4XBBA

1.85a resolution structure of norovirus 3cl protease complex with a covalently bound dipeptidyl inhibitor diethyl [(1r,2s)-2-[(n-{[(3-chlorobenzyl)oxy]carbonyl}-3-cyclohexyl-l-alanyl)amino]-1-hydroxy-3-(2-oxo-2h-pyrrol-3-yl)propyl]phosphonate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
175
structure length
165
Chain Sequence
HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Dipeptidyl Inhibitors of Norovirus 3CL Protease. Structure-Activity Relationships and Biochemical, X-ray Crystallographic, Cell-Based, and In Vivo Studies.
pubmed doi rcsb
source organism Norwalk virus (strain gi/human/united states/norwalk/1968)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-LIKE PROTEASE
total genus 39
structure length 165
sequence length 175
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbbA01
3SBKA 1AVWA 4IMZA 1HV7A 2A5IA 2PKSC 1KXDA 2PW8H 3KIDU 3TGKE 1GDNA 1W10U 1JIMA 2QXGA 1ZTKA 2A7JA 5IYTA 4CR5A 2FO9A 3MH4A 3U69H 1E37B 1RD3B 2BHGA 1N8OC 3RXKA 5H4IB 2BM2A 1FIZA 1S85A 2VVCA 3VB4A 5DP5A 3W95A 4AB9A 1GHBF 4ISHH 2Q6GA 3HGPA 1OWEA 4BNRA 4J1YA 3LGTA 2IOTA 1TOMH 8GCHG 3SU0A 3SJ9A 3ZZ5A 4E7NA 2JH6D 1NT1A 5C1YA 2GV7A 1L2EA 3GY4A 1AZZA 1KSNA 1HAVA 3FVFB 1P02A 1BRUP 1ORFA 2GV6A 1GI7B 2GZ7A 1ETTH 2ESTE 2ZU1A 1LHDH 3A82A 1KXCA 2XCNA 1T8NA 2OC7A 1T4VH 3MO9A 4OS6A 4VGCC 1CHGA 2QV1A 2P3FH 4CRGA 1EKBB 1P2NA 1GBJA 3DHKH 5EG4A 2FESH 2GCTB 1ZZZA 2AS9A 2Y6TA 4AG1A 1HAOH 1W0ZU 5C5NA 3M7UA 4R8TB 3CS7A 2Y80A 3ATLA 1HGTH 3SN8A 3MH6A 1NRNH 1G9IE 2A32A 2J95A 1B0FA 1MKXK 2TGAA 1BITA 4DJZB 2FTMA 4RN6A 1KTSB 1BQYA 2F3CE 4A6LA 2CV3A 3M3TA 3E1XB 1F0UA 1MTNB 1O2KA 1O2XA 4ZKNU 5DP9A 1ETRH 1K28D 3SI3H 1UTPA 2Z94A 3T2NA 3VFEA 5C1UA 2DE8A 1IQJA 1BHXB 4GCHF 1ZRKA 2XXLA 3QDZB 4NFFA 2XRCA 5EW1H 1LCYA 1TNKA 1C5LH 1XXDA 4HTCH 1PPEE 1XUGA 3M61U 3RU4D 4IBLH 1AN1E 1YM0A 3KHVA 4K1TA 5F8ZA 3VB5A 2PLXA 3I29A 1GBDA 1O3FA 2Y5HA 4CH2B 3AW0A 1F0SA 1F5LA 4JYVH 2Z3DA 1INCA 2BQ6B 2WYGA 3SV9A 1S6HA 5FHTA 5FBIA 1IOEA 4HFPB 3P8GA 1SFQB 2A4QA 2ZFTA 1AKSB 1FNIA 3SGAE 2JH5D 4X8VH 1AIXH 2XBYA 3LC5A 3M5MA 5SGAE 2ANMH 2C90B 2F9BH 1MTSA 1GL0E 3RXJA 4NIYA 3FZZA 1HXFH 3ZZ4A 3TH2H 3ZV8A 4BAMB 2AMQA 4B2BA 4I8JA 1ANCA 1SVPA 3MH5A 2G8TA 1C5VA 4ZH8A 2JKHA 7ESTE 4DURA 2FX6A 4BTTB 1RJXB 1O2ZA 4NIXA 3SV7A 3L6PA 3U1JB 3WY8A 1TPAE 1GPZA 1TONA 1QY6A 1AD8H 3D65E 1XKBC 1NTPA 1JIRA 3MH7A 4ABJA 3UQVA 1Y59T 2VWLA 4MQAA 1NO9H 1UCYH 1W12U 2GD4B 1EATA 2C8XB 1OWDA 3UNRA 1SC8U 1FY5A 1O5EH 3RDZA 1W11U 1WU1A 4ISOA 2FP7B 1F0TA 3F68H 2D2DA 2ODPA 1EXFA 3MO3A 1BJUA 1Y3UA 1VCWA 2Z3EA 3RLYH 2RDLA 1ZSKA 1GJ9B 3ZVDA 4BAKB 1TB6H 1W13U 2P3UB 4MPWA 1C5YB 2GTBA 3SU4A 3A7ZA 3LGIA 1THPB 3BN9A 4ZUHA 2ZDVH 1UTKA 2BD2A 4DOQA 1DY8A 4ABDA 5GDSH 4DW2U 2FOHA 1IHSH 3M3SA 4BAHB 2C4FH 1ELTA 1SGRE 1TX6A 2Y5FA 4MG3A 1W8BH 5L2ZH 2VH6A 4AFQA 1EX3A 2SGDE 1HAZB 1JBUH 1HJ9A 3QGNB 1K1JA 2SNWA 1QL8A 3PTBA 2XW9A 4X1QU 4OS7A 1MD8A 3TJVA 2CJIA 2SGAA 1TNLA 1EAIA 5C5OA 2PGQB 4CHAB 2Z9JA 3PTNA 1TGBA 1QB1A 3AW1A 1GBLA 1G30B 1SGNE 5JYIA 2TPIZ 2FOBA 2HLCA 1HAGE 1DLKB 1LVMA 3PYHA 6CHAB 2Z9KA 4JZEH 2H6MA 1O2GH 4MLFB 5F8TA 4ABGA 3ITIA 1O32A 1HB0B 2JETB 2SGFE 2GMTC 4WH6A 1ETSH 1LPKB 1G2LA 1C1NA 1FY8E 1GJAB 4K3JA 2VIWA 1P10A 3MNSA 1O3DA 1XM1A 2HPPH 1XXFA 2W3KA 3C1KA 3KNXA 5K0HA 1UTQA 1W7GH 2ZA5A 2ZWLH 5FX6A 1BBRK 2W3IA 3UTUH 2A0QB 1IQHA 2BDBA 2BDAA 2FWWA 2ZCKP 1O2SA 1C2EA 5GXPA 4B1TA 3SW2B 1KDQB 2A45B 3AAVA 4BXSA 3NCLA 2Z7FE 1P03A 3BTGE 4DCDA 2WPIS 2XWAA 2G81E 3P8NA 1TE0A 1RTFB 1OP0A 4O03A 2FPZA 1K1IA 1FN6A 2H9EH 2ILNA 4JK5A 2QIQA 3S9AA 3PB1E 1C2IA 1TIOA 3DFJA 1F5KU 2A2XH 3F9GA 3PO1C 4E05H 3UPEA 3S69A 4ABHA 1H8DH 2BQ7B 4NCYA 3RMNH 1WTGH 5LPRA 3LKWA 1O3EA 1BTPA 1LHGH 1AB9B 2AGGX 2ZPRA 5J4QA 2CGAA 3GY7A 1MU8B 1ABJH 2AFQB 1GHAF 2ZI2H 3UUZA 1Q3XA 2UWOA 1HAYB 3SUEA 1OP2A 1GI3A 3DT0H 1NROH 3QLPH 3ZZAA 1TX7A 1WV7H 4MPVA 1Q31A 1CBWC 1PPZA 1SBWA 2V35A 3SV2H 2A2QH 2VWNA 3TGJE 4D7FA 3RXAA 1S83A 3GOVB 1YLCA 1ZMJA 8LPRA 3C27B 3SV8A 2V6NA 3T29A 1L1JA 2XBXA 3RC4A 1GHXH 3EE0B 1P9UA 4JK6A 4MNXA 3SU5A 1C2LA 1KTTB 1NFYA 2UUFB 2DE9A 1GHAG 1KLJH 1MU6B 3HPTB 4Y6DA 1GBIA 2XC0A 5IDKA 1F5RA 5JDUB 1V2MT 1T8LA 2ODYB 3EDXB 2FOFA 3T28A 3RXGA 3TNSA 2AERH 3PO1B 3FP8E 4AYYB 3LJJA 1MQ6A 1UHBB 5A8YA 7LPRA 2GDDA 3DUXH 3RXEA 5FCRA 1SGCA 3GCOA 1RRKA 3LONA 1GJ7B 1C5ZB 1LHCH 1E36B 1YPHE 3F9EA 1Z1IA 2PKSB 4ASHA 1UK2A 2B0FA 2VGCB 4RKOB 1VGCB 1TMUH 3RLWH 4JMYA 2F91A 2VINA 1V2VT 1ZSJA 1PQ7A 3HGNA 1BMLA 5HXFA 2OC1A 3RUOA 4MPUA 1YPJH 2BLQA 5A0CA 2CXVA 1L4DA 1WCZA 1ZTLA 1NESE 1GGDC 1EZQA 3RU4T 1T8OA 4Q2KA 3SUFA 4K2YA 1BB0B 2BVRH 1SGDE 3MHWU 4ISNA 5AFYH 4I8HA 3KQDA 2STAE 2QXIA 5ABWA 2ZDAH 1SHYA 1CA8B 1TGCA 5CHAC 4K1SA 2QCYA 1T32A 5HM2A 1DX5M 1AFQB 4TPIZ 2G4UA 3SQEE 1ELFA 4BTIB 3SI4H 2P8OC 5EW2H 3RMLH 1SG8B 1MKWH 1HRTH 1O2TA 1QBOA 5EODA 2H1UA 1OKXA 3A8AA 2VVVA 3RXDA 2ZU2A 1O3AA 1T8MA 1N1LA 4H6TA 3ZZ8A 1BTZA 1ESTA 2H2ZA 2I6SA 2OC0A 1KYNA 9ESTA 2ZF0H 3QTVH 3RXSA 8KME2 3P6ZB 1FLEE 1WQSA 4X0WU 4ZKSU 4UONA 2PKAB 1GI8B 2YNAA 1FIWA 1BTHH 2GP9B 1BTYA 1GL1A 4B71A 1BCUH 3S7KB 3PLBA 4YTAA 2FDAA 4FUGA 5EU8A 1ZJDA 4FUHA 1P2KA 1HLTH 2P94A 2UWLA 2A31A 3TK6A 1OS8A 1KXBA 2ZDLA 1AFQC 2HNTE 1L1NA 4CRBA 4K60A 5I46H 7KMEH 2ZG0H 4X1PU 1K9OE 4NZLA 2ULLA 2ZZUH 3M36A 2HOBA 5FX5A 5A0BA 1CT0E 4Q7ZA 2QYIA 5A8XA 5A0AE 4MDSA 1C5QA 1VJ9U 1PPFE 2Y82A 1NY22 3QZQA 1C5OH 3LGUA 1TMTH 3B9FH 3P8FA 2ZDMA 1FZZA 3ODFA 1AFEH 1ZTJA 4Q80A 4OS2A 1GJ4H 4XE4A 1CT4E 2ZEBA 1E0FD 5JBCS 2DUCA 4ESTE 1SGFA 3V13A 3SQHE 4UFEH 2J38A 5L30H 3I78A 2QXHA 2FX4A 2C8WB 3E3TA 1GDUA 4FXGH 3UREA 3A88A 2GX4A 2AYWA 2OINA 1TRNA 5GCHG 1WAYB 1CA0C 3GCNA 2AMDA 2BY6X 3ZZCA 2R2MB 1QL7A 4FU8A 3PWCA 3PWBA 5ESBA 3MO6A 1P2QA 1FDPA 2OQ5A 4ABFA 2Y5GA 1GHBG 3A80A 1AZ8A 3MU4A 2PV9B 3LC3A 5HYOA 2BD9A 1GMDG 4KGAA 4X2VA 1PPCE 3EA9A 1NFXA 2NU3E 4HZHA 5EOKA 9LPRA 2ASUB 2BY8X 2GCHG 1DDJA 1D9IA 2Q1JA 3UWIA 4FU7A 1V2OT 1TRMA 1S81A 2FIRH 1P12E 5EXNA 5AFZH 2BOHB 1SGIB 1IAUA 1UVUH 2ZPQA 3N7OA 1FN8A 2NWNA 1YPMH 2SGPE 3M7TA 1C1SA 1FPCH 1PQ5A 2CMYA 3LH1A 1J15A 1HAHH 1O5AB 2TIOA 3O8BA 1GVZA 4OGXA 1JRSA 2GCHF 1ZGVA 1IQIA 1RFNA 3KQEA 5GWZA 1LVBA 2R9PA 1ZHRA 3TJUA 1PPBH 3ENSB 4X8UH 4GLYA 3QN7A 4FUJA 1GBBA 1JWTA 1GJ6A 1ZR0A 3LDXH 1MMJN 1OWKA 1FUJA 2O8WA 4UFDH 3RMOH 1O2RA 3RXMA 1AUJA 3RXPA 3LPRA 3EA7A 4JZDH 1Y5BT 6ESTA 5T6GA 3VPKA 4Q7XA 3K9XB 2CN0H 3TK5A 1CSOE 2CHAB 1C2DA 5F03A 1GHVH 3A84A 1A5HA 3SU3A 4MVNA 4DGJA 1KIGH 1O37A 1AMHA 1WYKA 5EXMA 3OSYA 1O2VA 2GCTC 1SQOA 3OY6U 1D4PB 2Z3CA 2ZQ2A 1SGYE 4B2CA 1K1PA 4K69A 3AVZA 3BEIB 1ZJKA 1S0RA 1HIAB 1BJVA 1QTFA 1A0LA 1JRTA 2ALVA 2TGPZ 4XBCA 2A5AA 3TU7H 1CE5A 1CHOG 4U32A 4AZ2B 1DS2E 2BD4A 6GCHF 4BAQB 2BYAX 1NU9A 1NRPH 1GMHF 1TABE 3T25A 5CE1A 5A2MH 2VU8E 3E0NB 1DVAH 2ZHQH 4KTSA 1O3GA 1CGIE 3ATWA 1CHOF 1QA7A 1QNJA 1SL3A 3E90B 1VCQA 4FUIA 1YCPK 4B74A 2BY7X 1GMHG 2OCVB 4NWKA 4INHA 4Y8YA 2W5EA 1UMAH 4LK4A 2UUJB 1GI0A 4K5ZA 1O0DH 6GCHG 5CHAB 4O3TA 4X8SH 5FPTA 2QXJA 3PM3A 4Y71A 1GI4A 3HKIB 2THFB 1AU8A 1FI8A 2Z9GA 3Q3XA 3P17H 4ABEA 1OWIA 2PTCE 2BQWB 4XSKU 3KN2A 3MOCA 1YC0A 1A4WH 1NPMA 4TWYA 2ZTYA 4TY7A 1C1UH 4IN1A 2UUYA 4CBOA 3GCHC 4ZXXH 4FUDA 2F9VA 1ELEE 1XUJA 1EUFA 5EQRA 2EI7A 3ZVGA 5A8ZA 2EI6A 2ZFQH 3ZZDA 1P05A 3P92A 3V7TA 4Y0ZE 2BLOA 2PUXB 4B2AA 1C2JA 2WPKS 2XTTB 4AFZA 4AFSA 1A2CH 1WTHD 3SNDA 1TBRH 3RXIA 3PLPA 3A8DA 4O3UA 2BLWA 1H9HE 4YOJA 2QAAA 1SGQE 1DUAA 3VB3A 3O8CA 1RTKA 3ODDA 4CREA 4QT8C 1W3CA 3HK6B 4XFQA 3GICB 2R0LA 1GI9B 4MTBA 1VITH 1AKSA 1TGNA 3S0NA 4U01A 2PHBA 5A09A 1NFWA 3AASA 1TGTA 3T27A 1F0RA 2WV5A 3PMHB 3K2UA 4YO9A 5GJ4B 3RXOA 5C2ZA 2ZQ1A 4K8BA 1BRAA 1NFUA 3E16B 3KF2A 1HXEH 4X6PA 1GDQA 1O2JA 1Y8TA 1CQQA 1SGTA 1GJBB 3O8RA 3RXVA 1NN6A 1Z1JA 1A7SA 2GZ8A 2RG3A 1O2HA 2HNTF 2KAIB 1LDTT 2BLVA 5GCHF 3LIWA 1ZHPA 2ZP0H 5T6DA 3TIUA 1A1RA 4A7IB 1AB9C 1ABIH 2G51A 5FPSA 1DXWA 4YZUA 4WH8A 3SO3A 2OQUA 1G3CA 1EAXA 1O39A 1XVOA 2EI8A 5AF9H 2ZU4A 4KTUA 1OX1A 2QY0B 3QTOH 3OX7U 4OS4A 4Y7BA 1SOZA 1UTNA 3ZVBA 3SNCA 1DANH 1J14A 2Q6DA 4DT7B 1P2OA 2FOAA 4WXIA 2ZFRH 1OSSA 4DY7B 2C8ZB 2BD3A 3VXEH 2OP9A 1QFKH 3UNQA 1SLVB 2XBVA 5DP6A 1GBAA 2Y81A 2FODA 4A92A 2TGTA 1SOTA 1HUTH 1A61H 1TGSZ 1TWXB 3TJOA 3ZYEA 3ZZ7A 1SI5H 1XUFA 3B23B 4X2YA 2Y7XA 4CRAA 2C3SA 4I8GA 5C67A 2A1DB 3LGVA 1FQ3A 5DG6A 2HGTH 5L6NH 4Y0YE 1MKWK 2BVXH 2CF8H 1P2JA 4PROA 1C5WB 3SU1A 1XUHA 1UK4A 5E0HA 1LPGB 1Q2WA 1UTLM 1G3BA 1QJ7B 1C1RA 4GUXA 1GCTC 4UFGH 2K1QA 4Z6AH 1CO7E 1YF4A 2AH4X 3RXCA 1UHBA 5JB8S 4MNYA 2AEIH 1V2ST 3BTFE 1SFIA 2A7CA 1MD7A 3BTQE 1C5RA 2FOCA 2QF3A 3RM2H 2BY5X 2G00A 3RC6A 1TPSA 3KEEA 2BDHA 3UWJH 4X6NA 1SR5C 5I25A 1MAXA 1G3EA 4I8LA 2R3YA 2FXRA 4H4FA 1O3LA 3BTWE 4OS1A 2AGEX 2ZFSA 2LNCA 3RC5A 2YNBA 2GKVE 5AHGH 2ZDNA 1QBVH 4AORA 1EZSC 2ZU5A 2Q6FA 5EXLA 1PQAA 2AIQA 4RSPA 5JBAS 1EJMA 1LO6A 2XC5A 4U30A 2Y7ZA 2F9UA 2ANKH 3PROA 4IS5A 1TAWA 2JH0D 1ELGA 1MBQA 2QF0A 1O38A 2EC9H 2R2WU 3ZVAA 4Y10E 1BMAA 4E06H 2OUAA 1HJAB 2ZGHA 2AMPA 2VIQA 3W94A 2ZGCA 5L2YH 1IQFA 3GY3A 3A89A 1VR1H 2HVXA 2C93B 1SGEE 1YCPH 1G32B 1DT2A 4K1EA 2ZECA 1MZAA 3IG6B 4KP0A 2FS8A 1ZYOA 3SHCH 3T5FH 1BBRE 4IC6A 4Y7AA 1T31A 3IWMA 1YBWA 1HAXB 2JETC 4ZHMU 1BT7A 3A81A 2BD5A 2UUKB 2G4TA 1LQEA 2XCFA 1GBHA 2VWOA 3LU9B 1NS3A 1BZXE 3K65B 1O2MA 3MU8A 1EPTC 3U8TH 4WVPE 3LT3A 2CF9H 1FJSA 4FVBA 1QRWA 4DVAU 2PSYA 2QA9E 5C3NA 4FU9A 1O3KA 2W7SA 4AGKA 1DLEA 1BTXA 4KELA 1FAKH 3GYLB 1ESAA 5TJXA 3E91A 5FXLA 4YM9A 1MZDA 2ZCLP 3SUDA 4INKA 1IQNA 2A4GA 4MPXA 1P2MA 1C5SA 1YPGH 1O2QA 4KTCA 1EB2A 3ESTA 1H8IH 4I33A 3ATKA 5JBBS 1MTUA 4RKJB 1NRSH 3LGYA 1VITG 4X1SU 1KXAA 1H9LB 2FYRA 1O5BB 2PFEA 3F9HA 1C2MA 1EOLA 1C9TA 5FPYA 1JXPA 1D3PB 3A86A 1RIWB 3MWIU 1C1OA 1TOCB 1KY9A 2TGDA 3D62A 1KLIH 2UWPA 1SLWB 1HIAA 3GDVA 3TLOA 2H5DA 4TPYA 1N6YA 3MU1A 1DITH 4B75A 1GCTB 1S6FA 2ZPSA 1THSH 1THRH 2PR3A 5BPEA 2GMTB 1UO6A 2BOKA 3E0PB 1O2NA 3M35A 1MCVA 2BMGB 3LOXA 1AE8H 2OBOA 1GHYH 1P04A 1LHEH 2WPLS 2OLGA 4ZMAH 3NXPA 3A7TA 1JMOH 2XYAA 1T4UH 4BOHA 4Q7YA 1SHHB 3RU4E 3BEUA 4TY6A 1GG6B 4CBNA 2H9TH 1GMDF 1AE5A 1P9SA 4JCNA 5DP8A 2B9LA 1O3PB 3A8BA 3L33A 5DP7A 3RXUA 3UNSA 4CRFA 1O3BA 1V2LT 3ZZBA 2OTVA 1JOUB 3GDSA 1YGCH 4JYTA 1TMBH 1FONA 3T62A 3MU5A 3SJOA 3UFAA 2BXTH 1GCDA 3Q3KA 2RA0A 2IJOB 3JZ1B 5EPYA 4HI3A 3HKJB 1EZXC 4R0IA 1Y3YA 1SQAA 3DD2H 4NFEA 5J4SA 4GSOA 3RP2A 1ELDE 1QA0A 2WPHS 3NPSA 1O3JA 1YYY1 1S5SA 4WJG2 3IITA 1EQ9A 1EJAA 5FBEA 3BTKE 3M37A 1IQMA 5DKMA 1DWBH 1IQKA 2F9NA 4CRDA 3S7HB 1OP8A 2QC2A 2TRMA 1XX9A 2BD7A 4GVUA 1RTLA 1GI6A 1TALA 2J92A 5LH8A 2FI4E 4TYDA 1P57B 3M7QA 4THNH 1O35A 1A0JA 2J2UA 1O2WA 1ZOMA 1F7ZA 2ZHDA 1DM4B 1P8VC 5E0GA 1QB9A 3UR6A 5DO4H 1G36A 1D3QB 1C2GA 1K1LA 1TFXA 3SORA 1EPTA 1GMCG 3ZZ6A 5G4BA 3STIA 2NU1E 3RXRA 3KGPA 1QJ1B 2G55A 1ZMLA 2B7DH 1DICA 1GI5A 3MI4A 5T3HA 1PYTC 1QQ4A 1V2RT 4X1RU 3TNTA 2V0BA 3D23A 1AWFH 5E2OA 1S82A 2ZTZA 2D8WA 4WWYA 2W26A 3SJIA 1Y3VA 1PYTD 3BTEE 1P09A 1QJ6B 2BB4A 3TGIE 3R0FA 3ATMA 3TVJB 2VIDA 1ZGIA 2FYQA 1Y5UT 4JYUH 4SGAE 1OWHA 2H9HA 2VGCC 3GY5A 1V6DA 3H7OA 5EGMA 5B6OA 1CBWB 1V2WT 1K2I1 3GDUA 1D6RA 1BA8B 1MTVA 3MU0A 3U1IB 3CS0A 1D6WA 2AIPA 5HGGA 2OD3B 3FP6E 1HBTH 2ZC9H 1TRYA 1HJAC 3AAUA 1C1VH 2FOEA 3M5OA 3QUMP 3GCHB 1MBMA 1PPGE 1Y3WA 4LZ1H 2BZ6H 1YKTA 4NSVA 1CT2E 4BAOB 4YOGA 2CHAC 4CRCA 1A3BH 1ZHMA 1OYTH 2FLRH 2BDGA 1AWHB 2XWBI 1CA0B 1C5XB 1TQ7B 2BDCA 1UVOA 1C2HA 1O3NA 1O2OA 1LQDB 1QR3E 3UQOA 1LVOA 4I32A 5K7RA 1O2IA 1NM6A 2WPMS 4ZKOU 1V3XA 2AGIX 4Y8XA 2ZHFH 2G5NA 1LKAA 3ATIA 4FUFA 4GHTA 2ZGJA 3U8OH 1C4V2 3BIUH 1GVLA 3RXTA 4D8NA 4AB8A 3RXHA 1C4U2 1GGDB 3CP7A 1ARBA 1BMNH 4I8KA 4BANB 3MNCA 1YPLH 4X2XA 4IC5A 4D9QA 4H6SB 3TH4H 1MTWA 1O2PA 1SGFG 4AFUA 6LPRA 2J34A 2O9QA 1GHWH 1O31A 2PUQH 1WOFA 1GHZA 4XBDA 3OYPA 1FPHH 1DPOA 3R3GB 5PTPA 4A1VA 1BTUA 2F83A 2ZKSA 1GJDB 4I7YH 4A1TA 1XVMA 1V2NT 1WUNH 1GJ5H 3VGCC 3O8DA 1O33A 2V3OH 3L3TA 1FY4A 3OU0A 4Y8ZA 3K6YA 1HNEE 4CHAC 2Z9IA 5DP3A 2BY9X 4MNWA 1OXGA 2EEKA 2J94A 2Z9LA 1DSTA 5LPEA 1EP5A 2IN2A 5GIBA 2QN5T 1ZLRA 3E6PH 3DFLA 3SZNA 1YPHC 1TQ0B 3D49H 1SLUB 1K1OA 4ZHLU 3VGCB 3ZV9A 1C4Y2 3F1SB 2F9PA 2F9OA 1DY9A 5EQQA 2VIVA 1TBQH 3A7WA 1TYNA 2BDYA 2GT8A 1TNGA 2WUBA 1H9IE 1UK3A 3ZZ3A 4Y79A 5F8XA 3NUMA 1C5TA 3BV9B 2VJ1A 3P8OA 3ZVCA 1C2KA 3GY6A 2RA3A 3U9AH 1TNJA 5EPNA 1O36A 3URCA 1KXEA 1WBGB 1FV9A 1DWDH 1XUIA 3Q76A 2FI3E 1YPEH 1Z8GA 2ZFPH 3NZIA 2P95A 4AX9H 1QQUA 3EA8A 5JPMH 4NGAH 1WQVH 2W7UA 2FI5E 2OC8A 1GBMA 2P8OB 1AVXA 2GVFA 4JZIA 1HPGA 1H1BA 3UR9A 3A85A 3RXQA 4X6OA 1W2KH 1P3CA 3GCTG 4NIWA 1GG6C 1VITF 3DA9B 1EAUA 1SGPE 2O8UA 4DIHH 1LPZB 1B0EA 2ZGBH 1EJNA 3PMBB 1A0HB 3UY9A 2FOGA 1OYQA 3Q00A 1C1PA 1P2IA 1C1QA 1PFXC 1W14U 2R0KA 3EAJA 3SGQE 3FAOA 5CMXH 1ARCA 3F9FA 1HJ8A 1N6XA 2I6QA 5HMAA 4DG4A 2B5TB 3U8RH 2ZDKA 3BSQA 4D7GA 1LMWB 2GZ9A 1DSUA 3UOPA 1QB6A 1K1MA 1CU1A 4X2WA 1S84A 4M7GA 3P95A 3TK9A 2OBQA 3VB7A 2ZCHP 1ANEA 1NRRH 5T6FA 4WMFA 2SGEE 1ZPZA 4NIVA 2XC4A 1ID5H 1ZRBA 1LHFH 2BVSH 1VZQH 3M3VA 3LH3A 4MNVA 1P06A 2WINI 1EZUC 2ZFFH 1V2KT 1CGJE 3ZVFA 3I77A 2M5TA 3QZRA 5E2PA 1FMGA 1QIXB 1O30A 3EQ0H 2A4RA 3BG8A 7GCHG 2HNTC 3ZVEA 1TPOA 2A5KA 3URDA 4ABAA 1RGQA 3PLKA 1UVTH 1L1GA 2QGRA 3V0XA 2RCEA 3H5CB 3GY8A 1W0YH 4UDWH 1UTJA 1WSSH 4GPGA 2P59A 1DOJA 1L4ZA 1P3EA 1V2QT 3A7YA 1O5GH 3QWCH 3P70B 3EGKH 1DWCH 3H7TA 3GCTF 1BHXF 4ZHAA 1FY3A 3BF6H 2YOLA 1PPHE 3TJNA 3BIVH 3JZ2B 1QRXA 2FLBH 4I31A 1T7CA 1AI8H 1IHTH 2ZHWH 3SV6A 1AO5A 5FCKA 4Y76A 1B5GH 1VCPA 3SJKA 1AHTH 3BEFB 3Q3YA 1FXYA 2ANYA 1IQGA 4GAWA 1VGCC 1DFPA 2XNIA 1QCPA 1AQ7A 1NRQH 2HRVA 2B8OH 2ZTXA 1QL9A 3U98H 1HCGA 1SSXA 4BTUB 4YLUA 1UCYE 4B73A 4A1XA 5LGOA 1GI1A 1CVWH 1HYLA 1YLDA 3EYDA 4FUBA 1C1WH 1SQTA 1ANBA 3FFGA 1K1NA 1KDQA 4WF8A 3T26A 3BTTE 4GHQA 5GPIB 4ZKRU 2FZZA 3RMMH 2NU2E 3NWUA 3STJA 3UIRA 5DJ7A 4YT7H 3QX5H 2ZIQH 5HM9A 1HFDA 4NA8A 1GBKA 1ELVA 2A4OA 2H5CA 2OXSA 1TX8A 1IQEA 1OOKB 7GCHF 2D26C 1A3EH 3BG4C 1XMNB 3KQCA 3SHAH 2SGQE 2WUCA 5E0JA 2KAIA 1C5UA 2BXUH 3V12A 1HAPH 1B7XB 3M5LA 1SMFE 1O3HA 4FUCA 4ZXYH 5TCCA 3RXBA 1GMCF 2P3TB 1V2PT 4ISLA 4LOYH 4K8YA 1OWJA 3B8JA 3BTME 1E34B 4O97A 3SNBA 1MCTA 1J8AA 1X7AC 4X6MA 4SGBE 4NSYA 1O5DH 1O2UA 1ZPBA 3GY2A 2VVUA 2VIPA 1BIOA 1EASA 1Z7KA 3K6ZA 1AGJA 1FY1A 2HALA 1UVSH 1GBFA 2FTLE 3SU2A 8GCHF 2PKAA 3LJOA 2GGVB 1W7XH 1ACBE 1C1MA 1Z6JH 1O2YA 1ANDA 1FAXA 4O9VA 3MMGA 1AVGH 1BUIA 5TCAA 3A7VA 3BG4B 3Q77A 2WYJA 4FUEA 1Y5AT 1XUKA 1AUTC 5F6MA 2NU4E 1IQLA 1QGFA 1KLTA 1Z71A 3SU6A 1M9UA 1HAVB 3QK1A 1N8OB 1O34A 3HK3B 1Z8RA 1ELCA 2PSXA 5DGJA 4WMDA 4OS5A 1U6QA 3PMAB 1UJ1A 3PMJA 1A46H 3SOSA 2NU0E 1ELBA 2GT7A 2VH0A 3OTJE 4X8TH 1V2TT 2IPHA 3GYMA 3S9CA 4UE7H 1O3OA 4ISIH 3LGWA 4ZAEA 1O3CA 5FAHA 4YESB 1G37A 6CHAC 4NZQA 3F6UH 4BXWA 4OGYA 4YOIA 1C5PA 4WMEA 3G01A 5ETXA 2P93A 1MUEB 4JZFH 1QURH 4GCHG 3SNAA 1VJAU 1Z8JB 3TITA 3NK8A 4IW4E 1O5CB 3RXLA 1BDAA 1C2FA 4HGCA 1RS0A 2R3UA 4Y11E 3TPIZ 1E35B 4FVDA 4NWLA 1A5GH 1GBEA 2ODQA 1CGHA 1Y3XA 1ZMNA 3SUGA 4D9RA 2PWXA 4F49A 3VXFH 4NA9H 1HAIH 2BDIA 2EA3A 1K21H 2J9NA 4NA7A 1V2JT 1GJ8B 5DPAA 1O3IA 2FOMB 3TH3H 1C5MD 5DP4A 3OY5U 4UEHH 4H42U 2LPRA 2FM2A 1OPHB 2G5VA 4XDEA 1GBCA 1UTOA 2FS9A 1K22H 4F4OC 1L0ZA 3CENA 1BRCE 1PQ8A 1HDTH 2V3HH 3SGBE 4ABBA 1DUEA 2XBWA 2ALPA 1KXFA 1QBNA 4AG2A 1MKXH 1ELAA 3RXFA 1RXPA 4CH8B 1BTWA 1TBZH 3QO6A 5JBTA 3MYWA 1D3DB 2FMJA 2VB0A 1QRZA 1BBRH 4E7RG 1MTNC 3HATH 3RM0H 1UTMA 4IGDA 1C1TA 2ZU3A 4X1NU 4WXVA 1PJPA 4YLQH 1BRBE 4LZ4B 1G2MA 1SPJA 3ZZ9A 1UCYK 1LTOA 2G52A 1MH0A 1ZPCA 1J9CH 4LXBH 4AGJA 5BRRE 1EB1H 1J16A 1EP6A 1YCPM 2P16A 1YPKH 2BX4A 2HPQH 3MNBA 1P0SH 2ZHEH 2VNTA 2TBSA 2WV4A 1TA2A 2J4IA 1ESBA 1S0QA 1MQ5A 2SFAA 5E8EH 3QGJA 1NC6A 3V3MA 2A7HA 4IMQA 2SNVA 3BTDE 1G3DA 2FEQH 1LKBA 1GI2A 3FZDA 1SLXB 2Z6BD 1BMMH 4B76A 2ZO3H 4AN7A 4INLA 4NG9H 1J17T 1EPTB 1TPPA 2BD8A 2WPJS 5EQSA 3A87A 1EOJA 1F92A 3KCGH 3BTHE 2HWLB 1ZSLA 1D3TB 2BZAA 2PGBB 2STBE 3A8CA 5LPFA 4DIIH 1DXPA 1GVKB 2GDEH 4XBBA 1A5IA 1P01A 1DWEH 4IN2A 3VB6A 4KKDA 4YT6H 5AVDA 3MTYA 2O8MA 1C5NH 2BTCE 1YP9A 4J2YB 3E8LA 1DE7H 3SNEA 2VIOA 1TNIA 1EAWA 1SB1H 4UD9H 4JZ1A 1P11E 1QHRB 4XOJA 3M5NA 1O3MA 1TA6A 5C1XA 2D1JA 4WY3A 1UVPA 3NKKA 3ELAH 1AY6H 4UFFH 1F2SE 4A5TS 2BX3A 1GJCB 1O2LA 2ANWA 5JB9S 5ESTE 4VGCB 1Z6EA 3FANA 1C9PA 2C8YB 1NU7B 4CR9A 1NZQH 4U2WA 1TNHA 1XKAC 3A83A 3MFJA 4ZROA 4TWWA 5C20A 3ZYDA 8ESTE 4ABIA 1H4WA 1V2UT 2VWMA 4AYVB 1TLDA 2ZGXH 3S9BA 3SJ8A 2O8LA 3KQBA 3A7XA 3VEQB 2O8TA 1RIWC 1GBTA 1MAYA 3FP7E 1O5FH 4AOQA 1LVYA 3MNXA 2ZNKH 3PV4A 1BOQA 1E38B 5DK1A 2PTNA 3GISB 3KL6A 1GWAA 3UOUA 4D76A 1Z8IB 4Z0KA
chains in the Genus database with same CATH superfamily
3SBKA 1AVWA 4IMZA 2W6ID 1HV7A 2A5IA 2PKSC 1KXDA 2PW8H 3KIDU 3TGKE 1GDNA 1W10U 1JIMA 2QXGA 5EJZA 1ZTKA 2A7JA 5IYTA 4CR5A 2FO9A 3MH4A 3U69H 1E37B 1RD3B 2BHGA 1N8OC 3RXKA 5H4IB 2BM2A 1FIZA 1S85A 2VVCA 3VB4A 5DP5A 3W95A 4AB9A 1GHBF 4ISHH 5HIZA 3HGPA 2Q6GA 1OWEA 4BNRA 4J1YA 3LGTA 3N99A 2IOTA 2EQNA 1TOMH 8GCHG 3SU0A 3SJ9A 3ZZ5A 4E7NA 2JH6D 1NT1A 1EFRD 5C1YA 2GV7A 1L2EA 3GY4A 1AZZA 1KSNA 1HAVA 3FVFB 1P02A 1BRUP 1ORFA 2GV6A 1GI7B 2GZ7A 2JJ2D 1ETTH 2ESTE 2ZU1A 1LHDH 3OEHD 2M2AA 3A82A 1KXCA 2XCNA 1T8NA 2OC7A 1T4VH 3MO9A 4OS6A 4VGCC 2XOKD 1CHGA 2QV1A 2P3FH 4CRGA 1EKBB 1P2NA 1GBJA 3DHKH 5EG4A 2FESH 2GCTB 1ZZZA 2AS9A 2Y6TA 4AG1A 1HAOH 1W0ZU 5C5NA 3M7UA 4R8TB 3CS7A 2Y80A 3ATLA 1HGTH 3SN8A 3MH6A 1NRNH 1G9IE 2A32A 2J95A 1B0FA 1MKXK 2TGAA 1BITA 3PV5A 4DJZB 2FTMA 4RN6A 1KTSB 1BQYA 2F3CE 4A6LA 2CV3A 3M3TA 3E1XB 1F0UA 1MTNB 1O2KA 1O2XA 4ZKNU 5DP9A 1ETRH 1K28D 3SI3H 1UTPA 2Z94A 3T2NA 3VFEA 5C1UA 2DE8A 2F4LA 1IQJA 1BHXB 4GCHF 1ZRKA 2XXLA 3QDZB 4NFFA 2XRCA 5EW1H 1LCYA 1TNKA 1C5LH 2J5UA 1XXDA 4HTCH 1PPEE 1XUGA 3M61U 3RU4D 4IBLH 1AN1E 1YM0A 3KHVA 4K1TA 5F8ZA 3VB5A 2PLXA 3I29A 1GBDA 1O3FA 2Y5HA 3EE7A 4CH2B 3AW0A 1F0SA 1F5LA 4JYVH 2Z3DA 1INCA 2BQ6B 2WYGA 4XD7D 3SV9A 1S6HA 2WHXA 5FHTA 5FBIA 1IOEA 4HFPB 3P8GA 1SFQB 2A4QA 2ZFTA 1AKSB 1FNIA 3SGAE 3NRLA 2JH5D 4X8VH 1AIXH 2XBYA 3LC5A 3M5MA 5SGAE 2ANMH 2C90B 2F9BH 1MTSA 1GL0E 3RXJA 4NIYA 3FZZA 1HXFH 3ZZ4A 3TH2H 3ZV8A 4BAMB 2AMQA 4B2BA 4I8JA 1ANCA 1SVPA 2GJGA 2G8TA 1C5VA 3MH5A 4ZH8A 2JKHA 7ESTE 4DURA 2FX6A 4BTTB 1RJXB 1O2ZA 4NIXA 2WSSD 3SV7A 3L6PA 1E79D 3U1JB 3WY8A 1TPAE 1GPZA 1TONA 1QY6A 1AD8H 3D65E 1XKBC 1NTPA 1JIRA 3MH7A 4ABJA 3UQVA 1Y59T 2VWLA 4MQAA 1NO9H 2K8IA 1UCYH 1W12U 2GD4B 1EATA 2C8XB 1OWDA 3UNRA 1SC8U 1FY5A 1O5EH 3RDZA 1W11U 1WU1A 4ISOA 2FP7B 1F0TA 3F68H 2D2DA 2ODPA 1EXFA 3MO3A 1BJUA 1Y3UA 1VCWA 2Z3EA 3RLYH 2RDLA 1ZSKA 1GJ9B 3ZVDA 3PV2A 4BAKB 1TB6H 1W13U 2P3UB 4MPWA 1C5YB 2GTBA 3SU4A 3A7ZA 2J97A 3LGIA 1THPB 3BN9A 4ZUHA 2ZDVH 1UTKA 2BD2A 4DOQA 1DY8A 4ABDA 5GDSH 4DW2U 2FOHA 1IHSH 3M3SA 4BAHB 2C4FH 1ELTA 1SGRE 2KX4A 1TX6A 2Y5FA 4MG3A 1W8BH 5KECA 2VH6A 5L2ZH 5KGOA 4AFQA 1EX3A 2SGDE 3UB0A 1HAZB 1JBUH 1HJ9A 3QGNB 1K1JA 2SNWA 1QL8A 3PTBA 2IPQX 2XW9A 4OS7A 1MD8A 4X1QU 5IK2D 2YMSC 3TJVA 2CJIA 2SGAA 1TNLA 1EAIA 3OAAD 5C5OA 3H09A 2PGQB 4CHAB 2Z9JA 3PTNA 1TGBA 1QB1A 3AW1A 1GBLA 1G30B 1SGNE 5JYIA 2TPIZ 2FOBA 2HLCA 1HAGE 1DLKB 1LVMA 3PYHA 6CHAB 2Z9KA 4JZEH 2H6MA 1O2GH 4MLFB 5F8TA 4ABGA 1WXRA 3ITIA 3OE7D 1O32A 2KCAA 1HB0B 2JETB 2KZ4A 2SGFE 2GMTC 5CHBA 4WH6A 2WZQA 1ETSH 1LPKB 1G2LA 1C1NA 1FY8E 1GJAB 1SQRA 4K3JA 2VIWA 1P10A 3MNSA 1O3DA 1XM1A 2HPPH 1XXFA 2W3KA 3C1KA 3KNXA 5K0HA 1UTQA 1W7GH 2ZA5A 2ZWLH 4TT3D 5FX6A 1BBRK 2W3IA 3UTUH 1KMHB 1IQHA 2A0QB 2BDBA 2BDAA 2FWWA 1O2SA 2ZCKP 5B6LA 1C2EA 5EIYA 5GXPA 4B1TA 1VKYA 3SW2B 1KDQB 2A45B 4P00A 3AAVA 4BXSA 3NCLA 2Z7FE 1P03A 2WV9A 3BTGE 4DCDA 2WPIS 2XWAA 2G81E 3P8NA 1TE0A 1RTFB 1OP0A 4O03A 2FPZA 1K1IA 1FN6A 2H9EH 2ILNA 4JK5A 2QIQA 3S9AA 3PB1E 1C2IA 1TIOA 3DFJA 1F5KU 2A2XH 3F9GA 3PO1C 4E05H 3UPEA 3S69A 4ABHA 1H8DH 2BQ7B 4NCYA 3RMNH 1WTGH 5LPRA 3LKWA 1O3EA 1BTPA 1LHGH 1AB9B 2AGGX 2ZPRA 5J4QA 2CGAA 3GY7A 1MU8B 1ABJH 2AFQB 1GHAF 2ZI2H 3UUZA 1Q3XA 2UWOA 1HAYB 3SUEA 1OP2A 1GI3A 3DT0H 1NROH 3QLPH 3ZZAA 1TX7A 1WV7H 4MPVA 1Q31A 1CBWC 1PPZA 1SBWA 2V35A 3SV2H 2A2QH 2VWNA 3TGJE 4D7FA 3RXAA 1S83A 3GOVB 1YLCA 1ZMJA 8LPRA 3C27B 3SV8A 2V6NA 3T29A 1L1JA 2XBXA 3RC4A 1GHXH 3EE0B 1P9UA 4JK6A 4MNXA 3SU5A 1C2LA 1KTTB 1NFYA 2UUFB 2DE9A 1GHAG 1KLJH 1MU6B 3HPTB 4Y6DA 1GBIA 2XC0A 5IDKA 1F5RA 5JDUB 1V2MT 1T8LA 1E1RD 2ODYB 3EDXB 2FOFA 3T28A 3RXGA 3TNSA 2AERH 3PO1B 3FP8E 4AYYB 2YMSB 1MQ6A 3LJJA 1UHBB 5A8YA 7LPRA 2GDDA 3DUXH 3RXEA 5FCRA 1SGCA 3GCOA 1RRKA 3LONA 1GJ7B 1C5ZB 1LHCH 1E36B 1YPHE 3F9EA 1Z1IA 2PKSB 4ASHA 1UK2A 2B0FA 3PRBA 2VGCB 4RKOB 1VGCB 1TMUH 3RLWH 4JMYA 2F91A 2VINA 1V2VT 1ZSJA 1PQ7A 3HGNA 1BMLA 5HXFA 2OC1A 3RUOA 4MPUA 1YPJH 1SKYE 2BLQA 5A0CA 2CXVA 1L4DA 1WCZA 1ZTLA 1NESE 1GGDC 1EZQA 3RU4T 1T8OA 4Q2KA 3FKSD 3SUFA 4K2YA 1BB0B 2BVRH 1SGDE 3MHWU 4ISNA 3WWBA 5AFYH 4I8HA 3KQDA 2STAE 2QXIA 5ABWA 2ZDAH 1SHYA 3F0PA 1CA8B 1TGCA 5CHAC 4K1SA 2QCYA 1T32A 5HM2A 1DX5M 1AFQB 4TPIZ 2G4UA 3SQEE 1ELFA 4BTIB 3SI4H 2P8OC 5EW2H 3RMLH 1FX0B 1SG8B 1MKWH 1HRTH 1O2TA 1QBOA 5EODA 2H1UA 1OKXA 3A8AA 2VVVA 3RXDA 2ZU2A 4RT1A 1O3AA 1T8MA 1N1LA 4H6TA 3ZZ8A 1BTZA 1ESTA 2H2ZA 2I6SA 2OC0A 1KYNA 9ESTA 2ZF0H 3QTVH 3RXSA 8KME2 3P6ZB 1FLEE 1WQSA 4X0WU 4ZKSU 4B6EA 4UONA 2PKAB 1GI8B 2YNAA 1FIWA 1BTHH 2GP9B 1BTYA 4YXWD 1GL1A 4B71A 3VG8A 1BCUH 3S7KB 3PLBA 4YTAA 2FDAA 4FUGA 5EU8A 1ZJDA 4FUHA 1P2KA 1UW7A 1HLTH 2P94A 2UWLA 2A31A 3WWFA 3TK6A 1OS8A 1KXBA 2ZDLA 1AFQC 2HNTE 1L1NA 4CRBA 4K60A 5I46H 7KMEH 2ZG0H 4X1PU 1K9OE 4NZLA 2ULLA 2ZZUH 3M36A 2HOBA 5FX5A 5A0BA 1CT0E 3DSPA 4Q7ZA 2QYIA 5A8XA 5A0AE 4MDSA 1H8ED 1C5QA 1VJ9U 1PPFE 2Y82A 1NY22 3QZQA 1C5OH 3LGUA 1TMTH 3B9FH 3P8FA 2ZDMA 4Z1MD 2KM0A 1FZZA 3ODFA 1AFEH 1ZTJA 4Q80A 4OS2A 1GJ4H 4XE4A 1CT4E 2ZEBA 1E0FD 5JBCS 1YLNA 2DUCA 2IJD1 4ESTE 1SGFA 3V13A 3SQHE 4UFEH 2J38A 5L30H 3I78A 2QXHA 2FX4A 2C8WB 3E3TA 1GDUA 4FXGH 3UREA 3A88A 2GX4A 2AYWA 2OINA 1TRNA 5GCHG 1WAYB 1CA0C 3GCNA 2AMDA 2BY6X 3ZZCA 2R2MB 1QL7A 4FU8A 3PWCA 3PWBA 5ESBA 4F48B 3MO6A 1P2QA 1FDPA 2OQ5A 4ABFA 2Y5GA 3WW7A 1GHBG 3A80A 1AZ8A 3MU4A 2PV9B 3LC3A 5HYOA 2BD9A 1GMDG 4KGAA 4X2VA 1PPCE 3EA9A 1NFXA 2NU3E 4HZHA 5EOKA 9LPRA 2ASUB 2BY8X 2GCHG 1DDJA 1D9IA 2Q1JA 3UWIA 4FU7A 1V2OT 1TRMA 1S81A 2FIRH 1P12E 5EXNA 5AFZH 2BOHB 1SGIB 1IAUA 1UVUH 2ZPQA 3N7OA 1FN8A 2NWNA 1YPMH 2SGPE 3M7TA 1C1SA 1FPCH 1PQ5A 2CMYA 3LH1A 1J15A 1HAHH 1O5AB 2TIOA 3O8BA 1GVZA 4OGXA 1JRSA 2GCHF 1ZGVA 1IQIA 1RFNA 3KQEA 5GWZA 1LVBA 2R9PA 1ZHRA 3TJUA 1PPBH 3ENSB 4X8UH 4GLYA 3QN7A 4FUJA 1GBBA 1JWTA 1GJ6A 1ZR0A 3LDXH 5DSFA 1MMJN 1OWKA 1FUJA 2O8WA 4UFDH 3RMOH 3N7EA 1O2RA 3RXMA 1AUJA 3RXPA 3LPRA 4I86A 3EA7A 4JZDH 1Y5BT 6ESTA 5T6GA 3VPKA 4Q7XA 3K9XB 2CN0H 3TK5A 1CSOE 2CHAB 1C2DA 5F03A 1GHVH 3A84A 1A5HA 3SU3A 4MVNA 4DGJA 1KIGH 1O37A 1AMHA 1WYKA 5EXMA 3OSYA 1O2VA 2GCTC 1SQOA 3OY6U 1D4PB 2Z3CA 2ZQ2A 1SGYE 4B2CA 1K1PA 4K69A 3AVZA 3BEIB 1ZJKA 1S0RA 1HIAB 1BJVA 1QTFA 1A0LA 1JRTA 2ALVA 2L74A 2TGPZ 4XBCA 2A5AA 3TU7H 1CE5A 1CHOG 4U32A 4AZ2B 1DS2E 2BD4A 3GS9A 6GCHF 4BAQB 2BYAX 1NU9A 1NRPH 1GMHF 1TABE 3T25A 5CE1A 5A2MH 2VU8E 3E0NB 1DVAH 2ZHQH 4KTSA 1O3GA 1CGIE 3ATWA 1CHOF 1QA7A 1QNJA 1SL3A 3E90B 1VCQA 4FUIA 1YCPK 4B74A 2BY7X 1GMHG 2OCVB 4NWKA 4INHA 4Y8YA 2W5EA 1UMAH 4LK4A 2UUJB 1GI0A 4K5ZA 1O0DH 6GCHG 5CHAB 4O3TA 4X8SH 5FPTA 2QXJA 3PM3A 4Y71A 1GI4A 3HKIB 2THFB 1AU8A 1FI8A 2Z9GA 3Q3XA 3P17H 2OK5A 4ABEA 5DN6D 1OWIA 2PTCE 2BQWB 4XSKU 3KN2A 3MOCA 1YC0A 1A4WH 1NPMA 4P02A 4TWYA 2ZTYA 4TY7A 1C1UH 4IN1A 2UUYA 4CBOA 3GCHC 4ZXXH 4FUDA 2F9VA 3U28C 3OFND 1ELEE 1XUJA 1EUFA 5EQRA 2EI7A 2V7QD 3ZVGA 5A8ZA 2EI6A 2ZFQH 3ZZDA 1P05A 3P92A 3V7TA 4Q63A 4Y0ZE 2BLOA 2PUXB 4B2AA 1C2JA 2WPKS 4OM9A 2XTTB 4AFZA 4AFSA 1A2CH 1WTHD 3SNDA 1TBRH 3RXIA 3PLPA 3A8DA 4O3UA 2BLWA 1H9HE 4YOJA 2QAAA 1SGQE 1DUAA 3VB3A 3O8CA 1RTKA 3ODDA 4CREA 4QT8C 1W3CA 3HK6B 4XFQA 3GICB 2R0LA 1GI9B 4MTBA 1VITH 4HG6A 1AKSA 1TGNA 3S0NA 3DSOA 4U01A 2PHBA 5A09A 3DSGA 1NFWA 3AASA 1TGTA 3T27A 1F0RA 2WV5A 3PMHB 3K2UA 4YO9A 5GJ4B 3RXOA 5C2ZA 2ZQ1A 4K8BA 1BRAA 1NFUA 3E16B 3KF2A 1W0KD 1HXEH 4X6PA 1GDQA 1O2JA 1Y8TA 1CQQA 1SGTA 1GJBB 3O8RA 3RXVA 1NN6A 1Z1JA 1A7SA 2GZ8A 2RG3A 1O2HA 2HNTF 2KAIB 1LDTT 2BLVA 5GCHF 3LIWA 1ZHPA 2ZP0H 5T6DA 3TIUA 1A1RA 4A7IB 1AB9C 1ABIH 2G51A 5FPSA 1DXWA 4YZUA 4WH8A 3SO3A 2OQUA 1G3CA 1EAXA 1O39A 1XVOA 2EI8A 5AF9H 2ZU4A 4KTUA 1OX1A 2QY0B 3QTOH 3OX7U 4OS4A 4Y7BA 1SOZA 1UTNA 3ZVBA 3SNCA 1DANH 1J14A 2Q6DA 4DT7B 1P2OA 2FOAA 4WXIA 2ZFRH 1OSSA 4DY7B 2C8ZB 2BD3A 3VXEH 2OP9A 1QFKH 3UNQA 1SLVB 2XBVA 5C17A 5DP6A 1GBAA 1QZ8A 2Y81A 2FODA 4A92A 2TGTA 1SOTA 1HUTH 1A61H 1TGSZ 1TWXB 3TJOA 3ZYEA 3ZZ7A 1SI5H 1XUFA 3B23B 4X2YA 2Y7XA 4CRAA 2C3SA 4I8GA 5C67A 2A1DB 3LGVA 1FQ3A 5DG6A 2HGTH 5L6NH 4Y0YE 1MKWK 2BVXH 2CF8H 1P2JA 4PROA 1C5WB 3SU1A 2RDEA 1XUHA 1UK4A 5E0HA 1LPGB 1Q2WA 1UTLM 1G3BA 1QJ7B 1C1RA 4GUXA 1GCTC 4UFGH 2K1QA 4Z6AH 1CO7E 1YF4A 2AH4X 3RXCA 1UHBA 5JB8S 4MNYA 4ASUD 2AEIH 1V2ST 3BTFE 1SFIA 2A7CA 1MD7A 3BTQE 1C5RA 2FOCA 2QF3A 3RM2H 2BY5X 2G00A 3RC6A 1TPSA 3KEEA 2BDHA 3UWJH 4X6NA 1SR5C 5I25A 1MAXA 1G3EA 4I8LA 2R3YA 2FXRA 4H4FA 1O3LA 3BTWE 4OS1A 2AGEX 2ZFSA 2LNCA 3RC5A 2LP6A 2YNBA 2GKVE 5AHGH 2ZDNA 1QBVH 4AORA 1EZSC 2ZU5A 2Q6FA 5EXLA 1PQAA 2AIQA 4RSPA 5JBAS 1EJMA 1LO6A 2XC5A 4U30A 2Y7ZA 2F9UA 2ANKH 3PROA 4IS5A 1TAWA 2JH0D 2WPDD 1ELGA 1MBQA 2QF0A 1O38A 2EC9H 2R2WU 4FETA 3ZVAA 4Y10E 1BMAA 4E06H 2OUAA 1HJAB 2ZGHA 2AMPA 2VIQA 3W94A 2ZGCA 5L2YH 1IQFA 3GY3A 3A89A 1VR1H 2HVXA 2C93B 1SGEE 1YCPH 1G32B 1DT2A 4K1EA 2ZECA 1MZAA 3IG6B 4KP0A 2FS8A 1ZYOA 3SHCH 3T5FH 1BBRE 4IC6A 4Y7AA 1T31A 3IWMA 1YBWA 1HAXB 2JETC 4ZHMU 1BT7A 3A81A 2BD5A 2UUKB 2G4TA 1LQEA 2XCFA 1GBHA 2VWOA 3LU9B 1NS3A 1BZXE 3K65B 1O2MA 3MU8A 1EPTC 2K0QA 3U8TH 4WVPE 3LT3A 2CF9H 2F43B 1FJSA 4FVBA 1QRWA 4DVAU 2PSYA 2QE7D 2QA9E 5C3NA 4FU9A 1O3KA 2W7SA 4AGKA 1DLEA 1BTXA 4KELA 1FAKH 5F53A 3GYLB 1ESAA 5TJXA 3E91A 5FXLA 4YM9A 1MZDA 2ZCLP 3SUDA 4INKA 3SZEA 1IQNA 2A4GA 4MPXA 1P2MA 1C5SA 1YPGH 1O2QA 4KTCA 3PRDA 1EB2A 3CNRA 3ESTA 1H8IH 4I33A 3ATKA 5JBBS 1MTUA 2LELA 4RKJB 1NRSH 3KYFA 3LGYA 1VITG 4X1SU 1KXAA 1H9LB 2FYRA 1O5BB 2PFEA 3F9HA 1C2MA 1EOLA 1C9TA 5FPYA 1JXPA 1D3PB 3A86A 1RIWB 3MWIU 1C1OA 1TOCB 1KY9A 2TGDA 3ZIAD 3D62A 1KLIH 2UWPA 1SLWB 1HIAA 3GDVA 3TLOA 2H5DA 4TPYA 1N6YA 3MU1A 1DITH 4B75A 1GCTB 1S6FA 2J98A 2ZPSA 1THSH 1THRH 2PR3A 5BPEA 2GMTB 1UO6A 2J98B 2BOKA 3E0PB 1O2NA 3M35A 1MCVA 2BMGB 3LOXA 1AE8H 2OBOA 1GHYH 1P04A 1LHEH 2WPLS 2OLGA 4ZMAH 5C94A 3NXPA 3A7TA 1JMOH 2XYAA 1T4UH 4BOHA 4Q7YA 1WDIA 1SHHB 3RU4E 3BEUA 4TY6A 1GG6B 4CBNA 2H9TH 1GMDF 1AE5A 1P9SA 4JCNA 5DP8A 2B9LA 1O3PB 3A8BA 3L33A 5DP7A 3RXUA 3UNSA 4CRFA 1O3BA 1V2LT 3ZZBA 2OTVA 1JOUB 3GDSA 1YGCH 4JYTA 1TMBH 1FONA 3T62A 3MU5A 3SJOA 4F55A 3UFAA 2BXTH 1GCDA 3Q3KA 2RA0A 2IJOB 3JZ1B 5EPYA 4HI3A 3HKJB 1EZXC 4R0IA 1Y3YA 1BMFD 1SQAA 3DD2H 2QF4A 4NFEA 5J4SA 4GSOA 3RP2A 1ELDE 1QA0A 2WPHS 3NPSA 1O3JA 1YYY1 1S5SA 4WJG2 3IITA 1EQ9A 1EJAA 5FBEA 3BTKE 3M37A 1IQMA 5DKMA 1DWBH 5C0UA 1IQKA 2F9NA 4CRDA 3S7HB 1OP8A 2QC2A 2TRMA 1XX9A 2BD7A 4GVUA 1RTLA 2KFWA 1GI6A 1TALA 2J92A 5LH8A 1E1QD 2FI4E 4TYDA 1P57B 5GNDA 3M7QA 4THNH 1O35A 1A0JA 2J2UA 1O2WA 1ZOMA 1F7ZA 2ZHDA 1DM4B 1P8VC 5E0GA 1QB9A 3UR6A 5DO4H 1G36A 1D3QB 1C2GA 1K1LA 1TFXA 3SORA 1EPTA 1GMCG 3ZZ6A 5G4BA 3STIA 2NU1E 3RXRA 3KGPA 1QJ1B 2G55A 1ZMLA 2B7DH 1DICA 4RI0A 1GI5A 3MI4A 5T3HA 1PYTC 1QQ4A 1V2RT 4X1RU 3TNTA 2V0BA 3D23A 1AWFH 5E2OA 1S82A 2ZTZA 2D8WA 4WWYA 2W26A 2JJ1D 3SJIA 1Y3VA 1PYTD 1YWUA 1P09A 3BTEE 1QJ6B 2BB4A 3TGIE 3R0FA 3ATMA 3TVJB 2VIDA 1ZGIA 2FYQA 1Y5UT 4JYUH 4SGAE 1OWHA 5EJ1A 2H9HA 2VGCC 4DT4A 3GY5A 1V6DA 3H7OA 5EGMA 5B6OA 1CBWB 1V2WT 1K2I1 3GDUA 1D6RA 1BA8B 1MTVA 3MU0A 3U1IB 3CS0A 3OEED 1D6WA 2AIPA 5HGGA 2OD3B 3FP6E 1HBTH 2ZC9H 1TRYA 1HJAC 3AAUA 1C1VH 2FOEA 3M5OA 3QUMP 3GCHB 1MBMA 1PPGE 1Y3WA 4LZ1H 2BZ6H 1YKTA 1MABB 1CT2E 4NSVA 4BAOB 4YOGA 2CHAC 4CRCA 1A3BH 1ZHMA 1OYTH 2FLRH 2BDGA 1AWHB 2XWBI 1CA0B 1C5XB 1TQ7B 2BDCA 1UVOA 1C2HA 1O3NA 1O2OA 1LQDB 1QR3E 3UQOA 1LVOA 4I32A 5K7RA 1O2IA 1NM6A 2WPMS 4ZKOU 1V3XA 2AGIX 4Y8XA 2ZHFH 2G5NA 1LKAA 3ATIA 4FUFA 4GHTA 2ZGJA 2EY4C 3U8OH 1C4V2 3BIUH 1GVLA 3RXTA 4D8NA 4AB8A 3RXHA 1C4U2 1GGDB 3CP7A 1ARBA 1BMNH 3F0OA 4I8KA 4BANB 3MNCA 1YPLH 4X2XA 4IC5A 4D9QA 4H6SB 3TH4H 1MTWA 1O2PA 1SGFG 4AFUA 6LPRA 2J34A 2O9QA 3F3BA 1GHWH 4AC9A 1O31A 2PUQH 1WOFA 2KCPA 1GHZA 4XBDA 3OYPA 1FPHH 1DPOA 3R3GB 5PTPA 4A1VA 1BTUA 2F83A 2ZKSA 1GJDB 4I7YH 4A1TA 1XVMA 1V2NT 1WUNH 1GJ5H 3VGCC 3O8DA 1O33A 2V3OH 3L3TA 1FY4A 3OU0A 4Y8ZA 3K6YA 1HNEE 3DCLA 4CHAC 2Z9IA 5DP3A 2BY9X 4MNWA 1OXGA 1W0JD 2EEKA 2J94A 1DSTA 2Z9LA 5LPEA 1EP5A 2IN2A 5GIBA 2QN5T 1COWD 1ZLRA 3E6PH 3DFLA 3SZNA 1YPHC 1TQ0B 3D49H 1SLUB 1K1OA 4ZHLU 3VGCB 3ZV9A 1C4Y2 3F1SB 2F9PA 2F9OA 3SYJA 1DY9A 5EQQA 2VIVA 1TBQH 3A7WA 1TYNA 2BDYA 2GT8A 1TNGA 2WUBA 1H9IE 1UK3A 3ZZ3A 4Y79A 5F8XA 3NUMA 1C5TA 3BV9B 2VJ1A 3P8OA 3ZVCA 1C2KA 4FOUC 3GY6A 2RA3A 3U9AH 1TNJA 5EPNA 1O36A 3URCA 1KXEA 1WBGB 1FV9A 1DWDH 1XUIA 3Q76A 2FI3E 1YPEH 1Z8GA 2ZFPH 3NZIA 2P95A 4AX9H 1QQUA 3EA8A 5JPMH 4NGAH 1WQVH 2W7UA 2FI5E 2OC8A 1GBMA 2P8OB 1AVXA 2GVFA 4JZIA 1HPGA 1H1BA 3UR9A 3A85A 3RXQA 4X6OA 4XRNA 1W2KH 1P3CA 3GCTG 3F2GA 4NIWA 1GG6C 1VITF 3DA9B 1EAUA 1SGPE 2O8UA 4DIHH 1LPZB 1B0EA 2ZGBH 1EJNA 3PMBB 1A0HB 3UY9A 2FOGA 1OYQA 3Q00A 1C1PA 1P2IA 1C1QA 1PFXC 1W14U 2R0KA 3EAJA 3SGQE 3FAOA 5CMXH 1ARCA 3F9FA 1HJ8A 2KCYA 1N6XA 2I6QA 5HMAA 4DG4A 2B5TB 3U8RH 2ZDKA 2KCOA 3BSQA 4D7GA 1LMWB 2GZ9A 2HLDD 1DSUA 2YMSD 3UOPA 1QB6A 1K1MA 1CU1A 4X2WA 1S84A 4M7GA 3P95A 3TK9A 2OBQA 3VB7A 2ZCHP 1ANEA 1NRRH 5T6FA 4WMFA 2SGEE 1ZPZA 4NIVA 2XC4A 1ID5H 1ZRBA 1LHFH 2BVSH 1VZQH 3M3VA 3LH3A 4MNVA 1P06A 2WINI 1EZUC 2ZFFH 1V2KT 1CGJE 3ZVFA 3I77A 2M5TA 3QZRA 5E2PA 1FMGA 1QIXB 1O30A 3EQ0H 2A4RA 3BG8A 7GCHG 2HNTC 3ZVEA 1TPOA 2A5KA 3URDA 4ABAA 1RGQA 3KYGA 3PLKA 3FOAA 1UVTH 1L1GA 3N7DA 5KEDA 2QGRA 3V0XA 2RCEA 3H5CB 3GY8A 1W0YH 4UDWH 1UTJA 1WSSH 4GPGA 2P59A 1DOJA 1L4ZA 4ZCNA 1P3EA 1V2QT 2VBCA 3A7YA 4ACAA 1O5GH 3QWCH 3P70B 3EGKH 1DWCH 3H7TA 3GCTF 1BHXF 4ZHAA 2KR7A 1FY3A 3BF6H 2YOLA 1PPHE 3TJNA 3BIVH 3JZ2B 1QRXA 2FLBH 5C0TA 4I31A 1T7CA 5HIYA 1AI8H 1IHTH 2ZHWH 3SV6A 1AO5A 5FCKA 4Y76A 1B5GH 1VCPA 3SJKA 1AHTH 3BEFB 3Q3YA 1FXYA 2ANYA 1IQGA 4GAWA 1VGCC 1DFPA 2XNIA 1QCPA 1AQ7A 1NRQH 2RFKC 2HRVA 2B8OH 2ZTXA 1QL9A 3U98H 1HCGA 1SSXA 4BTUB 4YLUA 1UCYE 4ACBA 4B73A 4A1XA 5LGOA 1GI1A 1CVWH 1HYLA 1YLDA 3EYDA 4FUBA 1C1WH 1SQTA 1ANBA 3FFGA 1K1NA 1KDQA 4WF8A 3T26A 3BTTE 4GHQA 5GPIB 4ZKRU 2FZZA 3RMMH 2NU2E 3NWUA 3STJA 3UIRA 5DJ7A 4YT7H 3QX5H 2ZIQH 5HM9A 1HFDA 4NA8A 1GBKA 1ELVA 2A4OA 2H5CA 2OXSA 1TX8A 1IQEA 1OOKB 7GCHF 2D26C 1A3EH 3BG4C 1NBMD 1XMNB 3KQCA 3SHAH 2SGQE 2WUCA 5E0JA 2KAIA 1C5UA 2BXUH 3V12A 1HAPH 3UAIC 1B7XB 3M5LA 1SMFE 1O3HA 4FUCA 4ZXYH 5TCCA 3RXBA 1GMCF 2P3TB 1V2PT 4ISLA 4LOYH 1K0HA 4K8YA 1OWJA 3B8JA 3BTME 1E34B 4O97A 3SNBA 1MCTA 1J8AA 1X7AC 4X6MA 1H8HD 4SGBE 3W1EA 4NSYA 1O5DH 1O2UA 1ZPBA 3GY2A 2VVUA 2VIPA 1Z7KA 1BIOA 1EASA 2XNDD 3K6ZA 5HKKD 1AGJA 1FY1A 2HALA 3OTPA 1UVSH 1GBFA 2FTLE 1OHHD 3SU2A 8GCHF 2PKAA 3LJOA 2GGVB 1W7XH 1ACBE 1C1MA 1Z6JH 3MQKC 1O2YA 1ANDA 3AK5A 1FAXA 4O9VA 3MMGA 1AVGH 1BUIA 5TCAA 3A7VA 3BG4B 3Q77A 2WYJA 4FUEA 1Y5AT 1XUKA 1AUTC 5F6MA 2NU4E 1IQLA 1QGFA 1KLTA 2JIZD 1Z71A 3SU6A 1M9UA 1HAVB 3QK1A 1N8OB 1O34A 3HK3B 1Z8RA 1ELCA 2PSXA 5DGJA 4WMDA 4OS5A 1U6QA 3PMAB 1UJ1A 3PMJA 1A46H 3SOSA 2NU0E 1ELBA 2GT7A 2VH0A 3OTJE 4X8TH 1V2TT 2IPHA 3GYMA 3S9CA 4UE7H 1O3OA 4ISIH 3LGWA 4ZAEA 1O3CA 5FAHA 4YESB 1G37A 6CHAC 2W6JD 4NZQA 3F6UH 3KQ5A 4OGYA 4BXWA 4YOIA 1C5PA 4WMEA 3G01A 2QF5A 5ETXA 2P93A 1MUEB 4JZFH 1QURH 4GCHG 3SNAA 1VJAU 1Z8JB 3TITA 5FL7D 3NK8A 4IW4E 1O5CB 3RXLA 3FN8A 1BDAA 1C2FA 4HGCA 1RS0A 2R3UA 4Y11E 3TPIZ 1E35B 4FVDA 4NWLA 1A5GH 1GBEA 2ODQA 1CGHA 1Y3XA 1ZMNA 3SUGA 4D9RA 2PWXA 4F49A 3VXFH 4NA9H 1HAIH 2BDIA 2EA3A 1K21H 2J9NA 4NA7A 1V2JT 2HVYB 1GJ8B 5DPAA 1O3IA 2FOMB 3TH3H 1C5MD 5DP4A 3OY5U 4UEHH 4H42U 2LPRA 2FM2A 1OPHB 2G5VA 4XDEA 1GBCA 1UTOA 2FS9A 1K22H 4F4OC 1L0ZA 3CENA 1BRCE 1PQ8A 1HDTH 2V3HH 3SGBE 4TSFD 4ABBA 1DUEA 2XBWA 2V3MA 2ALPA 1KXFA 1QBNA 4AG2A 1MKXH 1ELAA 3RXFA 1RXPA 4CH8B 1BTWA 5CDFE 1TBZH 3QO6A 5JBTA 3MYWA 1D3DB 2FMJA 2VB0A 1QRZA 1BBRH 4E7RG 1MTNC 3HATH 4M9FA 3RM0H 1UTMA 4IGDA 5EJLA 1C1TA 2ZU3A 4X1NU 4WXVA 1PJPA 4YLQH 1BRBE 4LZ4B 2L6OA 1G2MA 1SPJA 3ZZ9A 1UCYK 1LTOA 2G52A 1MH0A 1ZPCA 1J9CH 4LXBH 2AHME 2PP6A 4AGJA 5BRRE 1EB1H 1J16A 1EP6A 1YCPM 2P16A 1YPKH 2BX4A 2HPQH 3MNBA 1P0SH 2ZHEH 2VNTA 2TBSA 2WV4A 4Q4LA 1TA2A 2J4IA 1ESBA 1S0QA 1MQ5A 2SFAA 5E8EH 3QGJA 1NC6A 3V3MA 2A7HA 4IMQA 2SNVA 3BTDE 1G3DA 2FEQH 1LKBA 1GI2A 3FZDA 1SLXB 2Z6BD 1BMMH 4RT0A 4B76A 2ZO3H 4AN7A 4INLA 4NG9H 1J17T 1EPTB 1TPPA 2BD8A 3F2HA 2WPJS 5EQSA 3A87A 1EOJA 1F92A 3KCGH 3BTHE 2HWLB 2JDID 1ZSLA 1D3TB 2BZAA 2PGBB 2STBE 3A8CA 5LPFA 4DIIH 1DXPA 1GVKB 2GDEH 4XBBA 1A5IA 4B6FA 1P01A 1DWEH 4IN2A 3VB6A 4KKDA 4YT6H 5AVDA 3MTYA 2O8MA 1S6LA 1C5NH 2BTCE 1YP9A 4J2YB 3E8LA 1DE7H 3SNEA 2VIOA 1TNIA 2CK3D 1EAWA 1SB1H 4UD9H 4JZ1A 1P11E 1QHRB 4XOJA 3M5NA 1O3MA 1TA6A 5C1XA 2D1JA 4WY3A 1UVPA 3FO8D 1YY3A 3NKKA 3ELAH 1AY6H 4UFFH 1F2SE 4A5TS 2BX3A 1GJCB 1O2LA 2ANWA 3F2FA 5JB9S 5ESTE 4VGCB 1Z6EA 3FANA 1C9PA 2C8YB 1NU7B 4CR9A 1NZQH 4U2WA 1TNHA 1NBME 1XKAC 3A83A 3MFJA 4ZROA 4TWWA 5C20A 3ZYDA 8ESTE 4ABIA 1H4WA 1V2UT 2VWMA 4AYVB 1TLDA 2ZGXH 3S9BA 3SJ8A 5T1VA 2O8LA 3KQBA 3A7XA 3VEQB 2O8TA 1RIWC 1GBTA 1MAYA 3FP7E 1O5FH 4AOQA 1LVYA 3MNXA 2ZNKH 3PV4A 1BOQA 1E38B 5DK1A 2PTNA 3GISB 3KL6A 1GWAA 3UOUA 4D76A 1Z8IB 4Z0KA
chains in the Genus database with same CATH topology
3SBKA 1AVWA 4IMZA 1HV7A 2A5IA 2PKSC 1KXDA 2PW8H 3KIDU 3TGKE 1GDNA 1W10U 1JIMA 2QXGA 1ZTKA 2A7JA 5IYTA 4CR5A 2FO9A 3MH4A 3U69H 1E37B 1RD3B 2BHGA 1N8OC 3RXKA 5H4IB 2BM2A 1FIZA 1S85A 2VVCA 3VB4A 5DP5A 3W95A 4AB9A 1GHBF 4ISHH 2Q6GA 3HGPA 1OWEA 4BNRA 4J1YA 3LGTA 2IOTA 1TOMH 8GCHG 3SU0A 3SJ9A 3ZZ5A 4E7NA 2JH6D 1NT1A 5C1YA 2GV7A 1L2EA 3GY4A 1AZZA 1KSNA 1HAVA 3FVFB 1P02A 1BRUP 1ORFA 2GV6A 1GI7B 2GZ7A 1ETTH 2ESTE 2ZU1A 1LHDH 3A82A 1KXCA 2XCNA 1T8NA 2OC7A 1T4VH 3MO9A 4OS6A 4VGCC 1CHGA 2QV1A 2P3FH 4CRGA 1EKBB 1P2NA 1GBJA 3DHKH 5EG4A 2FESH 2GCTB 1ZZZA 2AS9A 2Y6TA 4AG1A 1HAOH 1W0ZU 5C5NA 3M7UA 4R8TB 3CS7A 2Y80A 3ATLA 1HGTH 3SN8A 3MH6A 1NRNH 1G9IE 2A32A 2J95A 1B0FA 1MKXK 2TGAA 1BITA 4DJZB 2FTMA 4RN6A 1KTSB 1BQYA 2F3CE 4A6LA 2CV3A 3M3TA 3E1XB 1F0UA 1MTNB 1O2KA 1O2XA 4ZKNU 5DP9A 1ETRH 1K28D 3SI3H 1UTPA 2Z94A 3T2NA 3VFEA 5C1UA 2DE8A 1IQJA 1BHXB 4GCHF 1ZRKA 2XXLA 3QDZB 4NFFA 2XRCA 5EW1H 1LCYA 1TNKA 1C5LH 1XXDA 4HTCH 1PPEE 1XUGA 3M61U 3RU4D 4IBLH 1AN1E 1YM0A 3KHVA 4K1TA 5F8ZA 3VB5A 2PLXA 3I29A 1GBDA 1O3FA 2Y5HA 4CH2B 3AW0A 1F0SA 1F5LA 4JYVH 2Z3DA 1INCA 2BQ6B 2WYGA 3SV9A 1S6HA 5FHTA 5FBIA 1IOEA 4HFPB 3P8GA 1SFQB 2A4QA 2ZFTA 1AKSB 1FNIA 3SGAE 2JH5D 4X8VH 1AIXH 2XBYA 3LC5A 3M5MA 5SGAE 2ANMH 2C90B 2F9BH 1MTSA 1GL0E 3RXJA 4NIYA 3FZZA 1HXFH 3ZZ4A 3TH2H 3ZV8A 4BAMB 2AMQA 4B2BA 4I8JA 1ANCA 1SVPA 3MH5A 2G8TA 1C5VA 4ZH8A 2JKHA 7ESTE 4DURA 2FX6A 4BTTB 1RJXB 1O2ZA 4NIXA 3SV7A 3L6PA 3U1JB 3WY8A 1TPAE 1GPZA 1TONA 1QY6A 1AD8H 3D65E 1XKBC 1NTPA 1JIRA 3MH7A 4ABJA 3UQVA 1Y59T 2VWLA 4MQAA 1NO9H 1UCYH 1W12U 2GD4B 1EATA 2C8XB 1OWDA 3UNRA 1SC8U 1FY5A 1O5EH 3RDZA 1W11U 1WU1A 4ISOA 2FP7B 1F0TA 3F68H 2D2DA 2ODPA 1EXFA 3MO3A 1BJUA 1Y3UA 1VCWA 2Z3EA 3RLYH 2RDLA 1ZSKA 1GJ9B 3ZVDA 4BAKB 1TB6H 1W13U 2P3UB 4MPWA 1C5YB 2GTBA 3SU4A 3A7ZA 3LGIA 1THPB 3BN9A 4ZUHA 2ZDVH 1UTKA 2BD2A 4DOQA 1DY8A 4ABDA 5GDSH 4DW2U 2FOHA 1IHSH 3M3SA 4BAHB 2C4FH 1ELTA 1SGRE 1TX6A 2Y5FA 4MG3A 1W8BH 5L2ZH 2VH6A 4AFQA 1EX3A 2SGDE 1HAZB 1JBUH 1HJ9A 3QGNB 1K1JA 2SNWA 1QL8A 3PTBA 2XW9A 4X1QU 4OS7A 1MD8A 3TJVA 2CJIA 2SGAA 1TNLA 1EAIA 5C5OA 2PGQB 4CHAB 2Z9JA 3PTNA 1TGBA 1QB1A 3AW1A 1GBLA 1G30B 1SGNE 5JYIA 2TPIZ 2FOBA 2HLCA 1HAGE 1DLKB 1LVMA 3PYHA 6CHAB 2Z9KA 4JZEH 2H6MA 1O2GH 4MLFB 5F8TA 4ABGA 3ITIA 1O32A 1HB0B 2JETB 2SGFE 2GMTC 4WH6A 1ETSH 1LPKB 1G2LA 1C1NA 1FY8E 1GJAB 4K3JA 2VIWA 1P10A 3MNSA 1O3DA 1XM1A 2HPPH 1XXFA 2W3KA 3C1KA 3KNXA 5K0HA 1UTQA 1W7GH 2ZA5A 2ZWLH 5FX6A 1BBRK 2W3IA 3UTUH 2A0QB 1IQHA 2BDBA 2BDAA 2FWWA 2ZCKP 1O2SA 1C2EA 5GXPA 4B1TA 3SW2B 1KDQB 2A45B 3AAVA 4BXSA 3NCLA 2Z7FE 1P03A 3BTGE 4DCDA 2WPIS 2XWAA 2G81E 3P8NA 1TE0A 1RTFB 1OP0A 4O03A 2FPZA 1K1IA 1FN6A 2H9EH 2ILNA 4JK5A 2QIQA 3S9AA 3PB1E 1C2IA 1TIOA 3DFJA 1F5KU 2A2XH 3F9GA 3PO1C 4E05H 3UPEA 3S69A 4ABHA 1H8DH 2BQ7B 4NCYA 3RMNH 1WTGH 5LPRA 3LKWA 1O3EA 1BTPA 1LHGH 1AB9B 2AGGX 2ZPRA 5J4QA 2CGAA 3GY7A 1MU8B 1ABJH 2AFQB 1GHAF 2ZI2H 3UUZA 1Q3XA 2UWOA 1HAYB 3SUEA 1OP2A 1GI3A 3DT0H 1NROH 3QLPH 3ZZAA 1TX7A 1WV7H 4MPVA 1Q31A 1CBWC 1PPZA 1SBWA 2V35A 3SV2H 2A2QH 2VWNA 3TGJE 4D7FA 3RXAA 1S83A 3GOVB 1YLCA 1ZMJA 8LPRA 3C27B 3SV8A 2V6NA 3T29A 1L1JA 2XBXA 3RC4A 1GHXH 3EE0B 1P9UA 4JK6A 4MNXA 3SU5A 1C2LA 1KTTB 1NFYA 2UUFB 2DE9A 1GHAG 1KLJH 1MU6B 3HPTB 4Y6DA 1GBIA 2XC0A 5IDKA 1F5RA 5JDUB 1V2MT 1T8LA 2ODYB 3EDXB 2FOFA 3T28A 3RXGA 3TNSA 2AERH 3PO1B 3FP8E 4AYYB 3LJJA 1MQ6A 1UHBB 5A8YA 7LPRA 2GDDA 3DUXH 3RXEA 5FCRA 1SGCA 3GCOA 1RRKA 3LONA 1GJ7B 1C5ZB 1LHCH 1E36B 1YPHE 3F9EA 1Z1IA 2PKSB 4ASHA 1UK2A 2B0FA 2VGCB 4RKOB 1VGCB 1TMUH 3RLWH 4JMYA 2F91A 2VINA 1V2VT 1ZSJA 1PQ7A 3HGNA 1BMLA 5HXFA 2OC1A 3RUOA 4MPUA 1YPJH 2BLQA 5A0CA 2CXVA 1L4DA 1WCZA 1ZTLA 1NESE 1GGDC 1EZQA 3RU4T 1T8OA 4Q2KA 3SUFA 4K2YA 1BB0B 2BVRH 1SGDE 3MHWU 4ISNA 5AFYH 4I8HA 3KQDA 2STAE 2QXIA 5ABWA 2ZDAH 1SHYA 1CA8B 1TGCA 5CHAC 4K1SA 2QCYA 1T32A 5HM2A 1DX5M 1AFQB 4TPIZ 2G4UA 3SQEE 1ELFA 4BTIB 3SI4H 2P8OC 5EW2H 3RMLH 1SG8B 1MKWH 1HRTH 1O2TA 1QBOA 5EODA 2H1UA 1OKXA 3A8AA 2VVVA 3RXDA 2ZU2A 1O3AA 1T8MA 1N1LA 4H6TA 3ZZ8A 1BTZA 1ESTA 2H2ZA 2I6SA 2OC0A 1KYNA 9ESTA 2ZF0H 3QTVH 3RXSA 8KME2 3P6ZB 1FLEE 1WQSA 4X0WU 4ZKSU 4UONA 2PKAB 1GI8B 2YNAA 1FIWA 1BTHH 2GP9B 1BTYA 1GL1A 4B71A 1BCUH 3S7KB 3PLBA 4YTAA 2FDAA 4FUGA 5EU8A 1ZJDA 4FUHA 1P2KA 1HLTH 2P94A 2UWLA 2A31A 3TK6A 1OS8A 1KXBA 2ZDLA 1AFQC 2HNTE 1L1NA 4CRBA 4K60A 5I46H 7KMEH 2ZG0H 4X1PU 1K9OE 4NZLA 2ULLA 2ZZUH 3M36A 2HOBA 5FX5A 5A0BA 1CT0E 4Q7ZA 2QYIA 5A8XA 5A0AE 4MDSA 1C5QA 1VJ9U 1PPFE 2Y82A 1NY22 3QZQA 1C5OH 3LGUA 1TMTH 3B9FH 3P8FA 2ZDMA 1FZZA 3ODFA 1AFEH 1ZTJA 4Q80A 4OS2A 1GJ4H 4XE4A 1CT4E 2ZEBA 1E0FD 5JBCS 2DUCA 4ESTE 1SGFA 3V13A 3SQHE 4UFEH 2J38A 5L30H 3I78A 2QXHA 2FX4A 2C8WB 3E3TA 1GDUA 4FXGH 3UREA 3A88A 2GX4A 2AYWA 2OINA 1TRNA 5GCHG 1WAYB 1CA0C 3GCNA 2AMDA 2BY6X 3ZZCA 2R2MB 1QL7A 4FU8A 3PWCA 3PWBA 5ESBA 3MO6A 1P2QA 1FDPA 2OQ5A 4ABFA 2Y5GA 1GHBG 3A80A 1AZ8A 3MU4A 2PV9B 3LC3A 5HYOA 2BD9A 1GMDG 4KGAA 4X2VA 1PPCE 3EA9A 1NFXA 2NU3E 4HZHA 5EOKA 9LPRA 2ASUB 2BY8X 2GCHG 1DDJA 1D9IA 2Q1JA 3UWIA 4FU7A 1V2OT 1TRMA 1S81A 2FIRH 1P12E 5EXNA 5AFZH 2BOHB 1SGIB 1IAUA 1UVUH 2ZPQA 3N7OA 1FN8A 2NWNA 1YPMH 2SGPE 3M7TA 1C1SA 1FPCH 1PQ5A 2CMYA 3LH1A 1J15A 1HAHH 1O5AB 2TIOA 3O8BA 1GVZA 4OGXA 1JRSA 2GCHF 1ZGVA 1IQIA 1RFNA 3KQEA 5GWZA 1LVBA 2R9PA 1ZHRA 3TJUA 1PPBH 3ENSB 4X8UH 4GLYA 3QN7A 4FUJA 1GBBA 1JWTA 1GJ6A 1ZR0A 3LDXH 1MMJN 1OWKA 1FUJA 2O8WA 4UFDH 3RMOH 1O2RA 3RXMA 1AUJA 3RXPA 3LPRA 3EA7A 4JZDH 1Y5BT 6ESTA 5T6GA 3VPKA 4Q7XA 3K9XB 2CN0H 3TK5A 1CSOE 2CHAB 1C2DA 5F03A 1GHVH 3A84A 1A5HA 3SU3A 4MVNA 4DGJA 1KIGH 1O37A 1AMHA 1WYKA 5EXMA 3OSYA 1O2VA 2GCTC 1SQOA 3OY6U 1D4PB 2Z3CA 2ZQ2A 1SGYE 4B2CA 1K1PA 4K69A 3AVZA 3BEIB 1ZJKA 1S0RA 1HIAB 1BJVA 1QTFA 1A0LA 1JRTA 2ALVA 2TGPZ 4XBCA 2A5AA 3TU7H 1CE5A 1CHOG 4U32A 4AZ2B 1DS2E 2BD4A 6GCHF 4BAQB 2BYAX 1NU9A 1NRPH 1GMHF 1TABE 3T25A 5CE1A 5A2MH 2VU8E 3E0NB 1DVAH 2ZHQH 4KTSA 1O3GA 1CGIE 3ATWA 1CHOF 1QA7A 1QNJA 1SL3A 3E90B 1VCQA 4FUIA 1YCPK 4B74A 2BY7X 1GMHG 2OCVB 4NWKA 4INHA 4Y8YA 2W5EA 1UMAH 4LK4A 2UUJB 1GI0A 4K5ZA 1O0DH 6GCHG 5CHAB 4O3TA 4X8SH 5FPTA 2QXJA 3PM3A 4Y71A 1GI4A 3HKIB 2THFB 1AU8A 1FI8A 2Z9GA 3Q3XA 3P17H 4ABEA 1OWIA 2PTCE 2BQWB 4XSKU 3KN2A 3MOCA 1YC0A 1A4WH 1NPMA 4TWYA 2ZTYA 4TY7A 1C1UH 4IN1A 2UUYA 4CBOA 3GCHC 4ZXXH 4FUDA 2F9VA 1ELEE 1XUJA 1EUFA 5EQRA 2EI7A 3ZVGA 5A8ZA 2EI6A 2ZFQH 3ZZDA 1P05A 3P92A 3V7TA 4Y0ZE 2BLOA 2PUXB 4B2AA 1C2JA 2WPKS 2XTTB 4AFZA 4AFSA 1A2CH 1WTHD 3SNDA 1TBRH 3RXIA 3PLPA 3A8DA 4O3UA 2BLWA 1H9HE 4YOJA 2QAAA 1SGQE 1DUAA 3VB3A 3O8CA 1RTKA 3ODDA 4CREA 4QT8C 1W3CA 3HK6B 4XFQA 3GICB 2R0LA 1GI9B 4MTBA 1VITH 1AKSA 1TGNA 3S0NA 4U01A 2PHBA 5A09A 1NFWA 3AASA 1TGTA 3T27A 1F0RA 2WV5A 3PMHB 3K2UA 4YO9A 5GJ4B 3RXOA 5C2ZA 2ZQ1A 4K8BA 1BRAA 1NFUA 3E16B 3KF2A 1HXEH 4X6PA 1GDQA 1O2JA 1Y8TA 1CQQA 1SGTA 1GJBB 3O8RA 3RXVA 1NN6A 1Z1JA 1A7SA 2GZ8A 2RG3A 1O2HA 2HNTF 2KAIB 1LDTT 2BLVA 5GCHF 3LIWA 1ZHPA 2ZP0H 5T6DA 3TIUA 1A1RA 4A7IB 1AB9C 1ABIH 2G51A 5FPSA 1DXWA 4YZUA 4WH8A 3SO3A 2OQUA 1G3CA 1EAXA 1O39A 1XVOA 2EI8A 5AF9H 2ZU4A 4KTUA 1OX1A 2QY0B 3QTOH 3OX7U 4OS4A 4Y7BA 1SOZA 1UTNA 3ZVBA 3SNCA 1DANH 1J14A 2Q6DA 4DT7B 1P2OA 2FOAA 4WXIA 2ZFRH 1OSSA 4DY7B 2C8ZB 2BD3A 3VXEH 2OP9A 1QFKH 3UNQA 1SLVB 2XBVA 5DP6A 1GBAA 2Y81A 2FODA 4A92A 2TGTA 1SOTA 1HUTH 1A61H 1TGSZ 1TWXB 3TJOA 3ZYEA 3ZZ7A 1SI5H 1XUFA 3B23B 4X2YA 2Y7XA 4CRAA 2C3SA 4I8GA 5C67A 2A1DB 3LGVA 1FQ3A 5DG6A 2HGTH 5L6NH 4Y0YE 1MKWK 2BVXH 2CF8H 1P2JA 4PROA 1C5WB 3SU1A 1XUHA 1UK4A 5E0HA 1LPGB 1Q2WA 1UTLM 1G3BA 1QJ7B 1C1RA 4GUXA 1GCTC 4UFGH 2K1QA 4Z6AH 1CO7E 1YF4A 2AH4X 3RXCA 1UHBA 5JB8S 4MNYA 2AEIH 1V2ST 3BTFE 1SFIA 2A7CA 1MD7A 3BTQE 1C5RA 2FOCA 2QF3A 3RM2H 2BY5X 2G00A 3RC6A 1TPSA 3KEEA 2BDHA 3UWJH 4X6NA 1SR5C 5I25A 1MAXA 1G3EA 4I8LA 2R3YA 2FXRA 4H4FA 1O3LA 3BTWE 4OS1A 2AGEX 2ZFSA 2LNCA 3RC5A 2YNBA 2GKVE 5AHGH 2ZDNA 1QBVH 4AORA 1EZSC 2ZU5A 2Q6FA 5EXLA 1PQAA 2AIQA 4RSPA 5JBAS 1EJMA 1LO6A 2XC5A 4U30A 2Y7ZA 2F9UA 2ANKH 3PROA 4IS5A 1TAWA 2JH0D