4XBBA

1.85a resolution structure of norovirus 3cl protease complex with a covalently bound dipeptidyl inhibitor diethyl [(1r,2s)-2-[(n-{[(3-chlorobenzyl)oxy]carbonyl}-3-cyclohexyl-l-alanyl)amino]-1-hydroxy-3-(2-oxo-2h-pyrrol-3-yl)propyl]phosphonate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
175
structure length
165
Chain Sequence
b'HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-LIKE PROTEASE
publication title Structure-Guided Design and Optimization of Dipeptidyl Inhibitors of Norovirus 3CL Protease. Structure-Activity Relationships and Biochemical, X-ray Crystallographic, Cell-Based, and In Vivo Studies.
pubmed doi rcsb
source organism Norwalk virus (strain gi/human/united states/norwalk/1968)
molecule tags Hydrolase/hydrolase inhibitor
total genus 39
structure length 165
sequence length 175
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xbbA01
2D1JA 1V2VT 2GD4B 1ESAA 4Y8ZA 1EAWA 4LOYH 2VWOA 3OSYA 1FAXA 4DIIH 3TH4H 4FUEA 3Q77A 1YKTA 4CRFA 1CT0E 3SNDA 3MI4A 2F9NA 4XDEA 2BHGA 1HXEH 1BITA 4ABIA 3TGJE 1UTMA 1V2OT 1K28D 2CV3A 5E0JA 4JZ1A 1G37A 4KGAA 4ABJA 4WJG2 1GBBA 1C1TA 3SGAE 3MYWA 1QQ4A 1QIXB 1SHYA 2QXGA 1TNIA 3NZIA 3S7HB 4INKA 1ANCA 2EA3A 2ZGXH 5JBTA 4MG3A 1LPGB 4ESTE 1C5SA 1QRWA 2C4FH 1BMNH 3CP7A 1DWCH 3OYPA 2BD5A 1UTKA 1SGTA 1AU8A 3N7OA 2P3FH 5EQRA 1GHAF 4LZ4B 1O2KA 2OP9A 2P8OB 2AIPA 3RP2A 2D26C 1J9CH 4Y0ZE 1T7CA 2QC2A 1P9SA 3A8DA 2AGGX 2VNTA 4BAHB 1P05A 2ZU1A 4FUCA 1ORFA 1T8LA 3RU4E 2ODQA 4TYDA 1DSUA 3SNBA 1TNJA 3QGNB 1MD7A 5L6NH 5I25A 1AN1E 1ZJKA 5E8EH 3RXUA 1OYTH 5A0AE 4MNWA 4ZH8A 2A0QB 4BXSA 2ZDKA 1KDQA 2FS9A 1K1JA 2XWAA 3TK9A 2CMYA 1AWFH 1YPHC 3ZZBA 4CHAB 4WMFA 1PQAA 4WF8A 2RA0A 1HIAA 1HNEE 2Y82A 1P2KA 2XNIA 1LDTT 4HFPB 4ASHA 3UNRA 4X1QU 1SGDE 4OS2A 1Z7KA 1LVYA 4NA8A 3TLOA 2BDGA 3ZZ9A 3QK1A 4X1SU 1XVMA 1XUHA 4IBLH 5CHAC 3ZVBA 4OS7A 2A7JA 1TGTA 1VCQA 3V12A 1EPTA 1C2IA 4Y6DA 2ZU5A 3MO6A 1O2OA 1C2LA 3VXFH 1A5GH 4I32A 1KTTB 2GT7A 3PTBA 1ZHMA 2PWXA 3CENA 4NIXA 1F2SE 1QL9A 2WPHS 1GG6C 2BDYA 3EE0B 3A87A 1JOUB 1AY6H 5A8YA 4R8TB 3KQEA 4O03A 2G4TA 1EB2A 2F9UA 1MBQA 1HAZB 9ESTA 5K0HA 1NRNH 1A5IA 2XC0A 1DE7H 1XUKA 2ZPQA 4M7GA 5J4QA 1W3CA 2Z9JA 2TGDA 3ODFA 2OTVA 3K6YA 4MPUA 4DW2U 1IAUA 4NWLA 2FOCA 1AGJA 2FZZA 2Z9GA 1DWDH 2PKSB 1SLXB 1AUTC 1AVXA 3I78A 2W5EA 2Y7XA 1CGHA 1XX9A 3ODDA 1D6RA 2CGAA 1LCYA 1QR3E 2BY6X 3UWIA 3SUEA 1DWBH 1PPEE 2WPMS 2ZTXA 1C1MA 2BLQA 6CHAB 1AVWA 4X6NA 7ESTE 1NT1A 3ATWA 1OKXA 1QRXA 1WU1A 3NK8A 1O3FA 1P2QA 1T8OA 1V3XA 2Y6TA 1O2GH 3M3VA 4E05H 3RLWH 4AFZA 3PLKA 5AHGH 3A8AA 3LH1A 1P2NA 3BN9A 3VB4A 3UPEA 1JWTA 3M7QA 2BTCE 1AFQB 1MAXA 2PV9B 3AAVA 3EA9A 1INCA 4Y8XA 1UK3A 4MNVA 3RDZA 1C4Y2 4AYVB 4Y71A 1O3KA 1O2IA 1SVPA 3L6PA 1MU6B 3EGKH 4WVPE 1O30A 2RCEA 2Z3CA 2BXTH 2VJ1A 1C1RA 4CRBA 1GBEA 3M61U 1PQ5A 1TBRH 1ANBA 2DUCA 2ZFPH 3URCA 3OU0A 1TGBA 3UY9A 2FI5E 1GWAA 5JB9S 1G2LA 1TPOA 1GI5A 1ZPZA 1VGCB 2WYJA 2ZU4A 1WSSH 4D9RA 1G3CA 3TK5A 3GDSA 3F9FA 2ESTE 4ISIH 4FUGA 4IC6A 3T2NA 2P3TB 4E7NA 1O2QA 1OYQA 1BCUH 1JRSA 4ZXXH 1BTWA 1FN6A 3TNSA 1L1NA 2ZA5A 2ZU2A 5TCCA 4B1TA 3U1JB 3TJUA 1HXFH 2J92A 1QBVH 2ZCHP 1FONA 2FLBH 4DOQA 3MHWU 1V2MT 2PUXB 2JKHA 1W7XH 2FESH 3P8GA 1K9OE 4AFSA 1P2IA 4LZ1H 1GMCG 4NG9H 1A5HA 1MU8B 2Y5GA 1DLKB 3SJOA 2Y5FA 1T31A 4YESB 1TALA 1BJVA 1EX3A 3BG8A 1QURH 1LMWB 3U8RH 2HPQH 3FZZA 4PROA 2YOLA 1LQDB 1ZPCA 3RXLA 2BZ6H 2HGTH 3KL6A 1F7ZA 1ELBA 3A88A 4XBBA 1O3NA 1SGIB 1ABIH 1NFUA 4I8KA 3UOUA 1G9IE 2SGEE 1W0ZU 1FY8E 1W8BH 8KME2 4IC5A 1BBRK 1BRAA 2CJIA 3BTKE 4INHA 2J9NA 4DG4A 2VVVA 1FXYA 1SGFG 1ZZZA 2A2QH 2FTMA 1K1PA 3SI4H 1HDTH 4WXIA 2BD4A 2SGDE 2BLWA 2JETB 1KXBA 2Z9LA 2W7SA 3PWBA 4GHQA 1YM0A 4GCHF 3RUOA 1L4DA 4O97A 2A7CA 2OXSA 1FLEE 1GJBB 3D23A 1NRPH 1TNGA 1V6DA 5L30H 3OY6U 1PPCE 4TY7A 2V6NA 1ARBA 3SI3H 4CR5A 4ABDA 1IQKA 3MH5A 1UHBA 5FAHA 1N6YA 5DO4H 1MTNC 5A0CA 4NZQA 8LPRA 1UVTH 1HYLA 1TOMH 2BY8X 4K3JA 2ZGHA 1P12E 2THFB 3A8CA 5A0BA 4CHAC 3BTEE 3RXQA 2A4GA 2G5NA 1LVBA 1MUEB 3D49H 5T3HA 1XUGA 2ZDMA 1NPMA 1BT7A 3PLBA 4U32A 2J95A 1BHXF 3MO3A 1AI8H 1MKWH 1XXFA 1MCVA 1O2PA 1Y3YA 1IQIA 1BRBE 1UCYH 3QLPH 1CA8B 6GCHG 3STJA 1F0SA 1O5FH 3SUDA 1UK2A 1JXPA 1A61H 3F68H 4A1TA 3ZZ5A 5FPYA 5LPFA 1P04A 1RRKA 4AYYB 1HAIH 1QA7A 4K1SA 1VZQH 2GTBA 3EYDA 4B75A 1GJ6A 3PO1B 2R2WU 1A46H 4XE4A 3UTUH 3E8LA 1SB1H 2B9LA 2HOBA 3M5MA 1A4WH 2ANKH 2H1UA 1ESTA 3SHCH 4ABHA 1YPJH 2F9PA 4IMZA 3RXVA 1C5WB 1O3PB 3V7TA 1ACBE 1O3GA 3MOCA 1Z8IB 4NIVA 3S9BA 2PKSC 3A7VA 1O3MA 4Q7ZA 4TWYA 1C1SA 2G4UA 1PPBH 3IWMA 1SQAA 1KTSB 1UTNA 2FEQH 1C5QA 2FX6A 1PQ7A 3FAOA 2BY7X 1J17T 2UUJB 1HLTH 6CHAC 4UD9H 1TWXB 2FMJA 3FFGA 2QGRA 2TIOA 4J1YA 3ATMA 1D3PB 3A7XA 3A86A 1F5RA 1GJ9B 3E0PB 1OWIA 1QB6A 5F8ZA 1TIOA 1WAYB 2ZGJA 4X8SH 4CRGA 1H9LB 5C1UA 4FU8A 3PTNA 4A7IB 1P9UA 1GDQA 1MTUA 3GOVB 4GSOA 1IQHA 2C8XB 1S85A 3RU4D 2BD7A 2ZQ1A 2GDEH 8GCHG 1AFQC 1BMAA 4MNXA 3RMOH 3E3TA 3UR6A 3F6UH 1D3QB 1WQSA 1GHBF 1Z6EA 1GDUA 1DY9A 4XFQA 1G32B 3E6PH 4FUDA 1EAXA 1ANEA 1ELCA 1YP9A 2AMDA 2BMGB 3AW1A 4JCNA 4F4OC 1C5LH 3F1SB 3MU5A 3M5LA 4X8UH 1C2HA 3S69A 3TIUA 3ZVEA 1VJ9U 4Q7YA 2AGIX 2Z3DA 2Q6DA 1ZLRA 1DFPA 4B2BA 1QHRB 1PPGE 2CN0H 1TPAE 4NFFA 3RMNH 2BYAX 1XM1A 4UFFH 2XXLA 2ZDLA 4FUJA 2F9OA 1HUTH 1F0RA 1VITG 2HALA 1FI8A 2ODPA 3GY5A 2Z3EA 2HWLB 1KY9A 1BJUA 2ZIQH 3GY7A 1W10U 1E38B 1C5RA 3MH7A 2BM2A 1QBOA 4BXWA 1O2XA 1OP0A 2FS8A 2ZFRH 1TQ7B 1N8OC 2W3KA 3KQDA 2C93B 1MTSA 1ZMLA 1EJNA 1YPHE 5DK1A 1FDPA 3BG4B 2FLRH 2QXIA 3D65E 3ZVGA 3SUFA 3K9XB 3T27A 1P11E 1CBWB 2PGQB 3EA7A 2VIOA 1JRTA 1O35A 2ODYB 3QZQA 1K2I1 5A8XA 1YYY1 2QYIA 1SR5C 1E0FD 2GCTB 1XUFA 1C2MA 4JYUH 1J16A 3TITA 1FPHH 5DGJA 1C5XB 1TRMA 4YLUA 3SV6A 1FAKH 1Z8JB 3SNAA 1RJXB 2QIQA 4X2XA 3SGBE 1NESE 3BEIB 3RXKA 3SU2A 3HK6B 1ZHRA 4JZFH 1LO6A 1RTFB 5EODA 1BBRH 2JETC 1FQ3A 1THRH 3GYLB 3LGTA 4IN2A 1L0ZA 2HNTC 1SBWA 3A84A 3M5OA 1K21H 1V2KT 3TJOA 5FXLA 3ZZAA 2BDBA 3KQBA 2P93A 3RXIA 4RSPA 3LONA 4TWWA 3Q3KA 1FIZA 2EI6A 2OC1A 1AZ8A 1LVMA 3Q00A 4DURA 2J4IA 2HRVA 1RS0A 1FMGA 2WINI 5TCAA 5T6FA 1QL7A 1SGYE 2FOAA 4MTBA 4ABFA 2EI8A 3PWCA 1VCPA 4I7YH 1C2KA 5HGGA 1LHFH 1M9UA 4J2YB 1NRQH 1NZQH 2O8MA 5C20A 4AFUA 1UO6A 3O8BA 1DSTA 2C3SA 2PFEA 5DP5A 2UWLA 2QA9E 3KGPA 1EJAA 3S9CA 3KHVA 4RKJB 2W7UA 1QB9A 2C8WB 5GCHF 1ETTH 1ELTA 2QAAA 1AFEH 1W0YH 4YT7H 1HAHH 1O2RA 1ZSLA 2ANYA 1Y5BT 3MH6A 4CH2B 1AMHA 5JDUB 1IQNA 4ZKRU 1EP5A 4ISNA 2QV1A 5SGAE 1EQ9A 1HAVA 1GBTA 1Y8TA 2G8TA 1N6XA 1E37B 3A7WA 1TFXA 2ZHWH 2GCHF 3TJNA 2BLOA 1OWDA 1WQVH 3SOSA 1JIRA 1NM6A 1XUIA 3KNXA 1F5LA 3HATH 2PSYA 1KLJH 3UIRA 5E0HA 1GL0E 3PO1C 1BDAA 1GJ4H 1TA2A 2WPIS 3RXEA 3GISB 3NUMA 1NY22 1GJ5H 3DT0H 1AO5A 1GHVH 1YLDA 1IQGA 4KELA 1MTNB 5EPYA 2CHAB 1TBZH 3NCLA 1MZAA 1ZSKA 2FXRA 1YLCA 1W14U 4NWKA 3STIA 1FJSA 1EJMA 3ZZCA 5FBIA 3UWJH 2OC7A 3QZRA 1C5OH 2FYRA 3TH3H 1GI0A 5L2ZH 1TONA 4ZHLU 1MKWK 1GI3A 3RLYH 3ZZDA 1TNKA 2ZWLH 2TGAA 2QN5T 3VPKA 1UCYK 3GCTG 3LC5A 2Z9IA 3K2UA 1PPHE 5E0GA 3BTDE 4JMYA 2ZDAH 4TPYA 4U2WA 3RC5A 1GI7B 2VIVA 4KTCA 4B2CA 2EEKA 2GV6A 2PGBB 1P06A 4YLQH 3SJIA 3HGNA 5LPEA 1O2HA 2O8UA 4WWYA 3PMAB 2NU0E 5CMXH 2PUQH 1GBJA 1UTOA 1ANDA 2V35A 3ITIA 3LGVA 3DUXH 1BTXA 3KF2A 1V2JT 3P92A 1DT2A 3ZVFA 2SGQE 3MH4A 2ZU3A 1SGCA 3H7TA 2VWMA 1SLWB 1HRTH 1YGCH 1T4VH 1V2TT 3T62A 4K60A 4YT6H 1NFWA 3KEEA 4ABAA 1H9HE 3RC6A 1TX7A 5LH8A 4ZMAH 1FY1A 2YNAA 1LQEA 1TLDA 1GVZA 1CU1A 4FXGH 4Y76A 1A1RA 1HAYB 4X0WU 2BB4A 2KAIB 3MFJA 1XUJA 2ZO3H 1CVWH 1O3CA 3MU0A 3LJOA 1A2CH 4BTTB 1DDJA 4IW4E 1P01A 3EDXB 4K1EA 3PMJA 1BRCE 1F5KU 1SHHB 1W2KH 4MQAA 1L2EA 4TY6A 4INLA 3GDUA 2ZTZA 9LPRA 5DPAA 1P0SH 4NSYA 6ESTA 5J4SA 1GMDG 4MPXA 3UQOA 3A89A 1P3EA 1UJ1A 3M7TA 2J2UA 2UWPA 3ZVAA 1F0TA 3R0FA 1ZGIA 2BD8A 3VFEA 1TPPA 2ZG0H 4UFEH 3TH2H 4XOJA 1C4U2 1UVOA 1ZTKA 1YBWA 1G3EA 3BG4C 1C2FA 1P03A 3GY3A 5JPMH 1HAOH 2ZKSA 1JBUH 2PTNA 1SG8B 1C4V2 1CBWC 3G01A 3D62A 4HGCA 4X8VH 1V2LT 5GXPA 1TGNA 2CXVA 2XC5A 3W94A 1UCYE 3SV8A 1S81A 1BMLA 2QXJA 1ELAA 4CREA 4KKDA 2F83A 2GCTC 3SORA 1Y3WA 1H8IH 3AVZA 1QA0A 1CHOG 3E0NB 1DANH 2ZZUH 2AERH 1TAWA 1ZRBA 4ZXYH 7GCHG 3PM3A 2ZHQH 2GX4A 1NRRH 3MMGA 5HM2A 2GKVE 3ZZ7A 3SQEE 2XBYA 1SFQB 3P8FA 2ZCKP 1W11U 2VB0A 4XBCA 3UNSA 5HYOA 2O8TA 4ABEA 1TBQH 1C2GA 2Q6GA 4NA7A 2FTLE 3KIDU 2FIRH 1TABE 1GL1A 4FU9A 4A6LA 3B8JA 1YF4A 1TMBH 2SFAA 2GP9B 5T6GA 5FPSA 3M37A 1KXDA 1JIMA 1GJAB 3MO9A 2AYWA 2R0LA 4YTAA 1FNIA 3RXCA 3H5CB 4NA9H 3FANA 1N8OB 2ZFTA 1NU9A 1QNJA 1UTJA 4QT8C 5A09A 1S5SA 3BTQE 3SU3A 1Z8GA 1O3EA 3BTHE 3B9FH 1ZPBA 2ZC9H 1GHZA 2F3CE 5EW1H 3HGPA 2HVXA 7LPRA 2M5TA 1H1BA 5DP4A 4ABBA 1TPSA 1WTHD 1QTFA 3S7KB 3EAJA 4JK6A 1D4PB 2C90B 5AFZH 4DY7B 1IQLA 2XYAA 1PYTC 3VXEH 4GLYA 1C1WH 1T8NA 1GHWH 1MTWA 1C1NA 1QJ7B 3BTME 1L1JA 4X1NU 1KIGH 5LPRA 1RFNA 2STAE 1XMNB 1O2YA 1OOKB 2UUYA 4UONA 1KYNA 2OUAA 1SGRE 3U9AH 2K1QA 3SU1A 5JBCS 1DWEH 3RM2H 4FVBA 3QX5H 1GPZA 2J34A 1CSOE 2ANMH 5ETXA 2QXHA 4ISHH 1HCGA 2CHAC 5EQQA 2G55A 4LK4A 1Y3UA 1Z1JA 4BTIB 1D3TB 2RDLA 1WV7H 2WYGA 1V2RT 3LH3A 3SU0A 2VWLA 4IGDA 3DHKH 2BOHB 2WPLS 1HGTH 1SOTA 3PB1E 1O2UA 2D8WA 1O3HA 1A3BH 5EW2H 1YPGH 1FY3A 1WBGB 4JK5A 1H9IE 1J8AA 2BQ6B 3OY5U 1SFIA 4K2YA 5DG6A 7KMEH 1QCPA 3DFLA 1NN6A 2ULLA 5DP7A 3S0NA 3GICB 1LKBA 5EQSA 3ENSB 2QF0A 4Y10E 1EZXC 2NU3E 1EXFA 4Q2KA 1P8VC 2SGPE 4H42U 1SGFA 4ZKNU 3IG6B 1O2MA 4SGBE 2ZFSA 2QY0B 1GJDB 2VIQA 3M36A 1W13U 3VB5A 2OD3B 1NRSH 1GMCF 2ZTYA 1B7XB 4I8LA 2JH6D 3GCOA 2AEIH 2LPRA 1FIWA 1Y59T 4XSKU 1RD3B 1TOCB 2PKAB 3ELAH 3LJJA 2OC8A 1RGQA 1SL3A 1EZQA 3U98H 3C1KA 2NU4E 4IN1A 1BTZA 3QO6A 2VU8E 4B71A 1GMHG 1MQ6A 3KN2A 2SGAA 1SGNE 1C5ZB 1AZZA 4ZROA 1BBRE 5GWZA 1GBKA 1IOEA 2Z6BD 3SUGA 1BTPA 1VR1H 1TRNA 4R0IA 1TRYA 1DLEA 2SGFE 1JMOH 1QB1A 1S83A 2B7DH 4K8BA 2OBQA 2B0FA 2RA3A 2RG3A 3IITA 3SW2B 1MKXK 5GJ4B 2HNTE 3A7TA 4IS5A 3V13A 1CE5A 5F03A 3ZV9A 2XBXA 4DVAU 3M5NA 1FV9A 4YZUA 1GBAA 4Y79A 4SGAE 2A31A 4K5ZA 1IQEA 5F8TA 2VWNA 2UUFB 1J15A 4JYVH 1TNLA 2H5CA 3MNXA 1HFDA 3SQHE 2BDAA 3E91A 1IQFA 1OWHA 6LPRA 1C1QA 1E34B 4CBNA 2BVRH 2Y5HA 4X1PU 3U8OH 1AKSB 2BZAA 1C5TA 2AFQB 4WMEA 2J38A 3TU7H 3ZYEA 4D7GA 3VB3A 5C3NA 2BQWB 1K1LA 2G51A 4I8GA 4ZHMU 1FY4A 5ABWA 2CF8H 1BQYA 2Y80A 1G36A 1CT2E 3SU6A 3ATKA 1O3OA 3C27B 5DP9A 4RKOB 1CQQA 3URDA 3TPIZ 4JZIA 4BAKB 2ZECA 1O5EH 1O5BB 3VB7A 1S6FA 1TQ0B 6GCHF 1GBHA 2HNTF 3B23B 3M3TA 3QN7A 4BAQB 4NIYA 3SBKA 4ISOA 1IHTH 2ZPSA 1MD8A 3Q3XA 3AW0A 3BTTE 1F0UA 2GMTB 2GGVB 4TPIZ 1O5DH 2VINA 4E06H 3GDVA 2UUKB 1FN8A 3PMHB 1SSXA 2GZ7A 1S0RA 2BQ7B 1OWEA 1GI4A 1NU7B 3I29A 2H9TH 3O8DA 1UVPA 1SQOA 3RC4A 2GT8A 1EZUC 2UWOA 1ZRKA 2V3OH 1CGJE 1ESBA 4GAWA 3P95A 5FX6A 1LVOA 3RXTA 2A2XH 4X6PA 5A2MH 3M3SA 4CRDA 3JZ1B 3LKWA 4AB8A 1OP2A 2XBVA 5GPIB 2BY9X 3RXAA 3UUZA 1QRZA 3F9EA 5FCRA 1CT4E 1F92A 2Y81A 1G3DA 2WV4A 2V3HH 4O9VA 3NKKA 4AZ2B 2STBE 5K7RA 1GHAG 2BDIA 3ZZ8A 3P70B 5EXNA 1LPZB 3GY8A 2ZHDA 2GZ8A 3AASA 2BVSH 5EU8A 4FU7A 1AVGH 2XW9A 1AE8H 1YPMH 2A45B 1SGPE 1B0FA 3UOPA 3CS0A 1LTOA 1LPKB 1AIXH 1MCTA 1Z1IA 4H6SB 1DS2E 3A7YA 5EXMA 1SOZA 3KCGH 1J14A 1HPGA 8GCHF 1W12U 1AQ7A 1O2JA 3PLPA 5FPTA 1UTPA 3VB6A 3A85A 1AWHB 3RXFA 4UFGH 1HBTH 3E16B 4ZKOU 2TGPZ 1KDQB 1V2NT 1C1PA 1EZSC 3H7OA 3A82A 1QJ6B 1SLVB 1A0LA 2BX4A 4BOHA 3I77A 1QQUA 4NCYA 1HIAB 1BZXE 1O3LA 1UK4A 5LGOA 1RIWB 1TYNA 1G2MA 4D7FA 2FPZA 2ZCLP 2ZGBH 2JH0D 2VH0A 3A80A 2FYQA 5G4BA 2NU2E 1YPEH 1A3EH 3LPRA 1H8DH 1BB0B 1GJ8B 4BAMB 3ZZ6A 1KXAA 2C8ZB 2I6SA 4FUHA 4CR9A 5IYTA 2ZNKH 1LHCH 1RXPA 3MNBA 4HI3A 3TK6A 2ALVA 3QTOH 3HPTB 1EPTB 1Z6JH 5C2ZA 3LGUA 1K1OA 3PV4A 1C9TA 1VITF 3ZZ3A 2VIPA 4X2YA 1NFYA 4FUIA 3CS7A 2Q6FA 3NWUA 1DUEA 4I31A 5FBEA 3RXBA 3BV9B 4WH8A 3RXMA 3ZZ4A 5BPEA 2WUBA 3SV7A 1OS8A 3BSQA 3A8BA 2FOEA 4X2VA 5TJXA 4FUBA 4OS4A 1DX5M 1ZJDA 4UDWH 4VGCB 5AFYH 4NZLA 1O3AA 2LNCA 4ISLA 4D9QA 1KXCA 2XTTB 1Z71A 1YCPK 5PTPA 1ABJH 1O3IA 1KXFA 1A0JA 2G00A 3L3TA 1C5UA 3BEFB 4FVDA 2GV7A 1GCTB 1WTGH 1O34A 4Y7BA 1LHDH 3SNEA 2EC9H 1GBFA 5C1YA 1GDNA 3UREA 1LHEH 2A5IA 2ZP0H 2ALPA 3RU4T 1O2NA 1O0DH 4D76A 1O33A 1WYKA 1N1LA 3LOXA 4OS1A 5F8XA 1X7AC 2ZFQH 3K65B 1DVAH 3O8RA 4D8NA 1GBCA 5HXFA 2IN2A 1GJCB 3GY4A 1K22H 1D6WA 1O5GH 2GDDA 3K6ZA 3P6ZB 1DITH 1SGQE 2GZ9A 2BOKA 3SN8A 2Y7ZA 4JZEH 1DICA 4I8HA 1DPOA 2GVFA 1C5MD 1EUFA 2BVXH 1G3BA 1MKXH 1T32A 1ZHPA 2TRMA 1OXGA 3LGWA 1DUAA 1K1IA 5H4IB 1GI8B 3L33A 5DP3A 1THPB 1ELDE 3ZVDA 4Q7XA 1XXDA 1ZMJA 4B73A 4X2WA 2PTCE 1BIOA 1NS3A 4FUFA 3FVFB 1W7GH 3UFAA 4ZHAA 1DOJA 1SLUB 2AMQA 3SGQE 3TJVA 4UFDH 1VITH 1MMJN 3RXGA 3QDZB 2BXUH 2G52A 1IHSH 1AHTH 1TE0A 2FODA 3RM0H 3F9GA 1S84A 2FO9A 2EI7A 1S82A 1NTPA 1CHGA 2BDHA 1MBMA 1E36B 2I6QA 1V2ST 1O2VA 3RXHA 1OP8A 5FX5A 1G30B 2TBSA 1P2MA 1GI1A 2XC4A 1BRUP 3R3GB 2OCVB 1BMMH 1E35B 3RXJA 4BANB 4A1VA 1QGFA 2DE9A 1PQ8A 3LIWA 4ABGA 1MH0A 1VJAU 3E1XB 1D3DB 3RMMH 4AFQA 1HAXB 2BD2A 2GMTC 4O3TA 1HB0B 1L1GA 4Z0KA 5JBBS 2NU1E 4JZDH 2HLCA 1CA0B 4OGXA 3RXSA 5AF9H 4I8JA 4YO9A 2H5DA 1QL8A 1DXPA 2OC0A 4NIWA 2B8OH 1Z8RA 5EXLA 1PFXC 3UR9A 4CH8B 1GGDB 1L4ZA 1EATA 1C1OA 3MTYA 5EG4A 1GHXH 2A5AA 2AS9A 2J94A 4X1RU 1GCDA 3SJ9A 2R3YA 4OGYA 3LGYA 3RXOA 1AB9B 1FUJA 3SJKA 2D2DA 4OS6A 4Y11E 2PW8H 3DD2H 1WUNH 4GHTA 3AAUA 1NO9H 4Y8YA 3TGKE 1P3CA 2ZGCA 3P17H 4MLFB 3A81A 1TNHA 1B5GH 3GCTF 3OX7U 1BHXB 3MU4A 2VGCB 2IPHA 2BY5X 2JH5D 4GCHG 1OWJA 5EOKA 2VIDA 1K1MA 2BX3A 4NFEA 3FP8E 1EKBB 1BA8B 2P3UB 5ESBA 1UHBB 1EASA 3VGCB 2R2MB 3GCHB 1ETSH 2H9EH 1BTHH 4KP0A 2P16A 1PPFE 3OTJE 3MU1A 1EOLA 3HK3B 1KXEA 3RXPA 1BUIA 1OPHB 2Z7FE 3RXRA 4DIHH 3GY2A 3ZV8A 4DJZB 4XBDA 2VVUA 3P8OA 4AOQA 1RIWC 1TMUH 2F9BH 4AGJA 2XBWA 3M7UA 1SC8U 5IDKA 2OLGA 2ZF0H 1CGIE 1BTYA 2PLXA 4WMDA 5DKMA 1GVLA 1O2LA 1TB6H 4B2AA 2KAIA 5FCKA 3TGIE 3QGJA 1EPTC 1SI5H 2WPKS 1PJPA 3MWIU 1Q3XA 2QCYA 4MDSA 4KTUA 4WXVA 1D9IA 1ELFA 2ILNA 1O38A 3JZ2B 4UEHH 1C5VA 5C5OA 5JBAS 4MPVA 2WUCA 2R0KA 1GBLA 2PSXA 1GMDF 3GYMA 4BNRA 2O8LA 1SGEE 3A83A 2ZPRA 3FZDA 1GI9B 1C9PA 1WOFA 2ANWA 2PR3A 3MNCA 2Z9KA 2FOFA 3BIUH 3A7ZA 2NWNA 1TMTH 1O2ZA 3EQ0H 1BOQA 2ZDVH 3SHAH 4I33A 5C5NA 1KLTA 3LC3A 5GDSH 1ARCA 1ZSJA 1YC0A 4VGCC 2FOBA 1MTVA 5FHTA 3F9HA 4HTCH 1TX6A 1GBDA 1FZZA 2FI4E 1O31A 1VCWA 3BEUA 1TGSZ 1MZDA 1GCTC 2ZI2H 1SPJA 1HJAB 2VVCA 2P8OC 1XKBC 2B5TB 3LDXH 1UVUH 1YCPH 4LXBH 3U1IB 4AX9H 4O3UA 1EB1H 2AMPA 2A4OA 1YPKH 1CHOF 2VIWA 4Z6AH 1C5PA 4WH6A 4H4FA 2Q1JA 1ZYOA 3P8NA 1O3BA 1ZGVA 2FOHA 2R9PA 3QWCH 2WPJS 3SV9A 1GI6A 2A5KA 1ETRH 4WY3A 4X6MA 3T26A 7GCHF 1A7SA 4DT7B 1A0HB 1C2DA 1DM4B 3RMLH 4BAOB 3HKIB 1RTLA 1QFKH 2BLVA 2H2ZA 1DXWA 3BTGE 1P09A 5C1XA 2IJOB 1V2QT 1HAGE 3M35A 5A8ZA 2XRCA 1GHBG 2P95A 3T5FH 5C67A 4ZKSU 1Q2WA 4DGJA 1ELVA 3NPSA 1K1NA 2W26A 5EGMA 5GIBA 3HKJB 4A1XA 3W95A 1O2TA 1GBIA 5DJ7A 5I46H 2H9HA 2QF3A 3WY8A 2SNVA 1OWKA 2TGTA 4THNH 5HM9A 2FDAA 2VH6A 1NROH 3U69H 1ZMNA 2FI3E 1KSNA 4YM9A 1AD8H 3KQCA 4Y7AA 3BIVH 4B76A 1Y3XA 2Z94A 5HMAA 1Y5AT 3V0XA 2OINA 4YOJA 3MU8A 1FY5A 4AORA 2BD3A 2A4QA 1THSH 2ZQ2A 1YPLH 2SNWA 3QTVH 2A32A 4K8YA 2ZHFH 4UE7H 5EPNA 1QJ1B 3QUMP 1C2JA 1LHGH 1UMAH 4CRAA 1XVOA 4NGAH 3SZNA 4AG1A 4K1TA 2TPIZ 1CA0C 1HJ9A 3EA8A 2OBOA 3DA9B 1RTKA 5B6OA 2G5VA 1TGCA 3TVJB 3VEQB 1HJ8A 1OSSA 4AB9A 5JB8S 1GGDC 2ZDNA 3PROA 2BDCA 2O8WA 3ESTA 1H4WA 5AVDA 4YOGA 2YNBA 1GI2A 2O9QA 1BTUA 1EAIA 5F6MA 3SV2H 2ASUB 5CE1A 1KLIH 1C2EA 1Q31A 3SU5A 1AB9C 2P59A 3LT3A 1GVKB 2FM2A 1HV7A 3O8CA 3Q76A 1GJ7B 3E90B 4U01A 2WV5A 2CF9H 5CHAB 4YOIA 2AIQA 1O2SA 3TNTA 1P10A 1S6HA 3FP6E 4H6TA 1ZTLA 1QBNA 4CBOA 1ZTJA 2AGEX 1V2PT 2VGCC 3SJ8A 3BTWE 1B0EA 2OQUA 2A7HA 4KTSA 4MPWA 3RXDA 1O32A 3ATIA 3PYHA 1YCPM 3GCNA 2ZFFH 1UVSH 4JYTA 4NSVA 1P2JA 1O39A 2FP7B 1U6QA 4U30A 2R3UA 1AUJA 1GG6B 1T8MA 1Y3VA 3ATLA 3VGCC 3GCHC 3BTFE 1PPZA 1C5YB 4B74A 3NXPA 1V2UT 3MNSA 4A5TS 1ZOMA 2P94A 1GHYH 1UTLM 4AGKA 1XKAC 1O2WA 1IQMA 1O5AB 1ELEE 3PMBB 3BF6H 1C1UH 2IOTA 2W3IA 4ZUHA 4HZHA 5L2YH 1VGCC 1IQJA 1P2OA 2FX4A 1EAUA 1P57B 2G81E 4X8TH 1ZR0A 2XWBI 4DCDA 5E2PA 2PHBA 3GY6A 3T29A 2PKAA 2FOGA 1C1VH 1OX1A 1NC6A 2A4RA 1GMHF 3Q3YA 4Y0YE 1WCZA 5GCHG 2XCNA 1LKAA 1MAYA 2F91A 4X6OA 4E7RG 8ESTE 5DP8A 2A1DB 2ZEBA 4RN6A 4OS5A 3DFJA 1HAVB 2C8YB 1PYTD 3T25A 5JYIA 4K69A 1T4UH 4GPGA 4GVUA 2ZHEH 3LU9B 2FOMB 3SNCA 1V2WT 1CO7E 2GCHG 3UNQA 1AE5A 3V3MA 1NFXA 2F9VA 2XCFA 4MNYA 4AN7A 3ZVCA 5E2OA 1EOJA 1DY8A 1HAPH 1Y5UT 4AG2A 1O36A 3UQVA 2OQ5A 4MVNA 5T6DA 2HPPH 1ID5H 1C5NH 2AH4X 3T28A 5BRRE 1SMFE 1TX8A 2H6MA 4Q80A 1O3DA 2FWWA 4A92A 1QY6A 1S0QA 2BD9A 1AKSA 1O37A 4IMQA 1UTQA 3SO3A 3ZYDA 4ZAEA 1GBMA 1EP6A 1TA6A 1MQ5A 3LGIA 3U8TH 3FP7E 1P02A 3SU4A 1O5CB 5DP6A 3S9AA 1HJAC 2V0BA 1FPCH 4GUXA 4F49A 4CRCA 5ESTE 1SQTA 4BTUB 1ELGA 2DE8A 1O3JA
chains in the Genus database with same CATH superfamily
2D1JA 1V2VT 2GD4B 2YMSC 1ESAA 4Y8ZA 1EAWA 4LOYH 2VWOA 3OSYA 1FAXA 2JJ2D 4DIIH 3TH4H 4FUEA 3Q77A 1YKTA 4CRFA 1CT0E 3SNDA 3MI4A 2F9NA 4XDEA 2BHGA 1WDIA 1HXEH 1BITA 4ABIA 3TGJE 1UTMA 1V2OT 1K28D 2CV3A 5E0JA 4JZ1A 1G37A 4KGAA 4ABJA 4WJG2 1GBBA 1C1TA 3SGAE 3MYWA 1QQ4A 1QIXB 1SHYA 2QXGA 1TNIA 3NZIA 3S7HB 4INKA 1ANCA 2EA3A 2ZGXH 5JBTA 4MG3A 1LPGB 4ESTE 2LP6A 1C5SA 1QRWA 2C4FH 1BMNH 3CP7A 1DWCH 3OYPA 4DT4A 2BD5A 1UTKA 1SGTA 1AU8A 3N7OA 3F2GA 2P3FH 5EQRA 1GHAF 4LZ4B 1O2KA 3OTPA 2OP9A 2P8OB 2AIPA 3RP2A 2D26C 1J9CH 4Y0ZE 4ZCNA 1T7CA 2QC2A 1P9SA 3A8DA 2AGGX 1YLNA 2VNTA 4BAHB 1P05A 2ZU1A 4YXWD 3EE7A 4FUCA 1ORFA 1T8LA 3RU4E 2ODQA 4TYDA 1DSUA 3SNBA 1TNJA 3QGNB 1MD7A 3OEHD 5L6NH 5I25A 1AN1E 1ZJKA 5E8EH 3RXUA 1OYTH 5A0AE 4MNWA 4ZH8A 2A0QB 4BXSA 2ZDKA 1KDQA 2FS9A 1K1JA 2XWAA 3TK9A 2CMYA 1AWFH 1YPHC 3ZZBA 4CHAB 4WMFA 1PQAA 4WF8A 2RA0A 2WPDD 1HIAA 1HNEE 2Y82A 2KM0A 1P2KA 2XNIA 1LDTT 4HFPB 4ASHA 3UNRA 4X1QU 1SGDE 4OS2A 1S6LA 1Z7KA 1LVYA 4I86A 4NA8A 3TLOA 2BDGA 3ZZ9A 3QK1A 4X1SU 1XVMA 1XUHA 4IBLH 5CHAC 3ZVBA 4OS7A 2A7JA 1TGTA 1VCQA 3V12A 1EPTA 1C2IA 4Y6DA 2ZU5A 3MO6A 1O2OA 1C2LA 3VXFH 1A5GH 4I32A 1KTTB 2GT7A 3PTBA 1ZHMA 2PWXA 3CENA 5CHBA 4NIXA 1F2SE 1QL9A 5DN6D 2V3MA 1GG6C 2BDYA 2WPHS 3EE0B 3A87A 1JOUB 3FOAA 1AY6H 5A8YA 4R8TB 3KQEA 4O03A 2G4TA 1EB2A 2F9UA 1MBQA 1HAZB 9ESTA 5K0HA 1NRNH 1A5IA 2XC0A 1DE7H 1XUKA 2ZPQA 4M7GA 5J4QA 1W3CA 3PV2A 2Z9JA 2TGDA 3ODFA 2OTVA 3K6YA 4MPUA 4DW2U 1IAUA 4NWLA 2FOCA 1AGJA 2FZZA 2Z9GA 1DWDH 2PKSB 1SLXB 1AUTC 1AVXA 3I78A 2W5EA 2Y7XA 1CGHA 1XX9A 3ODDA 1D6RA 2CGAA 1LCYA 1QR3E 2BY6X 4F55A 3UWIA 3SUEA 1DWBH 1PPEE 2WPMS 2ZTXA 1C1MA 2BLQA 6CHAB 1AVWA 4X6NA 7ESTE 1NT1A 3ATWA 1OKXA 1QRXA 1WU1A 3NK8A 1O3FA 1P2QA 1T8OA 1V3XA 2Y6TA 1O2GH 3M3VA 4E05H 3RLWH 4AFZA 3PLKA 5AHGH 3A8AA 3LH1A 1P2NA 3BN9A 3VB4A 3UPEA 1JWTA 3M7QA 2BTCE 1AFQB 1MAXA 2PV9B 3AAVA 3EA9A 1INCA 4Y8XA 1UK3A 4MNVA 3RDZA 1C4Y2 4AYVB 4Y71A 1O3KA 1O2IA 1SVPA 3L6PA 5DSFA 1MU6B 3EGKH 4WVPE 5C94A 1O30A 2RCEA 2Z3CA 2BXTH 2VJ1A 1C1RA 4CRBA 1GBEA 3M61U 1PQ5A 1TBRH 1ANBA 2DUCA 2ZFPH 3URCA 3OU0A 1TGBA 3UY9A 2FI5E 1GWAA 5JB9S 1G2LA 1TPOA 1GI5A 1ZPZA 1VGCB 2WZQA 2WYJA 2ZU4A 1WSSH 1UW7A 3CNRA 4D9RA 1G3CA 3TK5A 3GDSA 3F9FA 2ESTE 4ISIH 3FO8D 3N99A 2HLDD 4FUGA 4IC6A 3T2NA 2P3TB 4E7NA 1O2QA 1OYQA 1BCUH 1JRSA 4ZXXH 1BTWA 1FN6A 3TNSA 1L1NA 2ZA5A 2ZU2A 5TCCA 4B1TA 3UB0A 3U1JB 3TJUA 1HXFH 2J92A 1QBVH 2ZCHP 1FONA 2FLBH 4DOQA 3MHWU 1V2MT 2PUXB 2JKHA 1W7XH 2FESH 3P8GA 1K9OE 4AFSA 1P2IA 4LZ1H 1GMCG 4NG9H 1A5HA 1MU8B 2Y5GA 1DLKB 3SJOA 2Y5FA 1T31A 4YESB 1TALA 1BJVA 1EX3A 3BG8A 1QURH 1LMWB 3U8RH 2HPQH 4B6EA 3FZZA 4PROA 2YOLA 1LQDB 1ZPCA 3RXLA 2BZ6H 2HGTH 3KL6A 1F7ZA 1ELBA 3A88A 4XBBA 1O3NA 1SGIB 1ABIH 1NFUA 4I8KA 3UOUA 1G9IE 2SGEE 3F3BA 1W0ZU 1FY8E 1W8BH 8KME2 4IC5A 1BBRK 1BRAA 2CJIA 3BTKE 4INHA 2J9NA 4DG4A 2VVVA 1FXYA 1SGFG 1ZZZA 2A2QH 2FTMA 1K1PA 3SI4H 1HDTH 3ZIAD 4WXIA 2BD4A 2SGDE 2BLWA 2JETB 1KXBA 2Z9LA 2W7SA 3PWBA 4GHQA 1YM0A 4GCHF 3RUOA 1L4DA 4O97A 2A7CA 2OXSA 1FLEE 1GJBB 3D23A 1NRPH 1TNGA 1V6DA 2YMSB 5L30H 3OY6U 1PPCE 4TY7A 2V6NA 1ARBA 3SI3H 4CR5A 4ABDA 1IQKA 3MH5A 1UHBA 5FAHA 1N6YA 5DO4H 1MTNC 5A0CA 4NZQA 8LPRA 1UVTH 1HYLA 1TOMH 2BY8X 4K3JA 5HIYA 2ZGHA 1P12E 2THFB 3A8CA 5A0BA 4CHAC 3BTEE 3RXQA 2A4GA 2G5NA 1LVBA 1MUEB 3D49H 5T3HA 1XUGA 2ZDMA 1NPMA 1BT7A 3PLBA 4U32A 2J95A 1BHXF 3MO3A 1AI8H 1MKWH 1XXFA 1MCVA 1O2PA 1Y3YA 1IQIA 5HKKD 1BRBE 1UCYH 3QLPH 4XD7D 1CA8B 6GCHG 3STJA 1F0SA 1O5FH 3SUDA 1UK2A 1JXPA 1A61H 3F68H 4A1TA 3ZZ5A 5FPYA 5LPFA 1P04A 1RRKA 4AYYB 1HAIH 1QA7A 4K1SA 1VZQH 2GTBA 3EYDA 4B75A 1GJ6A 3PO1B 2R2WU 1A46H 1E1RD 4XE4A 3UTUH 3E8LA 1SB1H 2B9LA 2HOBA 3M5MA 1A4WH 2ANKH 2H1UA 2KCOA 1ESTA 3SHCH 4ABHA 1YPJH 2F9PA 4IMZA 3RXVA 1C5WB 1O3PB 3V7TA 1ACBE 1O3GA 3MOCA 1Z8IB 4NIVA 3S9BA 2PKSC 2J5UA 3A7VA 1O3MA 4Q7ZA 4TWYA 1C1SA 2G4UA 1PPBH 3IWMA 1SQAA 1KTSB 1UTNA 2FEQH 1C5QA 2FX6A 1PQ7A 3FAOA 2BY7X 1J17T 2UUJB 1HLTH 6CHAC 4UD9H 1TWXB 2FMJA 3FFGA 2QGRA 2TIOA 4J1YA 3ATMA 5B6LA 1D3PB 3A7XA 3A86A 1F5RA 1GJ9B 3E0PB 1OWIA 1QB6A 5F8ZA 1TIOA 1WAYB 2ZGJA 4X8SH 3SZEA 1H9LB 4CRGA 5C1UA 4FU8A 3PTNA 4A7IB 1P9UA 5FL7D 1GDQA 1MTUA 3GOVB 4GSOA 1IQHA 2C8XB 1S85A 3RU4D 2BD7A 2ZQ1A 2GDEH 8GCHG 2M2AA 1AFQC 1BMAA 4MNXA 3RMOH 3E3TA 3UR6A 3F6UH 3FKSD 1D3QB 1WQSA 1GHBF 1Z6EA 1GDUA 5CDFE 1DY9A 4XFQA 1G32B 3E6PH 4FUDA 1EAXA 1ANEA 1ELCA 1YP9A 2AMDA 2BMGB 3AW1A 4JCNA 4F4OC 1C5LH 1YWUA 3F1SB 3MU5A 3M5LA 4X8UH 1C2HA 3KQ5A 3S69A 3TIUA 3ZVEA 1VJ9U 4Q7YA 2AGIX 2Z3DA 2Q6DA 1ZLRA 1DFPA 4B2BA 1QHRB 1PPGE 2CN0H 1TPAE 4NFFA 3RMNH 2BYAX 1XM1A 2J97A 4UFFH 2XXLA 4ACBA 2ZDLA 4FUJA 2F9OA 1HUTH 1F0RA 1VITG 2HALA 1FI8A 4OM9A 2ODPA 3GY5A 2Z3EA 2HWLB 1KY9A 1BJUA 2ZIQH 3GY7A 1W10U 1E38B 1C5RA 3MH7A 2BM2A 1QBOA 4Z1MD 4BXWA 1O2XA 1SQRA 1OP0A 2FS8A 2ZFRH 1TQ7B 1N8OC 2W3KA 3KQDA 2C93B 1MTSA 1ZMLA 1EJNA 1YPHE 5DK1A 1FDPA 3BG4B 2FLRH 2QXIA 3D65E 3ZVGA 3SUFA 3K9XB 2K8IA 3T27A 1P11E 1CBWB 2PGQB 3EA7A 2VIOA 1JRTA 1O35A 2ODYB 3QZQA 1K2I1 5A8XA 1YYY1 2QF5A 2QYIA 1SR5C 1E0FD 2GCTB 1XUFA 1C2MA 2J98B 4JYUH 1J16A 3TITA 1WXRA 1FPHH 5DGJA 1C5XB 3FN8A 1TRMA 4YLUA 3SV6A 1FAKH 1Z8JB 2QE7D 1RJXB 3SNAA 2QIQA 4X2XA 2WSSD 3SGBE 1NESE 3BEIB 3KYGA 3RXKA 3SU2A 3HK6B 1ZHRA 4JZFH 1LO6A 1RTFB 5EODA 1BBRH 2JETC 1FQ3A 1THRH 5EJLA 3GYLB 3LGTA 4IN2A 1L0ZA 2HNTC 1QZ8A 1SBWA 3A84A 3M5OA 1K21H 1V2KT 3TJOA 5FXLA 3ZZAA 2BDBA 3KQBA 2P93A 3RXIA 4RSPA 3LONA 4TWWA 3Q3KA 1FIZA 2EI6A 2OC1A 1AZ8A 1LVMA 3Q00A 4DURA 2J4IA 2HRVA 1RS0A 1FMGA 2WINI 5TCAA 5T6FA 1QL7A 1SGYE 2FOAA 4MTBA 4ABFA 2EI8A 3PWCA 1VCPA 4I7YH 1C2KA 5HGGA 1LHFH 1M9UA 4J2YB 1NRQH 1NZQH 2O8MA 1W0KD 5C20A 4AFUA 1UO6A 3O8BA 1DSTA 2C3SA 2PFEA 5DP5A 2WV9A 2UWLA 2QA9E 3KGPA 1EJAA 3S9CA 3KHVA 1COWD 4RKJB 2W7UA 1QB9A 2C8WB 5GCHF 1ETTH 1ELTA 2QAAA 1AFEH 1W0YH 4YT7H 1HAHH 1O2RA 4Q63A 1ZSLA 2ANYA 1Y5BT 3MH6A 4CH2B 1AMHA 5JDUB 1IQNA 4ZKRU 1EP5A 4ISNA 2QV1A 5SGAE 1EQ9A 1HAVA 1GBTA 1Y8TA 2G8TA 1N6XA 1E37B 3A7WA 1TFXA 2ZHWH 2GCHF 3TJNA 2BLOA 1OWDA 1WQVH 3SOSA 1JIRA 1NM6A 1XUIA 3KNXA 1F5LA 3HATH 2PSYA 1KLJH 3UIRA 5E0HA 1GL0E 3PO1C 1BDAA 1GJ4H 1TA2A 2WPIS 3RXEA 2JIZD 3GISB 3NUMA 1NY22 1GJ5H 3DT0H 1AO5A 1GHVH 1YLDA 1IQGA 4KELA 1MTNB 5EPYA 2CHAB 1E1QD 1TBZH 4RT0A 3NCLA 1MZAA 1ZSKA 2FXRA 1YLCA 1W14U 4NWKA 3STIA 1FJSA 1EJMA 3ZZCA 5FBIA 3UWJH 2OC7A 3QZRA 1C5OH 2FYRA 3TH3H 1GI0A 2GJGA 5L2ZH 1TONA 4ZHLU 3F0OA 1MKWK 1GI3A 3RLYH 3ZZDA 1TNKA 2ZWLH 2TGAA 2QN5T 3VPKA 1UCYK 2XOKD 3GCTG 3LC5A 2Z9IA 3K2UA 1PPHE 5E0GA 1H8ED 3BTDE 2ZDAH 4JMYA 4TPYA 4U2WA 3RC5A 1GI7B 2VIVA 4KTCA 4B2CA 2EEKA 2GV6A 2PGBB 1P06A 4YLQH 3SJIA 3HGNA 5LPEA 1O2HA 2O8UA 4WWYA 3PMAB 2NU0E 5CMXH 2PUQH 1GBJA 1UTOA 1ANDA 2V35A 3ITIA 3LGVA 3DUXH 1BTXA 3UAIC 3KF2A 1V2JT 3P92A 1DT2A 3ZVFA 2SGQE 3MH4A 2ZU3A 1SGCA 3H7TA 2VWMA 1SLWB 1HRTH 1YGCH 1T4VH 1V2TT 3T62A 4K60A 4YT6H 1NFWA 3KEEA 4ABAA 1H9HE 3RC6A 1TX7A 5LH8A 5KECA 2RFKC 4ZMAH 1FY1A 2YNAA 1LQEA 1TLDA 1GVZA 1CU1A 2IJD1 4FXGH 4Y76A 1A1RA 1HAYB 4X0WU 2BB4A 2KAIB 3MFJA 1XUJA 2ZO3H 1CVWH 1O3CA 3MU0A 3LJOA 1A2CH 4BTTB 1DDJA 4IW4E 3WW7A 1P01A 3EDXB 4K1EA 3PMJA 1BRCE 1F5KU 1SHHB 1W2KH 4MQAA 1L2EA 4TY6A 4INLA 3GDUA 2ZTZA 9LPRA 2KX4A 1P0SH 4NSYA 5DPAA 6ESTA 5J4SA 1GMDG 4MPXA 3UQOA 3A89A 1P3EA 1UJ1A 3M7TA 2J2UA 2UWPA 3ZVAA 1F0TA 3R0FA 1ZGIA 1W0JD 2BD8A 1FX0B 3VFEA 1TPPA 2ZG0H 4UFEH 3TH2H 4XOJA 1C4U2 1UVOA 1ZTKA 1YBWA 1G3EA 3BG4C 1C2FA 1P03A 3GY3A 5JPMH 4RI0A 1HAOH 2ZKSA 1JBUH 4AC9A 2PTNA 4B6FA 1SG8B 1C4V2 1CBWC 3G01A 3D62A 4HGCA 4X8VH 1V2LT 5GXPA 1TGNA 2CXVA 2XC5A 3W94A 1UCYE 3SV8A 1S81A 1BMLA 2QXJA 1ELAA 4CREA 4KKDA 2F83A 2GCTC 3SORA 1Y3WA 1H8IH 3AVZA 1QA0A 1CHOG 3E0NB 4ACAA 1DANH 4TSFD 2ZZUH 5HIZA 2AERH 1TAWA 1ZRBA 4ZXYH 7GCHG 3PM3A 2ZHQH 2GX4A 1NRRH 3MMGA 5HM2A 2GKVE 3ZZ7A 3SQEE 2XBYA 1SFQB 1SKYE 3P8FA 2ZCKP 1W11U 2VB0A 4XBCA 5KGOA 3UNSA 5HYOA 2O8TA 4ABEA 1TBQH 1C2GA 2Q6GA 4NA7A 2FTLE 3KIDU 2FIRH 1TABE 1GL1A 4FU9A 4A6LA 3B8JA 1YF4A 1TMBH 2SFAA 2GP9B 5T6GA 5FPSA 3M37A 1KXDA 1JIMA 1GJAB 3MO9A 2AYWA 2R0LA 4YTAA 1FNIA 3RXCA 3H5CB 4NA9H 3FANA 1N8OB 2ZFTA 1NU9A 1QNJA 1UTJA 4QT8C 5A09A 1S5SA 3BTQE 3SU3A 1Z8GA 1O3EA 3BTHE 3B9FH 1ZPBA 2ZC9H 1GHZA 2F3CE 5EW1H 3HGPA 2HVXA 7LPRA 2M5TA 1H1BA 5DP4A 4ABBA 2QF4A 1TPSA 1WTHD 5IK2D 1QTFA 3S7KB 3EAJA 4JK6A 1D4PB 2C90B 5AFZH 4DY7B 1IQLA 2XYAA 1PYTC 3VXEH 4GLYA 1C1WH 1T8NA 1GHWH 1MTWA 1C1NA 1QJ7B 3BTME 1L1JA 4X1NU 1KIGH 4FETA 5LPRA 2JJ1D 1RFNA 2STAE 1XMNB 1O2YA 1OOKB 2UUYA 4UONA 1KYNA 2OUAA 1SGRE 3U9AH 2K1QA 3SU1A 5JBCS 1DWEH 3RM2H 4FVBA 2CK3D 3QX5H 1GPZA 2J34A 1CSOE 2ANMH 5ETXA 2QXHA 4ISHH 1HCGA 2CHAC 5EQQA 3W1EA 2G55A 4LK4A 3KYFA 1Y3UA 1Z1JA 4BTIB 1D3TB 2RDLA 5KEDA 1WV7H 2WYGA 1V2RT 3LH3A 3SU0A 2VWLA 4IGDA 3DHKH 2BOHB 2WPLS 1HGTH 1SOTA 3PB1E 1O2UA 2D8WA 1O3HA 1A3BH 5EW2H 1YPGH 1FY3A 1WBGB 4JK5A 1H9IE 1J8AA 2BQ6B 3OY5U 1SFIA 4K2YA 5DG6A 7KMEH 1QCPA 3DFLA 1NN6A 2ULLA 5DP7A 3S0NA 3GICB 1LKBA 5EQSA 3ENSB 2QF0A 4Y10E 3PRBA 1EZXC 2NU3E 1EXFA 4Q2KA 1P8VC 2SGPE 4H42U 1SGFA 4ZKNU 3IG6B 1O2MA 4SGBE 2ZFSA 2QY0B 1GJDB 2VIQA 3M36A 1W13U 3VB5A 2OD3B 1NRSH 1GMCF 2ZTYA 3DSOA 3H09A 1NBME 1B7XB 4I8LA 2JH6D 3GCOA 2AEIH 2LPRA 1FIWA 1Y59T 4XSKU 1RD3B 1TOCB 2LELA 2PKAB 3ELAH 3LJJA 2OC8A 1RGQA 1SL3A 1EZQA 3U98H 3C1KA 2NU4E 4IN1A 1BTZA 3QO6A 2VU8E 4B71A 1GMHG 1MQ6A 3KN2A 2SGAA 1SGNE 1C5ZB 1AZZA 4ZROA 1BBRE 5GWZA 1GBKA 1IOEA 2Z6BD 3SUGA 1BTPA 1VR1H 1TRNA 4R0IA 1TRYA 1DLEA 2SGFE 1JMOH 1QB1A 1S83A 2B7DH 4K8BA 2OBQA 2B0FA 2RA3A 2RG3A 3IITA 3SW2B 1MKXK 5GJ4B 2HNTE 3A7TA 4IS5A 3V13A 1CE5A 5F03A 3ZV9A 2XBXA 4DVAU 3M5NA 1FV9A 4YZUA 2OK5A 1GBAA 4Y79A 4SGAE 2A31A 4K5ZA 1IQEA 5F8TA 2VWNA 2UUFB 5EIYA 1J15A 4JYVH 1TNLA 2K0QA 2H5CA 3MNXA 1HFDA 3SQHE 2BDAA 3E91A 1IQFA 1OWHA 6LPRA 1C1QA 1E34B 4CBNA 2BVRH 2Y5HA 4X1PU 3U8OH 1AKSB 2BZAA 2RDEA 1C5TA 2AFQB 3OFND 4WMEA 2J38A 3TU7H 3ZYEA 4D7GA 3VB3A 5C3NA 2BQWB 1K1LA 2G51A 4I8GA 4ZHMU 1FY4A 5ABWA 2CF8H 1BQYA 2Y80A 1G36A 1CT2E 4XRNA 3SU6A 3ATKA 1O3OA 3C27B 5DP9A 4RKOB 1CQQA 3URDA 3TPIZ 4JZIA 4BAKB 2ZECA 1O5EH 1O5BB 3VB7A 1S6FA 1TQ0B 6GCHF 1GBHA 2HNTF 3B23B 3M3TA 3QN7A 4BAQB 4NIYA 1EFRD 3SBKA 4ISOA 1IHTH 2ZPSA 1MD8A 3Q3XA 3AW0A 3BTTE 1F0UA 2GMTB 2GGVB 4TPIZ 1O5DH 2VINA 4E06H 3GDVA 2UUKB 1FN8A 3PMHB 1SSXA 2GZ7A 1S0RA 2BQ7B 1OWEA 2WHXA 1GI4A 1NU7B 3I29A 2H9TH 3O8DA 1UVPA 1SQOA 3RC4A 2GT8A 1EZUC 5C17A 2UWOA 1ZRKA 3F0PA 2V3OH 1CGJE 1ESBA 4GAWA 3P95A 5FX6A 1LVOA 3RXTA 2A2XH 4X6PA 5A2MH 2F4LA 3M3SA 4CRDA 3JZ1B 3LKWA 4AB8A 1OP2A 2XBVA 5GPIB 1VKYA 2BY9X 3RXAA 3UUZA 1QRZA 3F9EA 5FCRA 1CT4E 1F92A 2Y81A 1G3DA 2WV4A 2V3HH 4O9VA 3NKKA 4AZ2B 2STBE 5K7RA 1GHAG 2BDIA 3ZZ8A 3P70B 5EXNA 1LPZB 3GY8A 2ZHDA 2GZ8A 3AASA 2BVSH 5EU8A 4FU7A 1AVGH 2XW9A 1AE8H 1YPMH 2A45B 1SGPE 1B0FA 3UOPA 3CS0A 1LTOA 1LPKB 1AIXH 1MCTA 1Z1IA 4H6SB 1DS2E 3A7YA 5EXMA 1SOZA 3KCGH 1J14A 1HPGA 8GCHF 1W12U 1AQ7A 1YY3A 1O2JA 3PLPA 5FPTA 1UTPA 3VB6A 3A85A 1AWHB 3RXFA 4UFGH 1HBTH 3E16B 4ZKOU 2TGPZ 1KDQB 1V2NT 1C1PA 1EZSC 3H7OA 3A82A 1QJ6B 1SLVB 1A0LA 2BX4A 4BOHA 3I77A 1QQUA 4NCYA 1HIAB 1BZXE 1O3LA 1UK4A 5LGOA 1RIWB 1TYNA 1G2MA 4D7FA 2FPZA 2ZCLP 2KR7A 2ZGBH 2JH0D 2VH0A 3A80A 2FYQA 5G4BA 2NU2E 1YPEH 1A3EH 3OEED 3LPRA 1OHHD 1H8DH 1BB0B 1GJ8B 4BAMB 3ZZ6A 1KXAA 2C8ZB 2I6SA 4FUHA 4CR9A 5IYTA 2ZNKH 3DSPA 1LHCH 1RXPA 3MNBA 4HI3A 3TK6A 2ALVA 3QTOH 3HPTB 1EPTB 1Z6JH 5C2ZA 3LGUA 1K1OA 3PV4A 1C9TA 1VITF 3ZZ3A 2VIPA 4X2YA 3SYJA 1NFYA 4FUIA 3CS7A 2Q6FA 3NWUA 1DUEA 4I31A 5FBEA 3RXBA 3BV9B 4WH8A 3RXMA 3ZZ4A 5BPEA 2WUBA 3SV7A 2AHME 1OS8A 3BSQA 3A8BA 1BMFD 2FOEA 4X2VA 5TJXA 4FUBA 4OS4A 1DX5M 1ZJDA 4UDWH 4VGCB 5AFYH 4NZLA 1O3AA 2LNCA 4ISLA 4D9QA 1KXCA 1H8HD 2XTTB 1Z71A 1YCPK 5PTPA 1ABJH 1O3IA 1KXFA 1A0JA 2G00A 3L3TA 1C5UA 3BEFB 4FVDA 2GV7A 3NRLA 1GCTB 1WTGH 1O34A 4Y7BA 1LHDH 3SNEA 2XNDD 2EC9H 1GBFA 5C1YA 2J98A 2KCPA 1GDNA 3UREA 1LHEH 2A5IA 2ZP0H 2ALPA 3RU4T 1O2NA 1O0DH 3OE7D 4D76A 1O33A 1WYKA 1N1LA 3LOXA 4OS1A 5F8XA 1X7AC 2ZFQH 3K65B 1DVAH 3O8RA 4D8NA 1GBCA 5HXFA 2IN2A 1GJCB 3GY4A 1K22H 1D6WA 1O5GH 2GDDA 3K6ZA 3P6ZB 1DITH 1SGQE 2GZ9A 2BOKA 3SN8A 2Y7ZA 4JZEH 3N7DA 1DICA 4I8HA 1DPOA 2GVFA 1C5MD 1EUFA 3GS9A 2BVXH 1G3BA 1MKXH 1T32A 1ZHPA 2TRMA 1OXGA 3DCLA 3LGWA 1DUAA 1K1IA 5H4IB 1GI8B 3L33A 5DP3A 1THPB 1ELDE 3ZVDA 4Q7XA 1XXDA 1ZMJA 4B73A 4X2WA 2PTCE 1BIOA 5F53A 1NS3A 4FUFA 3FVFB 1W7GH 3UFAA 4ZHAA 1DOJA 1SLUB 2AMQA 3SGQE 3TJVA 4UFDH 1VITH 1MMJN 3RXGA 3QDZB 2BXUH 2G52A 1IHSH 1AHTH 1TE0A 2FODA 3RM0H 3F9GA 1S84A 4Q4LA 2FO9A 3F2HA 2EI7A 1S82A 1NTPA 1CHGA 2BDHA 1MBMA 1E36B 2I6QA 1V2ST 1O2VA 3RXHA 1OP8A 5FX5A 1G30B 2TBSA 1P2MA 1GI1A 2XC4A 1BRUP 3R3GB 2OCVB 1BMMH 1E35B 3RXJA 4BANB 4A1VA 1QGFA 2DE9A 1PQ8A 3LIWA 4ABGA 1MH0A 1VJAU 3E1XB 1D3DB 3RMMH 4AFQA 1HAXB 4FOUC 2BD2A 2GMTC 4O3TA 1HB0B 1L1GA 4Z0KA 5JBBS 2NU1E 4JZDH 2HLCA 1CA0B 4OGXA 3RXSA 5AF9H 2KCAA 4I8JA 4YO9A 5EJ1A 2H5DA 1QL8A 1DXPA 2OC0A 4NIWA 2JDID 2B8OH 1Z8RA 5EXLA 1PFXC 3UR9A 4CH8B 2L74A 1GGDB 1L4ZA 2L6OA 1EATA 1C1OA 3MTYA 5EG4A 1GHXH 1NBMD 2A5AA 2AS9A 2J94A 4X1RU 4F48B 1GCDA 3SJ9A 2R3YA 4OGYA 3LGYA 3RXOA 1AB9B 1FUJA 3SJKA 2D2DA 4OS6A 4Y11E 2PW8H 3DD2H 1WUNH 4GHTA 3AAUA 1NO9H 4Y8YA 3TGKE 1P3CA 2ZGCA 3P17H 4MLFB 3A81A 1TNHA 1B5GH 3GCTF 2W6JD 3OX7U 1BHXB 3MU4A 3PV5A 4M9FA 2VGCB 2IPHA 2BY5X 2JH5D 4GCHG 1OWJA 5EOKA 2VIDA 1K1MA 2BX3A 4NFEA 3FP8E 1EKBB 1BA8B 2P3UB 5ESBA 1UHBB 2YMSD 1EASA 3VGCB 2R2MB 3GCHB 2HVYB 1ETSH 2H9EH 1BTHH 4KP0A 3AK5A 2P16A 1PPFE 3OTJE 3MU1A 3WWFA 5C0TA 1EOLA 3HK3B 1KXEA 3RXPA 1BUIA 1OPHB 2Z7FE 3RXRA 4DIHH 3GY2A 3ZV8A 4DJZB 4XBDA 2VVUA 3P8OA 4AOQA 1RIWC 1TMUH 2F9BH 4AGJA 2XBWA 3M7UA 1SC8U 5IDKA 2OLGA 2EQNA 2ZF0H 1CGIE 1BTYA 2PLXA 4WMDA 5DKMA 1GVLA 1O2LA 1TB6H 4B2AA 2KAIA 5FCKA 3TGIE 2F43B 3QGJA 1EPTC 1SI5H 2WPKS 1PJPA 3MWIU 1Q3XA 3F2FA 2QCYA 4MDSA 4KTUA 4WXVA 1D9IA 1ELFA 2ILNA 1O38A 3JZ2B 4UEHH 1C5VA 5C5OA 5JBAS 4MPVA 2WUCA 2R0KA 1GBLA 2PSXA 1GMDF 3GYMA 4BNRA 2O8LA 1SGEE 3A83A 2ZPRA 3FZDA 1GI9B 1C9PA 1WOFA 2ANWA 2PR3A 3MNCA 2Z9KA 2FOFA 3BIUH 3A7ZA 2NWNA 1TMTH 1O2ZA 3EQ0H 1BOQA 2ZDVH 3SHAH 4I33A 5C5NA 1KLTA 3LC3A 2KFWA 5GDSH 1ARCA 1ZSJA 1YC0A 4VGCC 2FOBA 1MTVA 5FHTA 3F9HA 4HTCH 1TX6A 1GBDA 3WWBA 1FZZA 2FI4E 1O31A 1VCWA 3BEUA 1TGSZ 1MZDA 1GCTC 2ZI2H 1SPJA 1HJAB 2VVCA 2P8OC 1XKBC 2B5TB 3LDXH 1UVUH 1YCPH 3PRDA 4LXBH 3U1IB 4AX9H 4O3UA 1EB1H 2AMPA 2A4OA 3DSGA 1YPKH 1CHOF 2VIWA 4Z6AH 1C5PA 4WH6A 4H4FA 2Q1JA 1ZYOA 3P8NA 1O3BA 1ZGVA 2FOHA 2R9PA 3QWCH 2WPJS 5C0UA 3SV9A 1GI6A 2A5KA 1ETRH 4WY3A 4X6MA 3T26A 7GCHF 1A7SA 4DT7B 1A0HB 1C2DA 1DM4B 3RMLH 4BAOB 3HKIB 1RTLA 1QFKH 2BLVA 2H2ZA 1DXWA 3BTGE 1P09A 5C1XA 2IJOB 1V2QT 1HAGE 3M35A 5A8ZA 2XRCA 1GHBG 2P95A 3T5FH 5C67A 4ZKSU 1Q2WA 4DGJA 1ELVA 3NPSA 3VG8A 1K1NA 2W26A 5EGMA 5GIBA 3HKJB 4A1XA 3W95A 1O2TA 1GBIA 5DJ7A 5I46H 2H9HA 2QF3A 1E79D 3WY8A 2SNVA 1OWKA 2TGTA 4THNH 5HM9A 2FDAA 2VH6A 1NROH 3U69H 1ZMNA 2FI3E 1KSNA 4YM9A 1AD8H 3KQCA 4Y7AA 3BIVH 4B76A 1Y3XA 2Z94A 5HMAA 1Y5AT 3V0XA 2OINA 4YOJA 3MU8A 3MQKC 1FY5A 4AORA 2BD3A 2A4QA 1THSH 2ZQ2A 2IPQX 1YPLH 2SNWA 3QTVH 2KCYA 2A32A 4K8YA 2ZHFH 4UE7H 5EPNA 1QJ1B 3QUMP 1C2JA 1LHGH 1UMAH 4CRAA 1XVOA 4NGAH 3SZNA 4AG1A 4K1TA 2TPIZ 1CA0C 1HJ9A 3EA8A 2OBOA 3DA9B 1RTKA 5B6OA 2G5VA 1TGCA 3TVJB 3VEQB 1HJ8A 1OSSA 4AB9A 5JB8S 1GGDC 2ZDNA 3PROA 2BDCA 2O8WA 3ESTA 1H4WA 5AVDA 4YOGA 2YNBA 1GI2A 1BTUA 2O9QA 1EAIA 5F6MA 3SV2H 4P02A 2ASUB 5CE1A 1KLIH 1C2EA 1Q31A 3SU5A 1AB9C 2P59A 3LT3A 1GVKB 2FM2A 1HV7A 3O8CA 3Q76A 1GJ7B 3E90B 4TT3D 4U01A 2WV5A 2CF9H 5CHAB 4YOIA 2AIQA 1O2SA 3TNTA 1P10A 1S6HA 3FP6E 4H6TA 1ZTLA 4P00A 1QBNA 4CBOA 2W6ID 1ZTJA 2AGEX 1V2PT 2VGCC 3SJ8A 3BTWE 1B0EA 2OQUA 2A7HA 2PP6A 4KTSA 4MPWA 3RXDA 1O32A 3ATIA 3PYHA 1YCPM 3GCNA 2ZFFH 1UVSH 4JYTA 4NSVA 1P2JA 1O39A 1KMHB 2FP7B 1U6QA 4U30A 2R3UA 1AUJA 1GG6B 1T8MA 1Y3VA 3ATLA 2KZ4A 3VGCC 3GCHC 5EJZA 3BTFE 1PPZA 1C5YB 4B74A 3NXPA 1V2UT 3MNSA 4A5TS 1ZOMA 2P94A 1GHYH 1UTLM 4AGKA 1XKAC 1O2WA 1IQMA 1O5AB 1ELEE 3PMBB 3BF6H 1C1UH 2IOTA 2W3IA 4ZUHA 4HZHA 5L2YH 1VGCC 1IQJA 4RT1A 1P2OA 2FX4A 1EAUA 1P57B 2G81E 4X8TH 1ZR0A 2XWBI 4DCDA 5E2PA 2PHBA 3GY6A 3T29A 2PKAA 2FOGA 1C1VH 1OX1A 3U28C 1NC6A 4ASUD 2A4RA 1GMHF 3Q3YA 4Y0YE 1WCZA 5GCHG 2XCNA 1LKAA 1MAYA 2F91A 4X6OA 4E7RG 8ESTE 5DP8A 2A1DB 2ZEBA 4RN6A 4OS5A 3DFJA 1HAVB 2C8YB 1PYTD 3T25A 5JYIA 4K69A 1T4UH 4HG6A 4GPGA 4GVUA 2ZHEH 1MABB 3LU9B 2FOMB 3SNCA 1V2WT 1CO7E 2GCHG 2EY4C 3UNQA 5GNDA 1AE5A 3V3MA 1NFXA 2F9VA 2XCFA 4MNYA 4AN7A 3ZVCA 5E2OA 1EOJA 1DY8A 1HAPH 1Y5UT 4AG2A 1O36A 3UQVA 2OQ5A 4MVNA 5T6DA 1K0HA 2HPPH 1ID5H 1C5NH 2AH4X 3T28A 5BRRE 1SMFE 1TX8A 2H6MA 4Q80A 1O3DA 2FWWA 4A92A 1QY6A 1S0QA 2BD9A 3OAAD 1AKSA 1O37A 4IMQA 1UTQA 3SO3A 3ZYDA 4ZAEA 1GBMA 1EP6A 1TA6A 1MQ5A 3LGIA 3U8TH 3FP7E 1P02A 5T1VA 3SU4A 1O5CB 5DP6A 3S9AA 1HJAC 2V0BA 1FPCH 4GUXA 2VBCA 4F49A 3N7EA 4CRCA 5ESTE 1SQTA 4BTUB 1ELGA 2V7QD 2DE8A 1O3JA
chains in the Genus database with same CATH topology
2D1JA 1V2VT 2GD4B 1ESAA 4Y8ZA 1EAWA 4LOYH 2VWOA 3OSYA 1FAXA 4DIIH 3TH4H 4FUEA 3Q77A 1YKTA 4CRFA 1CT0E 3SNDA 3MI4A 2F9NA 4XDEA 2BHGA 1HXEH 1BITA 4ABIA 3TGJE 1UTMA 1V2OT 1K28D 2CV3A 5E0JA 4JZ1A 1G37A 4KGAA 4ABJA 4WJG2 1GBBA 1C1TA 3SGAE 3MYWA 1QQ4A 1QIXB 1SHYA 2QXGA 1TNIA 3NZIA 3S7HB 4INKA 1ANCA 2EA3A 2ZGXH 5JBTA 4MG3A 1LPGB 4ESTE 1C5SA 1QRWA 2C4FH 1BMNH 3CP7A 1DWCH 3OYPA 2BD5A 1UTKA 1SGTA 1AU8A 3N7OA 2P3FH 5EQRA 1GHAF 4LZ4B 1O2KA 2OP9A 2P8OB 2AIPA 3RP2A 2D26C 1J9CH 4Y0ZE 1T7CA 2QC2A 1P9SA 3A8DA 2AGGX 2VNTA 4BAHB 1P05A 2ZU1A 4FUCA 1ORFA 1T8LA 3RU4E 2ODQA 4TYDA 1DSUA 3SNBA 1TNJA 3QGNB 1MD7A 5L6NH 5I25A 1AN1E 1ZJKA 5E8EH 3RXUA 1OYTH 5A0AE 4MNWA 4ZH8A 2A0QB 4BXSA 2ZDKA 1KDQA 2FS9A 1K1JA 2XWAA 3TK9A 2CMYA 1AWFH 1YPHC 3ZZBA 4CHAB 4WMFA 1PQAA 4WF8A 2RA0A 1HIAA 1HNEE 2Y82A 1P2KA 2XNIA 1LDTT 4HFPB 4ASHA 3UNRA 4X1QU 1SGDE 4OS2A 1Z7KA 1LVYA 4NA8A 3TLOA 2BDGA 3ZZ9A 3QK1A 4X1SU 1XVMA 1XUHA 4IBLH 5CHAC 3ZVBA 4OS7A 2A7JA 1TGTA 1VCQA 3V12A 1EPTA 1C2IA 4Y6DA 2ZU5A 3MO6A 1O2OA 1C2LA 3VXFH 1A5GH 4I32A 1KTTB 2GT7A 3PTBA 1ZHMA 2PWXA 3CENA 4NIXA 1F2SE 1QL9A 2WPHS 1GG6C 2BDYA 3EE0B 3A87A 1JOUB 1AY6H 5A8YA 4R8TB 3KQEA 4O03A 2G4TA 1EB2A 2F9UA 1MBQA 1HAZB 9ESTA 5K0HA 1NRNH 1A5IA 2XC0A 1DE7H 1XUKA 2ZPQA 4M7GA 5J4QA 1W3CA 2Z9JA 2TGDA 3ODFA 2OTVA 3K6YA 4MPUA 4DW2U 1IAUA 4NWLA 2FOCA 1AGJA 2FZZA 2Z9GA 1DWDH 2PKSB 1SLXB 1AUTC 1AVXA 3I78A 2W5EA 2Y7XA 1CGHA 1XX9A 3ODDA 1D6RA 2CGAA 1LCYA 1QR3E 2BY6X 3UWIA 3SUEA 1DWBH 1PPEE 2WPMS 2ZTXA 1C1MA 2BLQA 6CHAB 1AVWA 4X6NA 7ESTE 1NT1A 3ATWA 1OKXA 1QRXA 1WU1A 3NK8A 1O3FA 1P2QA 1T8OA 1V3XA 2Y6TA 1O2GH 3M3VA 4E05H 3RLWH 4AFZA 3PLKA 5AHGH 3A8AA 3LH1A 1P2NA 3BN9A 3VB4A 3UPEA 1JWTA 3M7QA 2BTCE 1AFQB 1MAXA 2PV9B 3AAVA 3EA9A 1INCA 4Y8XA 1UK3A 4MNVA 3RDZA 1C4Y2 4AYVB 4Y71A 1O3KA 1O2IA 1SVPA 3L6PA 1MU6B 3EGKH 4WVPE 1O30A 2RCEA 2Z3CA 2BXTH 2VJ1A 1C1RA 4CRBA 1GBEA 3M61U 1PQ5A 1TBRH 1ANBA 2DUCA 2ZFPH 3URCA 3OU0A 1TGBA 3UY9A 2FI5E 1GWAA 5JB9S 1G2LA 1TPOA 1GI5A 1ZPZA 1VGCB 2WYJA 2ZU4A 1WSSH 4D9RA 1G3CA 3TK5A 3GDSA 3F9FA 2ESTE 4ISIH 4FUGA 4IC6A 3T2NA 2P3TB 4E7NA 1O2QA 1OYQA 1BCUH 1JRSA 4ZXXH 1BTWA 1FN6A 3TNSA 1L1NA 2ZA5A 2ZU2A 5TCCA 4B1TA 3U1JB 3TJUA 1HXFH 2J92A 1QBVH 2ZCHP 1FONA 2FLBH 4DOQA 3MHWU 1V2MT 2PUXB 2JKHA 1W7XH 2FESH 3P8GA 1K9OE 4AFSA 1P2IA 4LZ1H 1GMCG 4NG9H 1A5HA 1MU8B 2Y5GA 1DLKB 3SJOA 2Y5FA 1T31A 4YESB 1TALA 1BJVA 1EX3A 3BG8A 1QURH 1LMWB 3U8RH 2HPQH 3FZZA 4PROA 2YOLA 1LQDB 1ZPCA 3RXLA 2BZ6H 2HGTH 3KL6A 1F7ZA 1ELBA 3A88A 4XBBA 1O3NA 1SGIB 1ABIH 1NFUA 4I8KA 3UOUA 1G9IE 2SGEE 1W0ZU 1FY8E 1W8BH 8KME2 4IC5A 1BBRK 1BRAA 2CJIA 3BTKE 4INHA 2J9NA 4DG4A 2VVVA 1FXYA 1SGFG 1ZZZA 2A2QH 2FTMA 1K1PA 3SI4H 1HDTH 4WXIA 2BD4A 2SGDE 2BLWA 2JETB 1KXBA 2Z9LA 2W7SA 3PWBA 4GHQA 1YM0A 4GCHF 3RUOA 1L4DA 4O97A 2A7CA 2OXSA 1FLEE 1GJBB 3D23A 1NRPH 1TNGA 1V6DA 5L30H 3OY6U 1PPCE 4TY7A 2V6NA 1ARBA 3SI3H 4CR5A 4ABDA 1IQKA 3MH5A 1UHBA 5FAHA 1N6YA 5DO4H 1MTNC 5A0CA 4NZQA 8LPRA 1UVTH 1HYLA 1TOMH 2BY8X 4K3JA 2ZGHA 1P12E 2THFB 3A8CA 5A0BA 4CHAC 3BTEE 3RXQA 2A4GA 2G5NA 1LVBA 1MUEB 3D49H 5T3HA 1XUGA 2ZDMA 1NPMA 1BT7A 3PLBA 4U32A 2J95A 1BHXF 3MO3A 1AI8H 1MKWH 1XXFA 1MCVA 1O2PA 1Y3YA 1IQIA 1BRBE 1UCYH 3QLPH 1CA8B 6GCHG 3STJA 1F0SA 1O5FH 3SUDA 1UK2A 1JXPA 1A61H 3F68H 4A1TA 3ZZ5A 5FPYA 5LPFA 1P04A 1RRKA 4AYYB 1HAIH 1QA7A 4K1SA 1VZQH 2GTBA 3EYDA 4B75A 1GJ6A 3PO1B 2R2WU 1A46H 4XE4A 3UTUH 3E8LA 1SB1H 2B9LA 2HOBA 3M5MA 1A4WH 2ANKH 2H1UA 1ESTA 3SHCH 4ABHA 1YPJH 2F9PA 4IMZA 3RXVA 1C5WB 1O3PB 3V7TA 1ACBE 1O3GA 3MOCA 1Z8IB 4NIVA 3S9BA 2PKSC 3A7VA 1O3MA 4Q7ZA 4TWYA 1C1SA 2G4UA 1PPBH 3IWMA 1SQAA 1KTSB 1UTNA 2FEQH 1C5QA 2FX6A 1PQ7A 3FAOA 2BY7X 1J17T 2UUJB 1HLTH 6CHAC 4UD9H 1TWXB 2FMJA 3FFGA 2QGRA 2TIOA 4J1YA 3ATMA 1D3PB 3A7XA 3A86A 1F5RA 1GJ9B 3E0PB 1OWIA 1QB6A 5F8ZA 1TIOA 1WAYB 2ZGJA 4X8SH 4CRGA 1H9LB 5C1UA 4FU8A 3PTNA 4A7IB 1P9UA 1GDQA 1MTUA 3GOVB 4GSOA 1IQHA 2C8XB 1S85A 3RU4D 2BD7A 2ZQ1A 2GDEH 8GCHG 1AFQC 1BMAA 4MNXA 3RMOH 3E3TA 3UR6A 3F6UH 1D3QB 1WQSA 1GHBF 1Z6EA 1GDUA 1DY9A 4XFQA 1G32B 3E6PH 4FUDA 1EAXA 1ANEA 1ELCA 1YP9A 2AMDA 2BMGB 3AW1A 4JCNA 4F4OC 1C5LH 3F1SB 3MU5A 3M5LA 4X8UH 1C2HA 3S69A 3TIUA 3ZVEA 1VJ9U 4Q7YA 2AGIX 2Z3DA 2Q6DA 1ZLRA 1DFPA 4B2BA 1QHRB 1PPGE 2CN0H 1TPAE 4NFFA 3RMNH 2BYAX 1XM1A 4UFFH 2XXLA 2ZDLA 4FUJA 2F9OA 1HUTH 1F0RA 1VITG 2HALA 1FI8A 2ODPA 3GY5A 2Z3EA 2HWLB 1KY9A 1BJUA 2ZIQH 3GY7A 1W10U 1E38B 1C5RA 3MH7A 2BM2A 1QBOA 4BXWA 1O2XA 1OP0A 2FS8A 2ZFRH 1TQ7B 1N8OC 2W3KA 3KQDA 2C93B 1MTSA 1ZMLA 1EJNA 1YPHE 5DK1A 1FDPA 3BG4B 2FLRH 2QXIA 3D65E 3ZVGA 3SUFA 3K9XB 3T27A 1P11E 1CBWB 2PGQB 3EA7A 2VIOA 1JRTA 1O35A 2ODYB 3QZQA 1K2I1 5A8XA 1YYY1 2QYIA 1SR5C 1E0FD 2GCTB 1XUFA 1C2MA 4JYUH 1J16A 3TITA 1FPHH 5DGJA 1C5XB 1TRMA 4YLUA 3SV6A 1FAKH 1Z8JB 3SNAA 1RJXB 2QIQA 4X2XA 3SGBE 1NESE 3BEIB 3RXKA 3SU2A 3HK6B 1ZHRA 4JZFH 1LO6A 1RTFB 5EODA 1BBRH 2JETC 1FQ3A 1THRH 3GYLB 3LGTA 4IN2A 1L0ZA 2HNTC 1SBWA 3A84A 3M5OA 1K21H 1V2KT 3TJOA 5FXLA 3ZZAA 2BDBA 3KQBA 2P93A 3RXIA 4RSPA 3LONA 4TWWA 3Q3KA 1FIZA 2EI6A 2OC1A 1AZ8A 1LVMA 3Q00A 4DURA 2J4IA 2HRVA 1RS0A 1FMGA 2WINI 5TCAA 5T6FA 1QL7A 1SGYE 2FOAA 4MTBA 4ABFA 2EI8A 3PWCA 1VCPA 4I7YH 1C2KA 5HGGA 1LHFH 1M9UA 4J2YB 1NRQH 1NZQH 2O8MA 5C20A 4AFUA 1UO6A 3O8BA 1DSTA 2C3SA 2PFEA 5DP5A 2UWLA 2QA9E 3KGPA 1EJAA 3S9CA 3KHVA 4RKJB 2W7UA 1QB9A 2C8WB 5GCHF 1ETTH 1ELTA 2QAAA 1AFEH 1W0YH 4YT7H 1HAHH 1O2RA 1ZSLA 2ANYA 1Y5BT 3MH6A 4CH2B 1AMHA 5JDUB 1IQNA 4ZKRU 1EP5A 4ISNA 2QV1A 5SGAE 1EQ9A 1HAVA 1GBTA 1Y8TA 2G8TA 1N6XA 1E37B 3A7WA 1TFXA 2ZHWH 2GCHF 3TJNA 2BLOA 1OWDA 1WQVH 3SOSA 1JIRA 1NM6A 1XUIA 3KNXA 1F5LA 3HATH 2PSYA 1KLJH 3UIRA 5E0HA 1GL0E 3PO1C 1BDAA 1GJ4H 1TA2A 2WPIS 3RXEA 3GISB 3NUMA 1NY22 1GJ5H 3DT0H 1AO5A 1GHVH 1YLDA 1IQGA 4KELA 1MTNB 5EPYA 2CHAB 1TBZH 3NCLA 1MZAA 1ZSKA 2FXRA 1YLCA 1W14U 4NWKA 3STIA 1FJSA 1EJMA 3ZZCA 5FBIA 3UWJH 2OC7A 3QZRA 1C5OH 2FYRA 3TH3H 1GI0A 5L2ZH 1TONA 4ZHLU 1MKWK 1GI3A 3RLYH 3ZZDA 1TNKA 2ZWLH 2TGAA 2QN5T 3VPKA 1UCYK 3GCTG 3LC5A 2Z9IA 3K2UA 1PPHE 5E0GA 3BTDE 4JMYA 2ZDAH 4TPYA 4U2WA 3RC5A 1GI7B 2VIVA 4KTCA 4B2CA 2EEKA 2GV6A 2PGBB 1P06A 4YLQH 3SJIA 3HGNA 5LPEA 1O2HA 2O8UA 4WWYA 3PMAB 2NU0E 5CMXH 2PUQH 1GBJA 1UTOA 1ANDA 2V35A 3ITIA 3LGVA 3DUXH 1BTXA 3KF2A 1V2JT 3P92A 1DT2A 3ZVFA 2SGQE 3MH4A 2ZU3A 1SGCA 3H7TA 2VWMA 1SLWB 1HRTH 1YGCH 1T4VH 1V2TT 3T62A 4K60A 4YT6H 1NFWA 3KEEA 4ABAA 1H9HE 3RC6A 1TX7A 5LH8A 4ZMAH 1FY1A 2YNAA 1LQEA 1TLDA 1GVZA 1CU1A 4FXGH 4Y76A 1A1RA 1HAYB 4X0WU 2BB4A 2KAIB 3MFJA 1XUJA 2ZO3H 1CVWH 1O3CA 3MU0A 3LJOA 1A2CH 4BTTB 1DDJA 4IW4E 1P01A 3EDXB 4K1EA 3PMJA 1BRCE 1F5KU 1SHHB 1W2KH 4MQAA 1L2EA 4TY6A 4INLA 3GDUA 2ZTZA 9LPRA 5DPAA 1P0SH 4NSYA 6ESTA 5J4SA 1GMDG 4MPXA 3UQOA 3A89A 1P3EA 1UJ1A 3M7TA 2J2UA 2UWPA 3ZVAA 1F0TA 3R0FA 1ZGIA 2BD8A 3VFEA 1TPPA 2ZG0H 4UFEH 3TH2H 4XOJA 1C4U2 1UVOA 1ZTKA 1YBWA 1G3EA 3BG4C 1C2FA 1P03A 3GY3A 5JPMH 1HAOH 2ZKSA 1JBUH 2PTNA 1SG8B 1C4V2 1CBWC 3G01A 3D62A 4HGCA 4X8VH 1V2LT 5GXPA 1TGNA 2CXVA 2XC5A 3W94A 1UCYE 3SV8A 1S81A 1BMLA 2QXJA 1ELAA 4CREA 4KKDA 2F83A 2GCTC 3SORA 1Y3WA 1H8IH 3AVZA 1QA0A 1CHOG 3E0NB 1DANH 2ZZUH 2AERH 1TAWA 1ZRBA 4ZXYH 7GCHG 3PM3A 2ZHQH 2GX4A 1NRRH 3MMGA 5HM2A 2GKVE 3ZZ7A 3SQEE 2XBYA 1SFQB 3P8FA 2ZCKP 1W11U 2VB0A 4XBCA 3UNSA 5HYOA 2O8TA 4ABEA 1TBQH 1C2GA 2Q6GA 4NA7A 2FTLE 3KIDU 2FIRH 1TABE 1GL1A 4FU9A 4A6LA 3B8JA 1YF4A 1TMBH 2SFAA 2GP9B 5T6GA 5FPSA 3M37A 1KXDA 1JIMA 1GJAB 3MO9A 2AYWA 2R0LA 4YTAA 1FNIA 3RXCA 3H5CB 4NA9H 3FANA 1N8OB 2ZFTA 1NU9A 1QNJA 1UTJA 4QT8C 5A09A 1S5SA 3BTQE 3SU3A 1Z8GA 1O3EA 3BTHE 3B9FH 1ZPBA 2ZC9H 1GHZA 2F3CE 5EW1H 3HGPA 2HVXA 7LPRA 2M5TA 1H1BA 5DP4A 4ABBA 1TPSA 1WTHD 1QTFA 3S7KB 3EAJA 4JK6A 1D4PB 2C90B 5AFZH 4DY7B 1IQLA 2XYAA 1PYTC 3VXEH 4GLYA 1C1WH 1T8NA 1GHWH 1MTWA 1C1NA 1QJ7B 3BTME 1L1JA 4X1NU 1KIGH 5LPRA 1RFNA 2STAE 1XMNB 1O2YA 1OOKB 2UUYA 4UONA 1KYNA 2OUAA 1SGRE 3U9AH 2K1QA 3SU1A 5JBCS 1DWEH 3RM2H 4FVBA 3QX5H 1GPZA 2J34A 1CSOE 2ANMH 5ETXA 2QXHA 4ISHH 1HCGA 2CHAC 5EQQA 2G55A