1SGEE

Glu 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgeE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgeE01
1HFDA 2ZPQA 3LJOA 1QHRB 3A85A 3I78A 3ZVCA 4I8GA 1Y3UA 4Y11E 1O39A 4ZUHA 1P05A 3FANA 2ZDNA 2B8OH 3A8AA 1C5QA 5FAHA 4B1TA 1V2RT 2YNAA 1DM4B 1EOJA 3KQBA 1O36A 1FIWA 1ZYOA 3SJ9A 4NFEA 3SQHE 1GI0A 3MTYA 2STBE 2Y80A 3GY5A 2J94A 2BX4A 1ELTA 1O5CB 1ZR0A 2H5CA 4NG9H 4TPYA 3M7TA 1GBTA 4ABFA 1H8IH 1AWHB 4INHA 3UQOA 4MPUA 2R9PA 2DE9A 1VJAU 1O5DH 2ZHDA 4AFQA 4BAQB 4ISOA 4K1TA 1AIXH 3VB4A 1F0UA 1NPMA 4KTSA 1O2JA 3BTTE 3MU5A 1IOEA 4D8NA 1YBWA 5C1YA 1P9UA 4Y10E 2WPMS 1EPTB 1ABJH 2EEKA 1DWEH 5DP4A 1O38A 1BT7A 1W13U 1ETTH 1KXCA 2OBQA 2ZTZA 3STJA 1MU6B 1EOLA 1D4PB 1JIRA 3B8JA 3BN9A 3K2UA 1W10U 3A7XA 1W0YH 2VIPA 1JRTA 1O3PB 4NIWA 1UHBA 1YPLH 6ESTA 1FUJA 1NRRH 1H4WA 1AE5A 1O32A 1EATA 1TGSZ 3U8OH 2QV1A 3RXPA 1F5KU 1C1QA 1PPZA 1QBNA 1ZPCA 3D62A 4AFZA 3KQDA 1EXFA 1INCA 1KTTB 2O8TA 5T6GA 4K3JA 1SLXB 1QJ7B 1NC6A 3P8OA 1M9UA 4OS4A 1GJ8B 1OXGA 1O31A 1RD3B 3LOXA 2VWLA 1OKXA 1XUKA 1EP5A 3EDXB 1PPGE 1A0JA 4JK6A 4JZFH 1SPJA 3BTFE 5E8EH 1ABIH 4X2VA 2ZDKA 1GI8B 5BPEA 3MO3A 2C93B 1FDPA 1TX8A 1TFXA 4K69A 3P92A 2PKAB 5TJXA 1D6RA 5JBAS 2M5TA 3P6ZB 3A8CA 1K1NA 3TJUA 4NZLA 1SGQE 1K28D 1HUTH 3LGIA 2ZFFH 2XXLA 2BVXH 1MCTA 1BTYA 3BTME 1J15A 1GHVH 1J14A 2FOAA 3W95A 1O2KA 1QNJA 1C5PA 1W7GH 2ANMH 3HK6B 2OC7A 1Y5BT 2J2UA 1TYNA 8GCHG 1BQYA 1ZHRA 3SGAE 2A4RA 4R0IA 1DVAH 2A45B 1GBAA 1BMLA 1HRTH 1C2DA 5AFZH 1P04A 1DX5M 3ZZAA 1WTHD 2FI3E 3RXKA 2BD8A 1EQ9A 1V2MT 3GY2A 3BTHE 4MG3A 1G3CA 1EJMA 3CP7A 1LDTT 5ESBA 5C1UA 3GOVB 5HM2A 4X0WU 4YOJA 1NN6A 1K2I1 2GGVB 1MAYA 4MNXA 3A7ZA 1C2EA 5K0HA 1F7ZA 3L33A 3TH2H 2DE8A 3SI3H 9ESTA 1MTVA 2D26C 2NU4E 5FHTA 4A1XA 1GHYH 1VZQH 1A61H 1ZRKA 1A1RA 1AFQB 2BY9X 5F8ZA 1LKAA 1YPHC 1KLTA 1MZDA 3GDUA 1NT1A 1S82A 2R0KA 2Z7FE 4YOGA 4HFPB 3ZVBA 4F4OC 1TGTA 1TNGA 3SGBE 2GKVE 3MU0A 1YPGH 2D1JA 3FAOA 3K6YA 2XRCA 1AWFH 4FUFA 4I8LA 1CQQA 3RXSA 1P8VC 4THNH 1LQDB 1EP6A 1HAHH 1O3BA 3P17H 4ZKSU 4CBNA 3HK3B 4DJZB 3DD2H 2BHGA 1BTUA 3TGJE 4ABGA 3RXQA 3ZZ5A 2PW8H 3A7WA 1O3GA 1SQAA 3IG6B 4K2YA 4XBBA 1GVKB 2F9UA 5GCHG 1O3CA 3SW2B 2J95A 1PJPA 1GHBF 3LGVA 4GHQA 5FCRA 4DCDA 3EA7A 1ZTJA 1FY3A 3RXFA 2ESTE 3A82A 1TMTH 3SV8A 2FODA 2F83A 2ZQ2A 1FN8A 1BJVA 3SZNA 2Y5FA 2ZCLP 4AN7A 1GBFA 1CO7E 2CN0H 4Y8XA 1NTPA 4O3UA 3UNRA 1C5TA 1WOFA 4X6MA 4TYDA 1HB0B 1H9LB 1QR3E 2P8OB 1GDUA 1DY8A 3UWIA 8KME2 1BTWA 2QXIA 2FTLE 1C2IA 1GCDA 5L30H 1C1UH 1JXPA 1YP9A 1Z6EA 2P3FH 4INLA 2BQ7B 1QJ1B 4J2YB 1MTNC 1WAYB 2GCTB 1SI5H 2BZAA 2VVUA 5GIBA 1LHCH 1WBGB 4WMFA 2PUXB 2FI5E 2TPIZ 3KHVA 5CE1A 1ANBA 3DT0H 1QCPA 1NRQH 2CMYA 1NFWA 2Z6BD 4FU8A 3LU9B 2VH6A 3F9EA 1A46H 1EB2A 1D3TB 1ZGIA 1WU1A 4ZAEA 5T6FA 4B2BA 1P3EA 2FEQH 1MBQA 3RC4A 3RM0H 2SGQE 3SNDA 3SV2H 4BXSA 2ZDAH 1OOKB 2NU0E 4SGAE 2ZFRH 1TRYA 1EAWA 1Y8TA 7LPRA 1ANEA 1SGTA 1CBWB 5J4SA 1F92A 4IC6A 2OUAA 4FXGH 3SJOA 1DANH 2FTMA 3EYDA 3PROA 5B6OA 4D9RA 1BBRH 7ESTE 3TK6A 1CA8B 1MQ6A 2VWMA 2PSXA 5EOKA 1UCYH 3SNEA 4ESTE 1DLEA 1XUFA 4ZKNU 2TBSA 4K1EA 5F6MA 2O8WA 3A87A 3C27B 2CF8H 4E05H 3RXRA 3ENSB 1GBLA 2ZHWH 1NZQH 3SJIA 1KDQB 2TGAA 3ZV9A 3P8NA 1QQUA 4IC5A 3HKJB 2ZCKP 1SMFE 1BRCE 4DOQA 1D9IA 1HAVA 1SGFA 1GDQA 1QJ6B 2W7UA 1Z6JH 3H7OA 2OQ5A 3SHAH 3RXAA 2Y81A 1XM1A 3ATLA 1FY8E 5A09A 6LPRA 3PLKA 4AFSA 3FP7E 3E91A 3PMAB 1V2TT 1MTUA 2UUYA 5CHAB 4ABBA 5FCKA 2G81E 2JH0D 3UWJH 3F9FA 1GI6A 1XXDA 1HAYB 1CHOF 1K1PA 3GY7A 2BD7A 3LGUA 5HMAA 2ZU5A 2QA9E 3O8CA 3M5NA 2GT7A 3A88A 2XYAA 2D8WA 3QZQA 2AERH 3E0NB 3SHCH 2QN5T 1RTLA 4BOHA 1ZLRA 5L6NH 3JZ2B 2BZ6H 1C5VA 1BBRK 1CA0B 1WUNH 4OS1A 1D6WA 2IN2A 3GY6A 2ZIQH 2F9VA 2GDDA 1TBZH 4JYVH 4AORA 1FMGA 4OS7A 4A1TA 3PO1B 2BX3A 3RXOA 2XBVA 1O2SA 2R0LA 5TCAA 4JZ1A 2R2MB 2A5IA 3OU0A 3PB1E 1TLDA 1B7XB 2WV4A 2CHAC 1TIOA 2KAIA 4ISHH 2VIVA 4B73A 4FU7A 4I33A 3MHWU 1CHGA 3IWMA 5HGGA 4OGYA 2P8OC 4F49A 1BMNH 3E16B 1T8OA 1GJ6A 1C1VH 2VU8E 4CRDA 1QGFA 1P2JA 2ZPSA 3T26A 2F9BH 2K1QA 5A2MH 2FPZA 2FMJA 2WUCA 1EJAA 1D3QB 2WINI 1GHZA 3ITIA 1F2SE 3D49H 3S0NA 1AHTH 2GCTC 1GJCB 2CF9H 2PUQH 1YLCA 4Z0KA 3STIA 3K6ZA 1QBOA 2ZPRA 2BD9A 1YPHE 4IBLH 1HJ9A 4KKDA 3ZV8A 2FLRH 5LGOA 1C1PA 2FOCA 3MI4A 4WF8A 2ZU2A 3ATKA 1RXPA 3O8BA 3LONA 3KEEA 4MPVA 4WJG2 1IQHA 1E38B 4B2CA 3TU7H 1QB6A 1C4V2 5GXPA 1NESE 1Z1JA 2PHBA 3SU6A 1RFNA 1ZTKA 1C5OH 1CBWC 1O3AA 2P93A 1C2MA 1TX7A 4IMQA 1S83A 1SB1H 1MD7A 3HGNA 1O35A 3BTGE 5C5OA 1G2LA 3U1IB 2FOGA 1DOJA 2IPHA 2OD3B 1K1JA 4GCHF 2EC9H 4MPWA 1YPMH 4A6LA 3SV6A 5K7RA 2GCHG 4NIXA 1SGDE 5EGMA 4Y79A 4MDSA 1JWTA 3ZZ9A 2STAE 2B0FA 1DUEA 2FX6A 1C1WH 3EA9A 2BLWA 2Y7XA 4H4FA 5FPSA 1O33A 3SOSA 2VIOA 1BHXB 3ZZ4A 1E34B 1SGNE 4X1QU 1AGJA 1GBDA 1DUAA 3MH7A 1YPEH 2QF0A 1NFYA 1G37A 2Z9GA 2P94A 2A4OA 1YPKH 2ZHEH 4LXBH 4NA8A 5JBBS 2QXJA 2OBOA 4RSPA 1K22H 5EXNA 3PMHB 1O2RA 4E7RG 1CSOE 1GMDG 4ISIH 2C8XB 1EZUC 1HAIH 2GZ8A 3F1SB 4B71A 1H1BA 2RA3A 4AB8A 4TPIZ 1ELGA 5CHAC 1VITG 3U1JB 3WY8A 1ZHPA 3T27A 3BEUA 5I25A 2BY5X 1WTGH 3LH3A 3SV9A 1O5FH 1G9IE 2AGEX 2RCEA 3KNXA 3LC5A 2GMTB 3SJKA 3TPIZ 1GMCG 1XVMA 1EZQA 1KIGH 2FOFA 2BD5A 2P3TB 1IQFA 3M36A 1TNIA 1C1TA 3M37A 5L2YH 1GBJA 1ZSKA 2PFEA 5I46H 1V2JT 4BAKB 1UVUH 2I6SA 4HI3A 5FXLA 4Y6DA 5FBIA 1PPEE 1WSSH 1LHFH 4RN6A 1O3IA 1CA0C 2A31A 1ESBA 5C2ZA 1TNHA 4MVNA 3SJ8A 3FVFB 2WPIS 1GBIA 3P70B 1N8OB 2ZU4A 2BVSH 1CT0E 3F9GA 2HPPH 3PO1C 1E37B 2SGEE 3M7UA 1DWBH 2EI6A 3GY8A 9LPRA 3A84A 4AZ2B 1UO6A 2BY6X 3RXJA 1BJUA 4JZEH 3ELAH 4I32A 4WMDA 3UPEA 3ATIA 1UK2A 1QL8A 2XTTB 2JH6D 1GI2A 4D9QA 3GCTF 3TNTA 5JBCS 2H1UA 1P11E 5JBTA 2PSYA 1TNKA 1FPCH 1YCPM 1DY9A 1EJNA 3V13A 3K9XB 1QL7A 1Z7KA 3NXPA 1GMHG 7GCHG 1LVOA 3VXFH 5GJ4B 5GWZA 2V6NA 2XNIA 4XFQA 2WPLS 2ZGXH 6GCHF 1KY9A 3RXHA 1KYNA 2ZA5A 2V3HH 3GY3A 3TVJB 4BAHB 3DFJA 5J4QA 2Z9IA 4DY7B 5FPTA 2PV9B 3TITA 2ZTXA 2ZGHA 1UTMA 1AKSB 1FPHH 1S5SA 3NZIA 3RMMH 1LVYA 3BTEE 1BRBE 3M5MA 1MTSA 3RLYH 3EGKH 1G3EA 2HNTF 3BIUH 1UK4A 4YESB 1O2XA 2ZO3H 4GUXA 1IQJA 2QXGA 4TWYA 1T4UH 1MTNB 2W5EA 4JMYA 1XUIA 1TOCB 4BAMB 4AGJA 1OP0A 2SGFE 2FO9A 3NKKA 3SQEE 1ZMNA 4CRFA 1HIAB 2XW9A 1SL3A 3VGCB 1MKWH 1O3JA 1ZTLA 1KLJH 1V6DA 1C5LH 5E2PA 1DWDH 1PQ7A 1OP8A 1ELCA 3I77A 3A7VA 1NRNH 4AG2A 1GBBA 2FDAA 3UQVA 1BZXE 4Q7ZA 2YOLA 4WH8A 4Y7AA 3VB5A 1K1OA 2TIOA 1Z8JB 1QA7A 1AD8H 3QGNB 4ZHMU 1RTKA 1OWDA 3PLBA 2G4TA 4UEHH 3F68H 4MLFB 1MCVA 1GBEA 1GBKA 3KF2A 1ARCA 1IQEA 2ZFPH 2ZGBH 2RG3A 3FP6E 2BD3A 4NGAH 2WPKS 2TGDA 1BOQA 2AMQA 4ABJA 5GPIB 2ZECA 1O3EA 4Z6AH 2G5VA 4BTTB 2GMTC 3T28A 1RIWB 3ZVGA 1QA0A 1SLUB 2A2QH 5EQRA 4ISLA 4B2AA 4X8TH 1QL9A 4K60A 3E8LA 1KDQA 2FOEA 1C1MA 1G32B 1DXPA 1P9SA 2BVRH 2Y6TA 1LHGH 1Z8IB 2H9EH 1NRPH 1C2FA 3MWIU 2H9TH 1V2OT 5BRRE 1P02A 3O8DA 1T8MA 4TWWA 1FY5A 2WUBA 1S84A 8LPRA 1FJSA 3MNCA 4RKJB 1HNEE 1SHYA 3V12A 1N8OC 1DDJA 2ODYB 2OLGA 4KTUA 1THPB 3A86A 1MKWK 4LOYH 3PWBA 4I7YH 5T6DA 1TABE 3UR9A 4YT7H 2ZU3A 1SGRE 3GCHB 5T3HA 1GWAA 2ALPA 1K9OE 2BYAX 2OP9A 3TNSA 3UNSA 1BTHH 4ZKOU 4JYTA 5DP8A 1DFPA 3OTJE 3E3TA 2BD2A 4X2YA 1MD8A 4A7IB 4CR9A 2BDIA 1C5NH 4XOJA 3P95A 1PYTC 3AAVA 3RXIA 1OYQA 3E6PH 2FIRH 1C5ZB 1FAKH 5DP5A 2XC0A 1FXYA 1Z71A 2QCYA 4X8SH 1K21H 3BTKE 1X7AC 3QTOH 3SUDA 4ZXXH 1DSUA 1F0SA 5HM9A 1L1GA 1D3DB 4XE4A 1Y3XA 1TRNA 5C20A 3PWCA 1P2IA 2CHAB 1C5RA 4IS5A 2ZFSA 1C2LA 1XMNB 2BDGA 3ZZCA 1ESTA 2WYJA 2ANWA 4NFFA 4B76A 4BAOB 1ID5H 4FUCA 3SBKA 2GP9B 2OQUA 5DO4H 3MMGA 3RXVA 4FU9A 1WQSA 2Q6GA 3MNBA 1XUJA 1QB9A 3R0FA 2NU1E 2F91A 3RU4E 2PWXA 2HWLB 1T8LA 2ASUB 1MKXK 2GT8A 1O2VA 4FUEA 2Z9LA 3SU1A 1PPHE 4Y0ZE 2ZZUH 3ODFA 2A32A 2J34A 2XWBI 2OTVA 4M7GA 1VCPA 3O8RA 1V2PT 3HATH 1EKBB 3DFLA 1GHAF 1HAPH 3VGCC 4JK5A 2CGAA 3M3VA 4HGCA 1AMHA 4FVBA 5PTPA 1WV7H 1CU1A 1NO9H 2C8WB 4DVAU 1AI8H 1EAIA 3B9FH 1HV7A 2FLBH 1P0SH 5A0AE 3P8FA 1L1NA 1O3DA 4O3TA 3MU8A 2VIWA 4DURA 1AVXA 3SORA 1BUIA 1GCTB 3AW1A 1VR1H 4O03A 1SGPE 4XBCA 1MMJN 1GHBG 4MPXA 4K8BA 3RLWH 4A5TS 4YLUA 2VWOA 1G36A 4BNRA 1DE7H 1IAUA 4Q2KA 1LHEH 4DGJA 1O3MA 1O2PA 3M35A 1A7SA 1UVPA 1RIWC 2SNVA 1SR5C 1GI9B 3A8BA 1TGBA 4ISNA 3VEQB 2AMPA 1NROH 3S9BA 3ZVFA 1O2UA 2BDHA 1P2NA 5DG6A 5EXLA 1HAGE 1IQLA 1V2VT 1G30B 2SGAA 3RXEA 1F0TA 1L2EA 1YGCH 1C5UA 5DP6A 5FBEA 3PV4A 3UR6A 3VFEA 4DIIH 2HNTC 1P3CA 1TA6A 5GDSH 3TLOA 4D76A 5CMXH 3BG4B 1BITA 5EXMA 2UUKB 2BY8X 3A81A 5EQQA 3F6UH 4Y7BA 3LPRA 1TQ0B 2BDAA 5AHGH 2OCVB 3GCHC 4H6SB 4ZHLU 1YPJH 1YKTA 4CRGA 1BCUH 2VJ1A 4GHTA 3KQCA 5FPYA 4K8YA 5L2ZH 1P06A 1QRWA 2GDEH 1OWJA 2XC4A 1O2QA 1RGQA 1YYY1 3ATWA 1FY4A 4AX9H 3T25A 1GVZA 1C1RA 1JOUB 1JRSA 3CS0A 1O2HA 1Y3VA 3S7KB 2C8YB 3TGKE 1LPZB 2WYGA 2B9LA 4I8JA 3MU1A 1C9PA 1P57B 4UE7H 2CXVA 4J1YA 1GI1A 2H6MA 3RMLH 1DS2E 1OYTH 1YC0A 2VINA 1S6HA 1SGCA 3LIWA 1KSNA 3ZZ6A 4I8HA 2YNBA 3G01A 1MAXA 3ESTA 3Q00A 2J92A 2ZWLH 1V3XA 1O3FA 2ANKH 2BXUH 1TAWA 3Q76A 3PLPA 3FZZA 4X6OA 3A80A 2FWWA 1NFXA 1YCPK 1A3BH 1O37A 1TWXB 3SO3A 3LKWA 2PKSB 1PQ5A 1DT2A 2SFAA 1OWKA 1UVTH 1UMAH 3H5CB 1EAUA 1CT2E 4FUJA 3TK9A 1QFKH 5A8ZA 3A89A 5IDKA 3AVZA 1GI7B 2PR3A 1MU8B 3GYLB 2G55A 1D3PB 4ABEA 4D7GA 1BRAA 2PTCE 4X8UH 3MH6A 1UTNA 3UFAA 1Z1IA 4O97A 3MFJA 1EPTA 1K1LA 2BB4A 4A1VA 2F9OA 2GX4A 4IN1A 2QIQA 2A4QA 1CHOG 3LJJA 1QBVH 3E90B 1IHTH 5A8YA 1A2CH 4UDWH 2R3YA 1C5WB 2ZF0H 2ZQ1A 3RU4T 6CHAC 1ELBA 2BMGB 5EODA 1O3NA 1L1JA 1O2WA 2H5DA 4CRCA 3CS7A 1T32A 1O2OA 1FY1A 1H9HE 4NCYA 4JCNA 1IQNA 2V35A 1ZOMA 2C3SA 1O5BB 1P10A 2XCFA 4CH2B 3D23A 4E7NA 2FS8A 1GCTC 3TGIE 5SGAE 4FUDA 1T4VH 1ETSH 4YZUA 2FM2A 1O2TA 4NIYA 3M7QA 3RC5A 2FP7B 1GBCA 3SU2A 4NIVA 5TCCA 3GDVA 1C1OA 1BDAA 1GI5A 1KXAA 1P2QA 4Y76A 1N6YA 4ABIA 2GV6A 2PKAA 1C5SA 2RDLA 4CRBA 3SNAA 3QO6A 1C2JA 3LC3A 3U8RH 1AZZA 1FLEE 1DSTA 2FOHA 2P95A 1EZSC 1GJ7B 1HXEH 1CGJE 1ZJDA 3LH1A 5C67A 5E0GA 2C8ZB 2F3CE 4UD9H 3OX7U 3QWCH 1TBRH 1EAXA 2XWAA 3HGPA 2HALA 4YM9A 1RRKA 1A5IA 4TY7A 3BG4C 2Y5GA 2ALVA 1SLWB 4GLYA 1LCYA 1B0FA 4A92A 4B74A 3T5FH 3BTWE 1HAVB 2UUFB 1GGDB 3UUZA 1OSSA 2Z94A 4INKA 2Y5HA 1TGCA 3VB7A 1SFIA 2BXTH 1O34A 1FI8A 1HXFH 2Z9JA 3NPSA 4MTBA 3QTVH 2AFQB 5FX5A 1AVGH 1ANCA 1NRSH 1A0HB 2O8UA 1W14U 4IW4E 3RUOA 2Z3EA 1IQGA 1P2KA 1J8AA 1TGNA 1LO6A 1ELAA 2HOBA 1G2MA 3LGYA 1BTZA 2ZNKH 3EE0B 3F9HA 4X1PU 3T2NA 2SGDE 3OY5U 1O2MA 3S9CA 1N1LA 2TRMA 1A4WH 1LTOA 1O5AB 2Y82A 3M5OA 2ODQA 4WH6A 5JYIA 1FAXA 1ZPBA 1OWEA 2O8MA 1CT4E 4WXVA 1OWIA 3T62A 1Y5AT 5DP7A 1GPZA 1FQ3A 2CJIA 4KTCA 1TALA 4XDEA 1HYLA 3RXUA 4GCHG 1VITH 1AUJA 1KXEA 5EU8A 2IJOB 1WQVH 2AGGX 4I31A 2ZC9H 1S6FA 4K1SA 1FN6A 2W3IA 4BXWA 1EASA 1O2ZA 1W11U 2PGQB 3UTUH 2PKSC 3A7TA 4RKOB 2EA3A 2JETB 1BB0B 3RXLA 3Q3XA 1ZZZA 2GTBA 5G4BA 1L4DA 1RJXB 1DXWA 3U69H 3HPTB 3RMOH 4AB9A 1GJBB 2XBYA 2H9HA 2KAIB 1LMWB 1GL1A 2HNTE 3GISB 5HXFA 4YTAA 4U32A 1SLVB 3RXCA 2AIPA 1KXBA 3GICB 1PPFE 1NY22 1BA8B 3SNCA 4XSKU 3LGWA 4MNVA 1PQAA 1BIOA 3RP2A 4XBDA 2FX4A 3SU5A 1BRUP 4CR5A 1PFXC 1V2ST 4KELA 4NSVA 5JB8S 1A3EH 4X1NU 2FOBA 1C4U2 8GCHF 1Q3XA 3MU4A 4WY3A 1AU8A 1C5YB 2C4FH 2BOKA 1G3DA 1G3BA 1C5MD 1Z8GA 4BTIB 2IOTA 1Q31A 1SGYE 2FI4E 2ZGCA 1A5GH 3OY6U 2BM2A 4FUIA 2Q6DA 3DUXH 3UREA 2RA0A 2C90B 2BD4A 4OS5A 4ZMAH 1O5EH 3FZDA 3BV9B 3KL6A 3E1XB 2AH4X 4JZDH 2AYWA 1ARBA 1GI3A 1PPCE 3SNBA 3SI4H 2UWLA 2FYRA 1O2YA 1SFQB 5DP9A 4ABHA 4GSOA 1HJAC 1TB6H 1BTXA 5E0JA 3RC6A 3M3SA 2BQWB 4TY6A 2QF3A 4WXIA 3GCTG 3MYWA 1IQMA 1AUTC 2PTNA 1ZGVA 1QTFA 1W0ZU 1XUHA 2A7JA 1K1MA 2SGPE 3PTBA 1DICA 2F9NA 3ZZ7A 2G8TA 2BLOA 1A5HA 5IYTA 3VB3A 1BMAA 1TPSA 2QXHA 2O8LA 3OSYA 3PTNA 4LK4A 1TPPA 3U8TH 3TJOA 2UWPA 5DK1A 1HDTH 4X6NA 2G00A 1Y59T 4K5ZA 1TBQH 3TJNA 5EQSA 6GCHG 2WPHS 5F8TA 1C1SA 2VGCB 3QUMP 4UFFH 1GGDC 1ELFA 3K65B 1DWCH 2OC8A 1V2NT 4Y71A 1KTSB 2Q1JA 1HGTH 5GCHF 2VNTA 4KP0A 3VB6A 4Y0YE 2ZFQH 4R8TB 1Q2WA 1BBRE 2FS9A 2A0QB 1LPKB 3M3TA 3ZVEA 2TGTA 4FVDA 1V2LT 1TMUH 3M5LA 1GI4A 1QRZA 1UCYE 1S81A 4LZ1H 2P16A 1ZJKA 2GD4B 4MQAA 3RXBA 1GL0E 1P03A 1XX9A 1Z8RA 2A5KA 2BOHB 1ACBE 2HPQH 1WYKA 1TPAE 5JB9S 1ZMLA 3FP8E 2HGTH 1O3HA 1N6XA 1HCGA 1MKXH 4UFGH 1A0LA 3TIUA 2B5TB 1AO5A 4VGCB 2J9NA 5C5NA 3TH4H 3QLPH 4X6PA 3BG8A 1P2OA 3D65E 3ZYDA 4H42U 2A5AA 2G51A 1IQIA 4O9VA 4GAWA 3SV7A 5DP3A 1CVWH 1TNLA 2R2WU 4NZQA 2V3OH 1HPGA 2OC0A 1Y5UT 2OC1A 3QK1A 3V0XA 1T7CA 2VB0A 1MTWA 2F9PA 2JETC 2XC5A 3PMJA 1TRMA 4HZHA 1YF4A 4CH8B 1THSH 2XBWA 1S85A 2VIDA 2AIQA 4ZHAA 4U01A 4NA7A 1F0RA 1W12U 4IN2A 3RMNH 1QQ4A 3MNSA 4MNWA 1SG8B 4SGBE 1P01A 5EW2H 3ATMA 2G4UA 1LVBA 1CGHA 3I29A 5ESTE 1E35B 3ODDA 3KN2A 1S0RA 1O2NA 3FFGA 3RXGA 4BTUB 1EUFA 4AG1A 4ZROA 4U2WA 1O3KA 3QGJA 4NSYA 2P3UB 2AMDA 3DHKH 5EPYA 3RXMA 3TJVA 2A7HA 2EI7A 1GJ9B 3BF6H 1Y3YA 1SGIB 2W7SA 1GJ4H 3PMBB 5A8XA 1OWHA 1OP2A 1VCQA 3UNQA 3TH3H 5LH8A 1TPOA 4CRAA 1EPTC 3U9AH 2A7CA 1F5RA 1XUGA 4UFDH 4ZXYH 3GDSA 1SQOA 2Z3DA 3MO9A 5DGJA 1GG6B 5JPMH 2ILNA 3QN7A 1TOMH 3U98H 4B75A 1ELVA 2A1DB 3Q3KA 1UHBB 4YT6H 2BLQA 3RDZA 5C1XA 4OGXA 2SNWA 1UVSH 5DPAA 1O2GH 3P8GA 1MZAA 1NU9A 4WMEA 2AGIX 3ZZBA 1C2HA 1ZHMA 5LPEA 3MOCA 1AB9B 3NCLA 4Y8ZA 4LZ4B 3OYPA 1UTJA 1ZRBA 1ELDE 1W3CA 2GV7A 1AFEH 5E0HA 3EQ0H 3RXTA 5F8XA 3NUMA 1LVMA 3BIVH 5EG4A 5FX6A 5DJ7A 6CHAB 2ZDLA 1QRXA 2OXSA 4GPGA 1TMBH 4DG4A 1XVOA 4NWKA 1VCWA 3KCGH 2BQ6B 3SUEA 2Z9KA 3LDXH 3Q77A 3W94A 2HLCA 2Z3CA 2ZI2H 1GVLA 2QC2A 1P2MA 2Q6FA 5EPNA 4WWYA 3DA9B 3KIDU 3PM3A 1TX6A 3GCOA 1AZ8A 1NS3A 2VGCC 1LQEA 4ABDA 1P12E 2QY0B 4ZKRU 3S7HB 1GBHA 4MNYA 3RXDA 1UTKA 5E2OA 2ZEBA 3BTQE 1CE5A 3MNXA 2B7DH 1XXFA 3S69A 3ZZDA 2ZKSA 2NU2E 5H4IB 1V2QT 4DIHH 1OPHB 3V3MA 2ZP0H 3ZVDA 3A8DA 3MH5A 4AFUA 1O30A 4HTCH 1UTLM 4FUBA 1YCPH 1F5LA 3BTDE 1E36B 3SUFA 4AYYB 3T29A 2JKHA 5C3NA 4U30A 1SVPA 3SU4A 3BEFB 4DT7B 1C9TA 2VH0A 4FUGA 1B0EA 3H7TA 3RU4D 2NWNA 4CBOA 1SQTA 4X8VH 2FXRA 2JH5D 3L3TA 1C4Y2 1GDNA 2GVFA 4AGKA 1O3OA 2VWNA 4D7FA 2LNCA 4VGCC 1DLKB 2ZDMA 3A83A 3SGQE 1Y3WA 1HLTH 4IMZA 1GHAG 1B5GH 1JBUH 1VGCB 5AFYH 3JZ1B 1T31A 1H8DH 1CGIE 3GCNA 5A0BA 4GVUA 1O5GH 1NFUA 1W2KH 1PPBH 1H9IE 1FNIA 1V2KT 1AFQC 1RTFB 4ZH8A 1SOTA 1J16A 1GHWH 2EI8A 3CENA 3SU3A 1ZSJA 3A7YA 2P59A 3URDA 3BSQA 2ZDVH 2ZU1A 1NM6A 3KQEA 4WVPE 4ABAA 4FUHA 1GBMA 1P09A 2BDCA 3ZYEA 1L4ZA 2QYIA 3L6PA 1QURH 4CHAB 1O2IA 3AASA 2ZCHP 2FOMB 2ULLA 2LPRA 1RS0A 4X2XA 2WPJS 7KMEH 4BANB 3PYHA 1MH0A 3NWUA 1ESAA 1SBWA 1AN1E 1VJ9U 2TGPZ 2PLXA 1LPGB 3GY4A 4JZIA 4UFEH 1UCYK 2ZHFH 4OS2A 1UTOA 1QIXB 1UJ1A 1L0ZA 2DUCA 1QB1A 2GCHF 1GJ5H 3LGTA 1GG6C 3M61U 1ORFA 2ODPA 2W26A 2J4IA 2AS9A 1SOZA 3UOUA 1LKBA 1GHXH 2THFB 1TA2A 4X1SU 1LHDH 4IGDA 1BHXF 1AVWA 1FZZA 1FONA 3LT3A 2H2ZA 4AOQA 2G5NA 2ZFTA 1AB9C 3UIRA 2ANYA 1T8NA 2QGRA 3SU0A 3EAJA 4Q80A 1KXFA 1BMMH 2BY7X 1IQKA 4CREA 1HAOH 1DPOA 1HAZB 1U6QA 2Y7ZA 3MH4A 5EW1H 4YOIA 2J38A 1GMDF 1HJ8A 1OX1A 2VVVA 1AKSA 1FIZA 4JYUH 3KGPA 1TQ7B 1EX3A 1VITF 2FESH 2ZGJA 1SSXA 4NWLA 1V2UT 1GJAB 4YLQH 1JIMA 3R3GB 3HKIB 2QAAA 2A4GA 1GMCF 3E0PB 1W7XH 1TE0A 4H6TA 3ZZ3A 2W3KA 3EA8A 4PROA 5LPFA 1THRH 1SHHB 3C1KA 1MUEB 2PGBB 1MQ5A 5ETXA 4ASHA 1E0FD 2HRVA 1XKAC 4NA9H 5ABWA 1HIAA 1HJAB 1GJDB 4UONA 2A2XH 1O3LA 4Q7YA 3VXEH 4OS6A 1J9CH 2ZG0H 1J17T 5HYOA 1O0DH 1C2GA 3UY9A 2BLVA 3URCA 2BDYA 4DW2U 1NU7B 4X2WA 1MBMA 5LPRA 1C1NA 3UOPA 1YM0A 4X1RU 2OINA 1TNJA 1SC8U 3B23B 3Q3YA 4Y8YA 1KXDA 1FV9A 3S9AA 1UK3A 2BTCE 3IITA 5DKMA 1BTPA 2AEIH 3MO6A 1HAXB 2O9QA 8ESTE 1PQ8A 5JDUB 1ELEE 2XCNA 3SUGA 2R3UA 1SGFG 2WV5A 1DITH 1TONA 2CV3A 4YO9A 1KLIH 2I6QA 1C5XB 3QZRA 5A0CA 1GMHF 1VGCC 3AAUA 3VPKA 7GCHF 1AQ7A 2BDBA 3ZVAA 4QT8C 1EB1H 2HVXA 1UVOA 1ANDA 3ZZ8A 3AW0A 5F03A 3NK8A 2ZHQH 3BEIB 3GYMA 1YLDA 4AYVB 1JMOH 2FYQA 1IHSH 1S0QA 2VVCA 2XBXA 5AVDA 2ZTYA 3TK5A 1WCZA 2V0BA 3N7OA 2NU3E 1OS8A 2VIQA 2UUJB 3RM2H 3SN8A 1ZSLA 1C2KA 1ZMJA 5AF9H 1ZPZA 1QY6A 4CHAC 1O2LA 1W8BH 1ETRH 1HBTH 1AY6H 1SGEE 1V2WT 3QX5H 1PYTD 1XKBC 4Q7XA 2UWOA 2FZZA 4E06H 3QDZB 2GZ9A 1UTPA 2G52A 1AE8H 2GZ7A 1EZXC 2D2DA 4KGAA 1UTQA 1K1IA 3V7TA 4I8KA
chains in the Genus database with same CATH superfamily
1HFDA 2ZPQA 3LJOA 1QHRB 3A85A 3I78A 3ZVCA 4I8GA 1Y3UA 4Y11E 1O39A 4ZUHA 1P05A 3FANA 2ZDNA 2B8OH 3A8AA 3UAIC 1C5QA 5FAHA 2QE7D 4B1TA 1V2RT 2YNAA 1DM4B 1EOJA 3KQBA 4ZCNA 1O36A 1FIWA 1ZYOA 3SJ9A 4NFEA 3SQHE 1GI0A 3MTYA 5EJLA 2STBE 2Y80A 3GY5A 2J94A 2BX4A 1ELTA 1O5CB 1ZR0A 2H5CA 4NG9H 4TPYA 3M7TA 1GBTA 4ABFA 1H8IH 1AWHB 4INHA 3UQOA 4MPUA 3H09A 2R9PA 2DE9A 1VJAU 1O5DH 2ZHDA 4AFQA 4BAQB 4ISOA 4K1TA 1AIXH 3VB4A 1F0UA 1NPMA 4KTSA 1O2JA 3BTTE 3MU5A 1IOEA 4D8NA 1YBWA 5C1YA 1P9UA 4Y10E 2WPMS 1EPTB 1ABJH 2EEKA 1DWEH 5DP4A 1O38A 1BT7A 1W13U 1ETTH 1KXCA 2OBQA 2ZTZA 4B6FA 3STJA 1MU6B 1EOLA 1D4PB 1JIRA 3B8JA 3BN9A 3K2UA 1W10U 3A7XA 1W0YH 2VIPA 1JRTA 1E79D 1O3PB 4NIWA 1UHBA 1YPLH 3PRBA 6ESTA 1FUJA 1NRRH 1H4WA 1AE5A 1O32A 1EATA 1TGSZ 3U8OH 2QV1A 3RXPA 1F5KU 1C1QA 1PPZA 1QBNA 1ZPCA 3D62A 4AFZA 3KQDA 1EXFA 1INCA 1KTTB 2O8TA 5T6GA 4K3JA 1SLXB 1QJ7B 1NC6A 3P8OA 1M9UA 4OS4A 1GJ8B 1OXGA 1O31A 1RD3B 3LOXA 1COWD 2VWLA 1OKXA 1XUKA 2WSSD 1EP5A 3EDXB 1PPGE 1A0JA 4JK6A 4JZFH 1SPJA 3BTFE 5E8EH 1ABIH 4X2VA 2ZDKA 1GI8B 5BPEA 3MO3A 2C93B 1FDPA 1TX8A 1TFXA 4K69A 3P92A 2PKAB 2J97A 5TJXA 1D6RA 5JBAS 2M5TA 3P6ZB 3A8CA 1K1NA 3TJUA 4ASUD 4NZLA 1SGQE 3DSPA 1K28D 1HUTH 3MQKC 3LGIA 2ZFFH 2XXLA 2BVXH 1MCTA 1VKYA 1BTYA 3BTME 3DCLA 5HIYA 1J15A 1GHVH 1J14A 2FOAA 3W95A 1O2KA 1QNJA 1C5PA 1W7GH 2ANMH 3HK6B 2OC7A 1Y5BT 2J2UA 1TYNA 8GCHG 1BQYA 1ZHRA 3SGAE 2A4RA 4R0IA 1DVAH 2A45B 1GBAA 1BMLA 1HRTH 1C2DA 4FETA 5AFZH 1P04A 1DX5M 3ZZAA 1WTHD 2FI3E 3RXKA 2BD8A 1EQ9A 1V2MT 3GY2A 3BTHE 4MG3A 1G3CA 1EJMA 3CP7A 1LDTT 5ESBA 5C1UA 3GOVB 5HM2A 4X0WU 4YOJA 1NN6A 2L74A 1K2I1 2GGVB 1MAYA 4MNXA 3A7ZA 1C2EA 5K0HA 1F7ZA 3L33A 3TH2H 2DE8A 3SI3H 9ESTA 2F4LA 1MTVA 2D26C 2NU4E 4FOUC 5FHTA 4A1XA 1GHYH 1VZQH 1A61H 1ZRKA 1A1RA 1AFQB 2BY9X 3FO8D 5F8ZA 1LKAA 1YPHC 1KLTA 1MZDA 3GDUA 1NT1A 1S82A 2R0KA 2Z7FE 4YOGA 4HFPB 3ZVBA 4F4OC 1TGTA 1TNGA 3SGBE 2GKVE 3MU0A 1YPGH 3F3BA 5CDFE 2D1JA 3FAOA 3K6YA 2XRCA 1AWFH 4FUFA 1BMFD 4I8LA 1CQQA 3RXSA 1P8VC 4THNH 1LQDB 1EP6A 1HAHH 1O3BA 3P17H 4ZKSU 4CBNA 3HK3B 3PV2A 4DJZB 3DD2H 2BHGA 1BTUA 3TGJE 4ABGA 3RXQA 3ZZ5A 2PW8H 3A7WA 1O3GA 1SQAA 3IG6B 4K2YA 4XBBA 1GVKB 2F9UA 5GCHG 1O3CA 3SW2B 2J95A 1PJPA 1YY3A 1GHBF 3LGVA 4GHQA 5FCRA 4DCDA 3EA7A 1ZTJA 1FY3A 3RXFA 2ESTE 3A82A 1TMTH 3SV8A 2FODA 2F83A 2ZQ2A 1FN8A 1BJVA 3SZNA 2Y5FA 2ZCLP 4AN7A 1GBFA 1CO7E 2CN0H 4Y8XA 1NTPA 4O3UA 3UNRA 1C5TA 1WOFA 4X6MA 5KEDA 4TYDA 1HB0B 1H9LB 1QR3E 2P8OB 1GDUA 1DY8A 3UWIA 8KME2 1BTWA 2QXIA 2FTLE 1C2IA 1GCDA 5L30H 1C1UH 1JXPA 1YP9A 1Z6EA 2P3FH 4INLA 2BQ7B 1QJ1B 4J2YB 1MTNC 1WAYB 2GCTB 2LP6A 1SI5H 2BZAA 2VVUA 5GIBA 1LHCH 1WBGB 4WMFA 2EQNA 2PUXB 2FI5E 2TPIZ 3KHVA 5B6LA 5CE1A 1ANBA 3DT0H 1QCPA 1NRQH 2CMYA 1NFWA 2Z6BD 4FU8A 3LU9B 2VH6A 3F9EA 1A46H 1EB2A 1D3TB 1ZGIA 1WU1A 4ZAEA 5KGOA 5T6FA 4B2BA 2CK3D 1P3EA 2FEQH 1MBQA 3RC4A 3RM0H 2SGQE 3SNDA 3SV2H 4BXSA 2ZDAH 1OOKB 2NU0E 4SGAE 2ZFRH 1TRYA 1EAWA 1Y8TA 7LPRA 1ANEA 1SGTA 1CBWB 2JDID 5J4SA 1F92A 4IC6A 2OUAA 4FXGH 3SJOA 2KR7A 1DANH 2FTMA 3EYDA 3PROA 5B6OA 4D9RA 1BBRH 7ESTE 3W1EA 1KMHB 1CA8B 1MQ6A 3TK6A 2K8IA 2VWMA 2PSXA 5EOKA 1UCYH 3SNEA 4ESTE 1DLEA 1XUFA 4ZKNU 2TBSA 4K1EA 5F6MA 2O8WA 3A87A 3C27B 2CF8H 4E05H 3RXRA 3ENSB 5C94A 1GBLA 2ZHWH 1NZQH 3SJIA 1KDQB 2TGAA 3ZV9A 3P8NA 1QQUA 4IC5A 3HKJB 2ZCKP 1SMFE 1BRCE 4DOQA 2KCAA 1D9IA 1HAVA 1SGFA 1GDQA 1QJ6B 2W7UA 1Z6JH 3H7OA 2OQ5A 3SHAH 3RXAA 2Y81A 1XM1A 3ATLA 1FY8E 5A09A 6LPRA 3PLKA 4AFSA 3FP7E 3E91A 3PMAB 1V2TT 1MTUA 2UUYA 5CHAB 4ABBA 5FCKA 2G81E 2JH0D 3UWJH 3F9FA 1GI6A 1XXDA 4I86A 1HAYB 1CHOF 1K1PA 3GY7A 2BD7A 3LGUA 2RDEA 2ZU5A 2QA9E 5HMAA 3O8CA 2QF4A 1S6LA 3M5NA 2GT7A 3A88A 2XYAA 2D8WA 3QZQA 2AERH 3E0NB 3SHCH 2QN5T 1RTLA 4BOHA 1ZLRA 5L6NH 3JZ2B 2BZ6H 1C5VA 1BBRK 1CA0B 1WUNH 4OS1A 1D6WA 5DN6D 2IN2A 3GY6A 2ZIQH 2F9VA 2GDDA 1TBZH 4JYVH 5DSFA 4AORA 1FMGA 4OS7A 4A1TA 3PO1B 2QF5A 2BX3A 3RXOA 2XBVA 1O2SA 2R0LA 5TCAA 4JZ1A 2R2MB 2A5IA 3OU0A 3PB1E 1TLDA 2V7QD 1B7XB 2WV4A 2CHAC 1TIOA 2KAIA 4ISHH 2VIVA 4B73A 4FU7A 4I33A 3MHWU 1CHGA 3IWMA 5HGGA 4OGYA 2P8OC 4F49A 1BMNH 3E16B 1T8OA 1GJ6A 1C1VH 2VU8E 4CRDA 1QGFA 1P2JA 2ZPSA 3T26A 2F9BH 2K1QA 5A2MH 2FPZA 2FMJA 2WUCA 1EJAA 1D3QB 2WINI 1GHZA 3ITIA 1F2SE 3D49H 3S0NA 1AHTH 2GCTC 1GJCB 2CF9H 2PUQH 1YLCA 4Z0KA 3STIA 3K6ZA 1QBOA 2ZPRA 2BD9A 1YPHE 4IBLH 1HJ9A 4KKDA 3ZV8A 2FLRH 5LGOA 1C1PA 2FOCA 3MI4A 4WF8A 3EE7A 2ZU2A 3ATKA 1RXPA 3O8BA 3LONA 3KEEA 4MPVA 4WJG2 1IQHA 1E38B 4B2CA 3TU7H 1QB6A 1C4V2 5GXPA 1NESE 1Z1JA 2PHBA 3SU6A 1RFNA 4P00A 1ZTKA 1C5OH 1CBWC 1O3AA 2P93A 1C2MA 1TX7A 4IMQA 1S83A 1SB1H 1MD7A 3HGNA 1O35A 3BTGE 5C5OA 1G2LA 3U1IB 2FOGA 1DOJA 2IPHA 2OD3B 1K1JA 4GCHF 2EC9H 4MPWA 1YPMH 4A6LA 3SV6A 5K7RA 3U28C 2GCHG 4NIXA 1SGDE 2HLDD 5EGMA 4Y79A 4MDSA 1JWTA 3ZZ9A 2STAE 2B0FA 1DUEA 2FX6A 1C1WH 3EA9A 2BLWA 2Y7XA 4H4FA 5FPSA 1O33A 3SOSA 2VIOA 2WHXA 1BHXB 3ZZ4A 1E34B 1SGNE 4X1QU 1AGJA 1GBDA 1DUAA 3MH7A 1YPEH 2QF0A 1NFYA 1G37A 3KYGA 3F2FA 2Z9GA 2P94A 2A4OA 1YPKH 2ZHEH 4LXBH 4NA8A 5JBBS 2QXJA 2OBOA 4RSPA 3SYJA 1K22H 5EXNA 3PMHB 2YMSC 1O2RA 4E7RG 1CSOE 1GMDG 4ISIH 2C8XB 1EZUC 1HAIH 2GZ8A 3F1SB 4B71A 1H1BA 2RA3A 4AB8A 4TPIZ 1ELGA 5CHAC 1VITG 3U1JB 3WY8A 1ZHPA 3T27A 3BEUA 5I25A 2BY5X 1WTGH 3LH3A 3SV9A 1O5FH 1G9IE 2AGEX 2RCEA 3KNXA 3LC5A 2GMTB 3SJKA 3TPIZ 1GMCG 1XVMA 1EZQA 3FN8A 1KIGH 2FOFA 2BD5A 2P3TB 1IQFA 3M36A 1TNIA 1C1TA 3M37A 5L2YH 1GBJA 1ZSKA 2PFEA 5I46H 1V2JT 4BAKB 1UVUH 2I6SA 4HI3A 3SZEA 5FXLA 3OEHD 4Y6DA 5FBIA 1PPEE 1WSSH 1LHFH 4RN6A 1O3IA 1CA0C 2A31A 1ESBA 5C2ZA 1TNHA 4MVNA 3SJ8A 3FVFB 2WPIS 1GBIA 3P70B 1N8OB 2ZU4A 2BVSH 1CT0E 3F9GA 2HPPH 3PO1C 1E37B 2SGEE 2J98B 3M7UA 5C0TA 1DWBH 2EI6A 3GY8A 9LPRA 3A84A 4AZ2B 1UO6A 2BY6X 3RXJA 1BJUA 4JZEH 3ELAH 4I32A 4WMDA 3UPEA 3ATIA 1UK2A 1QL8A 2XTTB 2JH6D 1GI2A 4D9QA 3GCTF 2WV9A 3TNTA 2KCPA 5JBCS 2H1UA 1SQRA 1P11E 5JBTA 2PSYA 1TNKA 1FPCH 1YCPM 1DY9A 1EJNA 3V13A 3K9XB 1QL7A 1Z7KA 3NXPA 1GMHG 7GCHG 1LVOA 3VXFH 5GJ4B 5GWZA 2V6NA 2XNIA 4XFQA 4Q4LA 2WPLS 2ZGXH 6GCHF 1KY9A 3RXHA 1KYNA 2ZA5A 2V3HH 3GY3A 3OAAD 3TVJB 4BAHB 3DFJA 5J4QA 2Z9IA 4DY7B 5FPTA 2PV9B 3TITA 2ZTXA 2ZGHA 1UTMA 1AKSB 1FPHH 1S5SA 3NZIA 3RMMH 1LVYA 3BTEE 1BRBE 3M5MA 1MTSA 3RLYH 3EGKH 1G3EA 2HNTF 3BIUH 3DSOA 1UK4A 4YESB 1O2XA 2ZO3H 4GUXA 1IQJA 2QXGA 4TWYA 1T4UH 1MTNB 2W5EA 4JMYA 1XUIA 1TOCB 4BAMB 5EJZA 4AGJA 2OK5A 1OP0A 2SGFE 2FO9A 3NKKA 5HKKD 3SQEE 1ZMNA 4CRFA 1HIAB 2XW9A 1SL3A 3VGCB 1MKWH 1K0HA 1O3JA 1ZTLA 1KLJH 1V6DA 1C5LH 5E2PA 1DWDH 1PQ7A 1OP8A 1ELCA 3I77A 3A7VA 1NRNH 4AG2A 1GBBA 2FDAA 3UQVA 1BZXE 4Q7ZA 2YOLA 4WH8A 4Y7AA 3VB5A 1K1OA 2TIOA 1Z8JB 1QA7A 1AD8H 3QGNB 4ZHMU 1RTKA 1OWDA 3PLBA 2G4TA 4ACAA 4UEHH 3F68H 4MLFB 1MCVA 1GBEA 1GBKA 3KF2A 1ARCA 1IQEA 2ZFPH 2ZGBH 2RG3A 3FP6E 2BD3A 4NGAH 2WPKS 2TGDA 1BOQA 2AMQA 4ABJA 5GPIB 2ZECA 1O3EA 4Z6AH 2G5VA 4BTTB 2GMTC 3T28A 1RIWB 3ZVGA 1QA0A 1SLUB 2A2QH 5EQRA 4ISLA 3OEED 4X8TH 4B2AA 1QL9A 4K60A 3E8LA 1KDQA 2FOEA 1C1MA 1G32B 1DXPA 1P9SA 2BVRH 2KCOA 2Y6TA 1LHGH 1Z8IB 2H9EH 1NRPH 1C2FA 3MWIU 2H9TH 1V2OT 5BRRE 1P02A 3O8DA 1T8MA 4TWWA 1FY5A 2WUBA 1S84A 8LPRA 4Q63A 4XRNA 1FJSA 3MNCA 4RKJB 1HNEE 1SHYA 3V12A 1N8OC 1DDJA 2ODYB 2OLGA 4KTUA 1THPB 3A86A 1MKWK 4LOYH 3PWBA 4I7YH 5T6DA 1TABE 3UR9A 4YT7H 2ZU3A 1SGRE 3GCHB 5T3HA 2WZQA 1GWAA 2ALPA 1K9OE 2BYAX 2OP9A 1EFRD 3TNSA 3UNSA 1BTHH 4ZKOU 4JYTA 5DP8A 3PRDA 1DFPA 3OTJE 4P02A 3E3TA 2BD2A 4X2YA 1MD8A 4A7IB 4CR9A 2BDIA 1C5NH 4XOJA 3P95A 1PYTC 3AAVA 3RXIA 1OYQA 3E6PH 2FIRH 1C5ZB 1FAKH 5DP5A 2XC0A 1FXYA 1Z71A 2QCYA 4X8SH 1K21H 3BTKE 1X7AC 3QTOH 3SUDA 4ZXXH 1DSUA 1F0SA 5HM9A 1L1GA 1D3DB 4XE4A 1Y3XA 1TRNA 3F2HA 5C20A 3PWCA 1P2IA 2CHAB 1C5RA 4IS5A 2ZFSA 1C2LA 1XMNB 2F43B 2BDGA 3WW7A 3ZZCA 1ESTA 2WYJA 2ANWA 4NFFA 4OM9A 4B76A 4BAOB 1ID5H 4FUCA 3SBKA 2GP9B 2OQUA 5DO4H 3MMGA 3RXVA 4FU9A 1WQSA 2Q6GA 3MNBA 1XUJA 1QB9A 3R0FA 2NU1E 2F91A 3RU4E 2PWXA 2HWLB 1T8LA 2ASUB 1MKXK 2GT8A 1O2VA 4FUEA 2Z9LA 3SU1A 1PPHE 4Y0ZE 2PP6A 2ZZUH 3ODFA 2A32A 2J34A 2XWBI 2OTVA 4M7GA 1VCPA 1MABB 3O8RA 1V2PT 3HATH 1EKBB 3DFLA 1GHAF 1HAPH 4M9FA 3VGCC 4JK5A 2CGAA 3M3VA 4HGCA 4AC9A 1AMHA 4FVBA 5PTPA 1WV7H 1CU1A 1NO9H 2C8WB 4DVAU 1AI8H 1EAIA 3B9FH 1HV7A 2FLBH 1P0SH 5A0AE 3P8FA 1L1NA 1O3DA 4O3TA 3MU8A 2VIWA 4DURA 1AVXA 3SORA 1BUIA 1GCTB 3AW1A 1VR1H 4O03A 1SGPE 4XBCA 1MMJN 1GHBG 4MPXA 4K8BA 3RLWH 4A5TS 4YLUA 5KECA 2VWOA 1G36A 2YMSD 4BNRA 1DE7H 1IAUA 4Q2KA 1LHEH 4DGJA 1O3MA 1O2PA 3M35A 1A7SA 1UVPA 1RIWC 2SNVA 1SR5C 1GI9B 3A8BA 1TGBA 4ISNA 3VEQB 2AMPA 1NROH 3S9BA 3ZVFA 1O2UA 2BDHA 1P2NA 5DG6A 1SKYE 5EXLA 1HAGE 1IQLA 1V2VT 4RT0A 1G30B 2SGAA 3RXEA 1F0TA 1L2EA 1YGCH 1C5UA 5DP6A 5FBEA 3PV4A 3UR6A 3VFEA 4DIIH 2HNTC 2YMSB 1P3CA 1TA6A 5GDSH 3TLOA 5EIYA 4D76A 5CMXH 3BG4B 1BITA 5EXMA 1YWUA 2UUKB 2BY8X 3A81A 5EQQA 3F6UH 4Y7BA 2KCYA 3LPRA 1TQ0B 2BDAA 5AHGH 2OCVB 3GCHC 4H6SB 4ZHLU 1YPJH 1YKTA 4CRGA 1BCUH 2VJ1A 4GHTA 3KQCA 5FPYA 4K8YA 5L2ZH 1P06A 1QRWA 2GDEH 1OWJA 2XC4A 1O2QA 1RGQA 1YYY1 3ATWA 1FY4A 4AX9H 3T25A 1GVZA 1C1RA 1JOUB 1JRSA 3CS0A 1O2HA 1Y3VA 3S7KB 4ACBA 2C8YB 3TGKE 1LPZB 2WYGA 2B9LA 4I8JA 3MU1A 1C9PA 1P57B 4UE7H 2CXVA 4J1YA 1GI1A 2H6MA 3RMLH 1DS2E 1OYTH 1YC0A 2VINA 1S6HA 3WWFA 1SGCA 3LIWA 1KSNA 3ZZ6A 4I8HA 2YNBA 3G01A 1MAXA 3ESTA 3Q00A 2J92A 2ZWLH 1V3XA 1O3FA 2ANKH 2BXUH 1TAWA 3Q76A 3PLPA 3FZZA 4X6OA 3A80A 2FWWA 1NFXA 1YCPK 1A3BH 1O37A 1TWXB 3SO3A 3LKWA 2PKSB 1PQ5A 1DT2A 2SFAA 1OWKA 1UVTH 1UMAH 3H5CB 1EAUA 1CT2E 4FUJA 3TK9A 1QFKH 5A8ZA 3A89A 5IDKA 3AVZA 1GI7B 2PR3A 5GNDA 1MU8B 3GYLB 2G55A 1D3PB 4ABEA 4Z1MD 4D7GA 1BRAA 2PTCE 4X8UH 3MH6A 2KFWA 1UTNA 3UFAA 1Z1IA 4O97A 3MFJA 1EPTA 1K1LA 2BB4A 3GS9A 2F9OA 4A1VA 2GX4A 4IN1A 2QIQA 2A4QA 1CHOG 3LJJA 1QBVH 3E90B 1IHTH 5A8YA 1A2CH 4UDWH 2R3YA 1C5WB 2ZF0H 2ZQ1A 3RU4T 6CHAC 1ELBA 2BMGB 5EODA 1O3NA 3N99A 1L1JA 1O2WA 2H5DA 4CRCA 3CS7A 1T32A 3N7DA 1O2OA 1FY1A 1H9HE 4NCYA 4JCNA 1IQNA 2V35A 1ZOMA 2C3SA 1O5BB 1P10A 2XCFA 4CH2B 3D23A 4E7NA 4XD7D 2FS8A 2EY4C 1GCTC 3TGIE 5SGAE 4FUDA 1T4VH 1ETSH 2AHME 4YZUA 2FM2A 1O2TA 4NIYA 3M7QA 3RC5A 2FP7B 1GBCA 3SU2A 4NIVA 5TCCA 3ZIAD 3GDVA 1C1OA 1BDAA 1GI5A 1KXAA 1P2QA 4Y76A 1N6YA 4ABIA 2GV6A 2PKAA 1C5SA 2RDLA 4CRBA 3SNAA 2KX4A 3QO6A 1C2JA 3LC3A 3U8RH 1AZZA 1FLEE 1DSTA 2FOHA 2P95A 2L6OA 1EZSC 1GJ7B 1HXEH 1CGJE 1ZJDA 3LH1A 5C67A 5E0GA 2C8ZB 2F3CE 4UD9H 3OX7U 3QWCH 1TBRH 1EAXA 2XWAA 3HGPA 2HALA 4YM9A 1RRKA 1A5IA 4TY7A 3BG4C 2Y5GA 2ALVA 1SLWB 4GLYA 1LCYA 1B0FA 4A92A 4B74A 3T5FH 3BTWE 1HAVB 2UUFB 1GGDB 3UUZA 1OSSA 2Z94A 4INKA 2Y5HA 1TGCA 3UB0A 3VB7A 1SFIA 2BXTH 1O34A 1FI8A 1HXFH 2Z9JA 3NPSA 4MTBA 3QTVH 2AFQB 5FX5A 1AVGH 1ANCA 1NRSH 1A0HB 2O8UA 1W14U 4IW4E 3RUOA 2Z3EA 1IQGA 1P2KA 1J8AA 1TGNA 1LO6A 1ELAA 2HOBA 1G2MA 3LGYA 1BTZA 2ZNKH 3EE0B 3F9HA 4X1PU 3T2NA 2SGDE 3OY5U 1O2MA 3S9CA 1N1LA 2TRMA 1A4WH 1LTOA 1O5AB 2Y82A 3M5OA 2ODQA 4WH6A 5JYIA 1FAXA 1ZPBA 1OWEA 2O8MA 1CT4E 4WXVA 1OWIA 3T62A 1Y5AT 5DP7A 1GPZA 1FQ3A 2CJIA 4KTCA 1TALA 4XDEA 1HYLA 3RXUA 4GCHG 1VITH 1AUJA 1KXEA 5EU8A 2IJOB 1WQVH 2AGGX 4I31A 2ZC9H 1S6FA 4K1SA 1FN6A 2W3IA 4BXWA 1EASA 1O2ZA 1W11U 2PGQB 3UTUH 2PKSC 3A7TA 4RKOB 2EA3A 2JETB 1BB0B 3RXLA 3Q3XA 1ZZZA 2GTBA 5G4BA 4TSFD 1L4DA 1RJXB 1DXWA 3U69H 2RFKC 3HPTB 3RMOH 4AB9A 1GJBB 2XBYA 3CNRA 2H9HA 2KAIB 1LMWB 1GL1A 2HNTE 3GISB 5HXFA 4YTAA 4U32A 1SLVB 3RXCA 2AIPA 1KXBA 3GICB 1PPFE 1NY22 1BA8B 3SNCA 4XSKU 3LGWA 4MNVA 1PQAA 1BIOA 3RP2A 4XBDA 2FX4A 3SU5A 1NBME 1BRUP 4CR5A 1PFXC 1V2ST 4KELA 4NSVA 5JB8S 1A3EH 4X1NU 2FOBA 1C4U2 8GCHF 1Q3XA 3MU4A 4WY3A 1AU8A 1C5YB 2C4FH 2BOKA 1G3DA 2XOKD 1G3BA 1C5MD 1Z8GA 3VG8A 4BTIB 2IOTA 1Q31A 1SGYE 2FI4E 2ZGCA 1A5GH 3OY6U 2BM2A 4FUIA 2Q6DA 3DUXH 3F0PA 3UREA 2RA0A 1W0KD 2VBCA 2C90B 2BD4A 4OS5A 4ZMAH 1O5EH 3FZDA 3BV9B 3KL6A 3E1XB 2AH4X 4JZDH 2AYWA 1ARBA 1GI3A 1PPCE 3SNBA 3SI4H 2UWLA 2FYRA 1O2YA 1SFQB 5DP9A 4ABHA 4GSOA 3FKSD 1HJAC 1TB6H 5CHBA 1E1RD 1BTXA 5E0JA 3RC6A 3M3SA 2BQWB 4TY6A 2QF3A 4WXIA 3GCTG 4YXWD 3MYWA 1IQMA 2WPDD 1AUTC 2PTNA 1ZGVA 1QTFA 1W0ZU 1XUHA 2A7JA 1K1MA 2SGPE 3PTBA 1DICA 2F9NA 2KZ4A 3ZZ7A 2G8TA 2BLOA 1A5HA 5IYTA 1W0JD 3VB3A 5C17A 1BMAA 1TPSA 2QXHA 2O8LA 3OSYA 3PTNA 4LK4A 1TPPA 3U8TH 3TJOA 2UWPA 5DK1A 1HDTH 4X6NA 2G00A 1Y59T 4K5ZA 1TBQH 3TJNA 4F48B 5EQSA 3OFND 3KYFA 6GCHG 2WPHS 5F8TA 1C1SA 2VGCB 3QUMP 4UFFH 1GGDC 1ELFA 2M2AA 3K65B 1DWCH 2OC8A 1V2NT 4Y71A 1KTSB 2Q1JA 1HGTH 5GCHF 1NBMD 2VNTA 4KP0A 3VB6A 4Y0YE 2ZFQH 4R8TB 3N7EA 1Q2WA 1BBRE 2FS9A 2A0QB 1LPKB 3M3TA 3ZVEA 2TGTA 4FVDA 1V2LT 1TMUH 3M5LA 1GI4A 1QRZA 1UCYE 1S81A 4LZ1H 2P16A 1ZJKA 2GD4B 4MQAA 3RXBA 1GL0E 1P03A 1XX9A 1Z8RA 2A5KA 2BOHB 1ACBE 2HPQH 2JIZD 1WYKA 1TPAE 5JB9S 1ZMLA 3FP8E 2HGTH 1O3HA 1N6XA 1HCGA 1MKXH 4UFGH 1A0LA 3TIUA 2B5TB 1AO5A 4VGCB 2J9NA 5C5NA 3TH4H 3QLPH 1H8ED 4X6PA 3BG8A 1P2OA 3D65E 3ZYDA 4H42U 2A5AA 2G51A 1IQIA 4O9VA 4GAWA 3SV7A 1YLNA 5DP3A 1CVWH 1TNLA 2R2WU 4NZQA 2V3OH 1HPGA 2OC0A 1Y5UT 2OC1A 3QK1A 3V0XA 3OE7D 1T7CA 2VB0A 1MTWA 2F9PA 2JETC 2XC5A 3PMJA 1TRMA 4HZHA 1YF4A 4CH8B 1THSH 2XBWA 1S85A 2VIDA 2AIQA 4ZHAA 4U01A 4NA7A 1F0RA 1W12U 4IN2A 3RMNH 1QQ4A 3MNSA 4MNWA 1SG8B 4SGBE 1P01A 5EW2H 3ATMA 2G4UA 1LVBA 1CGHA 3I29A 5ESTE 1E35B 3ODDA 3KN2A 1S0RA 1O2NA 3FFGA 3RXGA 4BTUB 1EUFA 4AG1A 4ZROA 4U2WA 1O3KA 3QGJA 4NSYA 2P3UB 2AMDA 3DHKH 5EPYA 3RXMA 3TJVA 2A7HA 2EI7A 1GJ9B 3BF6H 1Y3YA 1SGIB 2W7SA 1GJ4H 3PMBB 5A8XA 1OWHA 1OP2A 1VCQA 3UNQA 3TH3H 5LH8A 1TPOA 4CRAA 1EPTC 3U9AH 2A7CA 1F5RA 1XUGA 4UFDH 4ZXYH 3GDSA 1SQOA 2Z3DA 3MO9A 5DGJA 1GG6B 5JPMH 2ILNA 3QN7A 1TOMH 3U98H 4B75A 1ELVA 2A1DB 3Q3KA 1UHBB 4YT6H 2BLQA 3RDZA 5C1XA 4RT1A 4OGXA 2SNWA 1UVSH 5DPAA 1O2GH 3P8GA 1MZAA 1NU9A 4WMEA 2AGIX 3ZZBA 2W6ID 1C2HA 1ZHMA 5LPEA 3MOCA 1AB9B 3NCLA 4Y8ZA 4LZ4B 3OYPA 1UTJA 1ZRBA 1ELDE 4RI0A 1W3CA 2GV7A 1AFEH 5E0HA 3EQ0H 3RXTA 5F8XA 3NUMA 1LVMA 3BIVH 5EG4A 5FX6A 5DJ7A 6CHAB 2ZDLA 1QRXA 2OXSA 4GPGA 1TMBH 4DG4A 1XVOA 4NWKA 1VCWA 3KCGH 1QZ8A 2BQ6B 3SUEA 2Z9KA 3LDXH 1WXRA 3Q77A 3W94A 2HLCA 2Z3CA 2ZI2H 3FOAA 1GVLA 2QC2A 1P2MA 2Q6FA 5EPNA 3F2GA 3F0OA 4WWYA 3DA9B 3KIDU 3PM3A 1TX6A 3GCOA 1AZ8A 1NS3A 2VGCC 1LQEA 4ABDA 1P12E 2QY0B 4ZKRU 3S7HB 1GBHA 4MNYA 3RXDA 1UTKA 5E2OA 2ZEBA 3BTQE 1CE5A 3MNXA 2B7DH 1XXFA 3S69A 3ZZDA 2ZKSA 2NU2E 5H4IB 1V2QT 2V3MA 4DIHH 1OPHB 3V3MA 2ZP0H 3ZVDA 3A8DA 3MH5A 4AFUA 1O30A 4HTCH 4TT3D 1UTLM 2IPQX 4FUBA 1YCPH 3OTPA 1F5LA 3BTDE 1E36B 3SUFA 4AYYB 3T29A 2JKHA 5C3NA 4U30A 1SVPA 1OHHD 3SU4A 3BEFB 4DT7B 1C9TA 2VH0A 4FUGA 1B0EA 3H7TA 3RU4D 2NWNA 4CBOA 1SQTA 4X8VH 2FXRA 2JH5D 3L3TA 1C4Y2 1GDNA 2GVFA 4AGKA 1O3OA 2VWNA 4D7FA 2LNCA 4VGCC 1DLKB 2ZDMA 3A83A 3SGQE 1Y3WA 1HLTH 4IMZA 1GHAG 1B5GH 1JBUH 1VGCB 5AFYH 4F55A 3JZ1B 3PV5A 1T31A 1H8DH 1CGIE 3GCNA 5A0BA 4GVUA 1O5GH 1NFUA 1W2KH 1PPBH 1H9IE 1FNIA 1V2KT 1AFQC 1RTFB 4ZH8A 5FL7D 1SOTA 1J16A 1GHWH 2EI8A 3CENA 3SU3A 1ZSJA 3A7YA 2P59A 3URDA 3BSQA 2ZDVH 2ZU1A 1NM6A 3KQEA 4WVPE 4ABAA 4FUHA 1GBMA 1P09A 3DSGA 2BDCA 3ZYEA 1L4ZA 2QYIA 1FX0B 3L6PA 1QURH 4CHAB 1O2IA 2GJGA 3AASA 2ZCHP 2FOMB 2ULLA 2LPRA 1RS0A 4X2XA 2J98A 2WPJS 7KMEH 4BANB 3PYHA 1MH0A 3NWUA 1ESAA 1SBWA 1AN1E 1VJ9U 2TGPZ 2PLXA 1LPGB 1E1QD 3GY4A 4JZIA 4UFEH 1UCYK 2ZHFH 4OS2A 1UTOA 1QIXB 1UJ1A 1L0ZA 2DUCA 2LELA 1QB1A 2GCHF 1GJ5H 3LGTA 2HVYB 1GG6C 3M61U 1ORFA 2ODPA 2W26A 2J4IA 2AS9A 1SOZA 3UOUA 1LKBA 1GHXH 2THFB 1TA2A 4X1SU 1LHDH 4IGDA 1BHXF 1AVWA 1FZZA 1FONA 3LT3A 2H2ZA 4AOQA 2G5NA 2ZFTA 1AB9C 3UIRA 2ANYA 1T8NA 2QGRA 3SU0A 3EAJA 4Q80A 1KXFA 1BMMH 2BY7X 1IQKA 4CREA 1HAOH 3WWBA 1DPOA 1HAZB 1U6QA 2Y7ZA 3MH4A 5EW1H 4YOIA 2J38A 1GMDF 1HJ8A 1OX1A 2VVVA 1AKSA 1FIZA 4JYUH 2JJ2D 3KGPA 1TQ7B 1EX3A 5C0UA 1VITF 2FESH 1H8HD 2ZGJA 1SSXA 4NWLA 1V2UT 1GJAB 4YLQH 1JIMA 3R3GB 3HKIB 2QAAA 5T1VA 2A4GA 2IJD1 1GMCF 3E0PB 1W7XH 1TE0A 4H6TA 3ZZ3A 2W3KA 3EA8A 4PROA 5LPFA 1THRH 1SHHB 2J5UA 3C1KA 1MUEB 2PGBB 1MQ5A 5ETXA 4ASHA 1E0FD 2HRVA 1XKAC 4NA9H 5ABWA 1HIAA 1HJAB 1GJDB 4UONA 2A2XH 2W6JD 1O3LA 4Q7YA 3VXEH 4OS6A 1J9CH 4DT4A 2ZG0H 1J17T 5HYOA 1O0DH 1C2GA 3UY9A 5EJ1A 2BLVA 4B6EA 3URCA 2BDYA 4DW2U 1NU7B 4X2WA 3KQ5A 1MBMA 5LPRA 1C1NA 3UOPA 1YM0A 4X1RU 2JJ1D 2OINA 1TNJA 1SC8U 3B23B 3Q3YA 4Y8YA 1KXDA 1FV9A 3S9AA 1UK3A 2BTCE 3IITA 5DKMA 1BTPA 3AK5A 2AEIH 3MO6A 1HAXB 2O9QA 8ESTE 1PQ8A 5JDUB 1ELEE 2XCNA 3SUGA 2R3UA 1SGFG 2WV5A 1DITH 1TONA 2CV3A 4YO9A 1KLIH 2I6QA 1C5XB 3QZRA 5A0CA 1GMHF 1VGCC 3AAUA 3VPKA 7GCHF 1AQ7A 2BDBA 3ZVAA 1WDIA 4QT8C 1EB1H 2HVXA 1UVOA 1ANDA 3ZZ8A 3AW0A 5F03A 3NK8A 2ZHQH 3BEIB 3GYMA 1YLDA 4HG6A 4AYVB 1JMOH 2FYQA 1IHSH 1S0QA 2VVCA 2XBXA 2XNDD 5AVDA 2ZTYA 3TK5A 2K0QA 1WCZA 2V0BA 3N7OA 2NU3E 5HIZA 1OS8A 2VIQA 2UUJB 3RM2H 3SN8A 1ZSLA 2KM0A 1C2KA 1ZMJA 5AF9H 1ZPZA 1QY6A 4CHAC 1O2LA 1W8BH 1ETRH 1HBTH 1AY6H 1SGEE 1V2WT 3QX5H 5F53A 1PYTD 1XKBC 4Q7XA 2UWOA 2FZZA 4E06H 3QDZB 2GZ9A 1UW7A 1UTPA 2G52A 1AE8H 5IK2D 2GZ7A 1EZXC 2D2DA 4KGAA 3NRLA 1UTQA 1K1IA 3V7TA 4I8KA
chains in the Genus database with same CATH topology
1HFDA 2ZPQA 3LJOA 1QHRB 3A85A 3I78A 3ZVCA 4I8GA 1Y3UA 4Y11E 1O39A 4ZUHA 1P05A 3FANA 2ZDNA 2B8OH 3A8AA 1C5QA 5FAHA 4B1TA 1V2RT 2YNAA 1DM4B 1EOJA 3KQBA 1O36A 1FIWA 1ZYOA 3SJ9A 4NFEA 3SQHE 1GI0A 3MTYA 2STBE 2Y80A 3GY5A 2J94A 2BX4A 1ELTA 1O5CB 1ZR0A 2H5CA 4NG9H 4TPYA 3M7TA 1GBTA 4ABFA 1H8IH 1AWHB 4INHA 3UQOA 4MPUA 2R9PA 2DE9A 1VJAU 1O5DH 2ZHDA 4AFQA 4BAQB 4ISOA 4K1TA 1AIXH 3VB4A 1F0UA 1NPMA 4KTSA 1O2JA 3BTTE 3MU5A 1IOEA 4D8NA 1YBWA 5C1YA 1P9UA 4Y10E 2WPMS 1EPTB 1ABJH 2EEKA 1DWEH 5DP4A 1O38A 1BT7A 1W13U 1ETTH 1KXCA 2OBQA 2ZTZA 3STJA 1MU6B 1EOLA 1D4PB 1JIRA 3B8JA 3BN9A 3K2UA 1W10U 3A7XA 1W0YH 2VIPA 1JRTA 1O3PB 4NIWA 1UHBA 1YPLH 6ESTA 1FUJA 1NRRH 1H4WA 1AE5A 1O32A 1EATA 1TGSZ 3U8OH 2QV1A 3RXPA 1F5KU 1C1QA 1PPZA 1QBNA 1ZPCA 3D62A 4AFZA 3KQDA 1EXFA 1INCA 1KTTB 2O8TA 5T6GA 4K3JA 1SLXB 1QJ7B 1NC6A 3P8OA 1M9UA 4OS4A 1GJ8B 1OXGA 1O31A 1RD3B 3LOXA 2VWLA 1OKXA 1XUKA 1EP5A 3EDXB 1PPGE 1A0JA 4JK6A 4JZFH 1SPJA 3BTFE 5E8EH 1ABIH 4X2VA 2ZDKA 1GI8B 5BPEA 3MO3A 2C93B 1FDPA 1TX8A 1TFXA 4K69A 3P92A 2PKAB 5TJXA 1D6RA 5JBAS 2M5TA 3P6ZB 3A8CA 1K1NA 3TJUA 4NZLA 1SGQE 1K28D 1HUTH 3LGIA 2ZFFH 2XXLA 2BVXH 1MCTA 1BTYA 3BTME 1J15A 1GHVH 1J14A 2FOAA 3W95A 1O2KA 1QNJA 1C5PA 1W7GH 2ANMH 3HK6B 2OC7A 1Y5BT 2J2UA 1TYNA 8GCHG 1BQYA 1ZHRA 3SGAE 2A4RA 4R0IA 1DVAH 2A45B 1GBAA 1BMLA 1HRTH 1C2DA 5AFZH 1P04A 1DX5M 3ZZAA 1WTHD 2FI3E 3RXKA 2BD8A 1EQ9A 1V2MT 3GY2A 3BTHE 4MG3A 1G3CA 1EJMA 3CP7A 1LDTT 5ESBA 5C1UA 3GOVB 5HM2A 4X0WU 4YOJA 1NN6A 1K2I1 2GGVB 1MAYA 4MNXA 3A7ZA 1C2EA 5K0HA 1F7ZA 3L33A 3TH2H 2DE8A 3SI3H 9ESTA 1MTVA 2D26C 2NU4E 5FHTA 4A1XA 1GHYH 1VZQH 1A61H 1ZRKA 1A1RA 1AFQB 2BY9X 5F8ZA 1LKAA 1YPHC 1KLTA 1MZDA 3GDUA 1NT1A 1S82A 2R0KA 2Z7FE 4YOGA 4HFPB 3ZVBA 4F4OC 1TGTA 1TNGA 3SGBE 2GKVE 3MU0A 1YPGH 2D1JA 3FAOA 3K6YA 2XRCA 1AWFH 4FUFA 4I8LA 1CQQA 3RXSA 1P8VC 4THNH 1LQDB 1EP6A 1HAHH 1O3BA 3P17H 4ZKSU 4CBNA 3HK3B 4DJZB 3DD2H 2BHGA 1BTUA 3TGJE 4ABGA 3RXQA 3ZZ5A 2PW8H 3A7WA 1O3GA 1SQAA 3IG6B 4K2YA 4XBBA 1GVKB 2F9UA 5GCHG 1O3CA 3SW2B 2J95A 1PJPA 1GHBF 3LGVA 4GHQA 5FCRA 4DCDA 3EA7A 1ZTJA 1FY3A 3RXFA 2ESTE 3A82A 1TMTH 3SV8A 2FODA 2F83A 2ZQ2A 1FN8A 1BJVA 3SZNA 2Y5FA 2ZCLP 4AN7A 1GBFA 1CO7E 2CN0H 4Y8XA 1NTPA 4O3UA 3UNRA 1C5TA 1WOFA 4X6MA 4TYDA 1HB0B 1H9LB 1QR3E 2P8OB 1GDUA 1DY8A 3UWIA 8KME2 1BTWA 2QXIA 2FTLE 1C2IA 1GCDA 5L30H 1C1UH 1JXPA 1YP9A 1Z6EA 2P3FH 4INLA 2BQ7B 1QJ1B 4J2YB 1MTNC 1WAYB 2GCTB 1SI5H 2BZAA 2VVUA 5GIBA 1LHCH 1WBGB 4WMFA 2PUXB 2FI5E 2TPIZ 3KHVA 5CE1A 1ANBA 3DT0H 1QCPA 1NRQH 2CMYA 1NFWA 2Z6BD 4FU8A 3LU9B 2VH6A 3F9EA 1A46H 1EB2A 1D3TB 1ZGIA 1WU1A 4ZAEA 5T6FA 4B2BA 1P3EA 2FEQH 1MBQA 3RC4A 3RM0H 2SGQE 3SNDA 3SV2H 4BXSA 2ZDAH 1OOKB 2NU0E 4SGAE 2ZFRH 1TRYA 1EAWA 1Y8TA 7LPRA 1ANEA 1SGTA 1CBWB 5J4SA 1F92A 4IC6A 2OUAA 4FXGH 3SJOA 1DANH 2FTMA 3EYDA 3PROA 5B6OA 4D9RA 1BBRH 7ESTE 3TK6A 1CA8B 1MQ6A 2VWMA 2PSXA 5EOKA 1UCYH 3SNEA 4ESTE 1DLEA 1XUFA 4ZKNU 2TBSA 4K1EA 5F6MA 2O8WA 3A87A 3C27B 2CF8H 4E05H 3RXRA 3ENSB 1GBLA 2ZHWH 1NZQH 3SJIA 1KDQB 2TGAA 3ZV9A 3P8NA 1QQUA 4IC5A 3HKJB 2ZCKP 1SMFE 1BRCE 4DOQA 1D9IA 1HAVA 1SGFA 1GDQA 1QJ6B 2W7UA 1Z6JH 3H7OA 2OQ5A 3SHAH 3RXAA 2Y81A 1XM1A 3ATLA 1FY8E 5A09A 6LPRA 3PLKA 4AFSA 3FP7E 3E91A 3PMAB 1V2TT 1MTUA 2UUYA 5CHAB 4ABBA 5FCKA 2G81E 2JH0D 3UWJH 3F9FA 1GI6A 1XXDA 1HAYB 1CHOF 1K1PA 3GY7A 2BD7A 3LGUA 5HMAA 2ZU5A 2QA9E 3O8CA 3M5NA 2GT7A 3A88A 2XYAA 2D8WA 3QZQA 2AERH 3E0NB 3SHCH 2QN5T 1RTLA 4BOHA 1ZLRA 5L6NH 3JZ2B 2BZ6H 1C5VA 1BBRK 1CA0B 1WUNH 4OS1A 1D6WA 2IN2A 3GY6A 2ZIQH 2F9VA 2GDDA 1TBZH 4JYVH 4AORA 1FMGA 4OS7A 4A1TA 3PO1B 2BX3A 3RXOA 2XBVA 1O2SA 2R0LA 5TCAA 4JZ1A 2R2MB 2A5IA 3OU0A 3PB1E 1TLDA 1B7XB 2WV4A 2CHAC 1TIOA 2KAIA 4ISHH 2VIVA 4B73A 4FU7A 4I33A 3MHWU 1CHGA 3IWMA 5HGGA 4OGYA 2P8OC 4F49A 1BMNH 3E16B 1T8OA 1GJ6A 1C1VH 2VU8E 4CRDA 1QGFA 1P2JA 2ZPSA 3T26A 2F9BH 2K1QA 5A2MH 2FPZA 2FMJA 2WUCA 1EJAA 1D3QB 2WINI 1GHZA 3ITIA 1F2SE 3D49H 3S0NA 1AHTH 2GCTC 1GJCB 2CF9H 2PUQH 1YLCA 4Z0KA 3STIA 3K6ZA 1QBOA 2ZPRA 2BD9A 1YPHE 4IBLH 1HJ9A 4KKDA 3ZV8A 2FLRH 5LGOA 1C1PA 2FOCA 3MI4A 4WF8A 2ZU2A 3ATKA 1RXPA 3O8BA 3LONA 3KEEA 4MPVA 4WJG2 1IQHA 1E38B 4B2CA 3TU7H 1QB6A 1C4V2 5GXPA 1NESE 1Z1JA 2PHBA 3SU6A 1RFNA 1ZTKA 1C5OH 1CBWC 1O3AA 2P93A 1C2MA 1TX7A 4IMQA 1S83A 1SB1H 1MD7A 3HGNA 1O35A 3BTGE 5C5OA 1G2LA 3U1IB 2FOGA 1DOJA 2IPHA 2OD3B 1K1JA 4GCHF 2EC9H 4MPWA 1YPMH 4A6LA 3SV6A 5K7RA 2GCHG 4NIXA 1SGDE 5EGMA 4Y79A 4MDSA 1JWTA 3ZZ9A 2STAE 2B0FA 1DUEA 2FX6A 1C1WH 3EA9A 2BLWA 2Y7XA 4H4FA 5FPSA 1O33A 3SOSA 2VIOA 1BHXB 3ZZ4A 1E34B 1SGNE 4X1QU 1AGJA 1GBDA 1DUAA 3MH7A 1YPEH 2QF0A 1NFYA 1G37A 2Z9GA 2P94A 2A4OA 1YPKH 2ZHEH 4LXBH 4NA8A 5JBBS 2QXJA 2OBOA 4RSPA 1K22H 5EXNA 3PMHB 1O2RA 4E7RG 1CSOE 1GMDG 4ISIH 2C8XB 1EZUC 1HAIH 2GZ8A 3F1SB 4B71A 1H1BA 2RA3A 4AB8A 4TPIZ 1ELGA 5CHAC 1VITG 3U1JB 3WY8A 1ZHPA 3T27A 3BEUA 5I25A 2BY5X 1WTGH 3LH3A 3SV9A 1O5FH 1G9IE 2AGEX 2RCEA 3KNXA 3LC5A 2GMTB 3SJKA 3TPIZ 1GMCG 1XVMA 1EZQA 1KIGH 2FOFA 2BD5A 2P3TB 1IQFA 3M36A 1TNIA 1C1TA 3M37A 5L2YH 1GBJA 1ZSKA 2PFEA 5I46H 1V2JT 4BAKB 1UVUH 2I6SA 4HI3A 5FXLA 4Y6DA 5FBIA 1PPEE 1WSSH 1LHFH 4RN6A 1O3IA 1CA0C 2A31A 1ESBA 5C2ZA 1TNHA 4MVNA 3SJ8A 3FVFB 2WPIS 1GBIA 3P70B 1N8OB 2ZU4A 2BVSH 1CT0E 3F9GA 2HPPH 3PO1C 1E37B 2SGEE 3M7UA 1DWBH 2EI6A 3GY8A 9LPRA 3A84A 4AZ2B 1UO6A 2BY6X 3RXJA 1BJUA 4JZEH 3ELAH 4I32A 4WMDA 3UPEA 3ATIA 1UK2A 1QL8A 2XTTB 2JH6D 1GI2A 4D9QA 3GCTF 3TNTA 5JBCS 2H1UA 1P11E 5JBTA 2PSYA 1TNKA 1FPCH 1YCPM 1DY9A 1EJNA 3V13A 3K9XB 1QL7A 1Z7KA 3NXPA 1GMHG 7GCHG 1LVOA 3VXFH 5GJ4B 5GWZA 2V6NA 2XNIA 4XFQA 2WPLS 2ZGXH 6GCHF 1KY9A 3RXHA 1KYNA 2ZA5A 2V3HH 3GY3A 3TVJB 4BAHB 3DFJA 5J4QA 2Z9IA 4DY7B 5FPTA 2PV9B 3TITA 2ZTXA 2ZGHA 1UTMA 1AKSB 1FPHH 1S5SA 3NZIA 3RMMH 1LVYA 3BTEE 1BRBE 3M5MA 1MTSA 3RLYH 3EGKH 1G3EA 2HNTF 3BIUH 1UK4A 4YESB 1O2XA 2ZO3H 4GUXA 1IQJA 2QXGA 4TWYA 1T4UH 1MTNB 2W5EA 4JMYA 1XUIA 1TOCB 4BAMB 4AGJA 1OP0A 2SGFE 2FO9A 3NKKA 3SQEE 1ZMNA 4CRFA 1HIAB 2XW9A 1SL3A 3VGCB 1MKWH 1O3JA 1ZTLA 1KLJH 1V6DA 1C5LH 5E2PA 1DWDH 1PQ7A 1OP8A 1ELCA 3I77A 3A7VA 1NRNH 4AG2A 1GBBA 2FDAA 3UQVA 1BZXE 4Q7ZA 2YOLA 4WH8A 4Y7AA 3VB5A 1K1OA 2TIOA 1Z8JB 1QA7A 1AD8H 3QGNB 4ZHMU 1RTKA 1OWDA 3PLBA 2G4TA 4UEHH 3F68H 4MLFB 1MCVA 1GBEA 1GBKA 3KF2A 1ARCA 1IQEA 2ZFPH 2ZGBH 2RG3A 3FP6E 2BD3A 4NGAH 2WPKS 2TGDA 1BOQA 2AMQA 4ABJA 5GPIB 2ZECA 1O3EA 4Z6AH 2G5VA 4BTTB 2GMTC 3T28A 1RIWB 3ZVGA 1QA0A 1SLUB 2A2QH 5EQRA 4ISLA 4B2AA 4X8TH 1QL9A 4K60A 3E8LA 1KDQA 2FOEA 1C1MA 1G32B 1DXPA 1P9SA 2BVRH 2Y6TA 1LHGH 1Z8IB 2H9EH 1NRPH 1C2FA 3MWIU 2H9TH 1V2OT 5BRRE 1P02A 3O8DA 1T8MA 4TWWA 1FY5A 2WUBA 1S84A 8LPRA 1FJSA 3MNCA 4RKJB 1HNEE 1SHYA 3V12A 1N8OC 1DDJA 2ODYB 2OLGA 4KTUA 1THPB 3A86A 1MKWK 4LOYH 3PWBA 4I7YH 5T6DA 1TABE 3UR9A 4YT7H 2ZU3A 1SGRE 3GCHB 5T3HA 1GWAA 2ALPA 1K9OE 2BYAX 2OP9A 3TNSA 3UNSA 1BTHH 4ZKOU 4JYTA 5DP8A 1DFPA 3OTJE 3E3TA 2BD2A 4X2YA 1MD8A 4A7IB 4CR9A 2BDIA 1C5NH 4XOJA 3P95A 1PYTC 3AAVA 3RXIA 1OYQA 3E6PH 2FIRH 1C5ZB 1FAKH 5DP5A 2XC0A 1FXYA 1Z71A 2QCYA 4X8SH 1K21H 3BTKE 1X7AC 3QTOH 3SUDA 4ZXXH 1DSUA 1F0SA 5HM9A 1L1GA 1D3DB 4XE4A 1Y3XA 1TRNA 5C20A 3PWCA 1P2IA 2CHAB 1C5RA 4IS5A 2ZFSA 1C2LA 1XMNB 2BDGA 3ZZCA 1ESTA 2WYJA 2ANWA 4NFFA 4B76A 4BAOB 1ID5H 4FUCA 3SBKA 2GP9B 2OQUA 5DO4H 3MMGA 3RXVA 4FU9A 1WQSA 2Q6GA 3MNBA 1XUJA 1QB9A 3R0FA 2NU1E 2F91A 3RU4E 2PWXA 2HWLB 1T8LA 2ASUB 1MKXK 2GT8A 1O2VA 4FUEA 2Z9LA 3SU1A 1PPHE 4Y0ZE 2ZZUH 3ODFA 2A32A 2J34A 2XWBI 2OTVA 4M7GA 1VCPA 3O8RA 1V2PT 3HATH 1EKBB 3DFLA 1GHAF 1HAPH 3VGCC 4JK5A 2CGAA 3M3VA 4HGCA 1AMHA 4FVBA 5PTPA 1WV7H 1CU1A 1NO9H 2C8WB 4DVAU 1AI8H 1EAIA 3B9FH 1HV7A 2FLBH 1P0SH 5A0AE 3P8FA 1L1NA 1O3DA 4O3TA 3MU8A 2VIWA 4DURA 1AVXA 3SORA 1BUIA 1GCTB 3AW1A 1VR1H 4O03A 1SGPE 4XBCA 1MMJN 1GHBG 4MPXA 4K8BA 3RLWH 4A5TS 4YLUA 2VWOA 1G36A 4BNRA 1DE7H 1IAUA 4Q2KA 1LHEH 4DGJA 1O3MA 1O2PA 3M35A 1A7SA 1UVPA 1RIWC 2SNVA 1SR5C 1GI9B 3A8BA 1TGBA 4ISNA 3VEQB 2AMPA 1NROH 3S9BA 3ZVFA 1O2UA 2BDHA 1P2NA 5DG6A 5EXLA 1HAGE 1IQLA 1V2VT 1G30B