3LGYA

R178a mutant of the degs-deltapdz protease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
213
structure length
179
Chain Sequence
b'STDETPASYNLAVRRAAPAVVNVYNRLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPGQTITQGIISATFLQTDASINHGNSGGALVNSLGELMGINTLPEGIGFAIPFQLATKIMDKLIRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 36
structure length 179
sequence length 213
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgyA02
2R0KA 4YM9A 1SBWA 2F9OA 3A8BA 5A0BA 2PKSC 5JBAS 2G5NA 1ZPBA 4WY3A 1EPTA 1C1MA 1DFPA 3Q3YA 1EB2A 4DCDA 1MZAA 3M3SA 3A7TA 4VGCC 2Z7FE 3GYLB 4X6NA 1ZTKA 3P8NA 4I8GA 5AFYH 4AFQA 5FBIA 3SV7A 1GBLA 4YOGA 1Y3WA 1AB9B 1ZSKA 2GCTC 1TE0A 1CU1A 2AYWA 4SGBE 2QIQA 2G8TA 4Y10E 3VPKA 2NU3E 2ZFPH 3BG4C 1MD8A 2VINA 1TRNA 1MTVA 1O2HA 1TPAE 4X2YA 2OTVA 1SLVB 4PROA 4AG2A 5JYIA 5JBCS 1H4WA 3RXIA 1QJ7B 2BD4A 5TJXA 3NZIA 1BRUP 1F5RA 2BQ6B 1K1LA 2BYAX 3SU5A 1QTFA 2C90B 1QNJA 2FMJA 1EJNA 1E0FD 2BZAA 1ANBA 2ZFSA 1FY5A 3MO6A 4Y11E 3V3MA 1MU8B 2UUJB 1NFWA 1CT2E 2F9BH 5JB8S 2BDAA 1O2NA 4CRFA 2GCTB 1J8AA 1TFXA 1TRYA 3TVJB 4ZHLU 3S69A 5HMAA 2EC9H 2ANWA 4AB9A 2Z9JA 4ABGA 3MNXA 1SR5C 1C1UH 3SUEA 1SGTA 3RXEA 2FEQH 2GT7A 1ZSLA 2P3FH 1FN8A 2JKHA 3T25A 3R0FA 3A8CA 1S5SA 4KGAA 2ZDLA 3PTBA 1TX7A 4XBDA 1YPHC 2AFQB 4LK4A 1C5TA 1Q31A 3OU0A 5CHAB 3U8TH 4Z0KA 1HAGE 2A45B 4X1RU 2A5IA 1VCPA 3TH2H 2BB4A 3KCGH 5LGOA 2FI3E 4CR9A 2ODPA 3BEFB 3TK6A 3QDZB 4WXIA 1S81A 2CV3A 7KMEH 1AFEH 5FX6A 1M9UA 3RXGA 3Q77A 3VB7A 2G51A 1K28D 5C5OA 1G37A 1UHBA 5FXLA 2A4RA 3FP8E 1AVGH 2V0BA 4KELA 1AWFH 1O3LA 1C4U2 3FFGA 1T8LA 1AKSB 1SGFA 5ABWA 2WV4A 1P2QA 1OPHB 5EXNA 3SUFA 2A7HA 2GGVB 2HPQH 1T7CA 1UK3A 5DPAA 2XC4A 1MBQA 1HJAC 1TQ0B 1Y5UT 4ISOA 4NA8A 1Y3XA 1P2MA 1WTGH 2OUAA 3RXDA 2Q6FA 2ZHQH 3F68H 5E0HA 3H5CB 3UWIA 3MH6A 2AGGX 2Y7XA 3K65B 4BAOB 2Z3DA 1MTWA 1TRMA 4UFFH 4K8BA 4JZFH 5GDSH 4IS5A 3SQEE 1SPJA 2G81E 5EU8A 1TGCA 3KQCA 1S0QA 1ZMNA 3A8DA 1KXAA 1KXCA 2CF9H 2ZA5A 3PB1E 3ZZ8A 5CE1A 2DE8A 3T2NA 1AE5A 4F4OC 1O2MA 1BTHH 4UFGH 1MD7A 1WQVH 2NU0E 1HJAB 3NXPA 3MH4A 5FPTA 4BTUB 2H2ZA 3RU4T 2PTCE 2XYAA 4CRBA 5FHTA 1WOFA 2EI8A 4CH2B 2G00A 1EAIA 1GPZA 3LIWA 1EAUA 3GISB 3P8GA 1CT0E 3FP7E 1DLEA 1NFYA 3RXRA 3CENA 2P8OC 3AVZA 1FY1A 5SGAE 1HJ8A 2ZCKP 2ZECA 4A92A 1O3HA 3RXQA 1K22H 4Y76A 2PLXA 3ZVAA 3ZZBA 1YGCH 2FWWA 1ELDE 4X0WU 5T6FA 2JH0D 3K9XB 3HGNA 1PFXC 1QA0A 1P57B 2HNTF 4HFPB 3A7WA 2V3HH 4U30A 2FPZA 2A5AA 3SHCH 3UQVA 2C8WB 2BVXH 2J2UA 1O37A 4XDEA 2OC7A 3GY8A 2VU8E 3S9BA 2FOHA 1BQYA 5BRRE 4K60A 4R8TB 2P8OB 1BRCE 2XNIA 2FS9A 1G3BA 1TPPA 3Q76A 1XUGA 5FX5A 1K21H 1GMDF 1GBIA 1YPMH 1DSUA 4WH6A 3TJOA 4WF8A 1S83A 3HKJB 3I78A 3V12A 4ZH8A 1GDUA 1SGCA 2W3KA 1ARCA 2ZPRA 3OY5U 2BQWB 2BDCA 1L4ZA 1KLTA 1W10U 3LGYA 1Z1JA 2D2DA 4IW4E 3SI4H 2O9QA 1GBAA 3T27A 4ABDA 3RMNH 1C1QA 1FUJA 1GHZA 1A5HA 5DKMA 1HAIH 3BTEE 5ETXA 3RDZA 1SB1H 2R9PA 5AFZH 1D3DB 2GD4B 1O3GA 1AKSA 1QL8A 2BD5A 4BAQB 1JMOH 1W8BH 3TGKE 1V2RT 3MHWU 3EE0B 1EOLA 4DG4A 2WUCA 1MTSA 3RLYH 1HAPH 2AIQA 2W3IA 5DP8A 3EA8A 1VITH 2FDAA 2PGBB 3H7OA 4BTTB 3RMOH 3E91A 1UTJA 4XSKU 2VNTA 3NUMA 2BM2A 3F1SB 2H9TH 5T6GA 3VGCC 1MUEB 1K1PA 1PYTD 1J9CH 4BANB 1GI9B 1C1SA 4GPGA 2ANYA 1LVMA 3RUOA 3SU3A 3FAOA 2FS8A 1GI3A 2XCNA 3PO1C 4BAMB 2H6MA 3DHKH 2AMQA 1OWDA 1TGBA 2ASUB 2PW8H 4INLA 2TGTA 1UTNA 4WMEA 1GJBB 1QBNA 2XTTB 2BOHB 3RMLH 3ZYDA 2CHAB 3A83A 3VXFH 1HB0B 4CHAB 3U98H 3U69H 4ABBA 1O32A 1PPGE 4XFQA 1FDPA 1OXGA 2A4QA 1HAOH 4CRDA 1O3KA 3UNSA 3UUZA 1UK4A 1U6QA 1NZQH 3DUXH 2ZKSA 3TNTA 4ZHMU 4UDWH 1QL7A 3BV9B 1YPLH 2XXLA 1GJ9B 3BTWE 4ABIA 4DURA 3SU2A 1KTTB 1WAYB 3ZVFA 4X1SU 4ABEA 3P95A 3PO1B 3LJOA 1BMNH 4IMQA 2A5KA 3BF6H 3QTOH 4Y0ZE 3BTQE 3PYHA 1A7SA 3U8OH 3F9EA 4Q7YA 4AFSA 1H8IH 1FPCH 4ISNA 1EP5A 1TWXB 6CHAC 1LCYA 3IITA 1PQ7A 2BOKA 3PROA 1GMDG 3K6YA 1GG6B 1KXBA 1P2NA 1DWCH 4B71A 3TITA 4J2YB 3VB5A 5EODA 4ZKRU 1FZZA 1GJ6A 1WUNH 3RXUA 2FOEA 1O3JA 3GCTF 2PUXB 4ISHH 5L6NH 4RN6A 1OP0A 3A82A 1W11U 3TGIE 2WINI 3D23A 2A4OA 1OOKB 1ELVA 2RCEA 1XUFA 2BDGA 3AW0A 3KQEA 1GVLA 4I31A 1F0SA 3RXAA 1HFDA 1QJ1B 3PTNA 4JYUH 1SHHB 4THNH 1FNIA 5I25A 1HBTH 4O3UA 5K0HA 1FXYA 2QCYA 3SQHE 1S82A 3K6ZA 1O39A 1FAKH 5FBEA 2ZTYA 2ZF0H 1F5LA 1PQAA 1F5KU 1V2OT 4DJZB 1ELAA 2ZDNA 1GHYH 1RFNA 3UY9A 2XCFA 1EP6A 3UPEA 1ZMJA 1YPGH 2H5CA 1DWBH 3A86A 3OYPA 3PMHB 3RLWH 1CGIE 3BTME 4Q7XA 1DE7H 5DP4A 1E37B 1TBZH 5DP5A 5HGGA 5C2ZA 4DIIH 2VWMA 3BTDE 1O5GH 2XBWA 4FUIA 3O8RA 2BD7A 1GJ4H 1AVWA 2TPIZ 3HK6B 1J14A 1BJVA 2RG3A 1YCPM 2F91A 2ZGHA 1LPGB 3P17H 1O31A 2J9NA 1BRAA 4MLFB 1T8NA 1GVZA 2AH4X 2QXGA 4A6LA 1A0LA 1ANCA 1DX5M 3M37A 4DW2U 3BTGE 1QBOA 1FY3A 1O3NA 3CS7A 4AORA 4NSYA 1EKBB 4NSVA 1C5VA 2ODYB 2FOFA 3VXEH 3RC5A 3W95A 2FLBH 1K1OA 2ZPSA 4JMYA 1FY8E 1HAYB 3PMBB 4DGJA 3M35A 2ZCHP 4NIVA 1OSSA 1A0JA 1MKXH 4OS1A 4RSPA 3NWUA 1GI7B 2XBXA 3SNBA 4B2AA 2EI6A 4U2WA 2J34A 4Y7BA 1MZDA 1J16A 1LO6A 3DFLA 1EATA 2GDEH 1PPEE 3SHAH 5J4QA 1ORFA 4GHTA 3ZZAA 2ZEBA 1ETSH 2A32A 2EEKA 1BBRH 1XMNB 3GCTG 3MH7A 5A2MH 2R2MB 1TOCB 2BLVA 3U1IB 2OQ5A 1JOUB 1G3CA 1TBQH 3WY8A 1AGJA 1Z71A 1ZHMA 1Z1IA 3M3VA 3LGVA 1Q3XA 1G3EA 2Z9LA 2B5TB 1Z8JB 2QN5T 3ZVDA 1BHXF 5I46H 3MNBA 5EQSA 2EI7A 2A4GA 1Q2WA 1P2IA 3E6PH 1O38A 1EJMA 3KQDA 3M7UA 1C2MA 4FUEA 2CXVA 2ESTE 4YOJA 2D26C 2ALVA 3KN2A 1V2NT 4JK5A 1NO9H 3MU4A 1W7GH 1FONA 4AGJA 2Y5GA 1ZOMA 1ABIH 1UTKA 4YO9A 2G5VA 5F8XA 3DD2H 1JBUH 1LVBA 3L3TA 3AAUA 1BMLA 1FJSA 3KHVA 1BCUH 4Y8XA 3A85A 1GI2A 1UVOA 4MPXA 4LXBH 1NN6A 4A5TS 3GOVB 4B2CA 1P2KA 3GCHC 1GWAA 1T8MA 1PQ5A 3VEQB 3RXSA 2GZ7A 2A2XH 3ZVGA 1N8OC 1AI8H 1YPHE 2Y5HA 3SNAA 5H4IB 5DO4H 2ZIQH 2A1DB 1MCVA 1ANEA 1C5PA 3EDXB 1P0SH 4ZKNU 2F9UA 3NKKA 1C4V2 5EW2H 3C27B 1LHDH 4Q80A 1ID5H 2H1UA 2O8TA 4E06H 2BTCE 3GYMA 3BTTE 1TGSZ 1FI8A 1OYTH 1NFUA 4Y7AA 3SNDA 3SI3H 5DGJA 5EXMA 3LC5A 4MTBA 1DDJA 1LMWB 4BTIB 3SO3A 4CRGA 1GGDC 2V35A 1F2SE 5AHGH 1JRTA 5BPEA 1FN6A 1AFQB 1O36A 2O8WA 2BXUH 2NU2E 1DITH 1GL0E 2QC2A 1P2OA 1UTMA 1ZPCA 1QHRB 1O3DA 1TGTA 5DK1A 2C8ZB 1KIGH 2OBOA 5HXFA 2V3OH 1C1PA 2PKSB 2WYGA 1C5QA 4ZROA 3QUMP 2PFEA 2GT8A 3PMJA 2ZU5A 3KNXA 4VGCB 3U1JB 2NU4E 3BIUH 3MMGA 3LU9B 3M36A 1KLIH 2A2QH 1QQ4A 2Q6DA 5LPEA 4X6MA 1TA6A 1O3CA 1KTSB 2ZU3A 3RXFA 3A7ZA 1YPEH 2SFAA 1KXFA 4MNXA 2R3YA 1SQTA 3UFAA 1BMAA 1TIOA 5HM2A 1HAZB 4IN1A 3BG4B 1VCWA 1V2TT 3T5FH 4O3TA 3PLKA 2ZDKA 1LQEA 1AN1E 1F92A 5A8XA 2Y82A 2ODQA 2QA9E 3RXBA 1K2I1 1Y5BT 2XC5A 4NFFA 1F0TA 1BMMH 1P12E 3GDVA 4NIWA 3PWBA 1GVKB 1TLDA 3RXTA 1JRSA 2ZDAH 2VB0A 2NWNA 2YOLA 1O5AB 5DJ7A 4CBOA 3TGJE 2VWLA 1IAUA 1ZTJA 1Z8GA 3GY5A 1AD8H 1NRSH 1FLEE 3IG6B 3ATKA 2XC0A 3RC6A 2OC1A 4K3JA 4JZEH 1MKXK 3VB6A 1BOQA 2WPIS 1GI1A 2BDBA 5G4BA 4H6TA 5E0GA 2ALPA 4AOQA 1N6XA 1W7XH 4WJG2 4CH8B 3SV8A 1ELBA 1V2KT 1LKAA 2ZHWH 1D6WA 2AMPA 1BA8B 3NCLA 3TJUA 3GY6A 4GAWA 4FXGH 1VITF 5A09A 4ZHAA 3NPSA 2GTBA 2BLOA 2PGQB 2Z3EA 5E8EH 3EAJA 5C1XA 1KLJH 3T29A 4ASHA 3SJOA 2D8WA 4ZUHA 3FZZA 1A2CH 1O3BA 3Q3KA 5JB9S 3SN8A 4Y8ZA 3TJVA 1HAVB 1CGJE 4ISIH 4OS6A 4TY6A 1HCGA 1SLUB 2BD3A 2Z6BD 4O03A 1O2OA 3TNSA 2FZZA 1IQEA 1Z6JH 1V2LT 2O8LA 2BY5X 1SGEE 5F8TA 4H6SB 4GCHF 5GCHF 1P02A 4HTCH 1GJ7B 3ATIA 1J15A 1GBJA 2BDHA 4CREA 1HUTH 1AZZA 4FU7A 1QRZA 4AFZA 4E7RG 2VIPA 7ESTE 1BUIA 1EAXA 4NCYA 3SUGA 2UWLA 1VGCC 2QF0A 4ISLA 2NU1E 5IDKA 1S85A 3TK5A 2GVFA 3LKWA 2W5EA 3SU6A 3F9FA 1ELFA 1P04A 3OX7U 3UQOA 2BX4A 2ZPQA 1FMGA 3ZVCA 1K1JA 2ULLA 1WTHD 4J1YA 2OC8A 4O97A 1NRNH 4K8YA 3F9GA 4X1NU 2UUFB 3ZZCA 2J38A 1DPOA 1TNGA 1FAXA 1KXEA 1GI4A 3Q3XA 1AIXH 2SNVA 3KQBA 1IQJA 2RA0A 2BX3A 1CSOE 4TY7A 4SGAE 2QXJA 3A81A 2ANMH 5TCAA 3MU1A 2GDDA 1H9IE 3ELAH 2ZZUH 4YZUA 4HGCA 2GV7A 5LPFA 4MNWA 4D7GA 1ELEE 1GJDB 1AHTH 1GBFA 3GY4A 3URDA 1HRTH 1QB6A 1W13U 1MQ6A 2LPRA 1QFKH 1MCTA 1PYTC 1VR1H 5GWZA 1D3QB 5C1YA 1VITG 3M5LA 5L2YH 1UVSH 1MTNC 1A5GH 1GHWH 2QV1A 3S9CA 3HKIB 1SGNE 2A31A 4Y6DA 1O3FA 2ZCLP 3AW1A 3H7TA 1AUTC 3PMAB 3P8FA 2Y6TA 1C1NA 1YP9A 2C93B 3QX5H 1EXFA 2BD2A 1EASA 2ZQ1A 2HALA 4HI3A 3SV9A 1A46H 4X2XA 1NESE 2GP9B 1TALA 1HAVA 1NRPH 1C5NH 2VVCA 1C1RA 4GCHG 5GCHG 3JZ2B 3BTHE 3ZV8A 3TH3H 2B7DH 1HXFH 2AGEX 1GHAF 1DWDH 1QGFA 3I77A 2FIRH 4CBNA 2FX4A 3SUDA 1MTNB 4OGYA 1TQ7B 5HM9A 1TB6H 2BD8A 1SL3A 2JH6D 2C3SA 1CBWC 1KY9A 1Y59T 2PSYA 1C9PA 1O2WA 3DA9B 3TIUA 2GZ8A 1C1OA 1C5WB 4FUBA 4B75A 4FUFA 3ZV9A 1TNLA 2QF3A 1UCYH 1RTLA 1ABJH 4DOQA 1GI6A 2V6NA 1BTUA 3SJ9A 3UTUH 5EQQA 3PV4A 2CN0H 3OSYA 2CMYA 1DOJA 1CA0C 1SQAA 1YYY1 1O2PA 1AUJA 2GKVE 1A3EH 1G9IE 1EAWA 3L33A 2J94A 2P93A 1LHEH 1ZMLA 8KME2 3KF2A 1B5GH 1GBMA 2PKAB 3FANA 1QY6A 1O2IA 1GDNA 2AIPA 1J17T 1ZSJA 1OWEA 2QGRA 1P01A 2SGPE 2OP9A 3UOUA 2FESH 3VGCB 2XWBI 1AU8A 1W3CA 2ZFTA 4YLUA 3O8CA 1C2LA 1O3OA 3RXLA 1BZXE 1SG8B 1TONA 4U01A 1RGQA 4U32A 3ATLA 3NK8A 4FUHA 4AZ2B 2P3TB 4I8JA 1V2VT 3QK1A 5TCCA 4E05H 1IQHA 4E7NA 3ATWA 1O3AA 1O0DH 3EGKH 1LVOA 6LPRA 2VVVA 1ZJDA 4GVUA 4WXVA 5B6OA 3TPIZ 3FP6E 2Z3CA 1AZ8A 1SGRE 4IBLH 1Z8RA 2P3UB 3SV6A 2H9HA 2OLGA 1QA7A 2FOAA 3N7OA 2F9PA 1AO5A 2HNTC 3UR6A 1EJAA 4WWYA 8LPRA 1DWEH 4KTUA 3RM0H 1BBRE 2J95A 2KAIB 3B9FH 2FM2A 1THPB 4M7GA 2BD9A 2W7UA 3RXCA 1XUKA 2BHGA 4MNVA 3QTVH 5EOKA 3Q00A 2AS9A 2QYIA 1A3BH 1UTOA 1C2GA 1WSSH 6CHAB 1IQNA 2HOBA 3I29A 1ELTA 1BRBE 2WV5A 4JYTA 1GHAG 1C1TA 2O8MA 1BTYA 2VWNA 1BB0B 3TK9A 1D3PB 2HLCA 1MH0A 3ITIA 3SJ8A 1TPOA 1O5CB 1OX1A 3S9AA 2LNCA 2BY8X 2AMDA 2YNAA 3M5NA 1C5MD 1QRXA 4X8UH 4KTCA 1L1GA 1TAWA 2ZTXA 5DP3A 4DVAU 3LPRA 3BG8A 1Y3UA 1Y8TA 1BIOA 1PPZA 5GXPA 3A7YA 1CHOF 3SBKA 4A1TA 1EPTC 1MU6B 3EQ0H 1HAHH 3B8JA 4YLQH 4UE7H 1MQ5A 2FI5E 4WMDA 2HGTH 1GBEA 2D1JA 1V6DA 3PLPA 3MFJA 3LGTA 5ESTE 1W0YH 4FUDA 1C2DA 3ODDA 4IC5A 1TGNA 3EYDA 4X6PA 1QCPA 3QGJA 2PKAA 3BEUA 4AYYB 1ZRBA 1DANH 2QXIA 1IQGA 1V2WT 4IGDA 5F03A 2VIWA 2Y81A 5C5NA 3SU1A 1TBRH 1S84A 3EA9A 3D49H 3O8DA 1AQ7A 1C9TA 1SVPA 1H8DH 4UFDH 2ZI2H 4R0IA 1HXEH 1CE5A 1LTOA 4YTAA 3MU5A 4X8TH 4K2YA 1GCTC 4MPWA 1EZXC 5GJ4B 4F49A 1TMBH 5EW1H 2BY9X 1DICA 1S6HA 2CGAA 1G3DA 4RKJB 1O2JA 3UR9A 4JZDH 3TH4H 3ZZ3A 3M3TA 4CRAA 1V2MT 4NA7A 1B7XB 2GX4A 1UCYK 1TPSA 1ZHRA 3MOCA 1NS3A 3P70B 2VIDA 4NIYA 2PWXA 1MBMA 1OP2A 1BTXA 1P3CA 1KXDA 5A8YA 4JZ1A 1BITA 1OWJA 2KAIA 1ARBA 4ZXYH 1SGFG 2BVRH 1IQKA 1C5OH 1QJ6B 1SLWB 1TMUH 1E36B 3STJA 1RS0A 2BY7X 1DT2A 9LPRA 3RXJA 3SGQE 1TABE 2WPKS 1SGYE 1UO6A 2ZP0H 3URCA 4AN7A 4H4FA 1ZGIA 1O2ZA 2I6SA 1UVPA 1LKBA 4B73A 1QQUA 1NFXA 2AERH 4FUJA 4NZQA 2OXSA 4UEHH 1DXPA 4GLYA 1YF4A 1L2EA 3RU4E 2G55A 2PUQH 5L2ZH 4INKA 2UWPA 1BT7A 1EOJA 3E1XB 1CHOG 2OBQA 1CA8B 4O9VA 2Y5FA 2BVSH 4DY7B 3MH5A 3E90B 4KTSA 1HNEE 1XXFA 3V7TA 1HLTH 2ZC9H 2GMTC 2DUCA 5CMXH 3A80A 3EA7A 3ZZ5A 2ZG0H 3T26A 3PM3A 2ZGCA 4K1TA 4NGAH 4MG3A 1ZZZA 1OP8A 1TYNA 2F9VA 1GJAB 1GMCF 1AMHA 5EPNA 2BDIA 2K1QA 1RXPA 1D3TB 4AFUA 2B8OH 1AB9C 3QWCH 4AB8A 8ESTE 1N1LA 2OD3B 3GY7A 2FODA 1EUFA 4JCNA 1GJ8B 1QR3E 1HDTH 1SFQB 1GBDA 2SGQE 3BTFE 1OYQA 1O2YA 1V2PT 3SOSA 2GMTB 5LH8A 3R3GB 1XM1A 4A1XA 1UVUH 3GCHB 1O35A 1Z7KA 3RMMH 1OWKA 1N8OB 2XBYA 3P8OA 1WYKA 1A1RA 2XW9A 4TWWA 3GDUA 1L1JA 1TNKA 2FOBA 3ZZ9A 1LQDB 3SZNA 3SJKA 4LZ1H 3CS0A 3UIRA 4A1VA 2Y80A 1K1NA 1UVTH 5JBTA 1IQMA 2WPJS 3SW2B 2QY0B 4BXSA 1QB9A 2YNBA 3LT3A 4WH8A 1DSTA 1INCA 1PPHE 5L30H 2OC0A 2P59A 4D9QA 2Q6GA 2FOMB 3T28A 1NPMA 4Q7ZA 2HWLB 2ZFQH 1UTLM 2BQ7B 2CF8H 2VJ1A 1NU7B 1GGDB 3BEIB 4TYDA 1XVOA 2VVUA 3SORA 1T4UH 1P9SA 1XKAC 5CHAC 6ESTA 2Z9IA 1NTPA 4ZAEA 2ZU1A 1F0UA 5C1UA 3LGIA 3QZRA 1H9LB 1A4WH 1CGHA 1UK2A 4Y0YE 6GCHF 4WMFA 1H9HE 2Z9KA 1CHGA 2TIOA 3ZZ4A 4X8VH 4B2BA 1ETRH 1YLDA 1ZJKA 5EXLA 2HVXA 1K1MA 3TJNA 1YLCA 2XRCA 2STAE 4IMZA 4A7IB 4ABAA 3ZYEA 3C1KA 1C2KA 2THFB 1YPJH 1GBKA 1PPCE 1MAXA 3HK3B 2F3CE 3ENSB 4B74A 2J4IA 5GPIB 1GHBF 4K1EA 3CP7A 1TOMH 1GBCA 1BBRK 2ZFFH 1O2LA 1GMCG 4ZKOU 5EGMA 1F0RA 3MI4A 3SV2H 1E34B 1YM0A 1IHSH 3A7XA 4QT8C 3UOPA 4X6OA 2AEIH 4D8NA 3E0PB 4GHQA 3RP2A 3RU4D 1HYLA 1C1WH 2ZHDA 4X1PU 1AVXA 1E38B 3HATH 4YESB 1C2FA 1O2KA 1BHXB 1B0FA 3RC4A 4GSOA 2IOTA 8GCHF 1OWIA 5AVDA 3ZZ7A 4X2VA 1ZLRA 4B76A 2Y7ZA 1G36A 4D76A 1XUJA 3UNRA 4INHA 1W12U 1ZPZA 1O2RA 1Y5AT 1VCQA 4NA9H 3RXMA 1NU9A 5J4SA 1PPFE 1MKWH 1XUHA 2I6QA 1XKBC 3FVFB 4TPIZ 4BAKB 3KL6A 3A87A 2FXRA 1LVYA 1FPHH 1SLXB 4IN2A 1GI0A 1C2EA 1D9IA 4UONA 4UFEH 4JK6A 4BAHB 3LDXH 4D9RA 4TWYA 1LPZB 3M5MA 4FU8A 4OGXA 4HZHA 1FIWA 1UCYE 1BTWA 4AG1A 7GCHF 3MWIU 4Y8YA 3GICB 5A8ZA 2ZHFH 2OQUA 2ZGBH 2PSXA 2SGEE 4D7FA 2ANKH 4YT7H 2OINA 1GBTA 1WCZA 2B0FA 2BLWA 3KGPA 3P92A 1LPKB 1HIAB 2AGIX 2R0LA 3DFJA 1A61H 1O5EH 1VGCB 1XVMA 4Z6AH 2SGDE 3ZVBA 1ZGVA 1ZR0A 6GCHG 2VGCC 3TLOA 1EZQA 2FYQA 1RRKA 3S7HB 4OS2A 1P03A 4MVNA 1D6RA 1GL1A 4MPUA 1QB1A 4AYVB 1DY8A 2TRMA 2Z9GA 3L6PA 1O2UA 3B23B 1GDQA 3VFEA 1P3EA 2ZFRH 1C2JA 1OKXA 2UWOA 2O8UA 2WYJA 1NY22 1L1NA 1O5BB 1VZQH 1ZRKA 1Y3YA 1OS8A 1P8VC 3KEEA 3LC3A 4OS4A 1QRWA 1GHBG 1QBVH 1JIRA 1P05A 2QXHA 1FY4A 2Z94A 5EQRA 1N6YA 4ZMAH 3A8AA 1V2UT 5E0JA 1CT4E 1KYNA 1Z6EA 1THSH 1P11E 2RA3A 2G4TA 1EQ9A 4Q2KA 1PQ8A 4NWKA 3QGNB 2VGCB 1HGTH 3A84A 1SGDE 3ATMA 3LH3A 1GHVH 3SGAE 1EZUC 5FAHA 2SGFE 4LOYH 1RTFB 2FOCA 5JBBS 2FP7B 1SI5H 1IHTH 1C5RA 1NROH 1O2XA 1KDQB 5GIBA 4XOJA 5F8ZA 3E0NB 1EB1H 9ESTA 1E35B 3OY6U 1TX6A 3A89A 1HAXB 1JXPA 4CRCA 1QL9A 1LHGH 3QN7A 1DVAH 8GCHG 2FTLE 1AY6H 1SHYA 1BDAA 1O2SA 1WU1A 4B1TA 1P9UA 4K1SA 2EA3A 2HNTE 5C67A 1ELCA 1G32B 4ESTE 5IYTA 3UNQA 2Q1JA 4NZLA 1RIWC 3S7KB 4ZXXH 1C4Y2 3UWJH 1TA2A 3LONA 1RTKA 1ZTLA 4GUXA 1C5YB 2ZWLH 3JZ1B 5DP7A 2CHAC 4XBCA 2HPPH 1ESAA 4CHAC 1DY9A 5FPSA 4X8SH 3LGUA 5ESBA 3PWCA 1GBHA 3QO6A 4DIHH 4JYVH 1HV7A 1V2JT 2W26A 7GCHG 1YKTA 3QZQA 2GCHF 3D62A 4K69A 4I32A 2H5DA 2FYRA 4MNYA 2P16A 4BOHA 1NRRH 2VWOA 2SNWA 3HGPA 5E2OA 3VB3A 5DP9A 2R2WU 5K7RA 1CBWB 1DM4B 4ABJA 2H9EH 2SGAA 1RIWB 3MTYA 1WBGB 2XBVA 1HIAA 1FQ3A 4I8HA 1WQSA 5F6MA 1TMTH 1BJUA 3SU0A 2QAAA 3M61U 4BNRA 2ZQ2A 1GG6C 3E8LA 1O2QA 2J92A 1G2MA 3AASA 3STIA 3E3TA 2CJIA 5FPYA 1XX9A 1F7ZA 1CA0B 2W7SA 5A0CA 2P95A 4FUGA 3GDSA 2FX6A 2ILNA 3RXVA 1CVWH 1IQLA 1DUAA 2A0QB 1AE8H 1D4PB 3A88A 5AF9H 1SOTA 4DT7B 2BY6X 1MKWK 1IOEA 3GY3A 4I8LA 3M5OA 4X1QU 1O30A 1LHFH 1YCPH 1LDTT 1QIXB 1SFIA 3ODFA 1PJPA 3LH1A 1C5UA 2BZ6H 2VIVA 1EZSC 4TPYA 1T31A 3T62A 1P06A 1AWHB 1HJ9A 3ZZDA 3OTJE 1C2HA 4ZKSU 1T4VH 1A5IA 2VIOA 3G01A 1QURH 3VB4A 4ABFA 3TU7H 3F6UH 4FVBA 1C5SA 1SQOA 4ABHA 1C1VH 1KDQA 1UMAH 1RD3B 1CO7E 1ELGA 1BTPA 4MDSA 4NG9H 2FTMA 1ANDA 3F9HA 3U8RH 1K9OE 1V2ST 4IC6A 3QLPH 3LOXA 4FUCA 4KP0A 1W0ZU 1TNHA 2WPLS 5C3NA 2TGAA 1A0HB 1O5FH 2A7CA 5FCRA 1O3EA 3GCNA 2BLQA 2P94A 1OWHA 3ZVEA 2FLRH 1PPBH 1B0EA 1X7AC 4CR5A 1C5ZB 1L4DA 2ZDVH 4YOIA 4X2WA 3BTKE 3GY2A 3O8BA 5C20A 2BMGB 2R3UA 2UUYA 2RDLA 3BIVH 2FO9A 3A7VA 3SNCA 3U9AH 1P09A 2ZGXH 2VH0A 2GCHG 3MNCA 1SOZA 3MO9A 3SNEA 5HYOA 5FCKA 1ZHPA 2ZNKH 3M7TA 2B9LA 3W94A 1SGIB 4K5ZA 2GZ9A 3V13A 1SSXA 3ESTA 3MYWA 4BXWA 1Z8IB 2ZTZA 3PLBA 1Y3VA 1TNJA 2TBSA 1JWTA 2G52A 2FI4E 2A7JA 4JZIA 1UJ1A 1O3IA 2BDYA 2FOGA 2ZU4A 3AAVA 4I8KA 1ESBA 1O33A 1SGPE 4NFEA 1MMJN 3V0XA 4NWLA 1ACBE 1GMHF 1EPTB 1DS2E 1NT1A 1XXDA 4I33A 2TGPZ 1C2IA 1SC8U 1GI5A 1H1BA 2PHBA 3HPTB 3MO3A 4UD9H 3LGWA 2M5TA 2WUBA 4NIXA 5DG6A 1ZYOA 1RJXB 1CQQA 1VJAU 2C8XB 3SGBE 5JDUB 1V2QT 3ZZ6A 2F83A 5PTPA 1IQIA 1GCDA 5JPMH 4AX9H 1FV9A 4OS5A 2ZO3H 1IQFA 1SMFE 1DXWA 3GCOA 1GJCB 3MNSA 1O5DH 1L0ZA 1O2GH 1O2VA 1P2JA 5EPYA 2IJOB 2WPMS 1O3MA 1GJ5H 4FU9A 5T3HA 2ZDMA 3UREA 4LZ4B 1GCTB 3D65E 2VIQA 5EG4A 2ZGJA 4AGKA 5T6DA 1TX8A 2XWAA 2JETC 1DLKB 1ETTH 1S0RA 1K1IA 2GV6A 1BTZA 2STBE 7LPRA 1P10A 4OS7A 2BXTH 5LPRA 1O3PB 4FVDA 1XUIA 1SGQE 2IPHA 3MU8A 2C4FH 2ZHEH 1DUEA 1GI8B 1LHCH 1YPKH 3IWMA 2JH5D 1O34A 1YC0A 4XBBA 5DP6A 1VJ9U 1MTUA 1THRH 3MU0A 3SU4A 2G4UA 1ESTA 1EX3A 2ZU2A 1GBBA 3K2UA 3RXPA 3RXHA 1W2KH 4WVPE 3SJIA 1T8OA 2UUKB 4I7YH 1O2TA 3M7QA 4XE4A 1T32A 4Y79A 3RXOA 2WPHS 1W14U 3RM2H 2IN2A 2OCVB 3RXKA 4YT6H 1NC6A 3KIDU 1UTQA 1WV7H 4MPVA 2F9NA 1NM6A 2JETB 5A0AE 5E2PA 1HPGA 1MAYA 3BN9A 3BSQA 2DE9A 3FZDA 1C5XB 1G2LA 1V3XA 2TGDA 1YCPK 3E16B 1G30B 4RKOB 4KKDA 4MQAA 4H42U 2HRVA 2PTNA 3LJJA 3P6ZB 4Y71A 1GHXH 2PV9B 1FIZA 1TNIA 1JIMA 3DT0H 3S0NA 1KSNA 2PR3A 1NRQH 1S6FA 2C8YB 1UHBB 2VH6A 1YBWA 1UTPA 1AFQC 1GMHG 1C5LH
chains in the Genus database with same CATH superfamily
2R0KA 4YM9A 1SBWA 2F9OA 3A8BA 5A0BA 2PKSC 5JBAS 2G5NA 1ZPBA 4WY3A 1EPTA 1C1MA 1DFPA 3Q3YA 1EB2A 4DCDA 1MZAA 3M3SA 3A7TA 4VGCC 2Z7FE 3GYLB 4X6NA 1ZTKA 3P8NA 4I8GA 5AFYH 4AFQA 5FBIA 3SV7A 1GBLA 4YOGA 1Y3WA 1AB9B 1ZSKA 2GCTC 1TE0A 1CU1A 2AYWA 4SGBE 2QIQA 2G8TA 4Y10E 3VPKA 2NU3E 2ZFPH 3BG4C 1MD8A 2VINA 1TRNA 1MTVA 1O2HA 1TPAE 4X2YA 2OTVA 1SLVB 4PROA 4AG2A 5JYIA 5JBCS 1H4WA 3RXIA 5EJ1A 1QJ7B 2BD4A 5TJXA 3NZIA 1BRUP 1F5RA 2BQ6B 1K1LA 2BYAX 5HIZA 3SU5A 1QTFA 2C90B 1QNJA 2FMJA 1EJNA 1E0FD 2BZAA 1ANBA 2ZFSA 5KGOA 1FY5A 3MO6A 4Y11E 3V3MA 1MU8B 2UUJB 1NFWA 1CT2E 2F9BH 5JB8S 2BDAA 1O2NA 4CRFA 2GCTB 1J8AA 1TFXA 1TRYA 3TVJB 5CHBA 4ZHLU 3S69A 3OAAD 2EC9H 5HMAA 2ANWA 4AB9A 2Z9JA 4ABGA 3MNXA 1SR5C 1C1UH 3SUEA 1SGTA 3RXEA 2FEQH 2GT7A 1ZSLA 2P3FH 1FN8A 2JKHA 4B6FA 3T25A 3R0FA 3A8CA 1S5SA 4KGAA 2ZDLA 3PTBA 4ASUD 1TX7A 4XBDA 2QE7D 1YPHC 2AFQB 4LK4A 1C5TA 1Q31A 3OU0A 5CHAB 4YXWD 3U8TH 4Z0KA 1HAGE 2A45B 4X1RU 2A5IA 1VCPA 2J97A 3TH2H 2BB4A 3KCGH 5LGOA 2FI3E 4CR9A 2ODPA 3BEFB 3TK6A 3QDZB 4WXIA 1S81A 2CV3A 7KMEH 1AFEH 5FX6A 1M9UA 1MABB 3RXGA 3Q77A 3VB7A 2G51A 1K28D 5C5OA 1G37A 1UHBA 5FXLA 2A4RA 3FP8E 1AVGH 2V0BA 4KELA 1AWFH 1O3LA 1C4U2 3FFGA 1T8LA 1AKSB 1SGFA 5ABWA 2WV4A 1P2QA 1OPHB 5EXNA 3SUFA 2A7HA 2GGVB 2HPQH 1T7CA 1UK3A 5DPAA 2XC4A 2VBCA 1MBQA 1HJAC 1TQ0B 1Y5UT 4ISOA 4NA8A 1Y3XA 1P2MA 1WTGH 2OUAA 3RXDA 2Q6FA 2ZHQH 1E1QD 3F68H 5E0HA 3H5CB 3UWIA 3MH6A 2AGGX 2Y7XA 3K65B 3OEHD 4BAOB 2Z3DA 1MTWA 1TRMA 4UFFH 4K8BA 4JZFH 5GDSH 4IS5A 3SQEE 1SPJA 2G81E 5EU8A 1TGCA 3KQCA 1S0QA 1ZMNA 3A8DA 1KXAA 1KXCA 2CF9H 2ZA5A 3PB1E 3ZZ8A 5CE1A 2DE8A 3T2NA 1AE5A 4F4OC 1O2MA 1BTHH 4UFGH 1MD7A 1WQVH 2NU0E 1HJAB 3NXPA 3MH4A 5FPTA 4BTUB 2H2ZA 3RU4T 2PTCE 2XYAA 4CRBA 5FHTA 1WOFA 2EI8A 4CH2B 2G00A 1EAIA 1GPZA 5GNDA 3LIWA 1EAUA 3GISB 3P8GA 1CT0E 3FP7E 1DLEA 1NFYA 3RXRA 1QZ8A 3CENA 2P8OC 3AVZA 1FY1A 5SGAE 1HJ8A 2ZCKP 2KCPA 2ZECA 4A92A 1O3HA 3RXQA 1K22H 4Y76A 2PLXA 3ZVAA 3ZZBA 1YGCH 2FWWA 1ELDE 4X0WU 5T6FA 4Q63A 5HIYA 2JH0D 3K9XB 3HGNA 1PFXC 1E79D 1QA0A 1P57B 2HNTF 4HFPB 3A7WA 2KFWA 2V3HH 4U30A 2FPZA 3VG8A 2A5AA 3SHCH 3UQVA 2C8WB 2BVXH 2J2UA 1O37A 4XDEA 2OC7A 3GY8A 2VU8E 3S9BA 2FOHA 1BQYA 5BRRE 4K60A 4R8TB 2P8OB 1BRCE 2XNIA 2FS9A 1G3BA 1TPPA 3Q76A 1XUGA 5FX5A 1K21H 1GMDF 1GBIA 1YPMH 1DSUA 4WH6A 3TJOA 4WF8A 1S83A 3HKJB 3I78A 3V12A 4ZH8A 1GDUA 1SGCA 2W3KA 1ARCA 2ZPRA 3OY5U 2BQWB 2BDCA 1L4ZA 1KLTA 1W10U 3LGYA 1Z1JA 2D2DA 4IW4E 3SI4H 2O9QA 1GBAA 3T27A 4ABDA 3RMNH 1C1QA 1FUJA 1GHZA 1A5HA 5DKMA 1HAIH 3BTEE 5ETXA 3RDZA 1SB1H 2R9PA 5AFZH 1D3DB 2GD4B 1O3GA 1AKSA 1QL8A 2BD5A 4BAQB 1JMOH 1W8BH 3TGKE 1V2RT 3MHWU 3EE0B 1EOLA 4DG4A 2WUCA 2L74A 1MTSA 3RLYH 1HAPH 2AIQA 2W3IA 5DP8A 3EA8A 1VITH 2FDAA 2PGBB 3H7OA 4BTTB 3RMOH 3E91A 1UTJA 4XSKU 2VNTA 3NUMA 1H8ED 2BM2A 3F1SB 2H9TH 5T6GA 3VGCC 1MUEB 1K1PA 2RDEA 1PYTD 1J9CH 4BANB 1GI9B 1C1SA 4GPGA 2ANYA 1LVMA 3RUOA 3SU3A 3FAOA 2FS8A 1GI3A 2XCNA 5C94A 3PO1C 4BAMB 2H6MA 3DHKH 2AMQA 1OWDA 1TGBA 2ASUB 2PW8H 4INLA 2TGTA 1UTNA 4WMEA 1GJBB 1QBNA 2XTTB 2BOHB 3RMLH 2LP6A 3ZYDA 2CHAB 3A83A 3VXFH 1HB0B 4CHAB 3U98H 3U69H 4RT1A 4ABBA 1O32A 1PPGE 4XFQA 1FDPA 1OXGA 2A4QA 1HAOH 4CRDA 1O3KA 3UNSA 3UUZA 1UK4A 1U6QA 1NZQH 3DUXH 2ZKSA 3TNTA 4ZHMU 4UDWH 1QL7A 3BV9B 1YPLH 2XXLA 1GJ9B 3BTWE 4ABIA 4DURA 3SU2A 3AK5A 1KTTB 1WAYB 3ZVFA 4X1SU 4ABEA 3P95A 1K0HA 3PO1B 3LJOA 1BMNH 4IMQA 2A5KA 3BF6H 3QTOH 4Y0ZE 3BTQE 3PYHA 1A7SA 3U8OH 3F9EA 4Q7YA 4AFSA 1H8IH 1FPCH 4ISNA 1EP5A 1TWXB 6CHAC 1LCYA 3IITA 1PQ7A 2BOKA 3PROA 1GMDG 3K6YA 1GG6B 1KXBA 1P2NA 1DWCH 4B71A 3TITA 4J2YB 3VB5A 5EODA 3WWBA 4ZKRU 1FZZA 1GJ6A 1WUNH 3RXUA 3OFND 2FOEA 1O3JA 3GCTF 2PUXB 4ISHH 5L6NH 4RN6A 1OP0A 3A82A 1W11U 3TGIE 2WINI 3D23A 2A4OA 1OOKB 1ELVA 2RCEA 1XUFA 2BDGA 3AW0A 3KQEA 1GVLA 4I31A 1F0SA 3RXAA 1HFDA 1QJ1B 3PTNA 4JYUH 1SHHB 4THNH 1FNIA 5I25A 1HBTH 4O3UA 5K0HA 1W0JD 1FXYA 2QCYA 3SQHE 1S82A 3K6ZA 1O39A 1FAKH 5FBEA 2ZTYA 2ZF0H 3MQKC 1F5LA 1PQAA 1F5KU 1V2OT 3SYJA 4DJZB 2W6JD 1ELAA 2ZDNA 1GHYH 1RFNA 3UY9A 2XCFA 1EP6A 3UPEA 1ZMJA 1YPGH 2H5CA 1DWBH 3A86A 3OYPA 3PMHB 3RLWH 1CGIE 3BTME 4Q7XA 1DE7H 5DP4A 1E37B 1TBZH 5DP5A 5HGGA 5C2ZA 4DIIH 2KZ4A 3UB0A 2VWMA 3BTDE 1O5GH 2XBWA 2V7QD 4FUIA 3O8RA 2BD7A 1GJ4H 1KMHB 1AVWA 2TPIZ 3HK6B 1J14A 5HKKD 1BJVA 2RG3A 1YCPM 2F91A 2ZGHA 1LPGB 3P17H 1O31A 2J9NA 2LELA 1BRAA 4MLFB 1T8NA 1GVZA 2AH4X 2QXGA 3FOAA 4A6LA 1A0LA 1ANCA 1DX5M 3M37A 4XD7D 4DW2U 3BTGE 1QBOA 1FY3A 1O3NA 3CS7A 4AORA 4NSYA 1EKBB 4NSVA 5EIYA 1C5VA 2ODYB 2FOFA 3VXEH 3RC5A 3W95A 2FLBH 1K1OA 2ZPSA 4JMYA 1FY8E 1HAYB 3PMBB 4DGJA 3M35A 2ZCHP 4NIVA 1OSSA 1A0JA 1MKXH 4OS1A 4RSPA 2WPDD 3NWUA 1GI7B 2XBXA 3SNBA 4B2AA 2EI6A 4U2WA 2J34A 3CNRA 4Y7BA 1MZDA 1J16A 1LO6A 3DFLA 1EATA 4I86A 2GDEH 1PPEE 3SHAH 5J4QA 1ORFA 4GHTA 3ZZAA 2RFKC 2ZEBA 1ETSH 2A32A 2EEKA 1BBRH 1XMNB 3GCTG 3MH7A 5A2MH 2R2MB 1TOCB 2BLVA 3U1IB 2OQ5A 1JOUB 3KQ5A 1G3CA 1TBQH 3WY8A 1AGJA 1Z71A 1ZHMA 1Z1IA 3M3VA 3LGVA 1Q3XA 1G3EA 2KX4A 2Z9LA 2B5TB 1Z8JB 2QN5T 3ZVDA 1BHXF 4HG6A 4F48B 5I46H 2GJGA 3MNBA 5EQSA 2EI7A 2A4GA 1Q2WA 1P2IA 3E6PH 1O38A 1EJMA 3NRLA 3KQDA 3M7UA 1C2MA 4FUEA 2CXVA 2ESTE 4YOJA 2D26C 2ALVA 3KN2A 1V2NT 4JK5A 1NO9H 3MU4A 1W7GH 1FONA 4AGJA 2Y5GA 1ZOMA 1ABIH 1UTKA 4YO9A 2G5VA 5F8XA 3DD2H 1JBUH 1LVBA 3L3TA 3AAUA 1BMLA 1FJSA 3KHVA 2YMSC 1BCUH 4Y8XA 3A85A 1GI2A 1UVOA 4MPXA 4LXBH 1NN6A 4A5TS 3GOVB 4B2CA 1P2KA 3GCHC 1GWAA 1T8MA 2J5UA 1PQ5A 3VEQB 3RXSA 2GZ7A 3WW7A 2A2XH 3ZVGA 1N8OC 1AI8H 1YPHE 2Y5HA 3SNAA 5H4IB 5DO4H 2ZIQH 2A1DB 1MCVA 1ANEA 1C5PA 3EDXB 1P0SH 4ZKNU 2F9UA 3NKKA 1C4V2 5EW2H 3KYGA 3C27B 1LHDH 4Q80A 1YY3A 1ID5H 2H1UA 2O8TA 4E06H 2BTCE 2YMSB 3BTTE 3GYMA 1TGSZ 1FI8A 1OYTH 1NFUA 4Y7AA 3SNDA 3SI3H 5DGJA 5EXMA 3EE7A 3LC5A 4MTBA 1DDJA 1LMWB 4BTIB 3SO3A 4CRGA 1GGDC 1W0KD 2V35A 1F2SE 5AHGH 1JRTA 5BPEA 1FN6A 1AFQB 1O36A 2O8WA 2BXUH 2NU2E 1DITH 1GL0E 2QC2A 1P2OA 1UTMA 1ZPCA 1QHRB 1O3DA 1TGTA 5DK1A 2C8ZB 1KIGH 2OBOA 5HXFA 2V3OH 1C1PA 2PKSB 2WYGA 1C5QA 4ZROA 3QUMP 2PFEA 2GT8A 3PMJA 1YWUA 2ZU5A 3KNXA 4VGCB 3U1JB 2NU4E 3BIUH 3MMGA 3LU9B 3M36A 1KLIH 2A2QH 1QQ4A 2Q6DA 5LPEA 4X6MA 1TA6A 3F2HA 1O3CA 1KTSB 2ZU3A 3RXFA 3A7ZA 1YPEH 2SFAA 1KXFA 1SQRA 4MNXA 2R3YA 1SQTA 3UFAA 1BMAA 1TIOA 5HM2A 1HAZB 4IN1A 3BG4B 3H09A 1VCWA 1V2TT 3T5FH 4O3TA 5CDFE 3PLKA 2ZDKA 1LQEA 1AN1E 1F92A 5A8XA 3FKSD 2Y82A 2ODQA 2QA9E 3RXBA 1K2I1 1Y5BT 2XC5A 4NFFA 1F0TA 1YLNA 1BMMH 1P12E 3GDVA 4NIWA 3PWBA 5FL7D 1GVKB 1TLDA 3RXTA 1JRSA 2ZDAH 2VB0A 2NWNA 2YOLA 1O5AB 5DJ7A 4CBOA 3TGJE 2VWLA 1IAUA 1ZTJA 1Z8GA 3GY5A 1AD8H 1NRSH 1FLEE 3IG6B 3ATKA 2XC0A 2KCAA 3DSOA 3RC6A 2OC1A 4K3JA 4JZEH 1MKXK 3VB6A 1BOQA 2WPIS 1GI1A 2BDBA 4ACAA 5G4BA 4H6TA 5E0GA 2ALPA 4AOQA 3PRBA 1N6XA 1W7XH 4WJG2 4CH8B 3SV8A 1ELBA 1V2KT 1LKAA 2ZHWH 1D6WA 2AMPA 1BA8B 3NCLA 3TJUA 3GY6A 4GAWA 1VKYA 3OTPA 4FXGH 1VITF 2EY4C 4ZHAA 3NPSA 5A09A 2GTBA 2BLOA 2PGQB 2Z3EA 5E8EH 3EAJA 5C1XA 1KLJH 3T29A 4ASHA 3SJOA 2D8WA 3GS9A 4ZUHA 5KECA 3FZZA 4DT4A 1A2CH 1O3BA 3Q3KA 5JB9S 3SN8A 4Y8ZA 3TJVA 1HAVB 1CGJE 4ISIH 4OS6A 4TY6A 5EJLA 1HCGA 1SLUB 2BD3A 2Z6BD 4O03A 1O2OA 3TNSA 2FZZA 1IQEA 1Z6JH 1V2LT 2O8LA 2BY5X 1SGEE 5F8TA 3UAIC 4H6SB 4GCHF 5GCHF 1P02A 5C17A 4HTCH 1GJ7B 3ATIA 1J15A 1GBJA 2BDHA 4CREA 1HUTH 1AZZA 4FU7A 1QRZA 4AFZA 4E7RG 2VIPA 7ESTE 1BUIA 1EAXA 4NCYA 3SUGA 2UWLA 1VGCC 2QF0A 4ISLA 2NU1E 5IDKA 1S85A 3TK5A 2GVFA 3LKWA 2W5EA 3SU6A 3F9FA 3PRDA 1ELFA 1P04A 3OX7U 3UQOA 2BX4A 2ZPQA 1FMGA 3ZVCA 1K1JA 2ULLA 1WTHD 4J1YA 2OC8A 4O97A 1NRNH 4K8YA 3F9GA 4X1NU 2UUFB 3ZZCA 2J38A 1DPOA 1TNGA 1FAXA 5C0TA 1KXEA 1GI4A 3Q3XA 1AIXH 2SNVA 3KQBA 1IQJA 2RA0A 2BX3A 1CSOE 2EQNA 4TY7A 4SGAE 2QXJA 3A81A 2ANMH 5TCAA 3MU1A 2GDDA 1H9IE 3ELAH 2ZZUH 4YZUA 4HGCA 2GV7A 5LPFA 4MNWA 4D7GA 1ELEE 1GJDB 1AHTH 1GBFA 3GY4A 3URDA 1HRTH 1QB6A 1W13U 1MQ6A 2LPRA 1QFKH 1H8HD 1MCTA 1PYTC 1VR1H 5GWZA 4FETA 1D3QB 5C1YA 1VITG 3M5LA 5L2YH 1UVSH 4M9FA 1MTNC 1A5GH 2W6ID 1GHWH 2QV1A 3S9CA 3HKIB 1SGNE 2A31A 4Y6DA 1O3FA 2ZCLP 3AW1A 3H7TA 1AUTC 3PMAB 3P8FA 2Y6TA 1C1NA 1YP9A 2C93B 3QX5H 1EXFA 2BD2A 1EASA 2ZQ1A 2HALA 4HI3A 3SV9A 1A46H 4X2XA 1NESE 2GP9B 1TALA 1HAVA 1NRPH 2L6OA 1C5NH 2VVCA 1C1RA 4GCHG 5GCHG 2CK3D 4FOUC 3JZ2B 3BTHE 3ZV8A 3TH3H 2B7DH 1HXFH 2AGEX 1GHAF 1DWDH 1QGFA 3I77A 2FIRH 4CBNA 2FX4A 3SUDA 1MTNB 4OGYA 1TQ7B 5HM9A 1TB6H 2BD8A 1SL3A 2JH6D 2C3SA 1CBWC 1KY9A 1Y59T 2PSYA 1C9PA 1O2WA 3DA9B 3TIUA 2GZ8A 1C1OA 1S6LA 1C5WB 4FUBA 4B75A 4FUFA 3ZV9A 2J98B 1BMFD 1TNLA 2QF3A 1UCYH 1RTLA 1ABJH 4DOQA 1GI6A 2V6NA 1BTUA 2KM0A 3SJ9A 3UTUH 5EQQA 3PV4A 2CN0H 4RT0A 3OSYA 2CMYA 1DOJA 1CA0C 1SQAA 2PP6A 1YYY1 1O2PA 1AUJA 2GKVE 1A3EH 1G9IE 1EAWA 3L33A 2J94A 2P93A 1LHEH 1ZMLA 8KME2 3KF2A 1B5GH 1GBMA 2PKAB 3WWFA 3FANA 1QY6A 1O2IA 1GDNA 2AIPA 1J17T 1ZSJA 1OWEA 2QGRA 1P01A 2SGPE 2OP9A 3UOUA 2FESH 3VGCB 2XWBI 1AU8A 1W3CA 2ZFTA 3OEED 4YLUA 3O8CA 1C2LA 1O3OA 3RXLA 2F43B 1BZXE 1SG8B 1TONA 4U01A 1RGQA 4U32A 3ATLA 3NK8A 4FUHA 4AZ2B 4Q4LA 2P3TB 4I8JA 1V2VT 3QK1A 5TCCA 4E05H 1IQHA 4E7NA 3ATWA 1O3AA 1O0DH 4ACBA 3EGKH 1LVOA 6LPRA 1SKYE 2VVVA 1ZJDA 4GVUA 4WXVA 5B6OA 3TPIZ 3FP6E 2Z3CA 1AZ8A 1SGRE 4IBLH 1Z8RA 2P3UB 3SV6A 2H9HA 2OLGA 1QA7A 2FOAA 3N7OA 2F9PA 1AO5A 2HNTC 3UR6A 1EJAA 4WWYA 8LPRA 1E1RD 1DWEH 4KTUA 3RM0H 1BBRE 2J95A 2KAIB 3B9FH 2FM2A 1THPB 4M7GA 2BD9A 2W7UA 3RXCA 1XUKA 2BHGA 4MNVA 3QTVH 5EOKA 3Q00A 2AS9A 2QYIA 4AC9A 1A3BH 1UTOA 2IPQX 1C2GA 1WSSH 3F2GA 6CHAB 1IQNA 2HOBA 3I29A 1ELTA 1BRBE 2WV5A 3PV2A 4JYTA 5C0UA 1GHAG 1C1TA 2O8MA 1BTYA 2VWNA 1BB0B 3TK9A 1D3PB 2HLCA 1MH0A 3ITIA 3SJ8A 1TPOA 1O5CB 1OX1A 3W1EA 3S9AA 2LNCA 2BY8X 2AMDA 2YNAA 3M5NA 1C5MD 1QRXA 4X8UH 5T1VA 4KTCA 1L1GA 1TAWA 2ZTXA 5DP3A 4DVAU 3LPRA 3BG8A 1Y3UA 1Y8TA 1BIOA 1PPZA 5GXPA 3A7YA 1CHOF 3SBKA 4A1TA 1EPTC 1MU6B 3EQ0H 1HAHH 3B8JA 4YLQH 4UE7H 2J98A 1MQ5A 2FI5E 4WMDA 2HGTH 1GBEA 2D1JA 1V6DA 3PLPA 3MFJA 3LGTA 5ESTE 5EJZA 1W0YH 4FUDA 1C2DA 3ODDA 4IC5A 1TGNA 3EYDA 4X6PA 1QCPA 3QGJA 2PKAA 3BEUA 4AYYB 1ZRBA 1DANH 2QXIA 1IQGA 1V2WT 4IGDA 5F03A 2VIWA 2Y81A 5C5NA 3SU1A 1TBRH 1S84A 3EA9A 3D49H 3O8DA 1AQ7A 1C9TA 1SVPA 1H8DH 4UFDH 2ZI2H 4R0IA 1HXEH 1CE5A 1LTOA 2HLDD 4YTAA 3MU5A 4X8TH 4K2YA 1GCTC 4MPWA 1EZXC 5GJ4B 4F49A 1TMBH 5EW1H 2BY9X 1DICA 1S6HA 2CGAA 1G3DA 4RKJB 1O2JA 3UR9A 4JZDH 3TH4H 3ZZ3A 3M3TA 4CRAA 1V2MT 2XNDD 4NA7A 1B7XB 2GX4A 1UCYK 1TPSA 1ZHRA 3MOCA 1NS3A 2QF4A 3P70B 2VIDA 4NIYA 2PWXA 1MBMA 1OP2A 1BTXA 1P3CA 1KXDA 5A8YA 4JZ1A 1BITA 1OWJA 2KAIA 1ARBA 4TSFD 3DSPA 4ZXYH 1SGFG 2BVRH 1IQKA 1C5OH 1QJ6B 1SLWB 1TMUH 1E36B 3STJA 1RS0A 2BY7X 1DT2A 9LPRA 3RXJA 3SGQE 1TABE 2WPKS 1SGYE 1UO6A 2ZP0H 3URCA 4AN7A 4H4FA 1ZGIA 1O2ZA 2I6SA 1UVPA 1LKBA 4B73A 1QQUA 1NFXA 2AERH 4FUJA 4NZQA 2OXSA 4UEHH 1DXPA 4GLYA 1YF4A 1L2EA 3RU4E 3U28C 1FX0B 2G55A 2PUQH 5L2ZH 4INKA 3FN8A 2UWPA 1BT7A 1EOJA 3E1XB 1CHOG 2OBQA 1CA8B 3F0PA 4O9VA 2Y5FA 2BVSH 4DY7B 3DCLA 3E90B 3MH5A 4KTSA 1HNEE 1XXFA 3V7TA 1HLTH 2ZC9H 2GMTC 2DUCA 5CMXH 3A80A 3EA7A 4P00A 3ZZ5A 2ZG0H 3T26A 3PM3A 2ZGCA 4K1TA 4NGAH 4MG3A 1ZZZA 1OP8A 1TYNA 2F9VA 1GJAB 1GMCF 1AMHA 5EPNA 2BDIA 2K1QA 1RXPA 1D3TB 4AFUA 5B6LA 2B8OH 1AB9C 3QWCH 4AB8A 8ESTE 1N1LA 2OD3B 3GY7A 2FODA 1EUFA 4JCNA 1GJ8B 3F0OA 1QR3E 1HDTH 1SFQB 1GBDA 2SGQE 5KEDA 2QF5A 3BTFE 1OYQA 1O2YA 1V2PT 3SOSA 2GMTB 5LH8A 3R3GB 1XM1A 4A1XA 1UVUH 3GCHB 1O35A 1Z7KA 3RMMH 1OWKA 1N8OB 2XBYA 3P8OA 1WYKA 1A1RA 2XW9A 4TWWA 3GDUA 1L1JA 1TNKA 2FOBA 1WXRA 2JJ1D 3ZZ9A 1LQDB 3SZNA 3SJKA 4LZ1H 3CS0A 3UIRA 4A1VA 2Y80A 1K1NA 2WHXA 1UVTH 5JBTA 1IQMA 2WPJS 3SW2B 2QY0B 4BXSA 1QB9A 2YNBA 3LT3A 4WH8A 1DSTA 1INCA 1PPHE 5L30H 2OC0A 3N99A 2P59A 4D9QA 2Q6GA 2FOMB 3T28A 1NPMA 2YMSD 4P02A 2HWLB 4Q7ZA 2ZFQH 1UTLM 2BQ7B 2CF8H 2VJ1A 1NU7B 1GGDB 3BEIB 4TYDA 1XVOA 2VVUA 3SORA 1T4UH 1P9SA 1XKAC 5CHAC 6ESTA 2Z9IA 1NTPA 4ZAEA 2ZU1A 1F0UA 5C1UA 3LGIA 3QZRA 1H9LB 1A4WH 1CGHA 1UK2A 4Y0YE 6GCHF 4WMFA 1H9HE 2Z9KA 1CHGA 2TIOA 3ZZ4A 4X8VH 4B2BA 1ETRH 3F2FA 1YLDA 1ZJKA 5EXLA 2HVXA 1K1MA 3TJNA 1YLCA 2XRCA 2STAE 4IMZA 4A7IB 4ABAA 3ZYEA 3C1KA 1C2KA 3N7DA 2THFB 1YPJH 1GBKA 1PPCE 1MAXA 3HK3B 2F3CE 3ENSB 4B74A 2J4IA 5GPIB 3F3BA 1GHBF 4K1EA 3CP7A 5IK2D 1TOMH 1GBCA 1BBRK 2ZFFH 1EFRD 1O2LA 1GMCG 4ZKOU 5EGMA 1F0RA 4Z1MD 3MI4A 3SV2H 1E34B 1YM0A 1IHSH 3A7XA 4QT8C 3UOPA 3PV5A 4X6OA 2AEIH 4D8NA 3E0PB 4GHQA 3RP2A 3RU4D 1HYLA 1C1WH 2ZHDA 4X1PU 1AVXA 1E38B 3HATH 4YESB 1C2FA 1O2KA 1BHXB 1B0FA 3RC4A 4F55A 4GSOA 2IOTA 8GCHF 1OWIA 5AVDA 3ZZ7A 4X2VA 1ZLRA 4B76A 2Y7ZA 1G36A 4D76A 1XUJA 3UNRA 4INHA 1W12U 1ZPZA 1O2RA 1Y5AT 1VCQA 4NA9H 3RXMA 1NU9A 5J4SA 1PPFE 1MKWH 1XUHA 2I6QA 1XKBC 3FVFB 4TPIZ 4BAKB 3KL6A 3A87A 2FXRA 1LVYA 1FPHH 1SLXB 4IN2A 1GI0A 1C2EA 1D9IA 4UONA 4UFEH 4JK6A 4BAHB 3LDXH 4D9RA 4TWYA 1LPZB 3M5MA 4FU8A 4OGXA 4HZHA 1FIWA 1UCYE 1BTWA 4AG1A 7GCHF 3OE7D 3MWIU 4Y8YA 3GICB 5A8ZA 2ZHFH 2OQUA 2ZGBH 2PSXA 2SGEE 4D7FA 2ANKH 4YT7H 2OINA 1GBTA 1WCZA 2B0FA 2BLWA 3KGPA 3P92A 1NBME 1LPKB 1HIAB 2AGIX 2R0LA 3DFJA 1A61H 1O5EH 1VGCB 1XVMA 4Z6AH 2SGDE 3ZVBA 1ZGVA 1ZR0A 6GCHG 2VGCC 3TLOA 1EZQA 2FYQA 2KR7A 1RRKA 3S7HB 4OS2A 1P03A 4MVNA 1D6RA 1GL1A 4MPUA 1QB1A 4AYVB 1DY8A 2TRMA 2Z9GA 3L6PA 1O2UA 3B23B 1GDQA 3VFEA 1P3EA 2ZFRH 1C2JA 1OKXA 2UWOA 2O8UA 2WYJA 1NY22 1L1NA 1O5BB 1VZQH 1ZRKA 1Y3YA 1OS8A 1P8VC 3KEEA 3LC3A 4OS4A 1QRWA 1GHBG 1QBVH 1JIRA 1P05A 2QXHA 1FY4A 2Z94A 5EQRA 2AHME 1N6YA 4ZMAH 3A8AA 1V2UT 5E0JA 1CT4E 1KYNA 1Z6EA 1THSH 1P11E 2RA3A 2G4TA 1EQ9A 4Q2KA 1PQ8A 4NWKA 3QGNB 2VGCB 1HGTH 3A84A 1SGDE 3ATMA 3LH3A 1GHVH 3SGAE 1EZUC 3KYFA 5FAHA 2SGFE 4LOYH 1RTFB 2FOCA 5JBBS 2FP7B 1SI5H 1IHTH 1C5RA 1NROH 1O2XA 1KDQB 5GIBA 4XOJA 5F8ZA 3E0NB 1EB1H 9ESTA 1E35B 3OY6U 1TX6A 3A89A 1HAXB 1JXPA 4CRCA 2KCOA 1QL9A 2XOKD 1LHGH 3QN7A 1DVAH 8GCHG 2FTLE 1AY6H 1SHYA 1BDAA 1O2SA 1WU1A 2M2AA 4B1TA 1P9UA 4K1SA 2EA3A 3ZIAD 2HNTE 5C67A 1ELCA 1G32B 4ESTE 4ZCNA 5IYTA 3UNQA 5DSFA 2Q1JA 4NZLA 1RIWC 3S7KB 4ZXXH 1C4Y2 3UWJH 1TA2A 3LONA 1RTKA 1ZTLA 4GUXA 1C5YB 2ZWLH 3JZ1B 5DP7A 2CHAC 4XBCA 2HPPH 3DSGA 1ESAA 4CHAC 1DY9A 5FPSA 4X8SH 3LGUA 5ESBA 3PWCA 1GBHA 3QO6A 4DIHH 4JYVH 1HV7A 1V2JT 2W26A 7GCHG 1YKTA 3QZQA 2GCHF 3D62A 4K69A 4I32A 2H5DA 2JIZD 2FYRA 4MNYA 2P16A 4BOHA 1NRRH 2VWOA 2IJD1 2SNWA 3HGPA 5E2OA 3VB3A 5DP9A 2R2WU 5K7RA 3N7EA 1CBWB 1DM4B 4ABJA 2H9EH 2SGAA 1RIWB 2HVYB 3MTYA 1WBGB 2XBVA 1HIAA 1FQ3A 4I8HA 1WQSA 5F6MA 1TMTH 1BJUA 3SU0A 2QAAA 3M61U 1COWD 4BNRA 2ZQ2A 1GG6C 3E8LA 1O2QA 2J92A 1G2MA 3AASA 3STIA 3E3TA 2CJIA 5FPYA 1XX9A 1F7ZA 1CA0B 2W7SA 5A0CA 2P95A 4FUGA 3GDSA 2FX6A 2ILNA 3RXVA 1CVWH 1IQLA 1DUAA 2A0QB 1AE8H 5F53A 1D4PB 3A88A 5AF9H 1SOTA 4DT7B 2BY6X 4B6EA 1MKWK 1IOEA 3GY3A 4I8LA 3M5OA 4X1QU 2JJ2D 2WZQA 1O30A 1LHFH 1YCPH 1LDTT 1QIXB 1SFIA 3ODFA 1PJPA 3LH1A 4XRNA 1C5UA 2BZ6H 2VIVA 1NBMD 1EZSC 2K8IA 1T31A 4TPYA 3T62A 1P06A 1AWHB 1HJ9A 3ZZDA 3OTJE 1C2HA 4ZKSU 1T4VH 1A5IA 2VIOA 3G01A 1QURH 3VB4A 4ABFA 3TU7H 3F6UH 4FVBA 1C5SA 1SQOA 4ABHA 1C1VH 1KDQA 1UMAH 1RD3B 1CO7E 1ELGA 1BTPA 4MDSA 4NG9H 2FTMA 1ANDA 3F9HA 3U8RH 1K9OE 1V2ST 4IC6A 3QLPH 3LOXA 4FUCA 2K0QA 4KP0A 1W0ZU 1TNHA 2WPLS 5C3NA 2TGAA 1A0HB 1O5FH 2A7CA 5FCRA 1O3EA 3GCNA 2BLQA 2P94A 1OWHA 3ZVEA 2FLRH 1PPBH 1B0EA 1X7AC 4CR5A 1C5ZB 1L4DA 2ZDVH 4YOIA 4X2WA 3BTKE 3GY2A 3O8BA 5C20A 2BMGB 2R3UA 2UUYA 2RDLA 3BIVH 2FO9A 3A7VA 3SNCA 3U9AH 1P09A 2ZGXH 2VH0A 2GCHG 3MNCA 1SOZA 3MO9A 3SNEA 5HYOA 5FCKA 1ZHPA 2ZNKH 3M7TA 2B9LA 3W94A 1SGIB 4K5ZA 2GZ9A 3V13A 1SSXA 3ESTA 3MYWA 4BXWA 1Z8IB 2ZTZA 3PLBA 1Y3VA 1TNJA 2TBSA 1JWTA 2G52A 2FI4E 2A7JA 4JZIA 1UJ1A 1O3IA 2BDYA 2FOGA 2ZU4A 3AAVA 1UW7A 4I8KA 1ESBA 1O33A 1SGPE 4NFEA 1MMJN 3V0XA 4NWLA 2OK5A 1ACBE 1GMHF 1EPTB 1DS2E 1NT1A 1XXDA 4I33A 2TGPZ 1C2IA 1SC8U 1GI5A 1H1BA 2PHBA 3HPTB 3MO3A 4UD9H 3LGWA 2M5TA 2WUBA 4NIXA 5DG6A 1ZYOA 1RJXB 3FO8D 2WV9A 4RI0A 1CQQA 5DN6D 1VJAU 2C8XB 3SGBE 5JDUB 1V2QT 3ZZ6A 2WSSD 2F83A 5PTPA 1IQIA 1GCDA 5JPMH 4AX9H 1FV9A 4OS5A 2ZO3H 1IQFA 1SMFE 1DXWA 3GCOA 1OHHD 1GJCB 2JDID 3MNSA 1O5DH 1L0ZA 1O2GH 1O2VA 1P2JA 5EPYA 2IJOB 2WPMS 1O3MA 1GJ5H 4FU9A 5T3HA 2ZDMA 3UREA 4LZ4B 1GCTB 3D65E 2VIQA 5EG4A 2ZGJA 4AGKA 5T6DA 1TX8A 2XWAA 2JETC 1DLKB 1ETTH 1S0RA 1K1IA 2GV6A 1BTZA 2STBE 7LPRA 1P10A 4OS7A 2BXTH 5LPRA 1O3PB 4FVDA 4OM9A 1XUIA 4TT3D 1SGQE 2IPHA 3MU8A 2C4FH 2ZHEH 1DUEA 1GI8B 1LHCH 1YPKH 3IWMA 2JH5D 1O34A 1YC0A 4XBBA 5DP6A 1VJ9U 2KCYA 1MTUA 1THRH 3MU0A 3SU4A 2G4UA 1ESTA 1EX3A 2ZU2A 1GBBA 3K2UA 3RXPA 3RXHA 1W2KH 4WVPE 3SJIA 1T8OA 2UUKB 4I7YH 1O2TA 3M7QA 4XE4A 1T32A 4Y79A 3RXOA 2WPHS 1W14U 2V3MA 3RM2H 2IN2A 2OCVB 3RXKA 4YT6H 1NC6A 3KIDU 1UTQA 1WV7H 4MPVA 2F9NA 1NM6A 2JETB 5A0AE 5E2PA 3SZEA 1HPGA 1MAYA 1WDIA 3BN9A 3BSQA 2DE9A 3FZDA 1C5XB 1G2LA 1V3XA 2TGDA 1YCPK 3E16B 1G30B 4RKOB 4KKDA 4MQAA 4H42U 2HRVA 2PTNA 3LJJA 3P6ZB 4Y71A 1GHXH 2F4LA 2PV9B 1FIZA 1TNIA 1JIMA 3DT0H 3S0NA 1KSNA 2PR3A 1NRQH 1S6FA 2C8YB 1UHBB 2VH6A 1YBWA 1UTPA 1AFQC 1GMHG 1C5LH
chains in the Genus database with same CATH topology
2R0KA 4YM9A 1SBWA 2F9OA 3A8BA 5A0BA 2PKSC 5JBAS 2G5NA 1ZPBA 4WY3A 1EPTA 1C1MA 1DFPA 3Q3YA 1EB2A 4DCDA 1MZAA 3M3SA 3A7TA 4VGCC 2Z7FE 3GYLB 4X6NA 1ZTKA 3P8NA 4I8GA 5AFYH 4AFQA 5FBIA 3SV7A 1GBLA 4YOGA 1Y3WA 1AB9B 1ZSKA 2GCTC 1TE0A 1CU1A 2AYWA 4SGBE 2QIQA 2G8TA 4Y10E 3VPKA 2NU3E 2ZFPH 3BG4C 1MD8A 2VINA 1TRNA 1MTVA 1O2HA 1TPAE 4X2YA 2OTVA 1SLVB 4PROA 4AG2A 5JYIA 5JBCS 1H4WA 3RXIA 1QJ7B 2BD4A 5TJXA 3NZIA 1BRUP 1F5RA 2BQ6B 1K1LA 2BYAX 3SU5A 1QTFA 2C90B 1QNJA 2FMJA 1EJNA 1E0FD 2BZAA 1ANBA 2ZFSA 1FY5A 3MO6A 4Y11E 3V3MA 1MU8B 2UUJB 1NFWA 1CT2E 2F9BH 5JB8S 2BDAA 1O2NA 4CRFA 2GCTB 1J8AA 1TFXA 1TRYA 3TVJB 4ZHLU 3S69A 5HMAA 2EC9H 2ANWA 4AB9A 2Z9JA 4ABGA 3MNXA 1SR5C 1C1UH 3SUEA 1SGTA 3RXEA 2FEQH 2GT7A 1ZSLA 2P3FH 1FN8A 2JKHA 3T25A 3R0FA 3A8CA 1S5SA 4KGAA 2ZDLA 3PTBA 1TX7A 4XBDA 1YPHC 2AFQB 4LK4A 1C5TA 1Q31A 3OU0A 5CHAB 3U8TH 4Z0KA 1HAGE 2A45B 4X1RU 2A5IA 1VCPA 3TH2H 2BB4A 3KCGH 5LGOA 2FI3E 4CR9A 2ODPA 3BEFB 3TK6A 3QDZB 4WXIA 1S81A 2CV3A 7KMEH 1AFEH 5FX6A 1M9UA 3RXGA 3Q77A 3VB7A 2G51A 1K28D 5C5OA 1G37A 1UHBA 5FXLA 2A4RA 3FP8E 1AVGH 2V0BA 4KELA 1AWFH 1O3LA 1C4U2 3FFGA 1T8LA 1AKSB 1SGFA 5ABWA 2WV4A 1P2QA 1OPHB 5EXNA 3SUFA 2A7HA 2GGVB 2HPQH 1T7CA 1UK3A 5DPAA 2XC4A 1MBQA 1HJAC 1TQ0B 1Y5UT 4ISOA 4NA8A 1Y3XA 1P2MA 1WTGH 2OUAA 3RXDA 2Q6FA 2ZHQH 3F68H 5E0HA 3H5CB 3UWIA 3MH6A 2AGGX 2Y7XA 3K65B 4BAOB 2Z3DA 1MTWA 1TRMA 4UFFH 4K8BA 4JZFH 5GDSH 4IS5A 3SQEE 1SPJA 2G81E 5EU8A 1TGCA 3KQCA 1S0QA 1ZMNA 3A8DA 1KXAA 1KXCA 2CF9H 2ZA5A 3PB1E 3ZZ8A 5CE1A 2DE8A 3T2NA 1AE5A 4F4OC 1O2MA 1BTHH 4UFGH 1MD7A 1WQVH 2NU0E 1HJAB 3NXPA 3MH4A 5FPTA 4BTUB 2H2ZA 3RU4T 2PTCE 2XYAA 4CRBA 5FHTA 1WOFA 2EI8A 4CH2B 2G00A 1EAIA 1GPZA 3LIWA 1EAUA 3GISB 3P8GA 1CT0E 3FP7E 1DLEA 1NFYA 3RXRA 3CENA 2P8OC 3AVZA 1FY1A 5SGAE 1HJ8A 2ZCKP 2ZECA 4A92A 1O3HA 3RXQA 1K22H 4Y76A 2PLXA 3ZVAA 3ZZBA 1YGCH 2FWWA 1ELDE 4X0WU 5T6FA 2JH0D 3K9XB 3HGNA 1PFXC 1QA0A 1P57B 2HNTF 4HFPB 3A7WA 2V3HH 4U30A 2FPZA 2A5AA 3SHCH 3UQVA 2C8WB 2BVXH 2J2UA 1O37A 4XDEA 2OC7A 3GY8A 2VU8E 3S9BA 2FOHA 1BQYA 5BRRE 4K60A 4R8TB 2P8OB 1BRCE 2XNIA 2FS9A 1G3BA 1TPPA 3Q76A 1XUGA 5FX5A 1K21H 1GMDF 1GBIA 1YPMH 1DSUA 4WH6A 3TJOA 4WF8A 1S83A 3HKJB 3I78A 3V12A 4ZH8A 1GDUA 1SGCA 2W3KA 1ARCA 2ZPRA 3OY5U 2BQWB 2BDCA 1L4ZA 1KLTA 1W10U 3LGYA 1Z1JA 2D2DA 4IW4E 3SI4H 2O9QA 1GBAA 3T27A 4ABDA 3RMNH 1C1QA 1FUJA 1GHZA 1A5HA 5DKMA 1HAIH 3BTEE 5ETXA 3RDZA 1SB1H 2R9PA 5AFZH 1D3DB 2GD4B 1O3GA 1AKSA 1QL8A 2BD5A 4BAQB 1JMOH 1W8BH 3TGKE 1V2RT 3MHWU 3EE0B 1EOLA 4DG4A 2WUCA 1MTSA 3RLYH 1HAPH 2AIQA 2W3IA 5DP8A 3EA8A 1VITH 2FDAA 2PGBB 3H7OA 4BTTB 3RMOH 3E91A 1UTJA 4XSKU 2VNTA 3NUMA 2BM2A 3F1SB 2H9TH 5T6GA 3VGCC 1MUEB 1K1PA 1PYTD 1J9CH 4BANB 1GI9B 1C1SA 4GPGA 2ANYA 1LVMA 3RUOA 3SU3A 3FAOA 2FS8A 1GI3A 2XCNA 3PO1C 4BAMB 2H6MA 3DHKH 2AMQA 1OWDA 1TGBA 2ASUB 2PW8H 4INLA 2TGTA 1UTNA 4WMEA 1GJBB 1QBNA 2XTTB 2BOHB 3RMLH 3ZYDA 2CHAB 3A83A 3VXFH 1HB0B 4CHAB 3U98H 3U69H 4ABBA 1O32A 1PPGE 4XFQA 1FDPA 1OXGA 2A4QA 1HAOH 4CRDA 1O3KA 3UNSA 3UUZA 1UK4A 1U6QA 1NZQH 3DUXH 2ZKSA 3TNTA 4ZHMU 4UDWH 1QL7A 3BV9B 1YPLH 2XXLA 1GJ9B 3BTWE 4ABIA 4DURA 3SU2A 1KTTB 1WAYB 3ZVFA 4X1SU 4ABEA 3P95A 3PO1B 3LJOA 1BMNH 4IMQA 2A5KA 3BF6H 3QTOH 4Y0ZE 3BTQE 3PYHA 1A7SA 3U8OH 3F9EA 4Q7YA 4AFSA 1H8IH 1FPCH 4ISNA 1EP5A 1TWXB 6CHAC 1LCYA 3IITA 1PQ7A 2BOKA 3PROA 1GMDG 3K6YA 1GG6B 1KXBA 1P2NA 1DWCH 4B71A 3TITA 4J2YB 3VB5A 5EODA 4ZKRU 1FZZA 1GJ6A 1WUNH 3RXUA 2FOEA 1O3JA 3GCTF 2PUXB 4ISHH 5L6NH 4RN6A 1OP0A 3A82A 1W11U 3TGIE 2WINI 3D23A 2A4OA 1OOKB 1ELVA 2RCEA 1XUFA 2BDGA 3AW0A 3KQEA 1GVLA 4I31A 1F0SA 3RXAA 1HFDA 1QJ1B 3PTNA 4JYUH 1SHHB 4THNH 1FNIA 5I25A 1HBTH 4O3UA 5K0HA 1FXYA 2QCYA 3SQHE 1S82A 3K6ZA 1O39A 1FAKH 5FBEA 2ZTYA 2ZF0H 1F5LA 1PQAA 1F5KU 1V2OT 4DJZB 1ELAA 2ZDNA 1GHYH 1RFNA 3UY9A 2XCFA 1EP6A 3UPEA 1ZMJA 1YPGH 2H5CA 1DWBH 3A86A 3OYPA 3PMHB 3RLWH 1CGIE 3BTME 4Q7XA 1DE7H 5DP4A 1E37B 1TBZH 5DP5A 5HGGA 5C2ZA 4DIIH 2VWMA 3BTDE 1O5GH 2XBWA 4FUIA 3O8RA 2BD7A 1GJ4H 1AVWA 2TPIZ 3HK6B 1J14A 1BJVA 2RG3A 1YCPM 2F91A 2ZGHA 1LPGB 3P17H 1O31A 2J9NA 1BRAA 4MLFB 1T8NA 1GVZA 2AH4X 2QXGA 4A6LA 1A0LA 1ANCA 1DX5M 3M37A 4DW2U 3BTGE 1QBOA 1FY3A 1O3NA 3CS7A 4AORA 4NSYA 1EKBB 4NSVA 1C5VA 2ODYB 2FOFA 3VXEH 3RC5A 3W95A 2FLBH 1K1OA 2ZPSA 4JMYA 1FY8E 1HAYB 3PMBB 4DGJA 3M35A 2ZCHP 4NIVA 1OSSA 1A0JA 1MKXH 4OS1A 4RSPA 3NWUA 1GI7B 2XBXA 3SNBA 4B2AA 2EI6A 4U2WA 2J34A 4Y7BA 1MZDA 1J16A 1LO6A 3DFLA 1EATA 2GDEH 1PPEE 3SHAH 5J4QA 1ORFA 4GHTA 3ZZAA 2ZEBA 1ETSH 2A32A 2EEKA 1BBRH 1XMNB 3GCTG 3MH7A 5A2MH 2R2MB 1TOCB 2BLVA 3U1IB 2OQ5A 1JOUB 1G3CA 1TBQH 3WY8A 1AGJA 1Z71A 1ZHMA 1Z1IA 3M3VA 3LGVA 1Q3XA 1G3EA 2Z9LA 2B5TB 1Z8JB 2QN5T 3ZVDA 1BHXF 5I46H 3MNBA 5EQSA 2EI7A 2A4GA 1Q2WA 1P2IA 3E6PH 1O38A 1EJMA 3KQDA 3M7UA 1C2MA 4FUEA 2CXVA 2ESTE 4YOJA 2D26C 2ALVA 3KN2A 1V2NT 4JK5A 1NO9H 3MU4A 1W7GH 1FONA 4AGJA 2Y5GA 1ZOMA 1ABIH 1UTKA 4YO9A 2G5VA 5F8XA 3DD2H 1JBUH 1LVBA 3L3TA 3AAUA 1BMLA 1FJSA 3KHVA 1BCUH 4Y8XA 3A85A 1GI2A 1UVOA 4MPXA 4LXBH 1NN6A 4A5TS 3GOVB 4B2CA 1P2KA 3GCHC 1GWAA 1T8MA 1PQ5A 3VEQB 3RXSA 2GZ7A 2A2XH 3ZVGA 1N8OC 1AI8H 1YPHE 2Y5HA 3SNAA 5H4IB 5DO4H 2ZIQH 2A1DB 1MCVA 1ANEA 1C5PA 3EDXB 1P0SH 4ZKNU 2F9UA 3NKKA 1C4V2 5EW2H 3C27B 1LHDH 4Q80A 1ID5H 2H1UA 2O8TA 4E06H 2BTCE 3GYMA 3BTTE 1TGSZ 1FI8A 1OYTH 1NFUA 4Y7AA 3SNDA 3SI3H 5DGJA 5EXMA 3LC5A 4MTBA 1DDJA 1LMWB 4BTIB 3SO3A 4CRGA 1GGDC 2V35A 1F2SE 5AHGH 1JRTA 5BPEA 1FN6A 1AFQB 1O36A 2O8WA 2BXUH 2NU2E 1DITH 1GL0E 2QC2A 1P2OA 1UTMA 1ZPCA 1QHRB 1O3DA 1TGTA 5DK1A 2C8ZB 1KIGH 2OBOA 5HXFA 2V3OH 1C1PA 2PKSB 2WYGA 1C5QA 4ZROA 3QUMP 2PFEA 2GT8A 3PMJA 2ZU5A 3KNXA 4VGCB 3U1JB 2NU4E 3BIUH 3MMGA 3LU9B 3M36A 1KLIH 2A2QH 1QQ4A 2Q6DA 5LPEA 4X6MA 1TA6A 1O3CA 1KTSB 2ZU3A 3RXFA 3A7ZA 1YPEH 2SFAA 1KXFA 4MNXA 2R3YA 1SQTA 3UFAA 1BMAA 1TIOA 5HM2A 1HAZB 4IN1A 3BG4B 1VCWA 1V2TT 3T5FH 4O3TA 3PLKA 2ZDKA 1LQEA 1AN1E 1F92A 5A8XA 2Y82A 2ODQA 2QA9E 3RXBA 1K2I1 1Y5BT 2XC5A 4NFFA 1F0TA 1BMMH 1P12E 3GDVA 4NIWA 3PWBA 1GVKB 1TLDA 3RXTA 1JRSA 2ZDAH 2VB0A 2NWNA 2YOLA 1O5AB 5DJ7A 4CBOA 3TGJE 2VWLA 1IAUA 1ZTJA 1Z8GA 3GY5A 1AD8H 1NRSH 1FLEE 3IG6B 3ATKA 2XC0A 3RC6A 2OC1A 4K3JA 4JZEH 1MKXK 3VB6A 1BOQA 2WPIS 1GI1A 2BDBA 5G4BA 4H6TA 5E0GA 2ALPA 4AOQA 1N6XA 1W7XH 4WJG2 4CH8B 3SV8A 1ELBA 1V2KT 1LKAA 2ZHWH 1D6WA 2AMPA 1BA8B 3NCLA 3TJUA 3GY6A 4GAWA 4FXGH 1VITF 5A09A 4ZHAA 3NPSA 2GTBA 2BLOA 2PGQB 2Z3EA 5E8EH 3EAJA 5C1XA 1KLJH 3T29A 4ASHA 3SJOA 2D8WA 4ZUHA 3FZZA 1A2CH 1O3BA 3Q3KA 5JB9S 3SN8A 4Y8ZA 3TJVA 1HAVB 1CGJE 4ISIH 4OS6A 4TY6A 1HCGA 1SLUB 2BD3A 2Z6BD 4O03A 1O2OA 3TNSA 2FZZA 1IQEA 1Z6JH 1V2LT 2O8LA 2BY5X 1SGEE 5F8TA 4H6SB 4GCHF 5GCHF 1P02A 4HTCH 1GJ7B 3ATIA 1J15A 1GBJA 2BDHA 4CREA 1HUTH 1AZZA 4FU7A 1QRZA 4AFZA 4E7RG 2VIPA 7ESTE 1BUIA 1EAXA 4NCYA 3SUGA 2UWLA 1VGCC 2QF0A 4ISLA 2NU1E 5IDKA 1S85A 3TK5A 2GVFA 3LKWA 2W5EA 3SU6A 3F9FA 1ELFA 1P04A 3OX7U 3UQOA 2BX4A 2ZPQA 1FMGA 3ZVCA 1K1JA 2ULLA 1WTHD 4J1YA 2OC8A 4O97A 1NRNH 4K8YA 3F9GA 4X1NU 2UUFB 3ZZCA 2J38A 1DPOA 1TNGA 1FAXA 1KXEA 1GI4A 3Q3XA 1AIXH 2SNVA 3KQBA 1IQJA 2RA0A 2BX3A 1CSOE 4TY7A 4SGAE 2QXJA 3A81A 2ANMH 5TCAA 3MU1A 2GDDA 1H9IE 3ELAH 2ZZUH 4YZUA 4HGCA 2GV7A 5LPFA 4MNWA 4D7GA 1ELEE 1GJDB 1AHTH 1GBFA 3GY4A 3URDA 1HRTH 1QB6A 1W13U 1MQ6A 2LPRA 1QFKH 1MCTA 1PYTC 1VR1H 5GWZA 1D3QB 5C1YA 1VITG 3M5LA 5L2YH 1UVSH 1MTNC 1A5GH 1GHWH 2QV1A 3S9CA 3HKIB 1SGNE 2A31A 4Y6DA 1O3FA 2ZCLP 3AW1A 3H7TA 1AUTC 3PMAB 3P8FA 2Y6TA 1C1NA 1YP9A 2C93B 3QX5H 1EXFA 2BD2A 1EASA 2ZQ1A 2HALA 4HI3A 3SV9A 1A46H 4X2XA 1NESE 2GP9B 1TALA 1HAVA 1NRPH 1C5NH 2VVCA 1C1RA 4GCHG 5GCHG 3JZ2B 3BTHE 3ZV8A 3TH3H 2B7DH 1HXFH 2AGEX 1GHAF 1DWDH 1QGFA 3I77A 2FIRH 4CBNA 2FX4A 3SUDA 1MTNB 4OGYA 1TQ7B 5HM9A 1TB6H 2BD8A 1SL3A 2JH6D 2C3SA 1CBWC 1KY9A 1Y59T 2PSYA 1C9PA 1O2WA 3DA9B 3TIUA 2GZ8A 1C1OA 1C5WB 4FUBA 4B75A 4FUFA 3ZV9A 1TNLA 2QF3A 1UCYH 1RTLA 1ABJH 4DOQA 1GI6A 2V6NA 1BTUA 3SJ9A 3UTUH 5EQQA 3PV4A 2CN0H 3OSYA 2CMYA 1DOJA 1CA0C 1SQAA 1YYY1 1O2PA 1AUJA 2GKVE 1A3EH 1G9IE