3W94A

Structure of oryzias latipes enteropeptidase light chain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
235
structure length
235
Chain Sequence
VVGGVNAEKGAWPWMVSLHWRGRHGCGASLIGRDWLLTAAHCVYGKNTHLQYWSAVLGLHAQSSMNSQEVQIRQVDRIIINKNYNRRTKEADIAMMHLQQPVNFTEWVLPVCLASEDQHFPAGRRCFIAGWGRDAEGGSLPDILQEAEVPLVDQDECQRLLPEYTFTSSMLCAGYPEGGVDSCQGDSGGPLMCLEDARWTLIGVTSFGVGCGRPERPGAYARVSAFTSWIAETRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Enteropeptidase-1
publication title Structure basis for the unique specificity of medaka enteropeptidase light chain.
pubmed doi rcsb
source organism Oryzias latipes
total genus 54
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3w94A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3w94A01
1O2YA 1LHFH 2PV9B 1T8NA 3ZZBA 1TFXA 2VVCA 4I8KA 4DJZB 1UTPA 2WUCA 3H7TA 5HM9A 2PKAB 1C5NH 2VIPA 3PTBA 2WUBA 1SGCA 1LTOA 2SGQE 2RG3A 1GL1A 2G5VA 1G36A 2Y6TA 1O3EA 2VIWA 3SUDA 1S6HA 3A87A 1ELDE 3VB3A 1SOZA 2GTBA 1QBOA 1SGNE 4CR5A 3MI4A 1D3DB 2A45B 1MMJN 5FPYA 1O2ZA 2JH6D 1W2KH 4NIVA 1TX6A 1P05A 2Y7XA 1KDQB 2PKAA 1FLEE 1V2PT 2QXGA 3TVJB 4YTAA 4I8HA 4WY3A 1EP6A 1O35A 3ENSB 3KL6A 2VWLA 1RTKA 1TBRH 2TRMA 3C1KA 3VGCB 3MTYA 4ZH8A 1K1PA 3MFJA 2R2WU 1NM6A 1NU9A 1C2JA 4UFGH 3PTNA 1IQHA 1HAVB 2A32A 1ARBA 1C2MA 1ANBA 2Y5FA 1G30B 1P09A 4YOJA 4WXVA 3RXGA 2VVVA 5EQRA 3LT3A 3TGKE 1PPHE 3VPKA 1FN8A 1EAWA 1NY22 2F9UA 3E8LA 1P02A 2TBSA 1K1OA 3A86A 1G9IE 3DFLA 3LH3A 1VITF 2PR3A 3LGTA 1YPMH 3EA7A 1GBCA 3SNAA 2WPLS 4I8GA 5FBIA 4ISLA 3SUGA 1O3JA 3MO6A 4FUGA 1TX7A 1PPFE 1GHAG 1EPTC 1YPKH 3BTKE 4D7FA 3P92A 1IQJA 1O2XA 2G00A 4YOIA 1DOJA 2GDEH 2OBQA 3BEUA 1AU8A 1EASA 1W11U 1MZAA 2SGDE 4Y7AA 3BTFE 3M5MA 7KMEH 1O5AB 1NFYA 1YCPH 4Q7XA 1K1NA 1GMDF 1TGTA 1BMMH 1EXFA 1DT2A 1KLTA 2FOAA 1XXFA 2ZHQH 5FBEA 3LGUA 1GCTB 3S9AA 4AYYB 3TK9A 1TALA 1K1LA 3ZYDA 1SMFE 1CA0B 2ANKH 2ZHFH 3SV8A 1PQ8A 1VITH 3EA8A 4BAHB 5JBTA 1LQEA 2BY5X 3S0NA 1KXCA 3OTJE 1TA6A 4DIHH 2H9HA 3TLOA 1F0RA 2FOFA 4Y79A 1UHBA 5EQQA 4NSYA 1MH0A 1LPGB 3KGPA 5EXLA 4CRDA 3RXIA 3UUZA 3MNBA 1LMWB 3GCTG 2JKHA 4FXGH 1HYLA 3CS0A 1SSXA 3S7HB 4TPYA 5F03A 3F68H 4GHTA 4JZIA 3M35A 4ZKOU 3FP8E 4X1SU 1QB1A 1WSSH 2QAAA 1GCTC 1JMOH 4NIWA 1CA0C 1SG8B 1IQEA 2EI6A 1TGBA 3WY8A 1MTSA 4X6PA 1RTFB 2QN5T 3RXEA 1C2DA 3P6ZB 4IBLH 3ZVGA 2PKSB 2JH5D 3ZV8A 1FNIA 2PSXA 4XBCA 2R3UA 1UTNA 1O3HA 1AVXA 3T62A 4B2BA 2A5AA 3ATMA 1UVSH 1C9PA 1H9HE 2XBVA 3PLKA 1DX5M 2ZQ2A 5GPIB 3UPEA 1GI9B 2OLGA 1NFXA 4FVDA 3RDZA 5JDUB 1CBWB 1TGNA 3SZNA 5IDKA 1HUTH 1AB9C 1EZXC 1P10A 3EAJA 2ZU4A 1ZGIA 1BRUP 2P94A 2FDAA 1IQMA 5ABWA 3IITA 1NRQH 2A31A 3M36A 1HJ8A 3BEIB 1J14A 1HNEE 1GVKB 1ORFA 2B8OH 1SOTA 2PKSC 1XKAC 2ZU5A 1ELGA 1TBQH 3T28A 1P2KA 1ABIH 1GHBG 1C5SA 1UTOA 1V2LT 1C5RA 1KLIH 1TRNA 1YCPM 3VEQB 2ALVA 3ZVBA 1O3KA 1ZSKA 2PGBB 1TQ0B 3TNTA 1W3CA 3MH5A 3SGQE 4AG2A 1V2WT 5F8XA 1MTNB 4K8BA 3RXSA 2BTCE 1O5CB 3UY9A 3RXTA 1C2IA 2ZFTA 1NRPH 1XKBC 3RXHA 2QXJA 3SN8A 4K2YA 4A6LA 2TGPZ 2FOEA 2WPIS 1CHOF 3NZIA 3SU1A 3RM0H 4BAMB 4ABAA 1SGDE 2W3IA 5I25A 1SHYA 1UVUH 2AERH 4K60A 1FPCH 4RKOB 3V3MA 2ZDNA 4O3UA 1C5QA 1W7XH 3F9HA 1O3IA 3SNBA 1AE8H 2BD2A 2RCEA 2TIOA 3UTUH 1TNJA 1ETTH 3SU5A 2GZ8A 3NKKA 3LKWA 4VGCC 1C5YB 1GI2A 3TPIZ 4Y6DA 1TONA 5AFZH 3H7OA 1A5GH 2BQWB 2ESTE 2XC4A 4MPXA 4B76A 1F5KU 4BXWA 1GVZA 1W8BH 2LPRA 4Q80A 5LPFA 1DSTA 5HYOA 1WCZA 5E0JA 1F7ZA 3MWIU 1Q3XA 4INKA 1BTHH 2A0QB 2F9NA 2GX4A 1AY6H 4F49A 4INLA 5L2ZH 3A7XA 1QA7A 1HAIH 3RU4D 1GJ6A 2G51A 1FUJA 1AO5A 1GI4A 2Z9GA 1OXGA 4CBNA 3GCHC 3Q00A 4GLYA 4UFFH 2FZZA 2ZFQH 4R8TB 1BT7A 3DA9B 3ZVEA 1D9IA 4MDSA 3V0XA 1GI0A 5AVDA 2C8XB 1EOLA 2UUJB 2P3TB 3ATLA 1DLKB 2FS8A 1L4DA 1TB6H 2R0KA 4XFQA 2C90B 1HB0B 3CS7A 3BIVH 3E6PH 1YPGH 4BAOB 4JZDH 2GV7A 1XUFA 2ZCHP 1DANH 3RXKA 2BXTH 4BANB 7ESTE 2HALA 4BNRA 2XBYA 2R9PA 1SGRE 5DP3A 3RC5A 2FEQH 3U69H 1LPZB 3QLPH 2P16A 2G4UA 3ATWA 1GG6B 2BOKA 2DE8A 4WVPE 1NROH 1OSSA 3GCNA 2BYAX 4BTTB 3F1SB 1FXYA 3LGIA 5E2PA 2BY6X 1EZQA 4YT7H 3ZZ7A 2GMTC 4D76A 2SGAA 2A4GA 1JRTA 1OWDA 2HWLB 1O32A 3A8BA 1HPGA 5A0BA 2A2QH 1GBEA 4X6OA 3SORA 3UQVA 3RXOA 1SBWA 2W26A 4X0WU 1C2FA 1O31A 2Z9IA 4Y8ZA 3V12A 3TH4H 4X8SH 8GCHG 1CT4E 2GDDA 1O3LA 3M7QA 2O8TA 5JB9S 1ABJH 1FI8A 1DS2E 3SGAE 1LDTT 1SB1H 4HGCA 4IGDA 2A7HA 4FUEA 3I77A 3Q3KA 3V7TA 1VR1H 1IHTH 4CHAB 3D62A 1FY4A 2V0BA 2C93B 2OINA 1D4PB 1ZYOA 1IHSH 1GMHF 2H5CA 1O2HA 1ZPCA 3SNCA 4ABHA 2GGVB 3UR9A 3LDXH 1O30A 5AFYH 2BDHA 1ZTKA 4X8TH 1FZZA 2ZGJA 2ZHEH 1SL3A 1WBGB 4JZFH 1KTSB 2D2DA 5GJ4B 1O5FH 4AORA 3GYMA 1C5MD 1HIAB 2BDBA 1OYQA 1Z6EA 1FAKH 2ZEBA 1L1NA 1TLDA 4K1EA 2F9OA 5TCCA 4IS5A 2FMJA 1C1PA 1WQSA 2FI5E 2PTNA 5LH8A 2J38A 3L6PA 1O0DH 2ZU3A 5AHGH 2IOTA 1DXWA 5E2OA 1V6DA 1WTGH 1M9UA 1O3OA 2G52A 4U32A 4GSOA 1SGIB 5FX6A 2A7CA 1HIAA 2J94A 3BSQA 1EX3A 2BLWA 2JH0D 4DURA 1EQ9A 1FN6A 1UK4A 3S69A 2BD7A 1G37A 5JB8S 1GBAA 1C1MA 3U1JB 3NPSA 1JWTA 3VB6A 4D7GA 3URCA 2BB4A 5E0HA 2R0LA 2ZCKP 1K1JA 4SGAE 5T6FA 5C1XA 4H42U 4I7YH 3LC5A 1GJDB 4I8LA 1N6YA 2ZKSA 1A2CH 4ABGA 4MNYA 5IYTA 2Q6FA 2VNTA 1UK2A 2VWNA 1BRCE 2OTVA 3PB1E 2BQ7B 3ZZ6A 5I46H 3T29A 2FOMB 3KIDU 1A7SA 4J1YA 1P3EA 3ZZ9A 2A4RA 1A4WH 2NU0E 3SQEE 4ZXXH 4O03A 1Q2WA 2NU1E 2ODQA 3LGVA 3MMGA 5JBAS 2JETC 2WYGA 2HRVA 1NESE 3DFJA 5FCRA 1VGCB 2AS9A 3GDSA 3BN9A 2ZDLA 3IWMA 1C5TA 3A8DA 1PPCE 2FOCA 1O2IA 2VH0A 1T4UH 1CGJE 1ESBA 2HNTC 1Y3VA 1EUFA 2FI3E 2A5KA 1TNIA 1MQ6A 3E16B 3OYPA 1SGFG 3E1XB 1O2LA 2VWMA 3H5CB 1ZTLA 1ZPZA 1Z1JA 1A5HA 1MD7A 1C1VH 1YP9A 1GBLA 2BLVA 7GCHF 1WAYB 2BY9X 1ESTA 3QN7A 3SJOA 1YKTA 4X8VH 1QBNA 1W7GH 4KTSA 1T32A 1GHYH 3A82A 1T8OA 2PHBA 1Y3UA 3O8BA 1F5LA 1SC8U 2QY0B 4FU7A 1GI6A 1TOCB 3SV7A 3VB5A 3SUEA 1MTUA 2G5NA 2FESH 1YPHC 4OS4A 2ZPRA 3RMLH 5G4BA 1QURH 1QJ6B 4TWWA 2GCHG 1HAOH 2XWBI 3RU4T 1IOEA 1AWHB 2GD4B 4WXIA 1XMNB 4ZKSU 1P2IA 1HGTH 4PROA 1FQ3A 2WPKS 5JPMH 1UVPA 2SGEE 4JK6A 1FAXA 2XNIA 1HXFH 1ELEE 3NK8A 1AZZA 3SGBE 3SV9A 1MBQA 1MTWA 1HLTH 3TH2H 1KLJH 1FY1A 1D3TB 4IC6A 1D6WA 3HK6B 1H8DH 3MO9A 1T8MA 2OBOA 1C1UH 3QDZB 4HI3A 1Y3YA 1GWAA 2OXSA 2FOGA 1GBJA 1ZHRA 4ZHLU 4NA7A 1ANCA 1LHGH 1PQ5A 4E06H 1OWJA 3RMNH 2GKVE 5GCHF 1AZ8A 1AUTC 2GVFA 2VJ1A 1BTPA 1ELFA 3GDUA 4HTCH 3UFAA 2O8WA 3B9FH 1V2QT 4GCHF 4UD9H 4Q2KA 5A8XA 1ZHPA 1GBIA 3SU0A 1A3EH 2VH6A 1DXPA 2ZU1A 1GJ4H 1KIGH 4ISNA 3ZVAA 2TGTA 1A5IA 4ZMAH 1ZZZA 1Y59T 2XXLA 1GMDG 3BTHE 1N6XA 2VIVA 1OWHA 1GBTA 1OP2A 4NG9H 4B2AA 2W3KA 4Y0ZE 1NZQH 2STBE 2DE9A 1NRRH 2IN2A 3GCOA 1QFKH 1HV7A 1QRXA 1N8OC 2C3SA 2ZDMA 1C1TA 4MLFB 2Q1JA 2H6MA 3QZQA 1THPB 1EPTB 6ESTA 2IPHA 1P06A 4JZ1A 3AW1A 1S81A 3UWIA 4DOQA 3KCGH 3K6YA 1C5OH 4FVBA 1KDQA 3Q76A 5DJ7A 2PGQB 1FPHH 2QGRA 1J9CH 1G2MA 2ZFRH 1E0FD 2EI8A 3ESTA 3P8GA 3PMAB 1D3QB 4LOYH 5EGMA 3Q3YA 3PMBB 1FV9A 4ESTE 2Y5HA 4ZHMU 1HAVA 1LPKB 2ZDAH 1ETSH 2F83A 4DT7B 1RRKA 5LGOA 3STIA 1UTKA 3MU4A 1DWDH 1FDPA 5C5OA 1AE5A 4XOJA 1PQ7A 4I8JA 1XXDA 1YLDA 1QA0A 1QR3E 3VXFH 8KME2 1S83A 3P8NA 3SI4H 2BXUH 5A0AE 1BITA 2P93A 4K5ZA 2OD3B 2ZF0H 2RDLA 3GY4A 2CHAC 1S85A 1A46H 3UNRA 1U6QA 2ZECA 1QL9A 1C2KA 1F0TA 1BHXB 5EXMA 1EJAA 1TX8A 1C5WB 3C27B 3EDXB 2J4IA 5C3NA 1TABE 2XWAA 1UK3A 2ZNKH 3PMJA 4KTUA 1O3CA 1A0LA 1V2KT 2EI7A 1Z8GA 3RXCA 2BVXH 3GY3A 2G81E 4NIXA 4Y0YE 4JK5A 4DGJA 4ABEA 3SHAH 3SNEA 2CMYA 1QNJA 4TPIZ 2QIQA 2YOLA 3FVFB 1G32B 1BIOA 1GBHA 1P2JA 4CRGA 1ZMJA 1L0ZA 4ZROA 1P01A 3FZDA 3RUOA 1EZUC 4MVNA 1IQLA 1TAWA 4OS1A 4Y8XA 2OUAA 3S9BA 2FX6A 5JBCS 2Z9LA 2B0FA 1O2OA 5LPEA 3SU4A 1B0FA 4D9RA 1AB9B 1O3NA 4Y7BA 1QB6A 3BTWE 1MTVA 3P70B 2SNVA 2C8ZB 4XBBA 2FYRA 3NXPA 5DP8A 3GY7A 2WPMS 1ZR0A 2I6QA 1A3BH 4K1TA 4CRCA 1O2KA 1X7AC 4IW4E 4NZQA 4B71A 5C1UA 1HFDA 8LPRA 3KQBA 3PM3A 4NA9H 1ESAA 3TGJE 1ZJKA 2BY8X 3HK3B 1ZRBA 4XDEA 1A0JA 8ESTE 2HPQH 1ZGVA 3FP7E 3LIWA 4I33A 3SU6A 3MU5A 1CT2E 2BVSH 2Y81A 3FAOA 1RXPA 1P04A 1YCPK 3P8FA 1B5GH 1IQNA 1RIWC 3SV2H 5SGAE 2QXHA 4X2YA 2WV4A 5EQSA 1AKSB 4TWYA 1V2UT 1GHAF 1TOMH 3KHVA 3ODDA 3SNDA 3NWUA 2BDCA 1K21H 2Z94A 1XX9A 4WF8A 1QQ4A 1AVWA 1XUHA 4UFEH 1UO6A 2ZA5A 2XTTB 5C67A 4A1XA 4X1NU 3RXLA 1EAXA 5GXPA 1HJAC 3U8OH 3TH3H 1S84A 1SQTA 4HZHA 4IMQA 3ZZ4A 5CHAC 5EW2H 1H9LB 4CREA 1F2SE 1B0EA 1XVMA 2WINI 4X2XA 3RU4E 1H4WA 4Y10E 4VGCB 2BDAA 3SI3H 1O2WA 4X1RU 2NWNA 1NC6A 1GPZA 2HVXA 2IJOB 2EC9H 4WMEA 1RJXB 1BJVA 1EAIA 2PUXB 4O9VA 3TNSA 3GOVB 3K65B 3SW2B 2THFB 1HRTH 3GCTF 1TE0A 1GHVH 4XBDA 5GWZA 2V3HH 1PJPA 1ARCA 3QTVH 4JYVH 1CGIE 1PPBH 1PPGE 1CE5A 3GCHB 2SNWA 2A2XH 1DSUA 1SI5H 1UJ1A 1Y5UT 2Z7FE 4JCNA 1BDAA 3BTDE 2F9PA 2O8UA 4WH6A 1WV7H 4YO9A 1GBFA 4NWLA 3QO6A 3RXFA 2WPJS 5DG6A 1O36A 4AFZA 4B1TA 1EB2A 1INCA 5EG4A 1JXPA 5DP4A 1O2MA 3UOUA 4XE4A 1CHGA 1KXAA 4RKJB 3ZYEA 1DE7H 1C5LH 3O8DA 1BTUA 4IC5A 2BM2A 1GHXH 1O2VA 1UCYK 4I32A 3LH1A 2FLRH 7LPRA 4NFEA 1PQAA 1UTLM 5J4SA 3O8RA 3IG6B 2UWOA 1C4V2 1PPEE 4A1TA 2P8OC 1TGSZ 1AN1E 6GCHG 1GHBF 2GMTB 1QQUA 3S7KB 2ZZUH 3ZZDA 1Z8RA 1DVAH 6CHAC 1G3BA 2LNCA 1RS0A 2C8WB 2ASUB 5CE1A 1L1GA 5EODA 1GMHG 2FXRA 2HNTE 3T2NA 1GJBB 1P12E 4A7IB 2FYQA 3RP2A 1DICA 1KYNA 4K8YA 1GJCB 1ELCA 4MNVA 1QHRB 4AX9H 1TRYA 3K6ZA 2A4OA 3AASA 3E0PB 1SPJA 1ANEA 2GP9B 2V3OH 3MOCA 2ZFSA 3F6UH 3LU9B 1NU7B 2NU2E 1RD3B 3LJOA 1W0ZU 3W94A 2BD3A 3MNSA 1G3EA 3SJ8A 1D6RA 4AGJA 1TNKA 2AEIH 1LKBA 2G4TA 2XW9A 1DDJA 1LQDB 5F6MA 3I78A 5LPRA 2VWOA 2O8LA 4FU9A 3LC3A 2A7JA 2QA9E 2BD5A 4OGXA 4KELA 3RXBA 4DY7B 3M37A 1O39A 4X8UH 1ZJDA 5PTPA 3A7TA 3BG4C 5A2MH 4JYTA 1C1RA 3R0FA 2ZP0H 5E8EH 2OP9A 3KF2A 2QYIA 4A1VA 3SHCH 3UIRA 3FFGA 2F9VA 1GI1A 4JZEH 4U2WA 2AGEX 2UUYA 2QF0A 1VCQA 2FM2A 1C2HA 2ZPSA 1P8VC 1DM4B 1UMAH 1XUKA 3D65E 4ZAEA 1V2TT 2ZWLH 4MNWA 1YPEH 1GL0E 2W7SA 4GHQA 3STJA 2F3CE 1AI8H 4Z0KA 1LHCH 1UVTH 1TPSA 5TJXA 1XUJA 1SFIA 2H9EH 3QWCH 4BTIB 1MU6B 1OP8A 2NU3E 3M5LA 3F9GA 4Y76A 1S0QA 5DP7A 1FIZA 2XCFA 3ZVFA 4K3JA 1SGEE 3RXDA 3P8OA 1Z1IA 1AMHA 1LVYA 2K1QA 4WMFA 3SJIA 3HGPA 1BMLA 2SFAA 1O3BA 3RMOH 4KTCA 3S9CA 4QT8C 1GHZA 2CF8H 2ZI2H 4INHA 1BTWA 5CMXH 2AMDA 3SU3A 3MU8A 4H6SB 3A80A 1S5SA 3U8RH 1DUAA 1PFXC 3RXJA 1BRAA 1TRMA 1P0SH 2R2MB 1GI7B 1C4Y2 2ZQ1A 4X1QU 1SGYE 3VFEA 1YBWA 1ELBA 1WOFA 4CRFA 1O5EH 4D8NA 2QCYA 2QC2A 3PO1C 2A4QA 2JETB 1GHWH 3MNXA 1V3XA 2ZGHA 1C1NA 3RXAA 4TY7A 1DWBH 1S0RA 4FUIA 3BIUH 4B75A 1NPMA 4UFDH 3T27A 1C2GA 3MNCA 4MPUA 2P95A 4A92A 1OYTH 2TGAA 3FANA 4Y11E 1BB0B 4F4OC 1MZDA 1HCGA 1O5DH 3KQDA 4JMYA 3M7UA 2H2ZA 1BBRE 8GCHF 4LXBH 3RM2H 1GDUA 1QBVH 2H1UA 1Y5BT 1W0YH 4YZUA 1SGFA 4FUCA 1MAYA 1W14U 4X1PU 2A1DB 4ISHH 2I6SA 3LPRA 1YPJH 2J95A 4UONA 1FJSA 3A7VA 1VCWA 3E91A 3EE0B 1ZHMA 3A88A 3SOSA 3ATIA 3HATH 1MCTA 3Q77A 1NS3A 1GMCG 1VZQH 6LPRA 4X2VA 3RC6A 4ASHA 2CV3A 2SGPE 4K69A 1T7CA 2GT8A 3BG8A 3I29A 2XC5A 4FUFA 2ZFFH 3NUMA 3ODFA 3QX5H 3E90B 4SGBE 2FODA 2XYAA 4CH2B 4AYVB 1ZSJA 3DD2H 3DHKH 1GI3A 1P3CA 2P59A 5GCHG 1QIXB 2CXVA 3RXVA 5DKMA 4NA8A 3ZZAA 4JYUH 1ZLRA 3T26A 1JRSA 4AB9A 1HAGE 1TPOA 1KSNA 1RTLA 5FXLA 2V35A 3P95A 4NFFA 1TMBH 4GVUA 2ZDVH 1HAZB 1GJ7B 5TCAA 4AN7A 4DCDA 2ZHWH 1DY8A 1Q31A 1GGDB 1EZSC 3GY8A 1P2MA 1GI8B 2TGDA 3ZVDA 2BX4A 1J16A 4GUXA 4ISOA 2FTMA 3AAUA 2BDIA 1MKXH 2Q6DA 4ABIA 3LOXA 2Y82A 1Z7KA 2YNAA 1YGCH 3UNQA 1Y8TA 1GJ5H 2O9QA 1C5ZB 4CRAA 1CA8B 4O97A 1KXDA 5E0GA 1OX1A 2GT7A 1AUJA 3A89A 3GY5A 1QGFA 2ZGXH 9ESTA 2GCTC 3LGWA 4B74A 4YOGA 5EXNA 2OC0A 1D3PB 3MH7A 1VCPA 4DIIH 4NCYA 3AW0A 2FOBA 1B7XB 1K22H 1DY9A 1AFQB 3OY5U 1VJ9U 1BTYA 1GGDC 3PYHA 4KGAA 2A5IA 5FPTA 3BTGE 4IMZA 2BD9A 1OKXA 1V2JT 2ULLA 1VITG 4X2WA 2VB0A 3RLWH 4UDWH 1MU8B 3QGNB 1MD8A 1N8OB 1RGQA 2BX3A 3W95A 5C20A 2QXIA 5HGGA 4MNXA 2AIPA 5EU8A 1O2RA 4B73A 3A8AA 1O2UA 5EPYA 5F8TA 1BJUA 1AQ7A 2ZGBH 2AFQB 3TJNA 3U98H 4ABDA 1K1MA 1V2MT 2B9LA 1UTMA 1GVLA 3OX7U 2Z3DA 4OS6A 2HNTF 3DUXH 1AFQC 3CP7A 4XSKU 1P03A 4U30A 1C2LA 1F92A 3V13A 5DP6A 2ZIQH 1TMUH 3SJKA 5A8ZA 3JZ1B 4CRBA 2PSYA 1BRBE 2FWWA 2SGFE 2KAIB 4RN6A 1HDTH 4WMDA 1L1JA 2PUQH 1MKXK 1SVPA 2AMPA 4AGKA 4CR9A 5DP5A 4UE7H 2J92A 5T6DA 5C5NA 1QCPA 3TJOA 3ZV9A 1IAUA 3ZZ8A 5C1YA 3U9AH 1C1WH 3A7WA 4Y8YA 2CHAB 3SUFA 2AGIX 2GCHF 1XVOA 2KAIA 4I31A 2ZTYA 1KXEA 3M5NA 1XUIA 1EPTA 1QL8A 1TGCA 2OCVB 2OC8A 4KP0A 3ZVCA 2ANWA 5T6GA 3Q3XA 1JIMA 1QRWA 5ESTE 2BDGA 1AIXH 3U8TH 3M7TA 3QTOH 5GIBA 4Q7ZA 2GZ7A 1ANDA 1DITH 4NGAH 1ELTA 4Y71A 1PYTC 2BY7X 2ZDKA 4AB8A 2Z6BD 2AIQA 4YM9A 3L33A 1N1LA 2ALPA 1ELAA 3R3GB 3UR6A 2HLCA 3QK1A 4X6MA 3VGCC 1QRZA 3PWBA 1O3AA 1EP5A 3A84A 1SQAA 3N7OA 1HAPH 2OQ5A 3LGYA 4MQAA 1BCUH 3FP6E 3KQCA 2ZCLP 4YESB 1XM1A 1GDNA 1O5GH 1EJMA 3PLPA 1UHBB 1BQYA 1P2QA 2BDYA 2D8WA 1GBDA 3KEEA 5ESBA 3ITIA 4WJG2 2J2UA 3MU1A 4AFQA 1DFPA 2J34A 5FHTA 1GBKA 2QV1A 1ZRKA 3T25A 3O8CA 5FAHA 1NRSH 2VIQA 1CQQA 2RA3A 1RIWB 4NIYA 4X6NA 1C5PA 4NZLA 3SBKA 1C5VA 2FO9A 1SHHB 3FZZA 1GJ8B 1O5BB 1YYY1 1HAXB 1DLEA 1LHEH 1L4ZA 1CHOG 3F9EA 2ZFPH 3RXMA 3BEFB 3F9FA 3MH6A 1V2ST 1TMTH 2FTLE 2CJIA 1C5XB 4TYDA 1WU1A 3GISB 1EKBB 1HJAB 3MH4A 1QJ1B 3RLYH 2FOHA 4BXSA 3K9XB 4R0IA 3SO3A 2BOHB 5CHAB 1O3PB 1CVWH 1IQGA 2HPPH 1H1BA 1F5RA 3PLBA 2Z9JA 4FU8A 1O3MA 1ZMNA 2NU4E 1TQ7B 1O38A 1UCYE 1SQOA 3MO3A 1LKAA 3A7YA 2BD4A 2VINA 3JZ2B 1W10U 3RXRA 5A8YA 5DPAA 5F8ZA 4E7RG 3LJJA 1BOQA 3P17H 1HXEH 1WQVH 4FUHA 3U1IB 1AVGH 2AH4X 1SLXB 1GDQA 1TNLA 5J4QA 2ODPA 2ILNA 4ZUHA 4U01A 4MTBA 5BRRE 4BAKB 1AKSA 1THRH 4WH8A 3K2UA 1HJ9A 1BTZA 3A81A 1KY9A 1G3CA 1O34A 2AYWA 1YLCA 1BBRH 1LVOA 5BPEA 1J8AA 1A61H 1HAYB 2OC1A 1P9SA 1Z8JB 4YLQH 1LHDH 1OP0A 1UTQA 2YNBA 1BZXE 3AVZA 3GYLB 1CBWC 1UVOA 2OC7A 4ZXYH 2B7DH 2BZ6H 5AF9H 5L2YH 4TY6A 2ANYA 2ZTZA 1S6FA 2Z3EA 5H4IB 1C1SA 1HBTH 1E34B 1OOKB 4YT6H 1E35B 5C2ZA 5EW1H 1NFUA 1T4VH 3PWCA 4OS5A 3D23A 2P3FH 3UOPA 1TWXB 2ZPQA 4ABFA 1SLWB 1MCVA 3EGKH 1RFNA 1BHXF 4H4FA 1W13U 2P8OB 2V6NA 1E36B 1KXBA 2AGGX 5HM2A 6CHAB 1TNHA 3HPTB 5B6OA 2R3YA 1Y3XA 5DK1A 2ZC9H 1SLVB 2CGAA 5JYIA 2EA3A 1AWFH 4LZ1H 1MTNC 2G55A 3B8JA 1LVMA 3AAVA 1P57B 1BMNH 3RMMH 3T5FH 1F0UA 3ZZCA 1OWEA 1IQFA 1SR5C 1DPOA 2Z3CA 4ZKRU 1YM0A 2W5EA 1CU1A 2FP7B 2PTCE 3TIUA 2WPHS 1BBRK 1H8IH 1GCDA 4FUDA 3RC4A 1TPAE 2CF9H 1C9TA 4MPVA 1MKWH 4WWYA 1C4U2 1TIOA 4M7GA 1O3FA 3UQOA 1ZMLA 1F0SA 1JIRA 2BHGA 3KNXA 2ODYB 1J17T 2PW8H 2PWXA 1YC0A 5L6NH 1SGQE 1SFQB 1A0HB 3BG4B 3TITA 1O2JA 4MG3A 1ZOMA 2PFEA 5EOKA 1FY3A 3CENA 2OQUA 2H9TH 1GJ9B 3E0NB 1T8LA 5EPNA 9LPRA 3LONA 4OS7A 3TJUA 1ACBE 1LO6A 1IQKA 2VIDA 4D9QA 4Z6AH 2F9BH 1Z71A 1QJ7B 1THSH 4H6TA 1MQ5A 2VU8E 1CT0E 3BTEE 1O2PA 5K7RA 1G3DA 1YPHE 4AG1A 2BLOA 5FX5A 3UWJH 1P9UA 2P3UB 1ELVA 1FY8E 3BTQE 4CBOA 2BD8A 4BOHA 3QUMP 5A0CA 1ZTJA 1C1QA 3RXUA 1KXFA 2PLXA 1WUNH 5ETXA 1EJNA 1EATA 3ZZ3A 1JOUB 3L3TA 1QY6A 3BF6H 1Z8IB 1VJAU 1MKWK 2BLQA 5DP9A 2C8YB 1LCYA 4LK4A 2H5DA 2XBWA 5DO4H 3PROA 1L2EA 1OPHB 4DW2U 1O2GH 4IN1A 1GG6C 3BTME 1IQIA 1BUIA 1JBUH 4J2YB 2BQ6B 3A85A 1OWIA 1C1OA 3A7ZA 6GCHF 2ANMH 3PO1B 1MBMA 1P11E 2FIRH 1ID5H 1GJAB 4YLUA 2B5TB 2ZTXA 1NFWA 1O2TA 4RSPA 1GI5A 1TPPA 2XBXA 3ATKA 4THNH 2UWLA 5HXFA 1SLUB 2RA0A 1E38B 2Y80A 1TNGA 2XC0A 3OU0A 2M5TA 5FCKA 1J15A 3TK6A 1QB9A 1NN6A 3HKJB 2VVUA 1K9OE 1MAXA 1S82A 1O2QA 5T3HA 4OS2A 1O37A 4LZ4B 3M5OA 5FPSA 1CGHA 3SJ9A 1V2RT 3UREA 7GCHG 4FUBA 3DT0H 3G01A 1V2VT 5GDSH 2EEKA 2J9NA 1W12U 4BTUB 4CHAC 3BTTE 3TK5A 1OWKA 4CH8B 1UTJA 3QGJA 4E7NA 2STAE 1YF4A 3GY6A 1ETRH 2O8MA 2UUFB 3KN2A 3OY6U 2GV6A 3OSYA 1AD8H 2G8TA 4FUJA 2GZ9A 4K1SA 2FX4A 4HFPB 2FPZA 2XRCA 3VB7A 3ELAH 1MUEB 1EB1H 2QF3A 4AFUA 1AFEH 3RXQA 3NCLA 4AZ2B 1O2NA 4O3TA 2HOBA 2UUKB 2Y5GA 1FMGA 2C4FH 1HAHH 4ZHAA 1GBBA 1TA2A 3B23B 1AHTH 2F91A 4ZKNU 4AOQA 1CO7E 3MU0A 3URDA 1FIWA 2DUCA 1TBZH 4DVAU 1K2I1 1WTHD 1GBMA 1TYNA 1E37B 1BTXA 1T31A 1NTPA 1O2SA 2D26C 4DG4A 2UWPA 1EAUA 3E3TA 5DGJA 2FLBH 1CSOE 1PPZA 3HGNA 5L30H 3MHWU 1K1IA 1UCYH 1ZPBA 4GCHG 2VGCB 1O33A 1DUEA 2BVRH 3EA9A 2GCTB 2BZAA 3KQEA 2FI4E 1G2LA 2VIOA 1BMAA 2TPIZ 4B2CA 2HGTH 3GICB 5HMAA 2Q6GA 3MYWA 4GAWA 2Y7ZA 4GPGA 1NO9H 3D49H 4KKDA 4A5TS 1SGPE 1Y5AT 3ZZ5A 3EYDA 1K28D 3TU7H 3VXEH 4IN2A 1NT1A 1XUGA 3HKIB 1A1RA 3SQHE 4E05H 4NSVA 3SV6A 2WYJA 1Y3WA 3BV9B 3PV4A 1VGCC 3GDVA 4NWKA 4BAQB 1C2EA 3TGIE 2ZHDA 1O3DA 1FY5A 3UNSA 3A83A 1FONA 3SU2A 1P2OA 2D1JA 2W7UA 2ZU2A 3M3TA 2BMGB 1WYKA 5JBBS 1EOJA 2ZG0H 1PYTD 1H9IE 5K0HA 3VB4A 4AFSA 2VGCC 1OS8A 1BA8B 4ABJA 1AGJA 3TJVA 3A8CA 3PMHB 3EQ0H 2FS9A 1YPLH 4UEHH 2ZO3H 4OGYA 3GY2A 2XCNA 2Z9KA 4ISIH 3M61U 1LVBA 2ZGCA 1SGTA 1KTTB 4Q7YA 1V2NT 1C5UA 1Z6JH 1P2NA 1ZSLA 1QTFA 5A09A 1DWCH 1V2OT 1GMCF 1DWEH 3M3SA 1O3GA 4MPWA 2WV5A 3M3VA 3QZRA 3RXPA 1QL7A 4ABBA 2CN0H 2AMQA 1NRNH
chains in the Genus database with same CATH superfamily
4HG6A 1O2YA 1LHFH 2PV9B 1T8NA 3ZZBA 1TFXA 2VVCA 4I8KA 4DJZB 1UTPA 2WUCA 3H7TA 5HM9A 2PKAB 1C5NH 2VIPA 3PTBA 2WUBA 1SGCA 1LTOA 2SGQE 2RG3A 1GL1A 2G5VA 1G36A 2Y6TA 1O3EA 2VIWA 3SUDA 1S6HA 3A87A 1ELDE 3VB3A 1EFRD 1SOZA 2GTBA 1QBOA 1SGNE 4CR5A 3MI4A 1D3DB 2A45B 1MMJN 5FPYA 1O2ZA 2JH6D 1W2KH 4NIVA 1TX6A 1P05A 2Y7XA 1KDQB 2PKAA 1FLEE 1V2PT 2QXGA 3TVJB 4YTAA 4I8HA 4WY3A 1EP6A 1O35A 3ENSB 3KL6A 2VWLA 1RTKA 1TBRH 2TRMA 3C1KA 4I86A 3MTYA 3VGCB 4ZH8A 1K1PA 3MFJA 2R2WU 1NM6A 1NU9A 1C2JA 4UFGH 3F0OA 3FKSD 3PTNA 1IQHA 1HAVB 2A32A 1ARBA 1C2MA 1ANBA 2RDEA 2Y5FA 1G30B 1P09A 4YOJA 4WXVA 3RXGA 2VVVA 5EQRA 3LT3A 2M2AA 3TGKE 1PPHE 3VPKA 1FN8A 1EAWA 1NY22 2F9UA 3E8LA 1P02A 2TBSA 1K1OA 3A86A 1G9IE 2EY4C 3DFLA 3LH3A 1VITF 2PR3A 3LGTA 1YPMH 3EA7A 1GBCA 3SNAA 2WPLS 4I8GA 5FBIA 4ISLA 3SUGA 1O3JA 3MO6A 4FUGA 1TX7A 1PPFE 1GHAG 1EPTC 1YPKH 3BTKE 4D7FA 3P92A 1IQJA 1O2XA 2G00A 4YOIA 2W6JD 1DOJA 2GDEH 2OBQA 3BEUA 5GNDA 1AU8A 1EASA 1W11U 1MZAA 2SGDE 4Y7AA 2V7QD 3BTFE 3M5MA 7KMEH 1O5AB 1NFYA 1YCPH 3DSPA 4Q7XA 1K1NA 1GMDF 1TGTA 1BMMH 1EXFA 1BMFD 1DT2A 1KLTA 2FOAA 1XXFA 2ZHQH 5FBEA 3LGUA 1GCTB 3S9AA 5EJZA 4AYYB 3TK9A 1TALA 1K1LA 3ZYDA 1SMFE 1CA0B 2ANKH 2ZHFH 3SV8A 1PQ8A 1VITH 3EA8A 4BAHB 5JBTA 1LQEA 2BY5X 3S0NA 1KXCA 3OTJE 1TA6A 4DIHH 2H9HA 3TLOA 1F0RA 2FOFA 4Y79A 1UHBA 5EQQA 4NSYA 1MH0A 1LPGB 3KGPA 5EXLA 4CRDA 3RXIA 3UUZA 3MNBA 1LMWB 2PP6A 5HIYA 3GCTG 2JKHA 4FXGH 1HYLA 3CS0A 1SSXA 3S7HB 4TPYA 5F03A 3F68H 4GHTA 4JZIA 3M35A 4ZKOU 3FP8E 2VBCA 4X1SU 1QB1A 1WSSH 2QAAA 1GCTC 1JMOH 4NIWA 1CA0C 1SG8B 1IQEA 2EI6A 1TGBA 3WY8A 1MTSA 4X6PA 1RTFB 2QN5T 3RXEA 1C2DA 3P6ZB 4IBLH 3ZVGA 2PKSB 2JH5D 4Q63A 3ZV8A 1FNIA 2PSXA 4XBCA 2R3UA 1UTNA 1O3HA 1AVXA 3T62A 4B2BA 2A5AA 3ATMA 1UVSH 2JDID 1C9PA 1H9HE 2XBVA 3PLKA 1DX5M 2ZQ2A 5GPIB 3UPEA 1GI9B 2OLGA 1NFXA 5IK2D 4FVDA 3RDZA 5JDUB 1CBWB 1TGNA 3SZNA 5IDKA 1HUTH 1AB9C 4ZCNA 1EZXC 1P10A 3EAJA 2ZU4A 1ZGIA 1BRUP 2P94A 2FDAA 1IQMA 5ABWA 3IITA 1NRQH 2A31A 5T1VA 3M36A 1HJ8A 3BEIB 3UAIC 1J14A 1HNEE 1GVKB 1ORFA 2B8OH 1SOTA 2PKSC 1XKAC 2ZU5A 1ELGA 1TBQH 3T28A 3F3BA 1P2KA 1ABIH 1GHBG 1C5SA 1UTOA 1V2LT 1C5RA 1KLIH 1TRNA 1YCPM 3VEQB 2ALVA 3ZVBA 1O3KA 1ZSKA 2PGBB 1TQ0B 3TNTA 1W3CA 3MH5A 3SGQE 4AG2A 1V2WT 5F8XA 1MTNB 4K8BA 3RXSA 2BTCE 1O5CB 3UY9A 3RXTA 1C2IA 2ZFTA 1NRPH 1XKBC 3RXHA 2QXJA 3SN8A 4K2YA 4A6LA 2TGPZ 2FOEA 2WPIS 1CHOF 3NZIA 3SU1A 3RM0H 4BAMB 4ABAA 1SGDE 2W3IA 5I25A 1SHYA 1UVUH 2AERH 5CHBA 4K60A 1FPCH 4RKOB 3V3MA 2ZDNA 4O3UA 1C5QA 1W7XH 3F9HA 2JIZD 1O3IA 3SNBA 1AE8H 2BD2A 2RCEA 2TIOA 3UTUH 1TNJA 1ETTH 3SU5A 2GZ8A 3NKKA 3LKWA 4VGCC 1C5YB 1GI2A 3TPIZ 4Y6DA 1TONA 3NRLA 5AFZH 3H7OA 1A5GH 2BQWB 5KEDA 2ESTE 3FO8D 2XC4A 4MPXA 4B76A 1F5KU 4BXWA 1GVZA 1W8BH 2LPRA 4Q80A 5LPFA 1DSTA 5HYOA 1WCZA 1H8ED 5E0JA 1F7ZA 3MWIU 1Q3XA 1YY3A 4INKA 1BTHH 2A0QB 2F9NA 2GX4A 1AY6H 4F49A 4INLA 2AHME 5L2ZH 3A7XA 1QA7A 1HAIH 3RU4D 1GJ6A 2G51A 1FUJA 1AO5A 1GI4A 2Z9GA 1OXGA 4CBNA 3GCHC 3Q00A 4GLYA 4UFFH 2FZZA 2ZFQH 4R8TB 1BT7A 3DA9B 3ZVEA 1D9IA 4MDSA 3V0XA 1GI0A 5AVDA 2C8XB 4ACAA 1EOLA 2UUJB 2P3TB 3ATLA 1DLKB 2FS8A 1L4DA 1TB6H 2R0KA 4XFQA 2C90B 1HB0B 3CS7A 2GJGA 3BIVH 3E6PH 1YPGH 4BAOB 4JZDH 2GV7A 3KQ5A 1XUFA 2ZCHP 1DANH 3RXKA 2BXTH 4BANB 7ESTE 2HALA 4BNRA 2XBYA 2R9PA 1SGRE 5DP3A 3RC5A 2FEQH 3U69H 1LPZB 3QLPH 2P16A 2G4UA 3ATWA 1GG6B 2BOKA 2DE8A 4WVPE 1NROH 1OSSA 3GCNA 2BYAX 4BTTB 3F1SB 1FXYA 3LGIA 5E2PA 2BY6X 1EZQA 4YT7H 3ZZ7A 2GMTC 4D76A 2SGAA 2A4GA 1JRTA 1OWDA 2HWLB 1O32A 3A8BA 3SZEA 1HPGA 5A0BA 2A2QH 1GBEA 4X6OA 3SORA 3UQVA 3RXOA 1SBWA 2W26A 4X0WU 1C2FA 1O31A 2Z9IA 2XOKD 4Y8ZA 3V12A 3TH4H 4X8SH 8GCHG 1CT4E 2GDDA 1O3LA 3M7QA 2O8TA 5JB9S 1ABJH 1FI8A 1DS2E 3SGAE 1LDTT 1SB1H 4HGCA 4IGDA 2A7HA 4FUEA 3I77A 3Q3KA 3V7TA 1VR1H 1IHTH 4CHAB 3D62A 1FY4A 2V0BA 2C93B 2OINA 1D4PB 1ZYOA 1IHSH 1GMHF 2H5CA 1O2HA 2HLDD 1ZPCA 3SNCA 4ABHA 2GGVB 3UR9A 3LDXH 1O30A 5AFYH 2BDHA 1ZTKA 4X8TH 1FZZA 2ZGJA 2ZHEH 1SL3A 1WBGB 4JZFH 1KTSB 2D2DA 5GJ4B 1O5FH 4AORA 3GYMA 1C5MD 1HIAB 2BDBA 1OYQA 1Z6EA 1FAKH 2ZEBA 1L1NA 1TLDA 4K1EA 2F9OA 5TCCA 4IS5A 2FMJA 1C1PA 2OK5A 1WQSA 2FI5E 2PTNA 5LH8A 2J38A 3L6PA 1O0DH 2QE7D 2ZU3A 5AHGH 2IOTA 1DXWA 5E2OA 1V6DA 1WTGH 4Z1MD 1M9UA 1O3OA 2G52A 2J98A 4U32A 4GSOA 1SGIB 5FX6A 2A7CA 1HIAA 2J94A 3BSQA 1EX3A 2BLWA 1E1QD 2JH0D 4DURA 1EQ9A 1FN6A 1UK4A 3S69A 2BD7A 1G37A 3OFND 5JB8S 1GBAA 1C1MA 3U1JB 3NPSA 1JWTA 3VB6A 4F48B 4D7GA 3URCA 2BB4A 5E0HA 2R0LA 2ZCKP 3WW7A 1K1JA 4SGAE 5T6FA 5C1XA 4H42U 4I7YH 3LC5A 1GJDB 4I8LA 1N6YA 5C17A 2ZKSA 1A2CH 4ABGA 4MNYA 5IYTA 2Q6FA 2VNTA 1UK2A 2VWNA 1BRCE 2OTVA 3PB1E 2BQ7B 3ZZ6A 5I46H 3T29A 2FOMB 3KIDU 1A7SA 4J1YA 1P3EA 3ZZ9A 2A4RA 1A4WH 2NU0E 3SQEE 4ZXXH 4O03A 3OEED 1Q2WA 2NU1E 2ODQA 3KYGA 3LGVA 3MMGA 5JBAS 2JETC 2WYGA 2HRVA 1NESE 3DFJA 5FCRA 1NBME 3F2HA 1VGCB 2AS9A 3GDSA 3BN9A 2ZDLA 3IWMA 1C5TA 3A8DA 1PPCE 2FOCA 4RT1A 1S6LA 1O2IA 2VH0A 1T4UH 1CGJE 1ESBA 2HNTC 1Y3VA 1EUFA 2FI3E 2A5KA 1TNIA 1MQ6A 3E16B 3OYPA 1SGFG 3E1XB 1O2LA 2VWMA 3H5CB 1ZTLA 1ZPZA 1Z1JA 1A5HA 3N7DA 1MD7A 1C1VH 1YP9A 1GBLA 2BLVA 7GCHF 1WAYB 2BY9X 1ESTA 3QN7A 3SJOA 1YKTA 4X8VH 1QBNA 1W7GH 4KTSA 1T32A 1GHYH 5KECA 3A82A 1T8OA 2PHBA 1Y3UA 3O8BA 1F5LA 1SC8U 5KGOA 3MQKC 2QY0B 4FU7A 1GI6A 1TOCB 3SV7A 3VB5A 3SUEA 1MTUA 2G5NA 2FESH 1YPHC 4OS4A 2ZPRA 3RMLH 5G4BA 1QURH 1QJ6B 4TWWA 2GCHG 1HAOH 2XWBI 3RU4T 1IOEA 2KCOA 1COWD 1AWHB 2GD4B 4WXIA 1XMNB 4ZKSU 1P2IA 2WHXA 1HGTH 4PROA 1FQ3A 2WPKS 5JPMH 4TT3D 1UVPA 2SGEE 4JK6A 1FAXA 2XNIA 1HXFH 1ELEE 3NK8A 1AZZA 3SGBE 3SV9A 1MBQA 1MTWA 1HLTH 3TH2H 1KLJH 2JJ2D 1FY1A 1D3TB 4IC6A 1D6WA 3HK6B 1H8DH 3MO9A 1T8MA 2OBOA 1C1UH 3QDZB 4HI3A 1Y3YA 1GWAA 2OXSA 2FOGA 1GBJA 1ZHRA 4ZHLU 4NA7A 1ANCA 1LHGH 1PQ5A 4E06H 1OWJA 3RMNH 2GKVE 5GCHF 1AZ8A 1AUTC 2GVFA 2VJ1A 1BTPA 1ELFA 3GDUA 4HTCH 3UFAA 2O8WA 3B9FH 1V2QT 4GCHF 4UD9H 3DCLA 4Q2KA 5A8XA 1ZHPA 1GBIA 3SU0A 1A3EH 2VH6A 1DXPA 2ZU1A 1GJ4H 1KIGH 2QF5A 3OAAD 4ISNA 3ZVAA 2TGTA 1A5IA 4ZMAH 1ZZZA 1Y59T 2XXLA 1GMDG 3BTHE 4B6FA 1N6XA 2VIVA 1OWHA 1GBTA 1OP2A 4NG9H 4B2AA 2W3KA 4Y0ZE 1NZQH 2STBE 2DE9A 1NRRH 2IN2A 3GCOA 1QFKH 1HV7A 1QRXA 1N8OC 2C3SA 2ZDMA 1C1TA 4MLFB 2Q1JA 2H6MA 3QZQA 1THPB 1EPTB 6ESTA 2IPHA 1P06A 4JZ1A 3AW1A 1S81A 3UWIA 4DOQA 3KCGH 3K6YA 1C5OH 4FVBA 1KDQA 3Q76A 5DJ7A 2PGQB 1FPHH 2QGRA 1J9CH 1G2MA 2ZFRH 1E0FD 2EI8A 3ESTA 3P8GA 3PMAB 2WV9A 1D3QB 4LOYH 5C0TA 5EGMA 3Q3YA 3PMBB 1FV9A 4ESTE 2Y5HA 4ZHMU 1HAVA 1LPKB 2ZDAH 1ETSH 2F83A 4DT7B 1RRKA 5LGOA 3STIA 1UTKA 3MU4A 1DWDH 1FDPA 5C5OA 1AE5A 2K8IA 4XOJA 1PQ7A 4I8JA 1XXDA 1YLDA 1QA0A 1QR3E 3VXFH 8KME2 1S83A 3P8NA 3SI4H 2BXUH 5A0AE 1BITA 2P93A 4K5ZA 2OD3B 2ZF0H 2RDLA 3GY4A 2EQNA 2CHAC 1S85A 1A46H 3UNRA 1U6QA 2ZECA 1QL9A 1C2KA 1F0TA 1BHXB 5EXMA 1EJAA 1TX8A 1C5WB 3C27B 3EDXB 2J4IA 5C3NA 1TABE 2XWAA 1UK3A 2ZNKH 3PMJA 4KTUA 1O3CA 1A0LA 1V2KT 2EI7A 1Z8GA 3RXCA 2BVXH 3GY3A 2G81E 4NIXA 4Y0YE 4JK5A 4DGJA 4ABEA 3SHAH 2KCYA 3SNEA 2CMYA 1QNJA 4TPIZ 2QIQA 2YOLA 3FVFB 1G32B 1BIOA 1GBHA 1MABB 1P2JA 4CRGA 1ZMJA 1L0ZA 4ZROA 1P01A 3FZDA 1SKYE 1EZUC 4MVNA 1IQLA 3RUOA 1TAWA 4OS1A 4Y8XA 2OUAA 3S9BA 2FX6A 5JBCS 2Z9LA 2B0FA 2F43B 1O2OA 5LPEA 3SU4A 1B0FA 4D9RA 1AB9B 1O3NA 4Y7BA 1QB6A 3BTWE 1MTVA 3P70B 2SNVA 2C8ZB 4XBBA 2FYRA 3NXPA 5DP8A 3GY7A 2WPMS 1ZR0A 2I6QA 1A3BH 4K1TA 4CRCA 1O2KA 1SQRA 1X7AC 4IW4E 4NZQA 4B71A 1HFDA 5C1UA 8LPRA 3KQBA 3PM3A 3OTPA 3GS9A 4NA9H 1ESAA 1VKYA 3TGJE 1ZJKA 2BY8X 3HK3B 1ZRBA 4XDEA 1A0JA 8ESTE 2HPQH 1ZGVA 3FP7E 3LIWA 4I33A 3SU6A 3MU5A 1CT2E 2BVSH 2Y81A 3FAOA 1RXPA 1P04A 2KZ4A 1YCPK 3P8FA 1B5GH 1IQNA 1RIWC 3SV2H 5SGAE 5DSFA 2QXHA 4X2YA 2WV4A 5EQSA 1AKSB 4TWYA 1V2UT 1GHAF 1TOMH 3KHVA 3ODDA 4FETA 3NWUA 3SNDA 2BDCA 1K21H 2Z94A 1XX9A 4WF8A 1QQ4A 1AVWA 1XUHA 4UFEH 1UO6A 2ZA5A 2XTTB 5C67A 4A1XA 4X1NU 3RXLA 1EAXA 5GXPA 1HJAC 3U8OH 4OM9A 3TH3H 1S84A 1SQTA 4HZHA 4IMQA 3ZZ4A 2V3MA 5CHAC 5EW2H 1H9LB 4CREA 1F2SE 1B0EA 1XVMA 2WINI 4X2XA 3RU4E 1H4WA 4Y10E 4VGCB 2BDAA 3SI3H 5B6LA 1O2WA 4X1RU 2NWNA 1NC6A 1GPZA 1QZ8A 2HVXA 2IJOB 3N99A 5F53A 2EC9H 4WMEA 1RJXB 1BJVA 1EAIA 2PUXB 4O9VA 3TNSA 3GOVB 3K65B 3SW2B 2THFB 1HRTH 3GCTF 1TE0A 1GHVH 4XBDA 5GWZA 2V3HH 1PJPA 1ARCA 3QTVH 4JYVH 1CGIE 1PPBH 1PPGE 1CE5A 3GCHB 2KFWA 2SNWA 2A2XH 1DSUA 1SI5H 1UJ1A 1Y5UT 2Z7FE 4JCNA 1BDAA 3FN8A 3BTDE 2F9PA 2O8UA 4WH6A 1WV7H 3WWFA 4YO9A 1GBFA 4NWLA 3QO6A 3RXFA 2WPJS 5DG6A 1O36A 4AFZA 4B1TA 1EB2A 1INCA 5EG4A 1JXPA 5DP4A 1O2MA 3UOUA 4XE4A 1CHGA 5CDFE 1KXAA 4RKJB 3ZYEA 1DE7H 1C5LH 3O8DA 1BTUA 4IC5A 2BM2A 2J97A 1GHXH 1O2VA 1UCYK 4I32A 3LH1A 2K0QA 2FLRH 7LPRA 4NFEA 1PQAA 1UTLM 5J4SA 3O8RA 3IG6B 2UWOA 1C4V2 1PPEE 4A1TA 2P8OC 1TGSZ 1AN1E 6GCHG 1GHBF 2GMTB 1QQUA 3DSGA 2ZZUH 3S7KB 3ZZDA 1Z8RA 1DVAH 6CHAC 1G3BA 2LNCA 1RS0A 2C8WB 2ASUB 5CE1A 1L1GA 5EODA 1GMHG 2FXRA 2HNTE 3T2NA 1GJBB 1P12E 4A7IB 2FYQA 3RP2A 1DICA 1KYNA 4K8YA 1GJCB 1ELCA 4MNVA 1QHRB 4AX9H 1TRYA 3K6ZA 2A4OA 3AASA 3E0PB 1SPJA 1ANEA 2GP9B 2V3OH 3MOCA 2ZFSA 3F6UH 3LU9B 1NU7B 2NU2E 1RD3B 3LJOA 1W0ZU 3W94A 2BD3A 3MNSA 1G3EA 3SJ8A 1D6RA 4AGJA 1TNKA 3ZIAD 2AEIH 1LKBA 2G4TA 2XW9A 1DDJA 1LQDB 5F6MA 3I78A 5LPRA 2VWOA 3AK5A 2O8LA 4FU9A 3LC3A 2A7JA 2QA9E 2BD5A 4OGXA 4KELA 3RXBA 4DY7B 3M37A 4RT0A 1O39A 4X8UH 2JJ1D 1ZJDA 5PTPA 3A7TA 3BG4C 5A2MH 4JYTA 1C1RA 3R0FA 2ZP0H 5E8EH 2OP9A 3KF2A 2QYIA 4A1VA 3SHCH 3UIRA 3FFGA 2F9VA 1GI1A 4JZEH 4U2WA 2AGEX 2UUYA 2QF0A 1VCQA 2FM2A 1C2HA 2ZPSA 1OHHD 1P8VC 1DM4B 1UMAH 1XUKA 3D65E 4ZAEA 1V2TT 2ZWLH 4MNWA 1YPEH 1GL0E 2W7SA 4GHQA 3STJA 2F3CE 1AI8H 4Z0KA 1LHCH 1UVTH 1TPSA 5TJXA 1XUJA 1SFIA 2H9EH 3QWCH 4BTIB 1WXRA 1MU6B 2L6OA 1OP8A 2NU3E 3M5LA 3F9GA 4Y76A 1S0QA 5DP7A 1FIZA 2XCFA 3ZVFA 4K3JA 1SGEE 3RXDA 3P8OA 1Z1IA 1AMHA 1LVYA 2K1QA 4WMFA 3SJIA 3HGPA 1BMLA 2SFAA 1O3BA 3RMOH 4KTCA 3S9CA 4QT8C 1GHZA 2CF8H 2ZI2H 4INHA 1BTWA 5CMXH 2AMDA 3SU3A 3MU8A 4H6SB 3A80A 1S5SA 3U8RH 1DUAA 3PV5A 1PFXC 3RXJA 1BRAA 1TRMA 1P0SH 2R2MB 3DSOA 1GI7B 1C4Y2 4RI0A 2ZQ1A 4X1QU 1SGYE 3VFEA 1YBWA 1ELBA 1WOFA 4CRFA 1O5EH 4D8NA 2QCYA 2QC2A 3PO1C 2A4QA 2JETB 1GHWH 3MNXA 1V3XA 2ZGHA 1C1NA 3RXAA 4TY7A 1DWBH 1S0RA 4FUIA 3BIUH 4B75A 1NPMA 4UFDH 3T27A 1C2GA 3MNCA 4MPUA 2P95A 4A92A 1OYTH 2TGAA 3FANA 4Y11E 1BB0B 4F4OC 1MZDA 1HCGA 1O5DH 3KQDA 4JMYA 3M7UA 2H2ZA 1FX0B 1BBRE 8GCHF 4LXBH 3RM2H 1GDUA 1QBVH 2H1UA 1Y5BT 1W0YH 4YZUA 1SGFA 4FUCA 1MAYA 1W14U 3FOAA 2A1DB 4ISHH 4X1PU 2I6SA 3LPRA 1YPJH 2J95A 4UONA 1FJSA 3A7VA 1VCWA 3E91A 3EE0B 1ZHMA 3A88A 3SOSA 3ATIA 3HATH 1MCTA 3Q77A 1NS3A 1GMCG 1VZQH 6LPRA 4X2VA 3RC6A 4ASHA 2CV3A 2SGPE 4K69A 1T7CA 2GT8A 3BG8A 3I29A 2XC5A 4FUFA 2ZFFH 2KR7A 3NUMA 3ODFA 3QX5H 3E90B 4SGBE 2FODA 2XYAA 4Q4LA 1YWUA 4CH2B 2YMSC 1H8HD 4AYVB 1ZSJA 2HVYB 3DD2H 3DHKH 1GI3A 1P3CA 2P59A 5GCHG 1QIXB 2CXVA 3RXVA 5DKMA 4NA8A 3ZZAA 4JYUH 1ZLRA 3T26A 1JRSA 4AB9A 4AC9A 1HAGE 1TPOA 1KSNA 1RTLA 5FXLA 2V35A 3P95A 4NFFA 1TMBH 4GVUA 2ZDVH 1HAZB 1GJ7B 5TCAA 4AN7A 4DCDA 2ZHWH 1DY8A 1Q31A 1GGDB 1EZSC 3GY8A 1P2MA 1GI8B 2TGDA 3ZVDA 2BX4A 1J16A 4GUXA 4ISOA 2FTMA 3AAUA 2BDIA 1MKXH 2Q6DA 4ABIA 3LOXA 2Y82A 1Z7KA 2YNAA 1YGCH 3UNQA 1Y8TA 1GJ5H 1YLNA 2O9QA 3PRBA 1C5ZB 4CRAA 1CA8B 4O97A 1KXDA 5E0GA 1OX1A 5EIYA 2GT7A 1AUJA 4F55A 3A89A 3GY5A 1QGFA 2ZGXH 9ESTA 2GCTC 3LGWA 5DN6D 4B74A 4YOGA 5EXNA 2OC0A 1D3PB 3MH7A 1VCPA 4DIIH 4NCYA 3AW0A 2FOBA 1B7XB 1K22H 5HKKD 1DY9A 1AFQB 3OY5U 1WDIA 1VJ9U 1BTYA 1GGDC 3PYHA 4KGAA 2A5IA 5FPTA 3BTGE 4IMZA 2BD9A 1OKXA 1V2JT 2ULLA 1VITG 4X2WA 2VB0A 3RLWH 4UDWH 1MU8B 3QGNB 1MD8A 1N8OB 1RGQA 2BX3A 3W95A 5C20A 2QXIA 2KCAA 5HGGA 4MNXA 2AIPA 5EU8A 1O2RA 4B73A 3A8AA 1O2UA 5EPYA 5F8TA 1BJUA 1AQ7A 2ZGBH 2AFQB 3TJNA 3U98H 4ABDA 1K1MA 1V2MT 2B9LA 1UTMA 1GVLA 3OX7U 2Z3DA 4OS6A 2HNTF 3DUXH 1AFQC 3CP7A 5EJLA 4XSKU 1P03A 3W1EA 4U30A 1C2LA 1F92A 3V13A 5DP6A 2ZIQH 1TMUH 3SJKA 5A8ZA 3JZ1B 4CRBA 2PSYA 1BRBE 2FWWA 2SGFE 2KAIB 4RN6A 1HDTH 4WMDA 1L1JA 2PUQH 1MKXK 1SVPA 2AMPA 4AGKA 4CR9A 5DP5A 4UE7H 2J92A 5T6DA 5C5NA 1QCPA 3TJOA 3ZV9A 1IAUA 2WZQA 1E1RD 4P02A 4FOUC 3ZZ8A 5C1YA 3U9AH 2W6ID 1C1WH 3A7WA 4Y8YA 2CHAB 3SUFA 2AGIX 2GCHF 1XVOA 2KAIA 4I31A 2ZTYA 1KXEA 3M5NA 1XUIA 1EPTA 1QL8A 1TGCA 2OCVB 2OC8A 4KP0A 4M9FA 3ZVCA 2ANWA 5T6GA 3Q3XA 1JIMA 2L74A 1QRWA 5ESTE 2BDGA 4YXWD 1AIXH 3U8TH 3M7TA 3QTOH 5GIBA 4Q7ZA 2GZ7A 1ANDA 1DITH 4NGAH 1ELTA 2XNDD 4Y71A 1PYTC 2BY7X 2ZDKA 4AB8A 2Z6BD 2AIQA 4YM9A 3L33A 2KX4A 1N1LA 2ALPA 1K0HA 1ELAA 3R3GB 3UR6A 2HLCA 3QK1A 4X6MA 3VGCC 1QRZA 3PWBA 5EJ1A 1O3AA 1EP5A 3A84A 1SQAA 3N7OA 1HAPH 2OQ5A 3LGYA 4MQAA 1BCUH 3FP6E 3KQCA 2ZCLP 4YESB 1XM1A 1GDNA 1O5GH 1EJMA 3VG8A 3PLPA 1UHBB 1BQYA 1P2QA 2BDYA 2D8WA 1GBDA 3KEEA 5ESBA 3ITIA 4WJG2 2J2UA 3MU1A 4AFQA 1DFPA 2J34A 5FHTA 1GBKA 2QV1A 1ZRKA 3T25A 3O8CA 4P00A 5FAHA 1NRSH 2VIQA 1CQQA 2RA3A 1RIWB 4NIYA 4X6NA 1C5PA 4NZLA 3SBKA 1C5VA 2FO9A 1SHHB 3FZZA 1GJ8B 1O5BB 1YYY1 1HAXB 1DLEA 1LHEH 1L4ZA 1CHOG 3F9EA 2ZFPH 3RXMA 3BEFB 3F9FA 3MH6A 1V2ST 3F0PA 1TMTH 2FTLE 2CJIA 1C5XB 4TYDA 1WU1A 3GISB 1EKBB 1HJAB 3MH4A 1QJ1B 3RLYH 2FOHA 4BXSA 3K9XB 4R0IA 3SO3A 2BOHB 5CHAB 1O3PB 1CVWH 1IQGA 2HPPH 1H1BA 1F5RA 2QF4A 3PLBA 2Z9JA 4FU8A 1O3MA 1ZMNA 3F2GA 2NU4E 1TQ7B 1O38A 1UCYE 1SQOA 3MO3A 1LKAA 3A7YA 2BD4A 2VINA 3JZ2B 1W10U 3RXRA 5A8YA 5DPAA 2LELA 5F8ZA 4E7RG 3LJJA 1BOQA 3P17H 1HXEH 1WQVH 4FUHA 3U1IB 1AVGH 2AH4X 1SLXB 1GDQA 1TNLA 5J4QA 2ODPA 2ILNA 4ZUHA 4U01A 4MTBA 5BRRE 4BAKB 1AKSA 1THRH 4WH8A 3K2UA 1UW7A 1HJ9A 1BTZA 3A81A 1KY9A 3H09A 1G3CA 1O34A 2AYWA 1YLCA 1BBRH 1LVOA 3SYJA 5BPEA 1J8AA 1A61H 1HAYB 2OC1A 1P9SA 1Z8JB 4YLQH 1LHDH 1OP0A 1UTQA 2YNBA 1BZXE 3AVZA 3GYLB 1CBWC 1UVOA 2OC7A 4ZXYH 2B7DH 2BZ6H 5AF9H 5L2YH 4TY6A 3EE7A 2ANYA 2ZTZA 1S6FA 2Z3EA 5H4IB 1C1SA 1HBTH 5C94A 1E34B 4XD7D 1OOKB 4YT6H 1E35B 5C2ZA 5EW1H 1NFUA 1T4VH 3PWCA 4OS5A 3D23A 2P3FH 3UOPA 1TWXB 2ZPQA 4ABFA 1SLWB 1MCVA 3EGKH 1RFNA 1BHXF 4H4FA 1W13U 2P8OB 2V6NA 2WSSD 1E36B 1KXBA 2AGGX 5HM2A 6CHAB 1TNHA 3HPTB 5B6OA 2R3YA 1Y3XA 5DK1A 2ZC9H 1SLVB 3PV2A 2CGAA 5JYIA 2EA3A 1AWFH 4LZ1H 1MTNC 2G55A 3B8JA 1LVMA 3AAVA 1P57B 1BMNH 3RMMH 3T5FH 2J5UA 1F0UA 3ZZCA 1OWEA 1IQFA 1SR5C 1DPOA 2Z3CA 4ZKRU 1YM0A 2W5EA 1CU1A 2FP7B 2PTCE 3TIUA 2WPHS 1BBRK 1H8IH 1GCDA 4FUDA 3RC4A 1TPAE 2CF9H 1C9TA 4MPVA 1MKWH 4WWYA 1C4U2 1TIOA 4M7GA 1O3FA 3UQOA 1ZMLA 1F0SA 1JIRA 2BHGA 3KNXA 2ODYB 1J17T 2PW8H 2PWXA 1YC0A 5L6NH 1SGQE 1SFQB 1A0HB 3BG4B 3TITA 1O2JA 4MG3A 1ZOMA 2PFEA 5EOKA 2RFKC 1FY3A 2IPQX 3CENA 2OQUA 2H9TH 1GJ9B 3E0NB 1T8LA 5EPNA 9LPRA 3LONA 4OS7A 3TJUA 1ACBE 3F2FA 2IJD1 1LO6A 1IQKA 2VIDA 4ACBA 4D9QA 4Z6AH 2F9BH 1Z71A 1QJ7B 1THSH 4H6TA 1MQ5A 2VU8E 2LP6A 1CT0E 3BTEE 1O2PA 5K7RA 1G3DA 1YPHE 1KMHB 4AG1A 2BLOA 5FX5A 3UWJH 1P9UA 2P3UB 1ELVA 1FY8E 3BTQE 4CBOA 2BD8A 4BOHA 3QUMP 5A0CA 1ZTJA 1C1QA 3RXUA 1KXFA 2PLXA 1WUNH 5ETXA 3KYFA 1EJNA 1EATA 3ZZ3A 1JOUB 3L3TA 1QY6A 3BF6H 1Z8IB 1VJAU 1MKWK 2BLQA 5DP9A 2C8YB 1LCYA 4LK4A 2H5DA 2XBWA 5DO4H 3PROA 1L2EA 1OPHB 2YMSD 4DW2U 1O2GH 4IN1A 1GG6C 3BTME 1IQIA 1BUIA 1JBUH 4J2YB 2BQ6B 3A85A 1OWIA 1C1OA 3A7ZA 6GCHF 2ANMH 3PRDA 3PO1B 1MBMA 1P11E 2FIRH 1ID5H 1GJAB 4YLUA 2B5TB 2ZTXA 1NFWA 1O2TA 4RSPA 1GI5A 1TPPA 2XBXA 3ATKA 4THNH 2UWLA 2WPDD 5HXFA 1SLUB 2RA0A 1E38B 2Y80A 1TNGA 2XC0A 3OU0A 2M5TA 5FCKA 1J15A 3TK6A 3U28C 1QB9A 2J98B 1NN6A 3HKJB 2VVUA 1K9OE 1MAXA 1S82A 1O2QA 5T3HA 1E79D 4OS2A 3N7EA 1O37A 4LZ4B 3M5OA 5FPSA 1CGHA 3SJ9A 1V2RT 3UREA 7GCHG 4FUBA 3DT0H 3G01A 4DT4A 1V2VT 5GDSH 2EEKA 2J9NA 4B6EA 1W12U 4BTUB 4CHAC 3BTTE 3TK5A 1OWKA 4CH8B 1UTJA 3QGJA 4E7NA 2STAE 1YF4A 3GY6A 1ETRH 2O8MA 2UUFB 3KN2A 5HIZA 3OY6U 2GV6A 3OSYA 1AD8H 2G8TA 4FUJA 2GZ9A 4K1SA 2FX4A 4HFPB 5FL7D 2FPZA 2XRCA 2YMSB 3VB7A 3ELAH 1MUEB 1EB1H 2QF3A 4AFUA 1AFEH 2KM0A 3RXQA 3NCLA 4AZ2B 1O2NA 4O3TA 2HOBA 2UUKB 2Y5GA 1FMGA 2C4FH 1HAHH 4ZHAA 1GBBA 1TA2A 3B23B 1AHTH 2F91A 4ZKNU 4AOQA 1CO7E 3MU0A 3URDA 1FIWA 1W0JD 2DUCA 3UB0A 1TBZH 4DVAU 1K2I1 1WTHD 1GBMA 1TYNA 1E37B 1BTXA 1T31A 1NTPA 1O2SA 2D26C 4DG4A 2UWPA 1EAUA 3E3TA 5DGJA 2FLBH 1CSOE 3OEHD 1PPZA 3HGNA 5L30H 3MHWU 1K1IA 1UCYH 1ZPBA 4GCHG 2VGCB 1O33A 1DUEA 2BVRH 3EA9A 2GCTB 2BZAA 3KQEA 2FI4E 1G2LA 2VIOA 4TSFD 1BMAA 2TPIZ 4B2CA 2HGTH 3GICB 5HMAA 2Q6GA 3MYWA 4GAWA 2Y7ZA 4GPGA 1NO9H 3D49H 4KKDA 4A5TS 1SGPE 1Y5AT 3ZZ5A 3EYDA 1K28D 3TU7H 3VXEH 4IN2A 2CK3D 1NT1A 1XUGA 3HKIB 1A1RA 3SQHE 4E05H 4NSVA 3SV6A 2WYJA 1Y3WA 3BV9B 3PV4A 1VGCC 3GDVA 4NWKA 4BAQB 1C2EA 3TGIE 2ZHDA 1O3DA 1FY5A 3UNSA 3A83A 1FONA 3SU2A 1P2OA 2D1JA 2W7UA 2ZU2A 3M3TA 2BMGB 1WYKA 5JBBS 1EOJA 2ZG0H 1PYTD 1H9IE 5K0HA 3VB4A 4AFSA 2VGCC 1OS8A 4XRNA 1BA8B 4ABJA 1AGJA 3TJVA 1W0KD 3A8CA 3PMHB 3EQ0H 2FS9A 1YPLH 4UEHH 2ZO3H 4OGYA 2KCPA 3GY2A 3OE7D 1NBMD 3WWBA 2XCNA 2Z9KA 4ISIH 3M61U 1LVBA 2ZGCA 1SGTA 1KTTB 4Q7YA 1V2NT 1C5UA 1Z6JH 1P2NA 1ZSLA 1QTFA 2F4LA 5A09A 1DWCH 1V2OT 1GMCF 5C0UA 1DWEH 3M3SA 1O3GA 4MPWA 2WV5A 3M3VA 3QZRA 3RXPA 1QL7A 4ABBA 4ASUD 2CN0H 2AMQA 1NRNH 3CNRA
chains in the Genus database with same CATH topology
1O2YA 1LHFH 2PV9B 1T8NA 3ZZBA 1TFXA 2VVCA 4I8KA 4DJZB 1UTPA 2WUCA 3H7TA 5HM9A 2PKAB 1C5NH 2VIPA 3PTBA 2WUBA 1SGCA 1LTOA 2SGQE 2RG3A 1GL1A 2G5VA 1G36A 2Y6TA 1O3EA 2VIWA 3SUDA 1S6HA 3A87A 1ELDE 3VB3A 1SOZA 2GTBA 1QBOA 1SGNE 4CR5A 3MI4A 1D3DB 2A45B 1MMJN 5FPYA 1O2ZA 2JH6D 1W2KH 4NIVA 1TX6A 1P05A 2Y7XA 1KDQB 2PKAA 1FLEE 1V2PT 2QXGA 3TVJB 4YTAA 4I8HA 4WY3A 1EP6A 1O35A 3ENSB 3KL6A 2VWLA 1RTKA 1TBRH 2TRMA 3C1KA 3VGCB 3MTYA 4ZH8A 1K1PA 3MFJA 2R2WU 1NM6A 1NU9A 1C2JA 4UFGH 3PTNA 1IQHA 1HAVB 2A32A 1ARBA 1C2MA 1ANBA 2Y5FA 1G30B 1P09A 4YOJA 4WXVA 3RXGA 2VVVA 5EQRA 3LT3A 3TGKE 1PPHE 3VPKA 1FN8A 1EAWA 1NY22 2F9UA 3E8LA 1P02A 2TBSA 1K1OA 3A86A 1G9IE 3DFLA 3LH3A 1VITF 2PR3A 3LGTA 1YPMH 3EA7A 1GBCA 3SNAA 2WPLS 4I8GA 5FBIA 4ISLA 3SUGA 1O3JA 3MO6A 4FUGA 1TX7A 1PPFE 1GHAG 1EPTC 1YPKH 3BTKE 4D7FA 3P92A 1IQJA 1O2XA 2G00A 4YOIA 1DOJA 2GDEH 2OBQA 3BEUA 1AU8A 1EASA 1W11U 1MZAA 2SGDE 4Y7AA 3BTFE 3M5MA 7KMEH 1O5AB 1NFYA 1YCPH 4Q7XA 1K1NA 1GMDF 1TGTA 1BMMH 1EXFA 1DT2A 1KLTA 2FOAA 1XXFA 2ZHQH 5FBEA 3LGUA 1GCTB 3S9AA 4AYYB 3TK9A 1TALA 1K1LA 3ZYDA 1SMFE 1CA0B 2ANKH 2ZHFH 3SV8A 1PQ8A 1VITH 3EA8A 4BAHB 5JBTA 1LQEA 2BY5X 3S0NA 1KXCA 3OTJE 1TA6A 4DIHH 2H9HA 3TLOA 1F0RA 2FOFA 4Y79A 1UHBA 5EQQA 4NSYA 1MH0A 1LPGB 3KGPA 5EXLA 4CRDA 3RXIA 3UUZA 3MNBA 1LMWB 3GCTG 2JKHA 4FXGH 1HYLA 3CS0A 1SSXA 3S7HB 4TPYA 5F03A 3F68H 4GHTA 4JZIA 3M35A 4ZKOU 3FP8E 4X1SU 1QB1A 1WSSH 2QAAA 1GCTC 1JMOH 4NIWA 1CA0C 1SG8B 1IQEA 2EI6A 1TGBA 3WY8A 1MTSA 4X6PA 1RTFB 2QN5T 3RXEA 1C2DA 3P6ZB 4IBLH 3ZVGA 2PKSB 2JH5D 3ZV8A 1FNIA 2PSXA 4XBCA 2R3UA 1UTNA 1O3HA 1AVXA 3T62A 4B2BA 2A5AA 3ATMA 1UVSH 1C9PA 1H9HE 2XBVA 3PLKA 1DX5M 2ZQ2A 5GPIB 3UPEA 1GI9B 2OLGA 1NFXA 4FVDA 3RDZA 5JDUB 1CBWB 1TGNA 3SZNA 5IDKA 1HUTH 1AB9C 1EZXC 1P10A 3EAJA 2ZU4A 1ZGIA 1BRUP 2P94A 2FDAA 1IQMA 5ABWA 3IITA 1NRQH 2A31A 3M36A 1HJ8A 3BEIB 1J14A 1HNEE 1GVKB 1ORFA 2B8OH 1SOTA 2PKSC 1XKAC 2ZU5A 1ELGA 1TBQH 3T28A 1P2KA 1ABIH 1GHBG 1C5SA 1UTOA 1V2LT 1C5RA 1KLIH 1TRNA 1YCPM 3VEQB 2ALVA 3ZVBA 1O3KA 1ZSKA 2PGBB 1TQ0B 3TNTA 1W3CA 3MH5A 3SGQE 4AG2A 1V2WT 5F8XA 1MTNB 4K8BA 3RXSA 2BTCE 1O5CB 3UY9A 3RXTA 1C2IA 2ZFTA 1NRPH 1XKBC 3RXHA 2QXJA 3SN8A 4K2YA 4A6LA 2TGPZ 2FOEA 2WPIS 1CHOF 3NZIA 3SU1A 3RM0H 4BAMB 4ABAA 1SGDE 2W3IA 5I25A 1SHYA 1UVUH 2AERH 4K60A 1FPCH 4RKOB 3V3MA 2ZDNA 4O3UA 1C5QA 1W7XH 3F9HA 1O3IA 3SNBA 1AE8H 2BD2A 2RCEA 2TIOA 3UTUH 1TNJA 1ETTH 3SU5A 2GZ8A 3NKKA 3LKWA 4VGCC 1C5YB 1GI2A 3TPIZ 4Y6DA 1TONA 5AFZH 3H7OA 1A5GH 2BQWB 2ESTE 2XC4A 4MPXA 4B76A 1F5KU 4BXWA 1GVZA 1W8BH 2LPRA 4Q80A 5LPFA 1DSTA 5HYOA 1WCZA 5E0JA 1F7ZA 3MWIU 1Q3XA 4INKA 1BTHH 2A0QB 2F9NA 2GX4A 1AY6H 4F49A 4INLA 5L2ZH 3A7XA 1QA7A 1HAIH 3RU4D 1GJ6A 2G51A 1FUJA 1AO5A 1GI4A 2Z9GA 1OXGA 4CBNA 3GCHC 3Q00A 4GLYA 4UFFH 2FZZA 2ZFQH 4R8TB 1BT7A 3DA9B 3ZVEA 1D9IA 4MDSA 3V0XA 1GI0A 5AVDA 2C8XB 1EOLA 2UUJB 2P3TB 3ATLA 1DLKB 2FS8A 1L4DA 1TB6H 2R0KA 4XFQA 2C90B 1HB0B 3CS7A 3BIVH 3E6PH 1YPGH 4BAOB 4JZDH 2GV7A 1XUFA 2ZCHP 1DANH 3RXKA 2BXTH 4BANB 7ESTE 2HALA 4BNRA 2XBYA 2R9PA 1SGRE 5DP3A 3RC5A 2FEQH 3U69H 1LPZB 3QLPH 2P16A 2G4UA 3ATWA 1GG6B 2BOKA 2DE8A 4WVPE 1NROH 1OSSA 3GCNA 2BYAX 4BTTB 3F1SB 1FXYA 3LGIA 5E2PA 2BY6X 1EZQA 4YT7H 3ZZ7A 2GMTC 4D76A 2SGAA 2A4GA 1JRTA 1OWDA 2HWLB 1O32A 3A8BA 1HPGA 5A0BA 2A2QH 1GBEA 4X6OA 3SORA 3UQVA 3RXOA 1SBWA 2W26A 4X0WU 1C2FA 1O31A 2Z9IA 4Y8ZA 3V12A 3TH4H 4X8SH 8GCHG 1CT4E 2GDDA 1O3LA 3M7QA 2O8TA 5JB9S 1ABJH 1FI8A 1DS2E 3SGAE 1LDTT 1SB1H 4HGCA 4IGDA 2A7HA 4FUEA 3I77A 3Q3KA 3V7TA 1VR1H 1IHTH 4CHAB 3D62A 1FY4A 2V0BA 2C93B 2OINA 1D4PB 1ZYOA 1IHSH 1GMHF 2H5CA 1O2HA 1ZPCA 3SNCA 4ABHA 2GGVB 3UR9A 3LDXH 1O30A 5AFYH 2BDHA 1ZTKA 4X8TH 1FZZA 2ZGJA 2ZHEH 1SL3A 1WBGB 4JZFH 1KTSB 2D2DA 5GJ4B 1O5FH 4AORA 3GYMA 1C5MD 1HIAB 2BDBA 1OYQA 1Z6EA 1FAKH 2ZEBA 1L1NA 1TLDA 4K1EA 2F9OA 5TCCA 4IS5A 2FMJA 1C1PA 1WQSA 2FI5E 2PTNA 5LH8A 2J38A 3L6PA 1O0DH 2ZU3A 5AHGH 2IOTA 1DXWA 5E2OA 1V6DA 1WTGH 1M9UA 1O3OA 2G52A 4U32A 4GSOA 1SGIB 5FX6A 2A7CA 1HIAA 2J94A 3BSQA 1EX3A 2BLWA 2JH0D 4DURA 1EQ9A 1FN6A 1UK4A 3S69A 2BD7A 1G37A 5JB8S 1GBAA 1C1MA 3U1JB 3NPSA 1JWTA 3VB6A 4D7GA 3URCA 2BB4A 5E0HA 2R0LA 2ZCKP 1K1JA 4SGAE 5T6FA 5C1XA 4H42U 4I7YH 3LC5A 1GJDB 4I8LA 1N6YA 2ZKSA 1A2CH 4ABGA 4MNYA 5IYTA 2Q6FA 2VNTA 1UK2A 2VWNA 1BRCE 2OTVA 3PB1E 2BQ7B 3ZZ6A 5I46H 3T29A 2FOMB 3KIDU 1A7SA 4J1YA 1P3EA 3ZZ9A 2A4RA 1A4WH 2NU0E 3SQEE 4ZXXH 4O03A 1Q2WA 2NU1E 2ODQA 3LGVA 3MMGA 5JBAS 2JETC 2WYGA 2HRVA 1NESE 3DFJA 5FCRA 1VGCB 2AS9A 3GDSA 3BN9A 2ZDLA 3IWMA 1C5TA 3A8DA 1PPCE 2FOCA 1O2IA 2VH0A 1T4UH 1CGJE 1ESBA 2HNTC 1Y3VA 1EUFA 2FI3E 2A5KA 1TNIA 1MQ6A 3E16B 3OYPA 1SGFG 3E1XB 1O2LA 2VWMA 3H5CB 1ZTLA 1ZPZA 1Z1JA 1A5HA 1MD7A 1C1VH 1YP9A 1GBLA 2BLVA 7GCHF 1WAYB 2BY9X 1ESTA 3QN7A 3SJOA 1YKTA 4X8VH 1QBNA 1W7GH 4KTSA 1T32A 1GHYH 3A82A 1T8OA 2PHBA 1Y3UA 3O8BA 1F5LA 1SC8U 2QY0B 4FU7A 1GI6A 1TOCB 3SV7A 3VB5A 3SUEA 1MTUA 2G5NA 2FESH 1YPHC 4OS4A 2ZPRA 3RMLH 5G4BA 1QURH 1QJ6B 4TWWA 2GCHG 1HAOH 2XWBI 3RU4T 1IOEA 1AWHB 2GD4B 4WXIA 1XMNB 4ZKSU 1P2IA 1HGTH 4PROA 1FQ3A 2WPKS 5JPMH 1UVPA 2SGEE 4JK6A 1FAXA 2XNIA 1HXFH 1ELEE 3NK8A 1AZZA 3SGBE 3SV9A 1MBQA 1MTWA 1HLTH 3TH2H 1KLJH 1FY1A 1D3TB 4IC6A 1D6WA 3HK6B 1H8DH 3MO9A 1T8MA 2OBOA 1C1UH 3QDZB 4HI3A 1Y3YA 1GWAA 2OXSA 2FOGA 1GBJA 1ZHRA 4ZHLU 4NA7A 1ANCA 1LHGH 1PQ5A 4E06H 1OWJA 3RMNH 2GKVE 5GCHF 1AZ8A 1AUTC 2GVFA 2VJ1A 1BTPA 1ELFA 3GDUA 4HTCH 3UFAA 2O8WA 3B9FH 1V2QT 4GCHF 4UD9H 4Q2KA 5A8XA 1ZHPA 1GBIA 3SU0A 1A3EH 2VH6A 1DXPA 2ZU1A 1GJ4H 1KIGH 4ISNA 3ZVAA 2TGTA 1A5IA 4ZMAH 1ZZZA 1Y59T 2XXLA 1GMDG 3BTHE 1N6XA 2VIVA 1OWHA 1GBTA 1OP2A 4NG9H 4B2AA 2W3KA 4Y0ZE 1NZQH 2STBE 2DE9A 1NRRH 2IN2A 3GCOA 1QFKH 1HV7A 1QRXA 1N8OC 2C3SA 2ZDMA 1C1TA 4MLFB 2Q1JA 2H6MA 3QZQA 1THPB 1EPTB 6ESTA 2IPHA 1P06A 4JZ1A 3AW1A 1S81A 3UWIA 4DOQA 3KCGH 3K6YA 1C5OH 4FVBA 1KDQA 3Q76A 5DJ7A 2PGQB 1FPHH 2QGRA 1J9CH 1G2MA 2ZFRH 1E0FD 2EI8A 3ESTA 3P8GA 3PMAB 1D3QB 4LOYH 5EGMA 3Q3YA 3PMBB 1FV9A 4ESTE 2Y5HA 4ZHMU 1HAVA 1LPKB 2ZDAH 1ETSH 2F83A 4DT7B 1RRKA 5LGOA 3STIA 1UTKA 3MU4A 1DWDH 1FDPA 5C5OA 1AE5A 4XOJA 1PQ7A 4I8JA 1XXDA 1YLDA 1QA0A 1QR3E 3VXFH 8KME2 1S83A 3P8NA 3SI4H 2BXUH 5A0AE 1BITA 2P93A 4K5ZA 2OD3B 2ZF0H 2RDLA 3GY4A 2CHAC 1S85A 1A46H 3UNRA 1U6QA 2ZECA 1QL9A 1C2KA 1F0TA 1BHXB 5EXMA 1EJAA 1TX8A 1C5WB 3C27B 3EDXB 2J4IA 5C3NA 1TABE 2XWAA 1UK3A 2ZNKH 3PMJA 4KTUA 1O3CA 1A0LA 1V2KT 2EI7A 1Z8GA 3RXCA 2BVXH 3GY3A 2G81E 4NIXA 4Y0YE 4JK5A 4DGJA 4ABEA 3SHAH 3SNEA 2CMYA 1QNJA 4TPIZ 2QIQA 2YOLA 3FVFB 1G32B 1BIOA 1GBHA 1P2JA 4CRGA 1ZMJA 1L0ZA 4ZROA 1P01A 3FZDA 3RUOA 1EZUC 4MVNA 1IQLA 1TAWA 4OS1A 4Y8XA 2OUAA 3S9BA 2FX6A 5JBCS 2Z9LA 2B0FA 1O2OA 5LPEA 3SU4A 1B0FA 4D9RA 1AB9B 1O3NA 4Y7BA 1QB6A 3BTWE 1MTVA 3P70B 2SNVA 2C8ZB 4XBBA 2FYRA 3NXPA 5DP8A 3GY7A 2WPMS 1ZR0A 2I6QA 1A3BH 4K1TA 4CRCA 1O2KA 1X7AC 4IW4E 4NZQA 4B71A 5C1UA 1HFDA 8LPRA 3KQBA 3PM3A 4NA9H 1ESAA 3TGJE 1ZJKA 2BY8X 3HK3B 1ZRBA 4XDEA 1A0JA 8ESTE 2HPQH 1ZGVA 3FP7E 3LIWA 4I33A 3SU6A 3MU5A 1CT2E 2BVSH 2Y81A 3FAOA 1RXPA 1P04A 1YCPK 3P8FA 1B5GH 1IQNA 1RIWC 3SV2H 5SGAE 2QXHA 4X2YA 2WV4A 5EQSA 1AKSB 4TWYA 1V2UT 1GHAF 1TOMH 3KHVA 3ODDA 3SNDA 3NWUA 2BDCA 1K21H 2Z94A 1XX9A 4WF8A 1QQ4A 1AVWA 1XUHA 4UFEH 1UO6A 2ZA5A 2XTTB 5C67A 4A1XA 4X1NU 3RXLA 1EAXA 5GXPA 1HJAC 3U8OH 3TH3H 1S84A 1SQTA 4HZHA 4IMQA 3ZZ4A 5CHAC 5EW2H 1H9LB 4CREA 1F2SE 1B0EA 1XVMA 2WINI 4X2XA 3RU4E 1H4WA 4Y10E 4VGCB 2BDAA 3SI3H 1O2WA 4X1RU 2NWNA 1NC6A 1GPZA 2HVXA 2IJOB 2EC9H 4WMEA 1RJXB 1BJVA 1EAIA 2PUXB 4O9VA 3TNSA 3GOVB 3K65B 3SW2B 2THFB 1HRTH 3GCTF 1TE0A 1GHVH 4XBDA 5GWZA 2V3HH 1PJPA 1ARCA 3QTVH 4JYVH 1CGIE 1PPBH 1PPGE 1CE5A 3GCHB 2SNWA 2A2XH 1DSUA 1SI5H 1UJ1A 1Y5UT 2Z7FE 4JCNA 1BDAA 3BTDE 2F9PA 2O8UA 4WH6A 1WV7H 4YO9A 1GBFA 4NWLA 3QO6A 3RXFA 2WPJS 5DG6A 1O36A 4AFZA 4B1TA 1EB2A 1INCA 5EG4A 1JXPA 5DP4A 1O2MA 3UOUA 4XE4A 1CHGA 1KXAA 4RKJB 3ZYEA 1DE7H 1C5LH 3O8DA 1BTUA 4IC5A 2BM2A 1GHXH 1O2VA 1UCYK 4I32A 3LH1A 2FLRH 7LPRA 4NFEA 1PQAA 1UTLM 5J4SA 3O8RA 3IG6B 2UWOA 1C4V2 1PPEE 4A1TA 2P8OC 1TGSZ 1AN1E 6GCHG 1GHBF 2GMTB 1QQUA