3LGYA

R178a mutant of the degs-deltapdz protease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
213
structure length
179
Chain Sequence
STDETPASYNLAVRRAAPAVVNVYNRLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPGQTITQGIISATFLQTDASINHGNSGGALVNSLGELMGINTLPEGIGFAIPFQLATKIMDKLIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 36
structure length 179
sequence length 213
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgyA02
5LPRA 2QIQA 3AW0A 1SGNE 1UVUH 1GHZA 1FLEE 2Q6GA 5B6OA 5JPMH 4ZKRU 2UUKB 1SQAA 1NZQH 3NZIA 2C4FH 2IN2A 4X2VA 2CXVA 3B8JA 4ABEA 4X2WA 4ZROA 1KIGH 1H4WA 1LPKB 2ZPSA 1HLTH 1AO5A 2F9OA 2QYIA 3UNRA 1HRTH 4Y7AA 3LGIA 2TBSA 1A5IA 1V2UT 1MKXH 2G5VA 3O8BA 2G52A 4Y71A 4MLFB 1IQHA 4AFUA 4TPIZ 2R9PA 4ZH8A 4DCDA 3RXIA 4ZXXH 2BZAA 4AG2A 1GI4A 1N8OC 1QL9A 3A8BA 5F8XA 1IHTH 1C5XB 2NU1E 4H6SB 2FESH 5GDSH 2VIQA 1HB0B 1AIXH 1O2LA 3S7HB 4X6PA 1BDAA 2NU4E 2PV9B 4Y8XA 1GG6B 4Q7YA 1C9TA 1ZYOA 1P06A 3KQBA 4QT8C 1RIWC 2GT8A 2PFEA 4J2YB 4AFQA 1OX1A 5L2ZH 4TWYA 2Y80A 3I78A 4UFDH 2PR3A 1DE7H 1F0SA 3RXGA 1RRKA 1MAXA 1C2JA 1Y3UA 4GUXA 2BDIA 1K1MA 5GPIB 1GBJA 2O8UA 1KXCA 4X8UH 1E0FD 1HJAC 1ZTJA 3NUMA 3DHKH 1H1BA 2J9NA 1HJ9A 3V0XA 1GHYH 4JMYA 1CSOE 4WY3A 1V2TT 1GBFA 2A2XH 1C1PA 1EXFA 3E90B 1IQGA 1TMBH 4LZ1H 1TPSA 1BMNH 1D3QB 5K0HA 1SMFE 2XCFA 1SLUB 2BD2A 3M5MA 2FOFA 3NWUA 2ANKH 1TPAE 2ZIQH 3DD2H 2QXGA 3AW1A 1QJ7B 1FZZA 2C8XB 1IQEA 2WPMS 2OCVB 1L0ZA 1PQ5A 1TQ7B 2A45B 5GWZA 1CGHA 5DG6A 1DY9A 2XC5A 1NRNH 3SGAE 4JZEH 1P04A 1P03A 4MNVA 5A0AE 1O3IA 1XUFA 1UK4A 1Z8JB 4U30A 3ATIA 3RU4D 2VJ1A 1PQ7A 1ABIH 1GDNA 2CMYA 3QTVH 7GCHG 2QAAA 1GBDA 1P10A 1LVOA 2B5TB 5T6FA 1P2KA 2R0LA 5A0BA 1LVYA 2OUAA 6GCHF 2P59A 1BRAA 1G32B 4NIYA 5AFZH 1BBRE 1ELCA 2OQUA 1SGTA 1O5BB 2ZDVH 1GHWH 1TOMH 2HALA 3U8TH 1MTSA 4Y8YA 2ZKSA 3QK1A 3SV9A 1EP5A 3H7OA 2WUBA 3K6ZA 1ZGVA 2ODPA 3VPKA 3PLKA 1GVZA 4MPXA 3Q77A 4X6OA 3SUEA 2BLVA 3UPEA 4GSOA 1C5ZB 3EYDA 1SQOA 1HAHH 1EAIA 5HXFA 3TGIE 1SI5H 2BVRH 1EJAA 1AFQB 3B9FH 1SOTA 1YCPM 2ZI2H 3L6PA 2FWWA 2WYJA 1K9OE 2JKHA 2P3TB 2DUCA 5CE1A 4D9QA 1FXYA 2FYQA 3V3MA 5GCHG 1P9SA 2SGFE 1NRRH 3PROA 1TABE 2PUXB 1K1JA 4FUDA 5A8YA 1GL1A 1UMAH 2FOBA 2EA3A 3KQEA 1KXFA 2PKSB 2VB0A 1BHXB 3QGJA 5EQQA 1RS0A 3SBKA 5AVDA 4DY7B 2TPIZ 1W8BH 3T5FH 2XBWA 2P95A 4JZ1A 3U1IB 4NZLA 1E35B 2BB4A 2QC2A 3SO3A 4KTUA 1OWDA 1SGIB 3A8CA 3A8AA 4ZMAH 3PMAB 1WTGH 1GCDA 3CS7A 1ESTA 5C5OA 1O31A 4BAKB 3M35A 4INHA 1KDQB 4CR9A 1GBCA 1FPCH 1L4DA 1Q31A 1XUHA 3H7TA 5J4QA 1TX7A 2F9VA 3MHWU 1SR5C 1TALA 3LJJA 2A4RA 1GHBG 2FP7B 4A92A 2G5NA 1VCQA 1FN6A 3UFAA 3KL6A 1QHRB 1TNHA 3OYPA 4CRGA 1P2OA 3FZDA 1YLCA 2Y81A 4X1SU 4YTAA 1G3BA 3GY2A 1DWEH 5DGJA 1O2QA 1T8MA 3BG4C 1BTYA 5DKMA 3TLOA 3BTME 5A2MH 1O5GH 4GVUA 5DPAA 4NWLA 5ETXA 1O36A 2A4GA 1GI1A 3IITA 4BAHB 4FUIA 5AFYH 2BLQA 1MZAA 2J95A 2VIWA 5CMXH 5C67A 2SGEE 1O0DH 1Y3VA 2P93A 1Y59T 4WJG2 2J34A 3VXEH 4B74A 4IMQA 4ISNA 4ZHMU 2EEKA 1Z8IB 4NFEA 1O2UA 1S85A 1GHVH 1BJVA 2Q6DA 1DXPA 5F8TA 5E2OA 1P11E 7LPRA 1ZZZA 1TX8A 1OWHA 3U8RH 4X1NU 1RJXB 1J15A 2ALVA 4UDWH 1UVTH 1AD8H 1EZQA 1P0SH 2TGDA 3M7TA 5E0HA 2F9BH 2HRVA 1VJAU 1UVPA 1V2LT 2ZQ1A 1O3HA 2RDLA 2A7CA 3F6UH 1CBWC 1W0YH 3MNXA 5EG4A 1O34A 3CP7A 4YESB 3VFEA 3JZ2B 2PW8H 4NZQA 3QN7A 2PSXA 2ESTE 1DX5M 2BD4A 4X8VH 5E8EH 4H42U 1HDTH 1O2TA 1GCTC 3SUFA 1C1RA 2AERH 5EPYA 1HAIH 4B73A 1ZLRA 1AKSB 1CE5A 2C8ZB 4DW2U 4U01A 1NFUA 3OX7U 1GBLA 1EJNA 1F2SE 1T8LA 1A0JA 4ISHH 1BCUH 1GBMA 1ELDE 3UY9A 1MMJN 5DP4A 2FI4E 3SI3H 3SNBA 2JH5D 3MH7A 2HGTH 1P02A 3P95A 1C5RA 1LQDB 1YPHE 2CHAB 1TGSZ 4Y7BA 4I32A 2WUCA 4INKA 3O8DA 3NPSA 1NRSH 2A4OA 1AE5A 3A7TA 1GBHA 5EW1H 1C1MA 1FONA 1ZMJA 1DM4B 3RXHA 2FTMA 3HK3B 3TK6A 1EPTB 1G37A 2THFB 1HAVB 1KLIH 1W7GH 5GIBA 3RXTA 4OS1A 1THSH 2OLGA 3ZZAA 5C3NA 5DP9A 2UWPA 2ZGBH 3KN2A 1P01A 1IQIA 1FAKH 1HPGA 4KTSA 1EAUA 1HJAB 1SLXB 2H2ZA 4A6LA 4WF8A 5FCKA 5EXNA 1P2QA 2QF0A 3GY8A 2GZ8A 1MCTA 1EASA 3FVFB 4I8HA 4KGAA 1Z8GA 2ZGHA 2ZFFH 2GD4B 5K7RA 3BTFE 2SGPE 1BTWA 1XXFA 5I25A 5FPTA 1CHOG 1KDQA 1O2IA 1ZSLA 1C2IA 2ALPA 3BSQA 3Q3XA 2Z3DA 4I31A 3K6YA 4GAWA 3RP2A 5C1UA 1GWAA 1SGFA 1YPKH 4YLQH 3SGQE 3UWJH 2ODQA 5EW2H 3W94A 4CRAA 4IS5A 3PB1E 1C1TA 1V2MT 2R0KA 2ZDLA 1O3CA 2ZU4A 4OS7A 4UFEH 1V2QT 3ZVBA 5CHAB 1C1WH 1SVPA 5L2YH 1SGDE 1L2EA 4AOQA 2KAIB 1GL0E 1FY4A 3A8DA 3ZVCA 3U1JB 1P3CA 2M5TA 4RSPA 5A8ZA 1Z8RA 3A83A 3A7XA 4VGCB 4K69A 1Z7KA 1C5QA 1BJUA 3PMHB 1EZUC 2BDAA 3OSYA 4RKJB 2J92A 3A82A 4KTCA 1MU6B 2PUQH 3RXLA 3LONA 2ZQ2A 2GGVB 1K22H 3SU2A 3LH3A 1HJ8A 2BX3A 7GCHF 3M61U 3PLBA 1C2EA 4IC5A 4Q7ZA 1LHCH 1C5PA 1A4WH 5FPYA 5A8XA 3GCHC 1YKTA 4DT7B 2P16A 2VGCC 4E7NA 1RTLA 2ZDAH 1EAWA 1TGNA 5FHTA 4YLUA 1PYTC 3RUOA 4X6MA 1N6YA 1SGFG 1KYNA 4FU8A 3T27A 1A0HB 2O8TA 3ATLA 2D26C 3LH1A 1JRSA 4AFZA 4ZKNU 4I8GA 1D3DB 3HPTB 2BLOA 3MMGA 1F7ZA 1HXFH 1TLDA 1EAXA 4YO9A 1H8IH 3P8FA 1PPZA 4B1TA 6LPRA 1JXPA 1ELGA 1HXEH 1Y3XA 3TJNA 2XBXA 1GBKA 3VB5A 1AKSA 3E0NB 5GCHF 2ZG0H 1ESBA 2BOHB 2OP9A 2AMDA 1LVMA 4H6TA 3ZZCA 1AWFH 5DK1A 1QRWA 4FU7A 3EGKH 2XNIA 3R0FA 2A5IA 1CA8B 1O2WA 1YC0A 2HWLB 4ABDA 2BD3A 4NSYA 3STIA 4JYVH 4D9RA 4JZIA 3PMBB 1C4Y2 3MH5A 4FVDA 1GJ7B 5LPEA 1LHFH 2H6MA 1D3PB 4BTUB 1GI0A 1Y3YA 1EPTA 1C5TA 1HAVA 1DFPA 1UVSH 1BTZA 3MO3A 1GBAA 2FOEA 5IYTA 1P2MA 1C9PA 1PPFE 4M7GA 2OC0A 1GGDC 2FX6A 1FV9A 3LT3A 1TRNA 2HPPH 1YPEH 1HAGE 4Y8ZA 2VH0A 2Z9GA 1GBEA 4LOYH 1QR3E 2A5KA 3SNCA 1NPMA 3WY8A 4AZ2B 3PWCA 1ID5H 5L6NH 1GHBF 1T4UH 4Y0YE 1SPJA 2XCNA 2J94A 2WPLS 1UTNA 3RLWH 1V2WT 1O2YA 1WUNH 3A7ZA 1DXWA 3Q76A 3RU4E 1BMAA 1ETTH 1AI8H 2A32A 1G36A 2V35A 1NY22 2VIPA 1S6HA 2GTBA 2OTVA 3BTEE 4K1EA 3RC6A 1OSSA 1L1JA 1QBOA 1YCPH 3NKKA 5GXPA 3ITIA 5JBBS 1O2PA 1ZGIA 2P3FH 1C5MD 1XUIA 2VWNA 1WQVH 1O3EA 2LNCA 1DOJA 3NCLA 1Z71A 1G3DA 3RXQA 1FN8A 2O8LA 2BY8X 2OXSA 2BMGB 2P94A 1OWJA 1ETRH 3VB4A 3ZZ8A 1E38B 2O8WA 3GY7A 1H8DH 4FUHA 4I8KA 1BZXE 4NA8A 1ANDA 1FY8E 1PPBH 3SU3A 3LC5A 1QB6A 4Z6AH 2KAIA 1WBGB 3RXUA 1W10U 3ESTA 1RFNA 1C1VH 1HAPH 1GMDF 2AEIH 1G9IE 2BOKA 3P8NA 4X8SH 5EXLA 3MU1A 2C8YB 1S82A 3QWCH 3MTYA 2ZU5A 4KELA 2CV3A 2HNTF 2BDGA 3FAOA 4MVNA 3GICB 3SNDA 4E7RG 1C5VA 1O32A 2YNAA 4ZUHA 3PV4A 3LIWA 1GMCG 2BQWB 2H9HA 3MU8A 2VWLA 4CRBA 3P17H 1WQSA 2ZPQA 2W3KA 3S9CA 3TGJE 2ZWLH 5L30H 3BV9B 3GYMA 1BB0B 4UFGH 3MNSA 4K5ZA 1UK3A 1SGPE 2O9QA 2C93B 4R0IA 1JBUH 5EGMA 1TONA 1TGBA 4X2YA 4YOGA 1YBWA 4WMDA 4CH8B 4E06H 1GDQA 1TRYA 1DITH 2ZDMA 4NSVA 2FLRH 4JK5A 3BG8A 2XC4A 1GJAB 1CA0C 1ZHPA 2PKAB 1KSNA 1QL7A 1QTFA 4BAQB 3RC5A 5T6DA 2OC8A 4IMZA 3Q3YA 5DP8A 1P57B 1A7SA 1O35A 2OC7A 2Y5GA 1A5GH 1PYTD 1MKWK 2QA9E 2BY9X 4NA9H 3F9EA 2QY0B 1XX9A 1TGCA 1QRZA 1D6WA 1HIAA 2B0FA 2IJOB 1RTKA 1C5UA 4MPUA 3LGWA 1J8AA 1EQ9A 1DUEA 3STJA 1UCYK 5GJ4B 1ELTA 1FY5A 1H9IE 1FPHH 1MKWH 3E1XB 2BXTH 1JIRA 4A5TS 4U32A 3RC4A 1BIOA 2TGTA 3A89A 1NU9A 1Y8TA 2HOBA 4A1VA 2P8OC 1F0UA 1TNIA 3MU0A 1C2GA 1C2DA 5I46H 2FTLE 3MU5A 4MG3A 2UUYA 1W14U 4GCHG 3UOPA 4YT7H 4TY7A 4IGDA 1CHOF 1FMGA 1TPOA 3EDXB 2BD9A 5E2PA 3KEEA 2FOHA 1CVWH 3UIRA 2PTNA 4Y6DA 1AMHA 1ETSH 2DE9A 2QXIA 3F9FA 3OU0A 4E05H 2OBOA 1ZTLA 1BT7A 2G55A 3M5OA 4ISLA 4PROA 1IQJA 1MCVA 1NFYA 5EQRA 2UWLA 1QBNA 1DANH 1SOZA 1WV7H 2W7UA 2QF3A 1QRXA 2FZZA 4ZHAA 3A7VA 4Q7XA 1O2ZA 3M7QA 1SHYA 1V2OT 1WSSH 1RD3B 3TJOA 1ZTKA 2BX4A 3OY6U 1ELAA 1ZPBA 2VIVA 3BEUA 3A80A 2RCEA 1EP6A 3RXAA 4ABJA 1BTHH 1YM0A 1O2MA 3VGCB 1LCYA 1HAXB 1MD7A 4FUFA 1ZMNA 3GISB 4XE4A 4Y76A 2GKVE 2GMTB 1L1GA 1K1PA 1XM1A 5TCAA 1ANBA 1GJDB 1ORFA 3A7YA 2ZFTA 4CHAC 1TGTA 1P09A 4XBCA 2RG3A 1IAUA 4JZFH 3ZVEA 1NN6A 2LPRA 3RU4T 3ATWA 4MNYA 6CHAC 4OGYA 2FODA 3SUGA 2V6NA 1U6QA 1ZOMA 4NGAH 4WXVA 1T31A 4OS2A 2AIPA 3Q00A 1PPHE 1T32A 4I7YH 1BMMH 1EOLA 1RTFB 2TGAA 4FXGH 1G30B 2Y5FA 1SGEE 5AHGH 2FXRA 3R3GB 4DURA 2V0BA 1J9CH 1BMLA 1TNJA 4WWYA 3LPRA 3P92A 3LJOA 3LC3A 1VCWA 4INLA 1Z6EA 5FCRA 2Y82A 4O9VA 1OP8A 5FXLA 3ZV8A 2YOLA 1O33A 2ZZUH 1S83A 2BLWA 1TWXB 2WPJS 3QLPH 2ANMH 2R3UA 2F9NA 5C5NA 3BTWE 2FYRA 1KXAA 1PQAA 1HYLA 1A0LA 3F1SB 3NXPA 3U69H 1P12E 1VGCC 2F91A 3BTDE 1GMDG 4LK4A 3MH4A 2PKAA 4NCYA 2W26A 3GCOA 1O3PB 1K1OA 1P9UA 2VVVA 1VITG 3SV2H 4B71A 1S5SA 1GJ4H 3PO1B 1PQ8A 3EE0B 4IN2A 3PYHA 3SU6A 1B5GH 1QURH 2AYWA 1LKAA 3SU5A 2HVXA 2A31A 4HFPB 1O2NA 1HBTH 2ZFQH 1AY6H 3SU4A 1TBZH 2NWNA 1ZMLA 2TIOA 3KQCA 1TPPA 3GY6A 1AHTH 3SJ9A 5F8ZA 5HGGA 2AGEX 1AVWA 3G01A 1O2HA 3ZZ3A 1THRH 3GCNA 3QUMP 1M9UA 2FOAA 3GCTG 1GVKB 1N8OB 2VNTA 2ZNKH 2YNBA 5DP6A 2FDAA 2BXUH 3JZ1B 2STAE 1DT2A 2WPHS 2HNTC 1GG6C 1GBTA 4X1PU 1A3BH 2G81E 3MNBA 1AGJA 4MTBA 4UONA 2ZHWH 5FPSA 4O3TA 1ESAA 1RIWB 7KMEH 3U8OH 4DG4A 2GCHG 1B7XB 1DVAH 1TE0A 1ZSKA 4X6NA 2I6SA 4BOHA 4AYYB 2PGBB 3M3VA 1UTJA 2VWMA 1SLWB 2FI5E 1SL3A 1O30A 2V3OH 1GJCB 2BD7A 1HV7A 3FP8E 2Y6TA 3SGBE 3KHVA 5FBEA 3A84A 1EOJA 3CS0A 4Y10E 5TCCA 1K28D 3AAVA 2ZCLP 4BXSA 1F5RA 5F6MA 2SGAA 2ZDKA 3MNCA 4IN1A 1K1IA 2BY7X 1XVOA 1GI8B 2FOCA 2Z9KA 1PFXC 1Y5UT 3QO6A 4B2BA 1C5OH 3MU4A 1GVLA 2CN0H 3T25A 2WV4A 1D3TB 3S69A 3UREA 1GMCF 3GDUA 1K1LA 1TNKA 1TMTH 1F5KU 1MBMA 4NFFA 4A7IB 2CF8H 3SNEA 1BUIA 1MTUA 3BTHE 1SHHB 3RMOH 4DVAU 1UTLM 3RMNH 3D65E 3M36A 1MUEB 2R3YA 4DGJA 4K8BA 4ABGA 1HNEE 2A1DB 3T62A 1ZRBA 3EA9A 1SB1H 4SGBE 1O3DA 8LPRA 3TH2H 3ODDA 3I29A 1GI3A 1NROH 3Q3KA 1MBQA 4NIVA 3VB6A 3EAJA 4CBNA 4DOQA 1ZJKA 1AVGH 1LHEH 3ZVDA 1PPEE 1O2KA 1UHBB 2VIDA 1EB2A 2HPQH 1KXEA 1NRPH 2F3CE 3LOXA 2VVCA 1OYQA 1CGIE 2ZECA 4Y79A 1QJ1B 3AASA 3GY3A 5JBAS 2XWBI 5ESTE 1O3LA 1MTNC 1THPB 3BEFB 4AN7A 4CRDA 3TH4H 1S6FA 1HAYB 1XKBC 2XW9A 2UUJB 2ZHDA 3A81A 3D49H 1FNIA 3SW2B 1MQ5A 1TNGA 1O3BA 1ELVA 2Z9IA 4D7FA 1CO7E 5LGOA 1GJ8B 2PGQB 2FOGA 1KY9A 3S0NA 3QX5H 1EZSC 1V2NT 1Z1IA 2ZHFH 5A0CA 2PKSC 3TITA 1BRBE 1T8OA 1O5AB 2XTTB 2ZU2A 1MU8B 4GCHF 4ABHA 4IW4E 2R2WU 2ZO3H 1ELBA 1DY8A 2FO9A 1A3EH 4MNWA 1DPOA 2AS9A 1E34B 4HTCH 1UO6A 1DWCH 1UK2A 3K65B 3SU1A 4K3JA 2A2QH 1ZHMA 3RXBA 1ELFA 1TBQH 1FDPA 5DO4H 1KLTA 1S81A 1O38A 4DIIH 1W2KH 2PLXA 1NFWA 2FS9A 1W13U 1AU8A 1OXGA 4YZUA 4A1TA 2JETC 1S0RA 3GY4A 2Y5HA 1GJ5H 2A7JA 4AORA 1DUAA 4AX9H 3SV7A 1O5CB 3ODFA 4XOJA 1YYY1 1EATA 3AVZA 4B75A 1F5LA 3RXDA 3T29A 6CHAB 2GDDA 2J2UA 1CT2E 1F0TA 2BY5X 1V2KT 4LXBH 3RXRA 3ZV9A 4X1RU 2XYAA 3ZVAA 2GV6A 4HI3A 1S0QA 1BOQA 4GHQA 4DJZB 1OWEA 1K1NA 1DICA 3BG4B 3RXOA 3UOUA 1XVMA 2VIOA 3A86A 1S84A 2RA3A 1Y3WA 3QDZB 2J4IA 1TIOA 2QN5T 4TWWA 3UNQA 4Y11E 2D1JA 1LKBA 5BRRE 1CHGA 1FIWA 1MD8A 1DWBH 3O8RA 1XKAC 3SHCH 1WYKA 2GP9B 3IWMA 2XXLA 2AH4X 4OS6A 1VR1H 2XBYA 1DSUA 3VB7A 4B2CA 3RLYH 2PHBA 3SJIA 2FPZA 5HM9A 2JH6D 4JYUH 4B2AA 4O03A 3QGNB 1ZPZA 5BPEA 4BNRA 2BDCA 3M3SA 2W7SA 1SGRE 5DP5A 3ZZ4A 3K9XB 1C2LA 2BD8A 2P3UB 1A5HA 3TPIZ 2G4TA 2BDHA 2FEQH 1XMNB 1Z6JH 1SG8B 1FUJA 2ZF0H 1HUTH 2XWAA 1PJPA 1E36B 1CBWB 2OD3B 2WV5A 1L4ZA 1MKXK 2BDBA 1BA8B 4DIHH 2STBE 3E6PH 4K2YA 1SGYE 1V2VT 2WYGA 3M5LA 4JZDH 1C2FA 3P8GA 1GPZA 2H9TH 2WPKS 1INCA 4CR5A 1QJ6B 1GCTB 1VZQH 3BEIB 1UHBA 4D8NA 4BXWA 2Z3EA 3HKIB 3RMMH 2B7DH 3RXJA 8GCHG 1A1RA 2BZ6H 2ZCKP 2B9LA 1O2VA 2D2DA 2ZC9H 3DT0H 3BTTE 2ZGXH 1VITF 4NIXA 1P2IA 3TJVA 1EUFA 1T4VH 2XBVA 1WCZA 5LH8A 2CHAC 3T26A 3S7KB 1MTWA 1ZR0A 2F9PA 1ZRKA 1FY1A 2PWXA 3D62A 2AGIX 3O8CA 1H9HE 1O5DH 3SU0A 4J1YA 2IOTA 1IQFA 1EPTC 3ZYEA 1TA2A 1MZDA 2SGQE 1VCPA 4X2XA 5ESBA 1LHGH 9ESTA 1IOEA 1O5FH 1GMHG 2Q1JA 2Z6BD 4WH6A 2K1QA 2BM2A 1NM6A 2VWOA 3NK8A 3E3TA 3PMJA 1V2PT 3E8LA 5JBTA 1N6XA 4MNXA 1C5YB 4NA7A 2ZU3A 2G51A 3V12A 5JB8S 2ASUB 2JH0D 3GCTF 2OBQA 1ZSJA 4BAMB 3PTNA 4FUEA 1K21H 2BVXH 3FZZA 2FMJA 3UQVA 4FU9A 1W3CA 2C8WB 3UTUH 4YOJA 2TGPZ 1WTHD 3P70B 5E0JA 1WU1A 2Z94A 3URDA 1A61H 2FIRH 1EX3A 2TRMA 2GCHF 3TK9A 3PLPA 3ZVGA 5FBIA 3TJUA 4CRCA 2GZ9A 1EJMA 3ZZDA 5JYIA 1G3EA 1KTTB 2GCTC 2ZHQH 4ABAA 1UCYE 1O3FA 3A7WA 1LPZB 4XDEA 2Y7XA 1MAYA 1NS3A 3QZRA 3UR9A 4RKOB 3D23A 3BF6H 1TNLA 3UQOA 2ZA5A 3RDZA 1ARCA 1C1NA 1GBBA 1YPMH 3E0PB 5SGAE 4F4OC 5C20A 4ISOA 4YOIA 5CHAC 3MO6A 1Y5AT 1UCYH 4I8JA 1O3JA 2ZFRH 1C2KA 4IC6A 1AVXA 1MTVA 2O8MA 2NU3E 1C2HA 4X8TH 1O5EH 2ZTZA 2WINI 9LPRA 1D9IA 2ZGJA 3HGNA 4SGAE 4VGCC 1LMWB 1BBRK 1GI7B 4TPYA 1QFKH 3RMLH 2CJIA 2G8TA 1JMOH 2ZGCA 2BTCE 3ATMA 5EPNA 5FX6A 1MTNB 3BTQE 1GBIA 4CRFA 4FVBA 4KP0A 2FM2A 5EOKA 1V2ST 3A85A 4X0WU 2OINA 1OWIA 3RXEA 1AQ7A 1BTPA 1VJ9U 1BBRH 2ZCHP 1J16A 2GX4A 5A09A 6ESTA 2ZFPH 1V3XA 3GCHB 2VU8E 1BHXF 2VGCB 2G4UA 1OP2A 1AB9C 1W11U 1MQ6A 1TAWA 3I77A 4FUJA 1KXBA 3LDXH 4ABBA 1C4U2 1AE8H 1GHAG 4K8YA 1LHDH 2A5AA 2SNVA 2H1UA 3MYWA 1YF4A 4YT6H 1ZPCA 4I33A 1CT4E 4ZHLU 4ZKSU 5IDKA 3SJOA 4IBLH 1F0RA 3DUXH 4ABFA 1O3KA 1W7XH 4ZKOU 4XSKU 2GT7A 4MPWA 4MPVA 3ZZ9A 4D76A 1QNJA 1QL8A 1C5WB 1EZXC 5EODA 1B0EA 1TOCB 2CGAA 4XFQA 1UTQA 1P8VC 2BDYA 1TRMA 3EQ0H 2FOMB 2NU0E 1TFXA 2JETB 1LTOA 2FX4A 2QXHA 4F49A 4O3UA 1O3AA 1OS8A 1HAOH 3K2UA 3MWIU 5T3HA 1HGTH 1TYNA 3HGPA 4MQAA 3SUDA 2DE8A 3M5NA 3SNAA 2ULLA 2UUFB 3LGTA 1SGCA 1E37B 4THNH 4CH2B 1TA6A 1LQEA 2BHGA 3MOCA 4HGCA 2I6QA 5DP3A 3GY5A 2Z3CA 2ZHEH 1K2I1 3QTOH 3SJ8A 5FAHA 2EI7A 3TK5A 1O3OA 1GGDB 5HYOA 3LGUA 4UEHH 1IQMA 3HATH 1YPHC 1SLVB 2EI8A 4AB9A 4R8TB 1V2JT 2Q6FA 8KME2 3RXSA 4K1SA 2ZTXA 1G2LA 3PWBA 2ZP0H 3M37A 2BD5A 2AFQB 3MO9A 1O3NA 1X7AC 2BY6X 1Y5BT 4JYTA 1BQYA 1XUJA 2PTCE 1UTPA 2SGDE 4FUGA 5LPFA 1RGQA 5DP7A 1BRUP 2ZFSA 3TVJB 2EI6A 3RXFA 4ABIA 1P05A 2AMPA 1D6RA 3HKJB 3U9AH 1OP0A 3BTKE 1PPCE 3C27B 1QY6A 2VH6A 3OTJE 4TY6A 4ESTE 4AGKA 1TB6H 2H5DA 3P8OA 1G3CA 2F83A 4X1QU 3E91A 4CBOA 1TX6A 4A1XA 4GLYA 1RXPA 1YP9A 4HZHA 2ZU1A 1O2XA 1KTSB 4H4FA 3LU9B 5FX5A 1NESE 3SN8A 4AGJA 1ARBA 2QV1A 1JIMA 1LDTT 5DJ7A 3SZNA 3TIUA 5JBCS 3UR6A 3F9GA 2BYAX 2PSYA 1NC6A 3SQEE 5JDUB 2OQ5A 1V2RT 1NRQH 1CQQA 4OS5A 1SFQB 1KXDA 3FFGA 1C1SA 1XUGA 4XBBA 3FP6E 2GZ7A 4WMEA 1QBVH 3F68H 3UUZA 4UFFH 1DSTA 3LKWA 1UJ1A 2ZDNA 8ESTE 1UTKA 1C1OA 1SFIA 1AUTC 1O39A 5JB9S 2GVFA 1AWHB 1O2SA 3LGYA 1IQNA 1J14A 2H5CA 3AAUA 4ZAEA 3MFJA 3M7UA 1O2GH 2VINA 4LZ4B 2HLCA 1YPJH 4JK6A 3KGPA 3FANA 1P2JA 3A88A 5ABWA 4BTTB 1AN1E 2Z9LA 3RM0H 3SJKA 1Z1JA 3SV8A 2FLBH 3ELAH 5G4BA 1IHSH 1C2MA 5HMAA 1GI2A 3FP7E 1HAZB 1AUJA 5TJXA 1ANEA 4WH8A 3L33A 3DA9B 8GCHF 3PTBA 1OOKB 1FI8A 3KQDA 1FIZA 1XXDA 3H5CB 2ZEBA 1FQ3A 3ZVFA 2IPHA 7ESTE 2SNWA 1W0ZU 3TNSA 3V13A 2BVSH 4WMFA 3ENSB 5AF9H 5EXMA 3EA8A 2OC1A 2ZTYA 1SSXA 1UVOA 1BTXA 3V7TA 3UWIA 1FAXA 1FJSA 6GCHG 4OS4A 1BITA 1IQKA 2QGRA 4FUBA 1CA0B 1FY3A 1LPGB 1C5NH 3VEQB 2WPIS 2BQ7B 4RN6A 1GMHF 3DFLA 1Q2WA 5EU8A 2AIQA 1C1QA 1GI9B 3BTGE 3MH6A 4NIWA 3PM3A 1T7CA 1N1LA 2GCTB 4YM9A 1ABJH 4BANB 3GDSA 1GDUA 4CREA 1OPHB 3M3TA 3IG6B 2HNTE 4U2WA 3S9AA 1UTMA 1QB1A 1NU7B 1AFEH 1C4V2 1QQUA 3HK6B 2D8WA 3F9HA 1GI5A 3T28A 1DWDH 2F9UA 3DFJA 2C3SA 3RXCA 2P8OB 3E16B 3TU7H 3SQHE 4BAOB 1BRCE 1DLKB 2W5EA 3BIVH 2CF9H 2BQ6B 3MI4A 1A2CH 5T6GA 2Z9JA 4GPGA 4NWKA 5F03A 1VITH 2GDEH 1O37A 1YGCH 1AFQC 3S9BA 1TMUH 2UWOA 1NT1A 2SFAA 1H9LB 2G00A 1TQ0B 2A0QB 3SI4H 1XUKA 1QCPA 5HM2A 3VB3A 3ZZ5A 5H4IB 4Z0KA 2ANWA 1V6DA 1A46H 4TYDA 1OKXA 3U98H 2QCYA 1LO6A 3GDVA 3RM2H 1JOUB 1LVBA 1W12U 4ZXYH 2FS8A 4FUCA 3T2NA 1F92A 1KLJH 4GHTA 1J17T 1WAYB 1ACBE 5E0GA 3TH3H 3P6ZB 1PPGE 3ATKA 1D4PB 4B76A 3RXMA 3SHAH 1ZJDA 3SV6A 1MH0A 1GJ6A 4O97A 5EQSA 1B0FA 2ANYA 3GOVB 2AMQA 3N7OA 1QB9A 1L1NA 3ZZ6A 1AB9B 4Q2KA 3VGCC 3TNTA 2A4QA 3L3TA 1T8NA 2RA0A 2R2MB 1JRTA 4K60A 4NG9H 3UNSA 1QIXB 1EB1H 1P2NA 5C2ZA 2GMTC 1DS2E 1YLDA 1QQ4A 3TGKE 5C1YA 4AG1A 1CGJE 4Y0ZE 4MDSA 4CHAB 2V3HH 4BTIB 3QZQA 4UE7H 4AB8A 1QA0A 3RXVA 1AZZA 4KKDA 3SOSA 4ASHA 3ZZ7A 3SORA 1GJBB 1BTUA 4WXIA 4OGXA 1NO9H 3BN9A 1GI6A 2H9EH 4Q80A 3VXFH 4I8LA 2XRCA 1GHAF 1ZHRA 1C5LH 1YPLH 1JWTA 4WVPE 2QXJA 3ZZBA 4D7GA 1HIAB 3RXPA 3B23B 1WOFA 4UD9H 1YPGH 2AGGX 1EKBB 1CU1A 2A7HA 4JCNA 1SQTA 1O2JA 2ODYB 1QGFA 1ELEE 3KNXA 1O2OA 1OYTH 1G2MA 4AYVB 1HCGA 1NTPA 3A87A 2EC9H 3OY5U 1O3MA 2NU2E 1C1UH 1DLEA 1ANCA 1SC8U 1TBRH 3ZYDA 2VVUA 1C5SA 1OWKA 3GYLB 2GV7A 4AFSA 2J38A 5PTPA 4ISIH 1AZ8A 3BIUH 3KF2A 1HFDA 4XBDA 1NFXA 1GHXH 1CT0E 2C90B 1VGCB 3URCA 3CENA 1QA7A 1DDJA 2ZPRA 3LGVA 1UTOA 1YCPK 2B8OH 1IQLA 2FI3E 3W95A 2ILNA 2Z7FE 5J4SA 1SGQE 3EA7A 2W3IA 1O2RA 1O3GA 1Q3XA 1SBWA 3C1KA 1GJ9B 1P3EA 3PO1C 3KIDU 3KCGH 4K1TA 2XC0A 2Y7ZA 3RXKA 5C1XA
chains in the Genus database with same CATH superfamily
5LPRA 2QIQA 3AW0A 1SGNE 1UVUH 1GHZA 1FLEE 2Q6GA 5B6OA 5JPMH 4ZKRU 2UUKB 1SQAA 1NZQH 4B6EA 3NZIA 2C4FH 2IN2A 4X2VA 2CXVA 3B8JA 4ABEA 4X2WA 4ZROA 1KIGH 1H4WA 1LPKB 2ZPSA 1HLTH 1AO5A 2F9OA 2QYIA 3UNRA 1HRTH 4Y7AA 3LGIA 2TBSA 1A5IA 1V2UT 1MKXH 2G5VA 3O8BA 1FX0B 2G52A 4Y71A 4MLFB 1IQHA 4AFUA 4TPIZ 2R9PA 4ZH8A 4DCDA 3RXIA 4ZXXH 2BZAA 4AG2A 1GI4A 1N8OC 1QL9A 3A8BA 5F8XA 1IHTH 1C5XB 2NU1E 4H6SB 2FESH 5GDSH 2VIQA 1HB0B 1AIXH 3N7DA 1O2LA 3S7HB 4X6PA 1BDAA 2NU4E 2PV9B 4Y8XA 1GG6B 4Q7YA 1C9TA 1ZYOA 1P06A 3KQBA 4QT8C 1RIWC 2GT8A 2PFEA 4J2YB 4AFQA 1OX1A 5L2ZH 2F4LA 3KYFA 4TWYA 2Y80A 3I78A 4UFDH 2PR3A 1DE7H 1F0SA 3RXGA 1RRKA 1MAXA 1C2JA 1Y3UA 4GUXA 2BDIA 1K1MA 5GPIB 1GBJA 2O8UA 1KXCA 4X8UH 1E0FD 1HJAC 1ZTJA 3NUMA 3DHKH 1H1BA 2J9NA 1HJ9A 3V0XA 2KCAA 1GHYH 4JMYA 1CSOE 4WY3A 1V2TT 1GBFA 2A2XH 1C1PA 1EXFA 3E90B 1IQGA 1TMBH 4LZ1H 1TPSA 1BMNH 1D3QB 5K0HA 1SMFE 2XCFA 1SLUB 2BD2A 3M5MA 2FOFA 3NWUA 2ANKH 1TPAE 2ZIQH 3DD2H 2QXGA 2L6OA 1QJ7B 1FZZA 2C8XB 3AW1A 1IQEA 2WPMS 2OCVB 1L0ZA 1PQ5A 1TQ7B 2A45B 5GWZA 1CGHA 5DG6A 1DY9A 2XC5A 1NRNH 3SGAE 4JZEH 1P04A 1P03A 4MNVA 5A0AE 1O3IA 1XUFA 1UK4A 1Z8JB 4U30A 3ATIA 3RU4D 3F0PA 2VJ1A 1PQ7A 1ABIH 1GDNA 2CMYA 3QTVH 7GCHG 2QAAA 1GBDA 1P10A 1LVOA 2B5TB 5T6FA 1P2KA 2R0LA 5A0BA 1LVYA 2OUAA 6GCHF 2P59A 1BRAA 1G32B 4NIYA 5AFZH 1BBRE 1ELCA 2OQUA 1SGTA 1O5BB 2ZDVH 1GHWH 1TOMH 2HALA 3U8TH 1MTSA 4P00A 4TT3D 4Y8YA 2ZKSA 3QK1A 3SV9A 1EP5A 3H7OA 2WUBA 3K6ZA 1ZGVA 2ODPA 3VPKA 3PLKA 1GVZA 4MPXA 3Q77A 4X6OA 3SUEA 2BLVA 3UPEA 4GSOA 1C5ZB 3EYDA 1SQOA 1HAHH 1EAIA 5HXFA 3TGIE 1SI5H 2BVRH 1EJAA 1AFQB 3B9FH 1SOTA 1YCPM 2ZI2H 3L6PA 2FWWA 2WYJA 1K9OE 2JKHA 2P3TB 2DUCA 5CE1A 4D9QA 1FXYA 2FYQA 3V3MA 5GCHG 1P9SA 2SGFE 2J97A 1NRRH 3PROA 1TABE 2PUXB 1K1JA 4FUDA 5A8YA 1GL1A 1UMAH 2FOBA 2EA3A 3KQEA 1KXFA 2PKSB 2VB0A 1BHXB 3QGJA 5EQQA 1RS0A 3SBKA 5AVDA 4DY7B 2TPIZ 1W8BH 3T5FH 2XBWA 2P95A 4JZ1A 3U1IB 4NZLA 1E35B 2BB4A 2QC2A 3SO3A 4KTUA 1OWDA 1SGIB 3A8CA 3A8AA 4ZMAH 3PMAB 1WTGH 1GCDA 3CS7A 1ESTA 5C5OA 1O31A 2QF4A 4TSFD 4BAKB 3M35A 4INHA 1KDQB 4CR9A 1GBCA 4ACBA 1FPCH 1L4DA 1Q31A 1XUHA 3H7TA 5J4QA 1TX7A 2F9VA 3MHWU 1SR5C 1TALA 2J98B 3LJJA 2A4RA 1NBME 1GHBG 2FP7B 4A92A 2G5NA 1VCQA 1FN6A 2PP6A 3UFAA 3KL6A 1QHRB 1TNHA 2JIZD 3OYPA 4CRGA 1P2OA 3FZDA 1YLCA 2Y81A 4X1SU 4YTAA 1G3BA 5KGOA 3GY2A 1DWEH 3F0OA 5DGJA 1O2QA 1T8MA 3BG4C 1BTYA 5DKMA 3TLOA 3BTME 5A2MH 1O5GH 4GVUA 2YMSB 5DPAA 4NWLA 4YXWD 5ETXA 1O36A 2A4GA 1GI1A 3IITA 4BAHB 4FUIA 5AFYH 2BLQA 1MZAA 2J95A 2VIWA 5CMXH 5C67A 2SGEE 1O0DH 1Y3VA 3WWBA 2P93A 1Y59T 4WJG2 2J34A 3VXEH 4B74A 4IMQA 4ISNA 4ZHMU 2EEKA 1Z8IB 4NFEA 1O2UA 1S85A 1GHVH 1BJVA 2Q6DA 1DXPA 5F8TA 5E2OA 1P11E 7LPRA 1ZZZA 1TX8A 3FO8D 1OWHA 3U8RH 4X1NU 1RJXB 1J15A 2ALVA 4UDWH 1UVTH 1AD8H 1EZQA 1P0SH 2TGDA 3M7TA 5E0HA 2F9BH 2HRVA 1VJAU 1UVPA 1V2LT 2ZQ1A 1O3HA 2RDLA 5HIYA 2A7CA 3F6UH 1CBWC 3DSGA 1W0YH 3MNXA 5EG4A 1O34A 3CP7A 4YESB 3VFEA 3JZ2B 2F43B 2PW8H 4NZQA 3QN7A 2PSXA 2ESTE 1DX5M 2BD4A 4X8VH 5E8EH 4H42U 1HDTH 5HIZA 1O2TA 1GCTC 3SUFA 1C1RA 2AERH 5EPYA 1HAIH 4B73A 5DSFA 1ZLRA 1AKSB 1CE5A 2C8ZB 4DW2U 4U01A 1NFUA 3OX7U 1GBLA 1EJNA 1F2SE 1T8LA 1A0JA 4ISHH 1BCUH 1GBMA 1ELDE 3UY9A 1MMJN 5DP4A 2FI4E 3SI3H 3SNBA 2JH5D 3MH7A 2HGTH 1P02A 3P95A 1C5RA 1LQDB 1YPHE 2CHAB 1TGSZ 4Y7BA 4I32A 2WUCA 4INKA 3O8DA 3NPSA 1NRSH 2A4OA 1AE5A 3A7TA 1GBHA 5EW1H 1C1MA 1FONA 1ZMJA 5KEDA 1DM4B 3RXHA 2FTMA 3HK3B 3TK6A 1EPTB 1G37A 2THFB 1HAVB 1KLIH 1W7GH 5GIBA 3WWFA 3RXTA 4Z1MD 3FN8A 4OS1A 1THSH 1YWUA 2OLGA 3ZZAA 5C3NA 5DP9A 2UWPA 2ZGBH 3KN2A 1P01A 3GS9A 1IQIA 1FAKH 1MABB 1HPGA 4KTSA 1EAUA 1HJAB 1SLXB 2H2ZA 2JDID 5F53A 4A6LA 1YLNA 4WF8A 5FCKA 5EXNA 1P2QA 2QF0A 3GY8A 2GZ8A 1MCTA 1EASA 3FVFB 4I8HA 4KGAA 1Z8GA 2ZGHA 2ZFFH 2GD4B 5K7RA 3BTFE 2EQNA 2SGPE 1BTWA 1XXFA 5I25A 5FPTA 1CHOG 1KDQA 1O2IA 1ZSLA 1C2IA 2ALPA 2KCYA 3BSQA 3Q3XA 2Z3DA 4I31A 3K6YA 4GAWA 3RP2A 5C1UA 1GWAA 1SGFA 1YPKH 4YLQH 3SGQE 3UWJH 2ODQA 5EW2H 3W94A 4CRAA 4IS5A 3PB1E 1C1TA 1V2MT 2R0KA 2RDEA 2ZDLA 1O3CA 2ZU4A 4OS7A 4UFEH 1V2QT 3ZVBA 5CHAB 1C1WH 1SVPA 5L2YH 1SGDE 1L2EA 4AOQA 2KAIB 1GL0E 1FY4A 3A8DA 3ZVCA 3U1JB 1P3CA 2M5TA 4RSPA 5A8ZA 1Z8RA 3A83A 3A7XA 4VGCB 4K69A 1Z7KA 2KM0A 1C5QA 1BJUA 3PMHB 1EZUC 2BDAA 3OSYA 4RKJB 2J92A 3A82A 4KTCA 1MU6B 2PUQH 3RXLA 3LONA 2ZQ2A 2GGVB 1K22H 3SU2A 3LH3A 1HJ8A 2WHXA 2BX3A 7GCHF 3M61U 3PLBA 1C2EA 4IC5A 4Q7ZA 1LHCH 1C5PA 1A4WH 5FPYA 5A8XA 3GCHC 1YKTA 3PRBA 2P16A 4DT7B 2VGCC 4E7NA 1RTLA 2ZDAH 1EAWA 1TGNA 5FHTA 4YLUA 1PYTC 3RUOA 4X6MA 1N6YA 1SGFG 1KYNA 4FU8A 2M2AA 1KMHB 3T27A 1A0HB 2O8TA 3ATLA 2D26C 3LH1A 1JRSA 5IK2D 4AFZA 4ZKNU 4I8GA 1D3DB 1E1RD 3HPTB 5GNDA 4F48B 2BLOA 3MMGA 1F7ZA 2K0QA 1HXFH 1TLDA 1EAXA 4YO9A 1H8IH 3P8FA 1PPZA 4B1TA 6LPRA 1JXPA 1ELGA 1HXEH 1Y3XA 3TJNA 2XBXA 1GBKA 3VB5A 1AKSA 3E0NB 5GCHF 2ZG0H 1ESBA 2BOHB 2OP9A 2AMDA 1LVMA 4H6TA 3ZZCA 1AWFH 5DK1A 1QRWA 4FU7A 3EGKH 2XNIA 3R0FA 2A5IA 1CA8B 1O2WA 1YC0A 2HWLB 4ABDA 2BD3A 4NSYA 3STIA 2CK3D 4JYVH 4D9RA 4JZIA 3PMBB 1C4Y2 3MH5A 4FVDA 1GJ7B 5LPEA 1LHFH 2H6MA 1D3PB 1QZ8A 4BTUB 1GI0A 1Y3YA 1EPTA 1C5TA 1HAVA 1DFPA 1UVSH 1BTZA 3MO3A 1GBAA 2FOEA 5IYTA 1P2MA 1C9PA 1PPFE 4M7GA 2OC0A 1GGDC 2FX6A 1FV9A 3LT3A 1TRNA 2HPPH 1YPEH 1HAGE 4Y8ZA 2VH0A 2Z9GA 1GBEA 4LOYH 1QR3E 2A5KA 3SNCA 1NPMA 3WY8A 4AZ2B 3PWCA 1ID5H 5L6NH 1GHBF 1T4UH 4Y0YE 1SPJA 2XCNA 2J94A 2WPLS 1UTNA 3RLWH 1V2WT 1O2YA 1WUNH 3A7ZA 1DXWA 3Q76A 3RU4E 1BMAA 1ETTH 1AI8H 2A32A 1G36A 2V35A 1NY22 2VIPA 1S6HA 2GTBA 2OTVA 3BTEE 4K1EA 5EIYA 3RC6A 1OSSA 1L1JA 1QBOA 1YCPH 3NKKA 4ZCNA 5GXPA 3ITIA 5JBBS 1O2PA 1ZGIA 2P3FH 2QE7D 1C5MD 1XUIA 2VWNA 1WQVH 1O3EA 2LNCA 2WSSD 1DOJA 3NCLA 1Z71A 1G3DA 3RXQA 1FN8A 2O8LA 2BY8X 2OXSA 2BMGB 2P94A 1OWJA 1ETRH 3VB4A 3ZZ8A 1E38B 2O8WA 3GY7A 1H8DH 4FUHA 4I8KA 1BZXE 4NA8A 1ANDA 1FY8E 1PPBH 3SU3A 3LC5A 1QB6A 4Z6AH 2KAIA 1WBGB 3H09A 3RXUA 1W10U 3ESTA 1RFNA 1C1VH 2QF5A 1HAPH 1GMDF 2AEIH 1G9IE 2BOKA 3P8NA 4X8SH 5EXLA 3MU1A 2C8YB 1S82A 3QWCH 3MTYA 3W1EA 2ZU5A 4KELA 2CV3A 2HNTF 2BDGA 3FAOA 4MVNA 3GICB 3SNDA 4E7RG 1C5VA 1O32A 2YNAA 4ZUHA 3PV2A 3PV4A 3LIWA 1GMCG 2BQWB 2H9HA 3MU8A 2VWLA 4CRBA 3P17H 1WQSA 2ZPQA 2W3KA 3S9CA 3TGJE 2ZWLH 5L30H 3BV9B 3GYMA 1BB0B 4UFGH 3MNSA 4K5ZA 1UK3A 2KFWA 1SGPE 2O9QA 2C93B 4R0IA 1JBUH 1WDIA 5EGMA 1TONA 1TGBA 4X2YA 4YOGA 1YBWA 4WMDA 4CH8B 4E06H 1GDQA 1TRYA 1DITH 2ZDMA 4NSVA 2FLRH 4JK5A 3BG8A 2XC4A 1GJAB 1CA0C 1ZHPA 1KSNA 1QL7A 2PKAB 1QTFA 4BAQB 3RC5A 5T6DA 2OC8A 4IMZA 3Q3YA 5DP8A 1P57B 1A7SA 1O35A 2OC7A 2Y5GA 1A5GH 1PYTD 1SQRA 1MKWK 2QA9E 2BY9X 4NA9H 3F9EA 2QY0B 1XX9A 1TGCA 1QRZA 3DCLA 1D6WA 1HIAA 3NRLA 2B0FA 2IJOB 1RTKA 1C5UA 1H8ED 4MPUA 3LGWA 1J8AA 1EQ9A 1DUEA 3STJA 1UCYK 5GJ4B 1ELTA 1FY5A 1H9IE 1FPHH 3UB0A 1MKWH 3E1XB 2BXTH 1JIRA 4A5TS 4U32A 3RC4A 1BIOA 2KR7A 2TGTA 3A89A 1NU9A 1Y8TA 2HOBA 4A1VA 2P8OC 1F0UA 1TNIA 3MU0A 2KCPA 1C2GA 1C2DA 5I46H 2FTLE 3MU5A 4MG3A 2UUYA 1W14U 4GCHG 3UOPA 4YT7H 4TY7A 4IGDA 1CHOF 1FMGA 1H8HD 1TPOA 3EDXB 2BD9A 5E2PA 3KEEA 2FOHA 1CVWH 3UIRA 2PTNA 4Y6DA 1AMHA 3WW7A 1ETSH 2DE9A 2QXIA 3F9FA 3OU0A 4E05H 2OBOA 1ZTLA 1BT7A 2G55A 3M5OA 4ISLA 4PROA 1IQJA 1MCVA 1NFYA 5EQRA 2UWLA 1QBNA 1DANH 1SOZA 1WV7H 2W7UA 2QF3A 1QRXA 2FZZA 4ZHAA 3A7VA 4Q7XA 1O2ZA 3M7QA 1SHYA 2AHME 1V2OT 1WSSH 1RD3B 3TJOA 1ZTKA 2BX4A 3OY6U 1ELAA 1ZPBA 2VIVA 3BEUA 3A80A 2RCEA 1EP6A 3RXAA 4ABJA 1BTHH 1YM0A 1O2MA 3VGCB 1LCYA 1HAXB 1MD7A 4FUFA 1ZMNA 3GISB 4XE4A 1E1QD 4Y76A 2GKVE 2GMTB 1L1GA 1K1PA 1XM1A 5TCAA 1ANBA 1GJDB 1ORFA 3A7YA 2ZFTA 4CHAC 1TGTA 1P09A 4XBCA 2RG3A 1IAUA 3VG8A 3F2HA 4JZFH 3U28C 3ZVEA 1NN6A 2LPRA 3RU4T 3ATWA 4MNYA 6CHAC 4OGYA 2FODA 3SUGA 2V6NA 1U6QA 1ZOMA 4NGAH 4WXVA 1T31A 4OS2A 2AIPA 3Q00A 1PPHE 1T32A 2JJ1D 4I86A 4I7YH 3F2GA 1BMMH 1EOLA 1RTFB 2TGAA 4FXGH 1G30B 2Y5FA 5C94A 1YY3A 1SGEE 5AHGH 2FXRA 4Q63A 3R3GB 4DURA 2V0BA 1J9CH 1BMLA 1TNJA 4WWYA 3LPRA 3P92A 3LJOA 3LC3A 1VCWA 4INLA 1Z6EA 5FCRA 2Y82A 4O9VA 1OP8A 5FXLA 3ZV8A 2YOLA 1UW7A 1O33A 2ZZUH 1S83A 2BLWA 1TWXB 2WPJS 3QLPH 2ANMH 2R3UA 2F9NA 5C5NA 3BTWE 2FYRA 1KXAA 1PQAA 1HYLA 1A0LA 3F1SB 3NXPA 3U69H 1P12E 1VGCC 2F91A 4B6FA 3BTDE 1GMDG 4LK4A 3MH4A 2PKAA 4NCYA 2W26A 3GCOA 1O3PB 1K1OA 1P9UA 2VVVA 1VITG 3SV2H 4B71A 1S5SA 1GJ4H 3PO1B 1PQ8A 3EE0B 4IN2A 2KCOA 3PYHA 3SU6A 1B5GH 1QURH 2AYWA 1LKAA 3SU5A 2HVXA 2A31A 4HFPB 1O2NA 1HBTH 2WZQA 2ZFQH 1AY6H 3SU4A 1TBZH 2NWNA 4FETA 1ZMLA 2TIOA 3KQCA 3PRDA 5B6LA 1TPPA 3GY6A 1AHTH 3SJ9A 5F8ZA 5HGGA 2AGEX 1AVWA 3G01A 1O2HA 3ZZ3A 4P02A 1THRH 3GCNA 3QUMP 1M9UA 2FOAA 3GCTG 1GVKB 1N8OB 2VNTA 2ZNKH 2YNBA 5DP6A 2FDAA 2BXUH 3JZ1B 2STAE 1DT2A 2WPHS 2HNTC 1GG6C 1GBTA 4X1PU 1A3BH 2G81E 3MNBA 1AGJA 4MTBA 4UONA 2ZHWH 5FPSA 2J5UA 4O3TA 1ESAA 1RIWB 7KMEH 3U8OH 4DG4A 2GCHG 1B7XB 1DVAH 1TE0A 1ZSKA 4X6NA 2I6SA 4BOHA 4AYYB 2PGBB 3M3VA 1UTJA 2VWMA 1SLWB 2FI5E 1SL3A 5EJZA 1O30A 2V3OH 1GJCB 2BD7A 1HV7A 3FP8E 2Y6TA 3SGBE 3KHVA 5FBEA 3A84A 1EOJA 3CS0A 4Y10E 5TCCA 1K28D 3AAVA 2ZCLP 4BXSA 1F5RA 5F6MA 2SGAA 2ZDKA 3MNCA 4IN1A 1K1IA 2BY7X 1XVOA 1GI8B 2FOCA 2Z9KA 1PFXC 1Y5UT 3QO6A 4B2BA 1C5OH 3MU4A 1GVLA 2CN0H 3T25A 2WV4A 5C0UA 1D3TB 3S69A 3UREA 1GMCF 2KZ4A 2J98A 3GDUA 1K1LA 1TNKA 1TMTH 1F5KU 1MBMA 3UAIC 4NFFA 4A7IB 3N99A 2CF8H 3SNEA 1BUIA 1MTUA 3BTHE 1SHHB 3RMOH 4DVAU 1UTLM 2JJ2D 3RMNH 3D65E 3M36A 1MUEB 2R3YA 4DGJA 4K8BA 4ABGA 1HNEE 2A1DB 3T62A 1ZRBA 3EA9A 3KQ5A 1SB1H 4SGBE 1O3DA 8LPRA 3TH2H 3ODDA 3I29A 1GI3A 1NROH 3Q3KA 1MBQA 4NIVA 3VB6A 3EAJA 4CBNA 4DOQA 1ZJKA 1AVGH 1LHEH 3ZVDA 3OTPA 1PPEE 1O2KA 1WXRA 1UHBB 2VIDA 1EB2A 2HPQH 1KXEA 1NRPH 2F3CE 3LOXA 2VVCA 1OYQA 1CGIE 2ZECA 4Y79A 1QJ1B 3AASA 3GY3A 5JBAS 2XWBI 5ESTE 1O3LA 1MTNC 1THPB 3BEFB 4AN7A 4CRDA 3TH4H 1S6FA 1HAYB 1XKBC 2XW9A 2UUJB 2ZHDA 3A81A 3D49H 1FNIA 3SW2B 1MQ5A 1TNGA 1O3BA 1ELVA 2Z9IA 4D7FA 1CO7E 3SZEA 5LGOA 1GJ8B 2PGQB 2FOGA 1KY9A 2L74A 3S0NA 3QX5H 1EZSC 1V2NT 1Z1IA 2ZHFH 5A0CA 2PKSC 3FKSD 1BRBE 3TITA 1T8OA 1O5AB 2XTTB 2ZU2A 1MU8B 4GCHF 4ABHA 3OEED 4IW4E 2R2WU 2ZO3H 2KX4A 1ELBA 1DY8A 2FO9A 1A3EH 4MNWA 1DPOA 2AS9A 1E34B 4HTCH 1UO6A 1DWCH 1UK2A 3K65B 2XNDD 3SU1A 4K3JA 2A2QH 1ZHMA 3RXBA 1ELFA 1TBQH 1FDPA 5DO4H 1KLTA 1S81A 1O38A 4DIIH 1W2KH 2RFKC 2PLXA 1NFWA 2VBCA 2FS9A 3KYGA 1W13U 1AU8A 1OXGA 4YZUA 4A1TA 2JETC 1S0RA 3GY4A 2Y5HA 1GJ5H 2A7JA 4AORA 2XOKD 1DUAA 4AX9H 3SV7A 1O5CB 3ODFA 4XOJA 1YYY1 1EATA 3AVZA 4B75A 1F5LA 3RXDA 3T29A 6CHAB 2GDDA 2J2UA 1CT2E 1F0TA 2BY5X 1V2KT 4LXBH 3RXRA 3ZV9A 4X1RU 2XYAA 3ZVAA 2GV6A 4HI3A 1S0QA 1BOQA 4GHQA 4DJZB 1OWEA 1K1NA 1DICA 3BG4B 4RT0A 3RXOA 3UOUA 1XVMA 2VIOA 3A86A 1S84A 2RA3A 1Y3WA 2WV9A 2YMSC 3QDZB 2J4IA 1TIOA 2QN5T 4TWWA 3UNQA 4Y11E 2D1JA 1LKBA 5BRRE 1CHGA 2V7QD 1FIWA 1MD8A 1DWBH 3O8RA 1XKAC 3SHCH 1WYKA 2GP9B 3IWMA 2XXLA 4RT1A 2AH4X 4OS6A 3F2FA 1VR1H 5FL7D 2XBYA 1DSUA 3VB7A 4B2CA 3RLYH 2PHBA 3SJIA 2FPZA 5HM9A 2JH6D 4JYUH 4B2AA 4O03A 3QGNB 1ZPZA 5BPEA 4BNRA 2BDCA 3M3SA 2W7SA 1SGRE 5DP5A 3ZZ4A 3K9XB 1C2LA 2BD8A 2P3UB 1A5HA 3TPIZ 2G4TA 2BDHA 2FEQH 3OE7D 4ACAA 1XMNB 1Z6JH 1SG8B 1FUJA 2ZF0H 1HUTH 2XWAA 1PJPA 1E36B 1CBWB 2OD3B 2LP6A 2WV5A 4AC9A 1L4ZA 1MKXK 2BDBA 1BA8B 4DIHH 2STBE 3E6PH 4K2YA 1SGYE 1V2VT 2WYGA 3M5LA 4JZDH 3FOAA 1C2FA 5EJ1A 3P8GA 1GPZA 2H9TH 2WPKS 1INCA 4CR5A 1QJ6B 1GCTB 1VZQH 3BEIB 1UHBA 4D8NA 4BXWA 2Z3EA 3HKIB 5T1VA 3OFND 2B7DH 3RMMH 3RXJA 8GCHG 1A1RA 2BZ6H 2ZCKP 2B9LA 1O2VA 2D2DA 2ZC9H 3DT0H 3BTTE 2ZGXH 1VITF 4NIXA 1P2IA 3TJVA 1EUFA 1T4VH 2XBVA 1WCZA 5LH8A 2CHAC 3T26A 3S7KB 1MTWA 1ZR0A 2F9PA 1ZRKA 1FY1A 2PWXA 3D62A 2AGIX 3O8CA 1H9HE 1O5DH 3SU0A 4J1YA 2IOTA 1IQFA 1EPTC 3ZYEA 1TA2A 1MZDA 2SGQE 1VCPA 4X2XA 5ESBA 1LHGH 9ESTA 1IOEA 1O5FH 1GMHG 2Q1JA 4ASUD 2Z6BD 4WH6A 2K1QA 4HG6A 2BM2A 1NM6A 2VWOA 3NK8A 3E3TA 3PMJA 1V2PT 3E8LA 5JBTA 1N6XA 4MNXA 1C5YB 4NA7A 2ZU3A 2G51A 3V12A 5JB8S 2ASUB 2JH0D 3GCTF 5EJLA 2OBQA 1ZSJA 4BAMB 3PTNA 4FUEA 1K21H 2BVXH 3FZZA 2FMJA 3UQVA 4FU9A 1W3CA 2C8WB 3UTUH 4YOJA 2TGPZ 1WTHD 3P70B 5E0JA 1WU1A 2Z94A 3URDA 1A61H 1W0KD 1EX3A 2FIRH 2TRMA 2GCHF 3TK9A 3PLPA 3ZVGA 5FBIA 3TJUA 4CRCA 2GZ9A 1EJMA 3ZZDA 5JYIA 1G3EA 1KTTB 2GCTC 2ZHQH 4ABAA 1UCYE 1O3FA 3A7WA 1LPZB 4XDEA 2Y7XA 1MAYA 1NS3A 3QZRA 3UR9A 5CHBA 4RKOB 3D23A 3BF6H 1VKYA 1TNLA 2W6JD 3UQOA 2ZA5A 3RDZA 1ARCA 1C1NA 1GBBA 1E79D 1YPMH 3E0PB 5SGAE 4F4OC 5C20A 3EE7A 4ISOA 2HVYB 4YOIA 5CHAC 3MO6A 1Y5AT 1UCYH 4I8JA 1O3JA 2ZFRH 1C2KA 4IC6A 1AVXA 1MTVA 2O8MA 2NU3E 1C2HA 4X8TH 1O5EH 2ZTZA 2WINI 9LPRA 1D9IA 2ZGJA 3HGNA 4SGAE 4VGCC 1LMWB 1BBRK 1GI7B 5DN6D 4TPYA 2IJD1 1QFKH 3RMLH 2CJIA 2G8TA 1JMOH 2ZGCA 2BTCE 3ATMA 5EPNA 5FX6A 1MTNB 3BTQE 1GBIA 4CRFA 4FVBA 4KP0A 2FM2A 5EOKA 1V2ST 3A85A 4X0WU 4F55A 2OINA 1OWIA 3RXEA 1AQ7A 1BTPA 1VJ9U 1BBRH 2ZCHP 1J16A 2GX4A 5A09A 6ESTA 2ZFPH 1V3XA 3GCHB 2YMSD 2VU8E 1BHXF 2VGCB 2G4UA 1OP2A 1AB9C 1W11U 1MQ6A 1TAWA 3I77A 4FUJA 1KXBA 3LDXH 3AK5A 4ABBA 1C4U2 1AE8H 1GHAG 4K8YA 1LHDH 2A5AA 2SNVA 2H1UA 3MYWA 1YF4A 4YT6H 1ZPCA 4I33A 1CT4E 4ZHLU 4ZKSU 5IDKA 3SJOA 4IBLH 2W6ID 1F0RA 3DUXH 4ABFA 1O3KA 1W7XH 4ZKOU 4XSKU 2GT7A 4MPWA 4MPVA 3ZZ9A 4D76A 1QNJA 1QL8A 1C5WB 1EZXC 5EODA 1B0EA 1TOCB 2CGAA 4XFQA 1UTQA 1P8VC 2BDYA 1S6LA 3F3BA 1TRMA 3EQ0H 2FOMB 2NU0E 1TFXA 2JETB 1LTOA 2FX4A 2QXHA 4F49A 4O3UA 1O3AA 1OS8A 4FOUC 1HAOH 3K2UA 3MWIU 5T3HA 1HGTH 1TYNA 3HGPA 4MQAA 3SUDA 2DE8A 3M5NA 3SNAA 2ULLA 2UUFB 3LGTA 1SGCA 1E37B 4THNH 4CH2B 1TA6A 1LQEA 2BHGA 3MOCA 4HGCA 2I6QA 5DP3A 3GY5A 2Z3CA 2ZHEH 1K2I1 3QTOH 3SJ8A 5FAHA 2EI7A 3TK5A 1O3OA 1GGDB 5HYOA 3LGUA 4UEHH 1IQMA 4Q4LA 3HATH 1YPHC 1SLVB 5C17A 2EI8A 4AB9A 4R8TB 1V2JT 2Q6FA 8KME2 3RXSA 4K1SA 4XRNA 2ZTXA 1G2LA 3PWBA 2ZP0H 2GJGA 3M37A 2BD5A 2AFQB 3MO9A 1O3NA 1X7AC 2BY6X 1Y5BT 4JYTA 1BMFD 1BQYA 1XUJA 2PTCE 1UTPA 2SGDE 4FUGA 4RI0A 5LPFA 1RGQA 5DP7A 1BRUP 2ZFSA 3TVJB 2EI6A 1W0JD 1SKYE 3RXFA 4ABIA 1P05A 2AMPA 2EY4C 1D6RA 2V3MA 3HKJB 3U9AH 1OP0A 3BTKE 1PPCE 3C27B 1QY6A 2VH6A 3OTJE 4TY6A 4ESTE 4AGKA 1TB6H 2H5DA 3P8OA 1G3CA 2F83A 4X1QU 3E91A 4CBOA 1TX6A 4A1XA 4GLYA 1RXPA 1YP9A 4HZHA 2ZU1A 1O2XA 1KTSB 4H4FA 3LU9B 5FX5A 1NESE 3SN8A 4AGJA 1ARBA 2IPQX 1JIMA 1LDTT 2QV1A 5DJ7A 3SZNA 3TIUA 5JBCS 3UR6A 3F9GA 2BYAX 2PSYA 1NC6A 3SQEE 5JDUB 3DSOA 2OQ5A 1V2RT 1NRQH 1CQQA 4OS5A 1SFQB 4DT4A 1KXDA 3FFGA 1C1SA 1XUGA 4XBBA 3FP6E 2GZ7A 4WMEA 1QBVH 3F68H 3UUZA 4UFFH 1DSTA 3LKWA 1UJ1A 2ZDNA 8ESTE 1UTKA 4M9FA 1C1OA 1SFIA 1AUTC 1O39A 5JB9S 3MQKC 2GVFA 1AWHB 1O2SA 3LGYA 1IQNA 1J14A 2H5CA 3AAUA 4ZAEA 3MFJA 3M7UA 1O2GH 2VINA 4LZ4B 2HLCA 1YPJH 4JK6A 3KGPA 3FANA 1P2JA 3A88A 5ABWA 5HKKD 4BTTB 1AN1E 2Z9LA 3RM0H 3SJKA 1Z1JA 3SV8A 2FLBH 3ELAH 1K0HA 5G4BA 1IHSH 1C2MA 5HMAA 1GI2A 3FP7E 1HAZB 4OM9A 1AUJA 1NBMD 5TJXA 1ANEA 4WH8A 3L33A 3DA9B 8GCHF 3PTBA 1OOKB 1FI8A 3KQDA 3CNRA 1FIZA 1XXDA 3H5CB 2ZEBA 1FQ3A 3OAAD 3ZVFA 2IPHA 7ESTE 2SNWA 1W0ZU 3TNSA 3V13A 2LELA 2BVSH 4WMFA 3ENSB 5AF9H 5EXMA 3EA8A 2OC1A 2ZTYA 1SSXA 1UVOA 1BTXA 3V7TA 3UWIA 1FAXA 1FJSA 6GCHG 4OS4A 1BITA 1IQKA 2QGRA 4FUBA 1CA0B 1FY3A 1LPGB 1C5NH 3VEQB 2WPIS 2BQ7B 4RN6A 1GMHF 3DFLA 1Q2WA 5EU8A 3PV5A 2AIQA 2WPDD 1C1QA 3OEHD 1GI9B 3BTGE 3MH6A 4NIWA 3PM3A 3ZIAD 1T7CA 1N1LA 2GCTB 4YM9A 1ABJH 4BANB 3GDSA 1GDUA 4CREA 1OPHB 3M3TA 3IG6B 2HNTE 4U2WA 3S9AA 1UTMA 1QB1A 1NU7B 1AFEH 1C4V2 1QQUA 3HK6B 2D8WA 3F9HA 1GI5A 3T28A 1DWDH 2F9UA 3DFJA 2C3SA 3RXCA 2P8OB 3E16B 3SYJA 3TU7H 3SQHE 4BAOB 1BRCE 1DLKB 2W5EA 3BIVH 2CF9H 2BQ6B 1EFRD 3MI4A 1A2CH 5T6GA 2Z9JA 4GPGA 4NWKA 5F03A 1VITH 2HLDD 2GDEH 1O37A 1YGCH 5KECA 1AFQC 3S9BA 1TMUH 2UWOA 1NT1A 2SFAA 1H9LB 2G00A 1TQ0B 2A0QB 3SI4H 1XUKA 1QCPA 5HM2A 3VB3A 3ZZ5A 5H4IB 4Z0KA 2ANWA 1V6DA 1A46H 4TYDA 1OKXA 3U98H 2QCYA 1LO6A 3GDVA 3RM2H 1JOUB 1LVBA 1W12U 4ZXYH 2FS8A 4FUCA 1OHHD 3T2NA 1F92A 1KLJH 4GHTA 1COWD 1J17T 1WAYB 1ACBE 5E0GA 3TH3H 3P6ZB 1PPGE 3ATKA 1D4PB 4B76A 3RXMA 3SHAH 1ZJDA 3SV6A 1MH0A 1GJ6A 4O97A 3N7EA 5EQSA 1B0FA 2ANYA 3GOVB 2AMQA 3N7OA 1QB9A 1L1NA 2K8IA 3ZZ6A 1AB9B 4Q2KA 3VGCC 3TNTA 2A4QA 3L3TA 1T8NA 2RA0A 2R2MB 1JRTA 4K60A 4NG9H 3UNSA 1QIXB 1EB1H 1P2NA 2OK5A 5C2ZA 2GMTC 1DS2E 1YLDA 1QQ4A 3TGKE 5C1YA 4AG1A 1CGJE 4Y0ZE 4MDSA 4CHAB 2V3HH 4BTIB 3QZQA 4UE7H 4AB8A 1QA0A 3RXVA 1AZZA 4KKDA 3SOSA 4ASHA 3DSPA 3SORA 1GJBB 3ZZ7A 1BTUA 4WXIA 4OGXA 1NO9H 3BN9A 1GI6A 2H9EH 4Q80A 3VXFH 4I8LA 2XRCA 1GHAF 1ZHRA 1C5LH 1YPLH 1JWTA 4WVPE 2QXJA 3ZZBA 4D7GA 1HIAB 3RXPA 3B23B 1WOFA 4UD9H 1YPGH 2AGGX 1EKBB 1CU1A 2A7HA 4JCNA 1SQTA 1O2JA 2ODYB 4XD7D 1QGFA 1ELEE 3KNXA 1O2OA 1OYTH 1G2MA 4AYVB 1HCGA 1NTPA 3A87A 2EC9H 3OY5U 1O3MA 2NU2E 1C1UH 1DLEA 1ANCA 1SC8U 1TBRH 3ZYDA 2VVUA 1C5SA 1OWKA 3GYLB 2GV7A 4AFSA 2J38A 5PTPA 4ISIH 1AZ8A 3BIUH 3KF2A 1HFDA 4XBDA 1NFXA 1GHXH 1CT0E 2C90B 1VGCB 3URCA 3CENA 1QA7A 1DDJA 2ZPRA 3LGVA 1UTOA 1YCPK 2B8OH 1IQLA 2FI3E 3W95A 2ILNA 5C0TA 2Z7FE 5J4SA 1SGQE 3EA7A 2W3IA 1O2RA 5CDFE 1O3GA 1Q3XA 1SBWA 3C1KA 1GJ9B 1P3EA 3PO1C 3KIDU 3KCGH 4K1TA 2XC0A 2Y7ZA 3RXKA 5C1XA
chains in the Genus database with same CATH topology
5LPRA 2QIQA 3AW0A 1SGNE 1UVUH 1GHZA 1FLEE 2Q6GA 5B6OA 5JPMH 4ZKRU 2UUKB 1SQAA 1NZQH 3NZIA 2C4FH 2IN2A 4X2VA 2CXVA 3B8JA 4ABEA 4X2WA 4ZROA 1KIGH 1H4WA 1LPKB 2ZPSA 1HLTH 1AO5A 2F9OA 2QYIA 3UNRA 1HRTH 4Y7AA 3LGIA 2TBSA 1A5IA 1V2UT 1MKXH 2G5VA 3O8BA 2G52A 4Y71A 4MLFB 1IQHA 4AFUA 4TPIZ 2R9PA 4ZH8A 4DCDA 3RXIA 4ZXXH 2BZAA 4AG2A 1GI4A 1N8OC 1QL9A 3A8BA 5F8XA 1IHTH 1C5XB 2NU1E 4H6SB 2FESH 5GDSH 2VIQA 1HB0B 1AIXH 1O2LA 3S7HB 4X6PA 1BDAA 2NU4E 2PV9B 4Y8XA 1GG6B 4Q7YA 1C9TA 1ZYOA 1P06A 3KQBA 4QT8C 1RIWC 2GT8A 2PFEA 4J2YB 4AFQA 1OX1A 5L2ZH 4TWYA 2Y80A 3I78A 4UFDH 2PR3A 1DE7H 1F0SA 3RXGA 1RRKA 1MAXA 1C2JA 1Y3UA 4GUXA 2BDIA 1K1MA 5GPIB 1GBJA 2O8UA 1KXCA 4X8UH 1E0FD 1HJAC 1ZTJA 3NUMA 3DHKH 1H1BA 2J9NA 1HJ9A 3V0XA 1GHYH 4JMYA 1CSOE 4WY3A 1V2TT 1GBFA 2A2XH 1C1PA 1EXFA 3E90B 1IQGA 1TMBH 4LZ1H 1TPSA 1BMNH 1D3QB 5K0HA 1SMFE 2XCFA 1SLUB 2BD2A 3M5MA 2FOFA 3NWUA 2ANKH 1TPAE 2ZIQH 3DD2H 2QXGA 3AW1A 1QJ7B 1FZZA 2C8XB 1IQEA 2WPMS 2OCVB 1L0ZA 1PQ5A 1TQ7B 2A45B 5GWZA 1CGHA 5DG6A 1DY9A 2XC5A 1NRNH 3SGAE 4JZEH 1P04A 1P03A 4MNVA 5A0AE 1O3IA 1XUFA 1UK4A 1Z8JB 4U30A 3ATIA 3RU4D 2VJ1A 1PQ7A 1ABIH 1GDNA 2CMYA 3QTVH 7GCHG 2QAAA 1GBDA 1P10A 1LVOA 2B5TB 5T6FA 1P2KA 2R0LA 5A0BA 1LVYA 2OUAA 6GCHF 2P59A 1BRAA 1G32B 4NIYA 5AFZH 1BBRE 1ELCA 2OQUA 1SGTA 1O5BB 2ZDVH 1GHWH 1TOMH 2HALA 3U8TH 1MTSA 4Y8YA 2ZKSA 3QK1A 3SV9A 1EP5A 3H7OA 2WUBA 3K6ZA 1ZGVA 2ODPA 3VPKA 3PLKA 1GVZA 4MPXA 3Q77A 4X6OA 3SUEA 2BLVA 3UPEA 4GSOA 1C5ZB 3EYDA 1SQOA 1HAHH 1EAIA 5HXFA 3TGIE 1SI5H 2BVRH 1EJAA 1AFQB 3B9FH 1SOTA 1YCPM 2ZI2H 3L6PA 2FWWA 2WYJA 1K9OE 2JKHA 2P3TB 2DUCA 5CE1A 4D9QA 1FXYA 2FYQA 3V3MA 5GCHG 1P9SA 2SGFE 1NRRH 3PROA 1TABE 2PUXB 1K1JA 4FUDA 5A8YA 1GL1A 1UMAH 2FOBA 2EA3A 3KQEA 1KXFA 2PKSB 2VB0A 1BHXB 3QGJA 5EQQA 1RS0A 3SBKA 5AVDA 4DY7B 2TPIZ 1W8BH 3T5FH 2XBWA 2P95A 4JZ1A 3U1IB 4NZLA 1E35B 2BB4A 2QC2A 3SO3A 4KTUA 1OWDA 1SGIB 3A8CA 3A8AA 4ZMAH 3PMAB 1WTGH 1GCDA 3CS7A 1ESTA 5C5OA 1O31A 4BAKB 3M35A 4INHA 1KDQB 4CR9A 1GBCA 1FPCH 1L4DA 1Q31A 1XUHA 3H7TA 5J4QA 1TX7A 2F9VA 3MHWU 1SR5C 1TALA 3LJJA 2A4RA 1GHBG 2FP7B 4A92A 2G5NA 1VCQA 1FN6A 3UFAA 3KL6A 1QHRB 1TNHA 3OYPA 4CRGA 1P2OA 3FZDA 1YLCA 2Y81A 4X1SU 4YTAA 1G3BA 3GY2A 1DWEH 5DGJA 1O2QA 1T8MA 3BG4C 1BTYA 5DKMA 3TLOA 3BTME 5A2MH 1O5GH 4GVUA 5DPAA 4NWLA 5ETXA 1O36A 2A4GA 1GI1A 3IITA 4BAHB 4FUIA 5AFYH 2BLQA 1MZAA 2J95A 2VIWA 5CMXH 5C67A 2SGEE 1O0DH 1Y3VA 2P93A 1Y59T 4WJG2 2J34A 3VXEH 4B74A 4IMQA 4ISNA 4ZHMU 2EEKA 1Z8IB 4NFEA 1O2UA 1S85A 1GHVH 1BJVA 2Q6DA 1DXPA 5F8TA 5E2OA 1P11E 7LPRA 1ZZZA 1TX8A 1OWHA 3U8RH 4X1NU 1RJXB 1J15A 2ALVA 4UDWH 1UVTH 1AD8H 1EZQA 1P0SH 2TGDA 3M7TA 5E0HA 2F9BH 2HRVA 1VJAU 1UVPA 1V2LT 2ZQ1A 1O3HA 2RDLA 2A7CA 3F6UH 1CBWC 1W0YH 3MNXA 5EG4A 1O34A 3CP7A 4YESB 3VFEA 3JZ2B 2PW8H 4NZQA 3QN7A 2PSXA 2ESTE 1DX5M 2BD4A 4X8VH 5E8EH 4H42U 1HDTH 1O2TA 1GCTC 3SUFA 1C1RA 2AERH 5EPYA 1HAIH 4B73A 1ZLRA 1AKSB 1CE5A 2C8ZB 4DW2U 4U01A 1NFUA 3OX7U 1GBLA 1EJNA 1F2SE 1T8LA 1A0JA 4ISHH 1BCUH 1GBMA 1ELDE 3UY9A 1MMJN 5DP4A 2FI4E 3SI3H 3SNBA 2JH5D 3MH7A 2HGTH 1P02A 3P95A 1C5RA 1LQDB 1YPHE 2CHAB 1TGSZ 4Y7BA 4I32A 2WUCA 4INKA 3O8DA 3NPSA 1NRSH 2A4OA 1AE5A 3A7TA 1GBHA 5EW1H 1C1MA 1FONA 1ZMJA 1DM4B 3RXHA 2FTMA 3HK3B 3TK6A 1EPTB 1G37A 2THFB 1HAVB 1KLIH 1W7GH 5GIBA 3RXTA 4OS1A 1THSH 2OLGA 3ZZAA 5C3NA 5DP9A 2UWPA 2ZGBH 3KN2A 1P01A 1IQIA 1FAKH 1HPGA 4KTSA 1EAUA 1HJAB 1SLXB 2H2ZA 4A6LA 4WF8A 5FCKA 5EXNA 1P2QA 2QF0A 3GY8A 2GZ8A 1MCTA 1EASA 3FVFB 4I8HA 4KGAA 1Z8GA 2ZGHA 2ZFFH 2GD4B 5K7RA 3BTFE 2SGPE 1BTWA 1XXFA 5I25A 5FPTA 1CHOG 1KDQA 1O2IA 1ZSLA 1C2IA 2ALPA 3BSQA 3Q3XA 2Z3DA 4I31A 3K6YA 4GAWA 3RP2A 5C1UA 1GWAA 1SGFA 1YPKH 4YLQH 3SGQE 3UWJH 2ODQA 5EW2H 3W94A 4CRAA 4IS5A 3PB1E 1C1TA 1V2MT 2R0KA 2ZDLA 1O3CA 2ZU4A 4OS7A 4UFEH 1V2QT 3ZVBA 5CHAB 1C1WH 1SVPA 5L2YH 1SGDE 1L2EA 4AOQA 2KAIB 1GL0E 1FY4A 3A8DA 3ZVCA 3U1JB 1P3CA 2M5TA 4RSPA 5A8ZA 1Z8RA 3A83A 3A7XA 4VGCB 4K69A 1Z7KA 1C5QA 1BJUA 3PMHB 1EZUC 2BDAA 3OSYA 4RKJB 2J92A 3A82A 4KTCA 1MU6B 2PUQH 3RXLA 3LONA 2ZQ2A 2GGVB 1K22H 3SU2A 3LH3A 1HJ8A 2BX3A 7GCHF 3M61U 3PLBA 1C2EA 4IC5A 4Q7ZA 1LHCH 1C5PA 1A4WH 5FPYA 5A8XA 3GCHC 1YKTA 4DT7B 2P16A 2VGCC 4E7NA 1RTLA 2ZDAH 1EAWA 1TGNA 5FHTA 4YLUA 1PYTC 3RUOA 4X6MA 1N6YA 1SGFG 1KYNA 4FU8A 3T27A 1A0HB 2O8TA 3ATLA 2D26C 3LH1A 1JRSA 4AFZA 4ZKNU 4I8GA 1D3DB 3HPTB 2BLOA 3MMGA 1F7ZA 1HXFH 1TLDA 1EAXA 4YO9A 1H8IH 3P8FA 1PPZA 4B1TA 6LPRA 1JXPA 1ELGA 1HXEH 1Y3XA 3TJNA 2XBXA 1GBKA 3VB5A 1AKSA 3E0NB 5GCHF 2ZG0H 1ESBA 2BOHB 2OP9A 2AMDA 1LVMA 4H6TA 3ZZCA 1AWFH 5DK1A 1QRWA 4FU7A 3EGKH 2XNIA 3R0FA 2A5IA 1CA8B 1O2WA 1YC0A 2HWLB 4ABDA 2BD3A 4NSYA 3STIA 4JYVH 4D9RA 4JZIA 3PMBB 1C4Y2 3MH5A 4FVDA 1GJ7B 5LPEA 1LHFH 2H6MA 1D3PB 4BTUB 1GI0A 1Y3YA 1EPTA 1C5TA 1HAVA 1DFPA 1UVSH 1BTZA 3MO3A 1GBAA 2FOEA 5IYTA 1P2MA 1C9PA 1PPFE 4M7GA 2OC0A 1GGDC 2FX6A 1FV9A 3LT3A 1TRNA 2HPPH 1YPEH 1HAGE 4Y8ZA 2VH0A 2Z9GA 1GBEA 4LOYH 1QR3E 2A5KA 3SNCA 1NPMA 3WY8A 4AZ2B 3PWCA 1ID5H 5L6NH 1GHBF 1T4UH 4Y0YE 1SPJA 2XCNA 2J94A 2WPLS 1UTNA 3RLWH 1V2WT 1O2YA 1WUNH 3A7ZA 1DXWA 3Q76A 3RU4E 1BMAA 1ETTH 1AI8H 2A32A 1G36A 2V35A 1NY22 2VIPA 1S6HA 2GTBA 2OTVA 3BTEE 4K1EA 3RC6A 1OSSA 1L1JA 1QBOA 1YCPH 3NKKA 5GXPA 3ITIA 5JBBS 1O2PA 1ZGIA 2P3FH 1C5MD 1XUIA 2VWNA 1WQVH 1O3EA 2LNCA 1DOJA 3NCLA 1Z71A 1G3DA 3RXQA 1FN8A 2O8LA 2BY8X 2OXSA 2BMGB 2P94A 1OWJA 1ETRH 3VB4A 3ZZ8A 1E38B 2O8WA 3GY7A 1H8DH 4FUHA 4I8KA 1BZXE 4NA8A 1ANDA 1FY8E 1PPBH 3SU3A 3LC5A 1QB6A 4Z6AH 2KAIA 1WBGB 3RXUA 1W10U 3ESTA 1RFNA 1C1VH 1HAPH 1GMDF 2AEIH 1G9IE 2BOKA 3P8NA 4X8SH 5EXLA 3MU1A 2C8YB 1S82A 3QWCH 3MTYA 2ZU5A 4KELA 2CV3A 2HNTF 2BDGA 3FAOA 4MVNA 3GICB 3SNDA 4E7RG 1C5VA 1O32A 2YNAA 4ZUHA 3PV4A 3LIWA 1GMCG 2BQWB 2H9HA 3MU8A 2VWLA 4CRBA 3P17H 1WQSA 2ZPQA 2W3KA 3S9CA 3TGJE 2ZWLH 5L30H 3BV9B 3GYMA 1BB0B 4UFGH 3MNSA 4K5ZA 1UK3A 1SGPE 2O9QA 2C93B 4R0IA 1JBUH 5EGMA 1TONA 1TGBA 4X2YA 4YOGA 1YBWA 4WMDA 4CH8B 4E06H 1GDQA 1TRYA 1DITH 2ZDMA 4NSVA 2FLRH 4JK5A 3BG8A 2XC4A 1GJAB 1CA0C 1ZHPA 2PKAB 1KSNA 1QL7A 1QTFA 4BAQB 3RC5A 5T6DA 2OC8A 4IMZA 3Q3YA 5DP8A 1P57B 1A7SA 1O35A 2OC7A 2Y5GA 1A5GH 1PYTD 1MKWK 2QA9E 2BY9X 4NA9H 3F9EA 2QY0B 1XX9A 1TGCA 1QRZA 1D6WA 1HIAA 2B0FA 2IJOB 1RTKA 1C5UA 4MPUA 3LGWA 1J8AA 1EQ9A 1DUEA 3STJA 1UCYK 5GJ4B 1ELTA 1FY5A 1H9IE 1FPHH 1MKWH 3E1XB 2BXTH 1JIRA 4A5TS 4U32A 3RC4A 1BIOA 2TGTA 3A89A 1NU9A 1Y8TA 2HOBA 4A1VA 2P8OC 1F0UA 1TNIA 3MU0A 1C2GA 1C2DA 5I46H 2FTLE 3MU5A 4MG3A 2UUYA 1W14U 4GCHG 3UOPA 4YT7H 4TY7A 4IGDA 1CHOF 1FMGA 1TPOA 3EDXB 2BD9A 5E2PA 3KEEA 2FOHA 1CVWH 3UIRA 2PTNA 4Y6DA 1AMHA 1ETSH 2DE9A 2QXIA 3F9FA 3OU0A 4E05H 2OBOA 1ZTLA 1BT7A 2G55A 3M5OA 4ISLA 4PROA 1IQJA 1MCVA 1NFYA 5EQRA 2UWLA 1QBNA 1DANH 1SOZA 1WV7H 2W7UA 2QF3A 1QRXA 2FZZA 4ZHAA 3A7VA 4Q7XA 1O2ZA 3M7QA 1SHYA 1V2OT 1WSSH 1RD3B 3TJOA 1ZTKA 2BX4A 3OY6U 1ELAA 1ZPBA 2VIVA 3BEUA 3A80A 2RCEA 1EP6A 3RXAA 4ABJA 1BTHH 1YM0A 1O2MA 3VGCB 1LCYA 1HAXB 1MD7A 4FUFA 1ZMNA 3GISB 4XE4A 4Y76A 2GKVE 2GMTB 1L1GA 1K1PA 1XM1A 5TCAA 1ANBA 1GJDB 1ORFA 3A7YA 2ZFTA 4CHAC 1TGTA 1P09A 4XBCA 2RG3A 1IAUA 4JZFH 3ZVEA 1NN6A 2LPRA 3RU4T 3ATWA 4MNYA 6CHAC 4OGYA 2FODA 3SUGA 2V6NA 1U6QA 1ZOMA 4NGAH 4WXVA 1T31A 4OS2A 2AIPA 3Q00A 1PPHE 1T32A 4I7YH 1BMMH 1EOLA 1RTFB 2TGAA 4FXGH 1G30B 2Y5FA 1SGEE 5AHGH 2FXRA 3R3GB 4DURA 2V0BA 1J9CH 1BMLA 1TNJA 4WWYA 3LPRA 3P92A 3LJOA 3LC3A 1VCWA 4INLA 1Z6EA 5FCRA 2Y82A 4O9VA 1OP8A 5FXLA 3ZV8A 2YOLA 1O33A 2ZZUH 1S83A 2BLWA 1TWXB 2WPJS 3QLPH 2ANMH 2R3UA 2F9NA 5C5NA 3BTWE 2FYRA 1KXAA 1PQAA 1HYLA 1A0LA 3F1SB 3NXPA 3U69H 1P12E 1VGCC 2F91A 3BTDE 1GMDG 4LK4A 3MH4A 2PKAA 4NCYA 2W26A 3GCOA 1O3PB 1K1OA 1P9UA 2VVVA 1VITG 3SV2H 4B71A 1S5SA 1GJ4H 3PO1B 1PQ8A 3EE0B 4IN2A 3PYHA 3SU6A 1B5GH 1QURH 2AYWA 1LKAA 3SU5A 2HVXA 2A31A 4HFPB 1O2NA 1HBTH 2ZFQH 1AY6H 3SU4A 1TBZH 2NWNA 1ZMLA 2TIOA 3KQCA 1TPPA 3GY6A 1AHTH 3SJ9A 5F8ZA 5HGGA 2AGEX 1AVWA 3G01A 1O2HA 3ZZ3A 1THRH 3GCNA 3QUMP 1M9UA 2FOAA 3GCTG 1GVKB 1N8OB 2VNTA 2ZNKH 2YNBA 5DP6A 2FDAA 2BXUH 3JZ1B