4XBBA

1.85a resolution structure of norovirus 3cl protease complex with a covalently bound dipeptidyl inhibitor diethyl [(1r,2s)-2-[(n-{[(3-chlorobenzyl)oxy]carbonyl}-3-cyclohexyl-l-alanyl)amino]-1-hydroxy-3-(2-oxo-2h-pyrrol-3-yl)propyl]phosphonate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
175
structure length
165
Chain Sequence
HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Dipeptidyl Inhibitors of Norovirus 3CL Protease. Structure-Activity Relationships and Biochemical, X-ray Crystallographic, Cell-Based, and In Vivo Studies.
pubmed doi rcsb
source organism Norwalk virus (strain gi/human/united states/norwalk/1968)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-LIKE PROTEASE
total genus 39
structure length 165
sequence length 175
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbbA01
1W0ZU 4GCHG 2XWAA 1FV9A 1C2MA 5HM2A 1VITG 1GI3A 4CHAC 3TK5A 2FOMB 4GCHF 4MG3A 3V12A 1T7CA 2F83A 1SGTA 2AFQB 4RSPA 4CH2B 3RUOA 3EA9A 1OKXA 3UNQA 2NU0E 2EI7A 3MNCA 4KTUA 2EC9H 1TOCB 1YPMH 2CGAA 1INCA 2AMDA 4CRDA 5LPRA 3T26A 1UO6A 1O32A 1O5GH 1TA2A 2GGVB 1ZTJA 3RXFA 1GJ9B 1NO9H 1SQTA 2SFAA 3QGJA 3SJIA 3A82A 1PPHE 2R0LA 1Y3UA 1O35A 3P70B 4Y8XA 1PQ7A 2J34A 2GMTC 4HI3A 1LDTT 1MTSA 2WPLS 2A4QA 2BZ6H 1O2IA 2GCHF 1C2DA 1YLCA 3MO6A 2VH0A 1SQAA 1C5RA 2AGIX 1C5UA 2OCVB 3U1IB 4NIYA 1MKXK 1ZSLA 2P3UB 1TBZH 3P8OA 4MNWA 1LVYA 1QGFA 5AFZH 3E0NB 1MH0A 1LMWB 1V2MT 3RXHA 3KNXA 5FXLA 4U30A 3M5MA 1GJAB 2P3FH 5GWZA 1O3KA 1BZXE 3F9GA 3SU6A 1SGYE 2YNBA 1NZQH 2VWNA 1ZOMA 4CH8B 2XTTB 1GI5A 2VWLA 2ZCHP 3OSYA 3PMHB 3P8FA 1FNIA 2OD3B 4CREA 1TOMH 1AIXH 1J9CH 4E05H 1L4ZA 1C2LA 1LO6A 1SR5C 3L3TA 2A7JA 2C4FH 2VH6A 1CSOE 1BMNH 1OX1A 2J2UA 4K8YA 3EE0B 3RXVA 2GZ9A 5C67A 1A3EH 3O8CA 2BDBA 1T32A 1GMHF 3CENA 4Y8YA 4K2YA 3ZZ3A 3A87A 2V3OH 1ESAA 2QIQA 1A5GH 2A1DB 5T6FA 1C5SA 4Y7AA 4ZKRU 3PLKA 3RXRA 4CR5A 1Q2WA 1O2JA 1P3EA 4AYVB 4JZFH 1K2I1 1J14A 2AIQA 1HJAB 1P06A 2Z9JA 2FIRH 1O3DA 1ANBA 1GMDG 3SJOA 2ZWLH 5LH8A 2P95A 2ZTZA 3HPTB 1EPTC 2SGEE 4AFSA 3O8RA 5K7RA 4INKA 3BF6H 2BVRH 4MNXA 3R3GB 2CMYA 4J1YA 1ESTA 1ZPCA 2BB4A 2D2DA 5BPEA 4I8HA 1IQGA 1P12E 4I8KA 4FU9A 1ELDE 1K21H 4Y0YE 3EA7A 1D3QB 2ANKH 3UPEA 3V13A 1LQEA 4AFQA 1UVPA 1GCTC 1QB1A 1V2LT 2C93B 1NROH 1WYKA 3NXPA 2GZ8A 1SPJA 4TYDA 3SNDA 1TX8A 1MZAA 1O2LA 2ZA5A 1O2NA 4GPGA 1HIAA 2RG3A 2FOAA 1GBFA 1O3HA 3RXGA 5A8ZA 1HAXB 2PR3A 4LXBH 2ZFRH 1ETSH 4NWLA 1CGHA 1ELVA 1GJ4H 1D3PB 5LPFA 1GI4A 1ZHRA 3GY4A 1GI8B 1C9TA 1L1JA 1QY6A 1C5NH 1AQ7A 4XBDA 3SHAH 3H7OA 1OWHA 1A0JA 1HAVB 2SGFE 3DUXH 4ABGA 1CO7E 1Z8JB 2CHAB 1YLDA 4U2WA 4ZKOU 2XCNA 3RXLA 5L2YH 1CA0B 2ZFQH 4ASHA 4ZH8A 1TMTH 1ZMNA 2TBSA 2B8OH 2C8XB 1RXPA 4A1TA 1BCUH 1AUJA 2GVFA 1SFIA 1GJ8B 1UVOA 3VXFH 4GSOA 1A4WH 2H6MA 1F5KU 1HAGE 2H9TH 1S81A 1NC6A 3V7TA 2FTMA 2ZEBA 1LVBA 4UDWH 1AB9C 2XYAA 2GDEH 1E34B 3AW1A 1GBEA 1JBUH 3BTME 3KQEA 2BLOA 9ESTA 4E7RG 1SGDE 2PKSC 4AGJA 4ZAEA 3QGNB 1P09A 1ABIH 2ZCLP 1O2HA 2VB0A 1SGEE 4TPYA 1W3CA 2Z6BD 1SGQE 2NWNA 2HLCA 4ZKNU 2A2XH 4KTCA 2ZGHA 4K3JA 4XBCA 3A88A 1FY8E 1GI2A 4XFQA 4R8TB 2ALVA 3BTKE 4MTBA 4UFEH 1Y8TA 2ZNKH 7KMEH 4JMYA 2QXHA 4AGKA 2W7UA 3M5NA 3A7XA 2OBOA 5JBBS 3SUFA 3U8RH 1BIOA 1YPGH 2PKAB 6GCHF 4Y71A 3SN8A 1LHGH 1NRPH 3SI3H 1TMUH 1HDTH 3PO1C 2ZHFH 2ZHEH 4O3UA 1DVAH 3VB3A 4INLA 1TONA 5C1YA 1LHEH 1HNEE 5HYOA 1J15A 5ESBA 3S7KB 3KQDA 1ZHPA 1KDQB 1N8OB 2Z9IA 3RXMA 3P92A 2XC5A 1H1BA 1F0TA 1CA8B 2G4UA 2Z7FE 2P8OB 1IOEA 1FAXA 3P17H 1BT7A 3LH1A 1CT0E 1YPJH 3FVFB 1V2OT 2GZ7A 1RS0A 1SI5H 4MPXA 3UNRA 3RXPA 3VB4A 4JK5A 1YPLH 4B75A 4TY6A 2FWWA 1O2KA 1KXAA 2VIPA 1NRSH 3AASA 1BTYA 5EPYA 3ATMA 4AOQA 1ZMLA 5E2OA 1QL7A 1MKXH 3PYHA 1QRXA 1UHBB 1W13U 1QB9A 3ATLA 1PPGE 4MVNA 1GHBG 3RMLH 3TIUA 1P3CA 3E8LA 1UTQA 1Z7KA 2BDCA 4LOYH 1C5YB 1SGIB 2VU8E 2ZHWH 5F8XA 3SNCA 1MCVA 5AHGH 3CP7A 3E6PH 2AGEX 3SU5A 1YPEH 2FX4A 5EPNA 1TNJA 2WV4A 2A32A 2ZTXA 1K1OA 3LC3A 3SUEA 4B71A 3MH5A 1O2ZA 4YO9A 4YOJA 1L2EA 2ZDKA 3GDVA 1GBJA 5F03A 3ZZAA 2QCYA 4OS2A 3SI4H 1QJ6B 3UY9A 1AVWA 3UR6A 2A5KA 2ZHDA 1DM4B 2UUYA 5TCCA 1RRKA 1V6DA 1P04A 3A8AA 2ZFPH 2BD8A 2ZDVH 4K60A 5IDKA 4A92A 2H9HA 1O3GA 2FXRA 1WUNH 2AMQA 2A31A 1CU1A 1SVPA 1TABE 1VCWA 4F49A 1SSXA 3SU3A 3ZVGA 1H9HE 2G55A 2HNTC 1ZRKA 1Z8RA 3RXCA 1MU8B 1D3TB 2TGDA 1D6RA 2ODPA 1Y5UT 2ZQ1A 4WVPE 4BAQB 4AG2A 3MO3A 3TNTA 1ESBA 2IOTA 2SGDE 1GI7B 1DICA 4PROA 1T8LA 1Y5AT 2O8UA 4R0IA 1P01A 1C4Y2 1K1JA 3QX5H 2B0FA 1NFUA 2PTCE 1SGRE 3FAOA 4SGAE 5TJXA 2IPHA 2A4OA 1E38B 1OP2A 1Z6JH 1JOUB 2PTNA 2FOCA 2ILNA 3TGKE 3L6PA 4CR9A 1IQIA 3DT0H 5T3HA 5H4IB 3T2NA 1FY5A 1FZZA 2FEQH 2Z94A 3F6UH 2Y81A 5A0AE 2H5DA 3ZZ9A 1MU6B 3VGCC 2OTVA 4DW2U 1EX3A 1QRZA 1BRUP 4H6TA 4FU8A 1B5GH 1NM6A 1ELCA 1H8IH 5FX5A 3TGJE 1N6YA 2V3HH 4ZXXH 1TYNA 1SHYA 1GI6A 4LZ1H 2OINA 4DIHH 2BLVA 5L6NH 1LHFH 1VJAU 1AB9B 2QF0A 3SGBE 5DG6A 3SU4A 4DT7B 2WV5A 1SLXB 1PQ5A 3A83A 4NA7A 4YLUA 3GY7A 4AZ2B 1K1IA 3MWIU 1LVOA 1CHOF 1P9UA 3LONA 2FOHA 4DOQA 1FI8A 2ZG0H 2C3SA 1EAXA 3D23A 1TX7A 3ZZCA 2GD4B 3MH4A 1IQFA 1UJ1A 3HATH 1C1PA 3A7TA 2ALPA 4X6NA 3QWCH 5ESTE 1GBCA 4WH6A 1TE0A 1W14U 2XC0A 1S85A 3W94A 1O31A 2BQ6B 2TRMA 4XBBA 3GYLB 1TBRH 4DCDA 1UTKA 5FCRA 1C4V2 1AHTH 4K69A 6GCHG 2G51A 1FMGA 4CRAA 4IC5A 1NS3A 2Q6FA 4KTSA 1NY22 1GBAA 1SGCA 1DPOA 2BY8X 4HGCA 4WMFA 5DGJA 3GY2A 1NFYA 4B74A 3RC5A 2Y80A 1L4DA 4I31A 1P11E 3LOXA 1XXDA 1WOFA 1O38A 5DP6A 4OGXA 3RU4E 4OS4A 3UNSA 2BZAA 3F1SB 3U1JB 2Z3EA 3RDZA 2VVUA 1S0RA 2F9OA 1NT1A 3M3TA 5E8EH 2XWBI 6CHAB 1BBRE 3W95A 4B76A 3MTYA 2GMTB 2XBVA 3RM0H 5E2PA 1O30A 1P0SH 3A80A 3F9FA 3M3VA 1BMMH 1JRSA 1WU1A 3QZRA 3SNEA 3BG8A 4ABAA 4X8VH 1SLWB 1YF4A 5FAHA 1BRAA 5EXNA 2KAIA 2RCEA 1C1OA 2J94A 3ODFA 4K1TA 1BB0B 1A3BH 2C90B 2ZPRA 4CRCA 3A8BA 2QXJA 1MKWH 1BRCE 1C5WB 1LHCH 4FUGA 1BA8B 4IS5A 2ANYA 3U8OH 8GCHG 1NU9A 1DS2E 3PO1B 1MQ6A 2PW8H 4JYVH 3BIVH 4ABBA 8ESTE 1RD3B 2OC1A 6LPRA 1RIWB 1TALA 2VIWA 2Y7XA 2BDIA 1FUJA 1G2MA 1TLDA 5GDSH 1QIXB 2BYAX 4JK6A 1EATA 1CBWB 1MD7A 5A09A 3MU0A 4O9VA 1BTUA 3K65B 1F0UA 1AFQB 1P03A 3SZNA 3HGPA 4IBLH 1DT2A 5C2ZA 2K1QA 1O2TA 2GT8A 4IC6A 2UWOA 3SU2A 3STJA 2J4IA 2BXUH 3NCLA 4K1EA 3QO6A 1VGCB 1EB1H 1UK4A 3I77A 2V6NA 4UONA 1DUAA 3MU4A 4VGCB 3BTGE 3GCHB 3SV7A 1BUIA 5C20A 3KCGH 4U32A 1O5BB 1UVTH 3VFEA 2XNIA 1OWKA 5DP4A 2CF9H 4KP0A 4Z0KA 3KQBA 5EQSA 1AO5A 2NU1E 2B5TB 1UCYE 3SJKA 2ZGBH 2PUQH 7LPRA 5DPAA 4E06H 1W0YH 1CQQA 2XBWA 4OS7A 4BAHB 1AU8A 1GHXH 3MMGA 1VITH 3V0XA 4CRGA 1CGIE 2PWXA 5JBTA 1THSH 4UD9H 1AN1E 3PM3A 1N8OC 3N7OA 5A8XA 1EAUA 2G5VA 3VGCB 1ACBE 4CHAB 1XUIA 2D26C 4I8LA 1W2KH 1O5AB 5AF9H 1C2FA 5EODA 1H8DH 3GDUA 1DXWA 3MHWU 3OY5U 2VGCC 2WPJS 3F9EA 2FI5E 2Y5GA 1UTNA 2AEIH 1A1RA 2VWOA 2WYGA 1BRBE 1C2GA 1QNJA 3VEQB 3GY5A 2Y7ZA 1O3EA 1EZQA 1JIRA 4WWYA 3ELAH 5A8YA 4U01A 5PTPA 1AKSA 2BOKA 3MH7A 3RM2H 3A89A 1QURH 3BG4C 3TNSA 2CXVA 3LH3A 1GHAG 3SOSA 3R0FA 2F9BH 2ZC9H 1A0LA 1G3BA 5F8TA 1G3CA 4NGAH 1MUEB 3URDA 1Q3XA 4X2VA 3BTHE 1BDAA 1TGSZ 3LDXH 2Z3DA 1C1RA 1PPBH 5K0HA 3B23B 1GMDF 1BTZA 4YT7H 1MTWA 1C1QA 4UFDH 3U98H 5F6MA 1C5ZB 3ZVCA 4AB9A 1ZYOA 2OP9A 3LT3A 1AZ8A 2BVSH 1A5IA 4D9RA 1FPHH 2ZFSA 2SNWA 2J92A 4DY7B 3D62A 1ZMJA 4IW4E 5SGAE 1C9PA 3E1XB 1U6QA 1O2PA 5C5NA 1AE5A 3SGQE 4DGJA 4HTCH 1F0SA 3MU8A 4QT8C 4X6MA 3GDSA 8LPRA 1C1NA 2BM2A 2QGRA 1V2ST 1HJ8A 3GY3A 1LHDH 1JMOH 3MNXA 5DKMA 2O8WA 4UFFH 1GHAF 2H1UA 1P2JA 1WQSA 1RFNA 1HAPH 2HPPH 1WTGH 3SW2B 3HKIB 8KME2 2BD9A 1FDPA 1V2JT 3M7QA 1WV7H 4MPUA 2C8YB 2O8MA 2OBQA 5DP3A 1BBRK 1EZSC 3D65E 1GVKB 3T62A 1EZXC 4B2CA 1HBTH 2DUCA 1BHXF 4X1RU 1DWBH 4UE7H 1K1NA 5JPMH 1ZPZA 1TGBA 2BD5A 1CHGA 1C1MA 1C5PA 4DVAU 1W10U 4JZEH 1HUTH 1W12U 2OUAA 1D6WA 2O8LA 4CBNA 1TA6A 4A1XA 3M3SA 4FUDA 1Y3YA 3M61U 1GJDB 2FTLE 4X8SH 4D8NA 1YKTA 1FAKH 2OQ5A 4VGCC 3SORA 5E0JA 1QQ4A 3S9CA 3MO9A 4CBOA 1MTUA 3ZZDA 4ISLA 1TRNA 1K1MA 1SFQB 3QTVH 1UCYK 5A0BA 3A81A 1GBLA 4I8JA 1DOJA 1O3CA 3BTDE 5G4BA 2SGAA 2A4GA 1QBVH 2ZU1A 4Y79A 1BJUA 4THNH 2BDAA 3ZZ8A 1O5FH 2PSYA 5ABWA 1DWDH 5LPEA 2FLBH 4NCYA 5CHAC 1DE7H 1UCYH 3KHVA 1QJ1B 3DFJA 3MI4A 3LGVA 4ZUHA 2ZU3A 3UUZA 1ANDA 3AAVA 4DJZB 2DE8A 3H7TA 3M37A 3GICB 1GHWH 1NRQH 2Y5HA 2QN5T 3ZZ5A 2F9PA 4YESB 4NIWA 4ABDA 1NESE 1A0HB 1O0DH 4O3TA 2VIQA 4H42U 2HALA 3T25A 2QV1A 1EUFA 1DANH 2ANMH 3BEFB 1DLKB 1EXFA 2CV3A 1C4U2 1ZHMA 3LGTA 3GCTF 4KELA 3BN9A 3VB7A 3CS7A 4ABFA 4UFGH 1FPCH 1ELFA 5I25A 1OXGA 1O2QA 1AGJA 4FUJA 3LPRA 1LPKB 4NSYA 2YNAA 1K1PA 1EPTA 5EW1H 3LKWA 3FZZA 1UTMA 5CE1A 1H9IE 4GVUA 1BHXB 2WPKS 6CHAC 1EOJA 4ISIH 4Q7YA 2VGCB 1UTOA 1F5LA 3E90B 1C5OH 2JKHA 1O2YA 2C8WB 3PWCA 1QA7A 3RMMH 1GBTA 5GXPA 1O2OA 1HAOH 5FBEA 1EAIA 1YCPM 1EB2A 1ORFA 4ISNA 1MAYA 1SHHB 3CS0A 3A8CA 5GCHG 3S69A 3TGIE 1HCGA 3ATKA 5CHAB 1DFPA 1Y59T 3UIRA 3VPKA 2VVCA 1E0FD 1SGFA 4YOGA 2HNTF 1LQDB 2TGTA 1AVGH 1O2WA 2ZU2A 1GBHA 2A5IA 3F9HA 1IAUA 3ENSB 2ZFFH 2P16A 1SL3A 3UFAA 3SU0A 4OGYA 3ZVEA 4Y7BA 1TNHA 1AI8H 5DP9A 1GI9B 1BTWA 3I29A 4D7GA 1LPGB 2F91A 1BQYA 1RJXB 4NA9H 1K22H 3SQEE 4I8GA 2A7CA 2ODYB 2BY5X 1NN6A 1D3DB 1T8NA 2BX4A 3BIUH 1JWTA 2W26A 4IMZA 3QZQA 2A2QH 1KXCA 2GCHG 3HKJB 3BEIB 2BD7A 1GJ5H 1TNGA 1O3PB 2F9VA 5EQQA 2P59A 3PMAB 2I6SA 4WMDA 1GBBA 3D49H 2XW9A 3BTQE 1H9LB 1KXEA 2IN2A 1LVMA 2FOGA 3PLPA 1C5MD 1DXPA 1CT2E 4I33A 3KIDU 2ZDLA 4X8UH 3A7YA 5DO4H 4FVBA 1HAYB 2OLGA 1GPZA 1F92A 1P2OA 1YM0A 3M36A 4MNVA 3ZYEA 5I46H 1L0ZA 4RN6A 1KDQA 3RMOH 1NTPA 4HZHA 4NFEA 4WJG2 1T8OA 2BMGB 4ZMAH 1KLJH 1GMHG 2WPIS 1KXBA 1OSSA 2CF8H 5EXLA 1MQ5A 4WXIA 4ZKSU 1P05A 2Q6DA 2M5TA 4B1TA 1OS8A 2FS8A 3SUDA 2BLQA 1K9OE 4AYYB 1EJNA 3WY8A 2PFEA 3QTOH 1P2MA 1ARBA 2A45B 2ZHQH 1EQ9A 1LCYA 3KQCA 1KTSB 2GCTB 3UQVA 1HAHH 1TBQH 1P8VC 3KN2A 3C27B 2OXSA 3VXEH 1DY9A 4ZHMU 3FP8E 1DLEA 1ZJKA 2AMPA 1GL1A 1C5VA 4FUBA 4ABJA 1P57B 1O2XA 1AE8H 1ELAA 2VWMA 1UVSH 1GI0A 3A86A 4H6SB 3S0NA 2ESTE 1GHVH 1E37B 3LJOA 4X6PA 3IWMA 3SO3A 2BVXH 2WUCA 2ZTYA 5EU8A 3GY6A 2JH5D 1MD8A 3BG4B 4ESTE 1YPHE 2PLXA 1OPHB 1Z1JA 1EP5A 1FONA 3JZ1B 1D9IA 1SMFE 5J4SA 4JZ1A 4AN7A 2EEKA 3SV8A 5HXFA 1ELBA 5DP7A 1HXEH 1VCPA 2ZCKP 4A6LA 3MNSA 3S7HB 1MTVA 1TPOA 2FX6A 2STBE 3URCA 1F7ZA 1YBWA 1IQKA 3O8BA 3GOVB 2FS9A 3DD2H 2B9LA 2J38A 1UHBA 2QC2A 2GP9B 1FY1A 2BD2A 1ANEA 1ID5H 2W3KA 1ZGVA 1W11U 1IQJA 3RMNH 4YLQH 3TJOA 3PV4A 1ZJDA 3SV9A 1WCZA 3B9FH 1CHOG 3K2UA 1HGTH 3T27A 3TK6A 1K28D 1UTLM 2P3TB 2UUFB 5EXMA 2ZGCA 2PKSB 2NU2E 1J17T 2R3UA 3M5LA 3U8TH 1AZZA 2ASUB 1OOKB 1GMCG 3SV2H 5JYIA 5JDUB 4GAWA 4WMEA 4MLFB 1HLTH 3FP7E 1HV7A 2JETC 1O5DH 1WBGB 2AH4X 3GCHC 3NUMA 2JH6D 5T6DA 1XKBC 1VITF 1XUKA 1ZLRA 2WINI 2FODA 4Y8ZA 3TH4H 1ABJH 1CE5A 1V2KT 8GCHF 2FLRH 1IHTH 2XBYA 2PGBB 1TQ7B 4WH8A 5AVDA 1THRH 3UTUH 1TMBH 1TWXB 2YOLA 3ITIA 3UOPA 1IHSH 1M9UA 1XX9A 3STIA 1HFDA 1QR3E 1V2PT 1D4PB 2ZU5A 4X0WU 1ZRBA 3SV6A 4O03A 1UTPA 3T29A 1TPPA 1O3NA 1NU7B 2OC7A 3Q3XA 4XDEA 4YZUA 2BQWB 4ZHAA 1X7AC 4XE4A 1LPZB 2F9UA 1G30B 3VB6A 4BTTB 4UEHH 1IQNA 3MFJA 2D1JA 4TWWA 3A8DA 3LU9B 2ZKSA 2V0BA 4X2XA 1ELEE 2AS9A 2ZPQA 3SU1A 3BTTE 5DP8A 1QCPA 3TH3H 5FPYA 3RXOA 1OWEA 1O5CB 2BY6X 1O3JA 1P2IA 5C1UA 1T31A 1QJ7B 3FFGA 3UREA 4LK4A 1GDNA 3UWJH 1NRNH 3QN7A 2BXTH 5T6GA 3HGNA 3S9BA 3RXSA 4NSVA 1GG6B 2WUBA 1C1SA 3UOUA 3BTEE 1XUGA 1VGCC 3PLBA 1BJVA 4X1NU 4X8TH 2B7DH 1OYQA 3EDXB 3ODDA 2BY7X 3A7VA 1YGCH 5C3NA 4X1SU 5E0GA 1C2HA 1OP8A 4O97A 2AYWA 3A7WA 4F4OC 3IG6B 2O8TA 3NPSA 2RDLA 4BANB 2C8ZB 1CBWC 1V2VT 4FUHA 3SBKA 4X2WA 1ZR0A 4J2YB 3TPIZ 4MDSA 1HRTH 1RIWC 1S6HA 1FIZA 2QF3A 1ELTA 3TJUA 3SUGA 3UR9A 4ISOA 3MH6A 2ZGXH 2ZI2H 1O2RA 2BX3A 3AAUA 2Y6TA 1DSTA 2FMJA 3OY6U 2A5AA 1RGQA 1A7SA 1MTNC 2H2ZA 3S9AA 2TIOA 1KLIH 1GJCB 2THFB 1MBMA 2HVXA 1P2QA 1E35B 3TVJB 2P8OC 4FU7A 1GBIA 1S5SA 4JZIA 1ZSJA 2SGQE 2A0QB 7GCHG 2AERH 1CA0C 2HNTE 1RTLA 2CJIA 4OS1A 1SGFG 1KSNA 1EPTB 1AY6H 1IQEA 1Y3WA 1F5RA 4OS5A 4AB8A 3P6ZB 3PMJA 1YCPK 2ZIQH 3GY8A 3Q3YA 4DG4A 4YOIA 1O36A 1XUFA 2FZZA 5FX6A 1IQHA 1NRRH 2GTBA 3ZVFA 5B6OA 2QYIA 4BAKB 1MCTA 3ZZ6A 3PMBB 1W8BH 1TX6A 4I32A 1AVXA 1YC0A 1TRYA 1O3AA 5DK1A 3ZYDA 4AFUA 1B0FA 1C1UH 1XKAC 2PUXB 3SJ8A 5L2ZH 2VIDA 2EI8A 3F68H 1SGNE 3P8GA 5FPTA 3SQHE 4M7GA 5HMAA 1PPEE 3FZDA 1FN6A 1NFXA 1QL9A 1GL0E 2HOBA 1OYTH 1YPKH 2SGPE 1C2IA 1HPGA 2ZDMA 3H5CB 5F8ZA 3M35A 3SJ9A 3EQ0H 3HK3B 3Q3KA 1QBOA 2PSXA 5JBCS 3GCTG 2KAIB 4D76A 1QHRB 3GYMA 3BSQA 3KF2A 4CRFA 2FOEA 1TGCA 2FO9A 4B73A 3TH2H 4CRBA 3SNAA 1T4UH 1AFEH 2GV6A 3MOCA 1TPAE 1BTHH 3RLWH 3U9AH 1FN8A 1AKSB 1A61H 2XBXA 2F9NA 1GHZA 4IGDA 5GIBA 1EP6A 3JZ2B 4BTIB 3RXQA 2DE9A 1G37A 3PTNA 6ESTA 1G32B 3P8NA 1B0EA 4BXWA 1G3EA 1T4VH 1O5EH 1FXYA 1EKBB 1H4WA 2XC4A 1JRTA 2OQUA 3M5OA 1JXPA 2HRVA 3MU5A 1VZQH 4K8BA 2VINA 2GT7A 1Q31A 2QY0B 1DUEA 2J95A 3IITA 1O34A 2P94A 1QBNA 1MTNB 4FUIA 1PPZA 4A1VA 2PV9B 2Z3CA 3QLPH 1KIGH 3RU4D 2FYRA 1WAYB 5HM9A 3L33A 1CVWH 3VB5A 3T5FH 1GBKA 4LZ4B 5JB9S 4XOJA 1EOLA 2Z9GA 3RXUA 4KGAA 1KLTA 1O3FA 4H4FA 1V2RT 3ZVBA 4YTAA 2FM2A 1W7XH 1GGDC 1TNKA 4BOHA 2FP7B 2UWLA 1S0QA 2Q1JA 2ODQA 5CMXH 3NKKA 1FY4A 3RXDA 3RXTA 4Y6DA 1WQVH 1G36A 2BOHB 1C1WH 2EI6A 3TJVA 4FVDA 2Z9KA 4HFPB 1FY3A 3UWIA 3EA8A 3ZV8A 1CGJE 1C1VH 3RXIA 3LC5A 1DX5M 1NPMA 4NWKA 3K6YA 1PPCE 1Z8GA 1MAXA 4Z6AH 2QA9E 4TWYA 3PWBA 3EGKH 1L1NA 4WF8A 4AFZA 4A5TS 1BTPA 2AGGX 2BLWA 2FI3E 1UTJA 5JB8S 1RTFB 1FJSA 3P95A 4WY3A 1KTTB 1MKWK 1WSSH 3Q77A 1HJ9A 1IQMA 2HWLB 2XCFA 2VNTA 1HAIH 1QL8A 3KL6A 1O3MA 1SC8U 2Y5FA 2BD3A 1PFXC 2TPIZ 4IMQA 4INHA 4ZROA 3SHCH 2GKVE 3ZZ4A 5GCHF 1FQ3A 1O3IA 3AVZA 4AG1A 3M7UA 5DP5A 1DITH 1Z6EA 1SGPE 5EOKA 4ZXYH 3TITA 4BAOB 4B2AA 1GCDA 1LTOA 3SNBA 4JYTA 1P9SA 1SB1H 1QA0A 2G8TA 3QDZB 1UK3A 4BAMB 1OP0A 1Z71A 4TY7A 4NG9H 3RC6A 1ZPBA 4JZDH 2QAAA 1JIMA 4MNYA 3TU7H 3TK9A 1QFKH 2Y82A 1C5LH 1AWFH 4AORA 1THPB 4Y11E 4XSKU 1AUTC 2HPQH 3QK1A 2FPZA 2D8WA 2ZGJA 1V2NT 1TB6H 4MPVA 4OS6A 1A2CH 2R3YA 4FUFA 1DY8A 4Q80A 3GCNA 1TAWA 2ZQ2A 1ZGIA 1ZZZA 4MQAA 3RU4T 1BMLA 2H5CA 4Y10E 1XVMA 1N6XA 1PQ8A 3GISB 3BV9B 1E36B 2QXIA 3LIWA 1WTHD 2Q6GA 1N1LA 1O2MA 5FHTA 1B7XB 2R2WU 3ZV9A 3RXBA 4FUCA 3ZZBA 1GI1A 1T8MA 1DWEH 2ZO3H 4Q7XA 3ZVDA 1RTKA 1TNLA 1YYY1 2AIPA 2BD4A 4X2YA 1O3BA 2G00A 2GDDA 1DSUA 1TGTA 1FIWA 3RC4A 1OWIA 1PYTC 3BTWE 1DDJA 1Y3XA 1UMAH 1SLVB 2W5EA 4DIIH 4E7NA 1V2WT 1G9IE 3RXAA 3FANA 1MMJN 3LJJA 5A2MH 1TGNA 4GHQA 2VVVA 1Y5BT 1FLEE 1QQUA 3I78A 4YM9A 4IN1A 4YT6H 3T28A 2ANWA 3QUMP 3PB1E 4GLYA 5IYTA 1A5HA 2ZPSA 2PHBA 3E16B 2G52A 3NWUA 1J16A 1Z1IA 3KEEA 3V3MA 4Y76A 3EYDA 4NA8A 2ULLA 5HGGA 2R9PA 2HGTH 3GCOA 2GX4A 4BTUB 3C1KA 1MBQA 5JBAS 1TFXA 1EAWA 1ZTKA 1HXFH 1TPSA 2H9EH 9LPRA 1EJAA 2Z9LA 1O2UA 3LGWA 3NZIA 4X6OA 5DJ7A 1BMAA 2ZU4A 1PJPA 1GBMA 3KGPA 4JCNA 2ZP0H 2W3IA 2UUKB 2JH0D 3HK6B 1HB0B 1YPHC 4Y0ZE 3K6ZA 1C5QA 1SLUB 1HJAC 1BITA 3OU0A 4FXGH 3TJNA 2EA3A 5FBIA 5C5OA 2BDHA 1EASA 4GUXA 4JYUH 2FOBA 4X1QU 4A7IB 1G3DA 1XUHA 2GCTC 1DWCH 1C2JA 4BXSA 2SNVA 4NIXA 1OWJA 2IJOB 4Q2KA 2TGAA 5TCAA 4ISHH 4WXVA 1GBDA 2PKAA 1C5XB 3A7ZA 1TRMA 1LKBA 1VCQA 2WPMS 1L1GA 3MU1A 1O2SA 1Z8IB 1GMCF 2CHAC 3ZVAA 2CN0H 1P10A 2G4TA 5GJ4B 3UQOA 1P02A 1YCPH 1VR1H 1C5TA 1O39A 4D7FA 3LGUA 1GHYH 1GWAA 1QRWA 3FP6E 1UVUH 2OC0A 3MYWA 2ZZUH 1BBRH 3E3TA 1GG6C 2FYQA 1XUJA 2JETB 4BNRA 1ETRH 1TNIA 1SOZA 4NZQA 7GCHF 1EZUC 1ANCA 5LGOA 2BHGA 1S6FA 1GCTB 2F3CE 1GVLA 2BDGA 3RXJA 2BDYA 1PQAA 3ZZ7A 5EW2H 2G81E 1XM1A 4ABEA 2OC8A 4ABHA 3RXEA 2FI4E 3ESTA 4KKDA 3RP2A 4ABIA 2XRCA 1W7GH 1SOTA 1ETTH 2G5NA 1SBWA 2ZDAH 1ELGA 1TQ0B 5BRRE 2A4RA 3U69H 4DURA 2R2MB 3OTJE 3M7TA 1QB6A 4NIVA 3TLOA 1V2UT 5J4QA 2BQ7B 1P2KA 5L30H 5C1XA 4GHTA 2NU3E 1LKAA 5FCKA 1ZSKA 3AW0A 3ATIA 1AD8H 3RXKA 1O33A 4NZLA 1GJBB 1KY9A 1EJMA 4RKOB 2XXLA 1C2EA 1HAVA 1O2GH 1KXDA 2P93A 1V3XA 4X1PU 1K1LA 1OWDA 2O9QA 2VJ1A 1KXFA 3K9XB 1AMHA 1F2SE 1F0RA 3PTBA 1SQOA 5EQRA 1AWHB 1BOQA 3A85A 1PPFE 3LGYA 3NK8A 5AFYH 2GV7A 1HIAB 3BTFE 2STAE 4AX9H 2FESH 2NU4E 2UWPA 1GGDB 1O3OA 4K1SA 3B8JA 3MNBA 3OYPA 3Q00A 3E0PB 1J8AA 1TIOA 2RA0A 1YP9A 1HYLA 1GHBF 2VIOA 4B2BA 2W7SA 4NFFA 4ZHLU 4K5ZA 1Y3VA 3DFLA 5ETXA 5A0CA 3DHKH 3Q76A 4MPWA 1XVOA 4FUEA 1S83A 1GJ6A 1ZTLA 2A7HA 4Q7ZA 3A84A 2R0KA 2I6QA 3ATWA 1QTFA 2WPHS 1V2TT 1G2LA 2VIVA 4D9QA 2BTCE 5E0HA 2QXGA 2PGQB 2LPRA 1A46H 4IN2A 1VJ9U 1KYNA 2UUJB 2FDAA 1S84A 2WYJA 5FPSA 4I7YH 3SGAE 4TPIZ 1C1TA 1UK2A 2RA3A 1XXFA 5EGMA 2TGPZ 1AFQC 1GVZA 2LNCA 1O2VA 3LGIA 1GDQA 2BY9X 2ZDNA 3RLYH 7ESTE 1IQLA 5EG4A 1CT4E 3OX7U 1BTXA 3O8DA 1GJ7B 1MZDA 1HAZB 1P2NA 2FOFA 1ARCA 3E91A 3PROA 3EAJA 1SG8B 2J9NA 3BEUA 1O37A 2ZECA 1XMNB 3G01A 2ZF0H 4SGBE 1S82A 1NFWA 2V35A 5GPIB 1GDUA 3DA9B 1O3LA 1V2QT 1PYTD 4RKJB 1C2KA 2ZFTA
chains in the Genus database with same CATH superfamily
1W0ZU 4GCHG 2XWAA 1FV9A 1C2MA 5HM2A 1VITG 1GI3A 4CHAC 3TK5A 2FOMB 4GCHF 4MG3A 3V12A 1T7CA 2F83A 1SGTA 2AFQB 4RSPA 4CH2B 3RUOA 3EA9A 1OKXA 3UNQA 2NU0E 5B6LA 2EI7A 3MNCA 4KTUA 2EC9H 1TOCB 1YPMH 2CGAA 3PRDA 1INCA 2AMDA 4CRDA 5LPRA 3T26A 1UO6A 1O32A 1O5GH 1TA2A 2GGVB 1ZTJA 3RXFA 1GJ9B 1NO9H 1SQTA 2SFAA 3QGJA 3SJIA 3A82A 1PPHE 2R0LA 3U28C 1Y3UA 1O35A 3P70B 4Y8XA 1PQ7A 2J34A 2GMTC 4HI3A 1LDTT 1MTSA 2WPLS 3N7DA 2A4QA 2BZ6H 1O2IA 2GCHF 1C2DA 1YLCA 3MO6A 2VH0A 1SQAA 1C5RA 2AGIX 1C5UA 2OCVB 3SZEA 3U1IB 4NIYA 1MKXK 1ZSLA 2P3UB 1TBZH 3P8OA 4MNWA 1LVYA 1QGFA 5AFZH 2EY4C 3E0NB 1MH0A 1LMWB 1V2MT 3RXHA 3KNXA 5FXLA 4U30A 3M5MA 1GJAB 2P3FH 5GWZA 1O3KA 1BZXE 2QE7D 3F9GA 3SU6A 1SGYE 2YNBA 1NZQH 2VWNA 1ZOMA 4CH8B 2XTTB 1GI5A 2VWLA 2ZCHP 3OSYA 3PMHB 3P8FA 1FNIA 2OD3B 4CREA 1TOMH 1AIXH 1J9CH 4E05H 1L4ZA 1C2LA 1LO6A 1SR5C 3L3TA 2A7JA 2C4FH 2VH6A 1CSOE 1BMNH 1OX1A 2J2UA 4K8YA 3EE0B 3RXVA 2GZ9A 5C67A 1A3EH 3O8CA 2BDBA 2V3MA 1T32A 1GMHF 3CENA 4Y8YA 4K2YA 3ZZ3A 3A87A 2V3OH 1ESAA 2QIQA 1QZ8A 1A5GH 2A1DB 5T6FA 1C5SA 4RT0A 5KECA 4Y7AA 4ZKRU 3PLKA 3RXRA 4CR5A 1Q2WA 1O2JA 1P3EA 4AYVB 4JZFH 1K2I1 1J14A 2AIQA 4P00A 1HJAB 1P06A 2Z9JA 2FIRH 1O3DA 1ANBA 1GMDG 3SJOA 2ZWLH 5LH8A 2P95A 2ZTZA 3HPTB 1EPTC 2SGEE 4AFSA 3O8RA 5K7RA 4INKA 3BF6H 2BVRH 4MNXA 3R3GB 2CMYA 4J1YA 1ESTA 1ZPCA 2BB4A 2D2DA 5BPEA 4I8HA 1IQGA 1P12E 1S6LA 4I8KA 4FU9A 1ELDE 1K21H 4Y0YE 3EA7A 1D3QB 2ANKH 3UPEA 3V13A 1LQEA 4AFQA 1UVPA 1GCTC 1QB1A 1V2LT 2C93B 1NROH 1WYKA 3NXPA 2GZ8A 1SPJA 4TYDA 3SNDA 1TX8A 1MZAA 1O2LA 2ZA5A 1O2NA 4GPGA 1HIAA 2RG3A 2FOAA 1GBFA 1O3HA 3RXGA 5A8ZA 1HAXB 2PR3A 4LXBH 2ZFRH 1ETSH 4NWLA 1CGHA 1ELVA 1GJ4H 1D3PB 5LPFA 1GI4A 1ZHRA 3GY4A 1GI8B 1C9TA 1L1JA 5T1VA 1QY6A 1C5NH 1AQ7A 4XBDA 3SHAH 3H7OA 1OWHA 1A0JA 1HAVB 2SGFE 3DUXH 4ABGA 1CO7E 1Z8JB 2CHAB 1YLDA 4U2WA 4ZKOU 2XCNA 3RXLA 5L2YH 1CA0B 2ZFQH 4ASHA 4ZH8A 1TMTH 1ZMNA 2TBSA 2B8OH 2C8XB 1RXPA 4A1TA 1BCUH 1AUJA 2GVFA 1SFIA 1GJ8B 1UVOA 3VXFH 4GSOA 1A4WH 2H6MA 1F5KU 1HAGE 2XOKD 2H9TH 1S81A 1NC6A 3V7TA 2FTMA 2ZEBA 1LVBA 4UDWH 1AB9C 2XYAA 2GDEH 1E34B 3AW1A 1GBEA 1JBUH 3BTME 2LP6A 3KQEA 2BLOA 3F3BA 9ESTA 4E7RG 1SGDE 2PKSC 4AGJA 4ZAEA 3QGNB 1P09A 1ABIH 2ZCLP 1O2HA 2VB0A 1SGEE 4TPYA 1W3CA 2Z6BD 1SGQE 2NWNA 2HLCA 4ZKNU 2A2XH 4KTCA 2ZGHA 4K3JA 1EFRD 4XBCA 3A88A 1FY8E 1GI2A 4XFQA 4R8TB 2ALVA 3BTKE 4MTBA 4UFEH 1Y8TA 2ZNKH 7KMEH 4JMYA 2QXHA 2OK5A 4AGKA 2W7UA 3M5NA 3A7XA 3N99A 2OBOA 5JBBS 3SUFA 3U8RH 1BIOA 1YPGH 2PKAB 6GCHF 4Y71A 3SN8A 1LHGH 1NRPH 3SI3H 1TMUH 1HDTH 3PO1C 2ZHFH 2ZHEH 4O3UA 1DVAH 3VB3A 4INLA 1TONA 5C1YA 1LHEH 3F2HA 1HNEE 4F55A 5HYOA 1J15A 5ESBA 3S7KB 3KQDA 1ZHPA 1KDQB 1N8OB 2Z9IA 3RXMA 4RT1A 3P92A 2XC5A 1H1BA 1F0TA 1CA8B 2G4UA 2Z7FE 2P8OB 1IOEA 1FAXA 3P17H 1BT7A 3LH1A 1CT0E 1YPJH 3FVFB 1V2OT 2W6ID 2GZ7A 1RS0A 1SI5H 4MPXA 3UNRA 3RXPA 3VB4A 4JK5A 1YPLH 4B75A 4TY6A 2FWWA 1O2KA 1KXAA 2VIPA 1NRSH 3AASA 1BTYA 5EPYA 3ATMA 4AOQA 1ZMLA 5E2OA 1QL7A 1MKXH 3PYHA 1QRXA 1UHBB 2YMSC 1W13U 1QB9A 3ATLA 4AC9A 1PPGE 4MVNA 1GHBG 3RMLH 3TIUA 1P3CA 5KGOA 3E8LA 1UTQA 1Z7KA 2BDCA 4FOUC 4LOYH 1C5YB 1SGIB 2VU8E 2ZHWH 5F8XA 3SNCA 1MCVA 5AHGH 3CP7A 3E6PH 2AGEX 3SU5A 1YPEH 2FX4A 5EPNA 1TNJA 2WV4A 2A32A 2ZTXA 1K1OA 3LC3A 3SUEA 4B71A 3MH5A 1O2ZA 4YO9A 4YOJA 2KZ4A 1L2EA 2ZDKA 3GDVA 1GBJA 5F03A 3ZZAA 2QCYA 4OS2A 3SI4H 1QJ6B 3UY9A 1AVWA 3UR6A 2A5KA 2ZHDA 1DM4B 2UUYA 5TCCA 1RRKA 1V6DA 1P04A 3A8AA 2ZFPH 2BD8A 2ZDVH 4K60A 5IDKA 4A92A 2H9HA 1O3GA 2FXRA 1WUNH 2AMQA 2A31A 1CU1A 1SVPA 1TABE 1VCWA 4F49A 1SSXA 2IPQX 3SU3A 3ZVGA 1H9HE 2G55A 2HNTC 1ZRKA 1COWD 1YY3A 1Z8RA 3RXCA 1MU8B 1D3TB 2TGDA 1D6RA 2ODPA 1Y5UT 3N7EA 2ZQ1A 4WVPE 4BAQB 4AG2A 3MO3A 3TNTA 1ESBA 2IOTA 2SGDE 1GI7B 1DICA 3OTPA 4TSFD 4PROA 3W1EA 1T8LA 1Y5AT 2O8UA 4R0IA 1P01A 5DSFA 1C4Y2 1K1JA 3QX5H 4XD7D 2B0FA 1NFUA 2PTCE 1SGRE 3FAOA 4SGAE 3SYJA 5TJXA 2IPHA 2A4OA 1E38B 1OP2A 1Z6JH 1JOUB 2PTNA 3DSOA 2FOCA 2ILNA 3TGKE 3L6PA 4CR9A 1IQIA 3DT0H 5T3HA 5H4IB 3T2NA 1FY5A 1FZZA 2FEQH 2Z94A 3F6UH 2Y81A 5A0AE 2H5DA 3ZZ9A 1MU6B 3VGCC 2OTVA 4DW2U 1EX3A 1QRZA 1BRUP 4H6TA 4FU8A 1B5GH 1NM6A 1ELCA 1H8IH 5FX5A 3TGJE 1N6YA 2V3HH 4ZXXH 1TYNA 1SHYA 1GI6A 4LZ1H 2OINA 4DIHH 2BLVA 5L6NH 1LHFH 1VJAU 1AB9B 2QF0A 3SGBE 5DG6A 3SU4A 4DT7B 2WV5A 1SLXB 3MQKC 1PQ5A 3A83A 4NA7A 4YLUA 3GY7A 4AZ2B 1K1IA 3MWIU 1LVOA 1CHOF 1P9UA 3LONA 2FOHA 4DOQA 1FI8A 2ZG0H 2J5UA 2C3SA 1EAXA 3D23A 1TX7A 3ZZCA 2GD4B 3MH4A 4B6EA 1IQFA 1UJ1A 3HATH 1C1PA 3A7TA 2ALPA 4X6NA 3QWCH 5ESTE 1GBCA 4WH6A 1TE0A 1W14U 2XC0A 1S85A 3W94A 1O31A 2BQ6B 2TRMA 4XBBA 3GYLB 1TBRH 4DCDA 1UTKA 5FCRA 1C4V2 1AHTH 4K69A 6GCHG 2G51A 2M2AA 1FMGA 4CRAA 4IC5A 1NS3A 2Q6FA 5KEDA 4KTSA 1NY22 1GBAA 1SGCA 1DPOA 2BY8X 4HGCA 4WMFA 5DGJA 3GY2A 1NFYA 4B74A 3RC5A 2Y80A 1L4DA 4I31A 1P11E 4ASUD 3LOXA 1XXDA 1WOFA 1O38A 5DP6A 4OGXA 2KCOA 3RU4E 4OS4A 3UNSA 2BZAA 3F1SB 3U1JB 2Z3EA 3RDZA 2VVUA 1S0RA 2F9OA 1NT1A 3M3TA 5E8EH 2XWBI 6CHAB 1BBRE 3W95A 4B76A 3MTYA 2GMTB 2XBVA 3RM0H 5E2PA 1O30A 1P0SH 3A80A 3F9FA 2QF4A 3M3VA 1BMMH 3WWFA 1JRSA 1WU1A 2JDID 3QZRA 3SNEA 3BG8A 4ABAA 4X8VH 1SLWB 1YF4A 3ZIAD 5FAHA 1BRAA 5EXNA 2KAIA 2RCEA 1C1OA 1YLNA 2J94A 3ODFA 2CK3D 4K1TA 1BB0B 1A3BH 2C90B 2ZPRA 4CRCA 3A8BA 2QXJA 1MKWH 1BRCE 1C5WB 1LHCH 4FUGA 1BA8B 4IS5A 2ANYA 3U8OH 8GCHG 1NU9A 1DS2E 3PO1B 1MQ6A 2PW8H 4JYVH 3BIVH 4ABBA 2V7QD 1RD3B 2OC1A 8ESTE 6LPRA 1RIWB 1TALA 2VIWA 2Y7XA 2BDIA 1FUJA 1G2MA 1TLDA 3F0OA 5GDSH 1QIXB 2BYAX 4JK6A 2GJGA 1EATA 2KX4A 1CBWB 1MD7A 5A09A 3MU0A 4O9VA 1BTUA 3K65B 1F0UA 1AFQB 1P03A 3SZNA 2XNDD 3HGPA 4IBLH 1DT2A 5C2ZA 2K1QA 1O2TA 2GT8A 4IC6A 2UWOA 3SU2A 3STJA 2J4IA 2BXUH 3NCLA 4K1EA 3QO6A 1VGCB 1EB1H 1UK4A 3I77A 2V6NA 4UONA 1DUAA 3MU4A 4VGCB 3BTGE 3GCHB 3SV7A 3AK5A 1BUIA 5C20A 3KCGH 4U32A 1O5BB 1UVTH 2J98B 3VFEA 2XNIA 1OWKA 5DP4A 2CF9H 4KP0A 4Z0KA 3KQBA 5EQSA 1AO5A 2NU1E 2B5TB 1UCYE 3SJKA 2ZGBH 2PUQH 7LPRA 5DPAA 4E06H 1W0YH 1CQQA 2XBWA 4OS7A 4BAHB 1AU8A 1GHXH 3MMGA 1VITH 3V0XA 4CRGA 1CGIE 2PWXA 5JBTA 1THSH 4UD9H 1AN1E 3PM3A 1N8OC 3N7OA 5A8XA 1EAUA 2G5VA 3VGCB 1ACBE 4CHAB 1XUIA 2L74A 2D26C 4I8LA 1W2KH 1O5AB 5AF9H 1C2FA 5EODA 1H8DH 3GDUA 1DXWA 3MHWU 3OY5U 2VGCC 2WPJS 3WWBA 3F9EA 2FI5E 5C0UA 2Y5GA 1UTNA 2AEIH 1A1RA 2VWOA 2WYGA 1BRBE 1C2GA 1QNJA 3VEQB 3GY5A 1SQRA 1O3EA 2Y7ZA 1EZQA 2L6OA 1JIRA 4WWYA 3ELAH 5A8YA 4U01A 5PTPA 1AKSA 2BOKA 3MH7A 3RM2H 3A89A 1SKYE 1QURH 3BG4C 3TNSA 2CXVA 3LH3A 1GHAG 3SOSA 3R0FA 2F9BH 2ZC9H 1A0LA 1G3BA 5F8TA 1G3CA 4NGAH 1MUEB 3URDA 1Q3XA 4X2VA 3BTHE 5EJLA 1BDAA 1TGSZ 3LDXH 2Z3DA 1C1RA 1PPBH 5K0HA 3B23B 1GMDF 1BTZA 4YT7H 1MTWA 1C1QA 4UFDH 5HIYA 3U98H 5F6MA 1C5ZB 3ZVCA 4AB9A 1ZYOA 2OP9A 3LT3A 1AZ8A 2BVSH 1A5IA 2HVYB 4D9RA 1FPHH 2ZFSA 2SNWA 2J92A 4DY7B 3D62A 1ZMJA 4IW4E 5SGAE 1C9PA 3E1XB 1U6QA 1O2PA 5C5NA 1AE5A 3SGQE 4DGJA 4HTCH 1F0SA 3MU8A 1YWUA 4QT8C 4X6MA 3GDSA 8LPRA 1C1NA 2BM2A 2QGRA 1V2ST 1HJ8A 3GY3A 1LHDH 1JMOH 3MNXA 5DKMA 2O8WA 4UFFH 1GHAF 2H1UA 1P2JA 1WQSA 1RFNA 1VKYA 1HAPH 2HPPH 4M9FA 1WTGH 3SW2B 3HKIB 8KME2 2BD9A 1FDPA 1V2JT 3M7QA 1WV7H 4MPUA 2C8YB 3VG8A 2O8MA 2OBQA 5DP3A 1BBRK 1EZSC 3D65E 1GVKB 3T62A 1EZXC 4B2CA 1HBTH 2DUCA 1BHXF 4X1RU 1DWBH 4UE7H 3WW7A 1K1NA 5JPMH 1ZPZA 1TGBA 2BD5A 1CHGA 1C1MA 1C5PA 4DVAU 1W10U 4JZEH 1HUTH 1E79D 1W12U 2OUAA 1D6WA 2O8LA 4CBNA 1TA6A 4A1XA 3M3SA 4FUDA 1Y3YA 3M61U 1GJDB 2FTLE 4X8SH 3FN8A 1OHHD 4D8NA 1YKTA 1FAKH 2OQ5A 4VGCC 3SORA 5E0JA 1QQ4A 3S9CA 3MO9A 4CBOA 1MTUA 3ZZDA 4B6FA 2JJ2D 4ISLA 1TRNA 1K1MA 1SFQB 3QTVH 1UCYK 5A0BA 3A81A 1GBLA 4I8JA 1DOJA 1O3CA 3BTDE 5G4BA 2SGAA 2A4GA 1QBVH 2ZU1A 4Y79A 1BJUA 4THNH 2BDAA 3ZZ8A 1O5FH 2PSYA 5ABWA 1DWDH 5LPEA 1W0KD 2FLBH 4NCYA 5CHAC 1DE7H 1UCYH 3KHVA 1QJ1B 3DFJA 3MI4A 3LGVA 4ZUHA 2ZU3A 3UUZA 1ANDA 3AAVA 4DJZB 2DE8A 3H7TA 5CHBA 3M37A 3GICB 1GHWH 1NRQH 2QN5T 2Y5HA 1BMFD 3DCLA 2RDEA 3ZZ5A 2F9PA 4YESB 4NIWA 4ABDA 1NESE 1A0HB 1O0DH 4O3TA 2VIQA 4H42U 2HALA 3T25A 2QV1A 1EUFA 1DANH 2ANMH 3BEFB 1DLKB 1EXFA 2CV3A 2WV9A 1C4U2 1ZHMA 3LGTA 3GCTF 4KELA 3BN9A 3VB7A 3CS7A 4ABFA 4UFGH 1FPCH 1ELFA 5I25A 1OXGA 1O2QA 1AGJA 4FUJA 3LPRA 1LPKB 4NSYA 2YNAA 1K1PA 1EPTA 5EW1H 3LKWA 3FZZA 1UTMA 5CE1A 1H9IE 4GVUA 1BHXB 2WPKS 6CHAC 1EOJA 4ISIH 4Q7YA 2VGCB 1UTOA 1F5LA 3E90B 1C5OH 2JKHA 1O2YA 2C8WB 3PWCA 1QA7A 3RMMH 1GBTA 5GXPA 1O2OA 1HAOH 5FBEA 1EAIA 1YCPM 1EB2A 1ORFA 4ISNA 1MAYA 1SHHB 3CS0A 3A8CA 5GCHG 3S69A 3TGIE 1HCGA 3ATKA 5CHAB 1DFPA 1Y59T 3UIRA 3VPKA 2VVCA 1E0FD 1SGFA 4YOGA 2HNTF 1LQDB 2TGTA 1AVGH 1O2WA 1E1QD 2ZU2A 1GBHA 2A5IA 3F9HA 1IAUA 3ENSB 2ZFFH 2P16A 1SL3A 3KQ5A 3UFAA 3SU0A 4OGYA 3ZVEA 4Y7BA 1TNHA 1AI8H 5DP9A 1GI9B 1BTWA 3I29A 4D7GA 1LPGB 2F91A 1BQYA 1RJXB 4NA9H 4XRNA 1K22H 3SQEE 4I8GA 2A7CA 2LELA 2ODYB 2BY5X 1NN6A 4Q63A 1D3DB 1T8NA 2BX4A 3BIUH 1JWTA 2W26A 4IMZA 3QZQA 2A2QH 1KXCA 2GCHG 3HKJB 3BEIB 2BD7A 1GJ5H 1TNGA 1O3PB 2F9VA 5EQQA 2P59A 3PMAB 2I6SA 4WMDA 1GBBA 3D49H 2XW9A 3BTQE 1H9LB 1KXEA 2IN2A 1LVMA 2FOGA 3PLPA 1C5MD 1DXPA 1CT2E 4I33A 2YMSD 3KIDU 2ZDLA 4X8UH 3A7YA 3FKSD 5DO4H 4FVBA 1HAYB 2OLGA 1GPZA 1F92A 1P2OA 1YM0A 3M36A 4MNVA 3ZYEA 5I46H 1L0ZA 4RN6A 1KDQA 3RMOH 1NTPA 4HZHA 4NFEA 4WJG2 1T8OA 2BMGB 4ZMAH 1KLJH 1GMHG 2WPIS 1KXBA 1OSSA 3EE7A 2CF8H 5EXLA 1MQ5A 4WXIA 4ZKSU 1P05A 2Q6DA 2M5TA 4B1TA 1OS8A 2FS8A 3SUDA 2BLQA 1K9OE 4AYYB 1EJNA 3WY8A 2PFEA 3QTOH 1P2MA 1ARBA 2A45B 2ZHQH 4HG6A 1EQ9A 1LCYA 3KQCA 1KTSB 2GCTB 3UQVA 1HAHH 1TBQH 1P8VC 3KN2A 3C27B 4F48B 2OXSA 3VXEH 1DY9A 4ZHMU 3FP8E 1DLEA 1ZJKA 2AMPA 1GL1A 1C5VA 4FUBA 4ABJA 1UW7A 1P57B 1O2XA 1AE8H 1ELAA 2VWMA 1UVSH 1GI0A 3A86A 4H6SB 3S0NA 2ESTE 1GHVH 1E37B 3LJOA 4X6PA 3IWMA 3SO3A 2BVXH 2WUCA 2ZTYA 5EU8A 3GY6A 2JH5D 1MD8A 3BG4B 4ESTE 1YPHE 2PLXA 1OPHB 1Z1JA 1EP5A 1FONA 3JZ1B 1D9IA 1SMFE 5J4SA 4JZ1A 4AN7A 2EEKA 3SV8A 2JJ1D 5HXFA 1ELBA 5DP7A 1HXEH 1VCPA 2ZCKP 4A6LA 3MNSA 3S7HB 1MTVA 1TPOA 2FX6A 2STBE 3URCA 1F7ZA 1YBWA 1IQKA 3CNRA 3O8BA 3GOVB 2FS9A 3DD2H 2B9LA 2J38A 1UHBA 2QC2A 2GP9B 1FY1A 2BD2A 1ANEA 1ID5H 2W3KA 1ZGVA 1W11U 1IQJA 3RMNH 3DSGA 4YLQH 3TJOA 3PV4A 1ZJDA 3SV9A 1WCZA 3B9FH 1CHOG 3K2UA 1HGTH 3T27A 2YMSB 3TK6A 1K28D 1UTLM 2P3TB 2UUFB 5EXMA 1FX0B 2ZGCA 2PKSB 2NU2E 1J17T 2R3UA 3M5LA 3U8TH 1AZZA 2ASUB 1OOKB 1GMCG 3SV2H 5JYIA 5JDUB 4GAWA 4WMEA 4MLFB 1HLTH 3FP7E 1HV7A 2JETC 1O5DH 1WBGB 2AH4X 3GCHC 3NUMA 2JH6D 4TT3D 5T6DA 1XKBC 1VITF 2AHME 1XUKA 1ZLRA 2WINI 1WDIA 2FODA 4Y8ZA 3TH4H 1ABJH 1CE5A 1V2KT 8GCHF 2FLRH 1IHTH 2XBYA 2PGBB 1TQ7B 2F4LA 4WH8A 5AVDA 1THRH 1W0JD 3UTUH 1TMBH 1TWXB 2YOLA 3ITIA 5HIZA 3UOPA 1IHSH 1M9UA 1NBME 1XX9A 4YXWD 3STIA 1HFDA 1QR3E 1V2PT 1D4PB 2ZU5A 4X0WU 1ZRBA 3SV6A 4O03A 1UTPA 3T29A 1TPPA 1O3NA 1NU7B 2OC7A 3Q3XA 4XDEA 4YZUA 2BQWB 4ZHAA 1X7AC 4XE4A 1LPZB 2F9UA 4RI0A 1G30B 3VB6A 4BTTB 4UEHH 1IQNA 3MFJA 2D1JA 4TWWA 3A8DA 3LU9B 2ZKSA 2V0BA 4X2XA 1ELEE 2AS9A 2ZPQA 3SU1A 3BTTE 5DP8A 1QCPA 3TH3H 5FPYA 3RXOA 1OWEA 1O5CB 2BY6X 3F2GA 1O3JA 1P2IA 5C1UA 1T31A 1QJ7B 3FFGA 3UREA 5C0TA 4LK4A 5FL7D 1GDNA 3UWJH 1NRNH 3QN7A 2BXTH 5T6GA 3HGNA 3S9BA 3RXSA 4NSVA 2IJD1 1GG6B 2WUBA 4ACAA 1C1SA 3UOUA 3BTEE 1XUGA 2K0QA 1VGCC 3PLBA 1BJVA 1E1RD 4X1NU 4DT4A 4X8TH 2B7DH 1OYQA 3EDXB 3ODDA 2BY7X 3A7VA 1YGCH 5C3NA 4X1SU 4OM9A 5E0GA 1C2HA 1OP8A 4O97A 2AYWA 3A7WA 4F4OC 3IG6B 2O8TA 3NPSA 2RDLA 4BANB 2C8ZB 1CBWC 1V2VT 4FUHA 3SBKA 4X2WA 1ZR0A 4J2YB 3TPIZ 2KR7A 4MDSA 1HRTH 1RIWC 1S6HA 1FIZA 2QF3A 1ELTA 3TJUA 3SUGA 5EIYA 3UR9A 4ISOA 3MH6A 2ZGXH 2ZI2H 1O2RA 2BX3A 3AAUA 3UAIC 2Y6TA 1DSTA 2FMJA 3OY6U 2A5AA 1RGQA 1A7SA 1MTNC 2H2ZA 3S9AA 2TIOA 1KLIH 1GJCB 2THFB 1MBMA 2HVXA 1P2QA 1E35B 3TVJB 2P8OC 2J98A 4FU7A 1GBIA 1S5SA 4JZIA 1ZSJA 2SGQE 2A0QB 7GCHG 2AERH 1CA0C 2HNTE 1RTLA 2CJIA 4OS1A 1SGFG 1KSNA 1EPTB 1AY6H 1IQEA 1Y3WA 1F5RA 4OS5A 4AB8A 3P6ZB 3PMJA 1YCPK 2ZIQH 3GY8A 3Q3YA 4DG4A 4YOIA 1O36A 2WHXA 1XUFA 2FZZA 5FX6A 1IQHA 1NRRH 2GTBA 3ZVFA 5B6OA 2QYIA 4BAKB 1MCTA 3ZZ6A 3PMBB 1W8BH 3PRBA 1TX6A 3H09A 4I32A 1AVXA 3F0PA 1H8HD 1YC0A 1TRYA 1O3AA 5DK1A 3ZYDA 4AFUA 1B0FA 1C1UH 1XKAC 2PUXB 3SJ8A 5L2ZH 2VIDA 2EI8A 3F68H 1SGNE 3P8GA 5FPTA 3SQHE 4M7GA 5HMAA 1PPEE 3FZDA 4ACBA 1FN6A 1NFXA 1QL9A 1GL0E 2HOBA 1OYTH 2WPDD 1YPKH 2SGPE 5DN6D 1C2IA 1HPGA 2ZDMA 3H5CB 5F8ZA 3M35A 3SJ9A 3EQ0H 3HK3B 3Q3KA 1QBOA 2PSXA 5JBCS 3GCTG 2WZQA 3OFND 1K0HA 2KAIB 4D76A 1QHRB 3GYMA 3BSQA 3KF2A 4CRFA 2FOEA 1TGCA 2FO9A 4B73A 3TH2H 4CRBA 3SNAA 1T4UH 1AFEH 2GV6A 3MOCA 1TPAE 1BTHH 3RLWH 3U9AH 1FN8A 1AKSB 1A61H 2XBXA 2F9NA 1GHZA 4IGDA 5GIBA 5CDFE 1EP6A 3JZ2B 4BTIB 3RXQA 2DE9A 1G37A 3PTNA 6ESTA 1G32B 3P8NA 1B0EA 4FETA 1G3EA 1T4VH 4BXWA 1O5EH 1FXYA 1EKBB 1H4WA 2XC4A 1JRTA 2OQUA 3M5OA 1JXPA 2HRVA 3MU5A 1VZQH 2KCPA 4K8BA 2VINA 2GT7A 1Q31A 5IK2D 2QY0B 1DUEA 2J95A 3IITA 1O34A 1NBMD 2P94A 3UB0A 1QBNA 5C94A 1MTNB 4FUIA 1PPZA 4A1VA 2PV9B 2Z3CA 3QLPH 1KIGH 3RU4D 2FYRA 1WAYB 5HM9A 3L33A 1CVWH 3VB5A 3T5FH 1GBKA 4LZ4B 5JB9S 4XOJA 3PV5A 1EOLA 2Z9GA 3RXUA 4KGAA 1KLTA 3OEED 1O3FA 4H4FA 1V2RT 3ZVBA 2VBCA 4YTAA 2FM2A 1W7XH 1GGDC 1TNKA 4BOHA 2FP7B 2UWLA 1S0QA 2Q1JA 2ODQA 5CMXH 3NKKA 1FY4A 2KCAA 3RXDA 3OE7D 3RXTA 4Y6DA 1WQVH 1G36A 2BOHB 1C1WH 2EI6A 3KYFA 3TJVA 4FVDA 2Z9KA 4HFPB 1FY3A 3UWIA 3EA8A 3ZV8A 1CGJE 1C1VH 3RXIA 3LC5A 1DX5M 1NPMA 4NWKA 3K6YA 2W6JD 1PPCE 1Z8GA 1MAXA 4Z6AH 2QA9E 4TWYA 3PWBA 3EGKH 1L1NA 4WF8A 4AFZA 4A5TS 1BTPA 2AGGX 2BLWA 2FI3E 1UTJA 5JB8S 1RTFB 1FJSA 3P95A 4WY3A 1MABB 1KTTB 1MKWK 1WSSH 3Q77A 1HJ9A 5C17A 1IQMA 2HWLB 2XCFA 2VNTA 1HAIH 1QL8A 3KL6A 1O3MA 1SC8U 2Y5FA 2BD3A 1PFXC 2TPIZ 4IMQA 4INHA 4ZROA 3SHCH 2GKVE 3ZZ4A 5GCHF 1FQ3A 1O3IA 3AVZA 4AG1A 3M7UA 2K8IA 5DP5A 1DITH 1Z6EA 1SGPE 5EOKA 4ZXYH 3TITA 4ZCNA 4BAOB 4B2AA 1GCDA 1LTOA 3SNBA 4JYTA 1P9SA 1SB1H 1QA0A 2G8TA 3QDZB 1UK3A 4BAMB 1OP0A 1Z71A 4TY7A 4NG9H 3RC6A 1ZPBA 4JZDH 2QAAA 1JIMA 4MNYA 2QF5A 3TU7H 3TK9A 1QFKH 2Y82A 1C5LH 1AWFH 4AORA 5HKKD 1THPB 4Y11E 4XSKU 1AUTC 2HPQH 3QK1A 2FPZA 2D8WA 2ZGJA 1V2NT 1TB6H 4MPVA 4OS6A 3OEHD 1A2CH 2R3YA 4FUFA 1DY8A 4Q80A 3GCNA 1TAWA 2ZQ2A 1ZGIA 1ZZZA 4MQAA 4P02A 3RU4T 1BMLA 2H5CA 4Y10E 1XVMA 1N6XA 1PQ8A 3GISB 3BV9B 5EJZA 1E36B 2J97A 2QXIA 3LIWA 1WTHD 2Q6GA 1N1LA 1O2MA 5FHTA 1B7XB 2R2WU 3ZV9A 3RXBA 4FUCA 3ZZBA 1GI1A 1T8MA 1DWEH 2ZO3H 4Q7XA 3ZVDA 1RTKA 1TNLA 1YYY1 2AIPA 2BD4A 4X2YA 1O3BA 2G00A 2GDDA 1DSUA 1TGTA 3GS9A 1FIWA 3RC4A 1OWIA 1PYTC 3BTWE 2RFKC 1DDJA 1Y3XA 1UMAH 1SLVB 2W5EA 4DIIH 4E7NA 1V2WT 1G9IE 3RXAA 3FANA 1MMJN 3LJJA 5A2MH 1TGNA 4GHQA 2VVVA 1Y5BT 1FLEE 1QQUA 3I78A 4YM9A 4IN1A 4YT6H 3T28A 2ANWA 3QUMP 3PB1E 4GLYA 5IYTA 1A5HA 2ZPSA 2PHBA 3E16B 2G52A 3NWUA 1J16A 1Z1IA 3KEEA 3OAAD 3V3MA 4Y76A 3EYDA 4NA8A 2ULLA 5HGGA 2R9PA 2HGTH 3GCOA 2GX4A 4BTUB 1KMHB 3C1KA 1MBQA 5JBAS 1TFXA 1EAWA 1ZTKA 1HXFH 1TPSA 2H9EH 9LPRA 1EJAA 1H8ED 2Z9LA 2HLDD 1O2UA 3LGWA 3NZIA 4X6OA 5DJ7A 1BMAA 2ZU4A 1PJPA 1GBMA 3KGPA 3NRLA 2ZP0H 4JCNA 2W3IA 2UUKB 2JH0D 3HK6B 1HB0B 1YPHC 4Y0ZE 3K6ZA 1C5QA 1SLUB 1HJAC 1BITA 3OU0A 4FXGH 3TJNA 2EA3A 5FBIA 5C5OA 2BDHA 1EASA 4GUXA 4JYUH 2FOBA 5F53A 4X1QU 4A7IB 1G3DA 1XUHA 2GCTC 3DSPA 1DWCH 1C2JA 4BXSA 2SNVA 4NIXA 1OWJA 2IJOB 4Q2KA 3FO8D 2TGAA 5TCAA 4ISHH 4WXVA 1GBDA 2PKAA 1C5XB 3A7ZA 1TRMA 3KYGA 1LKBA 1VCQA 2WPMS 1L1GA 3MU1A 1O2SA 1Z8IB 1GMCF 2CHAC 3ZVAA 2CN0H 1P10A 2G4TA 3F2FA 5GJ4B 3UQOA 1P02A 1YCPH 1VR1H 1C5TA 1O39A 4D7FA 3LGUA 1GHYH 1GWAA 1QRWA 3FP6E 1UVUH 2OC0A 3MYWA 2ZZUH 1BBRH 3E3TA 1GG6C 2JIZD 2FYQA 1XUJA 2JETB 4BNRA 1ETRH 1TNIA 3FOAA 1SOZA 4NZQA 7GCHF 4I86A 2WSSD 1EZUC 1ANCA 5LGOA 2BHGA 1S6FA 1GCTB 2F3CE 1GVLA 2BDGA 3RXJA 2BDYA 1PQAA 3ZZ7A 5EW2H 2G81E 1XM1A 4ABEA 2PP6A 2OC8A 4ABHA 3RXEA 2FI4E 3ESTA 4KKDA 4Z1MD 3RP2A 4ABIA 2XRCA 1W7GH 1SOTA 1ETTH 2F43B 1SBWA 2G5NA 2ZDAH 1ELGA 1TQ0B 5GNDA 5BRRE 2A4RA 3U69H 4DURA 2R2MB 3OTJE 3M7TA 1QB6A 4NIVA 3TLOA 1V2UT 5J4QA 2BQ7B 1P2KA 5L30H 5C1XA 4GHTA 2NU3E 1LKAA 5FCKA 1ZSKA 2EQNA 3AW0A 3ATIA 1AD8H 3RXKA 1O33A 4NZLA 1GJBB 1KY9A 1EJMA 4RKOB 2XXLA 1C2EA 1HAVA 1O2GH 1KXDA 2P93A 1V3XA 4X1PU 1K1LA 1OWDA 2O9QA 2VJ1A 1KXFA 3K9XB 1AMHA 1F2SE 1F0RA 3PTBA 1SQOA 5EQRA 1AWHB 1BOQA 3A85A 1PPFE 2KFWA 3LGYA 2KCYA 3NK8A 5AFYH 2GV7A 5EJ1A 1HIAB 3BTFE 2STAE 4AX9H 2FESH 2NU4E 2UWPA 1GGDB 1O3OA 4K1SA 3B8JA 3MNBA 3OYPA 3Q00A 3E0PB 1J8AA 1TIOA 2RA0A 1YP9A 1HYLA 1GHBF 2VIOA 4B2BA 2W7SA 4NFFA 4ZHLU 4K5ZA 1Y3VA 3DFLA 5ETXA 5A0CA 3DHKH 3Q76A 4MPWA 1XVOA 4FUEA 1S83A 1GJ6A 1ZTLA 2A7HA 4Q7ZA 3A84A 2R0KA 2I6QA 3ATWA 1QTFA 2WPHS 1V2TT 1WXRA 1G2LA 2VIVA 4D9QA 2BTCE 5E0HA 2QXGA 2PGQB 2LPRA 1A46H 4IN2A 1VJ9U 1KYNA 2UUJB 2FDAA 1S84A 2WYJA 4Q4LA 5FPSA 4I7YH 3SGAE 4TPIZ 1C1TA 1UK2A 2RA3A 1XXFA 5EGMA 2TGPZ 1AFQC 1GVZA 2LNCA 1O2VA 3LGIA 1GDQA 2BY9X 2ZDNA 3RLYH 7ESTE 1IQLA 5EG4A 1CT4E 3OX7U 1BTXA 3O8DA 1GJ7B 1MZDA 1HAZB 1P2NA 2FOFA 1ARCA 3E91A 3PROA 3EAJA 1SG8B 2J9NA 3BEUA 1O37A 2ZECA 1XMNB 3G01A 2ZF0H 4SGBE 1S82A 1NFWA 2V35A 2KM0A 5GPIB 1GDUA 3DA9B 1O3LA 1V2QT 3PV2A 1PYTD 4RKJB 1C2KA 2ZFTA
chains in the Genus database with same CATH topology
1W0ZU 4GCHG 2XWAA 1FV9A 1C2MA 5HM2A 1VITG 1GI3A 4CHAC 3TK5A 2FOMB 4GCHF 4MG3A 3V12A 1T7CA 2F83A 1SGTA 2AFQB 4RSPA 4CH2B 3RUOA 3EA9A 1OKXA 3UNQA 2NU0E 2EI7A 3MNCA 4KTUA 2EC9H 1TOCB 1YPMH 2CGAA 1INCA 2AMDA 4CRDA 5LPRA 3T26A 1UO6A 1O32A 1O5GH 1TA2A 2GGVB 1ZTJA 3RXFA 1GJ9B 1NO9H 1SQTA 2SFAA 3QGJA 3SJIA 3A82A 1PPHE 2R0LA 1Y3UA 1O35A 3P70B 4Y8XA 1PQ7A 2J34A 2GMTC 4HI3A 1LDTT 1MTSA 2WPLS 2A4QA 2BZ6H 1O2IA 2GCHF 1C2DA 1YLCA 3MO6A 2VH0A 1SQAA 1C5RA 2AGIX 1C5UA 2OCVB 3U1IB 4NIYA 1MKXK 1ZSLA 2P3UB 1TBZH 3P8OA 4MNWA 1LVYA 1QGFA 5AFZH 3E0NB 1MH0A 1LMWB 1V2MT 3RXHA 3KNXA 5FXLA 4U30A 3M5MA 1GJAB 2P3FH 5GWZA 1O3KA 1BZXE 3F9GA 3SU6A 1SGYE 2YNBA 1NZQH 2VWNA 1ZOMA 4CH8B 2XTTB 1GI5A 2VWLA 2ZCHP 3OSYA 3PMHB 3P8FA 1FNIA 2OD3B 4CREA 1TOMH 1AIXH 1J9CH 4E05H 1L4ZA 1C2LA 1LO6A 1SR5C 3L3TA 2A7JA 2C4FH 2VH6A 1CSOE 1BMNH 1OX1A 2J2UA 4K8YA 3EE0B 3RXVA 2GZ9A 5C67A 1A3EH 3O8CA 2BDBA 1T32A 1GMHF 3CENA 4Y8YA 4K2YA 3ZZ3A 3A87A 2V3OH 1ESAA 2QIQA 1A5GH 2A1DB 5T6FA 1C5SA 4Y7AA 4ZKRU 3PLKA 3RXRA 4CR5A 1Q2WA 1O2JA 1P3EA 4AYVB 4JZFH 1K2I1 1J14A 2AIQA 1HJAB 1P06A 2Z9JA 2FIRH 1O3DA 1ANBA 1GMDG 3SJOA 2ZWLH 5LH8A 2P95A 2ZTZA 3HPTB 1EPTC 2SGEE 4AFSA 3O8RA 5K7RA 4INKA 3BF6H 2BVRH 4MNXA 3R3GB 2CMYA 4J1YA 1ESTA 1ZPCA 2BB4A 2D2DA 5BPEA 4I8HA 1IQGA 1P12E 4I8KA 4FU9A 1ELDE 1K21H 4Y0YE 3EA7A 1D3QB 2ANKH 3UPEA 3V13A 1LQEA 4AFQA 1UVPA 1GCTC 1QB1A 1V2LT 2C93B 1NROH 1WYKA 3NXPA 2GZ8A 1SPJA 4TYDA 3SNDA 1TX8A 1MZAA 1O2LA 2ZA5A 1O2NA 4GPGA 1HIAA 2RG3A 2FOAA 1GBFA 1O3HA 3RXGA 5A8ZA 1HAXB 2PR3A 4LXBH 2ZFRH 1ETSH 4NWLA 1CGHA 1ELVA 1GJ4H 1D3PB 5LPFA 1GI4A 1ZHRA 3GY4A 1GI8B 1C9TA 1L1JA 1QY6A 1C5NH 1AQ7A 4XBDA 3SHAH 3H7OA 1OWHA 1A0JA 1HAVB 2SGFE 3DUXH 4ABGA 1CO7E 1Z8JB 2CHAB 1YLDA 4U2WA 4ZKOU 2XCNA 3RXLA 5L2YH 1CA0B 2ZFQH 4ASHA 4ZH8A 1TMTH 1ZMNA 2TBSA 2B8OH 2C8XB 1RXPA 4A1TA 1BCUH 1AUJA 2GVFA 1SFIA 1GJ8B 1UVOA 3VXFH 4GSOA 1A4WH 2H6MA 1F5KU 1HAGE 2H9TH 1S81A 1NC6A 3V7TA 2FTMA 2ZEBA 1LVBA 4UDWH 1AB9C 2XYAA 2GDEH 1E34B 3AW1A 1GBEA 1JBUH 3BTME 3KQEA 2BLOA 9ESTA 4E7RG 1SGDE 2PKSC 4AGJA 4ZAEA 3QGNB 1P09A 1ABIH 2ZCLP 1O2HA 2VB0A 1SGEE 4TPYA 1W3CA 2Z6BD 1SGQE 2NWNA 2HLCA 4ZKNU 2A2XH 4KTCA 2ZGHA 4K3JA 4XBCA 3A88A 1FY8E 1GI2A 4XFQA 4R8TB 2ALVA 3BTKE 4MTBA 4UFEH 1Y8TA 2ZNKH 7KMEH 4JMYA 2QXHA 4AGKA 2W7UA 3M5NA 3A7XA 2OBOA 5JBBS 3SUFA 3U8RH 1BIOA 1YPGH 2PKAB 6GCHF 4Y71A 3SN8A 1LHGH 1NRPH 3SI3H 1TMUH 1HDTH 3PO1C 2ZHFH 2ZHEH 4O3UA 1DVAH 3VB3A 4INLA 1TONA 5C1YA 1LHEH 1HNEE 5HYOA 1J15A 5ESBA 3S7KB 3KQDA 1ZHPA 1KDQB 1N8OB 2Z9IA 3RXMA 3P92A 2XC5A 1H1BA 1F0TA 1CA8B 2G4UA 2Z7FE 2P8OB 1IOEA 1FAXA 3P17H 1BT7A 3LH1A 1CT0E 1YPJH 3FVFB 1V2OT 2GZ7A 1RS0A 1SI5H 4MPXA 3UNRA 3RXPA 3VB4A 4JK5A 1YPLH 4B75A 4TY6A 2FWWA 1O2KA 1KXAA 2VIPA 1NRSH 3AASA 1BTYA 5EPYA 3ATMA 4AOQA 1ZMLA 5E2OA 1QL7A 1MKXH 3PYHA 1QRXA 1UHBB 1W13U 1QB9A 3ATLA 1PPGE 4MVNA 1GHBG 3RMLH 3TIUA 1P3CA 3E8LA 1UTQA 1Z7KA 2BDCA 4LOYH 1C5YB 1SGIB 2VU8E 2ZHWH 5F8XA 3SNCA 1MCVA 5AHGH 3CP7A 3E6PH 2AGEX 3SU5A 1YPEH 2FX4A 5EPNA 1TNJA 2WV4A 2A32A 2ZTXA 1K1OA 3LC3A 3SUEA 4B71A 3MH5A 1O2ZA 4YO9A 4YOJA 1L2EA 2ZDKA 3GDVA 1GBJA 5F03A 3ZZAA 2QCYA 4OS2A 3SI4H 1QJ6B 3UY9A 1AVWA 3UR6A 2A5KA 2ZHDA 1DM4B 2UUYA 5TCCA 1RRKA 1V6DA 1P04A 3A8AA 2ZFPH 2BD8A 2ZDVH 4K60A 5IDKA 4A92A 2H9HA 1O3GA 2FXRA 1WUNH 2AMQA 2A31A 1CU1A 1SVPA 1TABE 1VCWA 4F49A 1SSXA 3SU3A 3ZVGA 1H9HE 2G55A 2HNTC 1ZRKA 1Z8RA 3RXCA 1MU8B 1D3TB 2TGDA 1D6RA 2ODPA 1Y5UT 2ZQ1A 4WVPE 4BAQB 4AG2A 3MO3A 3TNTA 1ESBA 2IOTA 2SGDE 1GI7B 1DICA 4PROA 1T8LA 1Y5AT 2O8UA 4R0IA 1P01A 1C4Y2 1K1JA 3QX5H 2B0FA 1NFUA 2PTCE 1SGRE 3FAOA 4SGAE 5TJXA 2IPHA 2A4OA 1E38B 1OP2A 1Z6JH 1JOUB 2PTNA 2FOCA 2ILNA 3TGKE 3L6PA 4CR9A 1IQIA 3DT0H 5T3HA 5H4IB 3T2NA 1FY5A 1FZZA 2FEQH 2Z94A 3F6UH 2Y81A 5A0AE 2H5DA 3ZZ9A 1MU6B 3VGCC 2OTVA 4DW2U 1EX3A 1QRZA 1BRUP 4H6TA 4FU8A 1B5GH 1NM6A 1ELCA 1H8IH 5FX5A 3TGJE 1N6YA 2V3HH 4ZXXH 1TYNA 1SHYA 1GI6A 4LZ1H 2OINA 4DIHH 2BLVA 5L6NH 1LHFH 1VJAU 1AB9B 2QF0A 3SGBE 5DG6A 3SU4A 4DT7B 2WV5A 1SLXB 1PQ5A 3A83A 4NA7A 4YLUA 3GY7A 4AZ2B 1K1IA 3MWIU 1LVOA 1CHOF 1P9UA 3LONA 2FOHA 4DOQA 1FI8A 2ZG0H 2C3SA 1EAXA 3D23A 1TX7A 3ZZCA 2GD4B 3MH4A 1IQFA 1UJ1A 3HATH 1C1PA 3A7TA 2ALPA 4X6NA 3QWCH 5ESTE 1GBCA 4WH6A 1TE0A 1W14U 2XC0A 1S85A 3W94A 1O31A 2BQ6B 2TRMA 4XBBA 3GYLB 1TBRH 4DCDA 1UTKA 5FCRA 1C4V2 1AHTH 4K69A 6GCHG 2G51A 1FMGA 4CRAA 4IC5A 1NS3A 2Q6FA 4KTSA 1NY22 1GBAA 1SGCA 1DPOA 2BY8X 4HGCA 4WMFA 5DGJA 3GY2A 1NFYA 4B74A 3RC5A 2Y80A 1L4DA 4I31A 1P11E 3LOXA 1XXDA 1WOFA 1O38A 5DP6A 4OGXA 3RU4E 4OS4A 3UNSA 2BZAA 3F1SB 3U1JB 2Z3EA 3RDZA 2VVUA 1S0RA 2F9OA 1NT1A 3M3TA 5E8EH 2XWBI 6CHAB 1BBRE 3W95A 4B76A 3MTYA 2GMTB 2XBVA 3RM0H 5E2PA 1O30A 1P0SH 3A80A 3F9FA 3M3VA 1BMMH 1JRSA 1WU1A 3QZRA 3SNEA 3BG8A 4ABAA 4X8VH 1SLWB 1YF4A 5FAHA 1BRAA 5EXNA 2KAIA 2RCEA 1C1OA 2J94A 3ODFA 4K1TA 1BB0B 1A3BH 2C90B 2ZPRA 4CRCA 3A8BA 2QXJA 1MKWH 1BRCE 1C5WB 1LHCH 4FUGA 1BA8B 4IS5A 2ANYA 3U8OH 8GCHG 1NU9A 1DS2E 3PO1B 1MQ6A 2PW8H 4JYVH 3BIVH 4ABBA 8ESTE 1RD3B 2OC1A 6LPRA 1RIWB 1TALA 2VIWA 2Y7XA 2BDIA 1FUJA 1G2MA 1TLDA 5GDSH 1QIXB 2BYAX 4JK6A 1EATA 1CBWB 1MD7A 5A09A 3MU0A 4O9VA 1BTUA 3K65B 1F0UA 1AFQB 1P03A 3SZNA 3HGPA 4IBLH 1DT2A 5C2ZA 2K1QA 1O2TA 2GT8A 4IC6A 2UWOA 3SU2A 3STJA 2J4IA 2BXUH 3NCLA 4K1EA 3QO6A 1VGCB 1EB1H 1UK4A 3I77A 2V6NA 4UONA 1DUAA 3MU4A 4VGCB 3BTGE 3GCHB 3SV7A 1BUIA 5C20A 3KCGH 4U32A 1O5BB 1UVTH 3VFEA 2XNIA 1OWKA 5DP4A 2CF9H 4KP0A 4Z0KA 3KQBA 5EQSA 1AO5A 2NU1E 2B5TB 1UCYE 3SJKA 2ZGBH 2PUQH 7LPRA 5DPAA 4E06H 1W0YH 1CQQA 2XBWA 4OS7A 4BAHB 1AU8A 1GHXH 3MMGA 1VITH 3V0XA 4CRGA 1CGIE 2PWXA 5JBTA 1THSH 4UD9H 1AN1E 3PM3A 1N8OC 3N7OA 5A8XA 1EAUA 2G5VA 3VGCB 1ACBE 4CHAB 1XUIA 2D26C 4I8LA 1W2KH 1O5AB 5AF9H 1C2FA 5EODA 1H8DH 3GDUA 1DXWA 3MHWU 3OY5U 2VGCC 2WPJS 3F9EA 2FI5E 2Y5GA 1UTNA 2AEIH 1A1RA 2VWOA 2WYGA 1BRBE 1C2GA 1QNJA 3VEQB 3GY5A 2Y7ZA 1O3EA 1EZQA 1JIRA 4WWYA 3ELAH 5A8YA 4U01A 5PTPA 1AKSA 2BOKA 3MH7A 3RM2H 3A89A 1QURH 3BG4C 3TNSA 2CXVA 3LH3A 1GHAG 3SOSA 3R0FA 2F9BH 2ZC9H 1A0LA 1G3BA 5F8TA 1G3CA 4NGAH 1MUEB 3URDA 1Q3XA 4X2VA 3BTHE 1BDAA 1TGSZ 3LDXH 2Z3DA 1C1RA 1PPBH 5K0HA 3B23B 1GMDF 1BTZA 4YT7H 1MTWA 1C1QA 4UFDH 3U98H 5F6MA 1C5ZB 3ZVCA 4AB9A 1ZYOA 2OP9A 3LT3A 1AZ8A 2BVSH 1A5IA 4D9RA 1FPHH 2ZFSA 2SNWA 2J92A 4DY7B 3D62A 1ZMJA 4IW4E 5SGAE 1C9PA 3E1XB 1U6QA 1O2PA 5C5NA 1AE5A 3SGQE 4DGJA 4HTCH 1F0SA 3MU8A 4QT8C 4X6MA 3GDSA 8LPRA 1C1NA 2BM2A 2QGRA 1V2ST 1HJ8A 3GY3A 1LHDH 1JMOH 3MNXA 5DKMA 2O8WA 4UFFH 1GHAF 2H1UA 1P2JA 1WQSA 1RFNA 1HAPH 2HPPH 1WTGH 3SW2B 3HKIB 8KME2 2BD9A 1FDPA 1V2JT 3M7QA 1WV7H 4MPUA 2C8YB 2O8MA 2OBQA 5DP3A 1BBRK 1EZSC 3D65E 1GVKB 3T62A 1EZXC 4B2CA 1HBTH 2DUCA 1BHXF 4X1RU 1DWBH 4UE7H 1K1NA 5JPMH 1ZPZA 1TGBA 2BD5A 1CHGA 1C1MA 1C5PA 4DVAU 1W10U 4JZEH 1HUTH 1W12U 2OUAA 1D6WA 2O8LA 4CBNA 1TA6A 4A1XA 3M3SA 4FUDA 1Y3YA 3M61U 1GJDB 2FTLE 4X8SH 4D8NA 1YKTA 1FAKH 2OQ5A 4VGCC 3SORA 5E0JA 1QQ4A 3S9CA 3MO9A 4CBOA 1MTUA 3ZZDA 4ISLA 1TRNA 1K1MA 1SFQB 3QTVH 1UCYK 5A0BA 3A81A 1GBLA 4I8JA 1DOJA 1O3CA 3BTDE 5G4BA 2SGAA 2A4GA 1QBVH 2ZU1A 4Y79A 1BJUA 4THNH 2BDAA 3ZZ8A 1O5FH 2PSYA 5ABWA 1DWDH 5LPEA 2FLBH 4NCYA 5CHAC 1DE7H 1UCYH 3KHVA 1QJ1B 3DFJA 3MI4A 3LGVA 4ZUHA 2ZU3A 3UUZA 1ANDA 3AAVA 4DJZB 2DE8A 3H7TA 3M37A 3GICB 1GHWH 1NRQH 2Y5HA 2QN5T 3ZZ5A 2F9PA 4YESB 4NIWA 4ABDA 1NESE 1A0HB 1O0DH 4O3TA 2VIQA 4H42U 2HALA 3T25A 2QV1A 1EUFA 1DANH 2ANMH 3BEFB 1DLKB 1EXFA 2CV3A 1C4U2 1ZHMA 3LGTA 3GCTF 4KELA 3BN9A 3VB7A 3CS7A 4ABFA 4UFGH 1FPCH 1ELFA 5I25A 1OXGA 1O2QA 1AGJA 4FUJA 3LPRA 1LPKB 4NSYA 2YNAA 1K1PA 1EPTA 5EW1H 3LKWA 3FZZA 1UTMA 5CE1A 1H9IE 4GVUA 1BHXB 2WPKS 6CHAC 1EOJA 4ISIH 4Q7YA 2VGCB 1UTOA 1F5LA 3E90B 1C5OH 2JKHA 1O2YA 2C8WB 3PWCA 1QA7A 3RMMH 1GBTA 5GXPA 1O2OA 1HAOH 5FBEA 1EAIA 1YCPM 1EB2A 1ORFA 4ISNA 1MAYA 1SHHB 3CS0A 3A8CA 5GCHG 3S69A 3TGIE 1HCGA 3ATKA 5CHAB 1DFPA 1Y59T 3UIRA 3VPKA 2VVCA 1E0FD 1SGFA 4YOGA 2HNTF 1LQDB 2TGTA 1AVGH 1O2WA 2ZU2A 1GBHA 2A5IA 3F9HA 1IAUA 3ENSB 2ZFFH 2P16A 1SL3A 3UFAA 3SU0A 4OGYA 3ZVEA