3W94A

Structure of oryzias latipes enteropeptidase light chain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
235
structure length
235
Chain Sequence
VVGGVNAEKGAWPWMVSLHWRGRHGCGASLIGRDWLLTAAHCVYGKNTHLQYWSAVLGLHAQSSMNSQEVQIRQVDRIIINKNYNRRTKEADIAMMHLQQPVNFTEWVLPVCLASEDQHFPAGRRCFIAGWGRDAEGGSLPDILQEAEVPLVDQDECQRLLPEYTFTSSMLCAGYPEGGVDSCQGDSGGPLMCLEDARWTLIGVTSFGVGCGRPERPGAYARVSAFTSWIAETRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enteropeptidase-1
publication title Structure basis for the unique specificity of medaka enteropeptidase light chain.
pubmed doi rcsb
source organism Oryzias latipes
molecule tags Hydrolase
total genus 54
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3w94A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3w94A01
1AE5A 1O3LA 1MU8B 2XBXA 1GJ8B 5A09A 3V0XA 5HM9A 3A7ZA 3P17H 1GBLA 1E35B 1EJNA 2GT7A 2UWPA 2SGEE 4ISHH 2J92A 1O2HA 1FIWA 3LU9B 2AMPA 3B9FH 1P9SA 1THRH 1P3CA 1DXPA 1DUAA 3KQBA 3OYPA 1QIXB 1EZSC 2FXRA 5K0HA 1FQ3A 3TGJE 1K9OE 3QGNB 2AMQA 3NUMA 1BTXA 1ORFA 2Z9JA 2AS9A 5C1YA 1VJAU 5LPEA 4JZ1A 1V2JT 8KME2 3VEQB 3U1IB 3LIWA 1EQ9A 1T8NA 4KTUA 2Y81A 5DK1A 2W3KA 1O39A 1P57B 1SC8U 2ULLA 3A89A 1KLTA 3LDXH 5J4QA 3Q3XA 1O2OA 3VPKA 1KIGH 1NRPH 2R3YA 3CENA 1K2I1 5BPEA 3GOVB 2BLVA 3MU0A 1SG8B 1TRNA 1QRXA 2BY7X 1VCQA 1UTQA 1MTWA 2H5DA 3ZZCA 1QCPA 2BVRH 1SI5H 5T3HA 3QO6A 1PQ5A 3A80A 2UWOA 3EGKH 3K65B 3D65E 1SQTA 3RXSA 1UVSH 4DJZB 2Z7FE 1EAWA 1F5KU 1P11E 1ZPBA 1WTGH 1SBWA 3ATLA 2F3CE 2GKVE 1NY22 1O0DH 4YOJA 2BQ6B 3E6PH 1IAUA 2CGAA 2BY9X 2GV7A 1O2MA 1MTVA 1BUIA 4K2YA 4ZKRU 1SFIA 1PFXC 3FP6E 5E2OA 2BY5X 2FOGA 1RTKA 4ABHA 1ANCA 2VGCC 1GHBF 1RRKA 5AFYH 1GBTA 4BAHB 2NU3E 2PV9B 3BTWE 1Z71A 4J1YA 2G5NA 2HWLB 3V7TA 4B2AA 1A2CH 3T25A 3SNAA 5F8ZA 1C1WH 1HXFH 4BAKB 1SB1H 4NFEA 1INCA 3QTVH 5SGAE 1AVXA 2ZGHA 2G00A 3HPTB 3ZV8A 3MHWU 2A5IA 1JIMA 3PLKA 1AE8H 2Z3EA 1C2HA 1RIWB 3BTME 3SORA 1HAVA 1TALA 1D6RA 1DLKB 2FS8A 2ESTE 4FXGH 2QIQA 1UTKA 3KL6A 4X2VA 3AAUA 1RTLA 5F8XA 1CSOE 1HFDA 2GCTC 4AGJA 1FY3A 3BN9A 1HAYB 4NFFA 4SGBE 3DD2H 2ANYA 3EE0B 3SU0A 4ZMAH 2OD3B 3A85A 4INHA 2GZ8A 2WINI 1GCDA 2BQ7B 1BITA 2BX4A 1KXBA 5GCHG 3MWIU 1C1MA 1PPFE 3STIA 5C1XA 5CMXH 4A7IB 4Z6AH 3TK6A 3AW1A 1GG6C 2RG3A 2Z9IA 4NWKA 4B76A 1CT4E 1PPZA 1JIRA 2THFB 2ALPA 4I31A 1TBRH 4IBLH 2QYIA 2RCEA 1IQHA 4MNVA 3UQVA 1AY6H 1GDUA 1BT7A 1HAXB 1SL3A 1BMAA 5GJ4B 5AF9H 2F91A 3A82A 2H2ZA 3RXKA 1G30B 4X1PU 5H4IB 1YM0A 1BCUH 2Y80A 1SGPE 2SGDE 1AKSA 1Y3XA 2QF0A 2FWWA 1XMNB 4D9RA 4MNYA 1KDQB 4OGYA 4GCHF 1TOCB 4U01A 5GIBA 1NS3A 1WBGB 2PSYA 2ZGXH 4BAQB 1YPJH 2FZZA 2FPZA 1G9IE 2Z6BD 4KTCA 3VB3A 2ANWA 3QZRA 1A5GH 1C1PA 3GDVA 3ZVCA 4Q2KA 2ODYB 4K8BA 5EODA 4DGJA 2DUCA 2BD4A 3I78A 1Y5UT 1O3HA 1W14U 3RXVA 2H1UA 3VGCB 2BDIA 1RXPA 1HYLA 5DPAA 4AG2A 1K22H 3ZZDA 2GV6A 2FLRH 1SGYE 2JH6D 3PTBA 4NIVA 1GL1A 1YBWA 2QN5T 4YOGA 4Y6DA 4ABDA 2ZHEH 2BD5A 2FLBH 1OWDA 1O3DA 2ZFFH 4CREA 3ZVFA 2FODA 1W0YH 3UPEA 1BMMH 4O3UA 3BEUA 1O2YA 1NC6A 1C2LA 1AIXH 4XOJA 3LGTA 1OP2A 3ZVGA 1ETSH 2ZHWH 5FX6A 2ODPA 4K1EA 2C4FH 1MBQA 1O2RA 5C3NA 4Y76A 3A83A 4JYTA 2BHGA 1D4PB 1L1JA 1NFYA 1P03A 5E0HA 2FDAA 4FUBA 3TIUA 4AN7A 2BOKA 1SGTA 1P8VC 1A61H 1H8DH 1QRZA 8LPRA 2FM2A 2ZF0H 1GI1A 2WV4A 4TWWA 3ATIA 5A0AE 2H9EH 3P70B 3NXPA 1P2QA 1FY4A 3RMNH 3RXCA 1B0EA 4KTSA 1ZTKA 2JETC 2STAE 2LNCA 4I8KA 3MO9A 3I77A 1NROH 4QT8C 2HNTE 1HV7A 2ZGBH 2ODQA 4YESB 4BTTB 1C1RA 3O8DA 4WXVA 5EU8A 1N1LA 3MU5A 1DVAH 1OWEA 1O2QA 3ZZAA 1Y5AT 1ID5H 1AGJA 1TGBA 1ABJH 4MDSA 1PPGE 3HKIB 4AORA 1A3BH 2SNWA 3LGUA 1SLUB 1J15A 1IHTH 2A4GA 1Y59T 1O37A 1SGQE 4UEHH 1O3NA 3SV9A 4I32A 1MAYA 4AG1A 3Q00A 4B74A 2P93A 3U8RH 4BNRA 3TK5A 4LOYH 4K1TA 3SUDA 4X8VH 2ANMH 4YOIA 2A5KA 1YPHE 2CV3A 2BZ6H 2ZHQH 2SGAA 2OC1A 1AI8H 2ZHFH 1ZMJA 3UTUH 1LTOA 2VVCA 4A5TS 3S0NA 4I8GA 2BY6X 1GBDA 1BB0B 1BTHH 3JZ1B 1T8LA 1G3EA 1ZYOA 1NFWA 1ZHPA 2FS9A 2PFEA 3SI4H 1JOUB 1YC0A 3RXAA 4OS5A 1K1IA 2R9PA 3ATWA 1TA2A 4AFZA 3RXLA 4X0WU 4CRDA 1FI8A 1LO6A 1KYNA 2Q1JA 1Y3YA 4Q7ZA 3RMOH 1W7XH 5EW2H 2XBWA 4WH8A 4X6NA 4LZ1H 1P2OA 1P12E 3AW0A 1BTPA 2OQUA 1P2NA 2F9UA 3S9BA 2BD2A 2BXTH 2Y82A 3SO3A 1SFQB 5JYIA 1OWHA 3IG6B 4NA9H 3OY5U 4YT7H 3PM3A 1LPGB 1TWXB 5EXNA 1ABIH 1GVZA 3PROA 4YLQH 3SGAE 3A88A 2EI8A 1QR3E 1THPB 3SBKA 4K3JA 5DO4H 2FTMA 3LGVA 3RXMA 5L2ZH 1T8MA 2HALA 4XBDA 1MKXH 2QXJA 4D76A 5GWZA 5DP9A 2ZDAH 4XFQA 2B5TB 5A0BA 1DX5M 4CBOA 1AWFH 1GJCB 1G2LA 2FI3E 1UVUH 2B9LA 2O8LA 1FPHH 2BTCE 4D7FA 2DE9A 4OS1A 2XTTB 4O97A 2GX4A 1SGEE 2ZCHP 3HATH 3E1XB 3MI4A 5B6OA 1CGHA 3P8GA 2IPHA 1ELFA 1C2FA 1DITH 1TGSZ 3ITIA 4AFQA 2Z9LA 1HIAB 2TGPZ 4INLA 1Y8TA 3URDA 3ZZ4A 1Y3VA 1ANEA 4SGAE 3DUXH 3RXBA 4DIIH 1O3IA 3SU5A 1EUFA 2OBOA 2G4TA 1MBMA 1C5UA 1LPKB 3H7TA 3KGPA 1LKAA 2ILNA 2PKAB 2BDCA 1ZLRA 1EXFA 3LH1A 5C5NA 1J17T 3E0NB 1OPHB 1PQAA 3A8AA 1L1NA 1C4V2 2P3UB 4RSPA 1UTLM 3MO3A 4ASHA 2FEQH 3S69A 2J4IA 1FAXA 2HRVA 2A7CA 1QB1A 1GCTC 4NZQA 1DSTA 5FBIA 3NK8A 5DP4A 1QHRB 3RC4A 1PPHE 2O9QA 4FU9A 1E37B 1O2PA 3RMMH 1SVPA 5T6FA 4WMDA 4KKDA 4CBNA 3LH3A 1M9UA 1BRUP 4FUHA 5ETXA 1QL7A 4X2XA 5AHGH 1E34B 1UMAH 1QRWA 3GCTF 4BTUB 3H7OA 1FV9A 3LOXA 1SQAA 4E06H 1QY6A 2FOCA 4ABEA 1H1BA 2ZFPH 3F9HA 1C5MD 5DG6A 5A2MH 3ZYDA 4JYUH 5GXPA 1F5RA 2OC0A 2BD9A 1RS0A 1BOQA 1YPHC 2BDBA 3SZNA 2WPHS 1TPAE 3U9AH 2CHAB 3PB1E 4ZXXH 3RXUA 4OS4A 1F7ZA 1W11U 3M7UA 4NGAH 1ETRH 1VGCB 1TMUH 2EI7A 2M5TA 2OC7A 1EPTB 2Z9GA 2ZGJA 2Z3CA 2GGVB 2FTLE 1ELGA 1IQLA 4FUCA 3E0PB 4X1SU 1GVKB 2GZ7A 3TNTA 4WXIA 1DSUA 1HDTH 2BOHB 7KMEH 1UHBA 1LDTT 1NRSH 3VB6A 1HRTH 4AZ2B 2C3SA 3Q3KA 1QJ1B 1Z1IA 2VWOA 4IS5A 5TJXA 3PV4A 4O3TA 4JMYA 3BTEE 3SV6A 4UDWH 1GMHF 4U32A 2HVXA 2RA3A 3E16B 3SNCA 1N8OC 1EKBB 1KDQA 2P8OC 1UCYH 2ALVA 1G32B 2BVSH 1AUJA 2ZCKP 3U8TH 1EB2A 2OCVB 3PTNA 1QQ4A 4ZKNU 1KLIH 1MD7A 4BAOB 3M35A 5EXMA 4IN1A 1IQGA 3SUFA 2C8XB 4D9QA 5GDSH 2HOBA 4GHTA 4NIYA 1HUTH 2OLGA 1WSSH 1UTOA 1OS8A 1MD8A 1ZSJA 2O8WA 3P8FA 1CGIE 2VWLA 3QWCH 1HJAC 1KLJH 2K1QA 3RM2H 1W10U 3PMHB 1ZR0A 3K2UA 3BG4B 1S82A 1LVMA 1NRNH 1S6FA 1C5YB 1ANBA 2P3TB 3BG8A 2ZDMA 4NA8A 2Z3DA 5DP3A 1N8OB 4FUDA 1GBKA 1GHYH 1MU6B 1FAKH 3ZVEA 1OOKB 2YNAA 1GBHA 3MNSA 2ZQ2A 1EAIA 1HAOH 3ENSB 3RLYH 3M3VA 1GBJA 1GBBA 3E91A 1L4ZA 3LONA 3PLBA 4J2YB 1UTJA 1K1PA 1IOEA 1F92A 2SGPE 3S9CA 3UQOA 1YLDA 3MNBA 1Q31A 2JKHA 4KELA 5FBEA 2A7HA 2QA9E 1IQEA 4Y0ZE 2YOLA 1SSXA 3W94A 1TONA 4DCDA 2GDDA 1OSSA 3MH5A 1P09A 3SU1A 4OS6A 1QB9A 1YCPK 3SU3A 1AZZA 1P05A 1O3MA 3LGIA 1C5TA 5DP8A 1ELAA 1IQNA 1C1UH 1GHXH 4IMZA 2UUJB 1LHEH 3QGJA 3TJVA 1RJXB 1GHAF 1N6YA 1P06A 1XUGA 2ZPSA 1SR5C 1BBRK 1BRCE 1XVOA 1AWHB 1TNLA 1RTFB 1ZJKA 4HTCH 3C1KA 3UNSA 1HLTH 1BHXF 4DOQA 1TPSA 2IN2A 1J9CH 3ZVDA 4NSVA 2PKSC 7ESTE 1W8BH 1S0QA 4UFFH 1NT1A 2FI4E 1W2KH 4WVPE 1LCYA 3FP8E 3GISB 5EQSA 8GCHG 1EJAA 3MYWA 3H5CB 4YLUA 2VIOA 1ESAA 1HAZB 2ZU2A 4IC6A 4MPVA 3M3SA 1BQYA 4GAWA 1P2JA 3NCLA 1BA8B 1C2DA 2VVVA 3MMGA 3RXJA 2TGTA 1XXFA 2CF8H 5EPYA 1FXYA 4NSYA 2V6NA 2NU1E 2PW8H 1MMJN 1HCGA 1ZGVA 4FUIA 4TWYA 4B75A 1Z7KA 2Q6FA 2GTBA 4JZFH 3RM0H 3KIDU 1TAWA 4ZHLU 4DG4A 1UVPA 3RXDA 2WYJA 2VVUA 2VH0A 3TK9A 1Z8RA 2XWBI 4I8LA 1GHZA 1A0LA 2F9NA 4JK6A 2OTVA 1B5GH 2W7SA 2H6MA 2QC2A 1QTFA 3ATMA 3R3GB 1O3FA 4YO9A 1G37A 3C27B 2ZNKH 2ZCLP 1GMDG 2GCHF 2VU8E 1HAHH 1C5XB 2VGCB 1ZZZA 1TX6A 2GMTC 2PHBA 2PUQH 3MU1A 4U2WA 1QURH 2O8UA 1A5IA 4FUFA 3KF2A 1Q3XA 2GP9B 4IW4E 3V12A 1O5AB 2CJIA 1O5BB 4DW2U 4AYVB 1EZUC 1NRQH 1O2TA 2BX3A 1O3GA 1CBWC 1O3OA 3SU4A 1K28D 3ZZ9A 1O5FH 2J95A 1TPOA 1FMGA 3FZDA 2PTNA 2LPRA 1A7SA 1UK4A 1DWBH 3L6PA 2G55A 3T28A 1ZRBA 3GDSA 1MUEB 4DURA 2EC9H 1UO6A 2XYAA 2GCTB 1T7CA 3BTFE 4WH6A 2BVXH 2BY8X 3D23A 3A8DA 1SLVB 2WPJS 1D3QB 1QBOA 2R0LA 3LC5A 4Q80A 4YTAA 3SNDA 5ABWA 3O8RA 2GMTB 4X8TH 4NIWA 1OYTH 4BAMB 2SGQE 1O2GH 1C1VH 3M5MA 1DT2A 3MO6A 1SQOA 2VIDA 1NU7B 1ELBA 1GG6B 1TOMH 3BTKE 5HGGA 3TJUA 1C2GA 3SQHE 1E36B 1TX7A 2PUXB 1A0HB 2HPQH 4OS7A 2IOTA 1CT2E 1SGNE 3N7OA 2XC4A 3DA9B 1VJ9U 3BV9B 5E0JA 3HKJB 3LKWA 1DM4B 1XX9A 2ZU1A 4XSKU 5DJ7A 1D3DB 1YPLH 1ACBE 1TMTH 3GY8A 5LGOA 1C5SA 4X6OA 3VXFH 4XBBA 2I6QA 2CMYA 1EZXC 1ZJDA 2SFAA 1BTUA 3W95A 3RDZA 2V3OH 3SW2B 1O5EH 1PYTC 1NPMA 3STJA 1AFQC 1UJ1A 2FOMB 4K69A 1EPTA 4WF8A 2BDGA 1IQKA 1O5CB 3M36A 1MCTA 3RC5A 1GL0E 2FESH 1SGIB 2R2WU 2QY0B 1ARCA 1O31A 1ELTA 2ZFSA 1ELEE 2TGDA 1GI2A 1K21H 4X2YA 4Q7XA 1GDQA 3ATKA 2A4RA 3ZYEA 1ELCA 2A4QA 3RU4E 2ZTZA 3EQ0H 1K1JA 2VINA 5ESBA 1K1OA 1WAYB 5CHAC 5JBBS 4YZUA 1CHOG 2ZP0H 3PO1C 2A1DB 3KN2A 5GPIB 2AIQA 1TNIA 4CR5A 1JBUH 1ARBA 2BD8A 3GY4A 5A8ZA 1AUTC 2VH6A 4Y0YE 4ZHMU 2P3FH 4UFEH 2BXUH 4GLYA 3E3TA 1BIOA 1GHVH 1SHHB 2OP9A 4R0IA 2UUFB 2ZO3H 4K60A 2B7DH 6CHAC 1A3EH 1V2NT 2PGBB 2OBQA 3A7TA 2C90B 4MG3A 1F0UA 3EYDA 4MPUA 4K8YA 4O03A 4ZROA 4JZIA 4K1SA 1ZMLA 3S9AA 2BLQA 3TLOA 1C5LH 1L0ZA 1ETTH 1Z8JB 2GD4B 1XM1A 3ZVBA 2R2MB 1J14A 1F5LA 4GVUA 2Y7ZA 2JETB 1MAXA 1HGTH 1BBRE 1BTWA 3MH6A 1WU1A 3MTYA 3OX7U 4E05H 1Z8GA 2A7JA 5DP7A 4CRGA 1FZZA 3Q76A 3DFJA 1C1SA 2XRCA 2G51A 1GI7B 1GJ6A 2AGIX 2EEKA 1E38B 1BDAA 1HPGA 3L33A 1YGCH 4ISIH 4K5ZA 5LH8A 1H9IE 4NCYA 5G4BA 3VB5A 4AFUA 2HGTH 1CQQA 1P2IA 3GYLB 4AYYB 4MPWA 2P16A 2STBE 4TPIZ 4CH8B 2Y6TA 6ESTA 1QA7A 1UVTH 1PPEE 1C2MA 2G5VA 2UUYA 5J4SA 1P02A 2AGEX 3ODDA 1HXEH 2FIRH 1GBCA 3U8OH 1VITH 1QJ6B 1YKTA 1ZOMA 3MNCA 1C1TA 2VIPA 4CRCA 3KHVA 5A8YA 1J8AA 1GI8B 3MFJA 2FP7B 1PPBH 1TRMA 3UNQA 1MTUA 2ZWLH 3RU4T 4F49A 1GMDF 3QZQA 4X1RU 4Y8YA 4BOHA 2F9VA 1D6WA 1O2UA 1TNGA 2NWNA 2ZU5A 5GCHF 1V2WT 5JB8S 3F6UH 3VFEA 5LPFA 1MQ6A 1LPZB 3GCHC 1HAGE 4E7RG 4AFSA 2QAAA 1FNIA 1XUJA 1CVWH 5A0CA 4MTBA 1GJ9B 3SJIA 3UREA 5PTPA 1CU1A 2ZDNA 5C1UA 1Y3WA 1W13U 2PSXA 2QF3A 2I6SA 2VJ1A 1PYTD 2XCNA 3TITA 2GZ9A 3A7VA 1OYQA 1TGNA 1S6HA 1V6DA 8ESTE 1XUKA 4FUJA 2ZA5A 4ABBA 1FN6A 1C5NH 4LK4A 3SNBA 1GMCG 2FYQA 1JRSA 5DKMA 4A92A 1QL8A 2A4OA 3U1JB 1J16A 1BMLA 4IN2A 3UUZA 5IDKA 1EAUA 1CA0C 1O2IA 4PROA 1AVGH 3SN8A 4M7GA 1LKBA 1TNHA 1JMOH 2ZIQH 3G01A 2A2QH 3MNXA 2A0QB 2FMJA 3UNRA 3ZVAA 1CE5A 2R3UA 2OINA 4UFDH 2FOHA 1AB9C 1Z6EA 1TIOA 1ZGIA 1TA6A 1AKSB 1HAPH 2C8YB 1ZPZA 1GI9B 2NU2E 3GCOA 1GI0A 1GHBG 1LMWB 2BZAA 1C2KA 1SMFE 1V2TT 1SLXB 2XWAA 5FX5A 2FOFA 2J2UA 1HB0B 4RN6A 3V3MA 3NKKA 1V2MT 2ZECA 4X6PA 3RXQA 2NU4E 3BTTE 1K1MA 2BMGB 3UWJH 2BDYA 1C2IA 1QFKH 4HFPB 2P95A 3EDXB 5EQQA 1S5SA 3GYMA 3SV8A 1YF4A 3BTDE 2W26A 5HMAA 3O8CA 1GPZA 2QV1A 5L2YH 1X7AC 1FLEE 3OSYA 2QGRA 4VGCC 5T6DA 1GCTB 1LHDH 2VWMA 3LC3A 4TPYA 2VNTA 3LGWA 3GDUA 2J94A 3HK3B 1AB9B 1ZSLA 1HJ8A 4WY3A 1OWKA 2ZFTA 3M61U 1SOZA 1NZQH 5LPRA 1E0FD 2AGGX 1AZ8A 1SOTA 2ASUB 2AMDA 3HGPA 1CHOF 3ZZ3A 1PPCE 2AIPA 2VB0A 2BDHA 7GCHG 1AN1E 1F0TA 1UK2A 3TH2H 2PTCE 1NU9A 3F9GA 5EXLA 4ZH8A 1GI5A 1GVLA 5E2PA 2PWXA 2V35A 1EAXA 1AMHA 1TLDA 1EJMA 2AYWA 5HXFA 1IQJA 2OC8A 1AFEH 3ELAH 4ISLA 4A1VA 4ZKOU 5AVDA 1N6XA 1CA8B 1OKXA 1UTPA 4AX9H 3B23B 2ZZUH 2JH0D 2OXSA 1XXDA 1C5VA 3BSQA 3UR9A 1ZTJA 2FOAA 2ZFQH 2DE8A 4DT7B 4JK5A 1C4Y2 4GCHG 3RMLH 3ZZ7A 3I29A 3ZZ5A 2PLXA 3PYHA 3LJOA 1GGDC 3IWMA 4Y7AA 1MKWK 1RFNA 2BLOA 1O2VA 6LPRA 2XW9A 4BANB 1A46H 2D2DA 1KXEA 2P8OB 3RXFA 1ANDA 1L1GA 1IQMA 3RUOA 1O3JA 1GWAA 4HI3A 2EI6A 5I46H 4FVDA 1TPPA 1VITG 3JZ2B 2A32A 4ABJA 3SHCH 1AVWA 1DUEA 2O8TA 4XBCA 1GI6A 1GHWH 1F0RA 4DIHH 3AAVA 3RU4D 4X8UH 3ESTA 3EA9A 4JZEH 1NN6A 1DDJA 4NG9H 1HJAB 1Y3UA 1ZHRA 1TMBH 1W12U 1WOFA 5BRRE 3UWIA 2KAIB 4ISNA 1K1LA 1KXAA 1F2SE 3PMAB 2BYAX 5C5OA 3SOSA 3EA7A 1FY8E 1S85A 1DS2E 4ABAA 1RGQA 2ZFRH 3HK6B 3TGIE 4ZHAA 3TPIZ 1QA0A 1OP8A 2GT8A 4Y10E 1H4WA 1TGCA 1O3BA 1U6QA 1MKXK 1OX1A 2O8MA 1C5WB 2ZPQA 4UE7H 4O9VA 5C2ZA 3FANA 2H9HA 4HZHA 2WPKS 3D49H 1AU8A 1HAIH 4NIXA 2AH4X 1A4WH 1NO9H 1GJ5H 2UUKB 3SHAH 1D9IA 1P2KA 1EOLA 1AQ7A 3F9EA 3UFAA 2TBSA 2G4UA 2SNVA 1S84A 4Y79A 1ZTLA 2ZI2H 5C20A 1FY5A 3MH4A 3SI3H 1O3PB 1KSNA 1DWEH 4B2BA 1GMCF 1WCZA 2HPPH 5I25A 3KQEA 4NZLA 1G3BA 3FZZA 1LQDB 2P59A 1TYNA 4RKJB 1DFPA 2TGAA 3EAJA 2EA3A 4FU8A 2GVFA 1QBNA 3GCNA 1RIWC 3SGBE 2A45B 3MU4A 4X8SH 4B73A 4TY7A 4Y8XA 2ZDLA 2CXVA 4KGAA 3VB7A 3R0FA 2W3IA 5EG4A 1C1NA 3TH4H 1SLWB 2PKSB 3SJOA 2ZEBA 2V3HH 5FCRA 1A0JA 1FUJA 3A8CA 3V13A 3TGKE 3A8BA 3Q77A 4ZUHA 4H42U 3RXEA 1NM6A 2W5EA 1NTPA 4ZXYH 1EATA 2C93B 3KNXA 3TJNA 3PLPA 2WPLS 3KEEA 4IC5A 4LZ4B 5DP6A 2ZKSA 3URCA 1W7GH 1TBQH 1TABE 4OGXA 4B71A 3F1SB 4TY6A 4B2CA 3BTHE 3FVFB 4WJG2 3NZIA 1F0SA 2Y5HA 1EP6A 3WY8A 2IJOB 3QN7A 1BRBE 3UY9A 3TVJB 3DHKH 3ZZBA 3SGQE 3T29A 1XKBC 1V2VT 1HNEE 1EOJA 1FIZA 1QNJA 1LVBA 1XUFA 3BTQE 3S7HB 3VB4A 4A1TA 3LGYA 3PWCA 3GICB 2WPMS 1HIAA 2BLWA 1V2UT 4NA7A 4YT6H 1VR1H 1V2QT 1AHTH 1CO7E 3MU8A 7GCHF 4MNWA 1O3AA 2ZGCA 1YCPM 1W3CA 1KXFA 4LXBH 2OUAA 5EW1H 4IGDA 2PKAA 2BB4A 1Y5BT 6GCHG 1NESE 3K6ZA 3VGCC 4B1TA 2D1JA 3QDZB 2J9NA 1SGFG 1UTNA 1ZPCA 1UHBB 1ZHMA 2G52A 2ZPRA 1UCYK 1GJAB 1O2KA 2QXGA 1C9TA 1TFXA 2B8OH 1IHSH 3SQEE 2P94A 4F4OC 5DP5A 5AFZH 3SJKA 2ZC9H 3BEFB 1BRAA 1GJDB 1QB6A 5JBAS 2FI5E 2PGQB 3S7KB 2TRMA 7LPRA 1GI4A 2XCFA 2QXHA 4GPGA 1T4UH 3FP7E 5E8EH 1MTNC 1QGFA 1CBWB 1YPGH 2AEIH 1TE0A 3A87A 1G2MA 1JXPA 1BJUA 1O3CA 3RXIA 4Y8ZA 1C1QA 3BF6H 4MLFB 3E90B 4NWLA 1DICA 3RP2A 4KP0A 4R8TB 3RXPA 4BTIB 4ZKSU 2D8WA 4X1QU 2FX6A 1JWTA 4FUGA 3OY6U 3M5LA 4WMEA 5DGJA 2B0FA 2HNTF 4A1XA 4CR9A 3M7QA 1P0SH 3A84A 1VITF 3GCTG 2BD3A 1GJ4H 1O3EA 2J34A 2BM2A 2WUCA 1C1OA 3F9FA 4GSOA 4MVNA 1OXGA 3SV2H 4GUXA 1P10A 1MTNB 3SJ8A 3OTJE 3TNSA 5L30H 4JCNA 1NRRH 3M7TA 2Q6GA 4YM9A 3RXRA 4I7YH 1TX8A 2XC0A 1DOJA 4ABGA 5ESTE 1UVOA 2VWNA 4IMQA 4I8HA 1QL9A 1TRYA 4WMFA 1FDPA 3OU0A 1KTSB 1A5HA 1T32A 1O3KA 1O2SA 2SGFE 5TCCA 1WQSA 1YPMH 1Z1JA 1YPKH 1C5PA 2AFQB 3U69H 3CP7A 1EB1H 4H6SB 1V2PT 1LHCH 2ZDKA 1AFQB 1FN8A 3K9XB 4CHAC 1GJ7B 3CS7A 2XC5A 1V2OT 2V0BA 1MCVA 4H6TA 4X6MA 1A1RA 1GMHG 1P3EA 3LT3A 1CGJE 4UONA 1P2MA 3P92A 2Z94A 3PWBA 1LVOA 1DE7H 2WUBA 3T27A 4CRBA 1BMNH 5FPSA 1CHGA 3QK1A 1B0FA 2C8WB 1DY8A 4MQAA 1H9HE 1DWDH 5CHAB 1PQ8A 3D62A 4XE4A 1BHXB 1S0RA 1WV7H 3PO1B 1EASA 8GCHF 5EQRA 2H9TH 1UK3A 5FPTA 2W7UA 1C5ZB 4X1NU 3UIRA 1O5DH 3GY2A 2ZQ1A 3RXGA 1LHGH 4AB9A 3RXHA 1DANH 4CHAB 1Z6JH 3ZZ8A 2BDAA 1MKWH 6CHAB 1P04A 1W0ZU 1Z8IB 3GY3A 4WWYA 3T5FH 1DLEA 4RKOB 1FY1A 1TNJA 4XDEA 2BQWB 2FO9A 1MZAA 1GI3A 1PQ7A 3F68H 3K6YA 1V2KT 1XUHA 3IITA 1BTYA 3QTOH 1XKAC 1FJSA 1ESBA 3SUEA 2BD7A 2J38A 1O36A 4D7GA 1O2ZA 2ZU3A 3UOUA 2KAIA 1C5QA 4UD9H 1KTTB 1GBMA 3RXTA 4FVBA 1FPCH 2RDLA 2QCYA 1OWJA 1B7XB 2ANKH 3KCGH 4GHQA 1XUIA 1ZSKA 2QXIA 1XVMA 2CN0H 1TBZH 3M37A 4Y71A 1GBAA 3AASA 1YPEH 2XNIA 1BZXE 2Z9KA 4AOQA 5JB9S 2A5AA 4A6LA 3LJJA 4ABFA 1KY9A 1SPJA 1T4VH 1IQFA 1YCPH 1YP9A 1YYY1 1LHFH 3HGNA 2FX4A 3U98H 5JPMH 1ELVA 2XXLA 1HAVB 2VIQA 3ODFA 1ZRKA 1NFUA 1D3TB 5FXLA 1O2JA 3DFLA 1BBRH 3FFGA 3P8OA 1G36A 1EX3A 5K7RA 1GHAG 2PR3A 2F9OA 5JBCS 2A31A 1G3CA 3BIVH 1GJBB 1ESTA 1V3XA 1KXDA 1LVYA 4AGKA 4CH2B 1TGTA 4DY7B 4U30A 3GY5A 6GCHF 2F83A 3KQCA 5F03A 1SGFA 5FPYA 1MZDA 4I8JA 1YLCA 3A7XA 3PMJA 3NPSA 2Y7XA 5JDUB 1FONA 1V2ST 1O2LA 5EOKA 1PJPA 3BIUH 3M5OA 1O32A 1O38A 1C2JA 3A7WA 1GDNA 2GDEH 2G8TA 3AVZA 2TPIZ 4MPXA 1H9LB 3GCHB 1WTHD 4ESTE 3TU7H 1T31A 3A81A 3P6ZB 4CRFA 1MH0A 1GBEA 1L2EA 1OP0A 3P95A 3QLPH 3B8JA 1AD8H 1SHYA 1O30A 2CHAC 1V2RT 2HNTC 1O2XA 5F8TA 2XBVA 2YNBA 2CF9H 2ZU4A 1UCYE 1VGCC 1WUNH 4CRAA 3RLWH 5HYOA 1EPTC 1KXCA 1VCPA 5C67A 4TYDA 1TNKA 3MOCA 2TIOA 1JRTA 5FAHA 1OWIA 2D26C 3MH7A 3SU2A 3RC6A 3EA8A 1GBFA 1DWCH 1L4DA 4MNXA 5EGMA 1VCWA 1UTMA 1CA0B 1THSH 4HGCA 1TB6H 4BXSA 3SJ9A 2WPIS 1HJ9A 3M5NA 1C5RA 3KQDA 2F9PA 2FOBA 1GBIA 4D8NA 1O33A 3A7YA 4UFGH 1O5GH 5JBTA 1SGRE 2FOEA 5FHTA 3GY7A 4Y7BA 5EPNA 2XBYA 2R0KA 1TQ0B 2GCHG 1TQ7B 3GY6A 2C8ZB 3FAOA 5FCKA 1WQVH 4BXWA 2HLCA 3ZV9A 5T6GA 4OS2A 2OQ5A 4AB8A 1V2LT 9ESTA 4FUEA 2ZG0H 4Y11E 1H8IH 2A2XH 2ZHDA 2JH5D 1Q2WA 3P8NA 1S83A 1SGDE 4I33A 1HBTH 1DPOA 1G3DA 2ZTXA 4VGCB 3BG4C 5IYTA 2WV5A 1D3PB 1CT0E 5E0GA 5L6NH 3E8LA 3SNEA 1S81A 3T62A 3QUMP 1MQ5A 1VZQH 4Q7YA 1IQIA 2FYRA 5HM2A 5CE1A 2F9BH 3A86A 1AO5A 4Z0KA 2VIVA 3BTGE 1O35A 2G81E 3LPRA 4ZAEA 3SV7A 4ISOA 2WYGA 3UR6A 4FU7A 1ELDE 4DVAU 1C4U2 1T8OA 2ZTYA 3VXEH 4INKA 1NFXA 1O2NA 1QBVH 1C5OH 1QJ7B 3M3TA 3Q3YA 4THNH 4ABIA 3SU6A 3QX5H 1EZQA 2VIWA 3NWUA 1O34A 1MTSA 3DT0H 3PMBB 2Y5GA 3RXOA 1K1NA 2ZDVH 4JZDH 3T26A 1EP5A 1C9PA 1SGCA 3CS0A 1O2WA 1C2EA 2Y5FA 2UWLA 1P9UA 1DXWA 9LPRA 5A8XA 4H4FA 1LQEA 2RA0A 5F6MA 1QQUA 4X2WA 1DY9A 3BEIB 3O8BA 3TJOA 1BTZA 1WYKA 2AERH 2NU0E 3L3TA 3T2NA 4JYVH 3SUGA 3UOPA 1BJVA 5TCAA 3ZZ6A 3TH3H 2H5CA 4E7NA 1GGDB 1P01A 2Q6DA 1RD3B 1ZMNA
chains in the Genus database with same CATH superfamily
1AE5A 1O3LA 1MU8B 2XBXA 1GJ8B 5A09A 4B6EA 3V0XA 5HM9A 3A7ZA 3P17H 1GBLA 1E35B 1EJNA 2GT7A 2UWPA 2SGEE 4ISHH 2J92A 1O2HA 1FIWA 3LU9B 2AMPA 3B9FH 1P9SA 1THRH 1P3CA 1DXPA 1DUAA 3KQBA 3OYPA 1QIXB 1EZSC 2FXRA 5K0HA 1FQ3A 3TGJE 1K9OE 3QGNB 2AMQA 3NUMA 1BTXA 1ORFA 2Z9JA 2AS9A 5C1YA 1VJAU 5LPEA 4JZ1A 1V2JT 2WZQA 8KME2 3VEQB 3U1IB 3LIWA 1EQ9A 1T8NA 4KTUA 2Y81A 2WV9A 5DK1A 2W3KA 1O39A 1P57B 1SC8U 2ULLA 3A89A 1KLTA 3LDXH 5J4QA 3Q3XA 1O2OA 3VPKA 1KIGH 1NRPH 2R3YA 3CENA 1K2I1 3FKSD 5BPEA 3GOVB 2BLVA 3MU0A 1SG8B 1TRNA 1QRXA 2BY7X 1VCQA 1UTQA 1MTWA 2H5DA 3ZZCA 1QCPA 2BVRH 1SI5H 5T3HA 3QO6A 1PQ5A 3A80A 4I86A 2UWOA 3EGKH 3K65B 3D65E 1SQTA 3RXSA 1UVSH 4DJZB 2Z7FE 1EAWA 1F5KU 1P11E 1ZPBA 1WTGH 1SBWA 3ATLA 2F3CE 2GKVE 1NY22 5KEDA 1O0DH 4YOJA 2BQ6B 3E6PH 1IAUA 2CGAA 2BY9X 2GV7A 1O2MA 1MTVA 1BUIA 4K2YA 4ZKRU 1SFIA 1PFXC 3FP6E 5E2OA 2BY5X 2FOGA 1RTKA 4ABHA 1ANCA 2VGCC 1GHBF 1RRKA 5AFYH 1GBTA 3MQKC 4BAHB 2NU3E 2PV9B 3BTWE 1Z71A 4J1YA 2G5NA 2HWLB 3V7TA 4B2AA 3PRDA 1A2CH 3T25A 3SNAA 5F8ZA 1C1WH 1HXFH 2KCAA 4BAKB 1SB1H 4NFEA 1INCA 3QTVH 5SGAE 1AVXA 2ZGHA 2G00A 3HPTB 3ZV8A 3MHWU 2A5IA 1JIMA 3PLKA 4AC9A 1AE8H 2Z3EA 1C2HA 1RIWB 3BTME 2QE7D 3SORA 1HAVA 1TALA 1D6RA 1DLKB 2FS8A 2ESTE 4FXGH 2QIQA 1UTKA 3KL6A 4X2VA 3AAUA 1RTLA 5F8XA 1CSOE 1HFDA 2GCTC 3OTPA 4AGJA 1FY3A 3BN9A 1HAYB 4NFFA 4SGBE 3DD2H 1QZ8A 2ANYA 3EE0B 3PRBA 3SU0A 4ZMAH 2OD3B 3A85A 4INHA 2GZ8A 2WINI 1GCDA 2BQ7B 1BITA 2BX4A 1KXBA 5GCHG 3MWIU 1C1MA 1PPFE 3STIA 5C1XA 4ASUD 5CMXH 4A7IB 4Z6AH 3TK6A 3AW1A 1GG6C 2RG3A 2Z9IA 4NWKA 3UAIC 4B76A 1CT4E 1PPZA 1JIRA 2THFB 2ALPA 4I31A 1TBRH 4IBLH 2QYIA 2RCEA 1IQHA 4MNVA 3UQVA 1AY6H 1GDUA 1BT7A 1HAXB 1SL3A 1BMAA 5GJ4B 5AF9H 2F91A 3A82A 2H2ZA 3RXKA 1G30B 4X1PU 5H4IB 1YM0A 1BCUH 2Y80A 1SGPE 2SGDE 1AKSA 1Y3XA 2QF0A 2FWWA 1XMNB 4D9RA 4MNYA 1KDQB 4OGYA 4GCHF 1TOCB 3KYGA 4U01A 5GIBA 1NS3A 1WBGB 2PSYA 2ZGXH 4BAQB 1YPJH 2FZZA 2FPZA 1G9IE 2Z6BD 4KTCA 3VB3A 2ANWA 3GS9A 3QZRA 1A5GH 1C1PA 3GDVA 3ZVCA 4Q2KA 2ODYB 4K8BA 5EODA 4DGJA 2DUCA 2BD4A 3I78A 1Y5UT 1O3HA 1W14U 3RXVA 2H1UA 3VGCB 2BDIA 1RXPA 1HYLA 5DPAA 4AG2A 1K22H 3ZZDA 2IPQX 2GV6A 2FLRH 1SGYE 2JH6D 3PTBA 4NIVA 1GL1A 1YBWA 2QN5T 2XOKD 4YOGA 4Y6DA 4ABDA 2ZHEH 2BD5A 2FLBH 1OWDA 1O3DA 2ZFFH 4CREA 3ZVFA 2FODA 1W0YH 3UPEA 1BMMH 4O3UA 3BEUA 1O2YA 1NC6A 1C2LA 1AIXH 4XOJA 3LGTA 1OP2A 3ZVGA 1ETSH 2ZHWH 5FX6A 2ODPA 4K1EA 2C4FH 1MBQA 1O2RA 5C3NA 4Y76A 3A83A 4JYTA 2BHGA 1D4PB 1L1JA 2HVYB 1NFYA 1P03A 5E0HA 2FDAA 4FUBA 3TIUA 4AN7A 2BOKA 1SGTA 1P8VC 1A61H 1H8DH 1QRZA 8LPRA 2FM2A 2ZF0H 1GI1A 2WV4A 4TWWA 3ATIA 3F2FA 5A0AE 2H9EH 3P70B 2XNDD 3NXPA 1P2QA 1FY4A 3RMNH 3RXCA 1B0EA 4KTSA 1ZTKA 2JETC 2STAE 2LNCA 2WHXA 4I8KA 3MO9A 1W0KD 3I77A 1NROH 4QT8C 2HNTE 4YXWD 1HV7A 2ZGBH 2ODQA 4YESB 4BTTB 1C1RA 3O8DA 4WXVA 5EU8A 1N1LA 3MU5A 1DVAH 1OWEA 1O2QA 3ZZAA 1Y5AT 1ID5H 1AGJA 1TGBA 1ABJH 4MDSA 1PPGE 3HKIB 4AORA 1A3BH 2SNWA 3LGUA 1SLUB 1J15A 1IHTH 2A4GA 1Y59T 1O37A 1SGQE 4UEHH 1O3NA 3SV9A 4I32A 1MAYA 4AG1A 3Q00A 4B74A 2P93A 3U8RH 4BNRA 3TK5A 4LOYH 4K1TA 3SUDA 4X8VH 2ANMH 4YOIA 4ZCNA 2A5KA 1YPHE 2CV3A 2BZ6H 2ZHQH 2SGAA 2OC1A 1AI8H 2ZHFH 1ZMJA 3UTUH 1LTOA 2VVCA 2WSSD 4A5TS 3S0NA 4I8GA 2BY6X 1GBDA 1BB0B 1BTHH 2RDEA 3JZ1B 1T8LA 1G3EA 1ZYOA 1NFWA 1ZHPA 2FS9A 2PFEA 3SI4H 1JOUB 1YC0A 3RXAA 4OS5A 1K1IA 2R9PA 3ATWA 1WDIA 1TA2A 4AFZA 3RXLA 4X0WU 4Z1MD 4CRDA 2F43B 1FI8A 1LO6A 1KYNA 2Q1JA 1Y3YA 4Q7ZA 3RMOH 1W7XH 5EW2H 2XBWA 4WH8A 4X6NA 4LZ1H 1P2OA 1P12E 3AW0A 1BTPA 2OQUA 1P2NA 2F9UA 3S9BA 2BD2A 2KFWA 2BXTH 2Y82A 3SO3A 1SFQB 3U28C 5JYIA 1OWHA 3IG6B 4NA9H 2KCOA 5CHBA 3OY5U 4YT7H 3PM3A 1LPGB 1TWXB 5EXNA 1ABIH 1GVZA 3PROA 4YLQH 3SGAE 3A88A 2EI8A 1QR3E 1THPB 3SBKA 4K3JA 5DO4H 2FTMA 3LGVA 3RXMA 5L2ZH 1T8MA 2HALA 4XBDA 1MKXH 2QXJA 4D76A 5GWZA 5DP9A 3F3BA 2ZDAH 4XFQA 2B5TB 5A0BA 1DX5M 4CBOA 1AWFH 1GJCB 1G2LA 2FI3E 1UVUH 2B9LA 2O8LA 1FPHH 2BTCE 4D7FA 2DE9A 4OS1A 2XTTB 4O97A 2GX4A 1SGEE 2ZCHP 3HATH 3E1XB 3MI4A 5B6OA 1CGHA 3P8GA 2IPHA 1ELFA 1C2FA 1DITH 1TGSZ 3ITIA 4AFQA 2Z9LA 1HIAB 2TGPZ 4INLA 1Y8TA 3URDA 3ZZ4A 1Y3VA 1ANEA 4SGAE 3DUXH 3RXBA 4DIIH 1O3IA 3SU5A 1EUFA 2OBOA 2G4TA 1MBMA 1C5UA 1LPKB 3H7TA 3KGPA 1LKAA 2ILNA 5B6LA 2PKAB 2BDCA 1ZLRA 4FOUC 1EXFA 3LH1A 5C5NA 1J17T 3E0NB 1OPHB 1PQAA 2YMSC 3A8AA 1L1NA 1C4V2 2P3UB 4RSPA 1UTLM 3MO3A 4ASHA 2FEQH 3S69A 2J4IA 1FAXA 1MABB 2A7CA 2HRVA 1QB1A 1GCTC 4NZQA 1DSTA 5FBIA 3NK8A 5DP4A 1QHRB 3RC4A 2J98A 1PPHE 2O9QA 4FU9A 1E37B 1O2PA 3RMMH 1SVPA 5T6FA 4WMDA 4KKDA 4CBNA 3LH3A 1M9UA 1BRUP 4FUHA 5ETXA 1QL7A 4X2XA 5AHGH 1E34B 1UMAH 1QRWA 3GCTF 4BTUB 3H7OA 1FV9A 3LOXA 1SQAA 4E06H 1QY6A 2FOCA 4ABEA 1H1BA 2ZFPH 3F9HA 1C5MD 5DG6A 5A2MH 3ZYDA 4JYUH 5GXPA 1F5RA 2OC0A 2BD9A 1RS0A 1BOQA 1YPHC 2BDBA 3SZNA 2WPHS 1TPAE 3U9AH 2CHAB 3PB1E 4ZXXH 3RXUA 4OS4A 1F7ZA 1W11U 3M7UA 4NGAH 1ETRH 1VGCB 1TMUH 2EI7A 2M5TA 2OC7A 1EPTB 2Z9GA 2ZGJA 2Z3CA 2GGVB 2FTLE 1S6LA 1ELGA 1IQLA 4FUCA 3E0PB 4X1SU 1GVKB 2GZ7A 3TNTA 4WXIA 1DSUA 1HDTH 2BOHB 7KMEH 1UHBA 1LDTT 1NRSH 4RI0A 3VB6A 1HRTH 4AZ2B 2C3SA 1UW7A 3Q3KA 1QJ1B 1Z1IA 2VWOA 4IS5A 5TJXA 3PV4A 4O3TA 4JMYA 3BTEE 3SV6A 4P00A 4UDWH 1GMHF 4U32A 2HVXA 2RA3A 3E16B 3SNCA 1N8OC 1EKBB 1KDQA 5IK2D 2P8OC 1UCYH 2ALVA 1G32B 2BVSH 1AUJA 2ZCKP 3U8TH 1EB2A 2OCVB 3PTNA 1QQ4A 4ZKNU 1KLIH 1MD7A 4BAOB 3M35A 5EXMA 4IN1A 1IQGA 3SUFA 2C8XB 4D9QA 2AHME 5GDSH 2HOBA 4GHTA 4NIYA 1HUTH 2HLDD 2OLGA 1WSSH 1UTOA 1OS8A 1MD8A 1ZSJA 2O8WA 3P8FA 1CGIE 2VWLA 3QWCH 1HJAC 1KLJH 2K1QA 3RM2H 1W10U 3PMHB 1ZR0A 4ACAA 3K2UA 3BG4B 1S82A 1LVMA 1NRNH 1S6FA 1C5YB 1ANBA 2P3TB 3BG8A 2KCPA 2ZDMA 4NA8A 2Z3DA 5DP3A 1N8OB 4FUDA 1GBKA 1GHYH 1MU6B 1FAKH 3ZVEA 1OOKB 2YNAA 1GBHA 3MNSA 2ZQ2A 1EAIA 1HAOH 3ENSB 3RLYH 3M3VA 1GBJA 1GBBA 3E91A 1L4ZA 3LONA 3PLBA 4J2YB 1UTJA 1K1PA 1IOEA 1F92A 2SGPE 3S9CA 3UQOA 1YLDA 3MNBA 1Q31A 2JKHA 4KELA 5FBEA 2A7HA 2QA9E 1IQEA 4Y0ZE 2YOLA 1SSXA 3W94A 1TONA 4DCDA 2GDDA 1OSSA 3MH5A 1P09A 3SU1A 4OS6A 1QB9A 1YCPK 3SU3A 1AZZA 1P05A 1O3MA 3LGIA 1C5TA 5DP8A 1ELAA 1IQNA 1C1UH 1GHXH 4IMZA 3F2HA 2UUJB 1LHEH 3QGJA 3TJVA 1RJXB 1GHAF 1N6YA 1P06A 1XUGA 2ZPSA 1SR5C 1BBRK 5HKKD 1BRCE 1XVOA 1AWHB 1TNLA 1RTFB 1ZJKA 4HTCH 3C1KA 3UNSA 1HLTH 1BHXF 4DOQA 3DSGA 3FN8A 1TPSA 2IN2A 1J9CH 3ZVDA 4NSVA 2PKSC 7ESTE 1W8BH 1S0QA 4UFFH 1NT1A 2FI4E 1W2KH 4WVPE 4Q63A 1COWD 1LCYA 3FP8E 3GISB 5EQSA 8GCHG 1EJAA 3MYWA 3H5CB 4YLUA 2VIOA 1ESAA 1HAZB 2ZU2A 4IC6A 4MPVA 3M3SA 1BQYA 4GAWA 1P2JA 3NCLA 1BA8B 1C2DA 2VVVA 3MMGA 3RXJA 2TGTA 1XXFA 2CF8H 5EPYA 1FXYA 4NSYA 2V6NA 2NU1E 2PW8H 1MMJN 1HCGA 1ZGVA 4FUIA 4TWYA 4B75A 1Z7KA 2Q6FA 2GTBA 4JZFH 3RM0H 3KIDU 1TAWA 1YY3A 4F48B 1E79D 4ZHLU 4DG4A 1UVPA 1EFRD 3RXDA 2WYJA 2VVUA 2VH0A 3TK9A 1Z8RA 2XWBI 4I8LA 1GHZA 1A0LA 4HG6A 4OM9A 2F9NA 4JK6A 2OTVA 1B5GH 2W7SA 2H6MA 2QC2A 1QTFA 3ATMA 3R3GB 1O3FA 4YO9A 1G37A 3C27B 2ZNKH 2ZCLP 1GMDG 2GCHF 2VU8E 1HAHH 1C5XB 2VGCB 1ZZZA 1TX6A 2GMTC 2PHBA 2PUQH 3MU1A 4U2WA 1QURH 2O8UA 1A5IA 4FUFA 3KF2A 1Q3XA 2GP9B 4IW4E 3V12A 1O5AB 2CJIA 1O5BB 4DW2U 4AYVB 1EZUC 1NRQH 1O2TA 2BX3A 1O3GA 1CBWC 1O3OA 3SU4A 1K28D 3ZZ9A 1O5FH 2J95A 1TPOA 3AK5A 1FMGA 3FZDA 2PTNA 2LPRA 1A7SA 1UK4A 1DWBH 2LP6A 3L6PA 2G55A 3T28A 1ZRBA 3GDSA 1MUEB 4DURA 2EC9H 1UO6A 3FOAA 2XYAA 2GCTB 1T7CA 3BTFE 4WH6A 2BVXH 2CK3D 2BY8X 3D23A 3A8DA 1SLVB 2WPJS 1D3QB 1QBOA 2R0LA 3LC5A 4Q80A 4YTAA 3SNDA 5ABWA 3O8RA 2GMTB 4X8TH 4NIWA 1OYTH 4BAMB 2SGQE 1O2GH 1C1VH 3M5MA 1DT2A 3MO6A 3KQ5A 1SQOA 2VIDA 1NU7B 1ELBA 2JIZD 1GG6B 1TOMH 3BTKE 5HGGA 3TJUA 1C2GA 3SQHE 1E36B 1TX7A 2PUXB 3N99A 1A0HB 2HPQH 4OS7A 2IOTA 1CT2E 1SGNE 3N7OA 2XC4A 3DA9B 1VJ9U 3BV9B 5E0JA 3HKJB 3LKWA 1DM4B 1XX9A 2ZU1A 4XSKU 5DJ7A 1D3DB 1YPLH 1ACBE 1TMTH 4TT3D 1NBME 2LELA 3GY8A 4F55A 5LGOA 1C5SA 4X6OA 3VXFH 4XBBA 2I6QA 4RT1A 2CMYA 1K0HA 1EZXC 1ZJDA 2M2AA 3H09A 1WXRA 2SFAA 1BTUA 3W95A 3RDZA 2V3OH 3SW2B 1O5EH 1PYTC 1FX0B 1NPMA 3STJA 5DN6D 1AFQC 1UJ1A 2FOMB 4K69A 1EPTA 4WF8A 2BDGA 1IQKA 1O5CB 3M36A 1MCTA 3RC5A 3SZEA 1GL0E 5F53A 2FESH 1SGIB 2R2WU 2JJ2D 2QY0B 1ARCA 1O31A 1ELTA 2ZFSA 1ELEE 2TGDA 1GI2A 1K21H 5HIZA 4X2YA 1VKYA 4Q7XA 1GDQA 3ATKA 2A4RA 3ZYEA 1ELCA 2A4QA 3RU4E 5C0UA 2ZTZA 3EQ0H 1K1JA 2VINA 5ESBA 1K1OA 1WAYB 5CHAC 5JBBS 4YZUA 1CHOG 2ZP0H 3PO1C 2A1DB 3KN2A 5GPIB 2AIQA 1TNIA 4CR5A 1JBUH 3KYFA 1ARBA 2BD8A 3GY4A 5A8ZA 1AUTC 2VH6A 4Y0YE 4ZHMU 2P3FH 4UFEH 2BXUH 4GLYA 3E3TA 1BIOA 1GHVH 1SHHB 2OP9A 4R0IA 2UUFB 2ZO3H 4K60A 2B7DH 6CHAC 1A3EH 1V2NT 2PGBB 2OBQA 3A7TA 2C90B 4MG3A 1F0UA 3EYDA 4MPUA 4K8YA 4O03A 4ZROA 4JZIA 4K1SA 1ZMLA 3S9AA 2BLQA 3TLOA 1C5LH 1L0ZA 1ETTH 1Z8JB 4FETA 2GD4B 1XM1A 3ZVBA 2R2MB 1J14A 1F5LA 4GVUA 2Y7ZA 2JETB 1MAXA 1HGTH 1BBRE 1H8ED 1BTWA 3MH6A 1WU1A 3MTYA 3OX7U 4E05H 1Z8GA 2A7JA 1YLNA 5DP7A 4CRGA 1FZZA 3Q76A 3DFJA 1C1SA 2XRCA 2G51A 1GI7B 1GJ6A 2AGIX 2EEKA 1E38B 1BDAA 1HPGA 3L33A 1YGCH 4ISIH 4K5ZA 5LH8A 1H9IE 4NCYA 5G4BA 3VB5A 4AFUA 2HGTH 1CQQA 1P2IA 3GYLB 4AYYB 3N7DA 4MPWA 2P16A 2STBE 4TPIZ 4CH8B 2Y6TA 6ESTA 5FL7D 1QA7A 1UVTH 1PPEE 1C2MA 2G5VA 2UUYA 5J4SA 1P02A 2AGEX 3ODDA 1HXEH 2FIRH 1GBCA 3U8OH 1VITH 1QJ6B 2QF4A 1YKTA 3WWFA 1ZOMA 3MNCA 1C1TA 2VIPA 4CRCA 3KHVA 5A8YA 1J8AA 5C0TA 1GI8B 3MFJA 2FP7B 1PPBH 1TRMA 3UNQA 1MTUA 2ZWLH 3RU4T 4F49A 1GMDF 3QZQA 4X1RU 4Y8YA 4BOHA 2F9VA 1D6WA 1O2UA 1TNGA 2NWNA 2ZU5A 5GCHF 1V2WT 5JB8S 3F6UH 3VFEA 5LPFA 5EJZA 1MQ6A 2EQNA 1LPZB 3GCHC 1HAGE 4E7RG 4AFSA 2QAAA 1FNIA 1XUJA 1CVWH 2K8IA 5A0CA 4MTBA 1GJ9B 3SJIA 3UREA 5PTPA 1CU1A 2ZDNA 5C1UA 1Y3WA 1W13U 2PSXA 2QF3A 2I6SA 2VJ1A 1PYTD 2XCNA 3TITA 3PV5A 2GZ9A 3A7VA 1OYQA 1TGNA 1S6HA 1V6DA 8ESTE 1XUKA 4FUJA 2ZA5A 4ABBA 1FN6A 1C5NH 4LK4A 3SNBA 1GMCG 2FYQA 1JRSA 5DKMA 4A92A 1QL8A 2A4OA 3U1JB 1J16A 1BMLA 4IN2A 3UUZA 5IDKA 1EAUA 1CA0C 1O2IA 4PROA 1AVGH 3SN8A 4M7GA 1LKBA 1TNHA 1JMOH 2ZIQH 3G01A 2A2QH 3MNXA 2A0QB 2FMJA 3UNRA 3ZVAA 2JJ1D 1CE5A 5KGOA 2R3UA 2OINA 4UFDH 2FOHA 1AB9C 1Z6EA 1TIOA 1ZGIA 1TA6A 1AKSB 1HAPH 2C8YB 1ZPZA 1GI9B 2NU2E 3GCOA 1GI0A 1GHBG 1LMWB 2BZAA 1C2KA 1SMFE 1V2TT 1SLXB 2XWAA 5FX5A 2FOFA 2J2UA 1HB0B 4RN6A 3V3MA 3NKKA 1V2MT 2ZECA 4X6PA 3RXQA 2NU4E 3BTTE 1K1MA 2BMGB 3UWJH 2BDYA 1C2IA 1QFKH 4HFPB 2P95A 3EDXB 5EQQA 1S5SA 2YMSB 3GYMA 3SV8A 1YF4A 3BTDE 2W26A 5HMAA 3O8CA 1GPZA 2QV1A 5L2YH 1X7AC 1FLEE 3OSYA 2QGRA 4VGCC 5T6DA 1GCTB 1LHDH 2VWMA 3LC3A 4TPYA 3DCLA 2VNTA 3LGWA 3GDUA 2J94A 3WWBA 3HK3B 1AB9B 1ZSLA 1E1RD 1HJ8A 4WY3A 1OWKA 2ZFTA 3M61U 5C94A 1SOZA 1NZQH 5LPRA 1E0FD 2AGGX 1AZ8A 1SOTA 2ASUB 2AMDA 3HGPA 2K0QA 3UB0A 1CHOF 3ZZ3A 1PPCE 2AIPA 2VB0A 2BDHA 7GCHG 1AN1E 1F0TA 1UK2A 2L6OA 3TH2H 2PTCE 1NU9A 3EE7A 3F9GA 5EXLA 4ZH8A 1GI5A 1GVLA 5E2PA 2PWXA 2V35A 1EAXA 1AMHA 1TLDA 1EJMA 2AYWA 5HXFA 1IQJA 2OC8A 1AFEH 3ELAH 4ISLA 4A1VA 4ZKOU 2VBCA 2RFKC 5AVDA 1N6XA 1CA8B 1OKXA 1UTPA 4AX9H 3B23B 2ZZUH 2JH0D 2OXSA 1XXDA 1C5VA 3W1EA 3BSQA 3UR9A 1ZTJA 2FOAA 2ZFQH 2DE8A 3OAAD 4DT7B 4JK5A 1C4Y2 4GCHG 3RMLH 3ZZ7A 3I29A 3ZZ5A 1NBMD 2PLXA 3PYHA 3LJOA 1GGDC 3IWMA 4Y7AA 3N7EA 1MKWK 1RFNA 2KR7A 2BLOA 1O2VA 6LPRA 2XW9A 4BANB 1A46H 2D2DA 1KXEA 2P8OB 3RXFA 1ANDA 1L1GA 1IQMA 3RUOA 2KM0A 1O3JA 1GWAA 4HI3A 2EI6A 5I46H 4FVDA 2IJD1 1TPPA 1VITG 3JZ2B 4XD7D 2W6ID 3PV2A 2A32A 4ABJA 3SHCH 1AVWA 1DUEA 2O8TA 4XBCA 1GI6A 1GHWH 1F0RA 4DIHH 3AAVA 3RU4D 4X8UH 3ESTA 3EA9A 4JZEH 1NN6A 5T1VA 1DDJA 4NG9H 5EIYA 1HJAB 1Y3UA 2YMSD 2JDID 1ZHRA 1TMBH 1W12U 1WOFA 5BRRE 3UWIA 2KAIB 4ISNA 1K1LA 1KXAA 1F2SE 3PMAB 2BYAX 5C5OA 3SOSA 3EA7A 1FY8E 1S85A 1DS2E 4ABAA 1RGQA 2ZFRH 3F2GA 3HK6B 3TGIE 4ZHAA 3TPIZ 1QA0A 3CNRA 1OP8A 2GT8A 4Y10E 1H4WA 1TGCA 1O3BA 1U6QA 1MKXK 1OX1A 2O8MA 1C5WB 2ZPQA 4UE7H 4O9VA 5C2ZA 3FANA 2H9HA 4HZHA 2WPKS 3D49H 1AU8A 1HAIH 4NIXA 2AH4X 1A4WH 1NO9H 1GJ5H 3DSPA 2UUKB 3SHAH 1D9IA 2KX4A 1P2KA 1EOLA 4RT0A 1AQ7A 3F9EA 3UFAA 3F0PA 4XRNA 2TBSA 2G4UA 2SNVA 1S84A 4Y79A 1ZTLA 2ZI2H 5C20A 1FY5A 3MH4A 3SI3H 1O3PB 1KSNA 1DWEH 4B2BA 1GMCF 1WCZA 2HPPH 5I25A 3KQEA 4NZLA 1G3BA 3FZZA 1LQDB 2P59A 1TYNA 4RKJB 1DFPA 2TGAA 3EAJA 2EA3A 4FU8A 2GVFA 1QBNA 3GCNA 1RIWC 3SGBE 2A45B 3MU4A 4X8SH 4B73A 4TY7A 2KZ4A 2ZDLA 2CXVA 4Y8XA 4KGAA 3VB7A 3R0FA 2W3IA 5EG4A 4B6FA 1C1NA 3TH4H 1SLWB 2PKSB 3SJOA 2ZEBA 2V3HH 5FCRA 1A0JA 1FUJA 3A8CA 3V13A 3TGKE 3A8BA 3Q77A 4ZUHA 4H42U 3RXEA 1NM6A 2W6JD 2W5EA 3FO8D 1NTPA 4ZXYH 1EATA 2C93B 3KNXA 3TJNA 3PLPA 2WPLS 3KEEA 4IC5A 4LZ4B 5DP6A 2ZKSA 3URCA 1W7GH 2J98B 1TBQH 1TABE 4OGXA 4B71A 3F1SB 4TY6A 4B2CA 3BTHE 3FVFB 4WJG2 3NZIA 1F0SA 2Y5HA 1OHHD 1EP6A 3WY8A 2IJOB 3QN7A 1BRBE 3UY9A 3OFND 3TVJB 3DHKH 3ZZBA 3SGQE 3T29A 1XKBC 1V2VT 1HNEE 1EOJA 1FIZA 1QNJA 1SKYE 1LVBA 1XUFA 3BTQE 3S7HB 3VB4A 4A1TA 3LGYA 1H8HD 3PWCA 3GICB 2WPMS 1HIAA 2BLWA 1V2UT 4NA7A 4YT6H 2QF5A 1VR1H 2WPDD 1V2QT 1AHTH 1CO7E 3MU8A 7GCHF 4MNWA 1O3AA 2ZGCA 1YCPM 1W3CA 1KXFA 4LXBH 2OUAA 5EW1H 4IGDA 2PKAA 2BB4A 1Y5BT 6GCHG 1NESE 3K6ZA 3VGCC 4B1TA 2D1JA 3QDZB 4DT4A 2J9NA 1SGFG 1UTNA 1ZPCA 1UHBB 1ZHMA 2G52A 2ZPRA 1UCYK 1GJAB 1O2KA 2QXGA 1C9TA 1TFXA 2B8OH 1IHSH 3SQEE 2P94A 4F4OC 5DP5A 5AFZH 3SJKA 5GNDA 2ZC9H 3BEFB 1BRAA 1GJDB 1QB6A 5JBAS 2FI5E 3NRLA 4M9FA 2PGQB 3S7KB 2TRMA 7LPRA 1GI4A 2XCFA 2QXHA 4GPGA 1T4UH 3FP7E 5E8EH 1MTNC 1QGFA 2GJGA 1CBWB 1YPGH 3SYJA 2AEIH 1TE0A 3A87A 1G2MA 1JXPA 1BJUA 1O3CA 4TSFD 3RXIA 4Y8ZA 4ACBA 1C1QA 3BF6H 4MLFB 3E90B 4NWLA 1DICA 3RP2A 4KP0A 4R8TB 3RXPA 4BTIB 4ZKSU 2D8WA 4X1QU 2FX6A 1JWTA 2L74A 4FUGA 3OY6U 3M5LA 5EJLA 4WMEA 1BMFD 5DGJA 2B0FA 2HNTF 4A1XA 4CR9A 3M7QA 1P0SH 3A84A 1VITF 3GCTG 2BD3A 1GJ4H 1O3EA 2J34A 2BM2A 2WUCA 1C1OA 3VG8A 3F9FA 4GSOA 4MVNA 1OXGA 3SV2H 4GUXA 1P10A 1MTNB 3SJ8A 3OTJE 3TNSA 5L30H 4JCNA 1NRRH 3M7TA 3ZIAD 2Q6GA 4YM9A 3RXRA 4I7YH 1TX8A 2XC0A 1DOJA 4ABGA 5ESTE 1UVOA 2VWNA 4IMQA 4I8HA 1QL9A 1TRYA 4WMFA 1FDPA 3OU0A 1KTSB 1A5HA 1T32A 1O3KA 1O2SA 2SGFE 5TCCA 3DSOA 1WQSA 1YPMH 1Z1JA 1YPKH 1C5PA 2AFQB 3U69H 3CP7A 1EB1H 4H6SB 1V2PT 1LHCH 2ZDKA 1AFQB 1FN8A 3K9XB 4CHAC 1GJ7B 3CS7A 2XC5A 1V2OT 1W0JD 2V0BA 2PP6A 1MCVA 4H6TA 4X6MA 1A1RA 1GMHG 1P3EA 3LT3A 1CGJE 4UONA 1P2MA 3P92A 2Z94A 3PWBA 1LVOA 3OEHD 1DE7H 2WUBA 3T27A 4CRBA 1BMNH 5FPSA 1CHGA 3QK1A 1B0FA 2C8WB 1DY8A 4MQAA 1H9HE 1DWDH 5CHAB 1PQ8A 3D62A 4XE4A 1BHXB 1S0RA 1WV7H 3PO1B 1EASA 2EY4C 8GCHF 5EQRA 2H9TH 4Q4LA 1UK3A 5FPTA 2W7UA 1C5ZB 4X1NU 3UIRA 1O5DH 3GY2A 2ZQ1A 3RXGA 1LHGH 4AB9A 3RXHA 1DANH 4CHAB 1Z6JH 3ZZ8A 2BDAA 1MKWH 6CHAB 1P04A 1W0ZU 1Z8IB 3GY3A 4WWYA 3T5FH 1DLEA 4RKOB 1FY1A 1TNJA 4XDEA 2BQWB 2FO9A 1MZAA 1GI3A 1PQ7A 3F68H 3K6YA 1V2KT 1XUHA 3IITA 1BTYA 3QTOH 1XKAC 1FJSA 1ESBA 3SUEA 2BD7A 2J38A 1O36A 4D7GA 1O2ZA 2ZU3A 3UOUA 2KAIA 1C5QA 4UD9H 5EJ1A 3F0OA 1KTTB 1GBMA 3RXTA 4FVBA 1FPCH 2RDLA 2QCYA 1OWJA 1B7XB 2ANKH 3KCGH 4GHQA 1XUIA 1ZSKA 2QXIA 1XVMA 2CN0H 1TBZH 3M37A 4Y71A 5KECA 1GBAA 3AASA 1YPEH 2XNIA 1BZXE 2Z9KA 4AOQA 5CDFE 5JB9S 2A5AA 4A6LA 3LJJA 1YWUA 4ABFA 1KY9A 1SPJA 1T4VH 1IQFA 1YCPH 1YP9A 1YYY1 1LHFH 3HGNA 2FX4A 3U98H 5JPMH 1ELVA 2XXLA 1HAVB 2VIQA 3ODFA 1ZRKA 3WW7A 1NFUA 1D3TB 5FXLA 1O2JA 3DFLA 1BBRH 3FFGA 3P8OA 1G36A 1EX3A 5K7RA 1GHAG 2PR3A 2F9OA 5JBCS 2A31A 1G3CA 3BIVH 1GJBB 1ESTA 1V3XA 1KXDA 1LVYA 4AGKA 4CH2B 1TGTA 4DY7B 4U30A 3GY5A 1KMHB 6GCHF 2F83A 3KQCA 5F03A 1SGFA 5FPYA 1MZDA 4I8JA 1YLCA 3A7XA 3PMJA 3NPSA 2Y7XA 1SQRA 5JDUB 1FONA 1V2ST 1O2LA 5EOKA 1PJPA 3BIUH 3M5OA 1O32A 1O38A 1C2JA 3A7WA 1GDNA 2GDEH 2G8TA 3AVZA 2TPIZ 4MPXA 1H9LB 3GCHB 1WTHD 4ESTE 3TU7H 1T31A 3A81A 3P6ZB 4CRFA 1MH0A 1GBEA 1L2EA 1OP0A 3P95A 3QLPH 3B8JA 1AD8H 1SHYA 1O30A 2CHAC 1V2RT 2HNTC 1O2XA 5F8TA 2OK5A 2XBVA 2YNBA 5DSFA 2CF9H 2F4LA 2ZU4A 1UCYE 1VGCC 1WUNH 4P02A 4CRAA 3RLWH 5HYOA 1EPTC 1KXCA 1VCPA 5C67A 4TYDA 2J97A 1TNKA 3MOCA 2TIOA 1JRTA 5FAHA 1OWIA 2D26C 3MH7A 3SU2A 3RC6A 3EA8A 1GBFA 1DWCH 1L4DA 4MNXA 5EGMA 1VCWA 1UTMA 1CA0B 1THSH 4HGCA 3OEED 1TB6H 4BXSA 3SJ9A 2WPIS 1HJ9A 3M5NA 1C5RA 3KQDA 2F9PA 2FOBA 1GBIA 4D8NA 1O33A 3A7YA 4UFGH 5HIYA 1O5GH 5JBTA 1SGRE 2FOEA 5FHTA 3GY7A 4Y7BA 5EPNA 2XBYA 2R0KA 1TQ0B 5C17A 2GCHG 1TQ7B 2V7QD 2C8ZB 3GY6A 3FAOA 5FCKA 1WQVH 4BXWA 2V3MA 2HLCA 3ZV9A 5T6GA 4OS2A 2OQ5A 4AB8A 1V2LT 9ESTA 4FUEA 2ZG0H 4Y11E 1H8IH 2A2XH 2ZHDA 2JH5D 1Q2WA 3P8NA 1E1QD 1S83A 2J5UA 1SGDE 4I33A 1HBTH 1DPOA 1G3DA 2ZTXA 4VGCB 3BG4C 5IYTA 2WV5A 1D3PB 1CT0E 5E0GA 5L6NH 3E8LA 3SNEA 1S81A 3T62A 3QUMP 1MQ5A 1VZQH 4Q7YA 1IQIA 2FYRA 5HM2A 5CE1A 2F9BH 3A86A 1AO5A 4Z0KA 2VIVA 3BTGE 1O35A 2G81E 3LPRA 4ZAEA 3SV7A 4ISOA 2WYGA 3UR6A 4FU7A 1ELDE 4DVAU 1C4U2 1T8OA 2ZTYA 3VXEH 4INKA 1NFXA 1O2NA 1QBVH 1C5OH 1QJ7B 3M3TA 3OE7D 3Q3YA 4THNH 3SU6A 4ABIA 3QX5H 1EZQA 2VIWA 3NWUA 1O34A 1MTSA 3DT0H 3PMBB 2Y5GA 3RXOA 1K1NA 2ZDVH 4JZDH 3T26A 1EP5A 1C9PA 1SGCA 3CS0A 1O2WA 1C2EA 2Y5FA 2UWLA 1P9UA 1DXWA 9LPRA 5A8XA 4H4FA 1LQEA 2RA0A 5F6MA 1QQUA 4X2WA 1DY9A 3BEIB 3O8BA 3TJOA 1BTZA 1WYKA 2AERH 2NU0E 3L3TA 3T2NA 2KCYA 4JYVH 3SUGA 3UOPA 1BJVA 5TCAA 3ZZ6A 3TH3H 2H5CA 4E7NA 1GGDB 1P01A 2Q6DA 1RD3B 1ZMNA
chains in the Genus database with same CATH topology
1AE5A 1O3LA 1MU8B 2XBXA 1GJ8B 5A09A 3V0XA 5HM9A 3A7ZA 3P17H 1GBLA 1E35B 1EJNA 2GT7A 2UWPA 2SGEE 4ISHH 2J92A 1O2HA 1FIWA 3LU9B 2AMPA 3B9FH 1P9SA 1THRH 1P3CA 1DXPA 1DUAA 3KQBA 3OYPA 1QIXB 1EZSC 2FXRA 5K0HA 1FQ3A 3TGJE 1K9OE 3QGNB 2AMQA 3NUMA 1BTXA 1ORFA 2Z9JA 2AS9A 5C1YA 1VJAU 5LPEA 4JZ1A 1V2JT 8KME2 3VEQB 3U1IB 3LIWA 1EQ9A 1T8NA 4KTUA 2Y81A 5DK1A 2W3KA 1O39A 1P57B 1SC8U 2ULLA 3A89A 1KLTA 3LDXH 5J4QA 3Q3XA 1O2OA 3VPKA 1KIGH 1NRPH 2R3YA 3CENA 1K2I1 5BPEA 3GOVB 2BLVA 3MU0A 1SG8B 1TRNA 1QRXA 2BY7X 1VCQA 1UTQA 1MTWA 2H5DA 3ZZCA 1QCPA 2BVRH 1SI5H 5T3HA 3QO6A 1PQ5A 3A80A 2UWOA 3EGKH 3K65B 3D65E 1SQTA 3RXSA 1UVSH 4DJZB 2Z7FE 1EAWA 1F5KU 1P11E 1ZPBA 1WTGH 1SBWA 3ATLA 2F3CE 2GKVE 1NY22 1O0DH 4YOJA 2BQ6B 3E6PH 1IAUA 2CGAA 2BY9X 2GV7A 1O2MA 1MTVA 1BUIA 4K2YA 4ZKRU 1SFIA 1PFXC 3FP6E 5E2OA 2BY5X 2FOGA 1RTKA 4ABHA 1ANCA 2VGCC 1GHBF 1RRKA 5AFYH 1GBTA 4BAHB 2NU3E 2PV9B 3BTWE 1Z71A 4J1YA 2G5NA 2HWLB 3V7TA 4B2AA 1A2CH 3T25A 3SNAA 5F8ZA 1C1WH 1HXFH 4BAKB 1SB1H 4NFEA 1INCA 3QTVH 5SGAE 1AVXA 2ZGHA 2G00A 3HPTB 3ZV8A 3MHWU 2A5IA 1JIMA 3PLKA 1AE8H 2Z3EA 1C2HA 1RIWB 3BTME 3SORA 1HAVA 1TALA 1D6RA 1DLKB 2FS8A 2ESTE 4FXGH 2QIQA 1UTKA 3KL6A 4X2VA 3AAUA 1RTLA 5F8XA 1CSOE 1HFDA 2GCTC 4AGJA 1FY3A 3BN9A 1HAYB 4NFFA 4SGBE 3DD2H 2ANYA 3EE0B 3SU0A 4ZMAH 2OD3B 3A85A 4INHA 2GZ8A 2WINI 1GCDA 2BQ7B 1BITA 2BX4A 1KXBA 5GCHG 3MWIU 1C1MA 1PPFE 3STIA 5C1XA 5CMXH 4A7IB 4Z6AH 3TK6A 3AW1A 1GG6C 2RG3A 2Z9IA 4NWKA 4B76A 1CT4E 1PPZA 1JIRA 2THFB 2ALPA 4I31A 1TBRH 4IBLH 2QYIA 2RCEA 1IQHA 4MNVA 3UQVA 1AY6H 1GDUA 1BT7A 1HAXB 1SL3A 1BMAA 5GJ4B 5AF9H 2F91A 3A82A 2H2ZA 3RXKA 1G30B 4X1PU 5H4IB 1YM0A 1BCUH 2Y80A 1SGPE 2SGDE 1AKSA 1Y3XA 2QF0A 2FWWA 1XMNB 4D9RA 4MNYA 1KDQB 4OGYA 4GCHF 1TOCB 4U01A 5GIBA 1NS3A 1WBGB 2PSYA 2ZGXH 4BAQB 1YPJH 2FZZA 2FPZA 1G9IE 2Z6BD 4KTCA 3VB3A 2ANWA 3QZRA 1A5GH 1C1PA 3GDVA 3ZVCA 4Q2KA 2ODYB 4K8BA 5EODA 4DGJA 2DUCA 2BD4A 3I78A 1Y5UT 1O3HA 1W14U 3RXVA 2H1UA 3VGCB 2BDIA 1RXPA 1HYLA 5DPAA 4AG2A 1K22H 3ZZDA 2GV6A 2FLRH 1SGYE 2JH6D 3PTBA 4NIVA 1GL1A 1YBWA 2QN5T 4YOGA 4Y6DA 4ABDA 2ZHEH 2BD5A 2FLBH 1OWDA 1O3DA 2ZFFH 4CREA 3ZVFA 2FODA 1W0YH 3UPEA 1BMMH 4O3UA 3BEUA 1O2YA 1NC6A 1C2LA 1AIXH 4XOJA 3LGTA 1OP2A 3ZVGA 1ETSH 2ZHWH 5FX6A 2ODPA 4K1EA 2C4FH 1MBQA 1O2RA 5C3NA 4Y76A 3A83A 4JYTA 2BHGA 1D4PB 1L1JA 1NFYA 1P03A 5E0HA 2FDAA 4FUBA 3TIUA 4AN7A 2BOKA 1SGTA 1P8VC 1A61H 1H8DH 1QRZA 8LPRA 2FM2A 2ZF0H 1GI1A 2WV4A 4TWWA 3ATIA 5A0AE 2H9EH 3P70B 3NXPA 1P2QA 1FY4A 3RMNH 3RXCA 1B0EA 4KTSA 1ZTKA 2JETC 2STAE 2LNCA 4I8KA 3MO9A 3I77A 1NROH 4QT8C 2HNTE 1HV7A 2ZGBH 2ODQA 4YESB 4BTTB 1C1RA 3O8DA 4WXVA 5EU8A 1N1LA 3MU5A 1DVAH 1OWEA 1O2QA 3ZZAA 1Y5AT 1ID5H 1AGJA 1TGBA 1ABJH 4MDSA 1PPGE 3HKIB 4AORA 1A3BH 2SNWA 3LGUA 1SLUB 1J15A 1IHTH 2A4GA 1Y59T 1O37A 1SGQE 4UEHH 1O3NA 3SV9A 4I32A 1MAYA 4AG1A 3Q00A 4B74A 2P93A 3U8RH 4BNRA 3TK5A 4LOYH 4K1TA 3SUDA 4X8VH 2ANMH 4YOIA 2A5KA 1YPHE 2CV3A 2BZ6H 2ZHQH 2SGAA 2OC1A 1AI8H 2ZHFH 1ZMJA 3UTUH 1LTOA 2VVCA 4A5TS 3S0NA 4I8GA 2BY6X 1GBDA 1BB0B 1BTHH 3JZ1B 1T8LA 1G3EA 1ZYOA 1NFWA 1ZHPA 2FS9A 2PFEA 3SI4H 1JOUB 1YC0A 3RXAA 4OS5A 1K1IA 2R9PA 3ATWA 1TA2A 4AFZA 3RXLA 4X0WU 4CRDA 1FI8A 1LO6A 1KYNA 2Q1JA 1Y3YA 4Q7ZA 3RMOH 1W7XH 5EW2H 2XBWA 4WH8A 4X6NA 4LZ1H 1P2OA 1P12E 3AW0A 1BTPA 2OQUA 1P2NA 2F9UA 3S9BA 2BD2A 2BXTH 2Y82A 3SO3A 1SFQB 5JYIA 1OWHA 3IG6B 4NA9H 3OY5U 4YT7H 3PM3A 1LPGB 1TWXB 5EXNA 1ABIH 1GVZA 3PROA 4YLQH 3SGAE 3A88A 2EI8A 1QR3E 1THPB 3SBKA 4K3JA 5DO4H 2FTMA 3LGVA 3RXMA 5L2ZH 1T8MA 2HALA 4XBDA 1MKXH 2QXJA 4D76A 5GWZA 5DP9A 2ZDAH 4XFQA 2B5TB 5A0BA 1DX5M 4CBOA 1AWFH 1GJCB 1G2LA 2FI3E 1UVUH 2B9LA 2O8LA 1FPHH 2BTCE 4D7FA 2DE9A 4OS1A 2XTTB 4O97A 2GX4A 1SGEE 2ZCHP 3HATH 3E1XB 3MI4A 5B6OA 1CGHA 3P8GA 2IPHA 1ELFA 1C2FA 1DITH 1TGSZ 3ITIA 4AFQA 2Z9LA 1HIAB 2TGPZ 4INLA 1Y8TA 3URDA 3ZZ4A 1Y3VA 1ANEA 4SGAE 3DUXH 3RXBA 4DIIH 1O3IA 3SU5A 1EUFA 2OBOA 2G4TA 1MBMA 1C5UA 1LPKB 3H7TA 3KGPA 1LKAA 2ILNA 2PKAB 2BDCA 1ZLRA 1EXFA 3LH1A 5C5NA 1J17T 3E0NB 1OPHB 1PQAA 3A8AA 1L1NA 1C4V2 2P3UB 4RSPA 1UTLM 3MO3A 4ASHA 2FEQH 3S69A 2J4IA 1FAXA 2HRVA 2A7CA 1QB1A 1GCTC 4NZQA 1DSTA 5FBIA 3NK8A 5DP4A 1QHRB 3RC4A 1PPHE 2O9QA 4FU9A 1E37B 1O2PA 3RMMH 1SVPA 5T6FA 4WMDA 4KKDA 4CBNA 3LH3A 1M9UA 1BRUP 4FUHA 5ETXA 1QL7A 4X2XA 5AHGH 1E34B 1UMAH 1QRWA 3GCTF 4BTUB 3H7OA 1FV9A 3LOXA 1SQAA 4E06H 1QY6A 2FOCA 4ABEA 1H1BA 2ZFPH 3F9HA 1C5MD 5DG6A 5A2MH 3ZYDA 4JYUH 5GXPA 1F5RA 2OC0A 2BD9A 1RS0A 1BOQA 1YPHC 2BDBA 3SZNA 2WPHS 1TPAE 3U9AH 2CHAB 3PB1E 4ZXXH 3RXUA 4OS4A 1F7ZA 1W11U 3M7UA 4NGAH 1ETRH 1VGCB 1TMUH 2EI7A 2M5TA 2OC7A 1EPTB 2Z9GA 2ZGJA 2Z3CA 2GGVB 2FTLE 1ELGA 1IQLA 4FUCA 3E0PB 4X1SU 1GVKB 2GZ7A 3TNTA 4WXIA 1DSUA 1HDTH 2BOHB 7KMEH 1UHBA 1LDTT 1NRSH 3VB6A 1HRTH 4AZ2B 2C3SA 3Q3KA 1QJ1B 1Z1IA 2VWOA 4IS5A 5TJXA 3PV4A 4O3TA 4JMYA 3BTEE 3SV6A 4UDWH 1GMHF 4U32A 2HVXA 2RA3A 3E16B 3SNCA 1N8OC 1EKBB 1KDQA 2P8OC 1UCYH 2ALVA 1G32B 2BVSH 1AUJA 2ZCKP 3U8TH 1EB2A 2OCVB 3PTNA 1QQ4A 4ZKNU 1KLIH 1MD7A 4BAOB 3M35A 5EXMA 4IN1A 1IQGA 3SUFA 2C8XB 4D9QA 5GDSH 2HOBA 4GHTA 4NIYA 1HUTH 2OLGA 1WSSH 1UTOA 1OS8A 1MD8A 1ZSJA 2O8WA 3P8FA 1CGIE 2VWLA 3QWCH 1HJAC 1KLJH 2K1QA 3RM2H 1W10U 3PMHB 1ZR0A 3K2UA 3BG4B 1S82A 1LVMA 1NRNH 1S6FA 1C5YB 1ANBA 2P3TB 3BG8A 2ZDMA 4NA8A 2Z3DA 5DP3A 1N8OB 4FUDA 1GBKA 1GHYH 1MU6B 1FAKH 3ZVEA 1OOKB 2YNAA 1GBHA 3MNSA 2ZQ2A 1EAIA 1HAOH 3ENSB 3RLYH 3M3VA 1GBJA 1GBBA 3E91A 1L4ZA 3LONA 3PLBA 4J2YB 1UTJA 1K1PA 1IOEA 1F92A 2SGPE 3S9CA 3UQOA 1YLDA 3MNBA 1Q31A 2JKHA 4KELA 5FBEA 2A7HA 2QA9E 1IQEA 4Y0ZE 2YOLA 1SSXA 3W94A 1TONA 4DCDA 2GDDA 1OSSA 3MH5A 1P09A 3SU1A 4OS6A 1QB9A 1YCPK 3SU3A 1AZZA 1P05A 1O3MA 3LGIA 1C5TA 5DP8A 1ELAA 1IQNA 1C1UH 1GHXH 4IMZA 2UUJB 1LHEH 3QGJA 3TJVA 1RJXB 1GHAF 1N6YA 1P06A 1XUGA 2ZPSA 1SR5C 1BBRK 1BRCE 1XVOA 1AWHB 1TNLA 1RTFB 1ZJKA 4HTCH 3C1KA 3UNSA 1HLTH 1BHXF 4DOQA 1TPSA 2IN2A 1J9CH 3ZVDA 4NSVA 2PKSC 7ESTE 1W8BH 1S0QA 4UFFH 1NT1A 2FI4E 1W2KH 4WVPE 1LCYA 3FP8E 3GISB 5EQSA 8GCHG 1EJAA 3MYWA 3H5CB 4YLUA 2VIOA 1ESAA 1HAZB 2ZU2A 4IC6A 4MPVA 3M3SA 1BQYA 4GAWA 1P2JA 3NCLA 1BA8B 1C2DA 2VVVA 3MMGA 3RXJA 2TGTA 1XXFA 2CF8H 5EPYA 1FXYA 4NSYA 2V6NA 2NU1E 2PW8H 1MMJN 1HCGA 1ZGVA 4FUIA 4TWYA 4B75A 1Z7KA 2Q6FA 2GTBA 4JZFH 3RM0H 3KIDU 1TAWA 4ZHLU 4DG4A 1UVPA 3RXDA 2WYJA 2VVUA 2VH0A 3TK9A 1Z8RA 2XWBI 4I8LA 1GHZA 1A0LA 2F9NA 4JK6A 2OTVA 1B5GH 2W7SA 2H6MA 2QC2A 1QTFA 3ATMA 3R3GB 1O3FA 4YO9A 1G37A 3C27B 2ZNKH 2ZCLP 1GMDG 2GCHF 2VU8E 1HAHH 1C5XB 2VGCB 1ZZZA 1TX6A 2GMTC 2PHBA 2PUQH 3MU1A 4U2WA 1QURH 2O8UA 1A5IA 4FUFA 3KF2A 1Q3XA 2GP9B 4IW4E 3V12A 1O5AB 2CJIA 1O5BB 4DW2U 4AYVB 1EZUC 1NRQH 1O2TA 2BX3A 1O3GA 1CBWC 1O3OA 3SU4A 1K28D 3ZZ9A 1O5FH 2J95A 1TPOA 1FMGA 3FZDA 2PTNA 2LPRA 1A7SA 1UK4A 1DWBH 3L6PA 2G55A 3T28A 1ZRBA 3GDSA 1MUEB 4DURA 2EC9H 1UO6A 2XYAA 2GCTB 1T7CA 3BTFE 4WH6A 2BVXH 2BY8X 3D23A 3A8DA 1SLVB 2WPJS 1D3QB 1QBOA 2R0LA 3LC5A 4Q80A 4YTAA 3SNDA 5ABWA 3O8RA 2GMTB 4X8TH 4NIWA 1OYTH 4BAMB 2SGQE 1O2GH 1C1VH 3M5MA 1DT2A 3MO6A 1SQOA 2VIDA 1NU7B 1ELBA 1GG6B 1TOMH 3BTKE 5HGGA 3TJUA 1C2GA 3SQHE 1E36B 1TX7A 2PUXB 1A0HB 2HPQH 4OS7A 2IOTA 1CT2E 1SGNE 3N7OA 2XC4A 3DA9B 1VJ9U 3BV9B 5E0JA 3HKJB 3LKWA 1DM4B 1XX9A 2ZU1A 4XSKU 5DJ7A 1D3DB 1YPLH 1ACBE 1TMTH 3GY8A 5LGOA 1C5SA 4X6OA 3VXFH 4XBBA 2I6QA 2CMYA 1EZXC 1ZJDA 2SFAA 1BTUA 3W95A 3RDZA 2V3OH 3SW2B 1O5EH 1PYTC 1NPMA 3STJA 1AFQC 1UJ1A 2FOMB 4K69A 1EPTA 4WF8A 2BDGA 1IQKA 1O5CB 3M36A 1MCTA 3RC5A 1GL0E 2FESH 1SGIB 2R2WU 2QY0B 1ARCA 1O31A 1ELTA 2ZFSA 1ELEE 2TGDA 1GI2A 1K21H 4X2YA 4Q7XA 1GDQA 3ATKA 2A4RA 3ZYEA 1ELCA 2A4QA 3RU4E 2ZTZA 3EQ0H 1K1JA 2VINA 5ESBA 1K1OA 1WAYB 5CHAC 5JBBS 4YZUA 1CHOG 2ZP0H 3PO1C 2A1DB 3KN2A 5GPIB 2AIQA 1TNIA 4CR5A 1JBUH 1ARBA 2BD8A 3GY4A 5A8ZA 1AUTC 2VH6A 4Y0YE 4ZHMU 2P3FH 4UFEH 2BXUH 4GLYA 3E3TA 1BIOA 1GHVH 1SHHB 2OP9A 4R0IA 2UUFB 2ZO3H 4K60A 2B7DH 6CHAC 1A3EH 1V2NT 2PGBB 2OBQA 3A7TA 2C90B 4MG3A 1F0UA 3EYDA 4MPUA 4K8YA 4O03A 4ZROA 4JZIA 4K1SA 1ZMLA 3S9AA 2BLQA 3TLOA 1C5LH 1L0ZA 1ETTH 1Z8JB 2GD4B 1XM1A 3ZVBA 2R2MB 1J14A 1F5LA 4GVUA 2Y7ZA 2JETB 1MAXA