3LGYA

R178a mutant of the degs-deltapdz protease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
213
structure length
179
Chain Sequence
STDETPASYNLAVRRAAPAVVNVYNRLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPGQTITQGIISATFLQTDASINHGNSGGALVNSLGELMGINTLPEGIGFAIPFQLATKIMDKLIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 36
structure length 179
sequence length 213
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgyA02
1MKWH 1D3QB 3KHVA 3MU5A 2SGDE 5DP5A 1RD3B 3RXTA 5F8TA 1JIRA 1O2TA 2F91A 1GBAA 2CGAA 1FY4A 2ZG0H 5DP4A 1G3DA 4MNWA 2SGFE 1H8IH 2A7CA 1WTGH 1KY9A 3VB4A 3S0NA 3PWCA 1WCZA 1QB6A 5FX6A 1Z6JH 2HALA 3BIVH 1P11E 2BHGA 3M7UA 3MU0A 1TX7A 1W12U 2J92A 2Z94A 1DWDH 1BTPA 1HJ9A 4ZHLU 2Y6TA 3MNSA 3LOXA 4FUGA 3PO1C 1A7SA 3TNSA 1T4UH 2TIOA 2G52A 3A7TA 3U8RH 1FN6A 1QJ1B 3ELAH 2Y80A 3T27A 3A81A 3LKWA 3ODFA 4X1NU 1QQUA 2ZIQH 4ZHMU 2ZPSA 4ZH8A 1SHYA 2FESH 5LGOA 1HYLA 4CRBA 5J4QA 2A2QH 3TK5A 3HGNA 1YC0A 3ZZ5A 4AG1A 1ZSLA 4HTCH 4JYUH 2JH0D 1ETSH 2H9TH 4DW2U 3I78A 1TALA 3SJIA 3OX7U 1A0HB 4CRAA 1HFDA 2ANWA 1LPZB 1BBRE 3UWJH 4Y7AA 4UDWH 3IG6B 1YPGH 1UCYE 1O5BB 4WH8A 1O3OA 2OC7A 1RRKA 5GDSH 2GMTB 3O8CA 1BDAA 2GCHG 1WOFA 3EGKH 2H6MA 1ELCA 1DICA 4CBNA 4Y0ZE 3DHKH 3HK3B 1TGNA 3TLOA 2AERH 2ZHEH 1G30B 4Q7ZA 5JBCS 3HKIB 1GHXH 1XUKA 3GDUA 1JRSA 4O9VA 1C1RA 4R0IA 1O2IA 1TABE 4HFPB 2ANYA 3TJUA 3MYWA 3SHCH 1T8NA 1EZSC 1VJAU 1C5OH 1E35B 3RXIA 4E06H 1NC6A 3ZYEA 5E2PA 1MTWA 1ELEE 4INKA 1C1MA 5T6DA 3MH7A 3BTFE 3SGQE 2Z3EA 1CBWB 2VGCB 3P92A 5E0GA 1OX1A 2ZGCA 2V0BA 4U30A 4FUDA 3EDXB 1ETRH 3BG4C 4YOJA 4UFDH 1DFPA 3P8OA 1MD8A 1TBQH 2P93A 5F8XA 2BD3A 2VVUA 4K8BA 5FPYA 3ZZDA 1IQGA 1CVWH 3QTOH 4LZ4B 1PYTC 1ZRBA 1Y3XA 3KQCA 3PMAB 5FAHA 1GHAG 2AMPA 2H1UA 2QAAA 1NRNH 4UD9H 2A5IA 1AE5A 1IQFA 1HAZB 2J38A 3SU3A 1O3PB 1SGCA 3RXLA 1IHSH 5PTPA 4Y11E 1RFNA 6ESTA 2H5DA 2ILNA 4BAHB 1ANCA 1UJ1A 1LO6A 1VITF 2GGVB 1EB1H 3FVFB 4J1YA 1O2MA 4TPIZ 1GHVH 3LC5A 4IC5A 3A7YA 3BTGE 5FXLA 3RXCA 1BTYA 1GGDC 1G3CA 1C2IA 1CGJE 2D2DA 1C4Y2 1ELDE 1PPZA 2OCVB 1D9IA 3MMGA 5F8ZA 4X1PU 1LHEH 3QZQA 5E0HA 1DXPA 1DITH 5JBTA 4BTUB 4GCHF 2ZU5A 2ZDMA 1C1NA 1MU8B 2ZHDA 1NT1A 2JETB 3F6UH 2Q1JA 2Y7XA 3RM2H 4AGKA 3MOCA 1YCPM 3A84A 1ZRKA 1O2ZA 3ZVFA 1K2I1 1UTKA 4TWWA 1A61H 2EI8A 1AB9B 4I8GA 1OP0A 2VWLA 2DUCA 3S9BA 3TGIE 2VWMA 1P9SA 2BD4A 2NU4E 5AFYH 4XDEA 1LHFH 1PQ5A 1PPEE 3L33A 1DY8A 2VB0A 2C8WB 3M3VA 2XWBI 1DSUA 1YPJH 1GBLA 1C5SA 3F1SB 1TQ0B 3GY8A 4A7IB 1QFKH 1L0ZA 5I46H 1W2KH 2BOKA 1HAGE 4ZKSU 4YO9A 1K21H 1WQVH 2ZPRA 1O3MA 1W8BH 1UTOA 3VFEA 1OSSA 3LPRA 2ZHWH 3QUMP 2Q6FA 3PB1E 1HAXB 4AFSA 3P6ZB 3B9FH 1W7GH 1V3XA 1C1TA 1HJAB 4X1RU 3AW1A 2ZFTA 3RC5A 4A5TS 4CHAC 3SU0A 4AFQA 2BQWB 1BTWA 1TWXB 3V13A 2FS9A 3LH3A 3F9EA 2PW8H 3A86A 3TGKE 4WVPE 2BY5X 1LKAA 1TGBA 1EP5A 1TNJA 1Y5AT 2K1QA 3BTEE 2AGIX 4JK5A 1WTHD 4ISNA 3TK6A 1O3KA 4A92A 2OD3B 1SQOA 2ZCHP 1JIMA 1D4PB 2GZ8A 3SO3A 1PPFE 1J16A 1FY8E 5IYTA 3STJA 2BDBA 2YOLA 2PUXB 1DVAH 1ELFA 2F83A 3PV4A 5EG4A 3ZZ4A 4KTUA 1D3TB 1FMGA 1TMUH 1AD8H 2ZI2H 3D23A 1QGFA 4YM9A 4GAWA 4VGCC 3UNRA 2GCTC 5H4IB 2CMYA 4KTSA 3GCNA 2PKAA 3TU7H 4SGBE 4HI3A 4ZXYH 2A32A 4BAOB 2R0LA 3GOVB 2O8TA 4A1VA 2CHAC 1K28D 1V2MT 3BEUA 2ZU3A 1FPHH 1HAYB 1EX3A 1CA0B 4CRGA 1SGNE 1G32B 3ZZBA 2GDEH 2BDCA 2VINA 1ZJKA 1XM1A 2BOHB 2PR3A 1TGCA 2WPKS 5SGAE 4ABGA 1E38B 2J9NA 3QN7A 3T26A 1A3EH 1N6YA 1MKXK 4H6TA 2BQ7B 2OQUA 5FX5A 1XUJA 1DS2E 1VJ9U 3SNBA 3KN2A 2HNTC 4BTTB 2IJOB 3RP2A 1GCTB 2TGTA 4CRFA 4B2BA 1GBCA 2R3UA 4FUCA 4K1TA 1LQDB 3GYLB 2ZPQA 1GBHA 2OTVA 2O9QA 4UFEH 2UWOA 4F4OC 4UFFH 1EOJA 3RXSA 1BMNH 1C5PA 3KNXA 2Y82A 1V2JT 1SMFE 3I77A 3RMMH 1TMBH 2FOFA 3G01A 3VGCB 2BVXH 1YPEH 1EJAA 1H9HE 1CHOF 1GBJA 1A5GH 3R0FA 1Y3YA 5HGGA 1C4V2 1GJ5H 2FIRH 2GZ7A 1QRXA 3H7TA 5DP9A 1P10A 4B71A 1GHBF 2ZTYA 1E37B 1Z1JA 1V2QT 1UCYH 2ZFPH 1C2JA 1P2IA 4O3TA 1N6XA 4AX9H 1H9IE 3FFGA 1BTHH 4A6LA 4WMEA 1GI3A 3E90B 4OS5A 1W11U 3ODDA 1YPLH 1AKSB 2GV7A 3GY2A 1TLDA 2P8OB 3CP7A 1SPJA 4D9RA 2UUYA 3L3TA 2JKHA 1GI7B 1C2FA 2OLGA 2AMQA 2OXSA 1YPHE 1MZAA 3PLKA 4BAQB 1EKBB 3EA8A 7GCHF 3UOPA 1H9LB 1GHZA 1V2LT 3HGPA 3ZZ7A 4AGJA 1O2JA 1A2CH 2RA3A 4D7GA 1O2QA 1D3DB 3M5MA 3KQEA 3ITIA 5JB9S 5GCHF 1DWEH 1O3NA 4INHA 5L30H 3KEEA 1HIAA 1ID5H 3ZZAA 1SQAA 1KSNA 4X8VH 2XXLA 4XBCA 1AY6H 1F5LA 1NFXA 1SGTA 4ZKOU 1MCTA 3KL6A 3F9HA 1GBBA 3RXHA 3SBKA 3OYPA 4DURA 3MU1A 1GJ6A 2ZZUH 4ZKNU 4D7FA 1FI8A 2G4TA 1QHRB 3ATIA 4O3UA 3VEQB 1O3JA 5IDKA 3LIWA 1S81A 1WYKA 2Q6GA 1QJ6B 1UMAH 1INCA 2V6NA 2RG3A 3DFJA 2VIWA 1OXGA 3KCGH 2PHBA 5GWZA 3RM0H 3A83A 5JBBS 2SFAA 1P57B 4I8HA 4YOIA 1P06A 2EI6A 3HK6B 3NKKA 1XUHA 4OGYA 1QR3E 3BTQE 4TYDA 4OS4A 1QNJA 3GDVA 1HRTH 1MTNB 2Y5HA 2SGPE 3A87A 5HMAA 1C9TA 3MO9A 3MH5A 4MNXA 3RMLH 1N1LA 3ZVBA 3M37A 4RKJB 1NFWA 2ANKH 3K6YA 1F5KU 1OWDA 1SLXB 3L6PA 4ZKRU 4XSKU 1AN1E 3EA7A 2QXIA 4GHQA 4JCNA 3GY4A 1A4WH 1FONA 2B9LA 3V3MA 1QY6A 1L4DA 1T8MA 2OQ5A 3RMOH 2CV3A 1PQAA 2SGQE 1GI0A 1KXBA 1LVOA 3QWCH 2QCYA 4FU9A 1BTUA 1D6WA 1SC8U 1BUIA 2O8LA 1SQTA 1ANDA 2ALPA 3MNBA 3Q77A 1XVOA 4IMZA 2C8XB 1RTKA 1O2UA 1THRH 2Z9KA 2XBYA 2P8OC 1QBVH 2GZ9A 3SNCA 4I8KA 3KQBA 4K3JA 1YCPK 2FTMA 1C2KA 1GJ4H 1O2VA 1H1BA 4B1TA 1DANH 1O3EA 3V0XA 3SV8A 4RN6A 8GCHG 4LZ1H 2HRVA 1UK3A 1OOKB 4ABJA 4E7NA 2STBE 2FWWA 2Z9LA 1AWHB 2BDIA 5F6MA 1IOEA 3LGWA 1LQEA 2F9BH 2D8WA 1FAXA 1MTSA 1S84A 3N7OA 3RLWH 4U32A 2BZ6H 1O2KA 1LVBA 5A0BA 9LPRA 1TE0A 5DPAA 1O3FA 1CA8B 4CBOA 3LJJA 1X7AC 1C5RA 1HXEH 1O2OA 2BMGB 2C8ZB 5C67A 1B0FA 1MAXA 2OBQA 3SV7A 2AGEX 1ZLRA 1TNGA 1O2WA 2FP7B 4Z0KA 2VH6A 1SR5C 1CT0E 1TNHA 1O38A 1ELAA 1G3EA 1DM4B 1BB0B 2O8MA 1ETTH 3SQEE 1C9PA 1P2NA 2V3HH 1NPMA 2QXGA 2PUQH 7KMEH 3O8RA 1SGQE 2BB4A 1AMHA 1TGTA 3TNTA 1Z6EA 3OTJE 1G36A 3MU4A 5E0JA 1O5AB 2Q6DA 3AAVA 3LH1A 4WMFA 2SGAA 1EPTB 1OYQA 5HYOA 4ABIA 1KXAA 1O33A 3U1JB 1GHAF 1ZTLA 1DWCH 1V6DA 4DGJA 4NSVA 5B6OA 5J4SA 1J17T 1T31A 3PROA 2YNBA 3VB5A 1Z7KA 1KYNA 1JRTA 1AZ8A 2ZQ2A 2B8OH 4OS6A 3ZVAA 1AFQB 1VZQH 3URDA 1O5CB 1ELVA 4B2AA 1GBEA 1H4WA 2R3YA 2XC5A 1QL8A 1DY9A 3TH2H 5A0AE 1O30A 5DKMA 1CT4E 4ABHA 2OC0A 2BTCE 4AOQA 3S9AA 2DE9A 1FPCH 3UTUH 4MDSA 2OUAA 1J9CH 1E34B 4XBDA 5DO4H 1F0UA 2BVRH 1OWEA 2ZA5A 1HAVA 3M36A 4GSOA 2F3CE 5C5NA 2AMDA 1ZHRA 2GD4B 1BMLA 2QF3A 4NA7A 1ABJH 4AN7A 2H5CA 1AVGH 1TNLA 4ZXXH 2GDDA 1TRMA 2ALVA 4Q7XA 2PKAB 4Y6DA 7ESTE 4NWLA 2R0KA 1GI4A 1RXPA 3D65E 3LGVA 4QT8C 4Y79A 1UHBB 1KXDA 1YLCA 2WPJS 1KLTA 4ZAEA 4ABAA 4BXWA 8LPRA 4DCDA 5EGMA 4THNH 5CHAC 1ZR0A 1BMMH 1FUJA 5A0CA 1THPB 4CH8B 3I29A 1DT2A 1FQ3A 2A4OA 3W95A 1TBZH 2BM2A 3LJOA 1V2WT 5FCRA 5C2ZA 4DT7B 3V12A 4MTBA 1XKAC 4ISIH 2OC8A 1LDTT 1SLWB 3RXVA 1OYTH 2A45B 1W14U 1G2LA 3Q3XA 4MQAA 3RMNH 3SUDA 1JMOH 2C3SA 4KELA 1J15A 1K1MA 2ZGBH 2UUFB 3D49H 1XVMA 3MI4A 2FOCA 1GBKA 2XW9A 1DLEA 1YKTA 1S0QA 2SNVA 3A85A 3B8JA 4AYVB 1BRAA 1OP2A 1BITA 1E36B 5EXNA 1S6FA 2CXVA 3DD2H 1MQ5A 1T7CA 1O5EH 1TFXA 1GMCF 2FO9A 2VIQA 4RSPA 1A46H 2FTLE 1EPTC 1UTNA 3OY5U 1XXFA 3TPIZ 3FP6E 1QCPA 1LPGB 2I6SA 4K8YA 1O36A 5G4BA 1BHXF 1UK2A 1OP8A 1NRPH 2J4IA 3RXAA 3ZVEA 3TK9A 1T32A 3FAOA 2ULLA 4KKDA 1L4ZA 1AFQC 2XBXA 2BY7X 5FPSA 4FXGH 5ABWA 4ISHH 4MPWA 1HB0B 1AUTC 1NY22 3BEFB 3F9FA 2BXTH 1AVWA 4NSYA 1O2NA 3NWUA 1O3DA 3SI4H 2F9OA 2XCNA 2LNCA 2ZP0H 4X2XA 4AZ2B 1LTOA 2NWNA 2ZU1A 3IWMA 1AI8H 1UTPA 1VITH 2AS9A 1QURH 2P3UB 3BTTE 3RLYH 1C5YB 1BRBE 2P3TB 1WAYB 2Y7ZA 3E3TA 1WBGB 1S83A 1Z1IA 3LGTA 2GKVE 4RKOB 5JBAS 4PROA 1XXDA 2BLQA 2GMTC 2TGDA 4ABFA 3A82A 5DP3A 3U9AH 1O3CA 4NZQA 1UTLM 1FAKH 1PFXC 3VB3A 1EUFA 4NIVA 1Y3VA 1DOJA 2QA9E 3SU4A 1NFUA 1CT2E 1K9OE 1IQLA 4UFGH 3QK1A 1O31A 4TWYA 1NZQH 1SGPE 1B5GH 1QTFA 5FBEA 1ANBA 1GDNA 3DT0H 3R3GB 4ZHAA 2HVXA 1GI5A 1GVLA 4R8TB 1KDQB 1C1SA 3PTBA 2GV6A 5EQRA 3Q76A 1OPHB 3P8FA 2ZWLH 2BDYA 3GICB 4ZMAH 1CBWC 2VGCC 3ZVCA 2J94A 5JDUB 1QBOA 5TCCA 1BMAA 2ZKSA 2GX4A 3FZZA 5EPYA 2BLWA 3UWIA 1NM6A 3MNXA 1TGSZ 4BANB 1BIOA 1RJXB 2VU8E 2P94A 1C1WH 3SU5A 1CGIE 3PWBA 2VWOA 2XC0A 1Y3WA 3K6ZA 2FLRH 2WV4A 1AO5A 1BRUP 1DUEA 1HAIH 3T2NA 1OKXA 1T8LA 2XCFA 3GCTF 1QL7A 1C2EA 2FEQH 2FS8A 3QGNB 1YPMH 3UIRA 2ZFQH 3T25A 1FIWA 1P09A 3HKJB 2QIQA 4WXIA 5L2ZH 1IQIA 2A4QA 1TIOA 1ZMNA 1EZQA 1GG6B 1ZZZA 3E16B 1WUNH 2OP9A 1AZZA 3STIA 2NU2E 1G2MA 1WU1A 3VXFH 1MD7A 1TBRH 3URCA 1BBRK 1O5DH 3QX5H 3M3TA 2PFEA 1V2ST 1CGHA 1FLEE 3NCLA 1B7XB 1ZTKA 1VITG 1UCYK 3EA9A 2ZHQH 1D3PB 2V35A 1PQ8A 3RXBA 1NS3A 1S0RA 2WINI 3M35A 4AYYB 3A7XA 1W10U 8ESTE 3PM3A 3A89A 1O39A 3SI3H 6GCHG 2QV1A 1O3LA 2JETC 3EYDA 2TRMA 1V2UT 3AASA 3ZV8A 1SFQB 2H9HA 2Z3DA 2BDGA 1P2OA 1RIWB 1GCDA 1AB9C 1O2GH 1OS8A 3PMHB 1TPPA 2A7HA 3GCHB 2PKSB 1EOLA 3P8GA 2IOTA 1GJ8B 1C1UH 3SUGA 2PV9B 1F7ZA 1IAUA 1EASA 2BLOA 2PTCE 1O3BA 3RUOA 3SJKA 1TONA 1FZZA 2BY8X 3UR6A 1V2TT 1MTVA 2XYAA 1GI9B 4GPGA 2A4GA 4WMDA 4OS1A 4X2YA 2PGBB 5C1XA 1HCGA 3RU4D 2QXJA 1HV7A 1HJAC 2WPHS 2DE8A 1EXFA 1O3GA 1ZMLA 3MU8A 5AF9H 1UVUH 3GISB 2ODQA 4AORA 1EZXC 4YLUA 1GI8B 1GJCB 1QB9A 4BAMB 2C93B 2H9EH 3SOSA 1ZPCA 4YTAA 1BHXB 3UUZA 1C1OA 5L2YH 1O2RA 2XC4A 1ZSJA 2SGEE 1W7XH 1V2PT 1FY5A 3C27B 4NFFA 5A09A 1DLKB 1SGRE 3T29A 3GDSA 4JYVH 2CF8H 2ZCKP 3SUEA 2ZDVH 3RU4E 1EAIA 3K65B 1BT7A 3SJ9A 3TITA 1TA6A 2GVFA 4X2VA 2BQ6B 4MVNA 5GXPA 1GL1A 5JB8S 2VVCA 2ZFFH 4D76A 8GCHF 3RDZA 1MKXH 3ZVGA 4ESTE 5EXMA 2FOAA 3ATKA 1D6RA 4NCYA 1V2RT 4YOGA 2STAE 1ELGA 3A8CA 1ZGVA 4Y7BA 1YP9A 5K0HA 1P05A 2QXHA 2A4RA 1SL3A 3PTNA 4ABEA 3ZYDA 1O3HA 3AAUA 4CRDA 1CA0C 4A1XA 5GIBA 1SFIA 4A1TA 1QRWA 1C5VA 2PSYA 2P3FH 5ESTE 2G5VA 1O5GH 1GMDG 1V2KT 4X6PA 4XBBA 4UEHH 5GPIB 1DXWA 1AHTH 1YPHC 2BD2A 4FU8A 1O5FH 5EQSA 4CR9A 1RTLA 1NN6A 1K1LA 1W13U 1SOZA 3RXJA 2W7UA 5C1YA 5T6FA 2BX4A 8KME2 1BTZA 2HOBA 3UQOA 3MH6A 1RS0A 5LH8A 1AUJA 2O8WA 1SGEE 2ZC9H 1GHWH 4O97A 1ZPBA 4Y8ZA 1GCTC 4H4FA 2ODPA 1F0RA 2V3OH 5C5OA 1GMHG 3SGBE 1KIGH 1C1PA 1A5HA 1PPCE 1TNKA 2BZAA 4K1SA 3GY3A 3EE0B 3W94A 1FNIA 1HPGA 3VGCC 4MG3A 3AVZA 4DIHH 2RDLA 4FUHA 4WY3A 1TAWA 2B0FA 5C3NA 3Q3YA 1THSH 1CHOG 2BD9A 1MKWK 1UVSH 3LGUA 3SW2B 3GY6A 2CF9H 5BRRE 4YLQH 5ESBA 3K9XB 2TGPZ 1O37A 1SLUB 1P3CA 1Q31A 3E0NB 3UFAA 5I25A 1Y5BT 1TRNA 3SNDA 1UTMA 1LHDH 1NRSH 1GHBG 5A8ZA 4K1EA 3BTKE 1K1PA 3HATH 5C1UA 7LPRA 5TJXA 1ANEA 1QIXB 1FIZA 2RA0A 4CR5A 2YNAA 2VJ1A 1Z71A 3A7VA 4Y10E 1KXFA 4B73A 1ZGIA 3NXPA 3PLBA 1C1VH 2BX3A 2GCHF 4D8NA 3SORA 1UO6A 1MAYA 5FPTA 5FBIA 4GLYA 4DY7B 4H6SB 1J14A 4JZFH 3UNQA 2G81E 2XNIA 7GCHG 2R2MB 1TQ7B 1JWTA 1S6HA 2BLVA 1GDQA 1V2NT 1GVKB 3NZIA 3PLPA 4HGCA 2ANMH 4MNVA 2AIQA 1GBTA 5T6GA 5GCHG 4FUJA 1XUFA 4TY7A 1Y59T 2FDAA 5AVDA 1GI2A 1K22H 2ZNKH 4WF8A 1XUGA 3AW0A 3TH3H 3A8AA 4DIIH 5EW1H 3RXUA 2HNTF 3DA9B 4Z6AH 1O2LA 4O03A 1SB1H 2PSXA 3MO3A 3VB6A 2FMJA 3BSQA 3M7TA 3Q3KA 4TPYA 4NIYA 2F9NA 4B74A 1A0LA 2FYRA 1YYY1 1A0JA 4AFZA 3LDXH 1IHTH 1GHYH 1ZOMA 1JOUB 2AH4X 1SBWA 1PQ7A 2W3KA 3FZDA 1P03A 1M9UA 2VIVA 4NZLA 1C2MA 2UUJB 4NWKA 3RXFA 3TIUA 4YT6H 2P16A 1SHHB 1L2EA 1MTNC 2VIDA 1C2GA 2FOHA 1V2OT 2HPPH 4GUXA 2ESTE 1O34A 1GJ9B 3HPTB 1AKSA 3BG8A 4Y71A 4FUIA 5AFZH 1F5RA 3MFJA 1BOQA 2ZECA 4TY6A 1YCPH 1GGDB 4BAKB 4FVDA 1PJPA 1O3AA 5A8YA 4IMQA 1CQQA 1C5LH 6CHAB 1A3BH 3RXRA 4X1SU 3E1XB 3QLPH 2VIOA 5EXLA 1PYTD 1SVPA 4K69A 2IPHA 1BCUH 4YESB 2BY9X 1EAUA 1C2DA 1G3BA 2F9PA 1NESE 1YM0A 2ZEBA 1DPOA 5GJ4B 4K60A 4NA8A 4AB8A 1KTTB 3TJNA 1ARBA 3H7OA 1B0EA 1SGDE 2ZCLP 2UWLA 4ZROA 2Z9GA 2OINA 3DUXH 4X6NA 1P2JA 1GL0E 3NPSA 3VXEH 1NRRH 5T3HA 5E8EH 5F03A 1ZJDA 3RC4A 2W3IA 2AGGX 1MMJN 3U8TH 1AWFH 4K5ZA 3KF2A 1S5SA 1O2SA 2NU3E 5C20A 1C5MD 2ZFSA 1O2HA 1ESTA 1P2KA 2F9UA 1L1NA 2VNTA 1Y5UT 1TOMH 1VR1H 3SU6A 3A8BA 5A8XA 2R2WU 2VH0A 3O8BA 4GHTA 3UNSA 3Q00A 2A0QB 3LU9B 3SN8A 3LT3A 1QJ7B 2AFQB 3O8DA 3QTVH 2PGQB 3RC6A 3SJ8A 1EAXA 4CHAB 2ZF0H 1VCPA 4Y0YE 5DG6A 1DUAA 1P2QA 3QZRA 1Z8GA 1P0SH 1Y3UA 2ZGJA 4KGAA 2F9VA 1C1QA 2RCEA 4I32A 2I6QA 1QB1A 3WY8A 2KAIA 1DWBH 3UY9A 1EJMA 1KLJH 3KIDU 1W0ZU 1CSOE 2FI3E 2HPQH 3JZ2B 3BF6H 4X1QU 4Y76A 2QC2A 3KGPA 4F49A 2ZU2A 3BN9A 4LXBH 3S9CA 2JH6D 2QN5T 1K1NA 3M61U 3RXKA 4AG2A 4I8JA 1IQJA 1MCVA 1QL9A 5EW2H 1JXPA 1GBDA 3ZZ3A 1LPKB 2FOGA 2GT7A 5DGJA 4WH6A 5HXFA 1O2PA 3VPKA 3NK8A 4VGCB 4LOYH 1EATA 1Z8IB 1LKBA 2GCTB 4MPUA 1CE5A 4NA9H 4ABBA 2W26A 4AB9A 1NO9H 2WUCA 3K2UA 4FUFA 3OU0A 3EQ0H 1BA8B 2CHAB 1SGYE 1MH0A 2VIPA 6CHAC 3CS7A 2HLCA 2OC1A 2EA3A 1FY3A 6GCHF 1ELTA 3FANA 1C2LA 1LVYA 2FZZA 1OWJA 1Q3XA 1GVZA 2ZTZA 3SHAH 1UVPA 3RU4T 4OS2A 1HNEE 2WYJA 4XFQA 1XMNB 1TX8A 2GP9B 1ZYOA 3D62A 5EQQA 1HIAB 2NU1E 2XTTB 1ESAA 4FU7A 2FOMB 3EAJA 4X0WU 1DDJA 2OBOA 1P12E 4MPXA 2BD5A 1PPBH 1C5NH 3ZZCA 1DSTA 2BD7A 2QYIA 2Z3CA 1BRCE 1CO7E 1S82A 2O8UA 2D1JA 1IQHA 4ZUHA 1ACBE 3LGIA 3TGJE 1HJ8A 4H42U 1YPKH 1SGFG 4MPVA 2G5NA 3T28A 3ZV9A 3M5LA 3UREA 3T62A 4E05H 1GJDB 1FY1A 3RXGA 2BVSH 2J34A 2Y5FA 1BJVA 2J2UA 1EPTA 2ZDAH 1IQKA 1BZXE 3KQDA 5LPFA 1LMWB 2ZGHA 5EPNA 1L1GA 2FI4E 2A5KA 2AYWA 3BTHE 1TPAE 2VVVA 1HAPH 2PTNA 2UWPA 2C90B 1TOCB 2R9PA 2ZQ1A 3RXEA 1WSSH 2XBVA 2A7JA 4HZHA 1SGIB 1VGCB 2ZDLA 4YZUA 3F68H 3P70B 2FLBH 4FUEA 1QRZA 2EC9H 2GTBA 4X6MA 1W3CA 4X8TH 4IBLH 2HWLB 1SLVB 1TPOA 2AIPA 1P02A 3SU1A 1F0TA 1QA0A 4BNRA 5A2MH 1O2XA 1FV9A 4I7YH 1NTPA 1OWKA 4Q80A 1GMCG 3SJOA 1GDUA 1CU1A 1O3IA 5CMXH 2P59A 1BJUA 3JZ1B 2HNTE 1G37A 2G8TA 1UVTH 2WPMS 1IQMA 2A31A 3SV6A 3GYMA 4K2YA 3P8NA 3P17H 1K1OA 3ZZ8A 2NU0E 1HXFH 1AGJA 2G51A 3MTYA 1F92A 1SG8B 4U2WA 3F9GA 1OWHA 3RXPA 1RGQA 1KXCA 2FX4A 4GCHG 4JZ1A 1UHBA 2VWNA 1E0FD 4E7RG 3S7HB 2QGRA 3MWIU 1GPZA 2ZHFH 4NIWA 1HDTH 3M7QA 1BTXA 1ORFA 2HGTH 5DK1A 1W0YH 1C5ZB 3ZVDA 1GMDF 2GT8A 4M7GA 3P95A 1HGTH 3LGYA 2Y5GA 4UE7H 2Z7FE 3M5NA 1TNIA 1FJSA 1TYNA 4Q7YA 2W5EA 2FX6A 2ZDKA 4ISOA 3E8LA 3SQHE 4I31A 1P04A 5DP6A 2WPLS 1J8AA 2ZO3H 3ENSB 1ABIH 1SOTA 3FP8E 2FXRA 1GI6A 4BOHA 3RXQA 1ZSKA 3PMBB 4X8UH 1CHGA 1F2SE 1MZDA 4U01A 4DOQA 1GMHF 1T4VH 1P9UA 1A1RA 3S69A 2P95A 5L6NH 4YT7H 2H2ZA 3UOUA 1GI1A 1LCYA 1Q2WA 1N8OB 2BD8A 3NUMA 1A5IA 1F0SA 1OWIA 4XOJA 4B2CA 4D9QA 3MHWU 1AU8A 2QY0B 3LC3A 3GY5A 3OSYA 1XUIA 5K7RA 3CENA 2THFB 2CN0H 1ARCA 5TCAA 1SI5H 4IGDA 1LHCH 2AEIH 2Z9IA 1SSXA 1PPGE 1EP6A 4WWYA 2FOEA 1ZHMA 2PWXA 1GBMA 3MO6A 2FM2A 1K1IA 1UTQA 3E91A 1YF4A 3M3SA 1EZUC 2EI7A 2FODA 4LK4A 1BBRH 1O35A 2WV5A 3SV2H 1L1JA 1NROH 3OY6U 4MLFB 1GBIA 2ZU4A 4INLA 1NU7B 1VGCC 4MNYA 3QDZB 1KXEA 4GVUA 1AQ7A 5EU8A 2TGAA 1C5QA 3A7WA 4IC6A 1DX5M 1GBFA 3E0PB 3A88A 3GCTG 3VB7A 1AE8H 2A2XH 4DVAU 4B75A 1BQYA 1WQSA 4OGXA 2ZGXH 1LVMA 1MUEB 5E2OA 4UONA 1NFYA 5EODA 5HM2A 4CH2B 1GG6C 1UTJA 2BYAX 2G55A 3ATMA 3TVJB 2J95A 1LHGH 3RXMA 3ESTA 4CREA 3E6PH 2XRCA 2W7SA 1YBWA 2WPIS 4JZIA 3CS0A 2XBWA 1HLTH 4X8SH 5JPMH 1HAVB 3TH4H 3UPEA 3PMJA 1ZTJA 1KLIH 3SV9A 1XX9A 3BIUH 3TJVA 1TB6H 4JMYA 2BDAA 2M5TA 4X2WA 4XE4A 3V7TA 4BTIB 3ATLA 1G9IE 5FHTA 3S7KB 1HUTH 3QGJA 3MNCA 3T5FH 2LPRA 1KTSB 1TA2A 1VCWA 3B23B 2ZTXA 1RIWC 1T8OA 2CJIA 2TPIZ 4JK6A 1AVXA 4J2YB 4B76A 1KDQA 3GCHC 5LPEA 4CRCA 2PKSC 1MQ6A 1GJBB 2UUKB 3DFLA 1AIXH 3UR9A 4IN2A 4AFUA 2FOBA 4ASHA 3BTDE 1YGCH 3SU2A 1IQNA 1JBUH 4NFEA 4Y8YA 4IS5A 1FXYA 9ESTA 1EJNA 1XKBC 2A5AA 5LPRA 1NRQH 3U1IB 5JYIA 1C5UA 1ZMJA 3U8OH 1VCQA 2G4UA 2FPZA 2ODYB 4FVBA 2EEKA 1C5WB 3RXDA 1QQ4A 1MTUA 3ZZ9A 1K1JA 1UK4A 1TMTH 1P3EA 2C8YB 3ATWA 4DG4A 1O32A 3SZNA 3SUFA 5DP7A 2FYQA 3H5CB 2BDHA 1N8OC 3TJOA 1TRYA 1GJAB 3M5OA 4X6OA 5EOKA 6LPRA 3PO1B 4OS7A 1AFEH 2KAIB 1ESBA 5BPEA 1FN8A 2ZFRH 4I8LA 1MU6B 4DJZB 1HAOH 2PLXA 3BTME 4FUBA 2WYGA 1IQEA 1HBTH 1U6QA 3A8DA 4ISLA 1EQ9A 1Z8JB 2WUBA 1ZPZA 4NG9H 3ZZ6A 1EB2A 1RTFB 3BTWE 5HM9A 2B7DH 1V2VT 1ZHPA 1C4U2 1PPHE 4JYTA 1UVOA 4Y8XA 3FP7E 1MBQA 2IN2A 2Z6BD 4SGAE 3BV9B 3PYHA 2FI5E 1O2YA 1C5TA 3BEIB 2SNWA 1QBNA 1DE7H 2TBSA 5CE1A 3QO6A 5ETXA 4WXVA 1ELBA 4NIXA 4JZEH 2BY6X 1SGFA 3A7ZA 3SGAE 3SNEA 4ABDA 1H8DH 1MBMA 2BXUH 4IW4E 1P8VC 4NGAH 1TX6A 3C1KA 3MH4A 1C5XB 1TPSA 2QF0A 5FCKA 2C4FH 2D26C 3RXOA 5CHAB 4I33A 1O0DH 4WJG2 4BXSA 2B5TB 2Z9JA 1S85A 4Q2KA 1YLDA 1NU9A 1Z8RA 5AHGH 1Y8TA 2ZDNA 1GWAA 3IITA 3A80A 4KP0A 4KTCA 1EAWA 3U69H 2ASUB 3SNAA 1P01A 2A1DB 3GCOA 3LONA 1QA7A 5DP8A 2JH5D 5DJ7A 3BG4B 1GJ7B 1WV7H 1P2MA 4IN1A 1FDPA 1HAHH 3GY7A 1C2HA 2XWAA 3U98H 2Y81A 4JZDH 2G00A 3UQVA
chains in the Genus database with same CATH superfamily
1MKWH 1D3QB 3KHVA 3MU5A 2SGDE 5DP5A 1RD3B 3RXTA 3SYJA 5F8TA 1JIRA 1O2TA 2F91A 1GBAA 2CGAA 1FY4A 2ZG0H 2W6JD 5DP4A 2K8IA 1G3DA 2XNDD 4MNWA 3SZEA 2SGFE 1H8IH 2A7CA 1WTGH 1KY9A 2EQNA 3VB4A 3S0NA 3PWCA 1WCZA 1QB6A 2RDEA 5FX6A 1Z6JH 2HALA 3BIVH 1P11E 2BHGA 3M7UA 3MU0A 1TX7A 1W12U 2J92A 1UW7A 2Z94A 1DWDH 1BTPA 1HJ9A 4ZHLU 2Y6TA 3MNSA 3LOXA 4FUGA 3PO1C 1A7SA 3TNSA 1T4UH 2TIOA 2G52A 3A7TA 3U8RH 1FN6A 1QJ1B 3ELAH 2Y80A 3T27A 3A81A 3LKWA 2M2AA 3ODFA 4X1NU 1QQUA 2ZIQH 4ZHMU 2ZPSA 4ZH8A 1SHYA 2FESH 5LGOA 1HYLA 4CRBA 5J4QA 2A2QH 3TK5A 3HGNA 1YC0A 3ZZ5A 4XRNA 1ZSLA 4AG1A 4HTCH 4JYUH 2JH0D 1ETSH 2H9TH 4DW2U 3I78A 1TALA 3SJIA 3OX7U 1A0HB 4CRAA 1HFDA 2ANWA 1LPZB 1BBRE 5EJZA 3UWJH 4Y7AA 4UDWH 3IG6B 1YPGH 1UCYE 1O5BB 4WH8A 1O3OA 2OC7A 1RRKA 5GDSH 2GMTB 3O8CA 1BDAA 2GCHG 1WOFA 3EGKH 3OEED 2H6MA 1ELCA 1DICA 4CBNA 4Y0ZE 3DHKH 3HK3B 1TGNA 3TLOA 2AERH 2ZHEH 1G30B 4Q7ZA 5JBCS 3HKIB 1GHXH 1XUKA 3GDUA 1JRSA 4O9VA 1C1RA 4R0IA 1O2IA 1TABE 4HFPB 2ANYA 3TJUA 3MYWA 3SHCH 1T8NA 1EZSC 1VJAU 1C5OH 1E35B 5KGOA 3RXIA 4E06H 1NC6A 3ZYEA 5E2PA 1MTWA 5DSFA 1ELEE 4INKA 1C1MA 5T6DA 3MH7A 3BTFE 3SGQE 2Z3EA 1CBWB 2VGCB 3P92A 5E0GA 1OX1A 2ZGCA 2V0BA 4U30A 4FUDA 3DSGA 3EDXB 1ETRH 3BG4C 4YOJA 4UFDH 1DFPA 3P8OA 1MD8A 1TBQH 2P93A 5F8XA 2BD3A 2VVUA 4K8BA 5FPYA 3ZZDA 1IQGA 1CVWH 3QTOH 4LZ4B 1PYTC 1ZRBA 1Y3XA 3KQCA 3PMAB 5FAHA 1GHAG 2AMPA 2H1UA 2QAAA 1NRNH 4UD9H 1VKYA 2A5IA 1AE5A 1IQFA 1HAZB 2J38A 3SU3A 1O3PB 1SGCA 3RXLA 1IHSH 5PTPA 4Y11E 1RFNA 6ESTA 2H5DA 2ILNA 4BAHB 1ANCA 1UJ1A 1LO6A 1VITF 2GGVB 1EB1H 3FVFB 4J1YA 1O2MA 4TPIZ 1GHVH 3LC5A 4IC5A 3A7YA 3BTGE 5FXLA 3RXCA 1BTYA 1GGDC 1G3CA 1C2IA 1CGJE 2D2DA 1C4Y2 1ELDE 1PPZA 2OCVB 1D9IA 3MMGA 5F8ZA 4X1PU 1LHEH 2GJGA 3QZQA 5E0HA 1DXPA 1DITH 5JBTA 4BTUB 4GCHF 2ZU5A 2ZDMA 1C1NA 1MU8B 2ZHDA 1NT1A 2JETB 3F6UH 2Q1JA 2Y7XA 3RM2H 4AGKA 3MOCA 1YCPM 3A84A 1ZRKA 1O2ZA 3ZVFA 1K2I1 1UTKA 4TWWA 1A61H 2EI8A 1AB9B 4I8GA 1OP0A 2VWLA 2DUCA 3S9BA 3TGIE 2VWMA 1P9SA 2BD4A 2NU4E 5AFYH 4XDEA 1LHFH 1PQ5A 1PPEE 3L33A 1DY8A 2VB0A 2C8WB 3M3VA 2XWBI 1DSUA 1YPJH 1GBLA 1C5SA 3F1SB 1TQ0B 3GY8A 4A7IB 1QFKH 1L0ZA 5I46H 1W2KH 2BOKA 1HAGE 4ZKSU 4YO9A 1K21H 1SQRA 1WQVH 2ZPRA 1O3MA 1W8BH 4OM9A 1UTOA 3VFEA 1OSSA 3LPRA 2ZHWH 3QUMP 2Q6FA 4DT4A 3PB1E 1HAXB 4AFSA 3P6ZB 3B9FH 1W7GH 1V3XA 1C1TA 1HJAB 4X1RU 3AW1A 2WSSD 2ZFTA 3RC5A 4A5TS 4CHAC 3SU0A 4AFQA 2BQWB 1BTWA 1TWXB 3V13A 2FS9A 3LH3A 3F9EA 2PW8H 3A86A 3TGKE 4WVPE 2BY5X 1LKAA 1TGBA 1EP5A 1TNJA 1Y5AT 2K1QA 3BTEE 2AGIX 4JK5A 1WTHD 4ISNA 3TK6A 1O3KA 4A92A 2OD3B 1SQOA 2ZCHP 1JIMA 1D4PB 2GZ8A 3SO3A 1PPFE 4B6FA 1J16A 1FY8E 3FO8D 5IYTA 3STJA 2BDBA 2PP6A 2YOLA 2PUXB 1DVAH 1ELFA 2F83A 3PV4A 5EG4A 3ZZ4A 4KTUA 1D3TB 1FMGA 1TMUH 3FN8A 1AD8H 2ZI2H 1E79D 3D23A 1QGFA 4YM9A 4GAWA 4VGCC 3UNRA 4FOUC 2GCTC 5H4IB 2CMYA 4KTSA 3GCNA 2PKAA 3TU7H 4SGBE 4HI3A 4ZXYH 3N7EA 2A32A 4BAOB 2R0LA 3GOVB 2O8TA 4A1VA 2CHAC 1K28D 1V2MT 3BEUA 2ZU3A 1FPHH 1HAYB 1EX3A 1CA0B 4HG6A 4CRGA 1SGNE 1G32B 3ZZBA 2GDEH 2WV9A 2BDCA 2VINA 1ZJKA 1XM1A 2BOHB 2PR3A 1TGCA 2WPKS 5SGAE 4ABGA 1E38B 2J9NA 3QN7A 3T26A 1A3EH 1N6YA 1MKXK 4H6TA 2BQ7B 2OQUA 5FX5A 1XUJA 1DS2E 1VJ9U 3SNBA 3KN2A 2HNTC 4BTTB 2IJOB 3RP2A 1GCTB 2TGTA 4CRFA 4B2BA 1GBCA 2R3UA 4FUCA 4K1TA 1LQDB 3GYLB 2ZPQA 1GBHA 2OTVA 2O9QA 4UFEH 2UWOA 4F4OC 4UFFH 1EOJA 3RXSA 1BMNH 1C5PA 3KNXA 2Y82A 1V2JT 1SMFE 3I77A 2JJ2D 1TMBH 2FOFA 3G01A 3RMMH 2BVXH 1YPEH 3VGCB 1EJAA 1H9HE 1CHOF 1GBJA 1A5GH 3R0FA 1Y3YA 5HGGA 1C4V2 1GJ5H 2FIRH 2GZ7A 1QRXA 3H7TA 5DP9A 1P10A 4B71A 1GHBF 2ZTYA 1E37B 1Z1JA 1V2QT 1UCYH 2ZFPH 1C2JA 1P2IA 4O3TA 1N6XA 4AX9H 1H9IE 3FFGA 1BTHH 4A6LA 4WMEA 4AC9A 1GI3A 3E90B 4OS5A 1W11U 3ODDA 1YPLH 1AKSB 2GV7A 3GY2A 1TLDA 2P8OB 3CP7A 1SPJA 4D9RA 2UUYA 3L3TA 2JKHA 1GI7B 1C2FA 2OLGA 4ZCNA 3WWBA 2AMQA 2OXSA 1YPHE 1MZAA 3PLKA 4BAQB 1EKBB 3EA8A 7GCHF 3UOPA 1H9LB 1GHZA 4ACAA 1V2LT 3HGPA 3ZZ7A 4AGJA 1O2JA 1A2CH 2RA3A 4D7GA 1O2QA 1D3DB 3M5MA 3KQEA 3ITIA 5JB9S 5GCHF 1DWEH 1O3NA 1OHHD 4INHA 5L30H 3KEEA 1HIAA 1ID5H 3ZZAA 1SQAA 1KSNA 4X8VH 2XXLA 4XBCA 1AY6H 1F5LA 1NFXA 1SGTA 2KCPA 4ZKOU 1MCTA 3KL6A 3F9HA 1GBBA 3RXHA 3SBKA 3OYPA 4DURA 3MU1A 2RFKC 1GJ6A 2ZZUH 4ZKNU 4D7FA 1FI8A 2G4TA 1QHRB 3ATIA 4O3UA 3VEQB 1O3JA 5IDKA 3LIWA 1S81A 1WYKA 2Q6GA 1QJ6B 1UMAH 3F0OA 1INCA 2V6NA 2RG3A 3DFJA 2VIWA 1OXGA 3KCGH 2PHBA 4TSFD 5GWZA 3RM0H 3A83A 5JBBS 2SFAA 1P57B 5T1VA 4I8HA 4YOIA 1E1RD 1P06A 2EI6A 3HK6B 3NKKA 1XUHA 4OGYA 1QR3E 3BTQE 4TYDA 4OS4A 1QNJA 3GDVA 5IK2D 1HRTH 1MTNB 2Y5HA 2SGPE 3A87A 5HMAA 1C9TA 3MO9A 3MH5A 5HIZA 4MNXA 3RMLH 1N1LA 3ZVBA 3M37A 1W0JD 1NFWA 4RKJB 2ANKH 3K6YA 1F5KU 1OWDA 1SLXB 3L6PA 4ZKRU 4XSKU 1AN1E 3EA7A 2QXIA 4GHQA 4JCNA 3GY4A 1A4WH 1FONA 2B9LA 3V3MA 1QY6A 1L4DA 3UAIC 1T8MA 2OQ5A 2F43B 3RMOH 2CV3A 1PQAA 2SGQE 1GI0A 1KXBA 1LVOA 3QWCH 2QCYA 4FU9A 1BTUA 1D6WA 1SC8U 1BUIA 2O8LA 1SQTA 3DSOA 1ANDA 2ALPA 3MNBA 3OAAD 1YY3A 3Q77A 1XVOA 4IMZA 2C8XB 1RTKA 1O2UA 1THRH 2Z9KA 2J98A 2XBYA 2P8OC 4Q4LA 1QBVH 2GZ9A 3SNCA 4I8KA 3KQBA 4K3JA 1YCPK 2FTMA 1C2KA 1GJ4H 1O2VA 1H1BA 4B1TA 1DANH 1O3EA 3V0XA 3SV8A 4RN6A 8GCHG 4LZ1H 2HRVA 1UK3A 1OOKB 4ABJA 4E7NA 2STBE 2FWWA 2Z9LA 1AWHB 2BDIA 5F6MA 1IOEA 3LGWA 1LQEA 5CHBA 2F9BH 2D8WA 1FAXA 1MTSA 1S84A 2JIZD 3N7OA 3RLWH 4U32A 2BZ6H 1O2KA 1LVBA 5A0BA 9LPRA 1TE0A 3KQ5A 5DPAA 1O3FA 2JJ1D 1CA8B 4CBOA 3LJJA 1X7AC 1C5RA 1HXEH 1O2OA 2BMGB 2C8ZB 5C67A 1B0FA 1MAXA 5KEDA 2OBQA 3OFND 5C0TA 3SV7A 2AGEX 1ZLRA 1TNGA 1O2WA 2FP7B 4Z0KA 2VH6A 2WZQA 1SR5C 1CT0E 2YMSB 1TNHA 1O38A 1ELAA 1G3EA 1DM4B 1BB0B 2O8MA 1ETTH 3SQEE 1C9PA 1P2NA 2QE7D 2V3HH 1NPMA 2QXGA 2PUQH 7KMEH 3O8RA 3F2HA 1SGQE 2BB4A 1AMHA 1TGTA 3TNTA 1Z6EA 3OTJE 1G36A 3MU4A 5E0JA 1O5AB 2Q6DA 3AAVA 3LH1A 4WMFA 2SGAA 1EPTB 1OYQA 5HYOA 4ABIA 1KXAA 1O33A 3U1JB 1GHAF 1ZTLA 1DWCH 1V6DA 4DGJA 4NSVA 5B6OA 5J4SA 1J17T 1T31A 3PROA 2YNBA 3VB5A 1Z7KA 1KYNA 1JRTA 1AZ8A 2ZQ2A 2B8OH 4OS6A 3ZVAA 1AFQB 1VZQH 2YMSD 3URDA 1O5CB 1ELVA 3EE7A 4B2AA 1GBEA 1H4WA 2R3YA 2XC5A 5B6LA 1QL8A 1DY9A 3TH2H 5A0AE 1O30A 5DKMA 1CT4E 4ABHA 2OC0A 2BTCE 4AOQA 3S9AA 2DE9A 1FPCH 3UTUH 4MDSA 2OUAA 4RT0A 1J9CH 1E34B 4XBDA 5DO4H 1F0UA 2BVRH 1OWEA 2ZA5A 1HAVA 3M36A 4ASUD 4GSOA 2F3CE 5C5NA 2J97A 2AMDA 1ZHRA 2GD4B 1H8HD 1BMLA 2QF3A 4NA7A 1ABJH 4AN7A 2H5CA 1AVGH 1TNLA 4ZXXH 2GDDA 1TRMA 2ALVA 4Q7XA 2PKAB 4Y6DA 7ESTE 4NWLA 2R0KA 1GI4A 1RXPA 3D65E 3LGVA 4QT8C 4Y79A 1UHBB 1KXDA 1YLCA 2WPJS 1KLTA 4ZAEA 4ABAA 4BXWA 8LPRA 4DCDA 5EGMA 4THNH 5CHAC 1ZR0A 1BMMH 1FUJA 5A0CA 1THPB 4CH8B 3I29A 1DT2A 1FQ3A 2A4OA 3W95A 3NRLA 1TBZH 2BM2A 3LJOA 3OEHD 1V2WT 5FCRA 5C2ZA 4DT7B 3V12A 4MTBA 1XKAC 4ISIH 2OC8A 1LDTT 1SLWB 3RXVA 1OYTH 2A45B 1W14U 1G2LA 3Q3XA 4MQAA 3RMNH 3SUDA 1JMOH 2C3SA 4KELA 2HVYB 3KYFA 1J15A 1K1MA 2ZGBH 2UUFB 3D49H 1XVMA 3MI4A 2FOCA 1GBKA 1WDIA 3WW7A 2XW9A 1DLEA 1YKTA 1S0QA 2SNVA 3A85A 3B8JA 4AYVB 1BRAA 1OP2A 1BITA 1E36B 5EXNA 1S6FA 2CXVA 3DD2H 1MQ5A 1T7CA 1O5EH 1TFXA 1GMCF 2FO9A 2VIQA 4RSPA 1A46H 2FTLE 4F48B 1EPTC 1UTNA 3OY5U 1XXFA 3TPIZ 3FP6E 1QCPA 1LPGB 2I6SA 4K8YA 1O36A 5G4BA 1BHXF 1UK2A 1OP8A 1NRPH 2J4IA 3RXAA 3ZVEA 3TK9A 1T32A 3FAOA 2ULLA 4KKDA 1L4ZA 1AFQC 2XBXA 2BY7X 5FPSA 4FXGH 5ABWA 4ISHH 4MPWA 2KCYA 1HB0B 1AUTC 1NY22 3BEFB 3F9FA 2BXTH 1AVWA 4NSYA 1O2NA 2LP6A 2KZ4A 3NWUA 1O3DA 3SI4H 2F9OA 2XCNA 2LNCA 2ZP0H 4X2XA 4AZ2B 1LTOA 2NWNA 2ZU1A 3IWMA 1AI8H 1UTPA 4Q63A 1VITH 2AS9A 1QURH 2P3UB 3BTTE 3RLYH 1C5YB 1BRBE 2P3TB 1WAYB 2Y7ZA 3E3TA 1WBGB 1S83A 1Z1IA 3LGTA 2GKVE 4RKOB 5JBAS 4PROA 1XXDA 2BLQA 2GMTC 2TGDA 4ABFA 3A82A 5DP3A 3U9AH 1O3CA 4NZQA 1UTLM 1FAKH 2CK3D 1PFXC 3VB3A 1EUFA 4NIVA 1Y3VA 2K0QA 1DOJA 2QA9E 3SU4A 1NFUA 1CT2E 1K9OE 1IQLA 4UFGH 3QK1A 1O31A 4TWYA 1NZQH 1SGPE 5HKKD 1B5GH 1COWD 1QTFA 5FBEA 1ANBA 1GDNA 3DT0H 3R3GB 4ZHAA 2HVXA 1GI5A 1GVLA 4R8TB 1KDQB 1C1SA 3PTBA 2GV6A 5EQRA 3FKSD 3Q76A 1OPHB 3P8FA 2ZWLH 2BDYA 3GICB 4ZMAH 1CBWC 2VGCC 3ZVCA 2J94A 5JDUB 1QBOA 5TCCA 1BMAA 2ZKSA 2GX4A 3FZZA 5EPYA 2BLWA 5C17A 3UWIA 1NM6A 3MNXA 1TGSZ 4BANB 1BIOA 1RJXB 2VU8E 1KMHB 2P94A 1C1WH 3SU5A 1CGIE 3PWBA 2VWOA 2XC0A 1Y3WA 3K6ZA 2FLRH 2WV4A 1AO5A 1BRUP 1DUEA 1HAIH 3T2NA 1OKXA 1T8LA 2XCFA 3GCTF 1QL7A 1C2EA 2FEQH 2FS8A 3GS9A 1YPMH 3QGNB 3UIRA 2ZFQH 3T25A 1FIWA 1P09A 3HKJB 2QIQA 4WXIA 3N99A 1IQIA 5L2ZH 2A4QA 1TIOA 1ZMNA 1EZQA 1GG6B 1ZZZA 3E16B 1WUNH 2OP9A 1AZZA 3STIA 2NU2E 1G2MA 1WU1A 3VXFH 1MD7A 1TBRH 3U28C 3URCA 1BBRK 1O5DH 3QX5H 3M3TA 2PFEA 1V2ST 1CGHA 1FLEE 3NCLA 1B7XB 1ZTKA 1VITG 4XD7D 1UCYK 3OTPA 3EA9A 2ZHQH 1D3PB 2V35A 1PQ8A 3RXBA 1NS3A 1S0RA 2WINI 3M35A 4AYYB 3A7XA 1W10U 3F2FA 8ESTE 3PM3A 3A89A 1O39A 3SI3H 6GCHG 2QV1A 1O3LA 1NBMD 2JETC 3DSPA 3EYDA 2TRMA 1V2UT 3F3BA 3AASA 3ZV8A 1SFQB 2H9HA 2Z3DA 2BDGA 1P2OA 1RIWB 1GCDA 1AB9C 1O2GH 1OS8A 3PMHB 1TPPA 2A7HA 3GCHB 2PKSB 1EOLA 3P8GA 2IOTA 1GJ8B 1C1UH 3SUGA 2PV9B 1F7ZA 1IAUA 1EASA 2BLOA 2PTCE 1O3BA 3RUOA 3SJKA 1TONA 2L74A 1FZZA 2BY8X 3UR6A 1V2TT 5FL7D 4M9FA 1MTVA 2XYAA 1GI9B 1NBME 4GPGA 2HLDD 2A4GA 4WMDA 4OS1A 4X2YA 2PGBB 2V7QD 5C1XA 1HCGA 3RU4D 2QXJA 1HV7A 1HJAC 2WPHS 2KCOA 2DE8A 1EXFA 1O3GA 1ZMLA 3MU8A 5AF9H 1UVUH 3GISB 2ODQA 4AORA 1EZXC 2KX4A 1GI8B 4YLUA 1QZ8A 1GJCB 1QB9A 4BAMB 2C93B 2H9EH 3SOSA 1ZPCA 4YTAA 1BHXB 3UUZA 1C1OA 5L2YH 1O2RA 2XC4A 1ZSJA 2SGEE 1W7XH 1V2PT 1FY5A 3C27B 4NFFA 5A09A 1DLKB 1SGRE 3T29A 3GDSA 4JYVH 2XOKD 2CF8H 2ZCKP 3SUEA 2ZDVH 3RU4E 1EAIA 3K65B 1BT7A 3SJ9A 3TITA 1TA6A 2GVFA 4X2VA 2BQ6B 4MVNA 2QF5A 5GXPA 1GL1A 5JB8S 2VVCA 2ZFFH 4D76A 8GCHF 3RDZA 1MKXH 2OK5A 3ZVGA 4ESTE 5EXMA 2FOAA 3ATKA 1D6RA 4NCYA 1V2RT 4YOGA 2STAE 1ELGA 3A8CA 1ZGVA 4Y7BA 1YP9A 5K0HA 1P05A 2QXHA 2A4RA 1SL3A 3PTNA 4ABEA 5EJ1A 3ZYDA 1O3HA 3AAUA 4CRDA 1CA0C 4A1XA 5GIBA 1SFIA 4A1TA 1QRWA 1C5VA 2PSYA 2P3FH 5ESTE 2G5VA 3W1EA 1O5GH 1GMDG 1V2KT 4X6PA 4XBBA 4UEHH 5GPIB 1DXWA 1AHTH 1YPHC 2BD2A 4FU8A 1O5FH 5EQSA 4CR9A 1RTLA 1NN6A 1K1LA 1W13U 1SOZA 3RXJA 2W7UA 5C1YA 5T6FA 2BX4A 4TT3D 8KME2 1BTZA 2HOBA 3UQOA 3MH6A 1RS0A 4RI0A 5LH8A 1AUJA 2O8WA 1SGEE 2ZC9H 1GHWH 4O97A 1ZPBA 4Y8ZA 1GCTC 4H4FA 2ODPA 1F0RA 2V3OH 5C5OA 1GMHG 3SGBE 1KIGH 2JDID 1C1PA 1A5HA 1PPCE 1TNKA 2BZAA 4K1SA 2EY4C 3GY3A 3EE0B 3W94A 1FNIA 1HPGA 3VGCC 4MG3A 3AVZA 4DIHH 2RDLA 4FUHA 4WY3A 1K0HA 1TAWA 2B0FA 5C3NA 3Q3YA 1THSH 1CHOG 2BD9A 1MKWK 2J5UA 1UVSH 3LGUA 3SW2B 3GY6A 2CF9H 5BRRE 4YLQH 5ESBA 3K9XB 2TGPZ 1O37A 1SLUB 1P3CA 1Q31A 3E0NB 3UFAA 5I25A 1Y5BT 1TRNA 3SNDA 1UTMA 5F53A 1LHDH 1NRSH 1GHBG 5A8ZA 4K1EA 3BTKE 4F55A 1K1PA 3HATH 4YXWD 5C1UA 7LPRA 5TJXA 1ANEA 1QIXB 1FIZA 2RA0A 4CR5A 5DN6D 2YNAA 2VJ1A 1Z71A 3A7VA 4Y10E 1KXFA 4B73A 1ZGIA 3NXPA 3PLBA 1C1VH 2BX3A 2GCHF 4D8NA 3SORA 1UO6A 1MAYA 5FPTA 5FBIA 4GLYA 4DY7B 4H6SB 1J14A 4JZFH 3UNQA 2G81E 5C94A 2XNIA 7GCHG 2R2MB 1TQ7B 1JWTA 1S6HA 2LELA 2BLVA 5GNDA 1GDQA 1V2NT 1GVKB 3FOAA 3NZIA 3PLPA 4HGCA 2ANMH 4MNVA 1MABB 2AIQA 2F4LA 1GBTA 5T6GA 5GCHG 4FUJA 1XUFA 4TY7A 1Y59T 2FDAA 5AVDA 1GI2A 1K22H 2ZNKH 4WF8A 1XUGA 3AW0A 3TH3H 3A8AA 4DIIH 5EW1H 3RXUA 2HNTF 3DA9B 4Z6AH 1O2LA 4O03A 1SB1H 2PSXA 3MO3A 3VB6A 2FMJA 3BSQA 3M7TA 3Q3KA 4ACBA 3PV2A 4TPYA 4NIYA 2F9NA 4B74A 1A0LA 2FYRA 1YYY1 1A0JA 4AFZA 3LDXH 1IHTH 1GHYH 3VG8A 1ZOMA 1JOUB 2AH4X 1SBWA 1PQ7A 2W3KA 2IPQX 3FZDA 1P03A 1M9UA 2VIVA 4NZLA 1C2MA 2UUJB 4NWKA 2KM0A 3RXFA 3TIUA 4YT6H 2P16A 1SHHB 1L2EA 1MTNC 2VIDA 1C2GA 2FOHA 1H8ED 1V2OT 2HPPH 4GUXA 2ESTE 1O34A 1GJ9B 3HPTB 1AKSA 3BG8A 4Y71A 4FUIA 5AFZH 1F5RA 3MFJA 1BOQA 2ZECA 4TY6A 1YCPH 1GGDB 4BAKB 4FVDA 1PJPA 1O3AA 5A8YA 4IMQA 1CQQA 1C5LH 6CHAB 1A3BH 3RXRA 4X1SU 3E1XB 3QLPH 2VIOA 5EXLA 1PYTD 1SVPA 4K69A 2IPHA 1BCUH 4YESB 4P02A 2BY9X 1EAUA 1C2DA 1G3BA 2F9PA 1NESE 1YM0A 2ZEBA 1DPOA 1BMFD 5GJ4B 4K60A 4NA8A 4AB8A 1KTTB 3TJNA 1ARBA 3H7OA 1B0EA 1SGDE 2ZCLP 2UWLA 4ZROA 2Z9GA 2OINA 3DUXH 4X6NA 1P2JA 1GL0E 3NPSA 3VXEH 1NRRH 5T3HA 5E8EH 5F03A 1ZJDA 3RC4A 2W3IA 2AGGX 1MMJN 3U8TH 1S6LA 1AWFH 4K5ZA 3KF2A 1S5SA 1O2SA 2NU3E 5C20A 1C5MD 2ZFSA 1O2HA 1ESTA 2VBCA 1P2KA 2F9UA 1L1NA 2VNTA 1Y5UT 1TOMH 1VR1H 3SU6A 3A8BA 3KYGA 5A8XA 2R2WU 2VH0A 3O8BA 4GHTA 3UNSA 3Q00A 2A0QB 3LU9B 3PRDA 3CNRA 3LT3A 3SN8A 1QJ7B 2AFQB 3O8DA 3QTVH 2PGQB 3RC6A 3SJ8A 1EAXA 4CHAB 2ZF0H 1VCPA 4Y0YE 5DG6A 1DUAA 1P2QA 3QZRA 1Z8GA 1P0SH 1Y3UA 2ZGJA 4KGAA 2F9VA 1C1QA 2RCEA 4I32A 2I6QA 1QB1A 3WY8A 2KAIA 1DWBH 2YMSC 3UY9A 1EJMA 1KLJH 3KIDU 1W0ZU 1CSOE 2FI3E 2HPQH 2KFWA 3JZ2B 3BF6H 2W6ID 4X1QU 4Y76A 2QC2A 3KGPA 4F49A 2ZU2A 1SKYE 3BN9A 4LXBH 3S9CA 2JH6D 2QN5T 1K1NA 3M61U 3RXKA 4AG2A 4I8JA 1IQJA 1MCVA 1QL9A 5EW2H 1JXPA 1GBDA 3ZZ3A 1LPKB 2FOGA 2GT7A 5DGJA 4WH6A 5CDFE 5HXFA 1O2PA 3VPKA 3NK8A 3ZIAD 4VGCB 4LOYH 1EATA 1Z8IB 1LKBA 2GCTB 4P00A 4MPUA 1CE5A 4NA9H 4ABBA 2W26A 4AB9A 1NO9H 2WUCA 3K2UA 4FUFA 3OU0A 3EQ0H 1BA8B 2CHAB 1SGYE 1MH0A 2VIPA 6CHAC 3CS7A 2HLCA 2OC1A 5EIYA 2EA3A 1FY3A 6GCHF 1ELTA 3FANA 1C2LA 1LVYA 2FZZA 1OWJA 1Q3XA 1GVZA 2ZTZA 3SHAH 1UVPA 3RU4T 4OS2A 1HNEE 2WYJA 4XFQA 1XMNB 1TX8A 2GP9B 1ZYOA 3D62A 5EQQA 1HIAB 2NU1E 2XTTB 1ESAA 2WHXA 4FU7A 3UB0A 2FOMB 3EAJA 4X0WU 1DDJA 2OBOA 1P12E 4MPXA 2BD5A 1PPBH 1C5NH 3ZZCA 1DSTA 2BD7A 2QYIA 2Z3CA 1BRCE 1CO7E 1S82A 2IJD1 2O8UA 2D1JA 1IQHA 4ZUHA 1ACBE 3LGIA 3TGJE 1HJ8A 4H42U 1YPKH 5EJLA 1SGFG 4MPVA 2G5NA 3T28A 3ZV9A 3M5LA 3UREA 3T62A 4E05H 1GJDB 1FY1A 3RXGA 2BVSH 2J34A 2Y5FA 1BJVA 2J2UA 1EPTA 2ZDAH 1IQKA 1BZXE 3KQDA 3AK5A 5LPFA 1LMWB 2ZGHA 2KCAA 5EPNA 1L1GA 2FI4E 2A5KA 2AYWA 3F2GA 3BTHE 1TPAE 2VVVA 1HAPH 2PTNA 2UWPA 2C90B 1TOCB 2R9PA 2ZQ1A 3RXEA 1WSSH 2XBVA 2A7JA 4HZHA 1SGIB 1VGCB 2ZDLA 4YZUA 3F68H 3P70B 2FLBH 4FUEA 1QRZA 2EC9H 2GTBA 4X6MA 1W3CA 4X8TH 4IBLH 2HWLB 1SLVB 1TPOA 2AIPA 1P02A 3SU1A 1F0TA 1QA0A 4BNRA 5A2MH 1O2XA 1FV9A 4I7YH 1NTPA 1OWKA 4Q80A 1GMCG 3SJOA 1GDUA 1CU1A 1O3IA 5CMXH 2P59A 3OE7D 1BJUA 3JZ1B 2HNTE 1G37A 2G8TA 1UVTH 2WPMS 1IQMA 2A31A 3SV6A 3GYMA 4K2YA 1WXRA 3P8NA 3P17H 1K1OA 3ZZ8A 2NU0E 1HXFH 1AGJA 2G51A 3MTYA 1F92A 1SG8B 4U2WA 3F9GA 1OWHA 3RXPA 1RGQA 1KXCA 2FX4A 4GCHG 1E1QD 4JZ1A 2J98B 1UHBA 2VWNA 1E0FD 4E7RG 3S7HB 2QGRA 3MWIU 1GPZA 2ZHFH 4NIWA 1HDTH 3M7QA 1BTXA 1ORFA 2HGTH 5DK1A 1W0YH 1C5ZB 3ZVDA 1GMDF 2GT8A 4M7GA 3P95A 1HGTH 3LGYA 2Y5GA 4UE7H 2Z7FE 3M5NA 1TNIA 1FJSA 1TYNA 4Q7YA 2W5EA 2FX6A 2ZDKA 4ISOA 1W0KD 3E8LA 1YWUA 3SQHE 4I31A 1P04A 5DP6A 2WPLS 1J8AA 2ZO3H 3ENSB 1ABIH 1SOTA 2KR7A 3FP8E 2FXRA 1GI6A 4BOHA 3RXQA 1ZSKA 3PMBB 4X8UH 1CHGA 5HIYA 1F2SE 1MZDA 4U01A 4DOQA 1GMHF 1T4VH 1P9UA 1A1RA 3S69A 2P95A 5L6NH 4YT7H 2H2ZA 3UOUA 1GI1A 1LCYA 1Q2WA 1N8OB 2BD8A 3NUMA 1A5IA 1F0SA 1OWIA 4XOJA 4B2CA 4D9QA 3MHWU 1AU8A 2QY0B 3LC3A 3GY5A 3OSYA 1XUIA 5K7RA 3CENA 2THFB 2CN0H 4I86A 1ARCA 5TCAA 1SI5H 4IGDA 1LHCH 2AEIH 2Z9IA 1SSXA 1PPGE 1EP6A 4WWYA 2FOEA 1ZHMA 2PWXA 1GBMA 3MO6A 2FM2A 1K1IA 1UTQA 3E91A 1YF4A 2L6OA 3M3SA 1EZUC 2EI7A 2FODA 4LK4A 1BBRH 2V3MA 1O35A 2WV5A 3SV2H 1L1JA 1NROH 3OY6U 4MLFB 1GBIA 2ZU4A 4INLA 1NU7B 1VGCC 4MNYA 3QDZB 1KXEA 4GVUA 1AQ7A 5EU8A 2TGAA 1C5QA 3A7WA 4IC6A 1DX5M 1GBFA 3E0PB 3A88A 3GCTG 3VB7A 1AE8H 2A2XH 4DVAU 4B75A 1BQYA 1WQSA 4OGXA 2ZGXH 1LVMA 1MUEB 5E2OA 4UONA 1NFYA 5EODA 5HM2A 4CH2B 1GG6C 1UTJA 2BYAX 2G55A 3ATMA 3TVJB 2J95A 1LHGH 3RXMA 3ESTA 3F0PA 4CREA 3E6PH 2XRCA 2W7SA 1YBWA 2WPIS 4JZIA 3CS0A 2XBWA 1HLTH 4X8SH 5JPMH 1HAVB 3TH4H 3UPEA 3PMJA 3PV5A 1ZTJA 1KLIH 4B6EA 3SV9A 1XX9A 3BIUH 3TJVA 1TB6H 4JMYA 2BDAA 2M5TA 3H09A 4X2WA 4XE4A 3V7TA 4BTIB 3ATLA 1G9IE 5FHTA 3S7KB 1HUTH 3QGJA 3MNCA 3T5FH 5KECA 2LPRA 1KTSB 1TA2A 1VCWA 3B23B 2ZTXA 1RIWC 1T8OA 2CJIA 2TPIZ 4JK6A 1AVXA 4J2YB 4B76A 1KDQA 3GCHC 5LPEA 4CRCA 1MQ6A 2PKSC 1GJBB 2UUKB 3DFLA 1AIXH 3UR9A 4IN2A 4AFUA 2FOBA 4ASHA 3BTDE 1YGCH 3SU2A 1IQNA 1JBUH 4NFEA 4Y8YA 4IS5A 1FXYA 9ESTA 1EJNA 1XKBC 2A5AA 5LPRA 1NRQH 3U1IB 5JYIA 1C5UA 1ZMJA 3U8OH 1VCQA 3WWFA 2G4UA 2FPZA 2ODYB 4FVBA 2EEKA 1C5WB 3RXDA 1QQ4A 1MTUA 3ZZ9A 1K1JA 1UK4A 1TMTH 1P3EA 2C8YB 3ATWA 4DG4A 1O32A 3SZNA 3SUFA 5DP7A 2FYQA 3H5CB 2BDHA 1N8OC 3TJOA 1TRYA 1GJAB 3M5OA 4X6OA 5EOKA 6LPRA 3PO1B 1YLNA 1AFEH 4OS7A 2KAIB 1ESBA 5BPEA 1FN8A 2ZFRH 4I8LA 1MU6B 4DJZB 3PRBA 4Z1MD 1HAOH 2PLXA 3BTME 4FUBA 4RT1A 2WYGA 1IQEA 1HBTH 1U6QA 3A8DA 4ISLA 1EQ9A 1Z8JB 2WUBA 1ZPZA 4NG9H 3ZZ6A 1EB2A 1RTFB 3BTWE 3N7DA 5HM9A 2B7DH 1V2VT 1ZHPA 1C4U2 2AHME 1PPHE 4JYTA 1UVOA 4Y8XA 3FP7E 1MBQA 2IN2A 2Z6BD 4SGAE 3BV9B 3PYHA 2FI5E 1O2YA 1C5TA 3BEIB 2SNWA 1QBNA 1DE7H 2TBSA 5CE1A 3QO6A 5ETXA 4WXVA 1ELBA 2WPDD 4NIXA 4JZEH 2BY6X 1SGFA 5C0UA 3A7ZA 3SGAE 3SNEA 4ABDA 1H8DH 1MBMA 2BXUH 4IW4E 1P8VC 4NGAH 1TX6A 3C1KA 3MH4A 1C5XB 1TPSA 2QF0A 5FCKA 2QF4A 2C4FH 3MQKC 1FX0B 2D26C 3RXOA 5CHAB 4I33A 1O0DH 4FETA 4WJG2 4BXSA 2B5TB 2Z9JA 1S85A 4Q2KA 1YLDA 1NU9A 1Z8RA 5AHGH 1Y8TA 3DCLA 2ZDNA 1GWAA 3IITA 3A80A 4KP0A 4KTCA 1EAWA 3U69H 2ASUB 3SNAA 1P01A 2A1DB 3GCOA 3LONA 1QA7A 5DP8A 2JH5D 5DJ7A 3BG4B 1GJ7B 1WV7H 1P2MA 4IN1A 1FDPA 1HAHH 3GY7A 1C2HA 2XWAA 1EFRD 3U98H 2Y81A 4JZDH 2G00A 3UQVA
chains in the Genus database with same CATH topology
1MKWH 1D3QB 3KHVA 3MU5A 2SGDE 5DP5A 1RD3B 3RXTA 5F8TA 1JIRA 1O2TA 2F91A 1GBAA 2CGAA 1FY4A 2ZG0H 5DP4A 1G3DA 4MNWA 2SGFE 1H8IH 2A7CA 1WTGH 1KY9A 3VB4A 3S0NA 3PWCA 1WCZA 1QB6A 5FX6A 1Z6JH 2HALA 3BIVH 1P11E 2BHGA 3M7UA 3MU0A 1TX7A 1W12U 2J92A 2Z94A 1DWDH 1BTPA 1HJ9A 4ZHLU 2Y6TA 3MNSA 3LOXA 4FUGA 3PO1C 1A7SA 3TNSA 1T4UH 2TIOA 2G52A 3A7TA 3U8RH 1FN6A 1QJ1B 3ELAH 2Y80A 3T27A 3A81A 3LKWA 3ODFA 4X1NU 1QQUA 2ZIQH 4ZHMU 2ZPSA 4ZH8A 1SHYA 2FESH 5LGOA 1HYLA 4CRBA 5J4QA 2A2QH 3TK5A 3HGNA 1YC0A 3ZZ5A 4AG1A 1ZSLA 4HTCH 4JYUH 2JH0D 1ETSH 2H9TH 4DW2U 3I78A 1TALA 3SJIA 3OX7U 1A0HB 4CRAA 1HFDA 2ANWA 1LPZB 1BBRE 3UWJH 4Y7AA 4UDWH 3IG6B 1YPGH 1UCYE 1O5BB 4WH8A 1O3OA 2OC7A 1RRKA 5GDSH 2GMTB 3O8CA 1BDAA 2GCHG 1WOFA 3EGKH 2H6MA 1ELCA 1DICA 4CBNA 4Y0ZE 3DHKH 3HK3B 1TGNA 3TLOA 2AERH 2ZHEH 1G30B 4Q7ZA 5JBCS 3HKIB 1GHXH 1XUKA 3GDUA 1JRSA 4O9VA 1C1RA 4R0IA 1O2IA 1TABE 4HFPB 2ANYA 3TJUA 3MYWA 3SHCH 1T8NA 1EZSC 1VJAU 1C5OH 1E35B 3RXIA 4E06H 1NC6A 3ZYEA 5E2PA 1MTWA 1ELEE 4INKA 1C1MA 5T6DA 3MH7A 3BTFE 3SGQE 2Z3EA 1CBWB 2VGCB 3P92A 5E0GA 1OX1A 2ZGCA 2V0BA 4U30A 4FUDA 3EDXB 1ETRH 3BG4C 4YOJA 4UFDH 1DFPA 3P8OA 1MD8A 1TBQH 2P93A 5F8XA 2BD3A 2VVUA 4K8BA 5FPYA 3ZZDA 1IQGA 1CVWH 3QTOH 4LZ4B 1PYTC 1ZRBA 1Y3XA 3KQCA 3PMAB 5FAHA 1GHAG 2AMPA 2H1UA 2QAAA 1NRNH 4UD9H 2A5IA 1AE5A 1IQFA 1HAZB 2J38A 3SU3A 1O3PB 1SGCA 3RXLA 1IHSH 5PTPA 4Y11E 1RFNA 6ESTA 2H5DA 2ILNA 4BAHB 1ANCA 1UJ1A 1LO6A 1VITF 2GGVB 1EB1H 3FVFB 4J1YA 1O2MA 4TPIZ 1GHVH 3LC5A 4IC5A 3A7YA 3BTGE 5FXLA 3RXCA 1BTYA 1GGDC 1G3CA 1C2IA 1CGJE 2D2DA 1C4Y2 1ELDE 1PPZA 2OCVB 1D9IA 3MMGA 5F8ZA 4X1PU 1LHEH 3QZQA 5E0HA 1DXPA 1DITH 5JBTA 4BTUB 4GCHF 2ZU5A 2ZDMA 1C1NA 1MU8B 2ZHDA 1NT1A 2JETB 3F6UH 2Q1JA 2Y7XA 3RM2H 4AGKA 3MOCA 1YCPM 3A84A 1ZRKA 1O2ZA 3ZVFA 1K2I1 1UTKA 4TWWA 1A61H 2EI8A 1AB9B 4I8GA 1OP0A 2VWLA 2DUCA 3S9BA 3TGIE 2VWMA 1P9SA 2BD4A 2NU4E 5AFYH 4XDEA 1LHFH 1PQ5A 1PPEE 3L33A 1DY8A 2VB0A 2C8WB 3M3VA 2XWBI 1DSUA 1YPJH 1GBLA 1C5SA 3F1SB 1TQ0B 3GY8A 4A7IB 1QFKH 1L0ZA 5I46H 1W2KH 2BOKA 1HAGE 4ZKSU 4YO9A 1K21H 1WQVH 2ZPRA 1O3MA 1W8BH 1UTOA 3VFEA 1OSSA 3LPRA 2ZHWH 3QUMP 2Q6FA 3PB1E 1HAXB 4AFSA 3P6ZB 3B9FH 1W7GH 1V3XA 1C1TA 1HJAB 4X1RU 3AW1A 2ZFTA 3RC5A 4A5TS 4CHAC 3SU0A 4AFQA 2BQWB 1BTWA 1TWXB 3V13A 2FS9A 3LH3A 3F9EA 2PW8H 3A86A 3TGKE 4WVPE 2BY5X 1LKAA 1TGBA 1EP5A 1TNJA 1Y5AT 2K1QA 3BTEE 2AGIX 4JK5A 1WTHD 4ISNA 3TK6A 1O3KA 4A92A 2OD3B 1SQOA 2ZCHP 1JIMA 1D4PB 2GZ8A 3SO3A 1PPFE 1J16A 1FY8E 5IYTA 3STJA 2BDBA 2YOLA 2PUXB 1DVAH 1ELFA 2F83A 3PV4A 5EG4A 3ZZ4A 4KTUA 1D3TB 1FMGA 1TMUH 1AD8H 2ZI2H 3D23A 1QGFA 4YM9A 4GAWA 4VGCC 3UNRA 2GCTC 5H4IB 2CMYA 4KTSA 3GCNA 2PKAA 3TU7H 4SGBE 4HI3A 4ZXYH 2A32A 4BAOB 2R0LA 3GOVB 2O8TA 4A1VA 2CHAC 1K28D 1V2MT 3BEUA 2ZU3A 1FPHH 1HAYB 1EX3A 1CA0B 4CRGA 1SGNE 1G32B 3ZZBA 2GDEH 2BDCA 2VINA 1ZJKA 1XM1A 2BOHB 2PR3A 1TGCA 2WPKS 5SGAE 4ABGA 1E38B 2J9NA 3QN7A 3T26A 1A3EH 1N6YA 1MKXK 4H6TA 2BQ7B 2OQUA 5FX5A 1XUJA 1DS2E 1VJ9U 3SNBA 3KN2A 2HNTC 4BTTB 2IJOB 3RP2A 1GCTB 2TGTA 4CRFA 4B2BA 1GBCA 2R3UA 4FUCA 4K1TA 1LQDB 3GYLB 2ZPQA 1GBHA 2OTVA 2O9QA 4UFEH 2UWOA 4F4OC 4UFFH 1EOJA 3RXSA 1BMNH 1C5PA 3KNXA 2Y82A 1V2JT 1SMFE 3I77A 3RMMH 1TMBH 2FOFA 3G01A 3VGCB 2BVXH 1YPEH 1EJAA 1H9HE 1CHOF 1GBJA 1A5GH 3R0FA 1Y3YA 5HGGA 1C4V2 1GJ5H 2FIRH 2GZ7A 1QRXA 3H7TA 5DP9A 1P10A 4B71A 1GHBF 2ZTYA 1E37B 1Z1JA 1V2QT 1UCYH 2ZFPH 1C2JA 1P2IA 4O3TA 1N6XA 4AX9H 1H9IE 3FFGA 1BTHH 4A6LA 4WMEA 1GI3A 3E90B 4OS5A 1W11U 3ODDA 1YPLH 1AKSB 2GV7A 3GY2A 1TLDA 2P8OB 3CP7A 1SPJA 4D9RA 2UUYA 3L3TA 2JKHA 1GI7B 1C2FA 2OLGA 2AMQA 2OXSA 1YPHE 1MZAA 3PLKA 4BAQB 1EKBB 3EA8A 7GCHF 3UOPA 1H9LB 1GHZA 1V2LT 3HGPA 3ZZ7A 4AGJA 1O2JA 1A2CH 2RA3A 4D7GA 1O2QA 1D3DB 3M5MA 3KQEA 3ITIA 5JB9S 5GCHF 1DWEH 1O3NA 4INHA 5L30H 3KEEA 1HIAA 1ID5H 3ZZAA 1SQAA 1KSNA 4X8VH 2XXLA 4XBCA 1AY6H 1F5LA 1NFXA 1SGTA 4ZKOU 1MCTA 3KL6A 3F9HA 1GBBA 3RXHA 3SBKA 3OYPA 4DURA 3MU1A 1GJ6A 2ZZUH 4ZKNU 4D7FA 1FI8A 2G4TA 1QHRB 3ATIA 4O3UA 3VEQB 1O3JA 5IDKA 3LIWA 1S81A 1WYKA 2Q6GA 1QJ6B 1UMAH 1INCA 2V6NA 2RG3A 3DFJA 2VIWA 1OXGA 3KCGH 2PHBA 5GWZA 3RM0H 3A83A 5JBBS 2SFAA 1P57B 4I8HA 4YOIA 1P06A 2EI6A 3HK6B 3NKKA 1XUHA 4OGYA 1QR3E 3BTQE 4TYDA 4OS4A 1QNJA 3GDVA 1HRTH 1MTNB 2Y5HA 2SGPE 3A87A 5HMAA 1C9TA 3MO9A 3MH5A 4MNXA 3RMLH 1N1LA 3ZVBA 3M37A 4RKJB 1NFWA 2ANKH 3K6YA 1F5KU 1OWDA 1SLXB 3L6PA 4ZKRU 4XSKU 1AN1E 3EA7A 2QXIA 4GHQA 4JCNA 3GY4A 1A4WH 1FONA 2B9LA 3V3MA 1QY6A 1L4DA 1T8MA 2OQ5A 3RMOH 2CV3A 1PQAA 2SGQE 1GI0A 1KXBA 1LVOA 3QWCH 2QCYA 4FU9A 1BTUA 1D6WA 1SC8U 1BUIA 2O8LA 1SQTA 1ANDA 2ALPA 3MNBA 3Q77A 1XVOA 4IMZA 2C8XB 1RTKA 1O2UA 1THRH 2Z9KA 2XBYA 2P8OC 1QBVH 2GZ9A 3SNCA 4I8KA 3KQBA 4K3JA 1YCPK 2FTMA 1C2KA 1GJ4H 1O2VA 1H1BA 4B1TA 1DANH 1O3EA 3V0XA 3SV8A 4RN6A 8GCHG 4LZ1H 2HRVA 1UK3A 1OOKB 4ABJA 4E7NA 2STBE 2FWWA 2Z9LA 1AWHB 2BDIA 5F6MA 1IOEA 3LGWA 1LQEA 2F9BH 2D8WA 1FAXA 1MTSA 1S84A 3N7OA 3RLWH 4U32A 2BZ6H 1O2KA 1LVBA 5A0BA 9LPRA 1TE0A 5DPAA 1O3FA 1CA8B 4CBOA 3LJJA 1X7AC 1C5RA 1HXEH 1O2OA 2BMGB 2C8ZB 5C67A 1B0FA 1MAXA 2OBQA 3SV7A 2AGEX 1ZLRA 1TNGA 1O2WA 2FP7B 4Z0KA 2VH6A 1SR5C 1CT0E 1TNHA 1O38A 1ELAA 1G3EA 1DM4B 1BB0B 2O8MA 1ETTH 3SQEE 1C9PA 1P2NA 2V3HH 1NPMA 2QXGA 2PUQH 7KMEH 3O8RA 1SGQE 2BB4A 1AMHA 1TGTA 3TNTA 1Z6EA 3OTJE 1G36A 3MU4A 5E0JA 1O5AB 2Q6DA 3AAVA 3LH1A 4WMFA 2SGAA 1EPTB 1OYQA 5HYOA 4ABIA 1KXAA 1O33A 3U1JB 1GHAF 1ZTLA 1DWCH 1V6DA 4DGJA 4NSVA 5B6OA 5J4SA 1J17T 1T31A 3PROA 2YNBA 3VB5A 1Z7KA 1KYNA 1JRTA 1AZ8A 2ZQ2A 2B8OH 4OS6A 3ZVAA 1AFQB 1VZQH 3URDA 1O5CB 1ELVA 4B2AA 1GBEA 1H4WA 2R3YA 2XC5A 1QL8A 1DY9A 3TH2H 5A0AE 1O30A 5DKMA 1CT4E 4ABHA 2OC0A 2BTCE 4AOQA 3S9AA 2DE9A 1FPCH 3UTUH 4MDSA 2OUAA 1J9CH 1E34B 4XBDA 5DO4H 1F0UA 2BVRH 1OWEA 2ZA5A 1HAVA 3M36A 4GSOA 2F3CE 5C5NA 2AMDA 1ZHRA 2GD4B 1BMLA 2QF3A 4NA7A 1ABJH 4AN7A 2H5CA 1AVGH 1TNLA 4ZXXH 2GDDA 1TRMA 2ALVA 4Q7XA 2PKAB 4Y6DA 7ESTE 4NWLA 2R0KA 1GI4A 1RXPA 3D65E 3LGVA 4QT8C 4Y79A 1UHBB 1KXDA 1YLCA 2WPJS 1KLTA 4ZAEA 4ABAA 4BXWA 8LPRA 4DCDA 5EGMA 4THNH 5CHAC 1ZR0A 1BMMH 1FUJA 5A0CA 1THPB 4CH8B 3I29A 1DT2A 1FQ3A 2A4OA 3W95A 1TBZH 2BM2A 3LJOA 1V2WT 5FCRA 5C2ZA 4DT7B 3V12A 4MTBA 1XKAC 4ISIH 2OC8A 1LDTT 1SLWB 3RXVA 1OYTH 2A45B 1W14U 1G2LA 3Q3XA 4MQAA 3RMNH 3SUDA 1JMOH 2C3SA 4KELA 1J15A 1K1MA 2ZGBH 2UUFB 3D49H 1XVMA 3MI4A 2FOCA 1GBKA 2XW9A 1DLEA 1YKTA 1S0QA 2SNVA 3A85A 3B8JA 4AYVB 1BRAA 1OP2A 1BITA 1E36B 5EXNA 1S6FA 2CXVA 3DD2H 1MQ5A 1T7CA 1O5EH 1TFXA 1GMCF 2FO9A 2VIQA 4RSPA 1A46H 2FTLE 1EPTC 1UTNA 3OY5U 1XXFA 3TPIZ 3FP6E 1QCPA 1LPGB 2I6SA 4K8YA 1O36A 5G4BA 1BHXF 1UK2A 1OP8A 1NRPH 2J4IA 3RXAA 3ZVEA 3TK9A 1T32A 3FAOA 2ULLA 4KKDA 1L4ZA 1AFQC 2XBXA 2BY7X 5FPSA 4FXGH 5ABWA 4ISHH 4MPWA 1HB0B 1AUTC 1NY22 3BEFB 3F9FA 2BXTH 1AVWA 4NSYA 1O2NA 3NWUA 1O3DA 3SI4H 2F9OA 2XCNA 2LNCA 2ZP0H 4X2XA 4AZ2B 1LTOA 2NWNA 2ZU1A 3IWMA 1AI8H 1UTPA 1VITH 2AS9A 1QURH 2P3UB 3BTTE 3RLYH 1C5YB 1BRBE 2P3TB 1WAYB 2Y7ZA 3E3TA 1WBGB 1S83A 1Z1IA 3LGTA 2GKVE 4RKOB 5JBAS 4PROA 1XXDA 2BLQA 2GMTC 2TGDA 4ABFA 3A82A 5DP3A 3U9AH 1O3CA 4NZQA 1UTLM 1FAKH 1PFXC 3VB3A 1EUFA 4NIVA 1Y3VA 1DOJA 2QA9E 3SU4A 1NFUA 1CT2E 1K9OE 1IQLA 4UFGH 3QK1A 1O31A 4TWYA 1NZQH 1SGPE 1B5GH 1QTFA 5FBEA 1ANBA 1GDNA 3DT0H 3R3GB 4ZHAA 2HVXA 1GI5A 1GVLA 4R8TB 1KDQB 1C1SA 3PTBA 2GV6A 5EQRA 3Q76A 1OPHB 3P8FA 2ZWLH 2BDYA 3GICB 4ZMAH 1CBWC 2VGCC 3ZVCA 2J94A 5JDUB 1QBOA 5TCCA 1BMAA 2ZKSA 2GX4A 3FZZA 5EPYA 2BLWA 3UWIA 1NM6A 3MNXA 1TGSZ 4BANB 1BIOA 1RJXB 2VU8E 2P94A 1C1WH 3SU5A 1CGIE 3PWBA 2VWOA 2XC0A 1Y3WA 3K6ZA 2FLRH 2WV4A 1AO5A 1BRUP 1DUEA 1HAIH 3T2NA 1OKXA 1T8LA 2XCFA 3GCTF 1QL7A 1C2EA 2FEQH 2FS8A 3QGNB 1YPMH 3UIRA 2ZFQH 3T25A 1FIWA 1P09A 3HKJB 2QIQA 4WXIA 5L2ZH 1IQIA 2A4QA 1TIOA 1ZMNA 1EZQA 1GG6B 1ZZZA 3E16B 1WUNH 2OP9A 1AZZA 3STIA 2NU2E 1G2MA 1WU1A 3VXFH 1MD7A 1TBRH 3URCA 1BBRK 1O5DH 3QX5H 3M3TA 2PFEA 1V2ST 1CGHA 1FLEE 3NCLA 1B7XB 1ZTKA 1VITG 1UCYK 3EA9A 2ZHQH 1D3PB 2V35A 1PQ8A 3RXBA 1NS3A 1S0RA 2WINI 3M35A 4AYYB 3A7XA 1W10U 8ESTE 3PM3A 3A89A 1O39A