3LGYA

R178a mutant of the degs-deltapdz protease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
213
structure length
179
Chain Sequence
STDETPASYNLAVRRAAPAVVNVYNRLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPGQTITQGIISATFLQTDASINHGNSGGALVNSLGELMGINTLPEGIGFAIPFQLATKIMDKLIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 36
structure length 179
sequence length 213
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgyA02
1F92A 4X1RU 1BHXF 2GVFA 2HOBA 1RTKA 1UTKA 3P8NA 1BBRK 1JIMA 2JETC 2G51A 4B74A 1GI8B 1G3CA 1C2MA 4GCHF 2FZZA 3GDUA 4X8VH 3HKIB 2VVVA 2QXHA 5DP4A 4BAOB 2CV3A 2Z7FE 5I46H 3ZV8A 3SUFA 2ODQA 1O2KA 2ZTXA 1MTVA 4DOQA 5C1XA 2WV4A 5FX5A 3O8RA 1LVMA 1AB9B 2BDBA 3MH7A 5DJ7A 3SHCH 1GBJA 3F9EA 3OTJE 1V2OT 3BN9A 5FPYA 1OWKA 5F8TA 2WPJS 1C5TA 4D9RA 1NFXA 2ZO3H 3MNBA 3GY5A 3VEQB 4ZKNU 1P2OA 1ZGVA 1WSSH 1D3PB 1SSXA 5K0HA 2ZU3A 1FLEE 4AG2A 1CE5A 4Q7YA 1QRWA 1T31A 4CHAB 2RG3A 2VB0A 1LPZB 3S69A 1SQAA 1K28D 3SQEE 2PSYA 5E8EH 3MTYA 1MTNC 1GI5A 4NGAH 1W0ZU 3BTGE 1O36A 4IN2A 1GGDB 2AIPA 2FI3E 4CRAA 1SGIB 2ZPRA 3G01A 4ZHMU 2FLRH 1GBLA 3M3TA 2Z3EA 1ZPZA 4WY3A 3PLBA 3SJ8A 2AERH 1AVXA 1AGJA 4JYTA 2R0KA 1Y8TA 4CRFA 1YM0A 1UVPA 1HJ8A 3RXHA 2Q1JA 1BTUA 1DICA 1GJBB 5PTPA 4X2WA 3A83A 3PMBB 3RC6A 3D62A 5I25A 3LGYA 1FN8A 5EODA 5K7RA 2CHAB 3BIUH 2QXIA 4MG3A 1SQTA 3RXJA 5DP6A 4TPIZ 2FI5E 1C1WH 1GJAB 2CF9H 3A7ZA 1SGFA 4X1NU 1K1NA 4X1SU 2GP9B 1GHYH 2BXTH 1IQFA 3GYMA 1GMCG 4JK6A 7GCHG 1AFQC 2KAIB 1H4WA 1Y3YA 3S9BA 2FIRH 2BB4A 3AW1A 3EA7A 1EZSC 2XXLA 2XRCA 3LPRA 1K9OE 4KTCA 4MPVA 4X1QU 2PTCE 4OS2A 1SHYA 1X7AC 4UDWH 1BJVA 3SNEA 4UD9H 1W13U 1SGCA 2EEKA 3QGNB 1MKXH 1L4DA 3SHAH 4YESB 3VB5A 2FI4E 2FLBH 3SJOA 3A81A 2DE8A 1O3FA 4KKDA 2Y5HA 1ABJH 5A09A 2AGEX 1WU1A 2OINA 5ESBA 4ZHAA 3PMJA 1GVLA 1BMLA 2QC2A 3BTWE 3TK9A 2TBSA 3EYDA 1UHBB 2P93A 3WY8A 2ZU5A 1F0UA 2JKHA 1O3IA 4IW4E 1QQ4A 3ODDA 1NRRH 1SGNE 1BTHH 3M7UA 2J4IA 1G3BA 1PPZA 1C4Y2 3ZVCA 5A8ZA 5FPTA 2FOMB 1CGHA 1QCPA 2ANWA 1O2UA 1NFWA 2EI7A 1T4UH 1F0SA 3GYLB 4RN6A 1BZXE 2VWMA 3A8BA 7LPRA 2ZQ1A 1OOKB 1GCTC 1BMNH 1C1OA 3C27B 3DHKH 2FTMA 4JYVH 1OXGA 1SGRE 1SGDE 1UCYE 1O3JA 1KXFA 1ETRH 2VGCB 3LIWA 3GY7A 2ZGBH 3RXSA 4A1XA 1CBWC 2THFB 1UTNA 1O3CA 2A2QH 1CT4E 1P04A 5EXMA 1V2ST 2V3OH 3RXFA 1O3EA 2D1JA 2OTVA 3VXFH 2HVXA 3W94A 1YKTA 1P2QA 1D6WA 1B0EA 3PMAB 2FWWA 2ZFQH 4DIIH 4O3TA 3K6ZA 4BAQB 1TIOA 2BM2A 1LQEA 2H5DA 2ALVA 5JYIA 1SFIA 5A0AE 3QZRA 1WQSA 1TMUH 2GCHG 2FYRA 4GHQA 1GBKA 3RXGA 1SLVB 2BD4A 1O3OA 4THNH 2OUAA 4Q2KA 3MWIU 5J4QA 2FXRA 1PPGE 3GCTG 1T8NA 2G5NA 4NIVA 3VGCC 1D3DB 2OQ5A 4OS6A 1INCA 1XVOA 1DUEA 1NFUA 1XUKA 1OWDA 4GPGA 2HPQH 3MH6A 3SNCA 2W5EA 3RM0H 1QL7A 3T26A 2BDGA 3UR6A 4CBNA 4IGDA 5AFZH 1KXEA 1HAOH 3BSQA 4CRBA 3L3TA 1PPBH 1O2LA 2FYQA 2TGAA 4IC6A 1GCDA 2BZAA 1MKWK 1A0HB 1XX9A 1Z8JB 3GOVB 1Q3XA 5EU8A 2W7UA 1DS2E 2I6SA 4ZHLU 1NO9H 2F9VA 2ZI2H 3SORA 1SGQE 1Z8GA 1XKBC 5T3HA 5GDSH 1NS3A 1MBMA 1YGCH 1AU8A 1GBTA 3FP7E 3ITIA 1KLTA 4BAHB 4A5TS 2ANYA 3ZZAA 3TGIE 1J14A 1A3EH 4ABHA 3F1SB 2NU4E 1AHTH 1G2LA 3LGWA 3SUDA 2OD3B 1P3EA 5C2ZA 3T29A 2O8WA 4H6TA 2Z94A 5GWZA 3PV4A 4GAWA 1OS8A 3SQHE 3U9AH 3QK1A 3SU1A 4INHA 1GI1A 2XBXA 2C93B 3ZVGA 2BQWB 1OSSA 4RSPA 5E0JA 4XDEA 3RU4E 1WV7H 2Z9GA 4MNVA 3SU2A 1DM4B 3U98H 4CBOA 2ZHDA 4SGBE 4YM9A 3RXLA 4MDSA 2XBVA 1ANBA 1WUNH 2ZEBA 2C90B 1TGSZ 3R3GB 8KME2 5EPYA 1LHDH 3MNXA 3MMGA 1UJ1A 4OS4A 5J4SA 2ASUB 1HAVA 1SI5H 1G36A 2AH4X 2OCVB 1EAIA 5A8XA 3P8FA 3HATH 1NM6A 3LGUA 2TIOA 3KQEA 3PYHA 1MAYA 3PWCA 2UUJB 4I31A 2Z9JA 4B1TA 1MTNB 2JH5D 3JZ2B 3Q76A 3MO6A 4Y6DA 2HGTH 1ELFA 1O2SA 1O2XA 4AGJA 2ZG0H 3CP7A 1Z71A 4CR9A 1AKSA 3SOSA 2TGDA 2OC0A 4AGKA 5AVDA 2QV1A 1GDUA 1QBVH 3GCTF 1F2SE 2OC7A 2D2DA 1CT2E 1DFPA 1V2KT 1BTWA 2PFEA 3FVFB 3LJJA 2QXJA 1A4WH 4MQAA 1JOUB 4E05H 1A5HA 2HRVA 5HMAA 2DE9A 3RMLH 3STIA 3NUMA 3RXAA 4JZDH 4TYDA 3RXDA 3ZZ8A 1CA0C 1IQGA 1C9PA 1NC6A 2FOFA 1GDQA 1JRSA 1BRAA 3M36A 4MVNA 3BTQE 2ZA5A 1H9LB 2Y81A 1IQIA 1FY5A 5C3NA 4AFUA 6GCHG 1ZZZA 2FS9A 2ZDVH 2AMPA 3RXKA 1E34B 1KYNA 1AFQB 1F0RA 1NN6A 2F9PA 2IOTA 1QRZA 2BVSH 3TNSA 3RP2A 3VB7A 1C5NH 2VWOA 1CA0B 2WPIS 2XC5A 1GMCF 1T8LA 2PUQH 1NPMA 1SVPA 4FUDA 2QA9E 1GJ7B 3KF2A 4B2BA 2SGFE 4UONA 1GJ6A 1XUJA 3A89A 3A87A 4NWKA 2CJIA 3SBKA 1HJAB 5ABWA 3RXTA 2D26C 4D9QA 4JZ1A 3O8BA 1HAZB 1UVTH 2A1DB 1ANDA 4FUBA 3W95A 1CO7E 5C67A 4H42U 2A0QB 4YLQH 1UVUH 5EG4A 1LTOA 1B0FA 1J9CH 2ZHFH 4K1TA 3R0FA 3BG8A 3TJUA 3I78A 2BLOA 1HAXB 1EP5A 1EAXA 2H9EH 1U6QA 4E7NA 1C5ZB 1ZJDA 2GKVE 3RXRA 1TNHA 3TGJE 1P2MA 4ZKSU 3BTKE 2STAE 1K1IA 1YPEH 3FP6E 3MI4A 4ZH8A 1O2YA 1FJSA 1KXAA 3ATKA 2GCTC 1GI6A 4YOJA 4LOYH 4X6PA 3ZZ5A 1EKBB 2P3FH 1QBOA 1FN6A 2FDAA 4ZXYH 1THRH 4O97A 1KXDA 2W7SA 5IDKA 1C1UH 2AGIX 1BDAA 2BTCE 1GBBA 1GVZA 1UO6A 5A0CA 4B2CA 2HLCA 4TY7A 1OKXA 2HPPH 2NU3E 1Z8RA 3S9AA 2P59A 2VVUA 4OS5A 1YLCA 2QN5T 5GXPA 2A4GA 2ZFRH 2ZTYA 1MD8A 2ZCLP 1THSH 2NWNA 1O2HA 4YT6H 5C5NA 3MU0A 3E91A 1SQOA 4X2VA 3K2UA 1P12E 4AX9H 4NA9H 1A5IA 1CA8B 2YNAA 4WMFA 4X2XA 2OQUA 1FQ3A 4KGAA 1EAWA 1HJAC 4X6MA 4XBCA 3AAVA 1OP0A 2OXSA 4OGYA 3PTBA 2RDLA 4Y8YA 3HPTB 1JXPA 3N7OA 2BQ6B 1GMHG 1GBFA 1OWJA 2ZZUH 1C2KA 3A8CA 3M5MA 3V12A 1WQVH 3UQVA 2H5CA 7ESTE 4I8GA 1FIZA 1C2FA 2V35A 1GHVH 3UNQA 1GHZA 1QIXB 1Q31A 1UTLM 2WPMS 2FS8A 1YPMH 1BQYA 1C5WB 4CRGA 1V2JT 2SGQE 3ATIA 1S6HA 1P11E 2BLWA 3ZVEA 3NZIA 3GY2A 1FONA 2F9NA 2ZTZA 1ELTA 2Y82A 1KXCA 1DWCH 1YCPK 2ZECA 4BNRA 2ZU2A 4U30A 3T5FH 1HIAB 4INLA 2LPRA 1O2MA 4ABFA 1A0JA 4YT7H 1GBCA 5F6MA 4BXSA 3RM2H 1TRYA 3Q3YA 4CH8B 1G32B 2B0FA 4Y71A 2BYAX 2XBYA 1S82A 1EZUC 1TWXB 1KDQB 2BZ6H 4D7FA 3LT3A 3O8CA 2WPLS 1ANEA 1C2GA 2B5TB 4Q80A 4AFZA 3ZZDA 3GDVA 3SN8A 1YPKH 4HGCA 1QURH 2VIVA 2JETB 4FUIA 1ABIH 2XC0A 3HK3B 3KN2A 3KQDA 5HXFA 3TVJB 1XUFA 1GBAA 1EPTC 1VGCC 5DO4H 3GISB 3SO3A 4AB8A 2J92A 3MH5A 4BOHA 3KL6A 1DWDH 6LPRA 2BD8A 4K1EA 3OX7U 1J15A 2ZP0H 3P17H 1DOJA 2SGPE 2H9TH 1XUGA 2A4QA 1SPJA 2XBWA 4B75A 2BLVA 1FMGA 5AFYH 5HM9A 2XWBI 1MTSA 1N8OC 2P95A 2PTNA 3OYPA 1PYTD 1TGTA 1EXFA 1WBGB 3TH4H 1DT2A 1HBTH 2TRMA 1O2GH 3HKJB 4IC5A 1W3CA 2ZWLH 1ZMJA 1TB6H 1UK4A 1K1MA 1AI8H 2Q6GA 4DJZB 1P2IA 2Z3CA 1G9IE 1FY1A 1HNEE 1BRBE 1HAVB 1OYTH 3ZZ9A 1BITA 2GCTB 2QYIA 6GCHF 5T6DA 4R0IA 1XMNB 3ATMA 5DP7A 5FXLA 3BTFE 2B9LA 1WTHD 5H4IB 5C1YA 1WCZA 1QJ6B 4B71A 1FPCH 1RJXB 4WWYA 5F8XA 4LK4A 2GGVB 1DWBH 1TNLA 4E7RG 2QY0B 1FPHH 4MNYA 3A82A 3M7TA 2C8ZB 4WF8A 1P2JA 1S85A 5AF9H 1C1TA 1CSOE 4KTUA 3A7XA 2J38A 1PQ5A 1EUFA 2Q6FA 2CGAA 2GMTC 2GCHF 2NU1E 3ESTA 5A8YA 1ESTA 4F49A 1V2WT 4Y7AA 1SGPE 1RRKA 4FVDA 2UWOA 1LHFH 1MTWA 2BVRH 4IMQA 4DY7B 3L33A 4RKJB 5CMXH 1NFYA 4A6LA 3SU6A 2FTLE 1FI8A 3EDXB 8GCHG 4ISLA 3RLWH 2G00A 4K60A 1P3CA 3GCOA 1TOCB 1HGTH 1LPKB 2VH6A 1IQKA 1QA7A 3LC5A 2O8TA 1O2PA 3UOPA 1DPOA 3SJIA 4U32A 1VITG 3VB3A 2FOBA 2F9BH 2CHAC 1B7XB 1TABE 1EZQA 3PM3A 5ESTE 3HGPA 1K1PA 3BEIB 4ABIA 1IOEA 1Y59T 3V7TA 1HB0B 1O3PB 4YLUA 2OBQA 2BY8X 1UK2A 3RLYH 4X6NA 3T25A 4LXBH 5JBCS 3BTEE 1JWTA 4DG4A 2FOAA 3M35A 8GCHF 2P94A 3PMHB 1CGJE 3BTME 1GVKB 2OLGA 1JMOH 3SNBA 1E38B 1MD7A 4NIYA 3GCHC 4WMDA 3VFEA 1A3BH 1HLTH 3GCHB 2FOCA 5JBBS 3ZZCA 1L0ZA 2SGAA 2Z9LA 5DPAA 3A86A 4NSYA 2P3UB 4ZUHA 4DGJA 3F9HA 5EXLA 1L1JA 2ZGCA 1S83A 3BTDE 1ORFA 2F3CE 1P09A 1ELBA 1P01A 4O3UA 1P9UA 1ELVA 5BRRE 1OWEA 4INKA 3DT0H 1W7GH 4JZFH 1HJ9A 1QFKH 3QO6A 1LHGH 2PGQB 3H7TA 2G55A 3UNRA 1O5GH 8ESTE 4LZ1H 3UWIA 2R3UA 3URCA 2EI6A 1KIGH 3PLPA 5E2OA 3SUGA 4FUCA 2YNBA 5EW2H 3V0XA 1GI2A 1TALA 2SGEE 5FCRA 1C5MD 2TPIZ 1M9UA 3TLOA 1QHRB 2VIOA 1HAPH 1G30B 3SGQE 4QT8C 1TPOA 3B9FH 1YBWA 3D23A 5JB8S 1DITH 4AB9A 1QTFA 1TA6A 1O5EH 3LH3A 4GHTA 4DW2U 3RXEA 2GT8A 2BDAA 2GX4A 1C4V2 1NRPH 2Y5GA 2OC1A 1GPZA 3E8LA 1LVBA 1C4U2 1PQAA 1S84A 1XUHA 3A84A 3ZZBA 5JBAS 5T6FA 1A46H 1AWHB 3UPEA 5L2YH 1LKAA 1T8OA 1W10U 4XBBA 4K69A 1LVOA 1GHBF 1HXEH 2VIQA 3C1KA 1BB0B 1O5CB 3U1IB 2BLQA 1SB1H 4NCYA 4CR5A 3IG6B 1BA8B 2PKAA 2ZIQH 5IYTA 3E16B 4JK5A 9LPRA 1S6FA 1FAXA 1TX6A 1D6RA 3KEEA 4YTAA 5GCHG 1MTUA 1QBNA 2ZFFH 5B6OA 1C9TA 1CU1A 1QNJA 2VU8E 4SGAE 3TH2H 4BTTB 3SJ9A 1H8DH 2SFAA 3ZVDA 3RXPA 2BD3A 1D4PB 3F9GA 3V3MA 3P70B 4I8HA 1EX3A 1ZRKA 2ZU4A 1WAYB 4TPYA 2C8XB 3A7TA 3S0NA 3TNTA 4IMZA 1H9IE 1GI9B 3MU8A 4NA7A 1RTFB 1S5SA 1ELGA 1D9IA 1YPGH 1W7XH 2WPHS 3DFJA 2A45B 3M5OA 5EQQA 1HAHH 3BEFB 3GY3A 1Q2WA 2PW8H 2ZHQH 1DUAA 1UVSH 2BY9X 2H1UA 4I8JA 2J95A 3I77A 1UTMA 1G3EA 1GBHA 1TPPA 1TBQH 3MU4A 2GT7A 2ZDKA 1MBQA 2F9UA 1RXPA 2AS9A 1DXPA 2RA3A 3VB4A 1O3NA 1Y3WA 2ZHEH 3MO3A 3FZZA 1BTPA 1QB6A 1AO5A 5EQRA 2A32A 1N1LA 1NRSH 1AD8H 1ZYOA 4YO9A 1EQ9A 4X1PU 3QTOH 4Y8ZA 2FP7B 1TQ7B 2V0BA 3IWMA 4H4FA 1ZSLA 2A7HA 1QL8A 1GMDG 3AAUA 1SLWB 1ZLRA 1QGFA 1LCYA 1W14U 2BY7X 4ESTE 3QZQA 1UCYH 2WYJA 3ZYDA 3A80A 1FY3A 1S0RA 2Q6DA 2BDCA 2UUYA 4R8TB 1Z1IA 3TJNA 3PWBA 5E0GA 1PYTC 3NKKA 1GJ8B 1V2TT 3RXUA 1CHOG 4ASHA 3SU0A 2A7JA 3SV2H 1TRMA 2QIQA 5HGGA 1DY8A 1MMJN 4FXGH 2AIQA 4BXWA 3LH1A 2FO9A 4FU9A 2QCYA 2GZ8A 2JH6D 4KELA 4AN7A 4ABAA 1WYKA 3K9XB 1AE5A 1O30A 1EJAA 1SLXB 3ODFA 2SNVA 1OX1A 3Q3KA 4Y11E 2CMYA 1DLKB 5GCHF 3FZDA 2VWLA 4BTUB 2SNWA 3D65E 2BOHB 1GI7B 1A2CH 4I8LA 1YP9A 1E37B 1ZR0A 3RDZA 4IBLH 3PLKA 2ZKSA 1IQEA 1C5QA 1OWHA 3LOXA 2Y7XA 3BIVH 1C1NA 3ZZ6A 1DDJA 2WYGA 4AG1A 3ATWA 1O2RA 2J2UA 3M61U 1VR1H 3LGIA 1S0QA 5GJ4B 3U8RH 3RMMH 1RS0A 2BDHA 3EAJA 3PO1B 1O39A 1ZRBA 2PR3A 1GJ5H 2FODA 1DXWA 5C20A 4A1TA 2A2XH 2Y80A 1H1BA 5CE1A 2F83A 2G81E 4AFSA 2AFQB 3FFGA 4Q7ZA 3QTVH 2P3TB 3K65B 1C5LH 2FOHA 5LPRA 1YCPH 1Y3XA 1IAUA 2VWNA 3QWCH 2Y5FA 1TLDA 1BMMH 1C1SA 1P10A 1SHHB 5CHAB 3UREA 1AUTC 1K21H 4HFPB 1XM1A 1KTSB 1NY22 1XUIA 3ATLA 4BTIB 3NXPA 1FV9A 1H8IH 1JBUH 5FX6A 2H6MA 1ETSH 1XXDA 1EASA 3GCNA 2GD4B 3ZYEA 1MQ5A 2GTBA 1EJMA 2ZC9H 4ZAEA 4JCNA 5C5OA 3U8TH 4VGCC 1O2IA 1O31A 2P8OC 2DUCA 2H9HA 1TA2A 1SR5C 3CS0A 1BCUH 5JB9S 4MLFB 2VJ1A 1F5KU 3NWUA 1A61H 3GY8A 1HAIH 1TPSA 1HRTH 5G4BA 1P06A 4XFQA 2QGRA 1GHAF 3LONA 3UNSA 4NG9H 3T28A 4U2WA 3SV8A 3A8DA 1BRUP 1KSNA 3RXCA 4U01A 3KQCA 3RU4D 1QRXA 1ARBA 3SV7A 2AEIH 5EGMA 1NRNH 1PPFE 1BBRH 1SL3A 1EAUA 1TRNA 3KNXA 1RD3B 1Z8IB 4H6SB 2TGPZ 4KTSA 4ZKRU 1MZDA 1AKSB 1DLEA 3ZZ4A 3P6ZB 1C1QA 5TJXA 1AFEH 3EQ0H 3ZVBA 1AIXH 4MNXA 4MPWA 4FUHA 1QY6A 3GY6A 1C2IA 1P0SH 1V2NT 2BX3A 5EOKA 4AFQA 1XKAC 1V2MT 1W11U 3ZZ7A 3M37A 1BHXB 1O3DA 1ELAA 4JYUH 3AASA 4UFGH 2F91A 1HV7A 1ZGIA 2HNTE 2GZ9A 4BAKB 5DKMA 2ANKH 2PV9B 1DANH 3QN7A 3MNSA 2IJOB 5FPSA 3NPSA 2YOLA 4ABEA 3BG4C 1ZHMA 3SU5A 2ILNA 1BUIA 1DX5M 3M5LA 4ABJA 3TGKE 5F03A 2R2MB 3MFJA 1GHBG 1O32A 4ZROA 1SOTA 4LZ4B 2VIDA 1Z6EA 3H5CB 2GMTB 3S7KB 3A7WA 1KTTB 4JZIA 5FBEA 2ZDNA 4KP0A 3ZZ3A 2ODYB 4JMYA 4FUJA 6ESTA 4DCDA 1J8AA 2SGDE 1P2NA 2PSXA 3T2NA 1YCPM 1B5GH 1V3XA 2VINA 1T32A 3MOCA 1CGIE 1O5DH 2RCEA 1W12U 2HNTC 1PPEE 1O34A 1O37A 1PFXC 2ANMH 4K2YA 1P9SA 1OWIA 5JBTA 3BTTE 1C5SA 1GBIA 1IHSH 1OPHB 1V6DA 3E3TA 3TITA 2GV6A 1UHBA 1C2HA 3A7YA 4DT7B 1MUEB 3SU4A 4D76A 1EOLA 1SFQB 3UUZA 3A7VA 3S9CA 2PHBA 1YPJH 1W8BH 1PQ7A 4M7GA 4X8TH 1G37A 2G8TA 4MPUA 4TWYA 1K1OA 4Z0KA 3HGNA 4OGXA 1RIWC 4DURA 1J16A 4UEHH 1O2WA 4IS5A 2G5VA 1EOJA 1SGTA 2ZFPH 1GJ9B 1ARCA 2A31A 3QX5H 3DFLA 4FU8A 2ZF0H 2QF0A 2BD5A 1P05A 1QJ7B 5DP8A 2R9PA 2VIPA 5CHAC 3K6YA 2P16A 1AWFH 3CENA 4VGCB 5L2ZH 1EJNA 4WH6A 1OYQA 2FPZA 3VXEH 1C5YB 3SNAA 1DY9A 1O3MA 1Z7KA 3F68H 4ZKOU 4IN1A 1C2JA 1N8OB 1C5RA 1Y5UT 3QDZB 1YYY1 2W3IA 3BEUA 2BY6X 3F6UH 5AHGH 1IQNA 3RMNH 3AW0A 3H7OA 2ESTE 4WMEA 1KY9A 1PJPA 1E35B 1ESBA 1TPAE 2VVCA 4WXIA 1P2KA 1RFNA 1GI3A 4FU7A 2ZDLA 4PROA 1EPTB 4FUFA 2O8MA 1N6YA 2WUCA 1VJAU 2JH0D 1UTOA 1FY4A 2XNIA 1ID5H 3LJOA 2WPKS 4UFEH 2OP9A 1P02A 1QR3E 5EQSA 2J9NA 1VITH 1GHWH 1SMFE 1GHXH 3HK6B 4B76A 2IN2A 1O3KA 3M7QA 3QUMP 3Q3XA 7KMEH 1L1GA 1A5GH 3EA9A 1O2QA 3RXMA 4WH8A 2G4UA 4Y7BA 2ODPA 4X2YA 1TE0A 3B8JA 1L2EA 4I33A 1PPHE 1V2UT 4NFEA 3UTUH 1FUJA 2J94A 3STJA 3VB6A 5L30H 3M5NA 3NCLA 3ZVFA 1BTYA 3A85A 1S81A 2CF8H 1T4VH 1T8MA 2A4RA 2GDEH 2OBOA 1F5RA 1L4ZA 2EA3A 3U69H 1FZZA 2KAIA 4A7IB 1HIAA 2ZQ2A 2J34A 1O2NA 5LPFA 1LHEH 2ZGJA 2ULLA 2Y6TA 1YF4A 3RU4T 5ETXA 4UFFH 3LDXH 2UWLA 1O2OA 5DK1A 3SNDA 1IQMA 1CVWH 1C2LA 1LHCH 1DWEH 2A7CA 4AYYB 4X8SH 2VIWA 1QJ1B 1GBEA 4ISHH 3KQBA 5DP9A 1BRCE 2BDYA 3SJKA 1GHAG 3OSYA 3RMOH 4NIXA 1SOZA 3MHWU 4Y0ZE 1C5PA 1GJDB 1MU8B 2GV7A 2ZNKH 3FANA 5TCAA 4CREA 1TMTH 3L6PA 5DG6A 2G4TA 1F0TA 3SZNA 1HAGE 5FHTA 4DVAU 4A92A 5JPMH 4K1SA 2C8WB 1CQQA 2QXGA 3M3SA 3SI4H 1H9HE 3OU0A 1ZMNA 4XSKU 3LC3A 1F5LA 1CBWB 3UQOA 1NROH 3PO1C 1O35A 4ISNA 1HAYB 1BBRE 5FCKA 4ISIH 4NWLA 1AUJA 2FESH 3P95A 3RC4A 2I6QA 1DVAH 1O2JA 3A8AA 4GLYA 2BY5X 4GVUA 4XE4A 4YOIA 5T6GA 3TIUA 5A0BA 1C1PA 3ENSB 1TNJA 3ZV9A 6CHAC 1EP6A 1ZPCA 4A1VA 4Y76A 1GJ4H 4NIWA 4CHAC 2WV5A 2ZHWH 1MZAA 3I29A 5HYOA 4NZQA 5EW1H 4WXVA 1THPB 4GUXA 5L6NH 1SGYE 2HWLB 2R2WU 3E6PH 1KLIH 1CHOF 3MH4A 1Z6JH 3BTHE 1Y3UA 4TY6A 4Z6AH 3GY4A 2ZFTA 3EE0B 4Y79A 2GZ7A 2V3HH 2A5AA 1WOFA 1K2I1 3BG4B 3Q77A 1BMAA 1O33A 2XCNA 1SG8B 1ZPBA 2PUXB 2BOKA 5A2MH 3SGBE 1O5AB 1BTZA 2BVXH 2RA0A 3P8OA 2G52A 1LDTT 1NRQH 1G3DA 1EZXC 1IHTH 3OY6U 5SGAE 4ZMAH 1RGQA 1NTPA 3UR9A 1UMAH 1GBDA 3QGJA 4Q7XA 4CH2B 1C1MA 1TONA 1JRTA 1GG6B 4K8BA 4YZUA 2A5IA 2VNTA 1QL9A 3LGTA 2BX4A 2FX4A 4ABDA 2PKAB 4Y0YE 1TQ0B 2Z9IA 1ZHPA 1P03A 1QB1A 1TGCA 1E36B 1AN1E 3ZVAA 1NZQH 1O3HA 2AMQA 1Y5AT 1KLJH 4BANB 4CRCA 3SU3A 1YLDA 1EB2A 2PGBB 1WTGH 2QAAA 2FMJA 2EC9H 1ZJKA 4MNWA 1G2MA 5C1UA 3AVZA 3Q00A 1P57B 1VCQA 1F7ZA 3RXIA 1EB1H 1GL0E 4B2AA 1GI4A 1EPTA 2VH0A 3FP8E 3GDSA 1UCYK 2HNTF 5GPIB 1Z1JA 1DSTA 1AMHA 2BMGB 2BHGA 4E06H 3RC5A 2FOGA 4JZEH 3EA8A 2Z3DA 4GSOA 2BDIA 5FAHA 3KIDU 1TAWA 3TJVA 2FOEA 2ZDMA 4GCHG 9ESTA 1W0YH 1AB9C 3MYWA 1GDNA 4Y8XA 1FY8E 1OP2A 1QB9A 2B8OH 4XOJA 5E2PA 3TK6A 1ZTKA 3UY9A 2GDDA 4X0WU 4I32A 3T27A 3KHVA 1V2PT 5DP3A 3A88A 1Y3VA 3B23B 1BIOA 2XWAA 1PPCE 4ZXXH 1GG6C 1HFDA 1VITF 2ZGHA 1JIRA 3CS7A 1GGDC 2BXUH 1HUTH 4ISOA 3TJOA 5DP5A 4K8YA 4J1YA 3UFAA 4D8NA 2ZDAH 1ACBE 4K3JA 2XCFA 2BD9A 1RTLA 2OC8A 1O2VA 4OS7A 1LKBA 3SI3H 2TGTA 1TFXA 1TGNA 2NU0E 3FAOA 1TYNA 3UWJH 2ZPSA 3SV9A 1FIWA 3DD2H 3P92A 3RXBA 1LVYA 3BF6H 1ELDE 2ZCHP 3IITA 1AQ7A 1TNGA 3URDA 3P8GA 1VCPA 2P8OB 1ELCA 1LQDB 1A0LA 2ZGXH 2O8UA 1K22H 1MQ6A 1KXBA 1GL1A 1UK3A 2PLXA 2ZPQA 3RXOA 3MNCA 1VCWA 2XW9A 2F9OA 4NA8A 1LMWB 1HPGA 1ELEE 2H2ZA 4HTCH 3SGAE 2M5TA 1TBRH 1NU9A 3MO9A 2B7DH 4UE7H 1C2DA 2AYWA 2O8LA 8LPRA 1AE8H 1D3QB 1ZMLA 1MAXA 5F8ZA 2AMDA 2D8WA 2FX6A 1HDTH 2PKSC 3TPIZ 1QA0A 3TU7H 3SUEA 1J17T 1KDQA 1O3BA 1MH0A 1NU7B 1ZTLA 2ZU1A 4WVPE 3PB1E 2PWXA 5HM2A 4HI3A 1NESE 1SLUB 3LKWA 2FM2A 1W2KH 3RUOA 7GCHF 4NSVA 2R3YA 2ZFSA 1ANCA 5EXNA 1IQJA 1YPLH 1GWAA 1V2QT 2WUBA 1VZQH 3MU5A 1O2ZA 1IQHA 1V2RT 3D49H 5DGJA 4ABGA 4BAMB 2UUFB 4TWWA 1XVMA 1QQUA 1LPGB 1GI0A 1UTQA 1C5VA 3DUXH 1ZOMA 3KCGH 5EPNA 1O3GA 4MPXA 1UTPA 2LNCA 1C2EA 2BQ7B 3ELAH 1V2LT 4AOQA 2R0LA 5E0HA 2C3SA 4UFDH 1IQLA 1DE7H 1A7SA 1TBZH 4AZ2B 1ETTH 1MCTA 3E0PB 4CRDA 5LH8A 2C4FH 3LU9B 2HALA 4FUEA 4O03A 5GIBA 3DA9B 1O3LA 4RKOB 1O38A 4MTBA 3RXQA 1O0DH 1CT0E 4X8UH 1O5FH 1DSUA 1OP8A 3T62A 1FAKH 3LGVA 1T7CA 3U1JB 4DIHH 1ZTJA 2W3KA 1HCGA 1TNKA 1P8VC 1YC0A 2XTTB 2XYAA 4WJG2 1AVWA 2UUKB 3F9FA 1A1RA 6CHAB 2NU2E 3E0NB 4F4OC 2WINI 1LO6A 2FEQH 1MCVA 3RXVA 1TOMH 1GBMA 1GMHF 1K1LA 3E90B 2Y7ZA 1SBWA 2W26A 4HZHA 1RIWB 1BT7A 3EGKH 3V13A 5TCCA 1CHGA 2A5KA 1HYLA 1D3TB 1GCTB 4I8KA 1C5XB 1O3AA 3SW2B 1UTJA 5JDUB 3KGPA 2CXVA 1VGCB 1N6XA 1YPHC 4I7YH 3QLPH 1BJUA 1O2TA 1XXFA 1AVGH 4X6OA 3O8DA 2ALPA 4O9VA 2Z9KA 2VGCC 4OS1A 2AGGX 1VJ9U 1SC8U 2EI8A 2QF3A 4XBDA 1ESAA 4NFFA 1K1JA 3TH3H 1TX8A 1TX7A 4ABBA 1GMDF 2A4OA 3UOUA 1ZHRA 4B73A 3NK8A 1YPHE 1NT1A 4YOGA 2STBE 2BD2A 2BD7A 2O9QA 3PTNA 1AY6H 1MKXK 1MKWH 1BTXA 1UVOA 5BPEA 1V2VT 1FNIA 3VPKA 3TK5A 1MU6B 3SV6A 1AZZA 1C1VH 2V6NA 2UWPA 2ZCKP 1BOQA 3VGCB 1L1NA 3OY5U 3E1XB 4J2YB 2PKSB 3PROA 1AZ8A 1Y5BT 1ZSJA 4D7GA 1C5OH 3GICB 1O5BB 1C1RA 1TNIA 5FBIA 2K1QA 2CN0H 4AORA 4FUGA 1SGEE 1FXYA 1FDPA 1PQ8A 1EATA 2IPHA 1ZSKA 1TGBA 1SGFG 1C5UA 3MU1A 3BV9B 4K5ZA 1E0FD 3U8OH 3JZ1B 2C8YB 4FVBA 5LPEA 5LGOA 1GJCB 3S7HB 1HXFH 1TMBH 2Z6BD 3UIRA 4NZLA 4AYVB 2XC4A 3M3VA 4Y10E
chains in the Genus database with same CATH superfamily
1F92A 4X1RU 1BHXF 2GVFA 2HOBA 1RTKA 1UTKA 3P8NA 1BBRK 1JIMA 2JETC 2G51A 4YXWD 4B74A 1GI8B 1G3CA 1C2MA 4GCHF 2FZZA 3GDUA 4X8VH 3HKIB 2VVVA 2QXHA 5DP4A 4BAOB 2CV3A 2Z7FE 5I46H 3ZV8A 3SUFA 2ODQA 1O2KA 2ZTXA 1MTVA 4DOQA 5C1XA 2WV4A 5FX5A 3O8RA 1LVMA 1AB9B 2BDBA 3MH7A 5DJ7A 3SHCH 1GBJA 3F9EA 3OTJE 1V2OT 3BN9A 5FPYA 1OWKA 5F8TA 2WPJS 1C5TA 4D9RA 1NFXA 2ZO3H 3MNBA 3GY5A 3VEQB 4ZKNU 1P2OA 2CK3D 1ZGVA 1WSSH 1D3PB 1SSXA 5K0HA 2ZU3A 1FLEE 2JIZD 1CE5A 3KYGA 4Q7YA 4AG2A 1QRWA 1T31A 4CHAB 2RG3A 3H09A 5IK2D 2VB0A 1LPZB 3S69A 1SQAA 1K28D 3SQEE 2PSYA 5E8EH 3MTYA 1MTNC 1GI5A 4NGAH 1W0ZU 3BTGE 2HLDD 1O36A 4IN2A 1GGDB 2AIPA 2FI3E 4CRAA 1SGIB 2ZPRA 3G01A 4ZHMU 2FLRH 1GBLA 3M3TA 2Z3EA 1ZPZA 4WY3A 3PLBA 3SJ8A 2AERH 1AVXA 1YY3A 1AGJA 4JYTA 2R0KA 1Y8TA 4CRFA 1YM0A 1UVPA 2WV9A 1HJ8A 3RXHA 2Q1JA 1BTUA 1DICA 1GJBB 5PTPA 4X2WA 3A83A 3PMBB 3RC6A 3D62A 5I25A 3LGYA 1FN8A 5EODA 5K7RA 2CHAB 3BIUH 3PRBA 2QXIA 4MG3A 1SQTA 3RXJA 5DP6A 4TPIZ 2FI5E 4FOUC 1C1WH 1GJAB 2CF9H 3A7ZA 1SGFA 4X1NU 1K1NA 5C17A 4X1SU 2GP9B 1GHYH 2BXTH 1IQFA 3GYMA 1GMCG 4JK6A 7GCHG 1AFQC 2KAIB 1H4WA 1Y3YA 3S9BA 2FIRH 2BB4A 3AW1A 3EA7A 1EZSC 2XXLA 2XRCA 3LPRA 1K9OE 4KTCA 4MPVA 4X1QU 2PTCE 4OS2A 1SHYA 1X7AC 4UDWH 1BJVA 3SNEA 4UD9H 5KGOA 1W13U 1SGCA 2EEKA 3QGNB 1MKXH 1L4DA 3SHAH 4YESB 3VB5A 2FI4E 2FLBH 1SQRA 3SJOA 3A81A 2DE8A 3NRLA 1O3FA 4KKDA 2Y5HA 1ABJH 5A09A 2AGEX 1WU1A 2OINA 5ESBA 4ZHAA 3PMJA 1GVLA 1BMLA 2QC2A 3BTWE 3TK9A 2TBSA 3EYDA 1UHBB 2P93A 3WY8A 2ZU5A 1F0UA 1FX0B 5CDFE 2JKHA 1O3IA 4IW4E 1QQ4A 3ODDA 1NRRH 1SGNE 1BTHH 3M7UA 2J4IA 1G3BA 1PPZA 1C4Y2 3PRDA 3ZVCA 5A8ZA 5FPTA 2FOMB 1CGHA 1QCPA 2ANWA 1O2UA 1NFWA 2EI7A 1T4UH 1F0SA 3GYLB 4RN6A 1BZXE 2VWMA 3A8BA 7LPRA 2ZQ1A 1OOKB 3FN8A 1GCTC 1BMNH 1C1OA 3C27B 3DHKH 2FTMA 4JYVH 1OXGA 1SGRE 1SGDE 1UCYE 1O3JA 1KXFA 1ETRH 2VGCB 3LIWA 3GY7A 2ZGBH 3RXSA 4A1XA 1CBWC 1MABB 2THFB 1UTNA 4DT4A 1O3CA 2A2QH 1CT4E 1P04A 5EXMA 1V2ST 2V3OH 3RXFA 1O3EA 2D1JA 2OTVA 3VXFH 2HVXA 3W94A 1YKTA 1P2QA 1D6WA 5KECA 1E79D 1B0EA 2L74A 2FWWA 3PMAB 5C94A 2ZFQH 4DIIH 4O3TA 3K6ZA 4BAQB 1TIOA 4AC9A 3N7EA 2BM2A 1LQEA 2H5DA 2ALVA 5JYIA 5KEDA 1SFIA 5A0AE 3QZRA 1WQSA 1TMUH 2GCHG 2FYRA 4GHQA 1GBKA 3RXGA 1SLVB 2BD4A 1O3OA 4THNH 2OUAA 4Q2KA 3MWIU 5J4QA 2FXRA 1PPGE 3GCTG 1T8NA 2G5NA 4NIVA 3VGCC 1D3DB 2OQ5A 4OS6A 1INCA 1XVOA 1DUEA 1NFUA 1XUKA 1WXRA 1OWDA 4GPGA 5CHBA 2HPQH 3MH6A 3SNCA 2W5EA 3RM0H 1QL7A 3T26A 2BDGA 3UR6A 4CBNA 4IGDA 5AFZH 1KXEA 1HAOH 3BSQA 4CRBA 3L3TA 1PPBH 1O2LA 2FYQA 2TGAA 4IC6A 1GCDA 2BZAA 1MKWK 1A0HB 1XX9A 1Z8JB 3GOVB 1Q3XA 5EU8A 2W7UA 1DS2E 2I6SA 4ZHLU 1NO9H 2F9VA 5DN6D 2ZI2H 3SORA 1SGQE 1Z8GA 1XKBC 5T3HA 5GDSH 1NS3A 1MBMA 1YGCH 2W6JD 1AU8A 1GBTA 3FP7E 3ITIA 1KLTA 4BAHB 4A5TS 2ANYA 3ZZAA 3TGIE 1J14A 1A3EH 4ABHA 3F1SB 2NU4E 1AHTH 1G2LA 3LGWA 3SUDA 2OD3B 1P3EA 5C2ZA 3T29A 2O8WA 4H6TA 2Z94A 5GWZA 3PV4A 4GAWA 1OS8A 3SQHE 3U9AH 3QK1A 3SU1A 4INHA 1GI1A 2XBXA 3WWBA 2C93B 3ZVGA 2BQWB 1OSSA 4RSPA 5E0JA 3CNRA 4XDEA 3RU4E 3UB0A 1WV7H 2Z9GA 4MNVA 3SU2A 1DM4B 2VBCA 3U98H 2ZHDA 4SGBE 4YM9A 4CBOA 3RXLA 4MDSA 2XBVA 1ANBA 1WUNH 2ZEBA 5EJ1A 2C90B 1TGSZ 3R3GB 8KME2 5EPYA 1LHDH 3MNXA 3MMGA 2OK5A 1UJ1A 4OS4A 5J4SA 2ASUB 1HAVA 2KZ4A 1SI5H 1G36A 2AH4X 2OCVB 1H8HD 1EAIA 5A8XA 3P8FA 3HATH 1NM6A 3LGUA 2TIOA 3KQEA 3PYHA 1MAYA 3PWCA 2UUJB 4I31A 2Z9JA 4B1TA 1MTNB 2JH5D 3JZ2B 3Q76A 3MO6A 3N7DA 4Y6DA 2HGTH 1ELFA 1O2SA 1O2XA 4AGJA 2ZG0H 3CP7A 1Z71A 4CR9A 1AKSA 3SOSA 2TGDA 2OC0A 4AGKA 5AVDA 2QV1A 1GDUA 1QBVH 3GCTF 1F2SE 2OC7A 2D2DA 1CT2E 1DFPA 1V2KT 1BTWA 2PFEA 3FVFB 3LJJA 2QXJA 1A4WH 4MQAA 1JOUB 4E05H 1A5HA 2HRVA 5HMAA 2DE9A 3RMLH 3STIA 3NUMA 3RXAA 4JZDH 4TYDA 3RXDA 3ZZ8A 1CA0C 1IQGA 1C9PA 1NC6A 2FOFA 1GDQA 1JRSA 1BRAA 3M36A 4MVNA 3BTQE 2ZA5A 1H9LB 2Y81A 1IQIA 1FY5A 2WHXA 5C3NA 4AFUA 6GCHG 1ZZZA 2FS9A 2ZDVH 2AMPA 3RXKA 1E34B 1KYNA 1AFQB 1F0RA 1NN6A 2F9PA 2IOTA 1QRZA 2BVSH 3TNSA 3RP2A 3VB7A 1C5NH 2VWOA 1CA0B 2WPIS 2V3MA 2XC5A 1GMCF 1T8LA 2JJ1D 2PUQH 1NPMA 1SVPA 4FUDA 2QA9E 1GJ7B 3KF2A 4B2BA 2SGFE 4UONA 1GJ6A 1XUJA 3A89A 3A87A 4NWKA 2CJIA 3SBKA 1HJAB 5ABWA 3RXTA 2D26C 4D9QA 4JZ1A 3O8BA 1HAZB 5HIZA 1UVTH 2A1DB 1ANDA 4FUBA 3W95A 1CO7E 5C67A 4H42U 2A0QB 4YLQH 4RI0A 1UVUH 5EG4A 1LTOA 1B0FA 1J9CH 2ZHFH 4K1TA 3R0FA 3BG8A 3TJUA 3I78A 2BLOA 1HAXB 1EP5A 1EAXA 2H9EH 1U6QA 4E7NA 1C5ZB 1ZJDA 2RDEA 2GKVE 3DSPA 3RXRA 1TNHA 3TGJE 1P2MA 4ZKSU 5HKKD 3BTKE 2STAE 4HG6A 1K1IA 1YPEH 3FP6E 3MI4A 4ZH8A 1O2YA 1FJSA 1KXAA 3ATKA 2GCTC 1GI6A 4YOJA 4LOYH 4X6PA 3ZZ5A 1EKBB 2P3FH 1QBOA 1FN6A 2FDAA 4ZXYH 1THRH 4O97A 1KXDA 2W7SA 5IDKA 1C1UH 2AGIX 1BDAA 2BTCE 1GBBA 1GVZA 1UO6A 5A0CA 4B2CA 2HLCA 4TY7A 1OKXA 2HPPH 2NU3E 1Z8RA 3S9AA 2P59A 2VVUA 4OS5A 1YLCA 2QN5T 5GXPA 2A4GA 2ZFRH 2ZTYA 1MD8A 4Q63A 2ZCLP 1THSH 2NWNA 1O2HA 4YT6H 5C5NA 3MU0A 3E91A 1SQOA 4X2VA 3K2UA 1P12E 5DSFA 4AX9H 4NA9H 1A5IA 3W1EA 1CA8B 2YNAA 4WMFA 4X2XA 2OQUA 1FQ3A 4KGAA 1EAWA 1HJAC 4X6MA 4XBCA 3AAVA 1OP0A 2OXSA 4OGYA 3PTBA 2RDLA 4Y8YA 3HPTB 1JXPA 3N7OA 2BQ6B 1GMHG 1GBFA 1OWJA 2ZZUH 1C2KA 3A8CA 3M5MA 3V12A 1WQVH 3UQVA 2H5CA 7ESTE 4I8GA 1FIZA 2L6OA 1C2FA 2V35A 1GHVH 3UNQA 1GHZA 1QIXB 1Q31A 1UTLM 2WPMS 2FS8A 1YPMH 1BQYA 1C5WB 4CRGA 1V2JT 2SGQE 3ATIA 1S6HA 1P11E 2BLWA 3ZVEA 3NZIA 3GY2A 1FONA 2F9NA 2ZTZA 1ELTA 2Y82A 1KXCA 1H8ED 1DWCH 1YCPK 2ZECA 4BNRA 2ZU2A 4U30A 2K8IA 3T5FH 1HIAB 4INLA 2LPRA 1O2MA 3OE7D 4ABFA 2QF5A 1A0JA 4YT7H 1GBCA 5F6MA 4BXSA 3RM2H 1TRYA 3Q3YA 4CH8B 1G32B 2B0FA 4Y71A 2BYAX 2XBYA 1S82A 1EZUC 1TWXB 1KDQB 2BZ6H 4D7FA 3LT3A 3O8CA 2WPLS 1ANEA 1C2GA 2B5TB 4Q80A 4AFZA 4Z1MD 3ZZDA 3GDVA 3SN8A 1YPKH 4HGCA 1QURH 2VIVA 2JETB 2KX4A 4FUIA 1ABIH 2XC0A 3HK3B 3KN2A 3KQDA 5HXFA 3TVJB 1XUFA 1GBAA 1EPTC 1VGCC 5DO4H 3GISB 1W0KD 3SO3A 4AB8A 2J92A 3MH5A 4BOHA 3KL6A 1DWDH 6LPRA 2BD8A 3WWFA 4K1EA 3OX7U 5T1VA 1J15A 2ZP0H 3P17H 1DOJA 2SGPE 2H9TH 1XUGA 3MQKC 2A4QA 1SPJA 2XBWA 4B75A 2BLVA 1FMGA 5AFYH 5HM9A 2XWBI 1MTSA 1N8OC 2P95A 2PTNA 3OYPA 1PYTD 1TGTA 1EXFA 1WBGB 4F55A 3TH4H 1DT2A 1HBTH 2TRMA 1O2GH 3HKJB 4IC5A 1W3CA 2ZWLH 1ZMJA 1TB6H 1UK4A 1K1MA 1AI8H 2Q6GA 4DJZB 1P2IA 2Z3CA 1G9IE 1FY1A 1HNEE 1BRBE 1HAVB 1OYTH 3ZZ9A 2J98A 1BITA 2GCTB 2QYIA 6GCHF 5T6DA 4R0IA 1XMNB 3ATMA 5DP7A 5FXLA 3BTFE 2B9LA 1WTHD 5H4IB 5C1YA 1WCZA 1QJ6B 4B71A 1FPCH 1RJXB 4WWYA 5F8XA 4LK4A 2GGVB 1DWBH 1TNLA 4E7RG 2QY0B 1FPHH 4MNYA 3A82A 3M7TA 2C8ZB 4WF8A 2LP6A 1P2JA 1S85A 5AF9H 1C1TA 1CSOE 4KTUA 3A7XA 2J38A 1PQ5A 1EUFA 2Q6FA 2CGAA 2GMTC 2GCHF 2NU1E 3ESTA 5A8YA 1ESTA 4F49A 1V2WT 4Y7AA 1SGPE 1RRKA 4FVDA 4P02A 2UWOA 1LHFH 1MTWA 2BVRH 4IMQA 4DY7B 3L33A 4RKJB 5CMXH 1NFYA 4A6LA 1BMFD 3SU6A 2FTLE 1FI8A 3EDXB 8GCHG 4ISLA 3RLWH 2G00A 4K60A 1P3CA 3GCOA 1TOCB 1HGTH 1LPKB 2VH6A 1IQKA 1QA7A 3LC5A 2O8TA 1O2PA 3UOPA 1DPOA 3SJIA 4U32A 1VITG 3VB3A 2FOBA 2F9BH 2CHAC 1B7XB 1TABE 1EZQA 3PM3A 5B6LA 5ESTE 3HGPA 1K1PA 3BEIB 4ABIA 1IOEA 3EE7A 1Y59T 3V7TA 1HB0B 1O3PB 4YLUA 2OBQA 2BY8X 1UK2A 3RLYH 4X6NA 3PV5A 3T25A 4LXBH 5JBCS 3BTEE 4XRNA 1JWTA 4DG4A 2FOAA 3M35A 4ZCNA 8GCHF 2P94A 1KMHB 3PMHB 1CGJE 3BTME 1GVKB 4Q4LA 2OLGA 1JMOH 3SNBA 1E38B 1MD7A 4NIYA 3GCHC 4WMDA 3VFEA 1A3BH 1HLTH 3GCHB 2FOCA 5JBBS 3ZZCA 1L0ZA 2SGAA 2Z9LA 5DPAA 3A86A 2KCOA 4NSYA 2P3UB 4ZUHA 4DGJA 3F9HA 5EXLA 1L1JA 2ZGCA 1S83A 2F4LA 3BTDE 1ORFA 2F3CE 1P09A 2YMSB 1ELBA 1P01A 4O3UA 1P9UA 2HVYB 1ELVA 5BRRE 1OWEA 4INKA 3DT0H 1W7GH 4JZFH 1HJ9A 1QFKH 3QO6A 1YLNA 1LHGH 2PGQB 3H7TA 2G55A 3UNRA 1O5GH 8ESTE 1QZ8A 4LZ1H 3UWIA 3DCLA 2R3UA 3FKSD 3KYFA 3URCA 2EI6A 4ASUD 1KIGH 3PLPA 5E2OA 3SUGA 4FUCA 2YNBA 5EW2H 3V0XA 1GI2A 1TALA 3OEED 2SGEE 5FCRA 1C5MD 2TPIZ 1M9UA 3TLOA 1QHRB 2VIOA 1HAPH 1G30B 3SGQE 4QT8C 1SKYE 1TPOA 3B9FH 1YBWA 3D23A 5JB8S 1DITH 4AB9A 4B6EA 1QTFA 1TA6A 1O5EH 3LH3A 4GHTA 4DW2U 3RXEA 2GT8A 2BDAA 2GX4A 1C4V2 1NRPH 2Y5GA 2OC1A 1GPZA 3E8LA 1LVBA 1C4U2 1PQAA 1S84A 1XUHA 3A84A 3ZZBA 5JBAS 5T6FA 1A46H 1AWHB 3UPEA 5L2YH 1LKAA 1T8OA 1W10U 4XBBA 4K69A 1LVOA 1GHBF 1HXEH 2VIQA 3C1KA 1BB0B 1O5CB 3U1IB 2BLQA 1SB1H 4NCYA 4CR5A 3IG6B 1BA8B 2PKAA 2ZIQH 5IYTA 3E16B 4JK5A 9LPRA 1S6FA 1FAXA 1TX6A 1D6RA 3KEEA 4YTAA 5GCHG 1MTUA 1QBNA 2ZFFH 5B6OA 1C9TA 1CU1A 1QNJA 2VU8E 4SGAE 3TH2H 4BTTB 2K0QA 3SJ9A 1H8DH 2SFAA 3ZVDA 3RXPA 2BD3A 1D4PB 3F9GA 3V3MA 3P70B 4I8HA 1EX3A 1ZRKA 2ZU4A 1WAYB 4TPYA 2C8XB 3A7TA 3S0NA 3TNTA 4IMZA 1H9IE 1GI9B 3MU8A 3OFND 5F53A 4NA7A 1RTFB 1S5SA 1ELGA 1D9IA 1YPGH 1W7XH 2WPHS 3DFJA 2A45B 4B6FA 3M5OA 5EQQA 1HAHH 3BEFB 3GY3A 1Q2WA 2PW8H 2ZHQH 1DUAA 1UVSH 2BY9X 2H1UA 4I8JA 3U28C 4ACAA 2J95A 3I77A 1UTMA 1G3EA 1GBHA 1TPPA 1TBQH 3MU4A 2GT7A 2ZDKA 1MBQA 2F9UA 2KCPA 1RXPA 2AS9A 1DXPA 3F2GA 2RA3A 3VB4A 1O3NA 1Y3WA 2ZHEH 3MO3A 3FZZA 1BTPA 1QB6A 1AO5A 5EQRA 2A32A 1N1LA 1NRSH 1AD8H 1ZYOA 4FETA 4YO9A 1EQ9A 4X1PU 3QTOH 4Y8ZA 2FP7B 1TQ7B 2V0BA 3IWMA 4H4FA 1ZSLA 2A7HA 1QL8A 1GMDG 3AAUA 4OM9A 1SLWB 1ZLRA 1QGFA 1LCYA 1W14U 2BY7X 4ESTE 3QZQA 1UCYH 2WYJA 3ZYDA 3A80A 1FY3A 1S0RA 2Q6DA 2BDCA 2UUYA 4R8TB 3N99A 1Z1IA 1W0JD 3TJNA 3PWBA 5E0GA 1PYTC 3NKKA 1GJ8B 1V2TT 3RXUA 4TT3D 1CHOG 4ASHA 3SU0A 2A7JA 3SV2H 1TRMA 2QIQA 5HGGA 1DY8A 2M2AA 1MMJN 4FXGH 2AIQA 4BXWA 3LH1A 2FO9A 4FU9A 2QCYA 2GZ8A 2JH6D 4KELA 4AN7A 4ABAA 1WYKA 3K9XB 1AE5A 1O30A 1EJAA 1SLXB 3F0OA 3ODFA 3SZEA 1YWUA 2SNVA 1OX1A 3Q3KA 2KR7A 4Y11E 2CMYA 1DLKB 5GCHF 3FZDA 2VWLA 4BTUB 2SNWA 3D65E 2BOHB 1GI7B 1A2CH 4I8LA 1YP9A 1E37B 1ZR0A 3RDZA 4IBLH 3PLKA 2ZKSA 1IQEA 1C5QA 1OWHA 3LOXA 2Y7XA 3BIVH 1C1NA 1WDIA 1DDJA 2WYGA 3ZZ6A 3ATWA 4AG1A 1O2RA 2J2UA 3F3BA 3M61U 1VR1H 3LGIA 1S0QA 5GJ4B 3U8RH 3RMMH 1RS0A 2BDHA 3EAJA 3PO1B 1O39A 1ZRBA 2PR3A 1GJ5H 2FODA 1DXWA 5C20A 4A1TA 2A2XH 2Y80A 1H1BA 5CE1A 2F83A 2G81E 4AFSA 2AFQB 3FFGA 4Q7ZA 3QTVH 2P3TB 3K65B 1C5LH 2FOHA 5LPRA 1YCPH 1Y3XA 1IAUA 2VWNA 2QF4A 2Y5FA 1TLDA 3QWCH 1BMMH 1C1SA 1P10A 1SHHB 5CHAB 3UREA 1AUTC 1K21H 4HFPB 1XM1A 1KTSB 1NY22 1XUIA 3ATLA 4BTIB 3NXPA 1FV9A 1H8IH 1JBUH 5FX6A 2H6MA 1ETSH 1XXDA 1E1RD 1EASA 3GCNA 2GD4B 3ZYEA 1MQ5A 2GTBA 1EJMA 2ZC9H 4ZAEA 4JCNA 5C5OA 3U8TH 4VGCC 1O2IA 1O31A 2P8OC 2DUCA 2H9HA 1TA2A 1SR5C 3CS0A 1BCUH 5JB9S 4MLFB 2VJ1A 1F5KU 2KCAA 2WSSD 1A61H 3GY8A 3NWUA 1HAIH 1TPSA 1HRTH 4P00A 5G4BA 1P06A 4XFQA 2QGRA 1GHAF 3LONA 3UNSA 4NG9H 3T28A 4U2WA 3SV8A 3A8DA 1BRUP 1KSNA 3RXCA 4U01A 3KQCA 3RU4D 1QRXA 1ARBA 3SV7A 2AEIH 5EGMA 1NRNH 1PPFE 2YMSC 1BBRH 1SL3A 1EAUA 1TRNA 3KNXA 1RD3B 1Z8IB 4H6SB 2TGPZ 4KTSA 4ZKRU 1MZDA 1AKSB 5EJZA 1DLEA 3ZZ4A 3P6ZB 1C1QA 5TJXA 1AFEH 3DSGA 3EQ0H 3ZVBA 1AIXH 4MNXA 4MPWA 4FUHA 1QY6A 3GY6A 1C2IA 1P0SH 1V2NT 2BX3A 5EOKA 4AFQA 1XKAC 1V2MT 1W11U 3ZZ7A 3M37A 1BHXB 1O3DA 1ELAA 3OEHD 4JYUH 3AASA 4UFGH 2F91A 1HV7A 1ZGIA 2HNTE 2GZ9A 4BAKB 5DKMA 2ANKH 2PV9B 2WZQA 1DANH 3QN7A 3MNSA 2IJOB 5EIYA 5FPSA 3NPSA 2YOLA 4ABEA 3BG4C 1ZHMA 3SU5A 2ILNA 1BUIA 1DX5M 3M5LA 4ABJA 3TGKE 3ZIAD 5F03A 2R2MB 3MFJA 1GHBG 1O32A 4ZROA 1SOTA 4LZ4B 2VIDA 1Z6EA 3H5CB 2GMTB 3S7KB 3A7WA 1KTTB 4JZIA 5FBEA 2ZDNA 4KP0A 3ZZ3A 2ODYB 4JMYA 4FUJA 6ESTA 4DCDA 3UAIC 1J8AA 2SGDE 1P2NA 2PSXA 3T2NA 1YCPM 1B5GH 1V3XA 2VINA 1T32A 3MOCA 1CGIE 1O5DH 2RCEA 1W12U 2HNTC 1PPEE 1O34A 1O37A 1PFXC 2ANMH 4K2YA 1P9SA 1OWIA 5JBTA 3BTTE 1C5SA 5EJLA 1GBIA 1IHSH 1OPHB 1V6DA 3E3TA 3TITA 2GV6A 1UHBA 1C2HA 3A7YA 4DT7B 1MUEB 3SU4A 4D76A 1EOLA 1SFQB 3UUZA 3A7VA 3OTPA 3S9CA 2PHBA 1YPJH 1W8BH 1PQ7A 4M7GA 4X8TH 1G37A 2G8TA 4MPUA 4TWYA 1K1OA 4Z0KA 3HGNA 4OGXA 1RIWC 2EY4C 4DURA 1J16A 4UEHH 1O2WA 4IS5A 2G5VA 1EOJA 1SGTA 2ZFPH 1GJ9B 1ARCA 2A31A 3QX5H 3DFLA 4FU8A 2ZF0H 2QF0A 2BD5A 1P05A 1QJ7B 5DP8A 2R9PA 2VIPA 5CHAC 3K6YA 2P16A 1AWFH 3CENA 4VGCB 5L2ZH 1EJNA 4WH6A 2J98B 1OYQA 2FPZA 3VXEH 1C5YB 3SNAA 1DY9A 1O3MA 1Z7KA 3F68H 4ZKOU 4IN1A 1C2JA 1N8OB 1C5RA 1Y5UT 3QDZB 1YYY1 2W3IA 3BEUA 2BY6X 3F6UH 5AHGH 1IQNA 3RMNH 3AW0A 3H7OA 2ESTE 4WMEA 1KY9A 1PJPA 2AHME 1E35B 1ESBA 1TPAE 2VVCA 4WXIA 1P2KA 1RFNA 1GI3A 4FU7A 2ZDLA 4PROA 1EPTB 4FUFA 2O8MA 1N6YA 2WUCA 1VJAU 2JH0D 1UTOA 1FY4A 2XNIA 1ID5H 3LJOA 2WPKS 4UFEH 2OP9A 1P02A 1QR3E 5EQSA 2J9NA 1VITH 1GHWH 1SMFE 1GHXH 1NBME 3VG8A 3HK6B 4B76A 2IN2A 1O3KA 3M7QA 3QUMP 3Q3XA 3FOAA 7KMEH 1L1GA 1A5GH 3EA9A 1O2QA 3RXMA 4WH8A 2G4UA 4Y7BA 2ODPA 4X2YA 1TE0A 3B8JA 1L2EA 3PV2A 4I33A 1PPHE 1V2UT 4TSFD 4NFEA 3UTUH 1FUJA 2J94A 3STJA 3VB6A 5L30H 3M5NA 3NCLA 3ZVFA 1BTYA 3A85A 1S81A 5HIYA 2CF8H 1E1QD 1T4VH 1T8MA 3FO8D 2A4RA 1VKYA 2GDEH 2OBOA 1F5RA 1L4ZA 2EA3A 3U69H 1FZZA 2J5UA 2KAIA 4A7IB 1HIAA 2ZQ2A 2J34A 1O2NA 2JDID 5LPFA 1LHEH 2WPDD 2ZGJA 2ULLA 2Y6TA 1YF4A 3RU4T 5ETXA 4UFFH 3LDXH 2UWLA 1O2OA 5DK1A 3SNDA 1IQMA 1CVWH 1C2LA 1LHCH 1DWEH 2A7CA 4AYYB 4X8SH 2VIWA 1QJ1B 1GBEA 4ISHH 3KQBA 5DP9A 1BRCE 2BDYA 3SJKA 1GHAG 3OSYA 3RMOH 4NIXA 1SOZA 3MHWU 4Y0ZE 1C5PA 1GJDB 4M9FA 1MU8B 2GV7A 2ZNKH 3FANA 5TCAA 4CREA 1TMTH 3L6PA 5DG6A 2G4TA 1F0TA 3SZNA 5C0UA 1HAGE 5FHTA 4DVAU 4A92A 5JPMH 4K1SA 2C8WB 1CQQA 2QXGA 3M3SA 3SI4H 1H9HE 3OU0A 1ZMNA 4XSKU 3LC3A 1F5LA 1CBWB 3UQOA 1NROH 3PO1C 1O35A 4ISNA 1HAYB 1BBRE 2QE7D 5FCKA 4ISIH 4NWLA 1AUJA 2FESH 3P95A 3RC4A 2I6QA 1DVAH 1O2JA 3A8AA 4GLYA 2BY5X 4GVUA 4XE4A 4YOIA 5T6GA 3TIUA 5A0BA 1C1PA 3ENSB 1TNJA 3ZV9A 6CHAC 1EP6A 1ZPCA 4A1VA 4Y76A 1GJ4H 2GJGA 4NIWA 4CHAC 2WV5A 2ZHWH 1MZAA 3I29A 5HYOA 4NZQA 5EW1H 4WXVA 1THPB 4GUXA 5L6NH 1SGYE 2HWLB 2R2WU 3E6PH 3F0PA 1KLIH 1CHOF 3MH4A 1Z6JH 3BTHE 1Y3UA 4TY6A 4Z6AH 3GY4A 2ZFTA 3EE0B 4Y79A 2GZ7A 2V3HH 2A5AA 1WOFA 1K2I1 3BG4B 4XD7D 3Q77A 1BMAA 1O33A 2XCNA 1SG8B 1ZPBA 2PUXB 2BOKA 4I86A 3SGBE 5A2MH 1O5AB 1BTZA 2BVXH 2RA0A 3P8OA 2G52A 1LDTT 1NRQH 1G3DA 1EZXC 1IHTH 3OY6U 5SGAE 4ZMAH 1RGQA 1NTPA 3UR9A 1UMAH 1GBDA 1OHHD 3QGJA 4Q7XA 4CH2B 2RFKC 1C1MA 1TONA 1JRTA 1GG6B 3OAAD 4K8BA 4YZUA 2A5IA 2VNTA 1QL9A 3LGTA 2BX4A 2FX4A 4ABDA 2PKAB 4Y0YE 1TQ0B 2Z9IA 4F48B 1ZHPA 1P03A 1QB1A 1TGCA 1E36B 1AN1E 3ZVAA 1NZQH 1O3HA 2AMQA 1Y5AT 1KLJH 4BANB 4CRCA 3SU3A 4ACBA 1YLDA 1EB2A 2PGBB 1WTGH 2QAAA 3KQ5A 2FMJA 2EC9H 1ZJKA 2KFWA 4MNWA 1G2MA 5C1UA 3AVZA 3Q00A 3F2FA 1P57B 1VCQA 1F7ZA 3RXIA 1EB1H 1GL0E 4B2AA 1GI4A 1EPTA 2VH0A 3FP8E 3GDSA 1UCYK 2HNTF 5GPIB 4RT1A 1Z1JA 1K0HA 1EFRD 1DSTA 1AMHA 2BMGB 2BHGA 4E06H 3RC5A 2FOGA 4JZEH 3EA8A 2Z3DA 4GSOA 2BDIA 5FAHA 3KIDU 1TAWA 3TJVA 2FOEA 2ZDMA 4GCHG 9ESTA 1W0YH 1AB9C 3MYWA 1GDNA 4Y8XA 1FY8E 1OP2A 1QB9A 2B8OH 4XOJA 5E2PA 3TK6A 1ZTKA 3UY9A 2GDDA 4RT0A 4X0WU 4I32A 3T27A 3KHVA 1V2PT 5DP3A 3A88A 1Y3VA 3B23B 1BIOA 2XWAA 1PPCE 4ZXXH 1GG6C 1HFDA 1VITF 2ZGHA 2PP6A 3SYJA 1JIRA 3CS7A 1GGDC 2BXUH 1HUTH 4ISOA 3TJOA 5DP5A 4K8YA 4J1YA 3UFAA 4D8NA 2ZDAH 2EQNA 1ACBE 4K3JA 2KCYA 2XCFA 2BD9A 1RTLA 2OC8A 1O2VA 4OS7A 1LKBA 3SI3H 2TGTA 2KM0A 1TFXA 1TGNA 2NU0E 3FAOA 1TYNA 3UWJH 2ZPSA 3SV9A 1FIWA 3DD2H 3P92A 3RXBA 1LVYA 3BF6H 1ELDE 2ZCHP 3IITA 1AQ7A 1TNGA 3URDA 3P8GA 1VCPA 2P8OB 1ELCA 1LQDB 1A0LA 2ZGXH 2O8UA 1K22H 1MQ6A 1KXBA 1GL1A 1UK3A 2PLXA 2ZPQA 3RXOA 3MNCA 1VCWA 2XW9A 2F9OA 1UW7A 1LMWB 2LELA 4NA8A 1HPGA 1ELEE 2H2ZA 4HTCH 3SGAE 2M5TA 1TBRH 1NU9A 3MO9A 2B7DH 4UE7H 1C2DA 2AYWA 2O8LA 8LPRA 1AE8H 1D3QB 1ZMLA 1MAXA 5F8ZA 2AMDA 2D8WA 2FX6A 1HDTH 2PKSC 3TPIZ 1QA0A 3TU7H 3SUEA 1J17T 3F2HA 1KDQA 1O3BA 1MH0A 1NU7B 1ZTLA 2ZU1A 4WVPE 3PB1E 2PWXA 5C0TA 5HM2A 4HI3A 1NESE 1SLUB 3LKWA 2FM2A 1W2KH 3RUOA 7GCHF 4NSVA 2R3YA 2ZFSA 1ANCA 5EXNA 1IQJA 1YPLH 1GWAA 1V2QT 2IPQX 2WUBA 2XOKD 1VZQH 3MU5A 1O2ZA 1IQHA 1V2RT 3D49H 5DGJA 4ABGA 4BAMB 2UUFB 4TWWA 1XVMA 1QQUA 1LPGB 1GI0A 1UTQA 1C5VA 3DUXH 1ZOMA 3KCGH 5EPNA 1O3GA 4MPXA 1UTPA 2LNCA 3GS9A 1C2EA 2BQ7B 3ELAH 1V2LT 4AOQA 2R0LA 5E0HA 2C3SA 4UFDH 1IQLA 1DE7H 1A7SA 1TBZH 4AZ2B 1ETTH 1MCTA 3E0PB 1NBMD 4CRDA 5LH8A 2XNDD 2C4FH 3LU9B 2HALA 4FUEA 4O03A 5GIBA 3DA9B 2IJD1 1O3LA 4RKOB 2F43B 1O38A 4MTBA 3RXQA 1O0DH 1CT0E 4X8UH 1O5FH 1DSUA 1OP8A 3T62A 1FAKH 3LGVA 1T7CA 3U1JB 4DIHH 1ZTJA 2W3KA 1HCGA 1TNKA 1P8VC 1YC0A 2XTTB 5GNDA 2XYAA 4WJG2 1AVWA 2UUKB 3F9FA 1A1RA 6CHAB 1COWD 2NU2E 3E0NB 4F4OC 2WINI 1LO6A 2FEQH 1MCVA 3RXVA 1TOMH 1GBMA 1GMHF 1K1LA 3E90B 2Y7ZA 1SBWA 2W26A 3AK5A 4HZHA 1RIWB 1BT7A 3EGKH 3V13A 5TCCA 1CHGA 2A5KA 1HYLA 1D3TB 1GCTB 4I8KA 1C5XB 1O3AA 2J97A 1UTJA 3SW2B 2YMSD 3KGPA 5JDUB 2CXVA 1VGCB 1N6XA 1YPHC 4I7YH 3QLPH 1BJUA 1O2TA 1XXFA 1AVGH 4X6OA 3O8DA 2ALPA 4O9VA 2Z9KA 2VGCC 4OS1A 2AGGX 1VJ9U 1SC8U 2EI8A 2QF3A 4XBDA 1ESAA 3WW7A 4NFFA 1K1JA 3TH3H 1TX8A 1TX7A 4ABBA 1GMDF 2A4OA 3UOUA 1ZHRA 4B73A 3NK8A 1YPHE 1NT1A 4YOGA 2STBE 2BD2A 2BD7A 2O9QA 3PTNA 1AY6H 1S6LA 1MKXK 1MKWH 1BTXA 1UVOA 5BPEA 1V2VT 1FNIA 3VPKA 3TK5A 1MU6B 2JJ2D 3SV6A 1AZZA 3DSOA 1C1VH 2V6NA 2UWPA 2ZCKP 1BOQA 3VGCB 1L1NA 3OY5U 3E1XB 4J2YB 2PKSB 3PROA 1AZ8A 1Y5BT 1ZSJA 4D7GA 1C5OH 3GICB 1O5BB 2V7QD 1C1RA 1TNIA 5FBIA 2K1QA 2W6ID 2CN0H 4AORA 5FL7D 4FUGA 1SGEE 1FXYA 1FDPA 1PQ8A 1EATA 2IPHA 1ZSKA 1TGBA 1SGFG 1C5UA 3MU1A 3BV9B 4K5ZA 1E0FD 3U8OH 3JZ1B 2C8YB 4FVBA 5LPEA 5LGOA 1GJCB 3S7HB 1HXFH 1TMBH 2Z6BD 3UIRA 4NZLA 4AYVB 2XC4A 3M3VA 4Y10E
chains in the Genus database with same CATH topology
1F92A 4X1RU 1BHXF 2GVFA 2HOBA 1RTKA 1UTKA 3P8NA 1BBRK 1JIMA 2JETC 2G51A 4B74A 1GI8B 1G3CA 1C2MA 4GCHF 2FZZA 3GDUA 4X8VH 3HKIB 2VVVA 2QXHA 5DP4A 4BAOB 2CV3A 2Z7FE 5I46H 3ZV8A 3SUFA 2ODQA 1O2KA 2ZTXA 1MTVA 4DOQA 5C1XA 2WV4A 5FX5A 3O8RA 1LVMA 1AB9B 2BDBA 3MH7A 5DJ7A 3SHCH 1GBJA 3F9EA 3OTJE 1V2OT 3BN9A 5FPYA 1OWKA 5F8TA 2WPJS 1C5TA 4D9RA 1NFXA 2ZO3H 3MNBA 3GY5A 3VEQB 4ZKNU 1P2OA 1ZGVA 1WSSH 1D3PB 1SSXA 5K0HA 2ZU3A 1FLEE 4AG2A 1CE5A 4Q7YA 1QRWA 1T31A 4CHAB 2RG3A 2VB0A 1LPZB 3S69A 1SQAA 1K28D 3SQEE 2PSYA 5E8EH 3MTYA 1MTNC 1GI5A 4NGAH 1W0ZU 3BTGE 1O36A 4IN2A 1GGDB 2AIPA 2FI3E 4CRAA 1SGIB 2ZPRA 3G01A 4ZHMU 2FLRH 1GBLA 3M3TA 2Z3EA 1ZPZA 4WY3A 3PLBA 3SJ8A 2AERH 1AVXA 1AGJA 4JYTA 2R0KA 1Y8TA 4CRFA 1YM0A 1UVPA 1HJ8A 3RXHA 2Q1JA 1BTUA 1DICA 1GJBB 5PTPA 4X2WA 3A83A 3PMBB 3RC6A 3D62A 5I25A 3LGYA 1FN8A 5EODA 5K7RA 2CHAB 3BIUH 2QXIA 4MG3A 1SQTA 3RXJA 5DP6A 4TPIZ 2FI5E 1C1WH 1GJAB 2CF9H 3A7ZA 1SGFA 4X1NU 1K1NA 4X1SU 2GP9B 1GHYH 2BXTH 1IQFA 3GYMA 1GMCG 4JK6A 7GCHG 1AFQC 2KAIB 1H4WA 1Y3YA 3S9BA 2FIRH 2BB4A 3AW1A 3EA7A 1EZSC 2XXLA 2XRCA 3LPRA 1K9OE 4KTCA 4MPVA 4X1QU 2PTCE 4OS2A 1SHYA 1X7AC 4UDWH 1BJVA 3SNEA 4UD9H 1W13U 1SGCA 2EEKA 3QGNB 1MKXH 1L4DA 3SHAH 4YESB 3VB5A 2FI4E 2FLBH 3SJOA 3A81A 2DE8A 1O3FA 4KKDA 2Y5HA 1ABJH 5A09A 2AGEX 1WU1A 2OINA 5ESBA 4ZHAA 3PMJA 1GVLA 1BMLA 2QC2A 3BTWE 3TK9A 2TBSA 3EYDA 1UHBB 2P93A 3WY8A 2ZU5A 1F0UA 2JKHA 1O3IA 4IW4E 1QQ4A 3ODDA 1NRRH 1SGNE 1BTHH 3M7UA 2J4IA 1G3BA 1PPZA 1C4Y2 3ZVCA 5A8ZA 5FPTA 2FOMB 1CGHA 1QCPA 2ANWA 1O2UA 1NFWA 2EI7A 1T4UH 1F0SA 3GYLB 4RN6A 1BZXE 2VWMA 3A8BA 7LPRA 2ZQ1A 1OOKB 1GCTC 1BMNH 1C1OA 3C27B 3DHKH 2FTMA 4JYVH 1OXGA 1SGRE 1SGDE 1UCYE 1O3JA 1KXFA 1ETRH 2VGCB 3LIWA 3GY7A 2ZGBH 3RXSA 4A1XA 1CBWC 2THFB 1UTNA 1O3CA 2A2QH 1CT4E 1P04A 5EXMA 1V2ST 2V3OH 3RXFA 1O3EA 2D1JA 2OTVA 3VXFH 2HVXA 3W94A 1YKTA 1P2QA 1D6WA 1B0EA 3PMAB 2FWWA 2ZFQH 4DIIH 4O3TA 3K6ZA 4BAQB 1TIOA 2BM2A 1LQEA 2H5DA 2ALVA 5JYIA 1SFIA 5A0AE 3QZRA 1WQSA 1TMUH 2GCHG 2FYRA 4GHQA 1GBKA 3RXGA 1SLVB 2BD4A 1O3OA 4THNH 2OUAA 4Q2KA 3MWIU 5J4QA 2FXRA 1PPGE 3GCTG 1T8NA 2G5NA 4NIVA 3VGCC 1D3DB 2OQ5A 4OS6A 1INCA 1XVOA 1DUEA 1NFUA 1XUKA 1OWDA 4GPGA 2HPQH 3MH6A 3SNCA 2W5EA 3RM0H 1QL7A 3T26A 2BDGA 3UR6A 4CBNA 4IGDA 5AFZH 1KXEA 1HAOH 3BSQA 4CRBA 3L3TA 1PPBH 1O2LA 2FYQA 2TGAA 4IC6A 1GCDA 2BZAA 1MKWK 1A0HB 1XX9A 1Z8JB 3GOVB 1Q3XA 5EU8A 2W7UA 1DS2E 2I6SA 4ZHLU 1NO9H 2F9VA 2ZI2H 3SORA 1SGQE 1Z8GA 1XKBC 5T3HA 5GDSH 1NS3A 1MBMA 1YGCH 1AU8A 1GBTA 3FP7E 3ITIA 1KLTA 4BAHB 4A5TS 2ANYA 3ZZAA 3TGIE 1J14A 1A3EH 4ABHA 3F1SB 2NU4E 1AHTH 1G2LA 3LGWA 3SUDA 2OD3B 1P3EA 5C2ZA 3T29A 2O8WA 4H6TA 2Z94A 5GWZA 3PV4A 4GAWA 1OS8A 3SQHE 3U9AH 3QK1A 3SU1A 4INHA 1GI1A 2XBXA 2C93B 3ZVGA 2BQWB 1OSSA 4RSPA 5E0JA 4XDEA 3RU4E 1WV7H 2Z9GA 4MNVA 3SU2A 1DM4B 3U98H 4CBOA 2ZHDA 4SGBE 4YM9A 3RXLA 4MDSA 2XBVA 1ANBA 1WUNH 2ZEBA 2C90B 1TGSZ 3R3GB 8KME2 5EPYA 1LHDH 3MNXA 3MMGA 1UJ1A 4OS4A 5J4SA 2ASUB 1HAVA 1SI5H 1G36A 2AH4X 2OCVB 1EAIA 5A8XA 3P8FA 3HATH 1NM6A 3LGUA 2TIOA 3KQEA 3PYHA 1MAYA 3PWCA 2UUJB 4I31A 2Z9JA 4B1TA 1MTNB 2JH5D 3JZ2B 3Q76A 3MO6A 4Y6DA 2HGTH 1ELFA 1O2SA 1O2XA 4AGJA 2ZG0H 3CP7A 1Z71A 4CR9A 1AKSA 3SOSA 2TGDA 2OC0A 4AGKA 5AVDA 2QV1A 1GDUA 1QBVH 3GCTF 1F2SE 2OC7A 2D2DA 1CT2E 1DFPA 1V2KT 1BTWA 2PFEA 3FVFB 3LJJA 2QXJA 1A4WH 4MQAA 1JOUB 4E05H 1A5HA 2HRVA 5HMAA 2DE9A 3RMLH 3STIA 3NUMA 3RXAA 4JZDH 4TYDA 3RXDA 3ZZ8A 1CA0C 1IQGA 1C9PA 1NC6A 2FOFA 1GDQA 1JRSA 1BRAA 3M36A 4MVNA 3BTQE 2ZA5A 1H9LB 2Y81A 1IQIA 1FY5A 5C3NA 4AFUA 6GCHG 1ZZZA 2FS9A 2ZDVH 2AMPA 3RXKA 1E34B 1KYNA 1AFQB 1F0RA 1NN6A 2F9PA 2IOTA 1QRZA 2BVSH 3TNSA 3RP2A 3VB7A 1C5NH 2VWOA 1CA0B 2WPIS 2XC5A 1GMCF 1T8LA 2PUQH 1NPMA 1SVPA 4FUDA 2QA9E 1GJ7B 3KF2A 4B2BA 2SGFE 4UONA 1GJ6A 1XUJA 3A89A 3A87A 4NWKA 2CJIA 3SBKA 1HJAB 5ABWA 3RXTA 2D26C 4D9QA 4JZ1A 3O8BA 1HAZB 1UVTH 2A1DB 1ANDA 4FUBA 3W95A 1CO7E 5C67A 4H42U 2A0QB 4YLQH 1UVUH 5EG4A 1LTOA 1B0FA 1J9CH 2ZHFH 4K1TA 3R0FA 3BG8A 3TJUA 3I78A 2BLOA 1HAXB 1EP5A 1EAXA 2H9EH 1U6QA 4E7NA 1C5ZB 1ZJDA 2GKVE 3RXRA 1TNHA 3TGJE 1P2MA 4ZKSU 3BTKE 2STAE 1K1IA 1YPEH 3FP6E 3MI4A 4ZH8A 1O2YA 1FJSA 1KXAA 3ATKA 2GCTC 1GI6A 4YOJA 4LOYH 4X6PA 3ZZ5A 1EKBB 2P3FH 1QBOA 1FN6A 2FDAA 4ZXYH 1THRH 4O97A 1KXDA 2W7SA 5IDKA 1C1UH 2AGIX 1BDAA 2BTCE 1GBBA 1GVZA 1UO6A 5A0CA 4B2CA 2HLCA 4TY7A 1OKXA 2HPPH 2NU3E 1Z8RA 3S9AA 2P59A 2VVUA 4OS5A 1YLCA 2QN5T 5GXPA 2A4GA 2ZFRH 2ZTYA 1MD8A 2ZCLP 1THSH 2NWNA 1O2HA 4YT6H 5C5NA 3MU0A 3E91A 1SQOA 4X2VA 3K2UA 1P12E 4AX9H 4NA9H 1A5IA 1CA8B 2YNAA 4WMFA 4X2XA 2OQUA 1FQ3A 4KGAA 1EAWA 1HJAC 4X6MA 4XBCA 3AAVA 1OP0A 2OXSA 4OGYA 3PTBA 2RDLA 4Y8YA 3HPTB 1JXPA 3N7OA 2BQ6B 1GMHG 1GBFA 1OWJA 2ZZUH 1C2KA 3A8CA 3M5MA 3V12A 1WQVH 3UQVA 2H5CA 7ESTE 4I8GA 1FIZA 1C2FA 2V35A 1GHVH 3UNQA 1GHZA 1QIXB 1Q31A 1UTLM 2WPMS 2FS8A 1YPMH 1BQYA 1C5WB 4CRGA 1V2JT 2SGQE 3ATIA 1S6HA 1P11E 2BLWA 3ZVEA 3NZIA 3GY2A 1FONA 2F9NA 2ZTZA 1ELTA 2Y82A 1KXCA 1DWCH 1YCPK 2ZECA 4BNRA 2ZU2A 4U30A 3T5FH 1HIAB 4INLA 2LPRA 1O2MA 4ABFA 1A0JA 4YT7H 1GBCA 5F6MA 4BXSA 3RM2H 1TRYA 3Q3YA 4CH8B 1G32B 2B0FA 4Y71A 2BYAX 2XBYA 1S82A 1EZUC 1TWXB 1KDQB 2BZ6H 4D7FA 3LT3A 3O8CA 2WPLS 1ANEA 1C2GA 2B5TB 4Q80A 4AFZA 3ZZDA 3GDVA 3SN8A 1YPKH 4HGCA 1QURH 2VIVA 2JETB 4FUIA 1ABIH 2XC0A 3HK3B 3KN2A 3KQDA 5HXFA 3TVJB 1XUFA 1GBAA 1EPTC 1VGCC 5DO4H 3GISB 3SO3A 4AB8A 2J92A 3MH5A 4BOHA 3KL6A 1DWDH 6LPRA 2BD8A 4K1EA 3OX7U 1J15A 2ZP0H 3P17H 1DOJA 2SGPE 2H9TH 1XUGA 2A4QA 1SPJA 2XBWA 4B75A 2BLVA 1FMGA 5AFYH 5HM9A 2XWBI 1MTSA 1N8OC 2P95A 2PTNA 3OYPA 1PYTD 1TGTA 1EXFA 1WBGB 3TH4H 1DT2A 1HBTH 2TRMA 1O2GH 3HKJB 4IC5A 1W3CA 2ZWLH 1ZMJA 1TB6H 1UK4A 1K1MA 1AI8H 2Q6GA 4DJZB 1P2IA 2Z3CA 1G9IE 1FY1A 1HNEE 1BRBE 1HAVB 1OYTH 3ZZ9A 1BITA 2GCTB 2QYIA 6GCHF 5T6DA 4R0IA 1XMNB 3ATMA 5DP7A 5FXLA 3BTFE 2B9LA 1WTHD 5H4IB 5C1YA 1WCZA 1QJ6B 4B71A 1FPCH 1RJXB 4WWYA 5F8XA 4LK4A 2GGVB 1DWBH 1TNLA 4E7RG 2QY0B 1FPHH 4MNYA 3A82A 3M7TA 2C8ZB 4WF8A 1P2JA 1S85A 5AF9H 1C1TA 1CSOE 4KTUA 3A7XA 2J38A 1PQ5A 1EUFA 2Q6FA 2CGAA 2GMTC 2GCHF 2NU1E 3ESTA 5A8YA 1ESTA 4F49A 1V2WT 4Y7AA 1SGPE 1RRKA 4FVDA 2UWOA 1LHFH 1MTWA 2BVRH 4IMQA 4DY7B 3L33A 4RKJB 5CMXH 1NFYA 4A6LA 3SU6A 2FTLE 1FI8A 3EDXB 8GCHG 4ISLA 3RLWH 2G00A 4K60A 1P3CA 3GCOA 1TOCB 1HGTH 1LPKB 2VH6A 1IQKA 1QA7A 3LC5A 2O8TA 1O2PA 3UOPA 1DPOA 3SJIA 4U32A 1VITG 3VB3A 2FOBA 2F9BH 2CHAC 1B7XB 1TABE 1EZQA 3PM3A 5ESTE 3HGPA 1K1PA 3BEIB 4ABIA 1IOEA 1Y59T 3V7TA 1HB0B 1O3PB 4YLUA 2OBQA 2BY8X 1UK2A 3RLYH 4X6NA 3T25A 4LXBH 5JBCS 3BTEE 1JWTA 4DG4A 2FOAA 3M35A 8GCHF 2P94A 3PMHB 1CGJE 3BTME 1GVKB 2OLGA 1JMOH 3SNBA 1E38B 1MD7A 4NIYA 3GCHC 4WMDA 3VFEA 1A3BH 1HLTH 3GCHB 2FOCA 5JBBS 3ZZCA 1L0ZA 2SGAA 2Z9LA 5DPAA 3A86A 4NSYA 2P3UB 4ZUHA 4DGJA 3F9HA 5EXLA 1L1JA 2ZGCA 1S83A 3BTDE 1ORFA 2F3CE 1P09A 1ELBA 1P01A 4O3UA 1P9UA 1ELVA 5BRRE 1OWEA 4INKA 3DT0H 1W7GH 4JZFH 1HJ9A 1QFKH 3QO6A 1LHGH 2PGQB 3H7TA 2G55A 3UNRA 1O5GH 8ESTE 4LZ1H 3UWIA 2R3UA 3URCA 2EI6A 1KIGH 3PLPA 5E2OA 3SUGA 4FUCA 2YNBA 5EW2H 3V0XA 1GI2A 1TALA 2SGEE 5FCRA 1C5MD 2TPIZ 1M9UA 3TLOA 1QHRB 2VIOA 1HAPH 1G30B 3SGQE 4QT8C 1TPOA 3B9FH 1YBWA 3D23A 5JB8S 1DITH 4AB9A 1QTFA 1TA6A 1O5EH 3LH3A 4GHTA 4DW2U 3RXEA 2GT8A 2BDAA 2GX4A 1C4V2 1NRPH 2Y5GA 2OC1A 1GPZA 3E8LA 1LVBA 1C4U2 1PQAA 1S84A 1XUHA 3A84A 3ZZBA 5JBAS 5T6FA 1A46H 1AWHB 3UPEA 5L2YH 1LKAA 1T8OA 1W10U 4XBBA 4K69A 1LVOA 1GHBF 1HXEH 2VIQA 3C1KA 1BB0B 1O5CB 3U1IB 2BLQA 1SB1H 4NCYA 4CR5A 3IG6B 1BA8B 2PKAA 2ZIQH 5IYTA 3E16B 4JK5A 9LPRA 1S6FA 1FAXA 1TX6A 1D6RA 3KEEA 4YTAA 5GCHG 1MTUA 1QBNA 2ZFFH 5B6OA 1C9TA 1CU1A 1QNJA 2VU8E 4SGAE 3TH2H 4BTTB 3SJ9A 1H8DH 2SFAA 3ZVDA 3RXPA 2BD3A 1D4PB 3F9GA 3V3MA 3P70B 4I8HA 1EX3A 1ZRKA 2ZU4A 1WAYB 4TPYA 2C8XB 3A7TA 3S0NA 3TNTA 4IMZA 1H9IE 1GI9B 3MU8A 4NA7A 1RTFB 1S5SA 1ELGA 1D9IA 1YPGH 1W7XH 2WPHS 3DFJA 2A45B 3M5OA 5EQQA 1HAHH 3BEFB 3GY3A 1Q2WA 2PW8H 2ZHQH 1DUAA 1UVSH 2BY9X 2H1UA 4I8JA 2J95A 3I77A 1UTMA 1G3EA 1GBHA 1TPPA 1TBQH 3MU4A 2GT7A 2ZDKA 1MBQA 2F9UA 1RXPA