWKA 5A0AE 2AEIH 3SNCA 2O8LA 1UHBB 4CRBA 4NZLA 4ZHMU 3UNQA 2HVYB 2KR7A 1HJ9A 4BANB 1A3EH 4TY6A 1GBTA 2GV6A 4CHAC 4MDSA 1HYLA 1QFKH 4UFDH 2EI8A 3GCTG 4RKOB 1ETSH 1XUFA 1BBRE 5HIYA 3SHAH 1C4V2 4BTUB 3Q3KA 4B2CA 1W7XH 4O3UA 2QXHA 2VIVA 3U9AH 2UUKB 4D7FA 1TPOA 1SHYA 1N6YA 2CXVA 5T1VA 1MKWK 3M3VA 2CHAB 3RC6A 1EZSC 3BEIB 1TNKA 1F7ZA 3PMHB 4U01A 4ISIH 1SGCA 2BY8X 1GJCB 1PYTC 1HAGE 1Z7KA 4XOJA 1P10A 4X2WA 1G3CA 1HGTH 2ZHDA 4JMYA 2ZPQA 4GLYA 1O2VA 3A82A 1TMTH 1MQ5A 4KELA 2VIWA 4WWYA 5DP3A 5PTPA 5ETXA 3PB1E 1E34B 2VVUA 1EFRD 1JIMA 2P8OC 3STJA 5IK2D 1F92A 3RMNH 2W7SA 1MTWA 1ZGIA 1W11U 1YCPK 1QNJA 2D1JA 1P03A 1NU7B 5FX5A 3ZYDA 3BV9B 1ZR0A 3PTBA 1FIWA 1KLJH 3GS9A 3W95A 1VKYA 2Z3CA 2STBE 3N99A 3M7QA 2SGDE 3FO8D 1QCPA 1D6RA 2BLQA 2ZEBA 1UCYH 1FPCH 3TJOA 3V13A 1C4Y2 3RXOA 1F5RA 1GCDA 2B7DH 1F2SE 1XUJA 2XOKD 3N7DA 4WXVA 1PPBH 2PHBA 3F68H 1CT4E 5C1XA 2OK5A 1BBRH 5DP9A 3I77A 2QE7D 2FTLE 1SGPE 2ZNKH 2W26A 3RM0H 4ZHLU 1TX6A 1CQQA 1NESE 1W0ZU 1THRH 3ZV8A 4FU9A 2Y7XA 5A0BA 1J9CH 1A0JA 2F9BH 2ZFPH 2G5NA 3ATWA 1TFXA 3M7UA 1MTSA 1GMDG 1QHRB 1O2KA 2B0FA 2VIDA 2Z9JA 4FUJA 4I8JA 2ESTE 4A1TA 5C3NA 1BA8B 3GICB 4RSPA 3NPSA 1NRSH 4JYTA 4DT7B 5C0UA 2BVSH 1UK4A 2RCEA 5F8XA 5EPYA 3ZVFA 1HAHH 1Z1IA 1Y3YA 4AX9H 1RS0A 1AWHB 1HIAA 4B73A 4NCYA 2OC7A 1C9PA 1GI1A 4IMQA 1P04A 2A7HA 1ZSJA 1V3XA 1ELEE 4LOYH 4YESB 4UDWH 2NWNA 3PRBA 2V7QD 3U1IB 1W7GH 3T5FH 5F6MA 1TNLA 1VJ9U 2CJIA 4IN2A 1Q3XA 1T8LA 2ZCKP 2AMDA 1TOMH 1O33A 4Y79A 1MD7A 1GHAG 3JZ1B 4MG3A 5ESTE 3U8RH 2FMJA 3GYMA 3AASA 3TIUA 1QZ8A 2HOBA 4Y0ZE 1C5ZB 4ESTE 5EW1H 1UTOA 5EQRA 1DWEH 2PSXA 3TJNA 3KYFA 1YBWA 3A85A 1MZAA 2YMSB 1W12U 1N1LA 3RXSA 1Y3VA 3PROA 4AGJA 2D26C 1O5EH 1UTJA 4WMFA 3UNRA 3SZEA 5DO4H 1TPPA 5EOKA 1JIRA 1ARBA 2ZTZA 2IPQX 2RA3A 4CRGA 2H9TH 3FVFB 5E2PA 1BJUA 2Q6DA 3N7OA 3SBKA 1LVMA 2A4OA 3UWJH 3MNSA 3HGNA 1BQYA 4ISOA 4Y7AA 4X6PA 3UB0A 1EZUC 4AYVB 1ZJDA 1O2ZA 4JYVH 1YCPM 4CRDA 1C1UH 2ZKSA 4A5TS 2TPIZ 4GVUA 4P02A 1O2GH 1V2ST 5KEDA 1SLVB 2AFQB 4NA8A 3UOUA 5HYOA 1TIOA 4DG4A 2TGDA 3V0XA 1LMWB 2H9HA 1QGFA 1GI0A 4UONA 3CNRA 1GBMA 1VCPA 2VIOA 4H6SB 7LPRA 2WV4A 2WUBA 3ATKA 1SL3A 1O3FA 1TRNA 2R0LA 4GAWA 5EXMA 2P8OB 4XRNA 1FXYA 2F9OA 4E05H 3A87A 3KEEA 1V2UT 1HAPH 2Y81A 5T6DA 3BTKE 1V6DA 3UQVA 1AU8A 4DT4A 1AFEH 4DOQA 8ESTE 1S6HA 1AGJA 1WBGB 1C2FA 3KN2A 2YMSD 1BMAA 1PQAA 1BRUP 2FYQA 4O97A 3MTYA 2Q6FA 4K1SA 1OXGA 1O3DA 3RXJA 2OC8A 3VGCC 1S0QA 3WW7A 1TGNA 1J16A 1LVOA 2RA0A 3QO6A 3LKWA 3W1EA 4UFGH 4OS2A 3ZZ9A 5ESBA 3SU6A 3FOAA 4NA7A 4XDEA 1EPTC 3MNCA 3SOSA 1TBRH 3VB5A 1UCYK 3GCHC 2XC0A 1W10U 3UY9A 1TPSA 2AHME 2H6MA 1HLTH 1O3AA 2OINA 2IJOB 1LHFH 2BDHA 2AIQA 3AAUA 3MH6A 1GHBF 2A5KA 1PYTD 3PO1C 1SGDE 1PPGE 2FEQH 3FZDA 1BBRK 3SGQE 4D76A 1W0JD 1BTWA 1QRXA 1P2QA 5HM9A 2QA9E 1RRKA 2SNVA 1BTUA 1LQEA 1S5SA 2OBOA 2DUCA 3MOCA 1DLEA 4CR9A 1AHTH 2BD4A 1XM1A 3E16B 1C5LH 3ATIA 3GCTF 4AFZA 3UREA 2V3MA 3PWBA 4K2YA 1IQJA 1K1IA 3M37A 3PMBB 1OWHA 1D4PB 1TAWA 3BIUH 1SKYE 1Y5UT 2BY9X 1EXFA 4K5ZA 3BIVH 5E0JA 2HWLB 3EA8A 2ZDVH 2RDLA 2ZU2A 1K9OE 1KDQB 3GDSA 3PMJA 3DSOA 5A8XA 3DFJA 1F5KU 1NU9A 4O3TA 5T6FA 3FKSD 2CK3D 1CA0C 1FAKH 5FCRA 5IYTA 2VNTA 3MQKC 3SQEE 3A8BA 3MH4A 1XUHA 3GCNA 4X1NU 1O3EA 2TBSA 1QBVH 1BITA 2ANYA 3UWIA 2K8IA 1P9UA 1NT1A 4OS1A 2TRMA 2G8TA 3C27B 3RXUA 4KTSA 1MH0A 2IN2A 4Y10E 1K1JA 3OY5U 2GV7A 4MNVA 2ZHEH 1HAVA 2YNAA 1Z8GA 2FS8A 5C2ZA 3SNEA 1KXDA 2C8WB 5FPSA 2A31A 2SGAA 4IGDA 3LJJA 4RI0A 4FUGA 3QN7A 2VWMA 5C94A 1IQHA 2FDAA 2ZCHP 3T25A 3TK6A 3PTNA 3BTEE 1CSOE 3ELAH 4ABIA 2ZA5A 1AI8H 1SMFE 1AWFH 1KTSB 2BZ6H 2BD7A 4KP0A 1HNEE 2KX4A 4MPXA 4NFEA 3RXFA 1SGRE 1S6FA 4Z6AH 4THNH 4GHTA 3KCGH 3MHWU 3RMMH 2AGIX 4WMDA 1W0KD 2JJ2D 3RXKA 1SGFA 3SW2B 4DURA 3Q77A 4X1RU 1VCWA 3ZZ3A 2HNTC 4I8KA 1LPKB 1NFXA 1L1JA 3FP6E 4BXSA 4FUFA 1YY3A 2O9QA 3ZYEA 4IW4E 1T8MA 1EUFA 2WYGA 3SNAA 5GDSH 1TPAE 4IN1A 1WUNH 2NU0E 1GBBA 1KSNA 1AVXA 1G9IE 1GMDF 1BOQA 4Y6DA 1WDIA 1ESAA 2NU2E 1AUTC 2ZDLA 4B6FA 1ZRBA 2ZWLH 1DPOA 2GTBA 3E91A 3FN8A 4MNWA 5CE1A 4FU8A 1ABIH 2ZFTA 3B9FH 2XWBI 1AVGH 2F4LA 1MTVA 1MTNC 2FLBH 3AW1A 1S83A 1V2MT 1ZGVA 1EQ9A 1NBMD 1FPHH 4I86A 3A7YA 3ZVDA 5E8EH 1NFYA 1F5LA 2C90B 1A1RA 2CHAC 3VGCB 3WWBA 3RDZA 2QXGA 1ANBA 1K22H 2UWOA 2VH6A 2FPZA 1SGQE 1Y5AT 4KKDA 1K1MA 1GJ4H 2PV9B 1E35B 2XBWA 5JPMH 1WTHD 1DICA 1OYQA 2QGRA 3L6PA 3V7TA 2PWXA 1EAUA 3DHKH 1XX9A 1GHAF 1A5GH 4ASHA 1DUEA 1J17T 2BZAA 1P3CA 5LH8A 1AKSA 1SGFG 3GCHB 1FY4A 2F9VA 4ABBA 5EW2H 3OTPA 2D2DA 3RXTA 1SOTA 2EI7A 2Z3DA 4MTBA 3PO1B 4M7GA 3E3TA 4J1YA 2R9PA 3LOXA 1QQUA 1DS2E 1ZHMA 2C93B 2HGTH 1UTKA 2A45B 1KXEA 2ZU5A 3R0FA 1QA0A 4ZHAA 1C2MA 6CHAC 2BD3A 3EAJA 1LO6A 2ZCLP 2R3YA 5L2ZH 3BG4C 1O2SA 2G52A 1Y3WA 2XC4A 1Y8TA 1BMLA 1TGCA 4ASUD 5L6NH 3LC5A 1O3LA 2BDGA 3SU5A 1TA6A 2J92A 5AF9H 3HGPA 1S84A 4P00A 1AVWA 3GCOA 2H2ZA 2VVVA 3TGKE 1IQEA 1CA0B 1V2VT 2HPPH 1NM6A 1DITH 4XFQA 4OGXA 4VGCB 5J4QA 4ZCNA 9ESTA 5GXPA 1XVMA 4FUBA 2AGEX 1W13U 5C5OA 4DJZB 3TJVA 1WTGH 3SJIA 1O3IA 1QJ6B 4CBOA 1O3MA 3ATMA 3P8NA 1C1VH 3PM3A 5GJ4B 1QY6A 1NZQH 1QA7A 2UWLA 2FYRA 4AOQA 1MUEB 1O3KA 1EOLA 2NU4E 1O2YA 1GJ8B 1JBUH 2C8XB 2GJGA 1GMHG 5E0GA 3RXHA 2ALVA 5DP5A 3RXBA 3MI4A 3HATH 1UTLM 2Y5FA 4DIHH 1TALA 1EZQA 1EP5A 1BCUH 1B0EA 2OP9A 3TLOA 3KHVA 4BNRA 1NPMA 2OQUA 2BOKA 4NIXA 1YKTA 4K8BA 1GWAA 3QGNB 4FETA 1IHSH 3F9GA 2Z7FE 3PWCA 3ZZ6A 3L3TA 4QT8C 1Z8JB 7KMEH 1RJXB 3SI4H 3LT3A 3S7KB 1P05A 4OS6A 1EZXC 3VB4A 1FY3A 1SQOA 1ELFA 3UPEA 3V3MA 1AZZA 2GVFA 1MD8A 3ZZCA 3RC5A 3CS7A 3O8CA 1BDAA 3Q00A 1V2PT 2XCFA 3ZVEA 1O2IA 3PRDA 3FFGA 4YT6H 2WZQA 2PFEA 1DE7H 1QRZA 1H9IE 1S81A 3MU4A 2GGVB 2NU3E 3LU9B 2WPHS 2TGAA 1NC6A 2BDAA 2BDYA 4ZH8A 2WINI 5EPNA 1SLXB 1F0RA 2BTCE 1TBZH 4NIWA 1GHZA 1DWCH 3T27A 3A8CA 2R2WU 3MO3A 5DJ7A 5A2MH 3RXLA 1TRMA 1HIAB 2UUJB 1C2LA 1FY1A 2ZF0H 4JZEH 1SG8B 3HPTB 3RXAA 1C5WB 3ZZAA 1QR3E 3NRLA 1VJAU 1MTNB 3F2GA 3SUEA 1L4ZA 1IQFA 2H5DA 1TONA 3ZZBA 1F0TA 4BTIB 3EA9A 1K21H 2JH0D 1XKAC 2GMTC 3P8FA 3URDA 4YLQH 1OKXA 2SGEE 5GCHG 2OXSA 3F2HA 1X7AC 4JZDH 1P11E 1YLDA 1G36A 1SB1H 1RTKA 2M2AA 2JETC 5EJZA 2GCTC 2WPJS 5CHAC 1RTLA 3OEED 3VXEH 5SGAE 1CT0E 3KL6A 4ZUHA 1FX0B 5FPYA 1SSXA 2C3SA 4IC6A 1VCQA 3C1KA 2VWNA 5I25A 1CU1A 2JKHA 3VEQB 3DSPA 3HK6B 2BY6X 4AZ2B 4ZKNU 3QTOH 3SYJA 3UR6A 3TK5A 1PPCE 4YZUA 4WH8A 1C1RA 4K60A 1OWIA 1AE8H 1QL7A 1ZTKA 4TPYA 1OPHB 3NXPA 3UFAA 1RXPA 2Q6GA 2WYJA 3MYWA 1G2LA 1TNHA 1Z8IB 3FP8E 3KQEA 5JBBS 2F91A 3SNBA 4D8NA 1IQMA 1HFDA 1O2RA 2OD3B 2QXIA 3SU0A 6CHAB 3IWMA 1C5SA 3MU0A 1GBLA 1E38B 1AIXH 3A86A 1BTXA 2ODQA 3BG4B 3F0OA 1TGTA 1A3BH 1HPGA 1Z71A 1RIWC 1HCGA 2TIOA 1HAZB 2FXRA 1Q31A 4ISNA 1K1OA 3VPKA 2C8YB 5JB8S 1PJPA 1VZQH 1G32B 1P09A 1B7XB 1C1QA 2GT8A 3GY3A 1DSTA 3DUXH 1HRTH 1FN6A 3A8AA 4RT1A 4XBBA 2VBCA 4IC5A 1W14U 3AW0A 3Q3YA 1TBQH 4LZ1H 2P3TB 2HPQH 1GI5A 5H4IB 1EAXA 1FNIA 1LKBA 4TWYA 4AB8A 1ELBA 2VH0A 4AGKA 2ZG0H 2B9LA 1EB2A 1F0UA 1WAYB 2BYAX 3RLYH 3SQHE 5DKMA 1Y59T 1P3EA 4Y8YA 5JBCS 1P57B 1G3EA
chains in the Genus database with same CATH topology
3PLKA 3K2UA 4TPIZ 3O8BA 1WQVH 2A5AA 3S0NA 3LH3A 3LGTA 1J8AA 2Q1JA 5L30H 1B5GH 3QGJA 1D3PB 2Z9IA 2FI4E 2ZECA 2PR3A 3ZZ4A 5E0HA 4ABGA 2FOBA 3G01A 3SJOA 2EA3A 2DE8A 4XBCA 3RXGA 1LPZB 1EJNA 2FX6A 4GSOA 4Y8XA 1XUGA 3P95A 3P92A 1D3QB 3K9XB 3M35A 1C5NH 3TITA 1GJ9B 1PPFE 5AFYH 1DUAA 1V2WT 3M3SA 1NO9H 1O2PA 4YTAA 4GPGA 2BLVA 2G00A 3FANA 2ZIQH 4R0IA 4CRCA 1DX5M 1AMHA 4YOIA 1C1OA 4Q7ZA 1ZMLA 1A5IA 3GDUA 3ODDA 5BPEA 1CHOG 3R3GB 3U8TH 3BSQA 1P02A 4I32A 2BVRH 1KTTB 2XBYA 1DT2A 1QJ7B 1UTQA 1GVKB 4K3JA 2G81E 2RG3A 2R0KA 1QBOA 1ORFA 1TX7A 1P8VC 2AMPA 3KGPA 1TNJA 3OTJE 1PQ5A 3GY8A 4H42U 2VWOA 3P70B 1KLTA 2VB0A 3CS0A 1ESTA 3TK9A 1SR5C 2ZGCA 1AD8H 1FY8E 3URCA 4BAQB 2Z6BD 3A88A 1OP8A 2GMTB 1O2QA 4YOGA 2Z9LA 5EXLA 1G3DA 2FOGA 3UQOA 1O30A 2P3FH 2A2QH 1PQ8A 2JETB 3U8OH 2GCTB 3ZV9A 2SGQE 5CHAB 2Y5HA 5F8ZA 1XXFA 2ZFRH 3LDXH 1HAVB 1SQTA 1TX8A 2QF3A 2I6SA 2LNCA 1YPKH 5EQSA 2CMYA 3SNDA 1O2WA 1D9IA 1T7CA 2O8MA 3LGVA 3A7VA 1GBDA 2GP9B 1Q2WA 5K0HA 2V6NA 4INKA 1N6XA 1FN8A 1GCTC 3E8LA 3BTFE 4JYUH 1YPLH 2J94A 1GMHF 3PV4A 2QN5T 4BAOB 1QJ1B 4K8YA 4H6TA 4YT7H 1MU6B 1HXFH 2UWPA 4WVPE 1ELGA 1RIWB 4GUXA 4I7YH 1AZ8A 4AYYB 2CF9H 1WOFA 1WQSA 1J14A 3RXIA 2XBXA 1TRYA 4TY7A 3A80A 2H5CA 2FWWA 4NIVA 3MWIU 5C1UA 1ZPZA 1E0FD 4FUCA 1C4U2 4Y76A 4HGCA 5AVDA 5TCAA 1YPHE 1YM0A 1UTNA 1TGBA 2AMQA 3PYHA 1XXDA 1BJVA 3QZQA 4X1SU 1TABE 1UVSH 3UUZA 1C5UA 1S0RA 1KXFA 4X2YA 2H1UA 2OBQA 2ZI2H 1W2KH 1KXAA 4DVAU 4NA9H 4Q7XA 4RKJB 4MNXA 4E7RG 3Q76A 3LIWA 5AHGH 2G51A 2Y5GA 5GIBA 3A84A 1MTUA 2AYWA 3FP7E 1NFWA 2TGPZ 1A0HB 1ELAA 4AG1A 2ZDAH 4X6OA 4UE7H 2PKSC 4BXWA 2GDDA 3RXMA 4LXBH 1FIZA 3B8JA 4K69A 1TGSZ 1Z6JH 2WPLS 2A0QB 1NROH 1C1PA 1LDTT 4MPVA 4WMEA 3P17H 3T2NA 3GY7A 2DE9A 2C8ZB 2Z3EA 1YF4A 1A7SA 1PPZA 1JRSA 1FAXA 4FUEA 1MCTA 1GVLA 1EKBB 4ABFA 3QK1A 1SBWA 4ZKOU 1AKSB 1T31A 5GCHF 2BX4A 1HAIH 1UK3A 4VGCC 3MO9A 4LZ4B 2A4QA 7GCHG 5DP8A 2XBVA 2XTTB 3RXDA 3UTUH 4ZROA 4J2YB 4X8UH 1V2NT 1QL8A 4FVBA 5T6GA 2J95A 3SU1A 3T28A 5ABWA 1YC0A 4FU7A 1IOEA 4HTCH 3CENA 3SGBE 1SLWB 4NG9H 3D65E 3SV9A 1IAUA 1C5VA 1UVTH 3A7WA 2A32A 1ARCA 2M5TA 1V2RT 1AQ7A 2FM2A 1C5RA 3SUGA 4H4FA 1BT7A 3KF2A 3HKJB 1THPB 1O31A 1T4VH 1EAWA 2AH4X 3QX5H 2ZDNA 2STAE 2BVXH 3RXQA 3P6ZB 2CF8H 3E0PB 2BQ6B 4O03A 4BAHB 2R3UA 1ESBA 1O5GH 2PLXA 1Z8RA 3OY6U 1AFQB 3SGAE 1SLUB 3M5MA 2OC1A 5HMAA 5DPAA 2BDBA 1DLKB 2UUYA 3M5OA 1O3PB 5A0CA 3A7ZA 2VIPA 5BRRE 4Q2KA 3W94A 1ANDA 1C1WH 5F8TA 3M36A 1LCYA 4LK4A 4Y71A 3ATLA 1H8DH 2IOTA 3F6UH 3SUFA 2ZFFH 1PPEE 1P2OA 4Q80A 3NK8A 2ZFQH 2BM2A 1VR1H 2FX4A 6ESTA 2F3CE 3RU4E 1GCTB 1MQ6A 2BQWB 3H7OA 2GZ7A 4E06H 4JZIA 9LPRA 1LVYA 3GY4A 1H4WA 2F83A 2FOMB 1EJMA 4GCHG 4HFPB 1CBWB 3EYDA 4BOHA 3DD2H 2ZGJA 1FUJA 2G4TA 3BTME 1ETRH 1ZLRA 3OSYA 4JK6A 2ZTXA 2GDEH 2BQ7B 3SJ8A 1NRPH 1H1BA 3TH2H 1C5YB 3T29A 4JZ1A 2ZFSA 4OS4A 1O37A 5LPFA 1GGDC 1C5QA 1GJBB 2VJ1A 4YOJA 1NS3A 3SHCH 1ZSKA 4HI3A 1DDJA 1T8OA 1CGJE 1MZDA 2Z9GA 2BXUH 1ELDE 8LPRA 3GYLB 2WUCA 1CHGA 1SGTA 3A7XA 3SN8A 1K1LA 4AN7A 3EA7A 3B23B 1DVAH 1HUTH 2V0BA 1ELTA 3E1XB 3V12A 2OQ5A 1CHOF 2P3UB 4AFQA 4UFEH 3ODFA 4ZAEA 1ACBE 1HB0B 4I8HA 1T32A 2PKSB 3NKKA 1ZZZA 2ZU3A 3QWCH 1SI5H 3NUMA 3UR9A 1GDNA 2G55A 1L1GA 2BD9A 1S85A 3SU4A 2ZPRA 7ESTE 1NRQH 1QRWA 4A92A 1HJAB 1QTFA 4BAMB 2ANKH 3A81A 1O3NA 1QQ4A 5HXFA 1K1PA 2W3KA 1NRRH 1TWXB 1DM4B 3ZZ8A 1JOUB 3QTVH 1L1NA 2Z94A 3ENSB 3D49H 1QURH 1WSSH 4DY7B 1MCVA 3FAOA 4JZFH 5TCCA 3TNTA 1H9HE 1O36A 2QCYA 3ZVAA 3LH1A 2THFB 3QLPH 8GCHG 3VFEA 1VGCC 4X8TH 2Z9KA 1GMCG 1AO5A 3SV6A 1BRAA 3TH3H 3OU0A 3TGJE 2OCVB 1GJAB 4Y0YE 3SV2H 2F9NA 3P8GA 4AFUA 3UNSA 4FVDA 2PTCE 3PLBA 5EQQA 2HALA 3T26A 3CP7A 4KTCA 1FZZA 2PUQH 2P59A 1FI8A 1SGIB 5JBAS 4U2WA 3F9HA 3RUOA 3UOPA 1V2KT 3SV8A 1KY9A 5I46H 2BY5X 1O2NA 1WV7H 3ZZ5A 1OWEA 1FMGA 1GG6C 2QAAA 3BTWE 3NZIA 5DK1A 1FJSA 2XCNA 4X1QU 1INCA 2SNWA 3LGUA 3GDVA 1GHXH 5C5NA 4B74A 4IBLH 2XW9A 4X6MA 1XKBC 1MKXH 1GBCA 4ISHH 1C2GA 3BN9A 1ELVA 1V2OT 3QZRA 4INLA 2O8TA 1C1MA 3VB6A 1BTHH 2CGAA 3BEFB 1Y3XA 2J34A 3RU4T 2FOHA 1O5DH 1QIXB 4DW2U 2PW8H 2W7UA 3LC3A 4X2XA 1GI3A 2BB4A 1BUIA 1GHBG 2P94A 1EPTA 1TMUH 3RXPA 2VU8E 3MFJA 3JZ2B 1YGCH 1F0SA 1O34A 1A5HA 3ZVGA 5JDUB 1UCYE 2J9NA 1C5PA 2WPIS 4MVNA 1L0ZA 2AIPA 4XBDA 3A7TA 4CBNA 1C2DA 4FUIA 1C5XB 1A0LA 1O2JA 5C67A 1FONA 2ZGHA 1GJ7B 1LHGH 1XUIA 2QIQA 2BDCA 2ZGXH 2V35A 1B0FA 1EX3A 1BB0B 2JH5D 2GCHG 1GGDB 2FS9A 1C5TA 1RGQA 3MH7A 2BD8A 2BHGA 4B75A 1UVUH 1BMNH 7GCHF 4SGAE 4Y11E 4DGJA 2W3IA 1ELCA 2BD5A 4B1TA 2FP7B 3K6ZA 1YYY1 4ABDA 1SHHB 2QY0B 4CRFA 5FCKA 3TU7H 1A2CH 1O2HA 6LPRA 1GDQA 1C2HA 2YOLA 1XVOA 2A4GA 3SU2A 3M7TA 1BRCE 1EB1H 2HVXA 3SI3H 4MQAA 3D23A 2G4UA 2QV1A 1SPJA 2BDIA 2KAIA 4HZHA 1O2TA 2A1DB 5TJXA 1GBAA 3D62A 4A1XA 5EODA 1GHYH 1D3TB 1BMMH 1AE5A 3K6YA 3S9BA 2HNTE 4MPWA 3OX7U 2P95A 3DA9B 1GI6A 3MO6A 1TQ0B 2V3HH 5FHTA 4F4OC 1VGCB 2HRVA 3RXRA 3I78A 2ANWA 6GCHG 4IMZA 1O39A 1AN1E 2PGBB 1SOZA 1TLDA 1C5OH 1MBQA 1HAXB 3S69A 1SGEE 2F9UA 2GZ9A 1P2JA 3E90B 3QDZB 4X6NA 1GJDB 2UUFB 2ZQ2A 3PLPA 1T4UH 5C1YA 4WH6A 3MNBA 3M3TA 1KIGH 2D8WA 3BEUA 2PKAA 4KTUA 4CR5A 1PFXC 1K2I1 1J15A 1EP6A 2WPKS 1UHBA 1CT2E 3OYPA 2ZZUH 4WF8A 3TH4H 4GHQA 4Y8ZA 1SFIA 5FXLA 4CREA 1ANCA 1GI7B 5JBTA 2QXJA 4GCHF 3RXEA 3TJUA 1L2EA 4TWWA 5T3HA 4OS5A 1GG6B 1U6QA 3TPIZ 1Y5BT 4B71A 2VWLA 3U69H 1H8IH 1ZOMA 1O5FH 4WXIA 2HLCA 3S9AA 3BF6H 2BD2A 5DG6A 1NY22 4ZMAH 1C1SA 1O32A 1E37B 1HXEH 2FOCA 5K7RA 1P01A 1DY9A 2AS9A 1O3HA 1SGYE 1FY5A 1M9UA 2K1QA 4ABHA 3SZNA 1LTOA 2BOHB 5GWZA 3WY8A 1P12E 1D3DB 4MLFB 1GI4A 1K1NA 2BY7X 2FI5E 2ILNA 2G5VA 1G2MA 1QB9A 3F9FA 4O9VA 5A8YA 2ASUB 1GBKA 2ZU1A 4JCNA 1UK2A 1RD3B 1MKXK 1GBJA 4NSYA 2FESH 4YM9A 2GT7A 1SVPA 1V2JT 3IG6B 3HKIB 3RLWH 4CHAB 1O5CB 2ZDMA 1G37A 1E36B 3RP2A 1OSSA 3VB3A 1UO6A 2H9EH 5FBEA 1HAOH 2XNIA 2FOFA 1AFQC 2XXLA 1HV7A 2Y7ZA 1MMJN 4E7NA 1OWDA 1UMAH 3RM2H 2EC9H 1FLEE 1YPEH 1ZYOA 3AAVA 1QL9A 2AERH 3HK3B 1OP2A 2ZQ1A 3MU8A 4NFFA 4U32A 3SU3A 1YPJH 3NCLA 1GI8B 2AGGX 5LPRA 1CE5A 4X8SH 3MU1A 2OUAA 3LONA 4NWLA 3EGKH 1GBHA 1QBNA 2XRCA 1NN6A 8GCHF 3MNXA 1TMBH 1GMCF 1WU1A 1GJ6A 1TB6H 1LPGB 1PPHE 1VITH 1NFUA 1BIOA 1V2TT 5E2OA 1DANH 1JWTA 1H9LB 1O38A 3RXVA 1CO7E 2BLWA 1ZSLA 1MAYA 4FUHA 2C4FH 2I6QA 4B2BA 1DWDH 1CBWC 1UTPA 4I8LA 3TNSA 4I33A 1OOKB 1BZXE 1VITG 1EJAA 3S9CA 2OC0A 3GY6A 1GL1A 1O2LA 5JB9S 2P16A 1SGNE 3MH5A 1XUKA 4ABJA 8KME2 1A61H 2A4RA 1O3GA 1QB1A 4FUDA 2P93A 4K1EA 1FQ3A 2W5EA 1ZRKA 1OWJA 3RMOH 3SV7A 4CH8B 3RC4A 4D9RA 1AB9C 5EXNA 3F9EA 5DP7A 5B6OA 1C1TA 2F9PA 2ZPSA 3BTDE 1HBTH 3RMLH 1W8BH 4ZXYH 2B5TB 1W3CA 2ZDKA 3O8DA 4BAKB 4A1VA 1DY8A 2ZHFH 1P2MA 1ZPCA 4IS5A 1FDPA 1NRNH 2V3OH 3PMAB 3UIRA 1IHTH 3BTTE 1YLCA 1UVPA 2PUXB 1CA8B 1OP0A 3A83A 4B76A 1SQAA 2WPMS 3K65B 2R2MB 2FOEA 2ZC9H 2ZO3H 1HJAC 3EQ0H 2SGFE 1GI9B 4UEHH 2ODPA 1A4WH 1O2MA 3LJOA 5L2YH 1CGHA 5IDKA 5A8ZA 1ABJH 1KLIH 2CV3A 2FOAA 1P2IA 3BTHE 1C9TA 4OGYA 1DXPA 1OWKA 1N8OC 1KXBA 2YNBA 3LGIA 1JMOH 2Y6TA 4X1PU 2BMGB 2OLGA 1SFQB 3KQDA 5DGJA 4YLUA 3I29A 1BHXF 1IQLA 3H7TA 2GCHF 3LPRA 4K1TA 3SJ9A 2FO9A 2GKVE 1P2KA 1LKAA 3A8DA 4CH2B 3EDXB 4B2AA 1O5BB 1C2KA 5AFZH 1JRTA 1WCZA 3STIA 1L4DA 4WJG2 2FZZA 2VGCC 2ZP0H 3P8OA 1ZTJA 1V2QT 1T8NA 3ZVCA 1ZMNA 2OTVA 1TQ7B 1GBFA 4ABAA 3ESTA 1KXCA 4NGAH 3S7HB 5LPEA 1ETTH 3A89A 2J2UA 1ID5H 2JH6D 3DFLA 1FV9A 3BTGE 2ZU4A 4XSKU 1NTPA 1ANEA 1TNGA 4F49A 4TYDA 2Y82A 3ZZDA 1MU8B 1EOJA 5DP6A 4RN6A 3H5CB 4U30A 1O5AB 2GZ8A 4INHA 3SORA 3SUDA 3NWUA 1MAXA 2XC5A 1LHDH 5HGGA 3RU4D 2PSYA 3E0NB 4CRAA 3Q3XA 1JXPA 4DCDA 4X2VA 3KNXA 2ZHWH 4I31A 4XE4A 1O3CA 1O3OA 2XYAA 1WYKA 1P9SA 3GOVB 3T62A 1LHEH 2J38A 1O3JA 2BX3A 1TA2A 1ZHPA 3KQCA 3U1JB 3FZZA 1C2IA 1GBIA 1D6WA 1LVBA 4AB9A 6GCHF 5DP4A 3GISB 2XWAA 2QC2A 3M5LA 1GJ5H 1C1NA 2FODA 4AG2A 1LHCH 2ODYB 1GVZA 4PROA 1MKWH 1GDUA 2A7CA 1SC8U 4SGBE 5FAHA 1BHXB 1Z1JA 1GL0E 2ALPA 2IPHA 4NSVA 2QF0A 3VXFH 5JYIA 2VVCA 1YPMH 2J4IA 3ZZ7A 1IQIA 2ZGBH 4I8GA 1GHVH 2EEKA 3M5NA 1RFNA 4NZQA 2FLRH 3TVJB 1Z6EA 1HDTH 3GY5A 1C2EA 1YCPH 1A46H 3VB7A 4AFSA 1UVOA 1KYNA 1CGIE