1SGEE

Glu 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgeE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgeE01
2OP9A 1W0ZU 1EAIA 1EQ9A 1HJ8A 3M61U 1EP5A 1NT1A 5C5OA 3ZYEA 3GY8A 4NA7A 1H8DH 4K8YA 1LHGH 1BJUA 3NK8A 4WXIA 2ZWLH 4I33A 4OS4A 2VVVA 1CQQA 2GCTB 1EZQA 4TPIZ 8LPRA 4UDWH 4AB8A 1XUIA 1W7GH 5EPYA 3GDUA 3MHWU 1TGSZ 1IQJA 3TNTA 5C5NA 1C5WB 3BEFB 1TRYA 1RTKA 3GY7A 1HPGA 3ATIA 3F6UH 1TE0A 3A80A 4AG1A 3GY3A 1T8NA 4NFEA 4ESTE 1QQUA 1OWDA 1O32A 3RUOA 4NGAH 2EI7A 3GCOA 7GCHG 1GJ4H 1UJ1A 1TRNA 1CBWC 2A1DB 1MBQA 4UFFH 4AG2A 2GCHG 2VH0A 5C20A 4RKOB 2SGAA 4H42U 1V6DA 1CA0C 1CU1A 1K1OA 2XXLA 4X1NU 1BOQA 2RG3A 3MU5A 3DT0H 1O39A 3HPTB 1IQGA 1TFXA 2VVUA 5A0AE 1JMOH 3EAJA 4M7GA 1RD3B 1P2OA 2I6QA 3GCTF 4MLFB 1ETSH 3A89A 1A3EH 3RLYH 3STIA 1LHFH 2QF3A 1MCVA 1E34B 3JZ2B 5EQQA 1DUAA 3QDZB 4FXGH 4GAWA 4FUCA 4U32A 1BUIA 3Q00A 1RTLA 1TNJA 5DP8A 1P2MA 1PPGE 1BIOA 4ISHH 2A4RA 2NWNA 4FU8A 4VGCB 4Y11E 1C1MA 2Z3EA 1DS2E 1YM0A 1AFQC 4IN1A 2ZPQA 2ANMH 3MNXA 2BXTH 3ZZ5A 2FOFA 3SGBE 3NPSA 1DLEA 1NFUA 1V2OT 2BY5X 2PHBA 1DT2A 3PMBB 1LMWB 3P70B 4WXVA 3ZZBA 4A5TS 1ELCA 1TGTA 1NZQH 1ELVA 2DE9A 1YP9A 4ZHLU 4BANB 2ZU5A 5GXPA 1IQLA 1U6QA 2NU0E 3A8CA 1ZRKA 1HJ9A 1K1PA 2A7JA 1P05A 2BDBA 2P3FH 4TWYA 1GJCB 2Y82A 1MU6B 2BD2A 4U01A 7KMEH 2ODPA 8GCHG 1O3JA 3HKJB 1LKAA 1C5OH 1O5AB 1LVOA 1T8MA 3SJ8A 1G30B 1ID5H 5EQRA 1DPOA 2QXGA 5EXNA 5A09A 4OGXA 2ZQ2A 3ZZ7A 4THNH 4Q80A 2ZFSA 1O2IA 3BG8A 3TLOA 2FOEA 4Y0ZE 2UWPA 4ABFA 1AWFH 2DUCA 1NFXA 1O5GH 1WV7H 3PTBA 1CHGA 2PKSC 1QJ7B 2H5CA 3E6PH 4K5ZA 4AGKA 1P2QA 1CO7E 1VITH 1L4DA 2O8TA 3M5MA 3QK1A 3SHAH 3A8DA 5L2ZH 1L4ZA 3SU3A 1C2LA 2V0BA 3BEUA 3LGVA 1SGPE 1O3GA 1DE7H 3V0XA 1P12E 2FYRA 2ILNA 2B8OH 4XDEA 1O5CB 3FZZA 2R2WU 3A7TA 3MU0A 1NC6A 2ZHFH 1GJ7B 3A84A 3SV6A 2BQ6B 1P04A 1ZMNA 1BBRH 1QB6A 4Y8ZA 2D8WA 4BAKB 1BRUP 1O2JA 1IHSH 2VB0A 2RCEA 5FX6A 4BXSA 2BD9A 2H9HA 1OS8A 2A2XH 1CT4E 1GHAG 5F8TA 2NU1E 1E35B 3O8RA 1ZMLA 4HZHA 2B7DH 1XVOA 1YPKH 1EOLA 4B75A 5HGGA 2D2DA 1RRKA 2XBXA 3TH2H 3T2NA 1ARCA 4MNWA 1SBWA 1W11U 3FP8E 2QV1A 3BTEE 1MCTA 5ESBA 1TLDA 3U1IB 4IW4E 4BOHA 3F9FA 3ITIA 4AB9A 5FAHA 3UOPA 4X1SU 4FUHA 1O2OA 1T8LA 1PQ7A 5DG6A 1GI9B 4X8SH 3ZVEA 1GI3A 2A7HA 5A2MH 2FODA 1UVTH 1WYKA 2F3CE 1GBBA 1NRQH 3LIWA 5EOKA 1EZXC 1VGCC 2GDEH 1F0TA 4MNVA 3TNSA 3GCHC 2PKAA 1GJAB 1ABJH 3TK6A 3UREA 1T32A 1DOJA 5A8ZA 3A82A 2ZF0H 1DDJA 3ZYDA 1YYY1 1Z1IA 2Q6FA 1CBWB 4MPVA 1S0RA 1OWHA 2FOHA 2ZHDA 4X6PA 3SUGA 1GBEA 1XUHA 2AGGX 1BZXE 3FZDA 1M9UA 2PTCE 1NN6A 1GMHF 3BTTE 1ZJDA 4I8GA 1GBCA 2YNAA 1BQYA 1CGJE 5F6MA 4YOJA 4K1TA 5LH8A 1BTZA 1RS0A 1BMAA 3LGYA 2HWLB 3EYDA 4HFPB 3KF2A 4KTSA 1ZMJA 1CA8B 2LPRA 4X8UH 3TJVA 2FOMB 4ABEA 3TH3H 1THSH 4INHA 1HB0B 3VPKA 2ZFRH 1KXBA 1CT0E 3P17H 2BB4A 2WPJS 3MO3A 1L1JA 1QHRB 2W7UA 1V2PT 2H2ZA 3S7HB 4OS6A 2JH5D 1TX7A 1SQOA 3M5NA 3PYHA 3RU4E 3DHKH 1J17T 4WY3A 1EPTC 1O3LA 1XM1A 1HXFH 2XTTB 1S5SA 3HGNA 4J2YB 4KP0A 2HNTC 1JXPA 5HM9A 2D26C 2ODQA 3QGJA 1C1VH 4I31A 5E0HA 3E90B 2XBWA 5T6FA 1EP6A 3T5FH 2IOTA 4WF8A 2G52A 1KLTA 1P2IA 4Y76A 1HDTH 4BAOB 1V2JT 1DVAH 2NU3E 1C2GA 1WOFA 1FUJA 1UTMA 3I77A 1SG8B 3MWIU 1S83A 2VJ1A 4Q2KA 1K1NA 4D8NA 4NSVA 1E36B 5PTPA 1ESBA 3PWCA 3QTOH 1HIAA 1PPCE 1IQKA 1MUEB 1GWAA 3UUZA 4CRFA 1SVPA 2P3TB 1SGCA 1W7XH 4MDSA 4B2AA 1DXWA 2WPHS 1SHYA 1ELBA 2BOKA 2BX4A 3E16B 3RXKA 1GMDF 2Y5FA 3A7VA 1BA8B 3E0PB 5C3NA 1P06A 2AFQB 2C93B 5C1UA 1RIWB 2FXRA 3EA8A 3MH5A 4CREA 3SO3A 4ZMAH 3MI4A 2ZU3A 2PKSB 4WVPE 1K22H 2ZFPH 1GHWH 5J4SA 2G5VA 1C1QA 1S81A 1FNIA 1QJ6B 2ZIQH 3QLPH 2KAIA 2Y6TA 1GJBB 3UNQA 1OPHB 2P8OC 3PROA 1O2VA 2PFEA 3LC3A 4XE4A 4B73A 1KYNA 3L6PA 2OBOA 2C8ZB 1AE5A 2Y7ZA 2VWOA 2G51A 3W95A 3F9GA 3MNCA 5JBAS 1EB1H 3URCA 2FOGA 2ZU1A 3T26A 1TOMH 1EAWA 2QAAA 4H4FA 5FPTA 4CRGA 3UNRA 2Q6DA 1AY6H 5ESTE 1Y5UT 1GG6B 3JZ1B 1MU8B 2TGPZ 5BPEA 1QL8A 3I78A 1T8OA 3PB1E 5J4QA 1FY5A 1YPEH 3PTNA 3STJA 1BBRE 2Z3CA 1C1TA 3M3VA 4FUIA 1W2KH 1LQEA 1Y8TA 1TNHA 3UY9A 3NZIA 5DP3A 3SJ9A 1QTFA 2JETC 5F8ZA 4JZDH 4H6SB 2ZTZA 1BTHH 1V2NT 5T3HA 1V3XA 2D1JA 3RXMA 4ABDA 3SZNA 3BTKE 2FYQA 1OWIA 1EJMA 1O2KA 4X6NA 2A2QH 1TPOA 3RMLH 1OYQA 2CJIA 4X0WU 1MKWH 1GL0E 1GPZA 2J2UA 4CR5A 1C2EA 3TH4H 1A46H 2OCVB 5B6OA 2R2MB 1VGCB 1GI4A 1SGDE 1P02A 3GCHB 1A61H 1MKWK 3SU6A 1PYTD 4HI3A 2W3IA 1XVMA 4KTUA 3P92A 3SGAE 4MTBA 1WBGB 4AZ2B 1W3CA 1AZ8A 2XBVA 2ZGHA 1P8VC 3H7OA 4BNRA 5FHTA 2YOLA 3CENA 2AIQA 1ZZZA 2XW9A 3BN9A 4INKA 5A8YA 3EA7A 3DFLA 1ACBE 1FLEE 1HJAC 1TGCA 2RA0A 2THFB 2Y80A 4X2XA 3T28A 2ZGCA 1O2UA 2A7CA 3U8OH 4YESB 1LPZB 4ISIH 2NU2E 4K3JA 2FO9A 3MH4A 1HFDA 1HAHH 1SLUB 4JCNA 1OWEA 1EUFA 1EATA 2W26A 3SJOA 1KXFA 2ZZUH 4MPWA 1ANDA 1Q2WA 2BZAA 1WTGH 2TGAA 1Z8JB 3TJUA 3UPEA 1C1OA 2UWOA 3ATMA 3SNDA 3SU4A 4LK4A 4A1XA 1GBJA 2F9UA 3DUXH 2SGQE 2FWWA 4ZROA 5FBEA 1BJVA 1IAUA 1EAUA 1FN6A 3MNSA 4GCHF 1EPTB 2ZA5A 2P95A 3KHVA 2A4GA 4R8TB 3EQ0H 4Y10E 3TGKE 1EKBB 2H6MA 1ZYOA 3KCGH 4DJZB 2ZDLA 1VITF 5EXLA 1DSUA 3GISB 1L1NA 1O3EA 4FU7A 1O3FA 2FDAA 4HTCH 1N8OB 1ZSJA 1TX6A 1UHBA 1AVGH 3B8JA 1OX1A 1YPHE 1GVKB 3LDXH 2ZC9H 1K9OE 2AH4X 4AX9H 2VGCB 1KY9A 2WV5A 2CV3A 1KIGH 2STBE 2TIOA 4XBCA 4Q7YA 1A5GH 2BD4A 1N6YA 3PM3A 1O3NA 3PLPA 2J4IA 5JBTA 1QGFA 1BHXB 4YT6H 3K9XB 3LJOA 3VEQB 3OTJE 4DY7B 5C1XA 1L2EA 2GT7A 3PO1C 1GCTC 1UTQA 1ANEA 2QIQA 5GCHF 3GOVB 3OX7U 5FCKA 5JDUB 2UWLA 1GMHG 1WU1A 1SR5C 1BRAA 1V2UT 3KQCA 3R3GB 4ABHA 4F4OC 3ZVCA 1NROH 2GTBA 1O3OA 1O3HA 4RN6A 1O5BB 3SBKA 1TQ7B 3VFEA 3Q76A 2EI8A 4ABAA 1AU8A 3SU5A 3UNSA 2H5DA 3MO9A 1HYLA 3DD2H 2ALPA 2F91A 2AS9A 1SLWB 2HALA 5JB9S 8KME2 5EW1H 2A5AA 3C27B 1F0RA 2OQ5A 3TVJB 2AGIX 3CP7A 3UR9A 1XUKA 1Z8GA 1Z8RA 1C5RA 1UK4A 3ZVAA 1OWKA 1ZGIA 1A0HB 2HPQH 2FOAA 2QY0B 1QRZA 4IMQA 1HAOH 2QCYA 1AB9B 2BLQA 3TGJE 2FESH 1EJNA 2BVSH 1PPFE 1GJDB 1HAVA 3V12A 1S85A 3QTVH 4OS5A 1DWBH 1SGIB 7LPRA 1C1RA 3IWMA 4AFQA 1NM6A 1LVMA 1SSXA 1WTHD 4Y8XA 1KSNA 2OD3B 1GMCF 3SNCA 1FXYA 1TPPA 3BTGE 2ZEBA 4D76A 1GMDG 1KXCA 3SV8A 1E0FD 2Z9JA 2UUKB 1FI8A 1HNEE 2WPMS 2WPLS 1RTFB 5I46H 1V2KT 4ZH8A 3ZV8A 1XXFA 1OSSA 3H7TA 4X8VH 4A1VA 1GI5A 3SI4H 2GP9B 3HKIB 1YCPM 1EJAA 2G4UA 1NU9A 3GDSA 1ORFA 1QA7A 1DY8A 2GV6A 3M35A 1UTLM 1VCWA 1IQMA 2V3HH 3KNXA 2R9PA 4AFSA 2GMTC 1LO6A 4JK6A 1O3CA 4FUBA 1KXAA 1NRRH 3BG4B 4A92A 2Z94A 1ZSKA 1TNKA 2BQ7B 3W94A 2PUXB 5EU8A 1HXEH 1KTSB 1OXGA 2AIPA 1FV9A 1C2JA 4FVDA 2CN0H 1WCZA 5K7RA 4A6LA 4CBNA 2J94A 4FVBA 2VH6A 2RDLA 2QC2A 1XUFA 3N7OA 1ANCA 3B23B 1G3EA 5FX5A 3SNBA 1AD8H 2V6NA 5GDSH 1NO9H 2BTCE 3RC5A 1C5TA 1SGFG 2A45B 4X1RU 5AVDA 1LQDB 1YPMH 4E06H 1WQVH 2P59A 2J9NA 2BDGA 1GJ6A 1GHYH 3VB5A 1C5LH 5H4IB 1WQSA 3RXIA 5L6NH 1F92A 5JYIA 4DVAU 1P2KA 3PMAB 1JBUH 5T6GA 1SC8U 3QZRA 3KL6A 1O2SA 5F03A 1H9LB 3SORA 1W13U 1P9UA 1SOZA 1CHOG 5E0GA 2PUQH 4MPXA 3RXBA 1AUTC 4Z0KA 3SUEA 6GCHF 4AORA 3S9AA 1FIWA 2GZ9A 3RXVA 5GPIB 5DJ7A 4ASHA 1THRH 1NESE 1GI1A 1DXPA 3S0NA 1JRTA 1G32B 4CHAC 1QL7A 1BRCE 1KLIH 1QR3E 2B5TB 2P16A 1GVLA 1Z8IB 4DIIH 2CF8H 2P3UB 2QF0A 3QX5H 1SGNE 3QWCH 5JBBS 4A7IB 1G2LA 1GBFA 1ZTJA 3GY5A 1AQ7A 2AEIH 2QXIA 1O35A 2TRMA 2P93A 2WYJA 1GJ5H 2C8XB 4NIXA 1LTOA 3K6ZA 1GHXH 3F9HA 3LKWA 1O2ZA 1MTNC 4DCDA 3F9EA 3S69A 1EAXA 1SFIA 2ZKSA 2ZCHP 1NS3A 1AWHB 1ZHRA 4UE7H 1VCPA 1D4PB 4AFZA 4UONA 5C2ZA 1HAZB 5CHAC 2AERH 2UUFB 4TWWA 5HM2A 2HPPH 1LVYA 1Y59T 4ZKOU 4MNYA 4GCHG 4FU9A 1O2QA 3P8FA 1C5VA 4WMFA 2ZDMA 3QUMP 3BTHE 1D6WA 1V2WT 1VCQA 4NWLA 3ZZ8A 1IQNA 2FOBA 2QYIA 1VITG 2VIWA 3A83A 4Y71A 2C90B 1ZTKA 3LH1A 1UCYH 1GL1A 2ZDKA 1UVPA 2J38A 1OKXA 2PV9B 2FMJA 1GI0A 1K21H 5SGAE 1Z1JA 1O2NA 1O3BA 3LGWA 1GGDC 1UCYK 2FEQH 3A8BA 3M5OA 3Q3KA 3UIRA 1PQ5A 1UO6A 3RMNH 4BAQB 5C67A 3K6YA 2WUBA 2FTMA 5JB8S 1K1MA 5K0HA 1UVUH 1AZZA 1XKAC 4OS2A 4RSPA 3SV2H 2VNTA 1LKBA 2C3SA 1NY22 1F0SA 1GI7B 1O36A 1O2LA 3R0FA 1CA0B 4OGYA 1MAYA 5GCHG 2BLWA 1QFKH 2OUAA 1HAXB 4I7YH 1FONA 2Y81A 4K69A 1AMHA 4ABJA 3SJIA 1O33A 1TRMA 2FI5E 2BVRH 1SGFA 1ARBA 2HLCA 3ZZAA 1E37B 2F9PA 4BXWA 2RA3A 2A31A 5DP5A 1VR1H 3TK9A 2HVXA 2Q6GA 1D6RA 2A32A 2PKAB 2V3OH 3AAVA 1HCGA 4WH6A 1HUTH 4B2CA 1W10U 2GMTB 4NSYA 2ANWA 1QNJA 3RXOA 1AFQB 3ZV9A 5E2OA 1UMAH 2SNVA 1LHDH 1XUGA 2W3KA 4NWKA 5LPFA 2ASUB 1BTXA 1AGJA 3Q3XA 4CR9A 4ISNA 5TCAA 4PROA 1V2LT 4ISOA 4Z6AH 1SOTA 2FM2A 1ABIH 3MNBA 1QRWA 1BMNH 3VB4A 4JZFH 3SV9A 1DANH 1KDQA 5JBCS 2ZECA 4F49A 1H9IE 4NIVA 2F9VA 1IQFA 1PPHE 4DURA 1HBTH 2ZNKH 4XBBA 2VWMA 1A3BH 3RXTA 3L33A 2BOHB 3RXQA 4X2WA 3LT3A 3VGCC 3LONA 1MMJN 2FLBH 1PPEE 3UOUA 1H9HE 1X7AC 5FCRA 1F5RA 1LPKB 3KQBA 4IC5A 1D3DB 2XBYA 3A85A 1FY3A 4Y8YA 3OU0A 1T4VH 2FTLE 1S6FA 3ODFA 1BB0B 3GCTG 5HMAA 1GHBF 3P8NA 3RMOH 1RJXB 1BRBE 2VVCA 1ZOMA 1TPSA 3FAOA 3E8LA 2G00A 1LHCH 3HATH 1DM4B 3M7TA 1FDPA 4NZLA 1HIAB 1LPGB 6CHAC 1Z71A 1XX9A 2B0FA 3KEEA 5ABWA 1SB1H 1C1NA 3MYWA 2ZU2A 3HK3B 4FUDA 1K28D 4ZKRU 4KELA 1TNLA 4AN7A 2OC7A 1OP8A 1O5DH 1GDQA 1LDTT 2BVXH 1SI5H 2ZPRA 3PLBA 1J8AA 5JPMH 4MQAA 1C5PA 2G5NA 1MTNB 1K2I1 1P11E 2XCNA 2IN2A 2LNCA 1TBRH 1IQIA 1YBWA 3FVFB 3RU4T 1PJPA 1HAYB 5FBIA 4O3UA 3A88A 3SUDA 1C2IA 3MMGA 1AVXA 4TY7A 2ANYA 5CHAB 1P3CA 3A8AA 3BTME 3E91A 5HYOA 1YCPH 2KAIB 3BTWE 1KXEA 2GCTC 3O8DA 2O9QA 1ZRBA 4Y0YE 2FI3E 2C8WB 3SQHE 1V2QT 1YCPK 2FX6A 4KTCA 4E7RG 5G4BA 1J9CH 5LGOA 2G55A 3M7QA 1BTWA 1ZR0A 4NG9H 3GY2A 2PWXA 2ZQ1A 1G9IE 3D49H 2OC1A 1OWJA 3A81A 2ZHQH 3L3TA 1GHZA 2DE8A 3ZVGA 4LOYH 1Y5AT 2UUJB 3TK5A 3TJNA 1O2RA 1F0UA 1DSTA 6GCHG 3MU4A 1BITA 1UCYE 1GVZA 4YM9A 3TIUA 4NZQA 2W5EA 3LC5A 5L30H 3U98H 3RXAA 3S9BA 4X6OA 4ABGA 4D9RA 2ZU4A 1IOEA 2R0KA 2PR3A 3GCNA 4AGJA 2VINA 3UTUH 3DA9B 1PPBH 1D3QB 3GY6A 2EA3A 2GZ7A 1HGTH 5GJ4B 5EG4A 2GGVB 4YO9A 2Q1JA 5GWZA 4D9QA 2ZFFH 4Y79A 1ETTH 1YC0A 2H1UA 2A5IA 2XWBI 4LZ4B 4TPYA 4X8TH 3BIUH 3SW2B 3U1JB 5EODA 1THPB 2PSXA 3NKKA 1D9IA 1P09A 2AGEX 1Y5BT 2ZP0H 4KGAA 1EOJA 1Z7KA 4U2WA 2CGAA 9ESTA 3QGNB 3ZZCA 1P57B 1SLXB 4VGCC 3ZZDA 4YLUA 2OC8A 4D7GA 3H5CB 1S6HA 4JZEH 3U8RH 1TGBA 1MBMA 4GSOA 4QT8C 2ZDVH 4NIWA 1O3AA 3PV4A 5EXMA 1MQ5A 2WUCA 1GBTA 1O2HA 3SI3H 2TBSA 2Z9GA 2Y5HA 3M7UA 1ELDE 1O37A 3UQVA 1W8BH 1CVWH 2ZDAH 1GHAF 4AOQA 1TMTH 3RDZA 1C5XB 1SFQB 3LU9B 3CS7A 2NU4E 4ZAEA 5DKMA 1DICA 1GDNA 4IC6A 2BD8A 2M5TA 1O2WA 3LGIA 2ZFTA 1O0DH 1DUEA 4CH2B 1A4WH 1TONA 1W12U 4ZUHA 3UQOA 4X2YA 3LOXA 3SOSA 1HAIH 1JRSA 2ZGJA 1TOCB 3OY6U 1G2MA 3VGCB 4XBDA 1O3MA 4YOGA 3U69H 3RC4A 1YPJH 3IITA 1B7XB 1O5EH 1DWCH 2ZPSA 3C1KA 1W14U 1MH0A 2ZHWH 2CF9H 3GICB 3MU8A 3OY5U 1NRNH 2HRVA 1Y3YA 2CHAC 1ZGVA 1A7SA 1UHBB 1P10A 4GHTA 3FFGA 5ETXA 2BDAA 5C1YA 2VIVA 2P8OB 2Z3DA 5LPEA 4WMDA 1AN1E 1ELTA 3E0NB 3RXUA 3RXFA 3ODDA 1C5QA 1G3BA 2ESTE 2BXUH 2BD7A 1UVSH 4YZUA 2ALVA 3QZQA 4SGAE 1FAKH 1Z6EA 1ZJKA 1DY9A 2PLXA 1NTPA 1MZAA 4DIHH 2V35A 3QN7A 2H9EH 2OTVA 1PQAA 3SNEA 1FPCH 2ANKH 3RXEA 2IJOB 4B76A 1C9TA 3KN2A 2QGRA 2ZFQH 4JZ1A 3QO6A 2WINI 3ZZ4A 3M3TA 1EZSC 2BLOA 3RM0H 1SGRE 3KQEA 1DX5M 1TA2A 3TU7H 2HGTH 1DWDH 1DWEH 1TBZH 2R3YA 3T27A 2BY6X 2VU8E 4NCYA 4IBLH 4K8BA 2FX4A 2JETB 5CE1A 3TJOA 2F9NA 1NU7B 3TPIZ 5A8XA 4K1EA 2HNTF 1O2YA 4UEHH 3RXCA 1MTVA 1O5FH 2O8UA 4JYUH 4FUGA 1MZDA 3T62A 2QXHA 2TPIZ 2XC5A 2ZGXH 4DG4A 1FZZA 2SGEE 5TCCA 2XCFA 1P2JA 1SMFE 4YLQH 3K2UA 4TYDA 1JOUB 1MTWA 6LPRA 1QJ1B 1GHBG 1T4UH 3KIDU 1HAVB 1C5SA 1AFEH 1PFXC 4MPUA 4INLA 3SGQE 2WPIS 1BHXF 1AO5A 1AVWA 1HJAB 1K1JA 1P9SA 4U30A 4CBOA 1ZHPA 2ODYB 3UFAA 2F9BH 2TGDA 1FMGA 1C5YB 1V2RT 5A0CA 1ESTA 5AHGH 2UUYA 4ABIA 3TITA 4IN2A 3A87A 4O9VA 3A7YA 1FY1A 5IDKA 4ZKNU 1AE8H 4JYVH 4D7FA 2O8WA 2Z7FE 1N1LA 1ESAA 1GDUA 3MO6A 1DLKB 2BDIA 4JZIA 4OS1A 1N6XA 2YNBA 3U9AH 4FUJA 1TYNA 4GUXA 1O30A 2ZG0H 3Q3YA 3A7ZA 1K1LA 1C5MD 3KGPA 2SFAA 2Z9LA 2SGDE 5E0JA 4B1TA 1UVOA 1SGEE 1C2HA 3SU2A 1QBOA 3RMMH 4AFUA 2AMDA 2AYWA 2BQWB 3O8BA 3V3MA 3SNAA 4ISLA 3M37A 1YF4A 3K65B 2VIPA 4I8HA 3MTYA 4NA9H 2W7SA 1MTUA 4X2VA 1QBNA 4ZXYH 3RP2A 1QY6A 5F8XA 1TGNA 3VB6A 3NCLA 1JIMA 3S7KB 3ZVFA 1A0LA 1SQTA 3KQDA 4E7NA 2ZI2H 3LH3A 3G01A 4IMZA 1C2DA 1F7ZA 1XUJA 3GY4A 3LGUA 1K1IA 1SGYE 5DP6A 1TX8A 1UTKA 2PGQB 1GI8B 5EQSA 4DGJA 1GI6A 3RXPA 2A5KA 2XWAA 5L2YH 1SLVB 4GPGA 4JYTA 2A0QB 1WAYB 1Q3XA 1GCDA 8ESTE 1BCUH 1CGIE 5AFZH 1P01A 1J14A 3WY8A 1C2FA 2BZ6H 1IQHA 3LPRA 3IG6B 3PO1B 4Q7ZA 1GCTB 1DITH 1RIWC 1SL3A 1Y3VA 4O3TA 1HAPH 1XKBC 3SU0A 2QXJA 3RLWH 2CHAB 1YLDA 3B9FH 3CS0A 3U8TH 3AASA 1O3PB 3HGPA 3P6ZB 2OQUA 3MH7A 2BY9X 1BTPA 3VXEH 1JWTA 4LZ1H 2VIDA 2BYAX 5TJXA 3RXSA 9LPRA 3A7WA 1MAXA 4B74A 3BF6H 4X1QU 1AUJA 1H1BA 2ZCLP 2Y5GA 2SGPE 3D23A 1ETRH 1HLTH 2G81E 3P8GA 1C1WH 4YT7H 1EX3A 1ELFA 1GG6C 1QB1A 4HGCA 3T29A 1A5HA 2QN5T 4I8KA 4NA8A 2VIQA 1QIXB 4BAMB 2C8YB 1TABE 1BBRK 1C4Y2 1FPHH 1Y3WA 3EGKH 1C2MA 5DO4H 1SGTA 1WUNH 5EGMA 2FIRH 1O31A 1NFYA 4WMEA 3AAUA 3AW1A 1UTNA 1O34A 1Q31A 4O03A 1O3KA 3BSQA 3A86A 1IHTH 1V2ST 4TY6A 1VJAU 1C9PA 4XOJA 3TGIE 3BTFE 3BTDE 3VXFH 3PWBA 3SU1A 1L1GA 2BY8X 3EE0B 3RXDA 2HOBA 2K1QA 1MD8A 1TB6H 1C5NH 3Q77A 5CMXH 1C5ZB 4UFEH 2BDHA 2A4QA 4UFGH 4KKDA 4Y7AA 2R0LA 1LVBA 1PYTC 4RKJB 1A5IA 1TALA 1FIZA 1FY8E 1AIXH 1EASA 3ZVDA 4JMYA 4X1PU 2GT8A 4MNXA 2F9OA 1KTTB 1P3EA 4AYYB 4Y7BA 1TBQH 3SHCH 3URDA 1MKXH 2STAE 3V7TA 1CT2E 2XRCA 1LCYA 3T25A 1GBHA 1TQ0B 3ZVBA 3ZZ9A 4O97A 4Q7XA 7ESTE 4CH8B 1DFPA 1MKXK 1TNGA 4GLYA 2ZDNA 5LPRA 4LXBH 2ZTXA 1G37A 4X6MA 2FP7B 1OOKB 3F1SB 4OS7A 2ZHEH 3AVZA 3UWIA 2OXSA 2Z6BD 3MFJA 5HXFA 2WPKS 3PMJA 2BDYA 3RU4D 2FS9A 3VB3A 2GVFA 3NXPA 3OYPA 1C2KA 1GMCG 1MQ6A 4WH8A 1BMLA 5E8EH 3FP6E 4FUFA 1NPMA 1N8OC 5EW2H 5DP4A 5DP7A 1O2XA 1FY4A 2FS8A 4R0IA 2B9LA 3SJKA 1HV7A 5IYTA 2VGCC 2PTNA 1S0QA 3PMHB 1BDAA 1BMMH 2IPHA 4CRBA 2I6SA 4DOQA 7GCHF 1B0FA 1YPGH 3ELAH 2JH6D 1EB2A 1J15A 5FPSA 1KDQB 2OLGA 5GIBA 2GCHF 2ZGBH 1B0EA 4ZHMU 3MU1A 4B2BA 1YPHC 1GBIA 4CHAB 1Y3XA 1GBLA 1EXFA 2TGTA 1O2TA 1YGCH 3MH6A 1C1UH 1FJSA 1PPZA 1QA0A 1NRPH 3RXHA 3O8CA 3ATKA 5AFYH 2BD3A 1UTOA 1UTJA 2AMQA 3EDXB 1S84A 3GYLB 2GKVE 1F2SE 1O38A 3SV7A 1OP0A 3RXGA 1GBKA 1YLCA 4XFQA 4ZHAA 3VB7A 1CE5A 2WV4A 3M3SA 4E05H 1QRXA 1VZQH 1FQ3A 4ABBA 4XSKU 4DW2U 1XMNB 2G4TA 2WYGA 5DGJA 4NFFA 2GD4B 3BIVH 2H9TH 1TWXB 2BMGB 2C4FH 1GJ9B 2BY7X 2O8MA 1UK3A 2AMPA 2OINA 3PLKA 3GDVA 3ENSB 2GZ8A 1GJ8B 1A0JA 3ZZ3A 2Z9KA 4ZXXH 2ZCKP 4JK5A 1SGQE 1RXPA 5I25A 1IQEA 3SN8A 2BDCA 1G36A 1W0YH 2BM2A 1B5GH 3I29A 1CSOE 1ZPBA 2J95A 2BD5A 2FZZA 1QQ4A 2Y7XA 4K1SA 1NRSH 2XC0A 2QA9E 2XYAA 4BTIB 4WWYA 1QB9A 1AB9C 2GV7A 3F68H 5DK1A 1C4U2 1ZPZA 4UFDH 5BRRE 1ELEE 3ATWA 4GHQA 2CMYA 1CGHA 3RM2H 1Z6JH 3ATLA 1JIRA 3BTQE 5AF9H 1ZSLA 2JKHA 1INCA 1LHEH 3DFJA 1YPLH 3BEIB 1QL9A 1P0SH 3HK6B 8GCHF 1TMUH 1BTUA 1BT7A 3M36A 2EEKA 1RFNA 4IS5A 3BV9B 1GGDB 1QCPA 4FUEA 4A1TA 2OC0A 2BLVA 2FLRH 5A0BA 1NFWA 5DP9A 1ELAA 1H8IH 3FANA 3M5LA 2EI6A 1AKSA 4BAHB 5FXLA 4CRCA 1YKTA 3SQEE 1CHOF 3AW0A 3RXJA 4Y6DA 1A1RA 1P2NA 2SNWA 1V2TT 4YOIA 1SHHB 1TA6A 4I8JA 3RXRA 4BTUB 1SQAA 4SGBE 3UR6A 5DPAA 3FP7E 3V13A 1PQ8A 1G3CA 1ELGA 1ANBA 2SGFE 2VWNA 1G3DA 2JH0D 1EPTA 3UWJH 2VWLA 3ESTA 1F5KU 1GBMA 2HNTE 2PSYA 3P8OA 2J34A 4B71A 1E38B 2A4OA 1O2PA 4AYVB 2FI4E 1T31A 1ZHMA 4NIYA 3GYMA 2R3UA 3OSYA 1FN8A 1F5LA 3BG4C 2XC4A 1KXDA 1AKSB 2GX4A 5FPYA 1D3TB 1P03A 1TNIA 1V2MT 1HAGE 2BX3A 3D65E 6ESTA 1O3IA 4K60A 4I32A 4BTTB 2J92A 3LJJA 3EA9A 3LGTA 1ZPCA 1C4V2 1KLJH 1EZUC 1OP2A 4DT7B 4CRAA 5E2PA 4GVUA 2O8LA 3A7XA 1O3DA 2EC9H 1MD7A 1UK2A 3S9CA 1D3PB 1GBAA 1FAXA 3ZZ6A 3D62A 1QURH 1QBVH 1C1SA 1TAWA 4H6TA 2GDDA 3E3TA 1SPJA 1A2CH 2VIOA 2ZTYA 2PGBB 1J16A 4UD9H 4J1YA 1RGQA 2BHGA 2PW8H 2G8TA 1BTYA 2OBQA 1XXDA 1S82A 1V2VT 1TMBH 1GI2A 2P94A 1GBDA 3E1XB 3RXLA 1AHTH 1C1PA 1VJ9U 1TIOA 1T7CA 4CRDA 4K2YA 1O2MA 2CXVA 2XNIA 2F83A 3P95A 3NWUA 1MTSA 4IGDA 4MG3A 4MVNA 3NUMA 1AI8H 1UTPA 1ZTLA 3RC6A 2FOCA 1ZLRA 4I8LA 3SUFA 2ULLA 6CHAB 5EPNA 1HRTH 1H4WA 4WJG2 2Z9IA 4YTAA 1Y3UA 2ZO3H 1C5UA 5T6DA 2FPZA 1L0ZA 1OYTH 1GHVH 4ZKSU 1TPAE 1O2GH 3MOCA 1WSSH
chains in the Genus database with same CATH superfamily
2OP9A 1W0ZU 1EAIA 1EQ9A 1E1RD 1HJ8A 3M61U 1EP5A 1NT1A 5C5OA 3ZYEA 3GY8A 4NA7A 2KM0A 1H8DH 2GJGA 4K8YA 1LHGH 1BJUA 3NK8A 4WXIA 2ZWLH 4I33A 4OS4A 1E79D 2VVVA 1CQQA 2GCTB 1EZQA 4TPIZ 8LPRA 2IPQX 4UDWH 2J98B 4AB8A 1XUIA 1W7GH 5EPYA 3GDUA 3MHWU 1TGSZ 1IQJA 3TNTA 5C5NA 1C5WB 3BEFB 1TRYA 1RTKA 3GY7A 1HPGA 3ATIA 3F6UH 5HKKD 1TE0A 3A80A 4AG1A 3GY3A 1T8NA 4NFEA 4ESTE 1QQUA 1OWDA 1O32A 3RUOA 4NGAH 2EI7A 3GCOA 7GCHG 1GJ4H 1UJ1A 1TRNA 1CBWC 2A1DB 1MBQA 4UFFH 4AG2A 2GCHG 2VH0A 5C20A 4RKOB 5IK2D 2SGAA 4H42U 1V6DA 1CA0C 1CU1A 1K1OA 2XXLA 4X1NU 1BOQA 2RG3A 3MU5A 3DT0H 1O39A 3HPTB 1IQGA 1TFXA 2VVUA 5A0AE 1JMOH 3EAJA 4M7GA 1RD3B 1P2OA 2I6QA 3GCTF 4MLFB 1ETSH 3SYJA 3A89A 1A3EH 3RLYH 3STIA 5C0TA 1LHFH 2QF3A 1MCVA 1E34B 3JZ2B 2OK5A 5EQQA 1DUAA 3QDZB 4FXGH 4XD7D 2L74A 4GAWA 4FUCA 4U32A 2F43B 4F55A 1BUIA 3Q00A 1RTLA 1TNJA 5DP8A 1P2MA 1PPGE 1BIOA 4ISHH 2A4RA 2NWNA 1E1QD 4FU8A 4VGCB 4Y11E 1C1MA 2J97A 2Z3EA 1DS2E 4F48B 1YM0A 1AFQC 3OE7D 4IN1A 2ZPQA 2ANMH 3MNXA 2BXTH 3ZZ5A 2FOFA 3SGBE 3NPSA 1DLEA 1NFUA 1V2OT 2BY5X 2PHBA 3KQ5A 1DT2A 3PMBB 1LMWB 3P70B 4WXVA 3ZZBA 4A5TS 1ELCA 1TGTA 1NZQH 1ELVA 2DE9A 1YP9A 4ZHLU 4BANB 2ZU5A 5GXPA 1IQLA 1U6QA 2NU0E 3A8CA 1ZRKA 1HJ9A 2K0QA 1K1PA 2A7JA 1P05A 2BDBA 2P3FH 4TWYA 4ASUD 2XNDD 1GJCB 2Y82A 1MU6B 2BD2A 4U01A 7KMEH 2ODPA 8GCHG 1VKYA 1O3JA 3HKJB 3PV5A 1LKAA 1C5OH 1O5AB 1LVOA 1T8MA 3SJ8A 1G30B 1ID5H 5EQRA 1DPOA 2QXGA 5EXNA 5A09A 4OGXA 2ZQ2A 3ZZ7A 2JIZD 4THNH 4Q80A 2ZFSA 2LELA 1O2IA 3BG8A 3TLOA 2FOEA 4Y0ZE 2UWPA 5DSFA 4ABFA 1AWFH 2DUCA 1NFXA 1O5GH 1WV7H 3PTBA 1CHGA 2PKSC 1QJ7B 2H5CA 3E6PH 4K5ZA 4AGKA 1P2QA 1CO7E 1VITH 1L4DA 2O8TA 3M5MA 3QK1A 3SHAH 3A8DA 5L2ZH 1L4ZA 3SU3A 1C2LA 2V0BA 3BEUA 3LGVA 1SGPE 1O3GA 1DE7H 3V0XA 1P12E 2FYRA 2ILNA 2B8OH 4XDEA 4Q63A 1O5CB 3FZZA 4YXWD 2R2WU 3A7TA 3MU0A 4DT4A 1NC6A 2ZHFH 1GJ7B 3A84A 3SV6A 2BQ6B 1P04A 1ZMNA 1BBRH 1QB6A 4Y8ZA 2D8WA 4BAKB 1BRUP 1O2JA 1IHSH 2VB0A 2RCEA 5FX6A 4BXSA 2BD9A 2H9HA 1OS8A 2A2XH 1CT4E 1GHAG 5F8TA 2NU1E 1E35B 3O8RA 1ZMLA 4HZHA 5EJLA 2B7DH 4ZCNA 4B6EA 1XVOA 1YPKH 2QE7D 1EOLA 4B75A 5HGGA 2D2DA 1RRKA 2XBXA 3TH2H 3T2NA 1ARCA 4MNWA 1SBWA 1W11U 3FP8E 2QV1A 3BTEE 1MCTA 5ESBA 1TLDA 3U1IB 4IW4E 4BOHA 3F9FA 3ITIA 4AB9A 1NBME 5FAHA 3UOPA 4X1SU 4FUHA 1O2OA 1T8LA 1PQ7A 2EY4C 5DG6A 1GI9B 4FETA 4X8SH 3ZVEA 1GI3A 2A7HA 5A2MH 2FODA 1UVTH 1WYKA 2F3CE 2KCYA 1GBBA 1NRQH 3LIWA 5EOKA 1EZXC 1VGCC 2GDEH 1F0TA 4MNVA 3TNSA 3GCHC 2PKAA 1GJAB 1ABJH 3TK6A 3UREA 1T32A 1DOJA 5A8ZA 3A82A 2ZF0H 1DDJA 3ZYDA 1YYY1 1Z1IA 2Q6FA 1EFRD 1CBWB 4MPVA 1S0RA 1OWHA 2FOHA 2ZHDA 4X6PA 3VG8A 3SUGA 1GBEA 1XUHA 2AGGX 1BZXE 5EJZA 3FZDA 1M9UA 2PTCE 1NN6A 1GMHF 3BTTE 1ZJDA 4I8GA 1GBCA 3KYGA 2YNAA 1BQYA 1CGJE 5F6MA 4YOJA 4K1TA 5LH8A 1BTZA 1RS0A 1BMAA 3LGYA 2HWLB 3EYDA 4HFPB 3KF2A 4KTSA 1ZMJA 1CA8B 2LPRA 4X8UH 3TJVA 2FOMB 4ABEA 3TH3H 1THSH 4INHA 1HB0B 3VPKA 2ZFRH 1KXBA 1CT0E 3P17H 2BB4A 2WPJS 3MO3A 1L1JA 1QHRB 2W7UA 1V2PT 2H2ZA 3S7HB 4OS6A 2JH5D 1TX7A 1SQOA 3M5NA 3PYHA 5KGOA 3RU4E 3DHKH 1J17T 4WY3A 1EPTC 2KCOA 1O3LA 1XM1A 1HXFH 2XTTB 1S5SA 3HGNA 4J2YB 4KP0A 2HNTC 1JXPA 5HM9A 2D26C 2ODQA 3QGJA 1C1VH 4I31A 5E0HA 3E90B 2XBWA 5T6FA 1EP6A 3T5FH 2IOTA 4WF8A 2G52A 1KLTA 1P2IA 4Y76A 1HDTH 4BAOB 1V2JT 1DVAH 2NU3E 1C2GA 1WOFA 1FUJA 1UTMA 3I77A 1SG8B 3MWIU 1S83A 2VJ1A 4Q2KA 1K1NA 4D8NA 4NSVA 1E36B 5PTPA 3SZEA 1ESBA 3PWCA 3QTOH 1HIAA 1PPCE 1IQKA 1MUEB 1GWAA 3UUZA 4CRFA 1SVPA 2P3TB 1SGCA 1W7XH 4MDSA 4B2AA 1DXWA 2WPHS 1SHYA 1ELBA 2BOKA 2BX4A 3E16B 3RXKA 1GMDF 2Y5FA 3A7VA 1BA8B 3E0PB 5C3NA 1P06A 2AFQB 2C93B 5C1UA 1RIWB 2FXRA 3EA8A 3MH5A 4CREA 3SO3A 4ZMAH 3MI4A 2ZU3A 3UAIC 2PKSB 4WVPE 1K22H 2ZFPH 1GHWH 5J4SA 2G5VA 1C1QA 1S81A 1FNIA 1QJ6B 2ZIQH 3QLPH 2HLDD 2KAIA 2Y6TA 1GJBB 3UNQA 1OPHB 2P8OC 3PROA 1O2VA 2PFEA 3LC3A 4XE4A 4B73A 1KYNA 3L6PA 2OBOA 2C8ZB 1AE5A 2Y7ZA 2VWOA 2G51A 3W95A 3F9GA 3MNCA 5JBAS 1EB1H 3URCA 4Q4LA 2FOGA 2ZU1A 3T26A 1TOMH 1EAWA 2QAAA 4H4FA 5FPTA 4CRGA 3UNRA 2Q6DA 1YLNA 1AY6H 5ESTE 1Y5UT 1GG6B 3JZ1B 1MU8B 2TGPZ 5BPEA 1QL8A 3I78A 1T8OA 3PB1E 5J4QA 1FY5A 1YPEH 3PTNA 3STJA 1BBRE 2Z3CA 1C1TA 3M3VA 4FUIA 1W2KH 1LQEA 1Y8TA 3NRLA 1TNHA 3UY9A 3NZIA 5DP3A 3SJ9A 1QTFA 2JETC 5F8ZA 4JZDH 4H6SB 2ZTZA 1H8HD 1BTHH 1V2NT 5T3HA 1V3XA 2D1JA 2EQNA 3RXMA 4ABDA 3SZNA 3BTKE 2FYQA 1OWIA 1EJMA 1O2KA 4X6NA 2A2QH 1TPOA 3RMLH 1OYQA 2CJIA 4X0WU 1MKWH 1GL0E 1GPZA 2J2UA 4CR5A 1C2EA 2JJ2D 3TH4H 1A46H 2OCVB 5B6OA 2R2MB 2WPDD 1VGCB 1GI4A 1SGDE 1P02A 3GCHB 1A61H 1MKWK 3SU6A 1PYTD 4HI3A 2W3IA 1XVMA 4KTUA 3P92A 3SGAE 4MTBA 1WBGB 4AZ2B 1W3CA 3GS9A 5B6LA 1AZ8A 2XBVA 2ZGHA 1P8VC 1K0HA 3H7OA 2KZ4A 4BNRA 2F4LA 5FHTA 2YOLA 3CENA 2AIQA 1ZZZA 2XW9A 3BN9A 4INKA 5A8YA 3EA7A 3DFLA 1ACBE 1FLEE 1HJAC 1TGCA 2RA0A 2THFB 2Y80A 4P02A 4X2XA 1QZ8A 2ZGCA 3T28A 1O2UA 2A7CA 3U8OH 4YESB 1LPZB 4ISIH 2NU2E 4K3JA 2FO9A 3MH4A 1HFDA 1HAHH 1SLUB 4JCNA 1OWEA 1EUFA 2XOKD 1EATA 2W26A 3SJOA 2KCPA 3PRBA 1KXFA 2ZZUH 4MPWA 1ANDA 1Q2WA 2BZAA 1WTGH 2TGAA 1Z8JB 3TJUA 3UPEA 1C1OA 2UWOA 3ATMA 3SNDA 3SU4A 4LK4A 4A1XA 1GBJA 2F9UA 3DUXH 2SGQE 2FWWA 4ZROA 5FBEA 1BJVA 1IAUA 1EAUA 1FN6A 3MNSA 4GCHF 1EPTB 2ZA5A 2P95A 3KHVA 2A4GA 4R8TB 3EQ0H 4Y10E 3TGKE 1EKBB 2H6MA 1ZYOA 3KCGH 1WDIA 4DJZB 2ZDLA 1VITF 5EXLA 1DSUA 3GISB 1L1NA 1O3EA 4FU7A 1O3FA 2FDAA 4HTCH 1N8OB 1ZSJA 1TX6A 1UHBA 1AVGH 3B8JA 1OX1A 1YPHE 1GVKB 3LDXH 2ZC9H 1UW7A 1K9OE 2AH4X 4AX9H 2VGCB 1KY9A 2WV5A 2CV3A 1KIGH 3N7DA 2STBE 5KEDA 2TIOA 4XBCA 4Q7YA 1A5GH 2BD4A 1N6YA 2V3MA 3PM3A 1O3NA 3PLPA 2J5UA 2J4IA 5JBTA 1QGFA 1BHXB 4YT6H 3K9XB 3LJOA 3VEQB 3OTJE 4DY7B 5C1XA 1L2EA 2GT7A 3PO1C 1GCTC 1UTQA 1ANEA 2QIQA 5GCHF 3GOVB 3OX7U 5FCKA 5JDUB 2UWLA 1GMHG 1WU1A 3PRDA 1SR5C 1BRAA 1V2UT 3KQCA 3R3GB 4ABHA 4F4OC 3WW7A 3ZVCA 1NROH 2GTBA 1O3OA 1O3HA 4RN6A 1O5BB 3SBKA 1TQ7B 3VFEA 3Q76A 2EI8A 4ABAA 1AU8A 3SU5A 3UNSA 2H5DA 3MO9A 1HYLA 3DD2H 2ALPA 2F91A 2AS9A 1SLWB 2HALA 5JB9S 8KME2 5EW1H 2A5AA 2KX4A 3C27B 3F2FA 3CNRA 1F0RA 2OQ5A 3TVJB 2AGIX 3CP7A 3UR9A 1XUKA 1Z8GA 1Z8RA 1C5RA 1UK4A 5T1VA 1OWKA 1ZGIA 1A0HB 2HPQH 3ZVAA 2FOAA 2QY0B 1QRZA 4IMQA 1HAOH 2QCYA 1AB9B 2BLQA 3TGJE 2FESH 1EJNA 2BVSH 1PPFE 1GJDB 1HAVA 3V12A 1S85A 3QTVH 4OS5A 1DWBH 1SGIB 7LPRA 1C1RA 3IWMA 4AFQA 1NM6A 1LVMA 1SSXA 1WTHD 4Y8XA 1KSNA 2OD3B 3AK5A 1GMCF 2CK3D 3SNCA 1FXYA 1TPPA 3BTGE 2ZEBA 4D76A 1GMDG 1KXCA 3SV8A 1E0FD 2Z9JA 2UUKB 1FI8A 1HNEE 2WPMS 3F0OA 4TT3D 2WPLS 1RTFB 2JJ1D 5I46H 1V2KT 2RDEA 4ZH8A 3ZV8A 1XXFA 1OSSA 3H7TA 4X8VH 4A1VA 1GI5A 3SI4H 2GP9B 3HKIB 1YCPM 1EJAA 2G4UA 1NU9A 3GDSA 1ORFA 1QA7A 1DY8A 2GV6A 4AC9A 3M35A 1UTLM 1VCWA 1IQMA 2V3HH 3KNXA 2R9PA 4AFSA 2GMTC 1LO6A 4JK6A 1O3CA 4FUBA 1KXAA 1NRRH 3BG4B 4A92A 2Z94A 1ZSKA 1TNKA 2BQ7B 3W94A 2PUXB 5EU8A 1HXEH 1KTSB 1OXGA 2AIPA 1FV9A 1C2JA 4FVDA 2CN0H 1WCZA 5K7RA 4A6LA 4CBNA 2J94A 4FVBA 2VH6A 2RDLA 5C0UA 2QC2A 1XUFA 3N7OA 1ANCA 3B23B 1G3EA 4XRNA 5FX5A 3SNBA 1AD8H 2V6NA 5GDSH 1NO9H 2BTCE 3RC5A 1C5TA 1SGFG 2A45B 3N7EA 4X1RU 5AVDA 1LQDB 1YPMH 4E06H 1WQVH 2P59A 2J9NA 2BDGA 1GJ6A 1GHYH 3VB5A 1C5LH 5H4IB 1WQSA 3RXIA 5L6NH 1F92A 5JYIA 4DVAU 1P2KA 3PMAB 1JBUH 5T6GA 1SC8U 3QZRA 3KL6A 1O2SA 5F03A 1H9LB 3SORA 1W13U 1P9UA 1SOZA 1CHOG 5E0GA 2PUQH 4MPXA 3RXBA 1AUTC 4Z0KA 3SUEA 6GCHF 4AORA 3S9AA 1FIWA 2GZ9A 3RXVA 5GPIB 5DJ7A 4ASHA 1THRH 1NESE 1GI1A 1DXPA 3S0NA 1JRTA 1G32B 4CHAC 1QL7A 1BRCE 1KLIH 1QR3E 2B5TB 2P16A 1GVLA 1Z8IB 4DIIH 2CF8H 2P3UB 2QF0A 3QX5H 1SGNE 3QWCH 5JBBS 4A7IB 2KR7A 1G2LA 1GBFA 1ZTJA 3GY5A 1AQ7A 2AEIH 2QXIA 1O35A 2TRMA 2P93A 2WYJA 1GJ5H 2C8XB 4NIXA 2YMSC 1LTOA 3K6ZA 1GHXH 3F9HA 3LKWA 1O2ZA 1MTNC 4DCDA 3EE7A 3F9EA 3S69A 1EAXA 1SFIA 2ZKSA 2ZCHP 1NS3A 1AWHB 1ZHRA 4UE7H 1VCPA 1D4PB 4AFZA 3DSPA 4UONA 5C2ZA 1HAZB 5CHAC 2AERH 2UUFB 4TWWA 2VBCA 5HM2A 2HPPH 1LVYA 2W6ID 5C17A 1Y59T 4ZKOU 4MNYA 4GCHG 4FU9A 1O2QA 3P8FA 1C5VA 4WMFA 2ZDMA 3QUMP 3BTHE 1D6WA 1V2WT 1VCQA 4NWLA 3ZZ8A 1IQNA 2FOBA 2QYIA 1VITG 2VIWA 3A83A 4Y71A 2C90B 1ZTKA 3LH1A 1UCYH 5CHBA 1GL1A 2ZDKA 1FX0B 1UVPA 4M9FA 2J38A 1OKXA 2PV9B 2FMJA 1GI0A 1K21H 2KCAA 1Z1JA 5SGAE 1O2NA 1O3BA 3LGWA 1GGDC 1UCYK 2FEQH 3A8BA 3M5OA 3Q3KA 3UIRA 1PQ5A 1UO6A 3RMNH 4BAQB 5C67A 3K6YA 2WUBA 2FTMA 5JB8S 1K1MA 5K0HA 1UVUH 1AZZA 1XKAC 4OS2A 4RSPA 3SV2H 2VNTA 1YWUA 1LKBA 2C3SA 1NY22 1F0SA 1GI7B 1O36A 1O2LA 3R0FA 1CA0B 4OGYA 1MAYA 5GCHG 2BLWA 1QFKH 2OUAA 1HAXB 4I7YH 1FONA 3UB0A 2Y81A 4K69A 1AMHA 4ABJA 3SJIA 1O33A 1TRMA 2FI5E 2BVRH 1SGFA 1ARBA 2HLCA 3ZZAA 1E37B 2F9PA 4BXWA 2RA3A 2A31A 5DP5A 1VR1H 3TK9A 2HVXA 2Q6GA 1D6RA 2A32A 2PKAB 2V3OH 3AAVA 2W6JD 1HCGA 4WH6A 1HUTH 4B2CA 1W10U 2GMTB 4NSYA 2ANWA 1QNJA 3RXOA 1AFQB 3ZV9A 5E2OA 1UMAH 2SNVA 1LHDH 1XUGA 2W3KA 4NWKA 5LPFA 2ASUB 1BTXA 1AGJA 3Q3XA 4CR9A 4ISNA 5TCAA 4PROA 2M2AA 1V2LT 4ISOA 4Z6AH 1SOTA 2FM2A 1ABIH 3MNBA 1QRWA 1BMNH 3VB4A 4JZFH 3SV9A 1DANH 1KDQA 5JBCS 2ZECA 4F49A 1H9IE 4NIVA 2F9VA 1IQFA 1PPHE 4DURA 1HBTH 2ZNKH 4XBBA 2VWMA 1A3BH 1COWD 3RXTA 3L33A 2BOHB 3RXQA 4X2WA 3LT3A 3VGCC 3LONA 1MMJN 2FLBH 1PPEE 3UOUA 1H9HE 1X7AC 5FCRA 1F5RA 1LPKB 3KQBA 4IC5A 1D3DB 2XBYA 3WWBA 3A85A 1FY3A 4Y8YA 3OU0A 1T4VH 2FTLE 1S6FA 3ODFA 1BB0B 3GCTG 5HMAA 1GHBF 3P8NA 3RMOH 1RJXB 1BRBE 2VVCA 1ZOMA 1TPSA 3FAOA 3E8LA 2G00A 1LHCH 3HATH 4HG6A 1DM4B 3M7TA 3F2HA 1FDPA 4NZLA 1HIAB 1LPGB 6CHAC 1Z71A 1XX9A 1MABB 2B0FA 3KEEA 5ABWA 1SB1H 1C1NA 3MYWA 2ZU2A 3HK3B 4FUDA 1K28D 5FL7D 4ZKRU 4KELA 1TNLA 4AN7A 2OC7A 1OP8A 2YMSB 1O5DH 1GDQA 1LDTT 2BVXH 1SI5H 2ZPRA 3PLBA 1J8AA 5JPMH 4MQAA 1C5PA 2G5NA 1MTNB 1K2I1 1P11E 2XCNA 2IN2A 2LNCA 1TBRH 1IQIA 1YBWA 3FVFB 3RU4T 1PJPA 1HAYB 5FBIA 4O3UA 3A88A 3SUDA 1C2IA 3MMGA 1AVXA 4TY7A 2QF5A 2ANYA 5CHAB 1P3CA 3A8AA 3BTME 3E91A 5HYOA 1YCPH 2KAIB 3BTWE 1KXEA 2GCTC 3O8DA 2O9QA 1ZRBA 4Y0YE 2FI3E 2C8WB 3SQHE 1V2QT 1YCPK 2FX6A 4KTCA 4E7RG 5G4BA 1J9CH 5LGOA 2G55A 3M7QA 1BTWA 1ZR0A 4NG9H 3GY2A 2PWXA 2ZQ1A 1G9IE 3D49H 2OC1A 1OWJA 3A81A 2ZHQH 3L3TA 3FOAA 1GHZA 2DE8A 3ZVGA 4LOYH 1Y5AT 3OFND 2UUJB 3TK5A 3TJNA 1O2RA 1F0UA 2IJD1 1DSTA 6GCHG 3MU4A 1BITA 1UCYE 5HIZA 1GVZA 4YM9A 3TIUA 4NZQA 2W5EA 3LC5A 5L30H 3U98H 3RXAA 3S9BA 4X6OA 4ABGA 4D9RA 2ZU4A 1IOEA 2R0KA 2PR3A 3GCNA 4AGJA 2VINA 3UTUH 3DA9B 1PPBH 1D3QB 3GY6A 2EA3A 2GZ7A 1HGTH 5GJ4B 5EG4A 2GGVB 4YO9A 2Q1JA 5GWZA 4D9QA 2ZFFH 4Y79A 1ETTH 1YC0A 2H1UA 2A5IA 2XWBI 4LZ4B 4TPYA 4X8TH 3BIUH 3SW2B 3U1JB 5EODA 1THPB 2PSXA 3NKKA 1D9IA 3N99A 1P09A 2AGEX 1Y5BT 2ZP0H 4KGAA 1EOJA 1Z7KA 4U2WA 2CGAA 9ESTA 3QGNB 3ZZCA 1P57B 1SLXB 4VGCC 3ZZDA 4YLUA 2OC8A 4D7GA 3H5CB 1S6HA 3OEHD 4JZEH 3U8RH 1TGBA 1MBMA 4GSOA 5HIYA 4QT8C 2ZDVH 4NIWA 1O3AA 3PV4A 5EXMA 1MQ5A 2WUCA 1GBTA 1O2HA 3SI3H 2TBSA 2Z9GA 2Y5HA 3M7UA 1ELDE 5F53A 1O37A 3ZIAD 3UQVA 1W8BH 1CVWH 2ZDAH 1GHAF 4AOQA 1TMTH 3RDZA 1C5XB 1SFQB 3LU9B 3CS7A 2NU4E 4ZAEA 5DKMA 1DICA 1GDNA 4IC6A 2BD8A 2M5TA 1O2WA 3LGIA 2ZFTA 3OAAD 1O0DH 1DUEA 4CH2B 1A4WH 1TONA 1W0JD 1W12U 4ZUHA 3UQOA 4X2YA 3LOXA 3SOSA 1HAIH 1JRSA 2ZGJA 1TOCB 3PV2A 3OY6U 1G2MA 3VGCB 4XBDA 2WHXA 1O3MA 4YOGA 3U69H 3RC4A 5C94A 1YPJH 3IITA 1B7XB 1O5EH 1DWCH 2ZPSA 3C1KA 1W14U 1MH0A 2ZHWH 2CF9H 3GICB 3MU8A 3OY5U 1NRNH 2HRVA 1Y3YA 2CHAC 1ZGVA 1A7SA 1UHBB 1P10A 4GHTA 3FFGA 5ETXA 2BDAA 5C1YA 2VIVA 2P8OB 2Z3DA 5LPEA 4WMDA 1AN1E 1ELTA 3E0NB 3RXUA 3RXFA 3ODDA 1C5QA 1G3BA 2ESTE 2BXUH 2BD7A 1UVSH 2J98A 2ALVA 4YZUA 2L6OA 3QZQA 1FAKH 4SGAE 1Z6EA 1ZJKA 1DY9A 2PLXA 1NTPA 1MZAA 4DIHH 2V35A 3QN7A 4RT1A 2H9EH 2OTVA 1PQAA 3SNEA 1FPCH 2ANKH 3RXEA 2IJOB 4B76A 1C9TA 3KN2A 2QGRA 2ZFQH 4JZ1A 2QF4A 3QO6A 2WINI 1SQRA 3ZZ4A 3M3TA 1EZSC 2BLOA 3RM0H 1SGRE 3KQEA 1DX5M 1TA2A 3TU7H 2HGTH 1DWDH 1DWEH 1TBZH 2R3YA 3OEED 3T27A 2BY6X 2VU8E 4NCYA 4IBLH 4K8BA 2FX4A 2JETB 5CE1A 3FKSD 3TJOA 2F9NA 1NU7B 2AHME 3TPIZ 5A8XA 4K1EA 2HNTF 1O2YA 4UEHH 3RXCA 1MTVA 1O5FH 2O8UA 4JYUH 4FUGA 1MZDA 3T62A 2QXHA 2TPIZ 2XC5A 2ZGXH 4DG4A 3MQKC 1FZZA 5GNDA 2SGEE 5TCCA 2XCFA 1P2JA 1SMFE 4YLQH 3K2UA 4TYDA 1JOUB 1MTWA 6LPRA 1QJ1B 1GHBG 1T4UH 3KIDU 1HAVB 1C5SA 1AFEH 1PFXC 4MPUA 4INLA 3SGQE 2WPIS 1BHXF 1AO5A 1AVWA 1HJAB 1K1JA 1P9SA 4U30A 4CBOA 2HVYB 1ZHPA 2ODYB 3UFAA 2F9BH 2TGDA 1FMGA 1C5YB 1V2RT 5A0CA 1BMFD 1ESTA 5AHGH 2UUYA 4ABIA 2V7QD 3TITA 4IN2A 3A87A 4O9VA 3A7YA 1FY1A 5IDKA 4ZKNU 1AE8H 4JYVH 4D7FA 2O8WA 2Z7FE 1N1LA 1ESAA 1GDUA 3MO6A 1DLKB 2BDIA 4ACAA 4JZIA 4OS1A 1N6XA 2YNBA 3U9AH 4FUJA 1TYNA 4GUXA 1O30A 2ZG0H 3Q3YA 3A7ZA 1K1LA 1C5MD 3KGPA 2SFAA 2Z9LA 2SGDE 5E0JA 4B1TA 1UVOA 1SGEE 1C2HA 3SU2A 1QBOA 3RMMH 4AFUA 2AMDA 2AYWA 2BQWB 3O8BA 3V3MA 3F2GA 4ISLA 3M37A 3SNAA 1YF4A 3K65B 2VIPA 4I8HA 3MTYA 4NA9H 2W7SA 1MTUA 4X2VA 1QBNA 4ZXYH 3RP2A 1QY6A 5F8XA 1TGNA 3VB6A 3NCLA 1JIMA 3S7KB 3ZVFA 1A0LA 1SQTA 3KQDA 4E7NA 2ZI2H 3LH3A 3G01A 4IMZA 1C2DA 4RT0A 1F7ZA 1XUJA 3GY4A 3LGUA 1K1IA 1SGYE 5DP6A 1TX8A 1UTKA 2PGQB 1GI8B 5EQSA 4DGJA 1GI6A 3RXPA 2A5KA 2XWAA 5L2YH 3FO8D 1SLVB 4GPGA 4JYTA 2A0QB 1WAYB 1Q3XA 1GCDA 8ESTE 1BCUH 1CGIE 5AFZH 1P01A 1J14A 3DSOA 3WY8A 1C2FA 2BZ6H 1IQHA 3LPRA 3IG6B 3PO1B 4Q7ZA 1GCTB 1DITH 1RIWC 1SL3A 1Y3VA 4O3TA 1HAPH 1XKBC 4RI0A 3SU0A 2QXJA 3RLWH 5DN6D 2CHAB 1YLDA 3B9FH 3CS0A 3U8TH 3AASA 1O3PB 3HGPA 3P6ZB 2OQUA 3MH7A 2BY9X 1BTPA 3VXEH 1JWTA 4LZ1H 2VIDA 2BYAX 5TJXA 3RXSA 9LPRA 3A7WA 1MAXA 4B74A 3BF6H 4X1QU 1AUJA 1H1BA 1YY3A 2ZCLP 2Y5GA 2SGPE 3D23A 1ETRH 1HLTH 2G81E 3P8GA 1C1WH 4YT7H 1EX3A 1ELFA 1GG6C 1QB1A 4HGCA 3T29A 1A5HA 2QN5T 4I8KA 4NA8A 2VIQA 1QIXB 4BAMB 2C8YB 1TABE 1BBRK 1C4Y2 1FPHH 2JDID 1Y3WA 3EGKH 1C2MA 5DO4H 1SGTA 1WUNH 5EGMA 2FIRH 1O31A 1NFYA 4WMEA 3AAUA 3AW1A 1UTNA 1O34A 1Q31A 4O03A 1O3KA 3BSQA 3A86A 1IHTH 1V2ST 4TY6A 1VJAU 1C9PA 4XOJA 3TGIE 3BTFE 3BTDE 3VXFH 1WXRA 3PWBA 1NBMD 3SU1A 1L1GA 2BY8X 3EE0B 3RXDA 2HOBA 2K1QA 1MD8A 1TB6H 1C5NH 3Q77A 5CMXH 1C5ZB 4UFEH 2BDHA 2A4QA 4UFGH 4KKDA 4Y7AA 2R0LA 1LVBA 1PYTC 4RKJB 1A5IA 1TALA 1FIZA 1W0KD 1FY8E 1AIXH 1EASA 3ZVDA 4JMYA 4X1PU 2GT8A 4MNXA 2F9OA 1KTTB 1P3EA 4AYYB 4Y7BA 1TBQH 2LP6A 3SHCH 3URDA 1MKXH 2STAE 3V7TA 1CT2E 4I86A 2XRCA 1LCYA 3T25A 1GBHA 1TQ0B 3ZVBA 3ZZ9A 4O97A 4Q7XA 7ESTE 5EIYA 4CH8B 1DFPA 1MKXK 1TNGA 4GLYA 1SKYE 2ZDNA 5LPRA 4LXBH 2ZTXA 1G37A 4X6MA 2FP7B 1OOKB 3F1SB 4OS7A 2ZHEH 3AVZA 3UWIA 2OXSA 3DCLA 2Z6BD 1KMHB 3MFJA 5HXFA 2WPKS 3PMJA 2BDYA 3RU4D 2FS9A 3VB3A 2GVFA 3NXPA 3OYPA 1C2KA 1GMCG 1MQ6A 4WH8A 1BMLA 5E8EH 3FP6E 4FUFA 1NPMA 1N8OC 4Z1MD 5EW2H 5DP4A 5DP7A 1O2XA 1FY4A 2FS8A 4R0IA 2B9LA 3SJKA 1HV7A 5IYTA 2VGCC 2PTNA 1S0QA 3PMHB 1BDAA 1BMMH 2IPHA 4CRBA 2I6SA 4DOQA 7GCHF 1B0FA 1YPGH 1S6LA 3ELAH 2JH6D 1EB2A 1J15A 5FPSA 1KDQB 2OLGA 5GIBA 2GCHF 2ZGBH 1B0EA 2WV9A 4ZHMU 3MU1A 4B2BA 1YPHC 1GBIA 4CHAB 1Y3XA 1GBLA 1EXFA 2TGTA 2PP6A 1O2TA 1YGCH 3MH6A 1C1UH 1FJSA 1PPZA 1QA0A 1NRPH 3RXHA 3O8CA 3ATKA 5AFYH 2BD3A 1UTOA 2YMSD 1UTJA 2AMQA 3EDXB 1S84A 3GYLB 2GKVE 1F2SE 1O38A 3SV7A 1OP0A 3RXGA 1GBKA 1YLCA 4XFQA 4ZHAA 3VB7A 1CE5A 2WV4A 3M3SA 4E05H 1QRXA 1VZQH 5KECA 1FQ3A 4ABBA 4XSKU 4DW2U 1XMNB 2G4TA 4B6FA 2WYGA 5DGJA 4NFFA 2GD4B 3BIVH 2H9TH 1TWXB 2BMGB 2C4FH 3FN8A 1GJ9B 2BY7X 2O8MA 1UK3A 2AMPA 2OINA 3PLKA 3GDVA 3ENSB 2GZ8A 1GJ8B 1A0JA 3ZZ3A 2Z9KA 4ZXXH 2ZCKP 4JK5A 1SGQE 1RXPA 5I25A 1IQEA 3SN8A 2BDCA 1G36A 1W0YH 2BM2A 1B5GH 3I29A 1CSOE 1ZPBA 2J95A 2BD5A 2FZZA 1QQ4A 2Y7XA 3DSGA 1NRSH 4K1SA 2XC0A 3OTPA 2QA9E 2KFWA 2XYAA 4BTIB 4WWYA 2RFKC 1QB9A 1AB9C 2GV7A 2K8IA 3F68H 5DK1A 1C4U2 1ZPZA 4UFDH 4ACBA 5BRRE 1ELEE 3ATWA 4GHQA 1H8ED 2CMYA 1CGHA 3RM2H 1Z6JH 3ATLA 1JIRA 3BTQE 5AF9H 1ZSLA 2JKHA 1INCA 1LHEH 3DFJA 1YPLH 3BEIB 1QL9A 1P0SH 3HK6B 8GCHF 1TMUH 4P00A 1BTUA 5CDFE 2WSSD 1BT7A 3M36A 2EEKA 1RFNA 4IS5A 3BV9B 1GGDB 4OM9A 1QCPA 4FUEA 4A1TA 2OC0A 2BLVA 2FLRH 5A0BA 1NFWA 5DP9A 1ELAA 1H8IH 3FANA 3M5LA 2EI6A 1AKSA 4BAHB 5FXLA 4CRCA 1YKTA 3SQEE 1CHOF 3AW0A 3RXJA 4Y6DA 1A1RA 1P2NA 2SNWA 4FOUC 1V2TT 4YOIA 1SHHB 1TA6A 4I8JA 3RXRA 4BTUB 1SQAA 4SGBE 3UR6A 5DPAA 3FP7E 3V13A 1PQ8A 1G3CA 1ELGA 1ANBA 2SGFE 2VWNA 3W1EA 1G3DA 2JH0D 1EPTA 3UWJH 2VWLA 3ESTA 1F5KU 1GBMA 2HNTE 2PSYA 3P8OA 2J34A 4B71A 1E38B 1OHHD 2A4OA 1O2PA 4AYVB 2FI4E 1T31A 1ZHMA 4NIYA 3GYMA 2R3UA 3OSYA 1FN8A 1F5LA 3BG4C 2XC4A 4TSFD 1KXDA 1AKSB 2GX4A 5FPYA 1D3TB 1P03A 1TNIA 1V2MT 1HAGE 2BX3A 3D65E 6ESTA 1O3IA 4K60A 4I32A 4BTTB 2J92A 3LJJA 3EA9A 3KYFA 3LGTA 2WZQA 3F0PA 1ZPCA 1C4V2 5EJ1A 3H09A 1KLJH 1EZUC 1OP2A 4DT7B 4CRAA 5E2PA 4GVUA 2O8LA 3A7XA 1O3DA 2EC9H 1MD7A 1UK2A 3S9CA 1D3PB 1GBAA 1FAXA 3ZZ6A 3D62A 1QURH 3U28C 1QBVH 1C1SA 1TAWA 4H6TA 2GDDA 3E3TA 1SPJA 1A2CH 2VIOA 2ZTYA 2PGBB 1J16A 4UD9H 4J1YA 1RGQA 2BHGA 2PW8H 2G8TA 1BTYA 3WWFA 2OBQA 1XXDA 1S82A 1V2VT 1TMBH 1GI2A 2P94A 1GBDA 3E1XB 3RXLA 1AHTH 1C1PA 1VJ9U 1TIOA 1T7CA 4CRDA 4K2YA 1O2MA 2CXVA 2XNIA 2F83A 3P95A 3NWUA 1MTSA 4IGDA 4MG3A 4MVNA 3NUMA 1AI8H 1UTPA 1ZTLA 3RC6A 2FOCA 1ZLRA 4I8LA 3SUFA 2ULLA 6CHAB 5EPNA 1HRTH 1H4WA 4WJG2 2Z9IA 4YTAA 1Y3UA 2ZO3H 1C5UA 5T6DA 2FPZA 1L0ZA 1OYTH 3F3BA 1GHVH 4ZKSU 1TPAE 1O2GH 3MOCA 1WSSH
chains in the Genus database with same CATH topology
2OP9A 1W0ZU 1EAIA 1EQ9A 1HJ8A 3M61U 1EP5A 1NT1A 5C5OA 3ZYEA 3GY8A 4NA7A 1H8DH 4K8YA 1LHGH 1BJUA 3NK8A 4WXIA 2ZWLH 4I33A 4OS4A 2VVVA 1CQQA 2GCTB 1EZQA 4TPIZ 8LPRA 4UDWH 4AB8A 1XUIA 1W7GH 5EPYA 3GDUA 3MHWU 1TGSZ 1IQJA 3TNTA 5C5NA 1C5WB 3BEFB 1TRYA 1RTKA 3GY7A 1HPGA 3ATIA 3F6UH 1TE0A 3A80A 4AG1A 3GY3A 1T8NA 4NFEA 4ESTE 1QQUA 1OWDA 1O32A 3RUOA 4NGAH 2EI7A 3GCOA 7GCHG 1GJ4H 1UJ1A 1TRNA 1CBWC 2A1DB 1MBQA 4UFFH 4AG2A 2GCHG 2VH0A 5C20A 4RKOB 2SGAA 4H42U 1V6DA 1CA0C 1CU1A 1K1OA 2XXLA 4X1NU 1BOQA 2RG3A 3MU5A 3DT0H 1O39A 3HPTB 1IQGA 1TFXA 2VVUA 5A0AE 1JMOH 3EAJA 4M7GA 1RD3B 1P2OA 2I6QA 3GCTF 4MLFB 1ETSH 3A89A 1A3EH 3RLYH 3STIA 1LHFH 2QF3A 1MCVA 1E34B 3JZ2B 5EQQA 1DUAA 3QDZB 4FXGH 4GAWA 4FUCA 4U32A 1BUIA 3Q00A 1RTLA 1TNJA 5DP8A 1P2MA 1PPGE 1BIOA 4ISHH 2A4RA 2NWNA 4FU8A 4VGCB 4Y11E 1C1MA 2Z3EA 1DS2E 1YM0A 1AFQC 4IN1A 2ZPQA 2ANMH 3MNXA 2BXTH 3ZZ5A 2FOFA 3SGBE 3NPSA 1DLEA 1NFUA 1V2OT 2BY5X 2PHBA 1DT2A 3PMBB 1LMWB 3P70B 4WXVA 3ZZBA 4A5TS 1ELCA 1TGTA 1NZQH 1ELVA 2DE9A 1YP9A 4ZHLU 4BANB 2ZU5A 5GXPA 1IQLA 1U6QA 2NU0E 3A8CA 1ZRKA 1HJ9A 1K1PA 2A7JA 1P05A 2BDBA 2P3FH 4TWYA 1GJCB 2Y82A 1MU6B 2BD2A 4U01A 7KMEH 2ODPA 8GCHG 1O3JA 3HKJB 1LKAA 1C5OH 1O5AB 1LVOA 1T8MA 3SJ8A 1G30B 1ID5H 5EQRA 1DPOA 2QXGA 5EXNA 5A09A 4OGXA 2ZQ2A 3ZZ7A 4THNH 4Q80A 2ZFSA 1O2IA 3BG8A 3TLOA 2FOEA 4Y0ZE 2UWPA 4ABFA 1AWFH 2DUCA 1NFXA 1O5GH 1WV7H 3PTBA 1CHGA 2PKSC 1QJ7B 2H5CA 3E6PH 4K5ZA 4AGKA 1P2QA 1CO7E 1VITH 1L4DA 2O8TA 3M5MA 3QK1A 3SHAH 3A8DA 5L2ZH 1L4ZA 3SU3A 1C2LA 2V0BA 3BEUA 3LGVA 1SGPE 1O3GA 1DE7H 3V0XA 1P12E 2FYRA 2ILNA 2B8OH 4XDEA 1O5CB 3FZZA 2R2WU 3A7TA 3MU0A 1NC6A 2ZHFH 1GJ7B 3A84A 3SV6A 2BQ6B 1P04A 1ZMNA 1BBRH 1QB6A 4Y8ZA 2D8WA 4BAKB 1BRUP 1O2JA 1IHSH 2VB0A 2RCEA 5FX6A 4BXSA 2BD9A 2H9HA 1OS8A 2A2XH 1CT4E 1GHAG 5F8TA 2NU1E 1E35B 3O8RA 1ZMLA 4HZHA 2B7DH 1XVOA 1YPKH 1EOLA 4B75A 5HGGA 2D2DA 1RRKA 2XBXA 3TH2H 3T2NA 1ARCA 4MNWA 1SBWA 1W11U 3FP8E 2QV1A 3BTEE 1MCTA 5ESBA 1TLDA 3U1IB 4IW4E 4BOHA 3F9FA 3ITIA 4AB9A 5FAHA 3UOPA 4X1SU 4FUHA 1O2OA 1T8LA 1PQ7A 5DG6A 1GI9B 4X8SH 3ZVEA 1GI3A 2A7HA 5A2MH 2FODA 1UVTH 1WYKA 2F3CE 1GBBA 1NRQH 3LIWA 5EOKA 1EZXC 1VGCC 2GDEH 1F0TA 4MNVA 3TNSA 3GCHC 2PKAA 1GJAB 1ABJH 3TK6A 3UREA 1T32A 1DOJA 5A8ZA 3A82A 2ZF0H 1DDJA 3ZYDA 1YYY1 1Z1IA 2Q6FA 1CBWB 4MPVA 1S0RA 1OWHA 2FOHA 2ZHDA 4X6PA 3SUGA 1GBEA 1XUHA 2AGGX 1BZXE 3FZDA 1M9UA 2PTCE 1NN6A 1GMHF 3BTTE 1ZJDA 4I8GA 1GBCA 2YNAA 1BQYA 1CGJE 5F6MA 4YOJA 4K1TA 5LH8A 1BTZA 1RS0A 1BMAA 3LGYA 2HWLB 3EYDA 4HFPB 3KF2A 4KTSA 1ZMJA 1CA8B 2LPRA 4X8UH 3TJVA 2FOMB 4ABEA 3TH3H 1THSH 4INHA 1HB0B 3VPKA 2ZFRH 1KXBA 1CT0E 3P17H 2BB4A 2WPJS 3MO3A 1L1JA 1QHRB 2W7UA 1V2PT 2H2ZA 3S7HB 4OS6A 2JH5D 1TX7A 1SQOA 3M5NA 3PYHA 3RU4E 3DHKH 1J17T 4WY3A 1EPTC 1O3LA 1XM1A 1HXFH 2XTTB 1S5SA 3HGNA 4J2YB 4KP0A 2HNTC 1JXPA 5HM9A 2D26C 2ODQA 3QGJA 1C1VH 4I31A 5E0HA 3E90B 2XBWA 5T6FA 1EP6A 3T5FH 2IOTA 4WF8A 2G52A 1KLTA 1P2IA 4Y76A 1HDTH 4BAOB 1V2JT 1DVAH 2NU3E 1C2GA 1WOFA 1FUJA 1UTMA 3I77A 1SG8B 3MWIU 1S83A 2VJ1A 4Q2KA 1K1NA 4D8NA 4NSVA 1E36B 5PTPA 1ESBA 3PWCA 3QTOH 1HIAA 1PPCE 1IQKA 1MUEB 1GWAA 3UUZA 4CRFA 1SVPA 2P3TB 1SGCA 1W7XH 4MDSA 4B2AA 1DXWA 2WPHS 1SHYA 1ELBA 2BOKA 2BX4A 3E16B 3RXKA 1GMDF 2Y5FA 3A7VA 1BA8B 3E0PB 5C3NA 1P06A 2AFQB 2C93B 5C1UA 1RIWB 2FXRA 3EA8A 3MH5A 4CREA 3SO3A 4ZMAH 3MI4A 2ZU3A 2PKSB 4WVPE 1K22H 2ZFPH 1GHWH 5J4SA 2G5VA 1C1QA 1S81A 1FNIA 1QJ6B 2ZIQH 3QLPH 2KAIA 2Y6TA 1GJBB 3UNQA 1OPHB 2P8OC 3PROA 1O2VA 2PFEA 3LC3A 4XE4A 4B73A 1KYNA 3L6PA 2OBOA 2C8ZB 1AE5A 2Y7ZA 2VWOA 2G51A 3W95A 3F9GA 3MNCA 5JBAS 1EB1H 3URCA 2FOGA 2ZU1A 3T26A 1TOMH 1EAWA 2QAAA 4H4FA 5FPTA 4CRGA 3UNRA 2Q6DA 1AY6H 5ESTE 1Y5UT 1GG6B 3JZ1B 1MU8B 2TGPZ 5BPEA 1QL8A 3I78A 1T8OA 3PB1E 5J4QA 1FY5A 1YPEH 3PTNA 3STJA 1BBRE 2Z3CA 1C1TA 3M3VA 4FUIA 1W2KH 1LQEA 1Y8TA 1TNHA 3UY9A 3NZIA 5DP3A 3SJ9A 1QTFA 2JETC 5F8ZA 4JZDH 4H6SB 2ZTZA 1BTHH 1V2NT 5T3HA 1V3XA 2D1JA 3RXMA 4ABDA 3SZNA 3BTKE 2FYQA 1OWIA 1EJMA 1O2KA 4X6NA 2A2QH 1TPOA 3RMLH 1OYQA 2CJIA 4X0WU 1MKWH 1GL0E 1GPZA 2J2UA 4CR5A 1C2EA 3TH4H 1A46H 2OCVB 5B6OA 2R2MB 1VGCB 1GI4A 1SGDE 1P02A 3GCHB 1A61H 1MKWK 3SU6A 1PYTD 4HI3A 2W3IA 1XVMA 4KTUA 3P92A 3SGAE 4MTBA 1WBGB 4AZ2B 1W3CA 1AZ8A 2XBVA 2ZGHA 1P8VC 3H7OA 4BNRA 5FHTA 2YOLA 3CENA 2AIQA 1ZZZA 2XW9A 3BN9A 4INKA 5A8YA 3EA7A 3DFLA 1ACBE 1FLEE 1HJAC 1TGCA 2RA0A 2THFB 2Y80A 4X2XA 3T28A 2ZGCA 1O2UA 2A7CA 3U8OH 4YESB 1LPZB 4ISIH 2NU2E 4K3JA 2FO9A 3MH4A 1HFDA 1HAHH 1SLUB 4JCNA 1OWEA 1EUFA 1EATA 2W26A 3SJOA 1KXFA 2ZZUH 4MPWA 1ANDA 1Q2WA 2BZAA 1WTGH 2TGAA 1Z8JB 3TJUA 3UPEA 1C1OA 2UWOA 3ATMA 3SNDA 3SU4A 4LK4A 4A1XA 1GBJA 2F9UA 3DUXH 2SGQE 2FWWA 4ZROA 5FBEA 1BJVA 1IAUA 1EAUA 1FN6A 3MNSA 4GCHF 1EPTB 2ZA5A 2P95A 3KHVA 2A4GA 4R8TB 3EQ0H 4Y10E 3TGKE 1EKBB 2H6MA 1ZYOA 3KCGH 4DJZB 2ZDLA 1VITF 5EXLA 1DSUA 3GISB 1L1NA 1O3EA 4FU7A 1O3FA 2FDAA 4HTCH 1N8OB 1ZSJA 1TX6A 1UHBA 1AVGH 3B8JA 1OX1A 1YPHE 1GVKB 3LDXH 2ZC9H 1K9OE 2AH4X 4AX9H 2VGCB 1KY9A 2WV5A 2CV3A 1KIGH 2STBE 2TIOA 4XBCA 4Q7YA 1A5GH 2BD4A 1N6YA 3PM3A 1O3NA 3PLPA 2J4IA 5JBTA 1QGFA 1BHXB 4YT6H 3K9XB 3LJOA 3VEQB 3OTJE 4DY7B 5C1XA 1L2EA 2GT7A 3PO1C 1GCTC 1UTQA 1ANEA 2QIQA 5GCHF 3GOVB 3OX7U 5FCKA 5JDUB 2UWLA 1GMHG 1WU1A 1SR5C 1BRAA 1V2UT 3KQCA 3R3GB 4ABHA 4F4OC 3ZVCA 1NROH 2GTBA 1O3OA 1O3HA 4RN6A 1O5BB 3SBKA 1TQ7B 3VFEA 3Q76A 2EI8A 4ABAA 1AU8A 3SU5A 3UNSA 2H5DA 3MO9A 1HYLA 3DD2H 2ALPA 2F91A 2AS9A 1SLWB 2HALA 5JB9S 8KME2 5EW1H 2A5AA 3C27B 1F0RA 2OQ5A 3TVJB 2AGIX 3CP7A 3UR9A 1XUKA 1Z8GA 1Z8RA 1C5RA 1UK4A 3ZVAA 1OWKA 1ZGIA 1A0HB 2HPQH 2FOAA 2QY0B 1QRZA 4IMQA 1HAOH 2QCYA 1AB9B 2BLQA 3TGJE 2FESH 1EJNA 2BVSH 1PPFE 1GJDB 1HAVA 3V12A 1S85A 3QTVH 4OS5A 1DWBH 1SGIB 7LPRA 1C1RA 3IWMA 4AFQA 1NM6A 1LVMA 1SSXA 1WTHD 4Y8XA 1KSNA 2OD3B 1GMCF 3SNCA 1FXYA 1TPPA 3BTGE 2ZEBA 4D76A 1GMDG 1KXCA 3SV8A 1E0FD 2Z9JA 2UUKB 1FI8A 1HNEE 2WPMS 2WPLS 1RTFB 5I46H 1V2KT 4ZH8A 3ZV8A 1XXFA 1OSSA 3H7TA 4X8VH 4A1VA 1GI5A 3SI4H 2GP9B 3HKIB 1YCPM 1EJAA 2G4UA 1NU9A 3GDSA 1ORFA 1QA7A 1DY8A 2GV6A 3M35A 1UTLM 1VCWA 1IQMA 2V3HH 3KNXA 2R9PA 4AFSA 2GMTC 1LO6A 4JK6A 1O3CA 4FUBA 1KXAA 1NRRH 3BG4B 4A92A 2Z94A 1ZSKA 1TNKA 2BQ7B 3W94A 2PUXB 5EU8A 1HXEH 1KTSB 1OXGA 2AIPA 1FV9A 1C2JA 4FVDA 2CN0H 1WCZA 5K7RA 4A6LA 4CBNA 2J94A 4FVBA 2VH6A 2RDLA 2QC2A 1XUFA 3N7OA 1ANCA 3B23B 1G3EA 5FX5A 3SNBA 1AD8H 2V6NA 5GDSH 1NO9H 2BTCE 3RC5A 1C5TA 1SGFG 2A45B 4X1RU 5AVDA 1LQDB 1YPMH 4E06H 1WQVH 2P59A 2J9NA 2BDGA 1GJ6A 1GHYH 3VB5A 1C5LH 5H4IB 1WQSA 3RXIA 5L6NH 1F92A 5JYIA 4DVAU 1P2KA 3PMAB 1JBUH 5T6GA 1SC8U 3QZRA 3KL6A 1O2SA 5F03A 1H9LB 3SORA 1W13U 1P9UA 1SOZA 1CHOG 5E0GA 2PUQH 4MPXA 3RXBA 1AUTC 4Z0KA 3SUEA 6GCHF 4AORA 3S9AA 1FIWA 2GZ9A 3RXVA 5GPIB 5DJ7A 4ASHA 1THRH 1NESE 1GI1A 1DXPA 3S0NA 1JRTA 1G32B 4CHAC 1QL7A 1BRCE 1KLIH 1QR3E 2B5TB 2P16A 1GVLA 1Z8IB 4DIIH 2CF8H 2P3UB 2QF0A 3QX5H 1SGNE 3QWCH 5JBBS 4A7IB 1G2LA 1GBFA 1ZTJA 3GY5A 1AQ7A 2AEIH 2QXIA 1O35A 2TRMA 2P93A 2WYJA 1GJ5H 2C8XB 4NIXA 1LTOA 3K6ZA 1GHXH 3F9HA 3LKWA 1O2ZA 1MTNC 4DCDA 3F9EA 3S69A 1EAXA 1SFIA 2ZKSA 2ZCHP 1NS3A 1AWHB 1ZHRA 4UE7H 1VCPA 1D4PB 4AFZA 4UONA 5C2ZA 1HAZB 5CHAC 2AERH 2UUFB 4TWWA 5HM2A 2HPPH 1LVYA 1Y59T 4ZKOU 4MNYA 4GCHG 4FU9A 1O2QA 3P8FA 1C5VA 4WMFA 2ZDMA 3QUMP 3BTHE 1D6WA 1V2WT 1VCQA 4NWLA 3ZZ8A 1IQNA 2FOBA 2QYIA 1VITG 2VIWA 3A83A 4Y71A 2C90B 1ZTKA 3LH1A 1UCYH 1GL1A 2ZDKA 1UVPA 2J38A 1OKXA 2PV9B 2FMJA 1GI0A 1K21H 5SGAE 1Z1JA 1O2NA 1O3BA 3LGWA 1GGDC 1UCYK 2FEQH 3A8BA 3M5OA 3Q3KA 3UIRA 1PQ5A 1UO6A 3RMNH 4BAQB 5C67A 3K6YA 2WUBA 2FTMA 5JB8S 1K1MA 5K0HA 1UVUH 1AZZA 1XKAC 4OS2A 4RSPA 3SV2H 2VNTA 1LKBA 2C3SA 1NY22 1F0SA 1GI7B 1O36A 1O2LA 3R0FA 1CA0B 4OGYA 1MAYA 5GCHG 2BLWA 1QFKH 2OUAA 1HAXB 4I7YH 1FONA 2Y81A 4K69A 1AMHA 4ABJA 3SJIA 1O33A 1TRMA 2FI5E 2BVRH 1SGFA 1ARBA 2HLCA 3ZZAA 1E37B 2F9PA 4BXWA 2RA3A 2A31A 5DP5A 1VR1H 3TK9A 2HVXA 2Q6GA 1D6RA 2A32A 2PKAB 2V3OH 3AAVA 1HCGA 4WH6A 1HUTH 4B2CA 1W10U 2GMTB 4NSYA 2ANWA 1QNJA 3RXOA 1AFQB 3ZV9A 5E2OA 1UMAH 2SNVA 1LHDH 1XUGA