3LGYA

R178a mutant of the degs-deltapdz protease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
213
structure length
179
Chain Sequence
STDETPASYNLAVRRAAPAVVNVYNRLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPGQTITQGIISATFLQTDASINHGNSGGALVNSLGELMGINTLPEGIGFAIPFQLATKIMDKLIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 36
structure length 179
sequence length 213
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgyA02
3MU1A 1QFKH 4UFEH 2LNCA 3RXTA 2G81E 1WTHD 1KLIH 3H5CB 4LK4A 2QF0A 1TONA 4D76A 4E06H 5CHAC 4NA9H 2AIQA 2NU3E 1FDPA 5FBEA 1D6RA 1GJ5H 2HVXA 4E05H 5L30H 4UDWH 2V0BA 2Q6GA 1AFQB 5E0JA 1T7CA 3T5FH 4ABJA 5AF9H 3KQCA 1V2OT 2ZECA 6LPRA 2BY7X 1C1OA 3GY2A 1N1LA 2IOTA 1DM4B 2SGQE 1LQDB 1NM6A 1O2UA 2BOHB 1QURH 3A8CA 2XRCA 1EZSC 1SI5H 3RXVA 4Y76A 3KGPA 4CBOA 2F83A 1PYTD 1A61H 1IAUA 1HRTH 3SU3A 1SSXA 1D9IA 4DVAU 3U8RH 4A1XA 1DXPA 4KTUA 4LZ1H 3DUXH 1A1RA 3E6PH 3RP2A 4X2XA 4WJG2 3RXFA 5L2YH 1LQEA 1P3EA 2R2WU 1FAXA 2Z6BD 3U98H 1WU1A 2ZFSA 4ESTE 2BDGA 3LU9B 4INKA 3O8CA 3T62A 2GZ9A 4O3TA 3BG4C 3RXCA 3F9GA 1KDQB 2C3SA 1L2EA 2BD7A 1BUIA 4Y0ZE 5GJ4B 3A7YA 2Z9IA 3E16B 1TE0A 1TBZH 4YT6H 4BTIB 2O8WA 2BHGA 5TJXA 1TAWA 2P59A 1O2RA 3LGVA 1Z6EA 3FP8E 5DP6A 5K0HA 5GIBA 2GKVE 1TGBA 1ZSJA 1YPGH 3ELAH 3D49H 1WYKA 1GJ6A 2FYRA 3OX7U 1ELBA 4OS6A 3D65E 1C1VH 5A0BA 1TNJA 1N6XA 4KELA 4FUJA 4DW2U 3D23A 2CHAC 4ZKRU 3RXAA 1V2MT 3NWUA 2ZPRA 4WF8A 4YOIA 1VCWA 1FY1A 4ISNA 1G9IE 4K8BA 5DP4A 2HPQH 3RMLH 5F6MA 2TGPZ 1SGFA 2EI6A 1UTKA 1ANBA 2STAE 1L4DA 3EA9A 1T8NA 1DSUA 2G8TA 4OS5A 1BTPA 4FUEA 1Y5BT 4MG3A 4D7FA 2ODPA 1YP9A 1IQJA 1D3DB 1C1SA 1QA0A 3MOCA 4YOGA 9ESTA 1TX6A 3RXJA 3I29A 5K7RA 2GCHG 1LHDH 3SGQE 1MQ5A 3GY3A 2ZFTA 2GCHF 1YCPM 3K6ZA 4XFQA 4A1TA 1BDAA 1C2MA 3BTKE 1JMOH 1FV9A 4GPGA 1ZZZA 1GG6B 3ZZ9A 4O03A 1ZHRA 2XNIA 1AWHB 1TOCB 1DY8A 1QBOA 2PSXA 4FUIA 2BY5X 1MAXA 1EJNA 2C93B 9LPRA 1EZUC 1LHEH 4AGJA 1TABE 4GUXA 3AAVA 1VGCB 3U8TH 1ELGA 5AFYH 2EA3A 2UUFB 5J4SA 1CO7E 1F5RA 3EA7A 3GISB 1K9OE 1V2VT 4BTUB 3LC3A 3MNBA 4DG4A 3ZZDA 3LJJA 2Y6TA 3W95A 1EP6A 4JK6A 2Q1JA 3C1KA 4CRFA 2CJIA 1C1WH 1BJUA 1L1JA 1W7GH 3TH2H 1D3QB 1EB1H 3V13A 4A5TS 1QQUA 1O2NA 4HI3A 3KF2A 5DPAA 3TH4H 2XWBI 1K1PA 4K1EA 1SBWA 2CF8H 1K28D 2GMTC 2GZ8A 4X8TH 3BTME 3QTOH 3SV8A 3F9HA 4ZUHA 1GVLA 1YCPK 3E1XB 4AN7A 2DE9A 4IC6A 2FXRA 3SNCA 1GHWH 1XKBC 1LHGH 3T27A 2AGGX 3RLWH 4D7GA 3VGCC 1KTTB 1MMJN 1G2MA 1YGCH 1CVWH 3A8DA 2BXUH 2RCEA 1BZXE 2TPIZ 3B9FH 7ESTE 2OINA 1C5MD 2Y5GA 3M3SA 1IHSH 2FS9A 3SUGA 1LVOA 2BDIA 2GV6A 1F7ZA 4XBDA 2PHBA 1JWTA 2ALPA 2XBVA 5AVDA 3SV2H 3BTEE 1UK3A 1DUEA 1OYTH 1NFYA 4BAHB 1GBKA 5SGAE 1E36B 1GHBG 2A7JA 1GBFA 4E7NA 5L6NH 3P8OA 5JB8S 4ZXYH 1GHBF 1UCYK 2OP9A 4I33A 1GJDB 3O8DA 4OS4A 3A85A 4Y71A 3SJOA 4K1SA 3K6YA 1Z8IB 2D2DA 1P01A 4NWLA 4I8HA 2A45B 3PO1B 1Q3XA 1UO6A 2BD9A 2GZ7A 5E8EH 3M7UA 3NUMA 3PM3A 4Y8ZA 3SGAE 4X8SH 1ACBE 2R2MB 1EKBB 3S7HB 2ZQ1A 1TNLA 1QTFA 4FVBA 2OC7A 2TBSA 1GCDA 2O8LA 1XKAC 1THSH 4I8JA 3HGPA 1TOMH 3BTWE 2QXHA 1B0FA 1O5GH 1C1NA 4A7IB 1C5NH 2BD4A 4O3UA 1DWCH 4X1SU 1FIWA 4IW4E 6CHAC 2NU2E 1GI6A 5DP8A 2FMJA 1O3FA 2ZNKH 1WOFA 2GDDA 1ELTA 1PQ5A 1SVPA 2VVVA 1YPLH 1UTOA 5DG6A 2WPIS 4MNYA 1BOQA 3IWMA 1YLCA 3BEUA 1SGDE 3SUFA 4X2VA 3BEIB 1C9TA 3RM0H 1AB9C 1LKAA 3SNAA 4BANB 2Y81A 1SG8B 1OWJA 4MPUA 4NA8A 1EZQA 2A0QB 1O39A 1NROH 1F0UA 2W3IA 2ZHWH 1SGFG 2FI5E 4FU8A 1W3CA 1X7AC 2G5NA 1EASA 1GJ7B 2ZCKP 3SU2A 4DOQA 1GBJA 1U6QA 1C2HA 4IC5A 1KIGH 2FDAA 1TB6H 2Y82A 1DITH 1CA8B 2A5AA 2UUYA 2J2UA 1ZPZA 2BLVA 1O3EA 3M35A 1EB2A 4NFFA 4CBNA 1BRUP 5BPEA 2SFAA 2GX4A 1HAVA 2QN5T 1NESE 1HUTH 1K22H 2BVXH 3SU0A 4IBLH 2FOBA 4NZLA 1AI8H 1O3MA 4AFSA 2ZO3H 2F9NA 2XCNA 2VIVA 4MQAA 4JZ1A 3RXEA 1KXBA 3LGIA 4H42U 2TIOA 3D62A 3RXRA 1BHXB 1MCVA 3GICB 2TRMA 3GCHC 4NWKA 1QR3E 2WPJS 2WYJA 4CHAC 1FLEE 2NU1E 5DP5A 3DT0H 3GDVA 2HWLB 4CR5A 3TVJB 1YPHE 4THNH 3U1JB 3SW2B 3UUZA 3TH3H 3H7TA 2TGAA 5EODA 1W7XH 1MKXK 1ELEE 3GY5A 3HKIB 1G3BA 2HNTE 1C9PA 3C27B 4Y0YE 1FY8E 1IQNA 1P0SH 4SGBE 4CRCA 2OUAA 2QA9E 4INHA 4Y11E 1QBNA 1AHTH 1AKSA 1O30A 1DSTA 1M9UA 4IGDA 3MMGA 3M61U 1BA8B 3QO6A 3LONA 3R3GB 2A2XH 1TQ0B 3OU0A 4MNVA 4X2WA 1CBWB 4R0IA 4NGAH 1C2JA 1O2KA 2QC2A 4WMFA 3L3TA 2M5TA 2C8ZB 3FVFB 1TBRH 4K5ZA 2F91A 3A81A 2ZDAH 2FOAA 2WPLS 5EXLA 3RDZA 1OX1A 5IYTA 3B8JA 2ZDLA 3EE0B 1YBWA 2LPRA 3E0PB 3RU4E 1SL3A 2JKHA 1GBHA 2AMPA 1ZMLA 2G4UA 2AH4X 3P6ZB 3E8LA 3RXDA 2B9LA 4GSOA 1O2XA 2FI4E 1GI0A 1V3XA 5TCCA 4NZQA 4NIXA 4X8UH 2ZDNA 1DE7H 4OS1A 1QRXA 3AW0A 3KNXA 1MD8A 4Y8YA 3M5MA 4YTAA 2JETC 2FOGA 3RXIA 3RXSA 3RC6A 1HNEE 1NO9H 1UVSH 2EI8A 3RXKA 1TFXA 1TYNA 1P57B 1OKXA 1GBDA 1EZXC 1SPJA 1HDTH 1O2LA 5EPYA 1CU1A 1NU7B 4Y6DA 2OCVB 3P8FA 2FTLE 2H9EH 1P2KA 2KAIB 3R0FA 4IMQA 2GMTB 1S81A 1AN1E 2VWMA 1BCUH 2AERH 4YZUA 4KTCA 4Z0KA 3BTHE 3MU4A 1W0YH 2AIPA 3S9AA 3FP6E 2C90B 3A84A 4B75A 1TX8A 4KP0A 1BBRE 4LXBH 4KGAA 3UQOA 3UNQA 2J34A 4IN1A 2IN2A 1N8OC 4J1YA 3LGTA 1YPHC 6ESTA 1ZHPA 1C5SA 2ZTYA 3HKJB 1C5YB 2PLXA 1O3HA 1OPHB 3UWJH 2ZFPH 1C2KA 4NIYA 1QIXB 2BTCE 1AVWA 3TJVA 3PWCA 1BJVA 2JH0D 2HNTC 1EXFA 2FS8A 1FIZA 1K2I1 1KTSB 2FPZA 1W2KH 5CE1A 2J94A 4D8NA 1ZHMA 1H8DH 1SQOA 3VB4A 1NRPH 2R3UA 3SU4A 1GI2A 3HK3B 3F68H 1ZOMA 1EOJA 1A3EH 2FESH 3F9FA 2G5VA 4CR9A 1AFEH 1O3OA 1H9LB 5LGOA 2AMDA 1ZJKA 4AZ2B 1Z8GA 3VXFH 2FX4A 3ZZAA 1UTQA 3GY8A 1D3TB 2WV5A 2ZHDA 4XBCA 2Z3DA 1G30B 5EW1H 2WV4A 1QJ6B 3K9XB 4DCDA 5DO4H 2BX4A 1FMGA 4QT8C 5C2ZA 1HAXB 2FYQA 4Q80A 5C1UA 1BBRH 1WUNH 1J14A 1QRWA 3PWBA 2BVRH 5FAHA 2W3KA 3SNDA 4AG1A 2V35A 1D3PB 3OYPA 5I25A 1XXFA 2F9PA 5ESBA 2A4QA 2OTVA 1ZR0A 3MNSA 3A89A 8GCHG 1THPB 1UK2A 1C2LA 1C5VA 1P9SA 3FFGA 5LPFA 1TA6A 8GCHF 4MPVA 6CHAB 1O3KA 2W26A 1NY22 1GL1A 1AY6H 2VVCA 5F03A 2STBE 4ZKOU 4TPIZ 5LPEA 1BTUA 2BY6X 2IJOB 7GCHG 1P10A 1BMNH 2ZTZA 2BDCA 3UQVA 1CT0E 3SUEA 3TK5A 1O37A 7GCHF 1S83A 7KMEH 3GCOA 2Q6DA 4J2YB 4Q7YA 2ZU3A 3U8OH 3E3TA 1IQEA 1QY6A 1DWBH 4AOQA 1BTZA 4DURA 1HAPH 1RFNA 2ODYB 2P8OC 2BD5A 1S82A 1WBGB 2NU4E 4NSVA 1C2GA 2WPMS 1SGNE 3RXBA 4B1TA 1P03A 2UWLA 1C5WB 1KXFA 3A7ZA 3SOSA 1RTKA 1IOEA 1BTXA 1GBLA 1VCQA 2SGEE 3DFJA 5T6DA 1O31A 1BMAA 3MFJA 4MNXA 1P04A 1TALA 2DUCA 1TX7A 1V2LT 3SJ8A 1BHXF 1O38A 2QCYA 1ORFA 1KXCA 1V2NT 1GI5A 3ITIA 1O2JA 1C5XB 2QY0B 4YESB 2ZDVH 1ZLRA 1TNIA 4YT7H 4GCHG 3PMBB 1O2QA 3A88A 3M5NA 3V12A 1QL8A 2A5KA 5A8ZA 1YLDA 4GCHF 2OQ5A 1D6WA 1OXGA 3STIA 1Z7KA 2F9OA 4BXSA 2PTNA 4UFDH 1SLWB 3ATKA 2FOCA 4K8YA 2P95A 2PWXA 3GDUA 4NSYA 1ZYOA 2PV9B 1HJ9A 2OC8A 1G3EA 5FPTA 2ZHEH 2BQWB 4Y7BA 2HGTH 1O3NA 3ATLA 1ZRKA 1W14U 1LMWB 2J92A 1ETRH 1ARBA 1ABIH 5ETXA 1SFIA 2BLWA 1LO6A 1S84A 5EQQA 4ZKNU 1ANDA 2FLRH 1TA2A 1N6YA 1OWIA 4X0WU 1Y59T 5E0GA 3RMMH 4X1PU 1AVXA 4JMYA 2ANYA 1QJ7B 2P3UB 1MU6B 2H5CA 3BN9A 1CSOE 1YPKH 1PQAA 3LIWA 1OSSA 1ESTA 3K65B 1T4VH 1TWXB 1O5BB 1RIWB 2ZZUH 3SQHE 3RXGA 3VPKA 3M5OA 4LOYH 5DGJA 4DY7B 1GHYH 1CE5A 4XBBA 1MBMA 2BMGB 3FAOA 1HIAB 5A09A 4HTCH 1O5FH 4JZEH 2GCTB 1ESBA 2EC9H 1C1QA 2VJ1A 3ODDA 1VJAU 2CN0H 4U30A 2ZC9H 3FZZA 3S0NA 2ZPQA 2AMQA 3P70B 1SQTA 3TNSA 5ESTE 1QNJA 1PPZA 1GCTB 2A7CA 4GLYA 3ATWA 2H2ZA 1EAXA 3OTJE 1ELCA 2FM2A 3B23B 4NA7A 2HRVA 1UTJA 3QTVH 3PYHA 4B2BA 1C1UH 4DJZB 3LT3A 1A0LA 2C8WB 3UWIA 3QDZB 3KHVA 3ZZ3A 5DKMA 3SQEE 1MTWA 4DGJA 4MLFB 1MTNC 2FO9A 1DS2E 1Z8JB 1SB1H 1C1MA 1BIOA 2ZWLH 2OC1A 1KYNA 1LVMA 1WV7H 1DANH 2HLCA 4K69A 5ABWA 1GI9B 4FUGA 3ZVEA 2BLQA 1PFXC 3UOUA 2XCFA 4INLA 1SHHB 1Z1JA 5DP3A 2BQ6B 4ZH8A 1TBQH 3QLPH 1GMCG 1P2NA 1F92A 1SR5C 3VXEH 2VU8E 1RD3B 1DLKB 1V2JT 1UVTH 3T25A 1GMCF 1A0HB 3ZZ8A 2RDLA 1GI7B 4MPWA 2PUXB 2TGDA 2ZF0H 1HAOH 3QZRA 1HLTH 1HFDA 2ZIQH 1QHRB 1NPMA 1O3GA 1G3CA 1V2UT 2UWOA 2V3HH 3SGBE 3CS0A 5EOKA 3MH7A 2OLGA 1NRNH 1AWFH 1O2WA 2D26C 2ZGCA 4WXIA 1TPSA 3A7XA 2NU0E 1ZPCA 3ZV9A 1CA0B 1EPTB 2HOBA 1DUAA 2PSYA 3V3MA 2A1DB 2VGCB 5T3HA 1V2ST 3DD2H 2G52A 1UCYE 3DA9B 1OP8A 1SGQE 1O36A 2FZZA 4B73A 2ZGBH 5GXPA 2VIOA 4OS7A 4YM9A 1DLEA 3A8AA 4I8LA 4Z6AH 1KY9A 1NRRH 1NTPA 1SGTA 1BRCE 1MZAA 1A46H 1V2PT 1O2MA 1GGDC 5HGGA 1PPEE 1O34A 4OGYA 1P2MA 2ZPSA 1SGPE 1LTOA 2FX6A 4ZKSU 2FIRH 5JB9S 3SN8A 1CGHA 1TQ7B 4FVDA 4O97A 2O8TA 1NU9A 4ISHH 1QB9A 1MD7A 1BMMH 1L1GA 1S6FA 1O2PA 1DDJA 2EI7A 2GTBA 1MQ6A 1WTGH 4VGCC 3ESTA 2R0LA 3K2UA 1BTYA 1FN6A 4JYTA 3BTGE 2VNTA 1GBIA 3RXUA 1EOLA 4H6SB 1QBVH 4X6MA 4K3JA 1KXEA 2FWWA 1YC0A 2AGIX 1BTWA 5CHAB 2ZU5A 4CRGA 1OOKB 3I78A 1ETTH 3ZVAA 2C8XB 2FTMA 3P95A 3SV7A 1MCTA 3KN2A 3QN7A 3RU4D 3TJOA 1TGSZ 1BRBE 1TPOA 1WQVH 4TY6A 1BTHH 1C2EA 4BTTB 1FPCH 1DWDH 2PR3A 2VINA 2J95A 1GMHG 3PROA 5GWZA 1GMHF 1C5QA 4WMEA 4JYUH 1P2QA 2JH5D 4AX9H 1GDUA 1UHBB 1O2SA 1C4V2 1PYTC 4U32A 2G4TA 1BQYA 5DP9A 2R9PA 5HXFA 1HAVB 1GBAA 4BAKB 1AFQC 3SNEA 3BTTE 1O2IA 3M5LA 3A7VA 1S85A 1A0JA 3L6PA 2ZEBA 4RKJB 3GDSA 2ZG0H 2F3CE 2ZCLP 1C2FA 3LH1A 2ANKH 4Y7AA 3MI4A 3BG4B 4CH8B 3JZ1B 3ZYDA 1BT7A 1AUTC 4AB8A 1P12E 1GI1A 1C4Y2 2VB0A 1GVZA 1B5GH 3ZZBA 1J9CH 1ZMNA 2H5DA 2AS9A 1JIMA 1IQIA 2PKAB 2RA0A 1Y3VA 2VVUA 1AGJA 1GBEA 3NPSA 1D4PB 3QWCH 4I8GA 1QJ1B 3WY8A 3MNXA 3MO9A 5C1XA 1NN6A 5B6OA 4DIIH 1ELDE 1O5AB 1ID5H 1W10U 5LPRA 4ISLA 4ABHA 1OP2A 2ANWA 2CHAB 1ELAA 2ULLA 4CRDA 2ZU4A 3ZYEA 1TGNA 4ISIH 1FJSA 1G36A 5A0AE 1W8BH 2CF9H 2OXSA 1LVBA 3A86A 2BD3A 2A4GA 2VWOA 1VITH 2UWPA 3BTDE 3HATH 4NIVA 1YPJH 3TPIZ 3UREA 1W12U 1GHZA 1GWAA 1ESAA 1HXEH 1THRH 4UFGH 1BRAA 1SGEE 2ZFFH 4NIWA 2CMYA 4ISOA 1O35A 1O33A 1XUKA 4A1VA 3IITA 3KIDU 3QK1A 1GI8B 1HBTH 1YF4A 2GP9B 3TJUA 3BTFE 1A5HA 4FUCA 4X6PA 1RXPA 1YPMH 4NFEA 1CQQA 2ZGXH 2VWNA 3SU5A 4TYDA 1UTPA 3T29A 1MKXH 3HPTB 1ELVA 2VWLA 1EATA 1SGYE 3TGIE 3P8GA 1AVGH 3VFEA 4X1RU 4AGKA 2O8MA 3HK6B 5FCKA 1O3AA 3A7TA 2Z9KA 3LJOA 4HGCA 2B7DH 2BYAX 1C5ZB 1OWEA 1KLJH 3CS7A 1ZTJA 2BVSH 3EAJA 2H9TH 3PTNA 1HAHH 2PGQB 1F0RA 3A80A 2PKSC 1C1RA 1PPBH 1SFQB 1DVAH 2ALVA 1GG6C 4WWYA 1ELFA 1DWEH 4BAMB 1OWDA 3E91A 4XSKU 1HPGA 2WUCA 3M7QA 1P2IA 3UOPA 3BEFB 2ANMH 3CP7A 4AFZA 1Y5AT 1GI4A 4D9RA 4MDSA 3TGKE 5JBCS 2A32A 4AB9A 3GY4A 5LH8A 1AU8A 4ABFA 1VGCC 1DY9A 1C5RA 1P11E 3MTYA 4X6NA 3URDA 1CHGA 1C1TA 1O2TA 1HB0B 2ZTXA 5C20A 3ATIA 1NS3A 3PLBA 1UMAH 1V2KT 2GVFA 3SJ9A 2Z9LA 5EW2H 3VB5A 1KXAA 2Y5FA 3RXHA 2ODQA 3RMOH 4ABIA 1GL0E 3LOXA 3VGCB 1O2YA 1MUEB 3SV6A 5GDSH 1E37B 5T6GA 1ZPBA 4MVNA 1IQGA 1FONA 1SOTA 1AO5A 1KLTA 2GT7A 3GYLB 3VB7A 2BM2A 3E90B 4JZDH 1C5LH 1ZMJA 1PPFE 2GGVB 3FP7E 2C4FH 2Z9GA 4Y10E 2P93A 1GBMA 1NC6A 2Z3EA 2BDHA 2BD2A 2G51A 1TGCA 1O3LA 5DJ7A 1L0ZA 3VB6A 4FU9A 1OWKA 5EPNA 3SHAH 1MTVA 2QIQA 2GDEH 2KAIA 3AAUA 4RSPA 2P16A 3PLPA 2A4RA 1T4UH 2UUJB 1GBTA 2VH0A 2Q6FA 1BITA 1EQ9A 1NZQH 4AORA 1BBRK 1E38B 1PPHE 4UONA 1T8OA 1C2DA 2JH6D 4I7YH 1PJPA 4X6OA 2OBQA 1GHAG 1O2ZA 3RUOA 1C5TA 1GBCA 3UR6A 2F9VA 2FP7B 5H4IB 2V3OH 1GHAF 2H6MA 4JYVH 2SNVA 1DXWA 4UFFH 4U01A 3AVZA 3RU4T 2YOLA 1EUFA 1XUIA 4ABGA 3PMHB 5HYOA 3Q3YA 3V0XA 2XTTB 4AFUA 4F4OC 1HAGE 1F5KU 2ZKSA 4YLUA 3ATMA 2FEQH 3CENA 3U9AH 5CMXH 1TLDA 1EJAA 1H9IE 1H8IH 2XYAA 3ODFA 5I46H 3GCNA 2B8OH 1MKWH 1WQSA 1YYY1 3PO1C 3SJIA 2WPKS 4FUDA 3EDXB 1PQ7A 3P8NA 3LDXH 1TGTA 1P2JA 2CGAA 3LGUA 4H4FA 2SGPE 2B0FA 5JDUB 4TWYA 4E7RG 4K60A 3UPEA 1VZQH 1A5IA 1OP0A 1AB9B 2C8YB 5JYIA 3RXPA 1F0SA 2WINI 2ZGHA 5EU8A 5PTPA 4X1QU 1LPKB 3L33A 1HAZB 1O3CA 2VIPA 3A7WA 2BZAA 2P3TB 1EAUA 1UVUH 1F0TA 1K1LA 1ANCA 3TNTA 1O5DH 3GY6A 1YPEH 1P06A 4HFPB 3ZVBA 4WY3A 2QXJA 5GCHG 4ZHMU 1GJ4H 5G4BA 2RA3A 3BTQE 1V2TT 5GCHF 4A92A 1TNGA 3Q3KA 3LH3A 4CRBA 5HM9A 1O3BA 1OWHA 1EAIA 1S5SA 1QQ4A 1CT2E 1HV7A 2BQ7B 1RS0A 2ZHQH 3ZVCA 3VB3A 3LPRA 1AE8H 1MZDA 4LZ4B 3A87A 2QAAA 2A2QH 3NXPA 1AIXH 3P92A 2AGEX 3RC4A 2BD8A 3TJNA 1F5LA 4YLQH 1FZZA 3FANA 4I32A 3GCHB 3TITA 1S0QA 4CHAB 4IS5A 3TK9A 1GJ8B 2A7HA 5AFZH 3T2NA 2QF3A 1A4WH 1NRSH 2ZI2H 4XDEA 2QXGA 2XBYA 3ZVGA 1ZJDA 3TU7H 1P2OA 1YM0A 3DHKH 2SGAA 3H7OA 1AUJA 3UTUH 2PFEA 2BOKA 3SU6A 1TMUH 4RN6A 1KDQA 3LC5A 1SGRE 1L4ZA 1AZ8A 2BZ6H 3KQBA 4ABBA 5FPYA 3NKKA 3RC5A 1GMDG 2FOEA 2A4OA 3RMNH 4GHTA 2Y7XA 3SNBA 1HCGA 1GMDF 2A31A 3U69H 3Q76A 1IHTH 3TIUA 3RXQA 2FODA 3QX5H 5DK1A 1Y3WA 1FI8A 1SLVB 5EQRA 1MTSA 4UD9H 4DIHH 4D9QA 1DX5M 1XUGA 3S9CA 2ZP0H 4ZMAH 1MH0A 5EXMA 3BV9B 4KTSA 3MU0A 1E0FD 3I77A 3RXOA 3SV9A 2CV3A 2QV1A 1KSNA 1RGQA 3STJA 2BB4A 3UR9A 1O2GH 1XUJA 1Y3XA 3TGJE 4JZFH 4K1TA 4SGAE 3ZV8A 3TK6A 1DICA 4FUFA 3A8BA 3PMAB 1P02A 1CBWC 5JPMH 3BF6H 1A5GH 1YKTA 5E2OA 3RXMA 2W5EA 2CXVA 2BDAA 4PROA 2J38A 2PKSB 3V7TA 3T26A 1ZGIA 1FXYA 5JBAS 2JETB 2QGRA 3MH4A 4ZROA 1HXFH 2TGTA 2ZFQH 2ZA5A 1CHOG 3BSQA 2F9BH 3M36A 1UTNA 1CT4E 1GVKB 4YO9A 5GPIB 3VEQB 1CHOF 3JZ2B 2OC0A 5FX6A 4AG2A 1XVOA 1F2SE 1ZSLA 1IQKA 3NK8A 5IDKA 3TLOA 1HIAA 2VIQA 1VJ9U 1SQAA 1JBUH 3MH5A 4JCNA 1QB1A 5E2PA 2HPPH 3E0NB 3LGWA 1KXDA 3ZVDA 1DT2A 5JBBS 1UVPA 1FQ3A 1GHXH 1XX9A 3N7OA 1K1JA 4AYYB 2QYIA 3ZZ7A 1N8OB 2VIDA 1V2RT 2ZHFH 2Z7FE 4ABDA 1W13U 1C4U2 1EP5A 2FOFA 1NFXA 3M3TA 1Q2WA 3ZZ5A 4UEHH 1V2QT 2W7SA 3RXLA 4JZIA 3EQ0H 3SO3A 2XXLA 1OYQA 2YNAA 1C5UA 1GI3A 1O3JA 3OY5U 1MTUA 3FZDA 2P3FH 3HGNA 3LGYA 3G01A 4RKOB 4WH6A 4CRAA 1J17T 3UNSA 1SGIB 4Y79A 4X2YA 2O9QA 2XW9A 2NWNA 4F49A 1OS8A 4TWWA 1BMLA 2WPHS 5JBTA 1G3DA 3Q00A 1WAYB 3PV4A 3NZIA 4OS2A 1YCPH 3A82A 1AD8H 1C1PA 2FOMB 2IPHA 2AYWA 3O8BA 1C5PA 1SC8U 4GAWA 4TPYA 1GJCB 5T6FA 1FY3A 2O8UA 1GDNA 2BDYA 3QUMP 1K21H 1QL9A 2B5TB 3AASA 4Y8XA 1GPZA 1JRSA 1WSSH 2Z94A 1EPTA 3RLYH 5FX5A 3KQDA 2ZU1A 3QGJA 4GHQA 3ZZ4A 4UE7H 3MYWA 4BAOB 3BIUH 1QCPA 3MU5A 4BOHA 1SLUB 2XC0A 1TMBH 3O8RA 4M7GA 1JXPA 2D1JA 4BAQB 1HJAC 5C5NA 2ILNA 3W94A 1UCYH 7LPRA 3AW1A 2VIWA 1AE5A 4XE4A 5C1YA 4B76A 1LHCH 2QXIA 2P94A 1Z1IA 2UUKB 6GCHG 5A2MH 3S9BA 1LPGB 1NFUA 1T31A 3LKWA 3U1IB 1SHYA 2BY8X 2GV7A 6GCHF 3P17H 1O2OA 1P09A 1G32B 3MHWU 3MWIU 1V2WT 1FN8A 1HJ8A 2P8OB 4YOJA 1JOUB 1INCA 4ZAEA 1S0RA 4MTBA 5EXNA 4MPXA 1Y3UA 3NCLA 1A2CH 3Q3XA 4X8VH 2XC4A 1K1IA 5EG4A 5TCAA 1J8AA 1TPAE 3SI3H 2V6NA 3GCTG 1LPZB 2BY9X 4Q2KA 1H4WA 5A8YA 3KCGH 3PLKA 1UTMA 3SUDA 1GDQA 2I6QA 3GCTF 1E35B 3MNCA 3MO3A 2OBOA 3MO6A 2OD3B 1XUFA 4Q7XA 3EYDA 3ZVFA 3M7TA 4AYVB 3QGNB 1WCZA 1K1NA 4ZXXH 1O32A 4B2AA 3MH6A 1UTLM 2THFB 3A83A 1TRNA 3EA8A 4K2YA 1T32A 1UK4A 2OQUA 3SHCH 3SZNA 1DFPA 4WMDA 3KEEA 3UNRA 1UHBA 2VH6A 4A6LA 4I31A 4O9VA 4B71A 3QZQA 4OGXA 1J16A 1UVOA 1K1MA 1GJAB 3S69A 2HALA 2R3YA 2W7UA 1GBBA 3PMJA 1AKSB 3GYMA 1MU8B 5FBIA 1UJ1A 2SGFE 2ZFRH 4FXGH 1B7XB 3SORA 5EGMA 1CGIE 2FOHA 5F8ZA 1ANEA 1NFWA 3KL6A 2XC5A 3F6UH 2DE8A 1XXDA 1L1NA 1NT1A 1T8MA 1GJ9B 5BRRE 3OSYA 1HYLA 1IQFA 3KQEA 1ZTLA 2XBXA 1PPGE 2PKAA 3S7KB 1Z6JH 1SMFE 4IN2A 1Z8RA 1P9UA 3IG6B 2H9HA 1O5EH 2Z3CA 1S6HA 2I6SA 1Q31A 1H1BA 1VCPA 1GHVH 3F9EA 2WYGA 5L2ZH 1K1OA 1QRZA 1SOZA 3T28A 1IQHA 1XM1A 3OY6U 1VITG 5F8TA 3BIVH 8KME2 1LKBA 1TRMA 4ABAA 5DP7A 2ZQ2A 1VITF 1IQLA 4WVPE 4ABEA 1ABJH 5J4QA 3URCA 1FNIA 2FI3E 1W11U 2ZDKA 2R0KA 1C5OH 4GVUA 3M37A 2YNBA 5E0HA 1C2IA 1AQ7A 1O5CB 1BB0B 4BXWA 1LHFH 1DOJA 1RTLA 2PUQH 4DT7B 1LCYA 2ASUB 3M3VA 4XOJA 5C5OA 2G55A 4FU7A 5F8XA 1O2VA 3ZZ6A 3ZZCA 4BNRA 4CH2B 3MU8A 1RIWC 2J4IA 1B0EA 3GY7A 3F1SB 1ZRBA 2H1UA 2GCTC 1QB6A 1MTNB 1EJMA 1O3PB 1Y3YA 4CREA 2K1QA 1H9HE 2SGDE 1ZSKA 4X1NU 1T8LA 4AFQA 1GCTC 2RG3A 2Y7ZA 2PW8H 4FUHA 4H6TA 1ZTKA 5C67A 4WXVA 1MAYA 1QGFA 2GT8A 2HNTF 1AZZA 3UFAA 2D8WA 3UIRA 1NRQH 1JRTA 1RTFB 1FY4A 3SBKA 1PPCE 2Z9JA 3GOVB 1FPHH 1P8VC 1HAYB 1XUHA 1J15A 1VR1H 2GD4B 1TNHA 2FLBH 4HZHA 2BDBA 1RRKA 5FCRA 8ESTE 1XMNB 1GJBB 2ZGJA 2ZU2A 2PGBB 1TMTH 4NG9H 2BX3A 2ESTE 2AFQB 1Y8TA 5FHTA 2ZCHP 1G37A 1SGCA 2A5IA 5C3NA 1FY5A 3BG8A 2XWAA 2J9NA 4B2CA 4WH8A 2BLOA 4B74A 4FUBA 4KKDA 4MNWA 8LPRA 4IMZA 3RM2H 1A7SA 1CGJE 1MBQA 1RJXB 3EGKH 3SU1A 1A3BH 2XBWA 1TNKA 4I8KA 1GGDB 2EEKA 5FXLA 1XVMA 3PB1E 1EAWA 5EQSA 1DPOA 5A0CA 1G2LA 5FPSA 1CA0C 1EPTC 1FUJA 1FAKH 1O3DA 2VGCC 1Z71A 3PTBA 4ZHLU 1ETSH 1EX3A 5HMAA 2Y80A 1TIOA 1IQMA 1MKWK 1HGTH 3SJKA 1SLXB 4VGCB 4ASHA 1V6DA 2SNWA 1QA7A 4JK5A 1TRYA 2F9UA 1QL7A 2WUBA 1P05A 1P3CA 4R8TB 4TY7A 1LDTT 1E34B 2ZDMA 1Y5UT 1O2HA 1W0ZU 4NCYA 1ARCA 5AHGH 2PTCE 2AEIH 2G00A 3Q77A 2Y5HA 5A8XA 1HJAB 1O3IA 1ZGVA 1HAIH 3UY9A 1O0DH 3ENSB 5HM2A 3DFLA 1LVYA 4ZHAA 1AMHA 1JIRA 2BXTH 4Q7ZA 3SI4H 4U2WA 1TPPA 1PQ8A
chains in the Genus database with same CATH superfamily
3MU1A 1E79D 1QFKH 4UFEH 2LNCA 3RXTA 2G81E 1WTHD 1KLIH 3H5CB 4LK4A 2QF0A 1TONA 4D76A 4E06H 5CHAC 4NA9H 4RT0A 2AIQA 5EIYA 2NU3E 1FDPA 5FBEA 1D6RA 1GJ5H 1MABB 2HVXA 4E05H 1WXRA 5L30H 4UDWH 2V0BA 2Q6GA 1AFQB 5E0JA 1T7CA 3T5FH 4ABJA 5AF9H 3KQCA 1V2OT 3OAAD 2ZECA 6LPRA 2BY7X 1C1OA 3GY2A 1N1LA 2IOTA 1DM4B 2SGQE 1LQDB 2W6ID 1NM6A 1O2UA 2BOHB 1QURH 5CDFE 3A8CA 2XRCA 1EZSC 1SI5H 3RXVA 4Y76A 3KGPA 4CBOA 2F83A 1PYTD 1A61H 1IAUA 1HRTH 3SU3A 1SSXA 1D9IA 4DVAU 3U8RH 4A1XA 1DXPA 4KTUA 4LZ1H 3DUXH 1A1RA 3E6PH 3RP2A 4X2XA 4WJG2 3RXFA 5L2YH 4B6EA 1LQEA 1P3EA 2R2WU 1FAXA 2Z6BD 3U98H 1WU1A 2ZFSA 4ESTE 2BDGA 3LU9B 4INKA 3O8CA 2KR7A 3T62A 2GZ9A 4O3TA 3BG4C 3RXCA 3F9GA 1KDQB 2C3SA 1L2EA 2BD7A 1BUIA 4Y0ZE 5GJ4B 3A7YA 2Z9IA 3E16B 1TE0A 1TBZH 4YT6H 4BTIB 2O8WA 2BHGA 5TJXA 1TAWA 2P59A 2V7QD 4TT3D 1O2RA 3LGVA 1Z6EA 3FP8E 5DP6A 5K0HA 5GIBA 2GKVE 1TGBA 1ZSJA 1YPGH 3ELAH 3D49H 1WYKA 1GJ6A 2FYRA 3OX7U 2RDEA 1ELBA 4OS6A 3D65E 1C1VH 2RFKC 5A0BA 1TNJA 1N6XA 4KELA 4FUJA 4DW2U 3D23A 2CHAC 4ZKRU 3RXAA 1V2MT 3NWUA 2ZPRA 4WF8A 4YOIA 1VCWA 1FY1A 4ISNA 1G9IE 4K8BA 5DP4A 2HPQH 3RMLH 5F6MA 2TGPZ 1SGFA 2EI6A 1UTKA 1ANBA 2STAE 1L4DA 3EA9A 1T8NA 1DSUA 2G8TA 4OS5A 1BTPA 2OK5A 4FUEA 1Y5BT 4MG3A 4D7FA 2ODPA 1YP9A 1IQJA 1D3DB 1C1SA 1QA0A 3MOCA 4YOGA 9ESTA 1TX6A 3RXJA 3I29A 5K7RA 2GCHG 1LHDH 3SGQE 1MQ5A 3GY3A 2ZFTA 2GCHF 1YCPM 3K6ZA 4XFQA 4A1TA 1BDAA 1C2MA 3BTKE 1JMOH 1FV9A 4GPGA 1ZZZA 1GG6B 3ZZ9A 5KEDA 2J5UA 4O03A 1ZHRA 2XNIA 1AWHB 1TOCB 1DY8A 1QBOA 2PSXA 4FUIA 2BY5X 1MAXA 1EJNA 2C93B 3CNRA 9LPRA 1EZUC 1LHEH 4AGJA 1TABE 4GUXA 3AAVA 1VGCB 3U8TH 1ELGA 5AFYH 2EA3A 2UUFB 5J4SA 1CO7E 1F5RA 3EA7A 3GISB 1K9OE 1V2VT 4BTUB 3LC3A 3MNBA 4DG4A 3ZZDA 3LJJA 2Y6TA 3W95A 1EP6A 4JK6A 2Q1JA 3C1KA 4CRFA 2CJIA 1C1WH 1BJUA 1L1JA 1W7GH 3TH2H 1D3QB 1EB1H 3V13A 4A5TS 1QQUA 1O2NA 4HI3A 3KF2A 5DPAA 3OTPA 3F2GA 3TH4H 2XWBI 1K1PA 4K1EA 1SBWA 2CF8H 1K28D 2GMTC 3F0OA 2GZ8A 4X8TH 3BTME 3QTOH 3SV8A 3F9HA 4ZUHA 1GVLA 1YCPK 3E1XB 4AN7A 2DE9A 4IC6A 2FXRA 3SNCA 1GHWH 1XKBC 1LHGH 3T27A 2AGGX 3RLWH 4D7GA 3VGCC 1KTTB 1MMJN 1G2MA 1YGCH 1CVWH 3A8DA 2BXUH 2RCEA 4OM9A 1BZXE 2TPIZ 3B9FH 7ESTE 2OINA 1C5MD 2Y5GA 3M3SA 1SQRA 1IHSH 2FS9A 2QE7D 3SUGA 1LVOA 2BDIA 2GV6A 1F7ZA 4XBDA 2PHBA 1JWTA 2ALPA 2XBVA 5AVDA 3SV2H 3BTEE 1UK3A 1DUEA 1OYTH 1NFYA 4BAHB 1GBKA 5SGAE 1E36B 1GHBG 2A7JA 1GBFA 4E7NA 5L6NH 3P8OA 5JB8S 4ZXYH 1GHBF 1UCYK 2OP9A 4I33A 1GJDB 3O8DA 4OS4A 3A85A 4Y71A 1E1QD 3SJOA 4K1SA 3K6YA 1Z8IB 2D2DA 1P01A 4NWLA 4I8HA 2A45B 3PO1B 1Q3XA 1UO6A 2BD9A 2GZ7A 2QF4A 3M7UA 3NUMA 3PM3A 5E8EH 4Y8ZA 3SGAE 4X8SH 1ACBE 2R2MB 1EKBB 3S7HB 2ZQ1A 1TNLA 1QTFA 4FVBA 2OC7A 5GNDA 2TBSA 1GCDA 2O8LA 1XKAC 1THSH 4I8JA 3HGPA 4ZCNA 1TOMH 3BTWE 2QXHA 1B0FA 5FL7D 1O5GH 1C1NA 4A7IB 1C5NH 2BD4A 4O3UA 1DWCH 3SYJA 3PV2A 4X1SU 1FIWA 4IW4E 6CHAC 2NU2E 1GI6A 5DP8A 2FMJA 1O3FA 2ZNKH 1WOFA 2GDDA 1ELTA 1PQ5A 1SVPA 2VVVA 1YPLH 1UTOA 5DG6A 2WPIS 4MNYA 1BOQA 3IWMA 1YLCA 3BEUA 1SGDE 3SUFA 4X2VA 3BEIB 1C9TA 3RM0H 1AB9C 1LKAA 3SNAA 4BANB 2Y81A 1SG8B 1OWJA 4MPUA 4NA8A 1EZQA 4M9FA 2A0QB 1O39A 1NROH 1F0UA 2W3IA 2ZHWH 1SGFG 2FI5E 4FU8A 1W3CA 1X7AC 2G5NA 1EASA 1GJ7B 2ZCKP 3SU2A 4DOQA 1GBJA 1U6QA 1C2HA 4IC5A 1KIGH 2FDAA 1TB6H 2Y82A 1DITH 1CA8B 2A5AA 2UUYA 2J2UA 1ZPZA 2KCPA 2BLVA 1O3EA 3M35A 1EB2A 4NFFA 4CBNA 1BRUP 5BPEA 2SFAA 2J97A 2GX4A 1HAVA 2QN5T 1NESE 1HUTH 1K22H 2BVXH 3KYGA 3SU0A 4IBLH 2FOBA 4NZLA 1AI8H 1O3MA 4AFSA 2ZO3H 2F9NA 2XCNA 2VIVA 4MQAA 4JZ1A 3RXEA 1KXBA 3LGIA 4H42U 2TIOA 3D62A 3RXRA 1BHXB 1MCVA 3GICB 2TRMA 3PV5A 3GCHC 4NWKA 1QR3E 2WPJS 2WYJA 4CHAC 1FLEE 2NU1E 5DP5A 3DT0H 3GDVA 2HWLB 4CR5A 3TVJB 1YPHE 4THNH 3U1JB 3SW2B 3UUZA 3TH3H 3H7TA 2TGAA 5EODA 1W7XH 1MKXK 1ELEE 2YMSB 3GY5A 3HKIB 1G3BA 2HNTE 1C9PA 3C27B 4Y0YE 1FY8E 1IQNA 1P0SH 4SGBE 4CRCA 2OUAA 2QA9E 4INHA 4Y11E 1QBNA 1AHTH 1AKSA 1O30A 1DSTA 1M9UA 4IGDA 3MMGA 3M61U 1BA8B 3QO6A 3LONA 3R3GB 2YMSD 2A2XH 1TQ0B 5HIZA 3OU0A 4MNVA 4X2WA 1CBWB 4R0IA 4NGAH 1C2JA 1O2KA 2QC2A 2J98B 4WMFA 3L3TA 2M5TA 2C8ZB 1SKYE 3FVFB 1TBRH 4K5ZA 2F91A 2QF5A 3A81A 2ZDAH 2FOAA 2WPLS 5EXLA 3RDZA 1OX1A 5IYTA 3B8JA 2ZDLA 3EE0B 1YBWA 2LPRA 3E0PB 3RU4E 1SL3A 2JKHA 1GBHA 2AMPA 1ZMLA 2G4UA 1W0JD 2AH4X 3P6ZB 3F3BA 3E8LA 3RXDA 2B9LA 4GSOA 1O2XA 2FI4E 1GI0A 1V3XA 5TCCA 4NZQA 4NIXA 4X8UH 2ZDNA 2W6JD 1DE7H 3FO8D 4OS1A 1QRXA 3AW0A 3KNXA 1MD8A 4Y8YA 3M5MA 4YTAA 2JETC 2FOGA 3RXIA 3RXSA 3RC6A 1HNEE 1NO9H 1UVSH 2EI8A 3RXKA 1TFXA 1TYNA 1P57B 1OKXA 1GBDA 1EZXC 1SPJA 1HDTH 1O2LA 5EPYA 1CU1A 1NU7B 4Y6DA 2OCVB 3P8FA 2FTLE 2H9EH 1P2KA 2KAIB 3R0FA 4IMQA 2GMTB 1S81A 1AN1E 2VWMA 1BCUH 2AERH 4YZUA 4KTCA 4Z0KA 3BTHE 3MU4A 1W0YH 2AIPA 3S9AA 3FP6E 2C90B 3A84A 4B75A 1TX8A 4KP0A 1BBRE 4LXBH 4KGAA 3UQOA 3UNQA 2J34A 4IN1A 2IN2A 1N8OC 4J1YA 3LGTA 1YPHC 6ESTA 1ZHPA 1OHHD 1C5SA 2ZTYA 3HKJB 1C5YB 2PLXA 1O3HA 1OPHB 3UWJH 2ZFPH 1C2KA 4NIYA 1QIXB 2BTCE 1AVWA 3TJVA 3PWCA 1BJVA 2JH0D 2HNTC 1EXFA 2FS8A 1FIZA 1K2I1 1KTSB 2FPZA 1W2KH 5CE1A 2J94A 4D8NA 1ZHMA 1H8DH 1SQOA 3VB4A 1NRPH 2R3UA 3SU4A 1GI2A 3HK3B 3F68H 1ZOMA 1EOJA 1A3EH 2FESH 3F9FA 2G5VA 2IJD1 4CR9A 1AFEH 4FOUC 1O3OA 1H9LB 5LGOA 2AMDA 1ZJKA 4AZ2B 1Z8GA 3VXFH 2FX4A 3ZZAA 1UTQA 3GY8A 1D3TB 2WV5A 2ZHDA 4XBCA 2KCYA 2Z3DA 1G30B 5EW1H 2WV4A 1QJ6B 3K9XB 4DCDA 5DO4H 2BX4A 1FMGA 4QT8C 5C2ZA 1HAXB 2FYQA 4Q80A 5C1UA 1BBRH 1WUNH 1J14A 1QRWA 3PWBA 5EJ1A 2BVRH 5FAHA 2W3KA 3SNDA 4AG1A 2V35A 1D3PB 3OYPA 5I25A 1XXFA 2F9PA 5ESBA 2A4QA 2OTVA 1ZR0A 3MNSA 3A89A 8GCHG 1THPB 1UK2A 1C2LA 1C5VA 1P9SA 3FFGA 5LPFA 1TA6A 8GCHF 4MPVA 6CHAB 1O3KA 2W26A 1NY22 1GL1A 1AY6H 2VVCA 5F03A 2STBE 4ZKOU 4TPIZ 5LPEA 1BTUA 2BY6X 2K0QA 2IJOB 7GCHG 1P10A 1BMNH 2ZTZA 2BDCA 3UQVA 1CT0E 3SUEA 3TK5A 1O37A 7GCHF 1S83A 7KMEH 3GCOA 2Q6DA 4J2YB 2CK3D 4Q7YA 2ZU3A 3U8OH 3E3TA 1IQEA 1QY6A 1DWBH 4AOQA 1BTZA 4DURA 1HAPH 1RFNA 2ODYB 2P8OC 2BD5A 1S82A 1WBGB 2NU4E 4NSVA 1C2GA 2WPMS 1SGNE 3RXBA 4B1TA 3SZEA 1P03A 2UWLA 1C5WB 1KXFA 3A7ZA 3SOSA 1RTKA 1IOEA 1BTXA 1GBLA 1VCQA 2SGEE 3DFJA 5T6DA 1O31A 1BMAA 3MFJA 4MNXA 1P04A 1TALA 2DUCA 1TX7A 1V2LT 3SJ8A 1BHXF 1O38A 2QCYA 1ORFA 1KXCA 1V2NT 1GI5A 3ITIA 1O2JA 1C5XB 2QY0B 4YESB 2ZDVH 1ZLRA 1TNIA 4YT7H 4GCHG 3PMBB 1O2QA 3A88A 3M5NA 3V12A 1QL8A 2A5KA 5A8ZA 1YLDA 4GCHF 2OQ5A 1D6WA 1OXGA 3STIA 1Z7KA 2F9OA 4BXSA 2PTNA 4UFDH 1SLWB 3ATKA 2FOCA 4K8YA 2P95A 2PWXA 3GDUA 4NSYA 2VBCA 1ZYOA 2PV9B 1HJ9A 2OC8A 1G3EA 3UAIC 2V3MA 5FPTA 2ZHEH 5C0UA 2BQWB 4Y7BA 2HGTH 1O3NA 3ATLA 1ZRKA 1W14U 1LMWB 2J92A 1ETRH 1ARBA 1ABIH 5ETXA 1SFIA 2BLWA 1LO6A 1S84A 5EQQA 4ZKNU 1ANDA 2FLRH 1TA2A 1N6YA 1OWIA 4X0WU 1Y59T 5E0GA 3RMMH 2KFWA 4X1PU 1AVXA 4JMYA 2ANYA 3N7DA 1QJ7B 2P3UB 1MU6B 2H5CA 3BN9A 1CSOE 1YPKH 1PQAA 3LIWA 1OSSA 1ESTA 3DSGA 3K65B 1T4VH 1TWXB 4XD7D 1O5BB 1RIWB 2ZZUH 3SQHE 3RXGA 3VPKA 3M5OA 4LOYH 5DGJA 4DY7B 1GHYH 1CE5A 4XBBA 1MBMA 2BMGB 3FAOA 1HIAB 5A09A 4HTCH 1O5FH 4JZEH 2GCTB 1ESBA 2EC9H 1C1QA 2VJ1A 3ODDA 1VJAU 2CN0H 4U30A 2ZC9H 3FZZA 3S0NA 2ZPQA 2AMQA 3P70B 1SQTA 3TNSA 5ESTE 1NBMD 1QNJA 1PPZA 1GCTB 2A7CA 4GLYA 3ATWA 2M2AA 2H2ZA 1EAXA 3OTJE 1ELCA 2FM2A 3B23B 4NA7A 2HRVA 1UTJA 3QTVH 3PYHA 4B2BA 1C1UH 4DJZB 4ACAA 3LT3A 1A0LA 2C8WB 3UWIA 3QDZB 3KHVA 3ZZ3A 5DKMA 3SQEE 1MTWA 4DGJA 4MLFB 1MTNC 2FO9A 1DS2E 1Z8JB 1SB1H 1C1MA 1BIOA 2ZWLH 2OC1A 1KYNA 1LVMA 4AC9A 1WV7H 1DANH 2HLCA 4K69A 4RI0A 5ABWA 1GI9B 4FUGA 3ZVEA 2BLQA 1PFXC 3UOUA 2XCFA 4INLA 1SHHB 1Z1JA 5DP3A 2BQ6B 4ZH8A 1TBQH 3QLPH 1GMCG 1P2NA 1F92A 1SR5C 3VXEH 4P00A 2VU8E 1RD3B 1DLKB 1V2JT 1UVTH 3T25A 1GMCF 1A0HB 3ZZ8A 2RDLA 1GI7B 4MPWA 2PUXB 2TGDA 2ZF0H 1HAOH 3QZRA 1HLTH 1HFDA 2ZIQH 1QHRB 1NPMA 1O3GA 1G3CA 1V2UT 2UWOA 2V3HH 3SGBE 3CS0A 5IK2D 5EOKA 3MH7A 2OLGA 1NRNH 1AWFH 1O2WA 2D26C 2ZGCA 4WXIA 5EJZA 1TPSA 3A7XA 2EY4C 2NU0E 1ZPCA 3ZV9A 1CA0B 1EPTB 2HOBA 1DUAA 2PSYA 3V3MA 2A1DB 2VGCB 5T3HA 1V2ST 3DD2H 2G52A 1UCYE 3DA9B 1OP8A 1SGQE 1O36A 2FZZA 4B73A 2ZGBH 5GXPA 2VIOA 4OS7A 4YM9A 1DLEA 3A8AA 4I8LA 4Z6AH 1KY9A 1NRRH 1NTPA 1KMHB 1SGTA 1BRCE 3FOAA 1MZAA 1A46H 1V2PT 1O2MA 1GGDC 1BMFD 5HGGA 5KGOA 1PPEE 1O34A 4OGYA 1P2MA 2ZPSA 1SGPE 1LTOA 2FX6A 4ZKSU 2FIRH 5JB9S 3SN8A 1CGHA 1TQ7B 4FVDA 4O97A 2O8TA 1NU9A 4ISHH 1QB9A 1MD7A 1BMMH 1L1GA 1S6FA 1O2PA 1DDJA 2EI7A 2GTBA 1MQ6A 1WTGH 4VGCC 5T1VA 3ESTA 2R0LA 3K2UA 1BTYA 1FN6A 4JYTA 3BTGE 2VNTA 1GBIA 3RXUA 1EOLA 4H6SB 1QBVH 4X6MA 4B6FA 4K3JA 1KXEA 4ASUD 2FWWA 1YC0A 2AGIX 1BTWA 5CHAB 2ZU5A 4CRGA 3DCLA 1OOKB 3I78A 1ETTH 3ZVAA 2C8XB 2FTMA 3P95A 3SV7A 1MCTA 4Q63A 3KN2A 2WPDD 3QN7A 3RU4D 3TJOA 1TGSZ 1BRBE 1TPOA 1WQVH 4TY6A 5HKKD 1BTHH 1C2EA 4BTTB 1FPCH 1DWDH 2PR3A 2VINA 2J95A 1GMHG 3PROA 5GWZA 1GMHF 1C5QA 4I86A 4WMEA 4JYUH 2LP6A 1P2QA 2JH5D 4AX9H 1GDUA 1UHBB 1O2SA 1C4V2 1PYTC 4U32A 2G4TA 1BQYA 5DP9A 2R9PA 5HXFA 1HAVB 1GBAA 4BAKB 3WWBA 1AFQC 3SNEA 3BTTE 1O2IA 3M5LA 3A7VA 1S85A 1A0JA 3L6PA 2ZEBA 4RKJB 3GDSA 2ZG0H 2F3CE 2AHME 2ZCLP 1C2FA 3LH1A 2ANKH 4Y7AA 3MI4A 3BG4B 4CH8B 3JZ1B 3ZYDA 1BT7A 1AUTC 4AB8A 1P12E 1GI1A 1C4Y2 2HVYB 3AK5A 2VB0A 1GVZA 1B5GH 3ZZBA 2XOKD 1J9CH 1ZMNA 2H5DA 2AS9A 1JIMA 1IQIA 2PKAB 2RA0A 2JDID 1Y3VA 2VVUA 1AGJA 1GBEA 2KCOA 3NPSA 1D4PB 3QWCH 4I8GA 1QJ1B 3WY8A 3MNXA 3FN8A 3MO9A 5C1XA 1NN6A 5B6OA 4DIIH 1ELDE 1O5AB 1ID5H 1W10U 5LPRA 4ISLA 4ABHA 1OP2A 2ANWA 2CHAB 1ELAA 2ULLA 4CRDA 2ZU4A 3ZYEA 1TGNA 4ISIH 1FJSA 1G36A 3DSPA 5A0AE 1W8BH 2CF9H 2OXSA 1LVBA 3A86A 2BD3A 2A4GA 2F43B 2VWOA 1VITH 2UWPA 3BTDE 3HATH 4NIVA 1YPJH 3TPIZ 3UREA 1W12U 1GHZA 1GWAA 1ESAA 1HXEH 1THRH 4UFGH 1BRAA 1SGEE 2ZFFH 4NIWA 2CMYA 4ISOA 1O35A 1O33A 1XUKA 4A1VA 3IITA 3KIDU 3QK1A 1GI8B 1HBTH 1YF4A 2GP9B 3TJUA 3BTFE 1A5HA 4FUCA 4X6PA 1RXPA 1YPMH 4NFEA 1CQQA 2ZGXH 1YWUA 2VWNA 3W1EA 3SU5A 4TYDA 1UTPA 3T29A 3N99A 1MKXH 3HPTB 5C94A 1ELVA 2VWLA 1EATA 1SGYE 3TGIE 3P8GA 1AVGH 3VFEA 4X1RU 4AGKA 2O8MA 3HK6B 5FCKA 1O3AA 3A7TA 2Z9KA 3LJOA 4HGCA 2B7DH 2BYAX 1C5ZB 1OWEA 1KLJH 5B6LA 3CS7A 1ZTJA 2BVSH 3EAJA 2H9TH 3PTNA 1HAHH 2PGQB 1F0RA 3A80A 2PKSC 1C1RA 1PPBH 1SFQB 1DVAH 2ALVA 1GG6C 4WWYA 1ELFA 1DWEH 4BAMB 1OWDA 3E91A 4XSKU 1HPGA 2WUCA 3M7QA 1P2IA 3UOPA 3BEFB 2ANMH 3CP7A 4AFZA 1Y5AT 1GI4A 4D9RA 2J98A 4MDSA 3TGKE 5JBCS 2A32A 4AB9A 3GY4A 5LH8A 1AU8A 4ABFA 1VGCC 1DY9A 1C5RA 1P11E 3MTYA 4X6NA 3URDA 1CHGA 4P02A 5KECA 1C1TA 1O2TA 1HB0B 2ZTXA 5C20A 3ATIA 2WSSD 1NS3A 3PLBA 1UMAH 1V2KT 2GVFA 3SJ9A 2Z9LA 5EW2H 3VB5A 1KXAA 2Y5FA 3RXHA 4Z1MD 2ODQA 3RMOH 3H09A 3F2HA 4ABIA 4RT1A 1GL0E 3LOXA 3VGCB 1O2YA 1MUEB 3SV6A 5GDSH 1E37B 5T6GA 1ZPBA 4MVNA 1IQGA 1FONA 1SOTA 1AO5A 1KLTA 2GT7A 3F2FA 3GYLB 3VB7A 2BM2A 3E90B 4JZDH 1C5LH 1UW7A 1ZMJA 1PPFE 2GGVB 3FP7E 2C4FH 2Z9GA 4Y10E 2P93A 1GBMA 1NC6A 2Z3EA 2BDHA 2BD2A 2G51A 1TGCA 1O3LA 5DJ7A 1L0ZA 3VB6A 4FU9A 1OWKA 5EPNA 3SHAH 1MTVA 2QIQA 2GDEH 2KAIA 3AAUA 4RSPA 2P16A 3PLPA 2A4RA 1T4UH 2UUJB 5CHBA 1GBTA 2VH0A 2Q6FA 1BITA 1EQ9A 1NZQH 4AORA 1BBRK 1E38B 1PPHE 4UONA 1T8OA 1C2DA 2JH6D 4I7YH 1PJPA 4X6OA 2OBQA 1GHAG 1O2ZA 3RUOA 1C5TA 1GBCA 5F53A 3UR6A 2F9VA 2FP7B 5H4IB 5HIYA 2V3OH 1GHAF 2H6MA 4JYVH 2SNVA 1DXWA 4UFFH 2L6OA 4U01A 3AVZA 3RU4T 2YOLA 1EUFA 1XUIA 4ABGA 3PMHB 5HYOA 3WW7A 3Q3YA 3V0XA 2XTTB 4AFUA 4F4OC 1HAGE 1F5KU 2ZKSA 4YLUA 3ATMA 2FEQH 3CENA 3U9AH 5CMXH 1TLDA 1EJAA 1H9IE 1H8IH 2XYAA 3ODFA 5I46H 3GCNA 2B8OH 1MKWH 1WQSA 1YYY1 3PO1C 3SJIA 2WPKS 4FUDA 3EDXB 2JJ1D 1PQ7A 3P8NA 3LDXH 3N7EA 1TGTA 1P2JA 2CGAA 3LGUA 4H4FA 2SGPE 2B0FA 5JDUB 4TWYA 4E7RG 4K60A 3UPEA 1VZQH 1A5IA 1OP0A 1AB9B 2C8YB 5JYIA 3RXPA 1F0SA 2WINI 2ZGHA 5EU8A 5PTPA 4X1QU 5C17A 1LPKB 3L33A 1HAZB 1O3CA 2VIPA 4F55A 3A7WA 4YXWD 2BZAA 2P3TB 1EAUA 1UVUH 1F0TA 1K1LA 1ANCA 3TNTA 1O5DH 3GY6A 1YPEH 1P06A 1S6LA 4HFPB 3ZVBA 4WY3A 2QXJA 5GCHG 4ZHMU 1GJ4H 5G4BA 2RA3A 3BTQE 1V2TT 5GCHF 4A92A 1TNGA 3Q3KA 3LH3A 4CRBA 5C0TA 5HM9A 1O3BA 1OWHA 1EAIA 1S5SA 1QQ4A 1CT2E 1HV7A 2BQ7B 1RS0A 2ZHQH 3ZVCA 3VB3A 3LPRA 1AE8H 1MZDA 4LZ4B 3A87A 2QAAA 2A2QH 3NXPA 1AIXH 3P92A 2AGEX 3RC4A 2BD8A 1K0HA 5DN6D 3TJNA 1F5LA 4YLQH 1FZZA 3FANA 4I32A 3GCHB 3TITA 1S0QA 4CHAB 4IS5A 3TK9A 1GJ8B 2A7HA 5AFZH 3T2NA 2QF3A 1A4WH 1NRSH 2PP6A 2LELA 2ZI2H 4XDEA 2QXGA 2XBYA 3ZVGA 1ZJDA 3TU7H 2KX4A 1P2OA 1YM0A 3DHKH 2SGAA 3H7OA 2WV9A 5DSFA 1AUJA 3UTUH 2BOKA 2PFEA 3SU6A 1TMUH 4RN6A 1KDQA 3LC5A 1SGRE 1L4ZA 3OFND 1AZ8A 2BZ6H 3KQBA 4ABBA 5FPYA 3NKKA 3RC5A 1GMDG 2FOEA 2A4OA 3RMNH 4GHTA 2Y7XA 3SNBA 1HCGA 1GMDF 2A31A 3U69H 3Q76A 1IHTH 3TIUA 4XRNA 3RXQA 2FODA 3QX5H 2JIZD 2YMSC 5DK1A 1Y3WA 1FI8A 1SLVB 5EQRA 1MTSA 4UD9H 4DIHH 4D9QA 1DX5M 1XUGA 3S9CA 2ZP0H 4ZMAH 1MH0A 5EXMA 3BV9B 4KTSA 3MU0A 1E0FD 3I77A 3RXOA 3SV9A 2CV3A 2QV1A 1KSNA 1RGQA 3STJA 2BB4A 3UR9A 1O2GH 1XUJA 1Y3XA 3TGJE 4JZFH 4K1TA 4SGAE 3ZV8A 3TK6A 1DICA 4FUFA 3A8BA 3PMAB 1P02A 1CBWC 5JPMH 3BF6H 1A5GH 1YKTA 3U28C 5E2OA 3RXMA 2W5EA 2CXVA 2BDAA 4PROA 2J38A 1COWD 2PKSB 3V7TA 3T26A 1ZGIA 1FXYA 5JBAS 2JETB 2QGRA 3MH4A 4ZROA 1HXFH 2TGTA 2ZFQH 2ZA5A 1CHOG 3BSQA 2F9BH 3M36A 1UTNA 1CT4E 1GVKB 4YO9A 5GPIB 3VEQB 1CHOF 3JZ2B 2OC0A 5FX6A 4AG2A 1XVOA 1F2SE 1ZSLA 1IQKA 2F4LA 3NK8A 5IDKA 3TLOA 1HIAA 2XNDD 2VIQA 1VJ9U 1SQAA 1JBUH 3MH5A 4JCNA 3OEHD 1QB1A 5E2PA 2HPPH 3E0NB 4F48B 3LGWA 1KXDA 3ZVDA 1DT2A 5JBBS 1UVPA 1FQ3A 1GHXH 1XX9A 3N7OA 1K1JA 4AYYB 2QYIA 3ZZ7A 1N8OB 2VIDA 3PRDA 1V2RT 2ZHFH 2Z7FE 4ABDA 1W13U 1C4U2 1EP5A 2FOFA 1NFXA 3M3TA 1Q2WA 3ZZ5A 4UEHH 1V2QT 2W7SA 3RXLA 2KCAA 4JZIA 3EQ0H 3SO3A 2XXLA 1OYQA 2YNAA 1C5UA 1GI3A 1O3JA 3OY5U 1MTUA 3FZDA 2P3FH 3HGNA 3LGYA 3G01A 4RKOB 3OE7D 4WH6A 4CRAA 1J17T 3UNSA 1WDIA 1SGIB 4Y79A 4X2YA 2O9QA 2XW9A 2NWNA 4F49A 1EFRD 1OS8A 1BMLA 2WPHS 4TWWA 5JBTA 1G3DA 3Q00A 1WAYB 3PV4A 3NZIA 4OS2A 1YCPH 2KM0A 3A82A 1AD8H 1C1PA 1FX0B 2FOMB 2AYWA 2IPHA 3O8BA 1C5PA 1SC8U 4GAWA 4TPYA 1GJCB 5T6FA 1FY3A 2O8UA 1GDNA 2BDYA 3QUMP 1VKYA 1K21H 1QL9A 2B5TB 3AASA 4Y8XA 1GPZA 1JRSA 1WSSH 2Z94A 1EPTA 3RLYH 2L74A 5FX5A 3KQDA 2ZU1A 3QGJA 4GHQA 3ZZ4A 4UE7H 3MYWA 4BAOB 3BIUH 1QCPA 3MU5A 4BOHA 1SLUB 2XC0A 1TMBH 3O8RA 4M7GA 1JXPA 5EJLA 2D1JA 4BAQB 1HJAC 5C5NA 2ILNA 3W94A 1UCYH 7LPRA 3AW1A 2VIWA 1AE5A 4XE4A 5C1YA 4B76A 1LHCH 2QXIA 2P94A 1Z1IA 3KYFA 2UUKB 6GCHG 2HLDD 5A2MH 3S9BA 1LPGB 1NFUA 1T31A 3LKWA 4HG6A 3U1IB 4DT4A 1SHYA 2BY8X 2GV7A 6GCHF 3P17H 1O2OA 1P09A 1G32B 3MHWU 3MWIU 3VG8A 1V2WT 1FN8A 1HJ8A 2P8OB 4YOJA 1JOUB 3MQKC 1INCA 4ZAEA 3PRBA 1S0RA 1NBME 4MTBA 5EXNA 4MPXA 1Y3UA 3NCLA 1A2CH 3Q3XA 4X8VH 2XC4A 1K1IA 5EG4A 5TCAA 1J8AA 1TPAE 3SI3H 2V6NA 3GCTG 1LPZB 2BY9X 4Q2KA 1H4WA 5A8YA 3KCGH 3PLKA 1UTMA 3SUDA 1GDQA 2I6QA 3GCTF 3ZIAD 1E35B 3MNCA 2JJ2D 1YLNA 3MO3A 4TSFD 2OBOA 3MO6A 2OD3B 1XUFA 4Q7XA 3EYDA 3ZVFA 3M7TA 4AYVB 3QGNB 1WCZA 2WZQA 1K1NA 4ZXXH 1O32A 4B2AA 3MH6A 1UTLM 1H8ED 2THFB 3A83A 1TRNA 3EA8A 4K2YA 1T32A 1UK4A 2OQUA 3SHCH 3SZNA 1DFPA 4WMDA 3KEEA 3UNRA 4ACBA 1UHBA 2VH6A 4A6LA 4I31A 4O9VA 4B71A 3QZQA 4OGXA 1J16A 1UVOA 1K1MA 1GJAB 3S69A 2HALA 2R3YA 2W7UA 1GBBA 3PMJA 1AKSB 3GYMA 1MU8B 5FBIA 1UJ1A 2SGFE 2ZFRH 4FXGH 1B7XB 3SORA 3EE7A 5EGMA 1CGIE 2FOHA 5F8ZA 1ANEA 1NFWA 3KL6A 3KQ5A 2XC5A 3F6UH 2DE8A 1XXDA 1L1NA 1NT1A 1T8MA 1GJ9B 5BRRE 2K8IA 3OSYA 1HYLA 1IQFA 3KQEA 1ZTLA 2XBXA 1PPGE 2PKAA 3S7KB 1Z6JH 1SMFE 4IN2A 3WWFA 1Z8RA 1P9UA 3IG6B 2H9HA 1O5EH 1QZ8A 2Z3CA 1E1RD 1S6HA 2I6SA 1Q31A 1H1BA 1VCPA 1W0KD 1GHVH 3F9EA 2WYGA 5L2ZH 1K1OA 1QRZA 1SOZA 3T28A 1IQHA 1XM1A 3OY6U 1VITG 5F8TA 3BIVH 8KME2 3GS9A 1LKBA 1TRMA 4ABAA 5DP7A 2ZQ2A 1VITF 1IQLA 4WVPE 4ABEA 1ABJH 5J4QA 3URCA 1FNIA 2FI3E 1W11U 2ZDKA 2WHXA 2R0KA 1C5OH 4GVUA 3M37A 2YNBA 5E0HA 1C2IA 1AQ7A 1O5CB 1BB0B 4BXWA 1LHFH 1DOJA 1RTLA 4Q4LA 2PUQH 4DT7B 1LCYA 2ASUB 3M3VA 4XOJA 5C5OA 2G55A 4FU7A 5F8XA 1O2VA 3ZZ6A 3ZZCA 4BNRA 4CH2B 3MU8A 1RIWC 3FKSD 2J4IA 1B0EA 3GY7A 3F1SB 1ZRBA 2H1UA 2GCTC 1QB6A 1MTNB 1EJMA 1O3PB 1Y3YA 4CREA 2K1QA 1H9HE 2SGDE 1ZSKA 4X1NU 1T8LA 4AFQA 1GCTC 2KZ4A 2RG3A 2Y7ZA 2PW8H 4FUHA 4H6TA 1ZTKA 5C67A 4WXVA 1MAYA 1QGFA 2GT8A 3F0PA 2HNTF 1AZZA 3UFAA 2D8WA 3UIRA 1NRQH 1JRTA 1RTFB 1FY4A 3SBKA 1PPCE 2Z9JA 3GOVB 1FPHH 1P8VC 1HAYB 1XUHA 1J15A 1VR1H 2GD4B 1TNHA 2FLBH 4HZHA 2BDBA 1RRKA 5FCRA 8ESTE 1XMNB 1GJBB 2IPQX 2EQNA 2ZGJA 2ZU2A 2PGBB 1TMTH 4NG9H 2BX3A 2ESTE 2AFQB 1Y8TA 5FHTA 2ZCHP 1G37A 1SGCA 2A5IA 5C3NA 1FY5A 3BG8A 2XWAA 2J9NA 4B2CA 2GJGA 4WH8A 2BLOA 4B74A 4FUBA 4KKDA 4MNWA 3UB0A 8LPRA 4IMZA 3RM2H 1A7SA 4FETA 1CGJE 1MBQA 1RJXB 3EGKH 3OEED 3SU1A 1A3BH 1H8HD 2XBWA 1TNKA 4I8KA 1GGDB 2EEKA 5FXLA 1XVMA 3PB1E 1EAWA 5EQSA 1DPOA 5A0CA 1G2LA 5FPSA 1CA0C 1EPTC 1FUJA 1FAKH 1O3DA 2VGCC 1Z71A 3PTBA 4ZHLU 1ETSH 1EX3A 5HMAA 2Y80A 1TIOA 1IQMA 1MKWK 1HGTH 3SJKA 1SLXB 4VGCB 4ASHA 1V6DA 2SNWA 1QA7A 4JK5A 1TRYA 2F9UA 1QL7A 2WUBA 1P05A 1P3CA 4R8TB 4TY7A 1LDTT 1E34B 2ZDMA 1Y5UT 1O2HA 1W0ZU 4NCYA 1ARCA 5AHGH 2PTCE 2AEIH 2G00A 3Q77A 2Y5HA 5A8XA 1HJAB 1O3IA 1ZGVA 1HAIH 3UY9A 1O0DH 3ENSB 5HM2A 3DFLA 1LVYA 1YY3A 4ZHAA 1AMHA 1JIRA 2BXTH 4Q7ZA 3SI4H 3DSOA 3NRLA 4U2WA 1TPPA 1PQ8A
chains in the Genus database with same CATH topology
3MU1A 1QFKH 4UFEH 2LNCA 3RXTA 2G81E 1WTHD 1KLIH 3H5CB 4LK4A 2QF0A 1TONA 4D76A 4E06H 5CHAC 4NA9H 2AIQA 2NU3E 1FDPA 5FBEA 1D6RA 1GJ5H 2HVXA 4E05H 5L30H 4UDWH 2V0BA 2Q6GA 1AFQB 5E0JA 1T7CA 3T5FH 4ABJA 5AF9H 3KQCA 1V2OT 2ZECA 6LPRA 2BY7X 1C1OA 3GY2A 1N1LA 2IOTA 1DM4B 2SGQE 1LQDB 1NM6A 1O2UA 2BOHB 1QURH 3A8CA 2XRCA 1EZSC 1SI5H 3RXVA 4Y76A 3KGPA 4CBOA 2F83A 1PYTD 1A61H 1IAUA 1HRTH 3SU3A 1SSXA 1D9IA 4DVAU 3U8RH 4A1XA 1DXPA 4KTUA 4LZ1H 3DUXH 1A1RA 3E6PH 3RP2A 4X2XA 4WJG2 3RXFA 5L2YH 1LQEA 1P3EA 2R2WU 1FAXA 2Z6BD 3U98H 1WU1A 2ZFSA 4ESTE 2BDGA 3LU9B 4INKA 3O8CA 3T62A 2GZ9A 4O3TA 3BG4C 3RXCA 3F9GA 1KDQB 2C3SA 1L2EA 2BD7A 1BUIA 4Y0ZE 5GJ4B 3A7YA 2Z9IA 3E16B 1TE0A 1TBZH 4YT6H 4BTIB 2O8WA 2BHGA 5TJXA 1TAWA 2P59A 1O2RA 3LGVA 1Z6EA 3FP8E 5DP6A 5K0HA 5GIBA 2GKVE 1TGBA 1ZSJA 1YPGH 3ELAH 3D49H 1WYKA 1GJ6A 2FYRA 3OX7U 1ELBA 4OS6A 3D65E 1C1VH 5A0BA 1TNJA 1N6XA 4KELA 4FUJA 4DW2U 3D23A 2CHAC 4ZKRU 3RXAA 1V2MT 3NWUA 2ZPRA 4WF8A 4YOIA 1VCWA 1FY1A 4ISNA 1G9IE 4K8BA 5DP4A 2HPQH 3RMLH 5F6MA 2TGPZ 1SGFA 2EI6A 1UTKA 1ANBA 2STAE 1L4DA 3EA9A 1T8NA 1DSUA 2G8TA 4OS5A 1BTPA 4FUEA 1Y5BT 4MG3A 4D7FA 2ODPA 1YP9A 1IQJA 1D3DB 1C1SA 1QA0A 3MOCA 4YOGA 9ESTA 1TX6A 3RXJA 3I29A 5K7RA 2GCHG 1LHDH 3SGQE 1MQ5A 3GY3A 2ZFTA 2GCHF 1YCPM 3K6ZA 4XFQA 4A1TA 1BDAA 1C2MA 3BTKE 1JMOH 1FV9A 4GPGA 1ZZZA 1GG6B 3ZZ9A 4O03A 1ZHRA 2XNIA 1AWHB 1TOCB 1DY8A 1QBOA 2PSXA 4FUIA 2BY5X 1MAXA 1EJNA 2C93B 9LPRA 1EZUC 1LHEH 4AGJA 1TABE 4GUXA 3AAVA 1VGCB 3U8TH 1ELGA 5AFYH 2EA3A 2UUFB 5J4SA 1CO7E 1F5RA 3EA7A 3GISB 1K9OE 1V2VT 4BTUB 3LC3A 3MNBA 4DG4A 3ZZDA 3LJJA 2Y6TA 3W95A 1EP6A 4JK6A 2Q1JA 3C1KA 4CRFA 2CJIA 1C1WH 1BJUA 1L1JA 1W7GH 3TH2H 1D3QB 1EB1H 3V13A 4A5TS 1QQUA 1O2NA 4HI3A 3KF2A 5DPAA 3TH4H 2XWBI 1K1PA 4K1EA 1SBWA 2CF8H 1K28D 2GMTC 2GZ8A 4X8TH 3BTME 3QTOH 3SV8A 3F9HA 4ZUHA 1GVLA 1YCPK 3E1XB 4AN7A 2DE9A 4IC6A 2FXRA 3SNCA 1GHWH 1XKBC 1LHGH 3T27A 2AGGX 3RLWH 4D7GA 3VGCC 1KTTB 1MMJN 1G2MA 1YGCH 1CVWH 3A8DA 2BXUH 2RCEA 1BZXE 2TPIZ 3B9FH 7ESTE 2OINA 1C5MD 2Y5GA 3M3SA 1IHSH 2FS9A 3SUGA 1LVOA 2BDIA 2GV6A 1F7ZA 4XBDA 2PHBA 1JWTA 2ALPA 2XBVA 5AVDA 3SV2H 3BTEE 1UK3A 1DUEA 1OYTH 1NFYA 4BAHB 1GBKA 5SGAE 1E36B 1GHBG 2A7JA 1GBFA 4E7NA 5L6NH 3P8OA 5JB8S 4ZXYH 1GHBF 1UCYK 2OP9A 4I33A 1GJDB 3O8DA 4OS4A 3A85A 4Y71A 3SJOA 4K1SA 3K6YA 1Z8IB 2D2DA 1P01A 4NWLA 4I8HA 2A45B 3PO1B 1Q3XA 1UO6A 2BD9A 2GZ7A 5E8EH 3M7UA 3NUMA 3PM3A 4Y8ZA 3SGAE 4X8SH 1ACBE 2R2MB 1EKBB 3S7HB 2ZQ1A 1TNLA 1QTFA 4FVBA 2OC7A 2TBSA 1GCDA 2O8LA 1XKAC 1THSH 4I8JA 3HGPA 1TOMH 3BTWE 2QXHA 1B0FA 1O5GH 1C1NA 4A7IB 1C5NH 2BD4A 4O3UA 1DWCH 4X1SU 1FIWA 4IW4E 6CHAC 2NU2E 1GI6A 5DP8A 2FMJA 1O3FA 2ZNKH 1WOFA 2GDDA 1ELTA 1PQ5A 1SVPA 2VVVA 1YPLH 1UTOA 5DG6A 2WPIS 4MNYA 1BOQA 3IWMA 1YLCA 3BEUA 1SGDE 3SUFA 4X2VA 3BEIB 1C9TA 3RM0H 1AB9C 1LKAA 3SNAA 4BANB 2Y81A 1SG8B 1OWJA 4MPUA 4NA8A 1EZQA 2A0QB 1O39A 1NROH 1F0UA 2W3IA 2ZHWH 1SGFG 2FI5E 4FU8A 1W3CA 1X7AC 2G5NA 1EASA 1GJ7B 2ZCKP 3SU2A 4DOQA 1GBJA 1U6QA 1C2HA 4IC5A 1KIGH 2FDAA 1TB6H 2Y82A 1DITH 1CA8B 2A5AA 2UUYA 2J2UA 1ZPZA 2BLVA 1O3EA 3M35A 1EB2A 4NFFA 4CBNA 1BRUP 5BPEA 2SFAA 2GX4A 1HAVA 2QN5T 1NESE 1HUTH 1K22H 2BVXH 3SU0A 4IBLH 2FOBA 4NZLA 1AI8H 1O3MA 4AFSA 2ZO3H 2F9NA 2XCNA 2VIVA 4MQAA 4JZ1A 3RXEA 1KXBA 3LGIA 4H42U 2TIOA 3D62A 3RXRA 1BHXB 1MCVA 3GICB 2TRMA 3GCHC 4NWKA 1QR3E 2WPJS 2WYJA 4CHAC 1FLEE 2NU1E 5DP5A 3DT0H 3GDVA 2HWLB 4CR5A 3TVJB 1YPHE 4THNH 3U1JB 3SW2B 3UUZA 3TH3H 3H7TA 2TGAA 5EODA 1W7XH 1MKXK 1ELEE 3GY5A 3HKIB 1G3BA 2HNTE 1C9PA 3C27B 4Y0YE 1FY8E 1IQNA 1P0SH 4SGBE 4CRCA 2OUAA 2QA9E 4INHA 4Y11E 1QBNA 1AHTH 1AKSA 1O30A 1DSTA 1M9UA 4IGDA 3MMGA 3M61U 1BA8B 3QO6A 3LONA 3R3GB 2A2XH 1TQ0B 3OU0A 4MNVA 4X2WA 1CBWB 4R0IA 4NGAH 1C2JA 1O2KA 2QC2A 4WMFA 3L3TA 2M5TA 2C8ZB 3FVFB 1TBRH 4K5ZA 2F91A 3A81A 2ZDAH 2FOAA 2WPLS 5EXLA 3RDZA 1OX1A 5IYTA 3B8JA 2ZDLA 3EE0B 1YBWA 2LPRA 3E0PB 3RU4E 1SL3A 2JKHA 1GBHA 2AMPA 1ZMLA 2G4UA 2AH4X 3P6ZB 3E8LA 3RXDA 2B9LA 4GSOA 1O2XA 2FI4E 1GI0A 1V3XA 5TCCA 4NZQA 4NIXA 4X8UH 2ZDNA 1DE7H 4OS1A 1QRXA 3AW0A 3KNXA 1MD8A 4Y8YA 3M5MA 4YTAA 2JETC 2FOGA 3RXIA 3RXSA 3RC6A 1HNEE 1NO9H 1UVSH 2EI8A 3RXKA 1TFXA 1TYNA 1P57B 1OKXA 1GBDA 1EZXC 1SPJA 1HDTH 1O2LA 5EPYA 1CU1A 1NU7B 4Y6DA 2OCVB 3P8FA 2FTLE 2H9EH 1P2KA 2KAIB 3R0FA 4IMQA 2GMTB 1S81A 1AN1E 2VWMA 1BCUH 2AERH 4YZUA 4KTCA 4Z0KA 3BTHE 3MU4A 1W0YH 2AIPA 3S9AA 3FP6E 2C90B 3A84A 4B75A 1TX8A 4KP0A 1BBRE 4LXBH 4KGAA 3UQOA 3UNQA 2J34A 4IN1A 2IN2A 1N8OC 4J1YA 3LGTA 1YPHC 6ESTA 1ZHPA 1C5SA 2ZTYA 3HKJB 1C5YB 2PLXA 1O3HA 1OPHB 3UWJH 2ZFPH 1C2KA 4NIYA 1QIXB 2BTCE 1AVWA 3TJVA 3PWCA 1BJVA 2JH0D 2HNTC 1EXFA 2FS8A 1FIZA 1K2I1 1KTSB 2FPZA 1W2KH 5CE1A 2J94A 4D8NA 1ZHMA 1H8DH 1SQOA 3VB4A 1NRPH 2R3UA 3SU4A 1GI2A 3HK3B 3F68H 1ZOMA 1EOJA 1A3EH 2FESH 3F9FA 2G5VA 4CR9A 1AFEH 1O3OA 1H9LB 5LGOA 2AMDA 1ZJKA 4AZ2B 1Z8GA 3VXFH 2FX4A 3ZZAA 1UTQA 3GY8A 1D3TB 2WV5A 2ZHDA 4XBCA 2Z3DA 1G30B 5EW1H 2WV4A 1QJ6B 3K9XB 4DCDA 5DO4H 2BX4A 1FMGA 4QT8C 5C2ZA 1HAXB 2FYQA 4Q80A 5C1UA 1BBRH 1WUNH 1J14A 1QRWA 3PWBA 2BVRH 5FAHA 2W3KA 3SNDA 4AG1A 2V35A 1D3PB 3OYPA 5I25A 1XXFA 2F9PA 5ESBA 2A4QA 2OTVA 1ZR0A 3MNSA 3A89A 8GCHG 1THPB 1UK2A 1C2LA 1C5VA 1P9SA 3FFGA 5LPFA 1TA6A 8GCHF 4MPVA 6CHAB 1O3KA 2W26A 1NY22 1GL1A 1AY6H 2VVCA 5F03A 2STBE 4ZKOU 4TPIZ 5LPEA 1BTUA 2BY6X 2IJOB 7GCHG 1P10A 1BMNH 2ZTZA 2BDCA 3UQVA 1CT0E 3SUEA 3TK5A 1O37A 7GCHF 1S83A 7KMEH 3GCOA 2Q6DA 4J2YB 4Q7YA 2ZU3A 3U8OH 3E3TA 1IQEA 1QY6A 1DWBH 4AOQA 1BTZA 4DURA 1HAPH 1RFNA 2ODYB 2P8OC 2BD5A 1S82A 1WBGB 2NU4E 4NSVA 1C2GA 2WPMS 1SGNE 3RXBA 4B1TA 1P03A 2UWLA 1C5WB 1KXFA 3A7ZA 3SOSA 1RTKA 1IOEA 1BTXA 1GBLA 1VCQA 2SGEE 3DFJA 5T6DA 1O31A 1BMAA 3MFJA 4MNXA 1P04A 1TALA 2DUCA 1TX7A 1V2LT 3SJ8A 1BHXF 1O38A 2QCYA 1ORFA 1KXCA 1V2NT 1GI5A 3ITIA 1O2JA 1C5XB 2QY0B 4YESB 2ZDVH 1ZLRA 1TNIA 4YT7H 4GCHG 3PMBB 1O2QA 3A88A 3M5NA 3V12A 1QL8A 2A5KA 5A8ZA 1YLDA 4GCHF 2OQ5A 1D6WA 1OXGA 3STIA 1Z7KA 2F9OA 4BXSA 2PTNA 4UFDH 1SLWB 3ATKA 2FOCA 4K8YA 2P95A 2PWXA 3GDUA 4NSYA 1ZYOA 2PV9B 1HJ9A 2OC8A 1G3EA 5FPTA 2ZHEH 2BQWB 4Y7BA 2HGTH 1O3NA 3ATLA 1ZRKA 1W14U 1LMWB 2J92A 1ETRH 1ARBA 1ABIH 5ETXA 1SFIA 2BLWA 1LO6A 1S84A 5EQQA 4ZKNU 1ANDA 2FLRH 1TA2A 1N6YA 1OWIA 4X0WU 1Y59T 5E0GA 3RMMH 4X1PU 1AVXA 4JMYA 2ANYA 1QJ7B 2P3UB 1MU6B 2H5CA 3BN9A 1CSOE 1YPKH 1PQAA 3LIWA 1OSSA 1ESTA 3K65B 1T4VH 1TWXB 1O5BB 1RIWB 2ZZUH 3SQHE 3RXGA 3VPKA 3M5OA 4LOYH 5DGJA 4DY7B 1GHYH 1CE5A 4XBBA 1MBMA 2BMGB 3FAOA 1HIAB 5A09A 4HTCH 1O5FH 4JZEH 2GCTB 1ESBA 2EC9H 1C1QA 2VJ1A 3ODDA 1VJAU 2CN0H 4U30A 2ZC9H 3FZZA 3S0NA 2ZPQA 2AMQA 3P70B 1SQTA 3TNSA 5ESTE 1QNJA 1PPZA 1GCTB 2A7CA 4GLYA 3ATWA 2H2ZA 1EAXA 3OTJE 1ELCA 2FM2A 3B23B 4NA7A 2HRVA 1UTJA 3QTVH 3PYHA 4B2BA 1C1UH 4DJZB 3LT3A 1A0LA 2C8WB 3UWIA 3QDZB 3KHVA 3ZZ3A 5DKMA 3SQEE 1MTWA 4DGJA 4MLFB 1MTNC 2FO9A 1DS2E 1Z8JB 1SB1H 1C1MA 1BIOA 2ZWLH 2OC1A 1KYNA 1LVMA 1WV7H 1DANH 2HLCA 4K69A 5ABWA 1GI9B 4FUGA 3ZVEA 2BLQA 1PFXC 3UOUA 2XCFA 4INLA 1SHHB 1Z1JA 5DP3A 2BQ6B 4ZH8A 1TBQH 3QLPH 1GMCG 1P2NA 1F92A 1SR5C 3VXEH 2VU8E 1RD3B 1DLKB 1V2JT 1UVTH 3T25A 1GMCF 1A0HB 3ZZ8A 2RDLA 1GI7B 4MPWA 2PUXB 2TGDA 2ZF0H 1HAOH 3QZRA 1HLTH 1HFDA 2ZIQH 1QHRB 1NPMA 1O3GA 1G3CA 1V2UT 2UWOA 2V3HH 3SGBE 3CS0A 5EOKA 3MH7A 2OLGA 1NRNH 1AWFH 1O2WA 2D26C 2ZGCA 4WXIA 1TPSA 3A7XA 2NU0E 1ZPCA 3ZV9A 1CA0B 1EPTB 2HOBA 1DUAA 2PSYA 3V3MA 2A1DB 2VGCB 5T3HA 1V2ST 3DD2H 2G52A 1UCYE 3DA9B 1OP8A 1SGQE 1O36A 2FZZA 4B73A 2ZGBH 5GXPA 2VIOA 4OS7A 4YM9A 1DLEA 3A8AA 4I8LA 4Z6AH 1KY9A 1NRRH 1NTPA 1SGTA 1BRCE 1MZAA 1A46H 1V2PT 1O2MA 1GGDC 5HGGA 1PPEE 1O34A 4OGYA 1P2MA 2ZPSA 1SGPE 1LTOA 2FX6A 4ZKSU 2FIRH 5JB9S 3SN8A 1CGHA 1TQ7B 4FVDA 4O97A 2O8TA 1NU9A 4ISHH 1QB9A 1MD7A 1BMMH 1L1GA 1S6FA 1O2PA 1DDJA 2EI7A 2GTBA 1MQ6A 1WTGH 4VGCC 3ESTA 2R0LA 3K2UA 1BTYA 1FN6A 4JYTA 3BTGE 2VNTA 1GBIA 3RXUA 1EOLA 4H6SB 1QBVH 4X6MA 4K3JA 1KXEA 2FWWA 1YC0A 2AGIX 1BTWA 5CHAB 2ZU5A 4CRGA 1OOKB 3I78A 1ETTH 3ZVAA 2C8XB 2FTMA 3P95A 3SV7A 1MCTA 3KN2A 3QN7A 3RU4D 3TJOA