3W94A

Structure of oryzias latipes enteropeptidase light chain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
235
structure length
235
Chain Sequence
VVGGVNAEKGAWPWMVSLHWRGRHGCGASLIGRDWLLTAAHCVYGKNTHLQYWSAVLGLHAQSSMNSQEVQIRQVDRIIINKNYNRRTKEADIAMMHLQQPVNFTEWVLPVCLASEDQHFPAGRRCFIAGWGRDAEGGSLPDILQEAEVPLVDQDECQRLLPEYTFTSSMLCAGYPEGGVDSCQGDSGGPLMCLEDARWTLIGVTSFGVGCGRPERPGAYARVSAFTSWIAETRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enteropeptidase-1
publication title Structure basis for the unique specificity of medaka enteropeptidase light chain.
pubmed doi rcsb
source organism Oryzias latipes
molecule tags Hydrolase
total genus 54
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3w94A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3w94A01
2FI3E 1AHTH 4TY6A 1O3BA 1YPKH 1FONA 2QXIA 4ABBA 5ABWA 3ATMA 3GCNA 3TGJE 4IN1A 1RTFB 3JZ2B 1Z6JH 1V2KT 3A84A 1CA0C 3SJ8A 1O39A 1GJ4H 1EJMA 1V3XA 1SGPE 3BEUA 2ZZUH 3PMJA 2A31A 2R0LA 1NROH 2ULLA 1XUFA 1DOJA 1G2LA 1IQEA 1NT1A 1IQJA 2FS9A 1LVYA 1T8LA 1ESBA 2SGDE 3FZDA 2ZFRH 4ABGA 1H8IH 1SQOA 3BTQE 1C4U2 2BQ7B 2Q6GA 1GMHG 1O31A 4Y7AA 1WQVH 2BD9A 1VGCC 1DVAH 1OXGA 1C2EA 2C90B 3V12A 3L6PA 3GY3A 2HPQH 2JKHA 2BOKA 3UUZA 1UTNA 2BD4A 1KXFA 5EODA 1RJXB 1HAXB 1F0UA 4MPVA 1O3JA 5DO4H 3RXBA 1K1PA 1FY3A 1GMDG 5HGGA 1MAYA 3PTBA 4B2BA 2ZCLP 3SORA 4BAMB 5JYIA 1TONA 4Y71A 1TWXB 1C4Y2 4UFGH 3RXTA 3K6YA 2RG3A 1GG6B 3ZVEA 2GCHG 2HWLB 4MNVA 1A2CH 4Q2KA 1TALA 2QAAA 1TNJA 1GHXH 1D9IA 3T2NA 3O8RA 1BB0B 2FLRH 1GBLA 2Z3CA 1MD8A 1Y3YA 1GCDA 1DXWA 4X2YA 5K0HA 2P95A 2ZQ1A 3TK9A 5GDSH 5AVDA 2A7HA 1ZPZA 1Y5BT 1QURH 5DKMA 3M5MA 2B9LA 1DUEA 1FI8A 1HJ8A 4J1YA 1EZUC 2WYJA 1C1RA 5FX5A 2JETC 2CF9H 1T8NA 3OSYA 1ANBA 4OS7A 2ZU5A 1WTHD 1C5TA 1MCVA 4Q7ZA 2FOEA 1J17T 2IJOB 3STIA 5K7RA 3MOCA 1S6FA 2SGFE 1K1NA 1O2VA 4SGAE 1QRWA 5HXFA 1ANCA 4K3JA 1DWCH 2CF8H 3M7QA 4ABJA 1HGTH 1ZMJA 1ETRH 2UUKB 3UR6A 1XM1A 2P8OB 3ATIA 2FEQH 1E38B 2I6QA 1T8MA 1QR3E 3M5LA 4I7YH 2BD7A 9LPRA 2VWLA 2V6NA 4NZLA 2VWOA 4U30A 3BTTE 3A83A 4BTTB 2WPMS 5FCRA 1WYKA 4OS4A 1NRNH 3UOUA 2Y82A 1ELDE 1XMNB 5F8ZA 2C8ZB 2BXUH 4KTSA 1KYNA 2FTMA 2OQ5A 2R3YA 4B75A 1D3DB 1Z8GA 2ZDKA 2ZFTA 4GAWA 4BAQB 4Y6DA 1FAKH 2QIQA 2O8LA 2TGDA 3HGPA 1KTTB 4MTBA 1VITH 1GI0A 3A7XA 1G3BA 1NFYA 3CP7A 1BHXF 4I31A 3GISB 1UCYH 2WV5A 5LH8A 1BUIA 1TMTH 2BY6X 2BZ6H 3LGYA 1ZPBA 1CT0E 1QRZA 2BMGB 5DJ7A 3ZZ3A 5JB9S 1EOJA 1HDTH 1KXBA 2CN0H 1GBHA 2Y80A 4XFQA 2XCNA 2H5CA 1V2OT 2J9NA 4JZFH 1EOLA 5BRRE 1BTUA 1S0QA 3BTHE 4UFEH 4NIXA 1SMFE 3TJUA 3B8JA 2FI4E 4OGXA 2FX4A 4GUXA 3VXFH 4CR9A 1TPSA 3SU5A 1QTFA 3DHKH 3R0FA 1FQ3A 1EATA 3RC5A 1QBOA 2ZGHA 3HGNA 1S83A 4ZHMU 2ZDAH 4I32A 1GBDA 2WV4A 1BMNH 3QZQA 3SGAE 2AGIX 2ALVA 3MNBA 1C2HA 1O2RA 3TH2H 1GDQA 3SJOA 2QGRA 5EXMA 1P2KA 3O8CA 3P17H 3KGPA 2W7UA 1P11E 2VGCC 5E0HA 3RU4D 1QB1A 1HPGA 1AB9C 1KXEA 2V35A 4DJZB 3MU0A 3ZZ4A 3RLWH 5CMXH 2W26A 2FXRA 3Q3YA 2GZ8A 1GHVH 2B8OH 3LT3A 2G52A 3BV9B 1C1QA 1G36A 1TMUH 2ZGBH 4PROA 3ENSB 3TH4H 3QGJA 4NIWA 4RKJB 3TITA 1FY8E 3OU0A 1OX1A 2VH0A 5DP3A 1HAIH 3T28A 1SOZA 3GDSA 2G81E 2A2XH 2GD4B 5E2OA 6LPRA 1WBGB 1YLDA 2ZEBA 3LKWA 1AO5A 4A92A 1O2HA 1ELTA 3P70B 4Y76A 5A0CA 3MHWU 1S85A 3K6ZA 3MH7A 1NZQH 5C3NA 1MQ6A 1YF4A 1HNEE 2WUBA 1LPKB 5GCHF 4X8SH 3SNCA 3TIUA 2PWXA 3VB7A 1KSNA 3FVFB 4JCNA 3LJJA 1QY6A 1ANDA 5JBCS 1MTNB 4YOIA 3BTWE 1IQLA 5A0BA 1M9UA 4Y8XA 1THPB 2R9PA 1C1WH 3DFJA 1QB6A 4JZ1A 1THSH 2ZCKP 1UTMA 1K22H 1SGDE 1EZQA 1QQUA 2Z6BD 3H5CB 2XNIA 3B9FH 2FMJA 5SGAE 1EB2A 1K21H 1FN6A 1HYLA 3RXRA 1GBFA 1T7CA 1THRH 3T62A 3NPSA 4AX9H 1O5AB 1TRMA 2FIRH 4WMFA 5E0GA 1GBBA 3A7YA 1OYQA 3KL6A 1ZMLA 1GHYH 2FOFA 2FS8A 4X1NU 4E7RG 1ELVA 3FZZA 1NU7B 3TH3H 1RD3B 1PPCE 1UVTH 4ABEA 4GLYA 1YCPK 2ZHWH 1P06A 5G4BA 1MH0A 1WU1A 2ZO3H 3BG4C 2AGEX 2BVXH 1ELGA 1TX7A 1O3HA 1LVBA 4I8LA 2GTBA 1VITF 5EQRA 2YNAA 2FOGA 1ZHMA 1D4PB 2BZAA 4NWKA 2D2DA 3ODFA 2BTCE 1GI6A 4XDEA 1HXFH 3F68H 4WH6A 4E06H 2Y7ZA 1MZDA 1AVGH 4ABHA 1TBRH 2ZPSA 4FU8A 2A1DB 3E16B 4O03A 3SOSA 1B7XB 3DT0H 3BN9A 1EPTA 2Z3DA 1SQAA 2VIOA 1DDJA 1Q2WA 3SV2H 2G51A 1V2QT 2F9PA 2F83A 3W95A 4CH2B 2UWLA 1P3EA 2VIPA 3U1IB 1MU8B 4XOJA 1ACBE 3ZVFA 1P2JA 3GY7A 1CHOF 1GJ5H 2BQWB 4ISNA 1ZSJA 1UMAH 1TIOA 2H9TH 2CGAA 1PQ7A 1CT4E 1XUGA 2BLOA 2LPRA 4XBDA 1ELBA 5IYTA 2PTNA 3OY5U 1W13U 3I78A 1S0RA 2AIQA 1FIWA 3LPRA 3TJNA 1F5RA 3U8OH 1MD7A 3LGTA 2QY0B 2PKAA 1GVLA 1W7GH 3NWUA 5T6GA 3MO6A 4NG9H 3RU4T 4FUEA 2FWWA 3E90B 4MNXA 1QBNA 3Q3KA 4Q80A 1TPAE 1L2EA 1MKWH 3P92A 4AFZA 1C5YB 2BY7X 1C1TA 1LVOA 1SGRE 2PGBB 2TIOA 2PUQH 1AD8H 4NFFA 2BVSH 1MKXH 1GDUA 5GCHG 4MQAA 2A4GA 4AG2A 1C5QA 2GX4A 2VU8E 3GYMA 2G55A 2GGVB 3SV7A 4GSOA 1ABIH 1TFXA 2Z9LA 1O2KA 1MU6B 1S82A 1JXPA 2AMDA 4FUBA 3SU2A 1TNHA 3SUFA 1GJ9B 4LOYH 3RXLA 2FODA 4WMDA 1WAYB 1GG6C 1NESE 4OS5A 1C9PA 2HPPH 5GWZA 1S84A 3ZV8A 5EQQA 4AN7A 4BXWA 1A46H 4JK5A 5LGOA 5A0AE 3M61U 2TRMA 3ODDA 1GJ7B 2FYQA 1K1IA 1BMAA 1P2NA 2ODYB 4ZH8A 1FY4A 2ZECA 3RM2H 1Y59T 4ABIA 5A8YA 3TGKE 5JBTA 1TAWA 3A85A 2ZGCA 3STJA 4CRBA 1SLUB 1D3TB 1C1PA 2QCYA 3BTFE 2QXGA 2OC7A 1ZR0A 3P8NA 1AY6H 3LU9B 3SU0A 1BA8B 2H6MA 1B5GH 3OX7U 3R3GB 1MCTA 4FVBA 3OTJE 4B74A 1SGQE 3S69A 3UPEA 1FV9A 1SB1H 1GI2A 2R3UA 2W3IA 4DCDA 1GBEA 2C8XB 3SU3A 5DPAA 4B71A 2BYAX 1LVMA 1GHBG 1CSOE 3MYWA 1YM0A 1C1VH 2P93A 2DE9A 3BTEE 1Q31A 3UQVA 5ESTE 1HFDA 1B0EA 4ISIH 1RIWC 3LC3A 3BSQA 4NCYA 2QC2A 4X6PA 2P3UB 1VR1H 4AOQA 1AFQC 3UQOA 1C2KA 1LKAA 1QJ6B 1BBRE 1O5EH 2ZHQH 1BTZA 5AFZH 1GWAA 1H8DH 4X6OA 3CENA 1UK4A 4CHAB 3ATKA 1SQTA 1EZXC 3SNAA 1NN6A 1DWEH 1L4DA 2BVRH 2AMQA 1E37B 1JRTA 1C2LA 2RCEA 1TX8A 1WCZA 5C1UA 3SHAH 3O8DA 2CXVA 4Y11E 3UNQA 1ORFA 4Y79A 1HLTH 5T3HA 2STAE 3Q77A 1UVSH 1HXEH 3FP7E 2QXJA 5F6MA 1UHBA 3A82A 1TQ7B 1IAUA 3D62A 4X1RU 3LGWA 1V2MT 1G2MA 3BTKE 4MPWA 1XXDA 1EP6A 2A2QH 2ZFPH 4X6NA 5EQSA 1OWDA 1MMJN 1ETTH 1ARBA 3ATWA 2BX4A 3PWBA 4UDWH 3AAUA 1UVOA 3M36A 1SGCA 4GCHF 5AFYH 1A0LA 1V2UT 2R2WU 4SGBE 1T32A 1BQYA 1O36A 4WXIA 3SUGA 4FUDA 1K1MA 1XVOA 1YBWA 4NA8A 1G30B 1Q3XA 2PLXA 4MLFB 3SU4A 2GMTB 1TPPA 2EC9H 1SFIA 4I8JA 1JIMA 2Z7FE 1G9IE 2AS9A 2ZI2H 1MBMA 2JH0D 3UTUH 1OWHA 1Y5UT 1W8BH 3AAVA 1CGJE 3LC5A 1C2GA 1OWIA 3S7HB 2ANMH 2BHGA 4U01A 4AB9A 4CRDA 4BNRA 2H5DA 1H4WA 1Y5AT 3SNEA 3AVZA 1BDAA 2FPZA 1K2I1 4A5TS 2PW8H 3EQ0H 3RXMA 1ELAA 5CHAB 2K1QA 2XBYA 2EEKA 1HIAA 1O5FH 2PKSB 4Y8YA 2YNBA 1O3IA 1O2LA 1C1OA 1EUFA 3RP2A 3QGNB 1YC0A 1S5SA 1DITH 2Y5GA 2FOAA 2AYWA 3L33A 3CS7A 1J14A 2PHBA 5EG4A 4LZ1H 8KME2 3U8TH 4AB8A 3A7TA 2VINA 4BAOB 1HJ9A 5FPTA 1FZZA 1DANH 3LGUA 2LNCA 3GY2A 5I46H 1GI1A 5C5NA 1BMLA 1OP2A 1AN1E 1BTHH 1SHHB 3H7TA 3GDVA 1GJAB 1C5UA 3LONA 4ZKSU 1FPCH 1UK3A 1LO6A 3SNBA 1LTOA 3LDXH 3EDXB 4D7FA 1V2NT 4B2CA 1YPHE 1K28D 1UJ1A 2GT7A 1LHGH 2A7CA 3A80A 2D8WA 2ZGJA 3HPTB 3PM3A 1GBAA 3E3TA 2UUYA 6GCHF 4CBNA 1D3PB 1P12E 2BY9X 4A7IB 1Y3UA 1QL7A 1O2SA 4HI3A 1YCPM 1BRBE 4Y0ZE 1BJVA 1UTPA 4O9VA 7GCHF 5A2MH 4DW2U 3MO3A 1CBWB 4YO9A 1PPHE 3TK5A 2BD2A 1V2RT 1ETSH 2FP7B 2O8UA 4FXGH 3GCHB 3D65E 4TWWA 3HK6B 1YPMH 2ODQA 2GP9B 3VGCB 3PB1E 2BX3A 3M5NA 3UIRA 1ZLRA 5ETXA 7LPRA 1O2IA 1EPTB 2Y7XA 2BDYA 3P8GA 3PTNA 3TU7H 4D9QA 4NGAH 2RDLA 1BBRK 2HGTH 2A5IA 3BTGE 2W5EA 3GY8A 1HBTH 1LPZB 1NS3A 3QK1A 4K1EA 1YP9A 4M7GA 1HAZB 3URCA 1PQ5A 2VB0A 2R2MB 5DP8A 1WUNH 2FZZA 1C5SA 1OP8A 4X8TH 3RU4E 1Z1JA 2XC0A 3SGBE 2G4UA 2ZU1A 4GCHG 3VB3A 2A4OA 3ZZ6A 1LDTT 3Q00A 1XKAC 2EI7A 3NZIA 5A09A 2ZFFH 3EGKH 3KHVA 4D7GA 1E36B 2GKVE 1AVXA 1ZGIA 3QLPH 4AGKA 4UEHH 1TGNA 1Z1IA 4JZDH 3KEEA 4NSYA 2EI8A 1TNGA 2CHAB 2ZKSA 7KMEH 1EKBB 3TJOA 3ITIA 1EASA 2PKAB 4NFEA 4FUFA 4XE4A 1PPGE 3NKKA 1VJ9U 2BDCA 2W7SA 3MNSA 3DD2H 2FOCA 3SN8A 3M3VA 4K8YA 4X6MA 1L1NA 3P95A 1RRKA 3PMHB 1GJ6A 4NA7A 3SUDA 2V3OH 4CRGA 2OLGA 4LK4A 1EZSC 1O2UA 5L6NH 3TNTA 1ZOMA 4Z6AH 2ASUB 2SFAA 1XUJA 1ZTKA 1ZMNA 1D6RA 1FDPA 5TCCA 1O2PA 1GI4A 1BT7A 2FLBH 1HAGE 1P9SA 4ZHAA 3GY6A 4QT8C 3RMNH 2ZP0H 2GVFA 1O2WA 1EP5A 1O32A 3FP6E 1G37A 5EXNA 1GCTB 3SUEA 3PWCA 5LPRA 3KIDU 8LPRA 1GJCB 1AWFH 1VJAU 1GJ8B 3EA9A 3VPKA 1Y3VA 4H42U 4WF8A 4JK6A 1GBJA 3SV9A 1SLXB 1HCGA 3SJKA 1MQ5A 1MTVA 1O5BB 2JH6D 2AERH 3T26A 2Z3EA 3PLBA 1ZHRA 2G5VA 4BOHA 4X1SU 2SGAA 4AG1A 1GGDB 1QCPA 3EA8A 5L2YH 2BDHA 2VWNA 2OBOA 3N7OA 3SHCH 4MPXA 1TRYA 2PSXA 1P03A 1WTGH 2QN5T 2ZIQH 3UWIA 1SI5H 4CRFA 4JYVH 2ANWA 2OQUA 1HRTH 2H9EH 1OPHB 3SV6A 3RM0H 3W94A 1P05A 7GCHG 1FXYA 4ZXYH 1NRSH 1SGTA 1T4VH 1AQ7A 1DSUA 3A8BA 4OS2A 2ZTYA 3MTYA 1W14U 5DK1A 4ISOA 1LQEA 2NU2E 4I8GA 4IBLH 1C9TA 1O3PB 3O8BA 5FBEA 4ZKOU 4JZEH 3DUXH 3A8DA 1WV7H 3SQEE 4A6LA 5EPNA 1OWJA 3E1XB 2HRVA 2BDIA 4F4OC 1TGCA 3E6PH 4NSVA 2OXSA 3AW1A 5C20A 2V3HH 3RXSA 2F91A 5C1YA 1LMWB 2ZHFH 2FDAA 5F03A 3TPIZ 2BOHB 4CH8B 1S6HA 5HM2A 2OUAA 4J2YB 2AH4X 4E05H 2OC1A 4MNWA 1Z8JB 1IHSH 1O3CA 2FOMB 4IMQA 1UHBB 3A89A 1OOKB 3A81A 1QL9A 3A86A 1O34A 1ZSLA 1SLVB 2AIPA 5JBAS 1BRAA 1E35B 1O2NA 2VH6A 3LJOA 1MUEB 2QXHA 2XBVA 1NY22 2OCVB 2FESH 3HKIB 4F49A 3M35A 4ZROA 1EJNA 2FTLE 4K1SA 4YESB 2A5KA 4YLQH 1O3OA 1ZSKA 3LGIA 3SI4H 3ATLA 1SLWB 5IDKA 2JETB 4YTAA 1SL3A 1C2DA 2XC5A 4MVNA 1GI7B 1GHAF 3A88A 4LXBH 1SG8B 3SV8A 4FUGA 3RXVA 1H9LB 1C5NH 2VIDA 4BAHB 1JWTA 1GHZA 3I29A 4R8TB 1K1OA 1O2MA 1P9UA 4K69A 1MTUA 5DG6A 5L30H 1AKSA 1YPHC 1WSSH 3SQHE 3V7TA 3QUMP 1DT2A 1P8VC 2BD3A 1W3CA 1T31A 1IHTH 4IMZA 4U2WA 2BQ6B 2SGPE 1TABE 4NZQA 1G32B 2ZQ2A 3RLYH 4JYTA 2HVXA 2IPHA 3MU5A 1K9OE 2EI6A 1HIAB 3PLKA 1OSSA 2P3TB 1ANEA 3BEIB 4MNYA 2C8WB 2ZF0H 2J2UA 2ZTZA 3S9BA 3RXFA 1FPHH 1X7AC 2G8TA 3BIVH 3EA7A 4IW4E 4K5ZA 3F6UH 4ABAA 3E91A 3F9HA 3E8LA 4H6SB 1GI9B 4WWYA 1F0RA 4CRCA 1XUHA 4FU9A 2G00A 4NIVA 4NWLA 2P59A 2ANYA 1MBQA 1NFUA 1ABJH 2BD8A 3KN2A 2ZG0H 3UNSA 1O30A 1QHRB 2PKSC 3P6ZB 2VIVA 5PTPA 1GMCF 5JB8S 1UTQA 2ZDNA 1KXAA 4AYYB 1EAWA 5AHGH 1AWHB 1IQNA 5EXLA 2A45B 3D49H 2FX6A 1ZTLA 4A1XA 1J9CH 1CGIE 1YGCH 2ZCHP 2NU1E 2WPKS 4ASHA 1DPOA 3QTVH 2CMYA 2BDAA 2HNTF 3RXOA 3M3TA 3U9AH 3LOXA 4WY3A 4E7NA 3D23A 2SGQE 3RXDA 2XBXA 4A1TA 4INKA 1CQQA 1A5HA 1NM6A 1NFXA 1Y8TA 2VGCB 2FYRA 3V3MA 2F3CE 1UTOA 3T29A 3UFAA 3UOPA 1EAXA 6CHAB 3G01A 1A4WH 2R0KA 1DFPA 1QB9A 2WPHS 2ZFQH 2OTVA 1AUTC 1P09A 4IC6A 5EW2H 2EA3A 2GCTB 2XXLA 1LHCH 3VXEH 5DP9A 3BEFB 2C3SA 2H1UA 1SFQB 1BJUA 2XCFA 3FP8E 5FXLA 4MG3A 2D26C 1QL8A 2Q6FA 3CS0A 3PROA 4X2WA 4OGYA 1CBWC 1C2JA 1NRPH 2A0QB 2FO9A 2XBWA 4YM9A 5CE1A 4BANB 1L0ZA 1F0SA 1ZPCA 8ESTE 3GCHC 1C5LH 1CHGA 3SJ9A 2KAIA 2Z9IA 2ZGXH 1VITG 4TWYA 1K1JA 2HNTC 5FAHA 2BM2A 5I25A 1IQMA 1GL0E 3P8OA 4HTCH 3P8FA 4ABFA 3ZYEA 3MO9A 4JYUH 1ID5H 1O2ZA 2P3FH 2P8OC 5EGMA 2VWMA 1BTPA 3HATH 4FUCA 3E0PB 1DM4B 2AGGX 3ZZ5A 4K60A 1GMDF 3EE0B 2D1JA 3MNXA 1DE7H 1PPBH 2PUXB 5L2ZH 1UK2A 2BDBA 2AFQB 3UWJH 2UWPA 2ZFSA 1SSXA 5LPEA 3QO6A 2G4TA 2J94A 2F9VA 2ZC9H 2GCHF 2SGEE 5GJ4B 3SW2B 3VEQB 1HAPH 3DFLA 1N8OB 2WYGA 4KELA 4D9RA 1TRNA 4B76A 1JOUB 1C5OH 3ZVAA 1AU8A 2ZNKH 1CHOG 1GI5A 1PYTC 1SGIB 2I6SA 4XBBA 1O3EA 3SU1A 1HJAB 4CREA 2P16A 1VCWA 2O9QA 1RTLA 2J38A 3ZVDA 1P3CA 1G3CA 3BTDE 3UR9A 1FAXA 3A8CA 3RC4A 1W7XH 4DGJA 4X8VH 1RFNA 2CV3A 1MKWK 5C67A 2SNWA 5FX6A 1LQDB 1YLCA 4Y0YE 1FNIA 4KKDA 1MKXK 3GCOA 1ZRKA 3PO1B 4FUHA 5FPYA 1TQ0B 3AASA 1EXFA 1JRSA 1GMCG 1SGFG 1UTLM 1A3EH 1AMHA 1H9IE 1NRRH 1KTSB 4YZUA 5LPFA 1ZZZA 1P02A 3RXQA 1OS8A 5TJXA 4WJG2 2GDDA 1INCA 3RXAA 4AORA 2IOTA 3M7TA 1PQAA 5JBBS 3QX5H 1XX9A 2BXTH 1O3LA 5J4QA 1GJDB 1RGQA 1C2MA 3MWIU 1A3BH 2TGPZ 5JPMH 1EAIA 3C27B 1P0SH 1V2PT 3OYPA 1GGDC 1XKBC 3KCGH 4VGCB 3GYLB 3URDA 3WY8A 4AFSA 2OD3B 4CRAA 2ZDVH 1ELCA 4K2YA 1OWEA 3TGIE 5HMAA 3SGQE 4X2XA 4Y10E 1DICA 2GZ7A 3KQBA 1QFKH 2P94A 3H7OA 3T25A 3VB6A 2Y6TA 1DXPA 1NC6A 3SJIA 1AUJA 3ZZDA 4LZ4B 1BTYA 1AE8H 1TNLA 1V2TT 1PJPA 2NWNA 3RXEA 4H6TA 1O2YA 3M37A 4WXVA 5JDUB 5FBIA 1AGJA 3FANA 1P04A 4BAKB 1SBWA 2B7DH 4X0WU 1XUKA 2XC4A 1C2FA 2F9NA 1W2KH 4U32A 1TA2A 5T6DA 3K65B 1MTNC 1E0FD 1LHEH 4JZIA 3ZZ8A 5TCAA 3ZZ7A 4NA9H 4CBOA 5B6OA 1TB6H 1CA8B 4INHA 2DUCA 4X1QU 4KTUA 3RXCA 1AZ8A 3RXUA 3SZNA 2ZTXA 5FCKA 1Z8RA 1KDQA 4O3TA 2NU3E 1ESTA 1C1MA 1V6DA 2ZWLH 3RMOH 1HAOH 1SGYE 3RXJA 8GCHF 1NU9A 1UTKA 1QGFA 1UTJA 3PLPA 1AVWA 3ZZCA 4R0IA 2ALPA 9ESTA 1QA0A 1EJAA 1BCUH 1F7ZA 1O3GA 1BZXE 3U8RH 1O35A 3KQCA 1SGNE 2O8WA 4Y7BA 4ZKRU 1HUTH 2FOBA 2BY8X 2BDGA 3NCLA 3C1KA 4AFQA 1GI3A 3Q3XA 1HAVA 1CGHA 1N1LA 2BD5A 4D8NA 1HB0B 1LPGB 2GV6A 4WVPE 4ZAEA 1AKSB 1PQ8A 1RTKA 1FIZA 3BF6H 2UWOA 1XXFA 3MH6A 1TBQH 1UCYE 1FY5A 1C2IA 1OKXA 1L1JA 4INLA 2XTTB 3NUMA 2BLWA 2ZDMA 3MH5A 1BRCE 1PFXC 1AFEH 3Q76A 1QRXA 2VVUA 4HZHA 2F9BH 5DGJA 4ZXXH 2A4QA 2A4RA 4ISHH 3EYDA 1SOTA 4O97A 1C5WB 1RIWB 2WPIS 5FHTA 3GOVB 2VJ1A 1J15A 1O2XA 1IOEA 1UO6A 1C5XB 2JH5D 2ZA5A 1A5GH 1AFQB 1TYNA 1V2JT 4XSKU 1TNIA 3MU8A 3GY5A 4YOGA 3F9GA 1V2WT 1TLDA 4X1PU 1L4ZA 4ZMAH 5HYOA 1TBZH 2H9HA 1NPMA 1SC8U 3U1JB 5EW1H 1A7SA 4UFFH 4ZKNU 5J4SA 3TK6A 5E8EH 5F8TA 1IQIA 4TPIZ 4BXSA 4WH8A 1U6QA 5DP7A 3ZVBA 1O3FA 1Z7KA 3RXHA 2M5TA 1P2IA 1H9HE 3KQEA 1MZAA 1GBTA 1N6XA 4GPGA 1VZQH 1F5KU 4DIHH 1YCPH 1EX3A 1ZJKA 1P2QA 2QF0A 1LCYA 1EQ9A 3RXPA 1O3AA 5DP6A 1CVWH 3UREA 1B0FA 1KLJH 2HNTE 1O38A 3TLOA 1S81A 4AGJA 2GDEH 4UONA 1V2ST 1AZZA 2YOLA 1TNKA 1C1SA 1LKBA 4Y8ZA 1FY1A 1A5IA 2Y5HA 3DA9B 1OWKA 4RN6A 3S0NA 1CA0B 3ZYDA 1ZRBA 3ZVCA 1DY8A 1FUJA 4BTUB 4I8KA 4RKOB 1DY9A 4IS5A 1GBIA 2O8MA 1ELFA 1A0JA 4DIIH 1P01A 4DOQA 2B5TB 1HV7A 6GCHG 4AFUA 8GCHG 6CHAC 1Z8IB 2KAIB 2Z9JA 1IQFA 2ANKH 4AYVB 2VVVA 2GCTC 1TGSZ 4GVUA 3QWCH 1KXCA 2OINA 1W11U 3V13A 2OC0A 1GVKB 1VGCB 2PGQB 2ZHDA 1O2TA 1P10A 3RMLH 5FPSA 1KIGH 3PYHA 1MTWA 3BTME 1GHWH 3U69H 1CU1A 3BIUH 1FLEE 3M7UA 3EAJA 2PV9B 3FFGA 2SNVA 2TPIZ 1WQSA 2STBE 3SI3H 1ZTJA 4YT7H 3QTOH 2A32A 2OP9A 1W10U 4O3UA 2PTCE 3MNCA 2RA3A 3U98H 1TGBA 1TPOA 2PSYA 5C5OA 1MAXA 3OY6U 3RUOA 3GY4A 4AZ2B 3PMAB 4YT6H 1C5RA 3T27A 1NRQH 3KF2A 4Q7YA 1TA6A 1XVMA 2RA0A 1A1RA 1DWBH 1J8AA 2FI5E 2F9OA 1GVZA 1QJ7B 4KGAA 2PFEA 1YPGH 4A1VA 1UCYK 1GJBB 1IQHA 1GI8B 3ELAH 1O5DH 2ZPQA 1N8OC 4ESTE 4CHAC 2HLCA 1Y3WA 3NK8A 1FN8A 4YOJA 1W12U 1YPJH 2HOBA 1PPZA 3SBKA 1BRUP 5A8XA 1HJAC 5BPEA 1MTSA 3A87A 1C5PA 5DP4A 3AW0A 1BIOA 2BB4A 4H4FA 3PMBB 1AE5A 1NO9H 2WPLS 5DP5A 2BY5X 1YPLH 4XBCA 3VB4A 5A8ZA 1GBKA 4X8UH 4OS6A 1W0ZU 2Z9KA 2TGAA 3QN7A 4FVDA 1O37A 2A7JA 1O2OA 2IN2A 1O0DH 3PO1C 3GICB 1VCQA 1XUIA 1GHBF 1PYTD 1BITA 1CE5A 4TY7A 3RXIA 1SGFA 1DLKB 1TGTA 3MH4A 5C1XA 4JMYA 3MU4A 4DG4A 1T4UH 2Y81A 3ESTA 1L1GA 4Q7XA 2V0BA 2G5NA 2QYIA 1C4V2 1QQ4A 2GMTC 4IC5A 4K8BA 3JZ1B 1BTXA 1Y3XA 1AIXH 2BLVA 2QV1A 4FUIA 4KTCA 1SPJA 3UY9A 3MMGA 1G3EA 1H1BA 2ZU2A 3S9CA 1SHYA 1TX6A 3FAOA 1O3MA 2Q6DA 1YPEH 2WINI 1ZYOA 1GBMA 2ZPRA 3UNRA 3A8AA 3KNXA 3PV4A 2XWBI 1HAHH 4GHTA 2XW9A 3IITA 2FOHA 4YLUA 4DY7B 2NU0E 4VGCC 7ESTE 1QNJA 2TGTA 3F1SB 4UD9H 5C2ZA 2VIQA 5EPYA 3B23B 5CHAC 4FUJA 1SR5C 1GPZA 3GCTF 4D76A 1EAUA 1F92A 3IWMA 1O2QA 1D3QB 2OBQA 1OYTH 2NU4E 3ZZAA 3BG8A 3S9AA 1DS2E 1BOQA 5E2PA 2ZHEH 2F9UA 1KDQB 5AF9H 1C1UH 3GDUA 1KY9A 1JIRA 1UVPA 2ZU4A 2DE8A 3KQDA 1GBCA 1ELEE 1SVPA 1DX5M 1DUAA 3A7ZA 1C5ZB 1JMOH 1G3DA 1GL1A 4ZUHA 2THFB 4NIYA 1DSTA 3RC6A 1J16A 4ABDA 5GPIB 1WOFA 3M3SA 1P2MA 4BTIB 2Y5FA 4X2VA 3HK3B 3TNSA 3ZV9A 4UFDH 4KP0A 1QIXB 1HAVB 1AB9B 3RMMH 3L3TA 2BLQA 2GT8A 2VIWA 4HFPB 4IN2A 3SU6A 1BHXB 2QF3A 4WMEA 3SNDA 3F9EA 3V0XA 1V2VT 4HGCA 2WUCA 2O8TA 1QBVH 1K1LA 3ZVGA 1V2LT 1YYY1 5T6FA 1YKTA 4K1TA 3LH1A 1GMHF 1KLTA 2GZ9A 2Z9GA 4GHQA 2J92A 2J34A 4B73A 3ZZ9A 2XRCA 3LH3A 2UUFB 1JBUH 1HAYB 3K9XB 4DT7B 1NTPA 1O5CB 4TPYA 1O5GH 2ZDLA 1VCPA 2AMPA 3VGCC 1SGEE 3LGVA 6ESTA 4ISLA 4THNH 1GDNA 1O33A 1EPTC 1P2OA 1ZJDA 5E0JA 2XWAA 5EU8A 2ILNA 1GHAG 4DVAU 3A7VA 3MFJA 2CJIA 1O2GH 3TVJB 3RXKA 1BTWA 2Z94A 3K2UA 1KLIH 1LHFH 2AEIH 1D6WA 1UVUH 2ESTE 1ESAA 3E0NB 4MDSA 1C5MD 4Z0KA 3A7WA 2WPJS 1F0TA 2Q1JA 1F2SE 1IQKA 1BMMH 3SO3A 2FM2A 1CT2E 1TMBH 3I77A 2XYAA 1PPEE 2UUJB 5F8XA 1Z71A 2C93B 2CHAC 2W3KA 3F9FA 3QDZB 1TOMH 5H4IB 1LHDH 2QA9E 2GV7A 5HM9A 1ARCA 1C1NA 1ZHPA 3M5OA 5GXPA 1O3KA 1A0HB 2C8YB 4B1TA 1CO7E 2ODPA 3HKJB 1O2JA 3VB5A 1N6YA 4I33A 3RDZA 3LIWA 3S7KB 1FMGA 4ZHLU 1RXPA 3TJVA 1AI8H 2H2ZA 1QA7A 3QZRA 1QJ1B 4OS1A 1W0YH 1T8OA 2J95A 2OC8A 1DLEA 2B0FA 3RXGA 3BG4B 2VVCA 4UE7H 1PPFE 1F5LA 1O3NA 1Z6EA 1P57B 4DURA 1KXDA 4RSPA 2ZU3A 1IQGA 4MPUA 3GCTG 1ZGVA 3VFEA 1C5VA 4IGDA 2A5AA 3NXPA 4CR5A 5GIBA 5ESBA 2HALA 1FJSA 1NFWA 3MI4A 3ZZBA 4FU7A 1GCTC 2TBSA 3IG6B 4I8HA 2PR3A 1TE0A 1E34B 1RS0A 3T5FH 1EB1H 4TYDA 2VNTA 1O3DA 2J4IA 1A61H 1DWDH 3MU1A 1BBRH 1TOCB 4B2AA 1OP0A 5EOKA 2C4FH
chains in the Genus database with same CATH superfamily
2FI3E 1AHTH 4TY6A 1O3BA 1YPKH 1FONA 2QXIA 4ABBA 5ABWA 3ATMA 3GCNA 1H8HD 3TGJE 4IN1A 1RTFB 3JZ2B 1Z6JH 1V2KT 3A84A 1CA0C 3NRLA 3SJ8A 1O39A 1GJ4H 1EJMA 1V3XA 1SGPE 3BEUA 2ZZUH 3PMJA 4XD7D 2A31A 2R0LA 5C0TA 1NROH 2ULLA 1XUFA 1DOJA 1G2LA 1IQEA 1NT1A 1IQJA 2FS9A 1LVYA 1T8LA 1ESBA 2SGDE 3FZDA 2ZFRH 2J97A 4ABGA 2KCYA 1H8IH 1SQOA 3BTQE 1C4U2 2BQ7B 2Q6GA 4XRNA 1GMHG 1O31A 4Y7AA 1WQVH 2BD9A 1VGCC 1DVAH 1OXGA 1C2EA 2C90B 3V12A 3L6PA 3GY3A 2HPQH 2JKHA 1QZ8A 2BOKA 3UUZA 1UTNA 2BD4A 1KXFA 5EODA 1RJXB 1HAXB 2YMSD 1F0UA 4MPVA 1O3JA 5DO4H 3RXBA 1K1PA 1FY3A 1GMDG 5HGGA 1MAYA 3PTBA 4B2BA 2ZCLP 3SORA 4BAMB 5JYIA 1TONA 4Y71A 1TWXB 1C4Y2 4UFGH 3RXTA 1E1QD 2VBCA 3K6YA 2RG3A 1GG6B 3ZVEA 2GCHG 2HWLB 4MNVA 1A2CH 4Q2KA 1TALA 2QAAA 1TNJA 1GHXH 1D9IA 3T2NA 3O8RA 1BB0B 2FLRH 1GBLA 2Z3CA 1MD8A 1Y3YA 1GCDA 1DXWA 4X2YA 5K0HA 2P95A 2ZQ1A 3TK9A 5GDSH 5AVDA 2A7HA 1ZPZA 1Y5BT 1QURH 5DKMA 3M5MA 2B9LA 1COWD 1DUEA 1FI8A 1HJ8A 4J1YA 1NBMD 1EZUC 2WYJA 1C1RA 5FX5A 3KYFA 2JETC 2CF9H 1T8NA 3OSYA 1ANBA 4OS7A 2ZU5A 1WTHD 1C5TA 1MCVA 4Q7ZA 2FOEA 1J17T 2IJOB 3STIA 5K7RA 3MOCA 1S6FA 2SGFE 1K1NA 1O2VA 4SGAE 1QRWA 5HXFA 1ANCA 4K3JA 1DWCH 2CF8H 3M7QA 4ABJA 1HGTH 1ZMJA 1ETRH 2UUKB 3UR6A 1XM1A 2P8OB 2LELA 3ATIA 2FEQH 1E38B 2I6QA 1T8MA 1QR3E 3M5LA 4I7YH 2BD7A 4FOUC 9LPRA 2VWLA 2V6NA 4NZLA 2VWOA 4U30A 3BTTE 3A83A 4BTTB 2WPMS 5FCRA 1WYKA 4OS4A 1NRNH 3UOUA 2Y82A 1ELDE 1XMNB 5F8ZA 2C8ZB 2BXUH 4KTSA 1KYNA 2FTMA 2OQ5A 2R3YA 4B75A 1D3DB 1Z8GA 2ZDKA 2ZFTA 4GAWA 4BAQB 4Y6DA 1FAKH 2QIQA 2O8LA 2TGDA 4RT1A 3HGPA 1KTTB 4MTBA 1VITH 1KMHB 3UB0A 1GI0A 3A7XA 1G3BA 1NFYA 3CP7A 1BHXF 4I31A 3GISB 1UCYH 2WV5A 5LH8A 1BUIA 1TMTH 2BY6X 2BZ6H 3LGYA 4RT0A 1ZPBA 4TSFD 1CT0E 1QRZA 2BMGB 5DJ7A 3ZZ3A 5JB9S 1EOJA 1HDTH 1KXBA 2CN0H 1GBHA 1W0KD 2Y80A 4XFQA 2XCNA 2H5CA 1V2OT 2J9NA 4JZFH 1EOLA 5BRRE 1BTUA 2HLDD 1S0QA 3BTHE 5C0UA 4UFEH 4NIXA 1SMFE 3TJUA 3B8JA 2FI4E 4OGXA 2FX4A 4GUXA 3VXFH 5EJLA 4CR9A 1TPSA 3SU5A 1QTFA 3DHKH 3R0FA 1FQ3A 1EATA 3RC5A 1QBOA 2ZGHA 3HGNA 1S83A 4ZHMU 2ZDAH 4I32A 1GBDA 2WV4A 1BMNH 4P00A 3QZQA 3SGAE 2AGIX 2ALVA 3MNBA 5KGOA 1C2HA 1O2RA 3TH2H 1GDQA 3SJOA 2QGRA 5EXMA 1P2KA 3O8CA 3P17H 3KGPA 3WW7A 2W7UA 1P11E 2VGCC 5E0HA 3RU4D 1QB1A 1HPGA 1AB9C 1KXEA 2V35A 4DJZB 3MU0A 3ZZ4A 3RLWH 2F43B 2K0QA 5CMXH 2W26A 2FXRA 3Q3YA 2GZ8A 1GHVH 2B8OH 3LT3A 2G52A 3BV9B 1C1QA 1G36A 1TMUH 2ZGBH 4PROA 3ENSB 3TH4H 3QGJA 4NIWA 4RKJB 3TITA 1FY8E 3OU0A 1OX1A 3F2GA 2VH0A 5DP3A 1HAIH 3T28A 1VKYA 1SOZA 3GDSA 2G81E 2A2XH 2GD4B 5E2OA 6LPRA 1WBGB 1YLDA 2ZEBA 3LKWA 1AO5A 4A92A 1O2HA 1ELTA 3P70B 4Y76A 5A0CA 3MHWU 1S85A 3K6ZA 3MH7A 1NZQH 2JIZD 5C3NA 1MQ6A 1YF4A 1HNEE 2WUBA 1LPKB 5GCHF 4X8SH 3SNCA 3TIUA 2PWXA 3VB7A 1KSNA 3FVFB 4JCNA 3LJJA 1QY6A 1ANDA 5JBCS 1MTNB 4YOIA 3BTWE 1IQLA 5A0BA 1M9UA 4Y8XA 1THPB 2R9PA 1C1WH 3DFJA 1QB6A 5HKKD 4JZ1A 1THSH 2ZCKP 1UTMA 1K22H 4F55A 1SGDE 1EZQA 1QQUA 2Z6BD 3H5CB 2XNIA 3B9FH 2FMJA 5SGAE 1EB2A 1K21H 1FN6A 1HYLA 3RXRA 1GBFA 1T7CA 1THRH 3T62A 3NPSA 4AX9H 1O5AB 1TRMA 2FIRH 2WPDD 4WMFA 5E0GA 1GBBA 3A7YA 2KM0A 1OYQA 3KL6A 1ZMLA 2PP6A 1GHYH 2FOFA 4ACBA 2FS8A 4X1NU 4E7RG 1ELVA 3FZZA 1NU7B 3TH3H 1RD3B 1PPCE 1UVTH 4ABEA 4GLYA 4M9FA 1YCPK 1OHHD 2ZHWH 1P06A 5G4BA 1MH0A 1WU1A 2ZO3H 3BG4C 2AGEX 2BVXH 1ELGA 1TX7A 1O3HA 1LVBA 4I8LA 2JJ1D 2GTBA 1VITF 5EQRA 2YNAA 2FOGA 1ZHMA 1D4PB 2BZAA 4NWKA 1YWUA 2D2DA 2BTCE 1GI6A 3ODFA 4XDEA 1HXFH 3OTPA 3F68H 4WH6A 4E06H 2Y7ZA 1MZDA 3WWFA 1AVGH 4ABHA 4P02A 1TBRH 2ZPSA 4FU8A 2A1DB 3E16B 4O03A 3SOSA 1B7XB 3DT0H 3BN9A 1EPTA 3TGIE 2Z3DA 1EFRD 1SQAA 2VIOA 1DDJA 1Q2WA 3SV2H 2G51A 1V2QT 2F9PA 2F83A 3W95A 4CH2B 2UWLA 1P3EA 2VIPA 3U1IB 1MU8B 4XOJA 1ACBE 3ZVFA 1P2JA 3GY7A 1CHOF 1GJ5H 2BQWB 4ISNA 1ZSJA 1UMAH 1TIOA 2H9TH 2CGAA 1PQ7A 1CT4E 1XUGA 2BLOA 2LPRA 4XBDA 1ELBA 5IYTA 2PTNA 3OY5U 1W13U 3I78A 1S0RA 2AIQA 1FIWA 3LPRA 3TJNA 1F5RA 3U8OH 1MD7A 3LGTA 2QY0B 2PKAA 1GVLA 1W7GH 3NWUA 5T6GA 3MO6A 4NG9H 3RU4T 4FUEA 2FWWA 3E90B 4MNXA 1QBNA 3Q3KA 4Q80A 1TPAE 3PV5A 1L2EA 1MKWH 3P92A 4AFZA 1C5YB 2BY7X 1C1TA 4AC9A 1LVOA 1SGRE 2PGBB 2TIOA 2PUQH 1AD8H 4NFFA 2BVSH 1MKXH 1GDUA 5GCHG 4MQAA 2A4GA 2J5UA 4AG2A 1C5QA 2GX4A 2VU8E 3GYMA 2G55A 2GGVB 3SV7A 4GSOA 1ABIH 1TFXA 2Z9LA 1O2KA 1MU6B 2QE7D 1S82A 1JXPA 2AMDA 4FUBA 3SU2A 1TNHA 3SUFA 1GJ9B 4LOYH 3RXLA 2FODA 4WMDA 1WAYB 1GG6C 1NESE 4OS5A 1C9PA 2HPPH 5GWZA 1S84A 3ZV8A 5EQQA 4AN7A 4BXWA 1A46H 4JK5A 5LGOA 5A0AE 3M61U 2TRMA 3ODDA 1GJ7B 2FYQA 1K1IA 1BMAA 1P2NA 2ODYB 4ZH8A 1FY4A 2YMSB 2ZECA 3RM2H 1Y59T 4ABIA 5A8YA 3TGKE 3OEED 5JBTA 1TAWA 3A85A 2ZGCA 3STJA 4CRBA 1SLUB 1D3TB 1C1PA 2QCYA 3BTFE 2QXGA 2OC7A 1ZR0A 3P8NA 1AY6H 3LU9B 3SU0A 1BA8B 2H6MA 1B5GH 3OX7U 3R3GB 1MCTA 1E1RD 4FVBA 3OTJE 4B74A 1SGQE 3S69A 3UPEA 1FV9A 1SB1H 1GI2A 2R3UA 3F2HA 5T1VA 2W3IA 4DCDA 1GBEA 5GNDA 2C8XB 3SU3A 5DPAA 4B71A 2BYAX 1LVMA 1GHBG 1CSOE 3MYWA 1YM0A 1C1VH 2P93A 2DE9A 3BTEE 1Q31A 3UQVA 5ESTE 1HFDA 1B0EA 3SYJA 4ISIH 1RIWC 3LC3A 3BSQA 4NCYA 2QC2A 4X6PA 2P3UB 1VR1H 4AOQA 3FO8D 1AFQC 3UQOA 1C2KA 1LKAA 1QJ6B 1BBRE 1O5EH 2ZHQH 1BTZA 5AFZH 1GWAA 1H8DH 4X6OA 3CENA 1UK4A 4CHAB 3ATKA 1SQTA 1EZXC 3SNAA 5DN6D 1NN6A 1DWEH 1L4DA 2BVRH 2AMQA 1E37B 1JRTA 1C2LA 2RCEA 1TX8A 1WCZA 5C1UA 3SHAH 3O8DA 2CXVA 4Y11E 3UNQA 1ORFA 4Y79A 1HLTH 5T3HA 2STAE 3Q77A 1UVSH 1HXEH 3FP7E 1FX0B 2QXJA 5F6MA 1UHBA 3A82A 1SQRA 1TQ7B 1IAUA 3D62A 4X1RU 3LGWA 1V2MT 1G2MA 3BTKE 4MPWA 1XXDA 1EP6A 2A2QH 2ZFPH 4X6NA 5EQSA 1OWDA 1MMJN 1ETTH 1ARBA 3ATWA 2BX4A 3PWBA 4UDWH 3AAUA 1UVOA 3M36A 1SGCA 4GCHF 5AFYH 1A0LA 1V2UT 2R2WU 4SGBE 3PV2A 2QF5A 1T32A 1BQYA 1O36A 1MABB 4WXIA 3SUGA 4FUDA 1K1MA 1XVOA 1YBWA 4ZCNA 4NA8A 1G30B 1Q3XA 2PLXA 3F0PA 4MLFB 3SU4A 2GMTB 3N7DA 1TPPA 2EC9H 1SFIA 4I8JA 1JIMA 2Z7FE 1G9IE 2AS9A 2ZI2H 1MBMA 2JH0D 3UTUH 1OWHA 1Y5UT 1W8BH 3AAVA 1CGJE 3LC5A 1C2GA 1OWIA 3S7HB 2CK3D 2ANMH 2BHGA 4U01A 4AB9A 4CRDA 1NBME 4HG6A 4BNRA 2H5DA 1H4WA 1Y5AT 3SNEA 3AVZA 1BDAA 2FPZA 1K2I1 4A5TS 2PW8H 3EQ0H 3FN8A 1ELAA 3RXMA 5CHAB 2K1QA 2XBYA 2L74A 2EEKA 1HIAA 1O5FH 2PKSB 4Y8YA 2YNBA 1O3IA 1O2LA 1C1OA 1EUFA 4OM9A 3RP2A 3QGNB 1YC0A 1S5SA 1DITH 2Y5GA 2FOAA 3PRDA 2AYWA 3L33A 3CS7A 1J14A 2PHBA 5EG4A 4LZ1H 8KME2 3U8TH 4AB8A 3A7TA 2VINA 4BAOB 1HJ9A 5FPTA 1FZZA 1DANH 3LGUA 2LNCA 3GY2A 5I46H 1GI1A 5C5NA 1BMLA 1OP2A 1AN1E 1BTHH 1SHHB 3H7TA 3GDVA 1GJAB 4DT4A 1C5UA 3LONA 4ZKSU 1FPCH 3FKSD 1UK3A 1LO6A 3SNBA 1LTOA 3LDXH 3EDXB 4D7FA 1V2NT 4B2CA 1YPHE 1K28D 1UJ1A 2GT7A 1LHGH 4YXWD 2A7CA 2RDEA 2D8WA 3A80A 2ZGJA 3HPTB 3PM3A 1K0HA 1GBAA 3E3TA 2UUYA 6GCHF 4CBNA 1D3PB 1P12E 2BY9X 4A7IB 1Y3UA 1QL7A 1O2SA 4HI3A 1YCPM 1BRBE 4Y0ZE 1BJVA 1UTPA 4O9VA 7GCHF 5A2MH 3EE7A 3GS9A 4DW2U 3MO3A 1CBWB 4YO9A 1PPHE 3TK5A 2BD2A 1V2RT 1ETSH 2FP7B 2O8UA 4FXGH 3GCHB 3D65E 4TWWA 3HK6B 1YPMH 2ODQA 2GP9B 3VGCB 3PB1E 2BX3A 3M5NA 3UIRA 1ZLRA 5ETXA 7LPRA 1O2IA 1EPTB 2Y7XA 2BDYA 3P8GA 3PTNA 3TU7H 4D9QA 4NGAH 2RDLA 1BBRK 2HGTH 2A5IA 2XNDD 3BTGE 2W5EA 3GY8A 1HBTH 1LPZB 1NS3A 3QK1A 4K1EA 1YP9A 4M7GA 1HAZB 3URCA 1PQ5A 2VB0A 2R2MB 5DP8A 1WUNH 2FZZA 3ZIAD 1C5SA 1OP8A 4X8TH 3RU4E 1Z1JA 2XC0A 3SGBE 2G4UA 1UW7A 3DSOA 2ZU1A 5F53A 4GCHG 3VB3A 2A4OA 3ZZ6A 5C94A 1LDTT 3Q00A 1XKAC 2EI7A 3NZIA 5A09A 2ZFFH 3EGKH 3KHVA 4D7GA 1E36B 2GKVE 1AVXA 1ZGIA 3QLPH 4AGKA 4UEHH 1TGNA 1Z1IA 4JZDH 3KEEA 4NSYA 2EI8A 1TNGA 2CHAB 2ZKSA 7KMEH 1EKBB 3TJOA 3ITIA 2K8IA 1EASA 2PKAB 4NFEA 4FUFA 4XE4A 1PPGE 3NKKA 1VJ9U 2BDCA 2W7SA 3MNSA 3DD2H 2FOCA 3OE7D 3SN8A 3M3VA 4K8YA 4X6MA 1L1NA 1W0JD 3P95A 1RRKA 3PMHB 1GJ6A 4NA7A 3SUDA 2V3OH 3MQKC 4CRGA 2OLGA 4LK4A 1EZSC 1O2UA 5L6NH 3TNTA 1ZOMA 4Z6AH 2ASUB 2SFAA 1XUJA 1ZTKA 1ZMNA 5B6LA 1D6RA 1FDPA 5TCCA 1O2PA 1GI4A 1BT7A 2FLBH 1HAGE 1P9SA 4ZHAA 3GY6A 4QT8C 3RMNH 2ZP0H 2GVFA 1O2WA 1EP5A 1O32A 3FP6E 1G37A 5EXNA 1GCTB 3SUEA 3PWCA 5LPRA 3KIDU 8LPRA 1GJCB 1AWFH 1VJAU 1GJ8B 3EA9A 3VPKA 1Y3VA 4H42U 4WF8A 4JK6A 1GBJA 3SV9A 1SLXB 1HCGA 3SJKA 1MQ5A 1MTVA 1O5BB 2JH6D 2AERH 3T26A 2Z3EA 3PLBA 1ZHRA 2G5VA 4BOHA 4X1SU 2SGAA 4AG1A 1GGDB 1QCPA 3EA8A 5L2YH 2BDHA 2VWNA 2OBOA 3N7OA 3SHCH 4MPXA 1TRYA 2WZQA 2PSXA 1P03A 1WTGH 2QN5T 2ZIQH 3UWIA 5EJ1A 1SI5H 4CRFA 4JYVH 2ANWA 2OQUA 1HRTH 2H9EH 1OPHB 2YMSC 3SV6A 3RM0H 3W94A 1P05A 1YY3A 7GCHG 1FXYA 4ZXYH 1NRSH 1SGTA 1T4VH 1AQ7A 1DSUA 3A8BA 4OS2A 2ZTYA 3MTYA 3KQ5A 1W14U 5DK1A 4ISOA 1LQEA 2NU2E 4I8GA 4IBLH 1C9TA 1O3PB 3O8BA 5FBEA 4ZKOU 4JZEH 4Z1MD 3DUXH 3A8DA 1WV7H 3SQEE 4A6LA 5EPNA 1OWJA 3E1XB 2HRVA 2BDIA 4F4OC 1TGCA 3E6PH 4NSVA 2OXSA 3AW1A 5C20A 2V3HH 3RXSA 2F91A 5C1YA 1LMWB 2ZHFH 2FDAA 5F03A 3TPIZ 2BOHB 4CH8B 1S6HA 5HM2A 3DSGA 2OUAA 4J2YB 2AH4X 4E05H 1E79D 2OC1A 1Z8JB 4MNWA 1IHSH 1O3CA 2FOMB 4IMQA 1UHBB 3A89A 1OOKB 3A81A 1QL9A 2QF4A 3A86A 1O34A 1ZSLA 1SLVB 2AIPA 5JBAS 1BRAA 1E35B 1O2NA 2VH6A 3LJOA 1MUEB 2QXHA 2XBVA 1NY22 2OCVB 2FESH 3H09A 2V3MA 3DSPA 3HKIB 4F49A 3M35A 4ZROA 1EJNA 2FTLE 4K1SA 4YESB 2A5KA 4YLQH 1O3OA 1ZSKA 3LGIA 3SI4H 2JDID 3ATLA 1SLWB 5IDKA 2JETB 4YTAA 1SL3A 1C2DA 2XC5A 4MVNA 1GI7B 1GHAF 3A88A 4LXBH 1SG8B 3SV8A 2JJ2D 4FUGA 3RXVA 1H9LB 1C5NH 2VIDA 4BAHB 1JWTA 1GHZA 5HIYA 5KECA 2EQNA 3I29A 4R8TB 1K1OA 1O2MA 1P9UA 4K69A 1MTUA 5DG6A 5L30H 1AKSA 1YPHC 1WSSH 1H8ED 1BMFD 3SQHE 3V7TA 3QUMP 1DT2A 1P8VC 2BD3A 1W3CA 1T31A 1IHTH 4IMZA 4U2WA 2BQ6B 2SGPE 1TABE 4NZQA 1G32B 2ZQ2A 5EJZA 3RLYH 4JYTA 2HVXA 2IPHA 3MU5A 1K9OE 2EI6A 1HIAB 3PLKA 1OSSA 2P3TB 1ANEA 3BEIB 4MNYA 2C8WB 2ZF0H 2J2UA 2ZTZA 3S9BA 3RXFA 1FPHH 1X7AC 2G8TA 3BIVH 3EA7A 4IW4E 4K5ZA 3F6UH 2LP6A 4ABAA 3E91A 3F9HA 3E8LA 4H6SB 1GI9B 4WWYA 1F0RA 4CRCA 1XUHA 4FU9A 2G00A 4NIVA 4NWLA 2P59A 2ANYA 1MBQA 1NFUA 1ABJH 2BD8A 3KN2A 2ZG0H 4B6EA 5CHBA 3UNSA 1O30A 1QHRB 2PKSC 3P6ZB 2VIVA 5PTPA 1GMCF 5JB8S 1UTQA 2ZDNA 1KXAA 2IJD1 4AYYB 1EAWA 5AHGH 1AWHB 1IQNA 5EXLA 2A45B 3D49H 2FX6A 1ZTLA 4A1XA 1J9CH 1CGIE 1YGCH 2ZCHP 2NU1E 2WPKS 4ASHA 1DPOA 3QTVH 2CMYA 2BDAA 2HNTF 3RXOA 3M3TA 3U9AH 3LOXA 4WY3A 4E7NA 3D23A 2SGQE 3RXDA 2XBXA 4A1TA 4INKA 1CQQA 1A5HA 1NM6A 2KCPA 1NFXA 1Y8TA 2VGCB 4I86A 2FYRA 3V3MA 2F3CE 1UTOA 3T29A 3UFAA 3UOPA 1EAXA 6CHAB 3G01A 1A4WH 2R0KA 1DFPA 1QB9A 2WPHS 2ZFQH 2OTVA 1AUTC 1P09A 4IC6A 5EW2H 2EA3A 2GCTB 4TT3D 2XXLA 1LHCH 3VXEH 2W6JD 5DP9A 3BEFB 2C3SA 2H1UA 1SFQB 1BJUA 2XCFA 3FP8E 5FXLA 4MG3A 2D26C 1QL8A 2Q6FA 3CS0A 3PROA 4X2WA 4OGYA 1CBWC 1C2JA 1NRPH 2A0QB 2FO9A 2XBWA 1WDIA 4YM9A 5CE1A 4BANB 1L0ZA 1F0SA 1ZPCA 8ESTE 3GCHC 1C5LH 1CHGA 3SJ9A 2KAIA 2Z9IA 2ZGXH 1VITG 4TWYA 1K1JA 2HNTC 5FAHA 2BM2A 5I25A 1IQMA 1GL0E 3P8OA 4HTCH 3P8FA 4ABFA 4ASUD 3ZYEA 3MO9A 4JYUH 1ID5H 1O2ZA 2P3FH 2P8OC 4FETA 2VWMA 5EGMA 1BTPA 3HATH 4FUCA 3E0PB 1DM4B 2AGGX 3F0OA 3ZZ5A 4K60A 1GMDF 3EE0B 2D1JA 3MNXA 1DE7H 1PPBH 2PUXB 5L2ZH 1UK2A 2BDBA 2AFQB 3UWJH 2UWPA 2ZFSA 1SSXA 5LPEA 3QO6A 2G4TA 2J94A 2F9VA 2ZC9H 2GCHF 2SGEE 5GJ4B 3SW2B 3VEQB 1HAPH 3DFLA 1N8OB 2WYGA 4KELA 4D9RA 1TRNA 4B76A 1JOUB 1C5OH 3ZVAA 1AU8A 2V7QD 2ZNKH 1CHOG 1GI5A 1PYTC 1SGIB 2I6SA 4XBBA 1O3EA 3SU1A 1HJAB 4CREA 2P16A 1VCWA 2O9QA 1RTLA 2J38A 3ZVDA 1P3CA 1G3CA 2WHXA 3BTDE 3UR9A 1FAXA 3A8CA 3RC4A 1W7XH 4DGJA 4X8VH 1RFNA 5KEDA 2CV3A 1MKWK 5C67A 2SNWA 5FX6A 1LQDB 1YLCA 4Y0YE 1FNIA 4KKDA 1MKXK 3GCOA 1ZRKA 3PO1B 4FUHA 5FPYA 1TQ0B 3AASA 1EXFA 1JRSA 1GMCG 1SGFG 1UTLM 1A3EH 1AMHA 1H9IE 1NRRH 1KTSB 4YZUA 5LPFA 1ZZZA 1P02A 3RXQA 1OS8A 5TJXA 4WJG2 2GDDA 1INCA 3RXAA 4AORA 2IOTA 3M7TA 1PQAA 5JBBS 3QX5H 1XX9A 2BXTH 1O3LA 5J4QA 1GJDB 1RGQA 1C2MA 3MWIU 1A3BH 2TGPZ 5JPMH 1EAIA 3C27B 3OEHD 1P0SH 1V2PT 3OYPA 1GGDC 1XKBC 3KCGH 4VGCB 3GYLB 3URDA 3WY8A 4AFSA 2OD3B 2WSSD 2ZDVH 1ELCA 4K2YA 1OWEA 4CRAA 1SKYE 5HMAA 4F48B 3SGQE 4X2XA 4Y10E 1DICA 2GZ7A 3KQBA 1QFKH 2P94A 3H7OA 3T25A 3VB6A 2Y6TA 1DXPA 1NC6A 3SJIA 1AUJA 3ZZDA 4LZ4B 5IK2D 1BTYA 1AE8H 1TNLA 1V2TT 1PJPA 2NWNA 3RXEA 4H6TA 1O2YA 3M37A 4WXVA 5JDUB 5FBIA 1AGJA 3FANA 1P04A 4BAKB 1SBWA 2B7DH 4X0WU 1XUKA 2XC4A 1C2FA 2F9NA 1W2KH 4U32A 1TA2A 5T6DA 3K65B 1MTNC 1E0FD 1LHEH 4JZIA 3ZZ8A 5TCAA 3ZZ7A 4NA9H 4CBOA 3U28C 5B6OA 1TB6H 1CA8B 2GJGA 4INHA 2DUCA 4X1QU 4KTUA 3RXCA 1AZ8A 3RXUA 3SZNA 2ZTXA 5FCKA 1Z8RA 1KDQA 4O3TA 2NU3E 1ESTA 1C1MA 1V6DA 2ZWLH 3RMOH 1HAOH 1SGYE 3RXJA 8GCHF 1NU9A 1UTKA 1QGFA 1UTJA 2KZ4A 3PLPA 1AVWA 3ZZCA 4R0IA 2ALPA 9ESTA 2KFWA 1QA0A 1EJAA 1BCUH 1F7ZA 1O3GA 1BZXE 3U8RH 1O35A 3KQCA 1SGNE 2O8WA 3CNRA 4Y7BA 4ZKRU 1HUTH 2FOBA 2BY8X 2BDGA 3NCLA 3C1KA 4AFQA 1GI3A 3Q3XA 1HAVA 1CGHA 1N1LA 2BD5A 4D8NA 1HB0B 1LPGB 2GV6A 4WVPE 4ZAEA 5CDFE 1AKSB 1PQ8A 1RTKA 1FIZA 3BF6H 2UWOA 1XXFA 3MH6A 1TBQH 1UCYE 1FY5A 1C2IA 1OKXA 1L1JA 3SZEA 4INLA 2XTTB 3NUMA 2BLWA 2ZDMA 3MH5A 1BRCE 1PFXC 3UAIC 1AFEH 3Q76A 1QRXA 2VVUA 4HZHA 2F9BH 5DGJA 4ZXXH 2A4QA 2A4RA 4ISHH 3EYDA 5DSFA 1SOTA 4O97A 1C5WB 1RIWB 2WPIS 5FHTA 3GOVB 2VJ1A 1J15A 1O2XA 1IOEA 1UO6A 1C5XB 2JH5D 2ZA5A 1A5GH 1AFQB 1TYNA 1V2JT 4XSKU 1TNIA 3MU8A 3GY5A 4YOGA 3F9GA 1V2WT 1TLDA 4X1PU 1L4ZA 4ZMAH 5HYOA 1TBZH 2H9HA 1NPMA 1SC8U 3U1JB 5EW1H 1A7SA 4UFFH 4ZKNU 5J4SA 2IPQX 3TK6A 5E8EH 5F8TA 1IQIA 4TPIZ 4BXSA 4WH8A 3KYGA 1U6QA 5DP7A 3ZVBA 1O3FA 1Z7KA 3RXHA 2M5TA 1P2IA 1H9HE 4Q63A 3KQEA 1MZAA 1WXRA 1GBTA 1N6XA 4GPGA 1VZQH 1F5KU 4DIHH 1YCPH 1EX3A 1ZJKA 1P2QA 2QF0A 1LCYA 1EQ9A 2J98A 3RXPA 1O3AA 5DP6A 1CVWH 3UREA 1B0FA 1KLJH 2HNTE 1O38A 3TLOA 1S81A 4AGJA 2GDEH 4UONA 1V2ST 1AZZA 3AK5A 2YOLA 1TNKA 1C1SA 1LKBA 4Y8ZA 1FY1A 3OFND 1A5IA 2Y5HA 3DA9B 1OWKA 4RN6A 3S0NA 1CA0B 3ZYDA 1ZRBA 3ZVCA 1DY8A 4ACAA 1FUJA 4BTUB 4I8KA 4RKOB 1DY9A 4IS5A 1GBIA 2O8MA 1ELFA 1A0JA 4DIIH 1P01A 4DOQA 2B5TB 1HV7A 6GCHG 4AFUA 8GCHG 6CHAC 1Z8IB 2KAIB 2Z9JA 1IQFA 2ANKH 4AYVB 2VVVA 2GCTC 1TGSZ 4GVUA 3QWCH 1KXCA 2OINA 1W11U 3V13A 2OC0A 1GVKB 1VGCB 2PGQB 2ZHDA 1O2TA 1P10A 3RMLH 5FPSA 1KIGH 3PYHA 1S6LA 1MTWA 3BTME 3VG8A 1GHWH 3U69H 1CU1A 3BIUH 1FLEE 3M7UA 3EAJA 2PV9B 3FFGA 2SNVA 2TPIZ 1WQSA 2STBE 3SI3H 1ZTJA 4YT7H 3QTOH 2A32A 2OP9A 1W10U 4O3UA 2PTCE 3MNCA 2RA3A 3U98H 1TGBA 1TPOA 2PSYA 3F3BA 5C5OA 1MAXA 3OY6U 3RUOA 3GY4A 4AZ2B 3PMAB 4YT6H 1C5RA 3T27A 1NRQH 3KF2A 4Q7YA 2HVYB 1TA6A 1XVMA 2RA0A 1A1RA 1DWBH 1J8AA 2FI5E 2F9OA 1GVZA 1QJ7B 2OK5A 4KGAA 2PFEA 1YPGH 3PRBA 4A1VA 1UCYK 1GJBB 2W6ID 1IQHA 1GI8B 3ELAH 1O5DH 2ZPQA 1N8OC 4ESTE 4CHAC 2HLCA 1Y3WA 3NK8A 1FN8A 4YOJA 1W12U 1YPJH 2HOBA 1PPZA 3SBKA 1BRUP 5A8XA 1HJAC 2F4LA 5BPEA 1MTSA 3A87A 1C5PA 5DP4A 3AW0A 1BIOA 2BB4A 4H4FA 3PMBB 1AE5A 1NO9H 2WPLS 5DP5A 2BY5X 1YPLH 2KX4A 4XBCA 3VB4A 5A8ZA 1GBKA 4X8UH 4OS6A 1W0ZU 2Z9KA 2TGAA 3QN7A 4FVDA 1O37A 2KCOA 2A7JA 1O2OA 2IN2A 1O0DH 3PO1C 3GICB 1VCQA 1XUIA 1GHBF 1PYTD 1BITA 1CE5A 4TY7A 3RXIA 1SGFA 1DLKB 1TGTA 3MH4A 5C1XA 4JMYA 3MU4A 4DG4A 1T4UH 2Y81A 3ESTA 1L1GA 4Q7XA 2V0BA 2G5NA 2QYIA 1C4V2 1QQ4A 2GMTC 2KCAA 4IC5A 4K8BA 3JZ1B 1BTXA 1Y3XA 1AIXH 2BLVA 2QV1A 4FUIA 4KTCA 1SPJA 3UY9A 3MMGA 1G3EA 1H1BA 2ZU2A 3S9CA 1SHYA 1TX6A 3FAOA 1O3MA 2Q6DA 1YPEH 2WINI 1ZYOA 1GBMA 2ZPRA 3UNRA 3A8AA 3KNXA 3PV4A 2XWBI 2L6OA 1HAHH 4GHTA 2XW9A 3IITA 2FOHA 4YLUA 4DY7B 2NU0E 4VGCC 7ESTE 1QNJA 2TGTA 3F1SB 4UD9H 5C2ZA 2VIQA 5EPYA 3B23B 5CHAC 4FUJA 1SR5C 1GPZA 3GCTF 4D76A 1EAUA 1F92A 5C17A 3N7EA 3IWMA 1O2QA 2AHME 1D3QB 2OBQA 1OYTH 2NU4E 3ZZAA 3BG8A 3S9AA 1DS2E 1BOQA 5E2PA 2WV9A 2ZHEH 2F9UA 1KDQB 5AF9H 1C1UH 3GDUA 1KY9A 1JIRA 1UVPA 2ZU4A 2DE8A 3KQDA 1GBCA 2EY4C 1ELEE 1SVPA 1DX5M 1DUAA 3A7ZA 1C5ZB 1JMOH 1G3DA 1GL1A 4ZUHA 2THFB 4NIYA 3WWBA 1DSTA 3RC6A 1J16A 4ABDA 5GPIB 1WOFA 3M3SA 1P2MA 4BTIB 2Y5FA 4X2VA 3HK3B 3TNSA 3ZV9A 4UFDH 4KP0A 1QIXB 1HAVB 1AB9B 3RMMH 3L3TA 2BLQA 2GT8A 2VIWA 4HFPB 3OAAD 4IN2A 3SU6A 1BHXB 2QF3A 4WMEA 3SNDA 3F9EA 3V0XA 1V2VT 2XOKD 4HGCA 2WUCA 2O8TA 1QBVH 1K1LA 3ZVGA 5FL7D 1V2LT 1YYY1 5T6FA 1YKTA 4K1TA 3LH1A 1GMHF 1KLTA 2GZ9A 2Z9GA 4GHQA 2J92A 2J34A 4B73A 3ZZ9A 2KR7A 2XRCA 3LH3A 2UUFB 1JBUH 1HAYB 3K9XB 4DT7B 1NTPA 1O5CB 4TPYA 1O5GH 2ZDLA 1VCPA 2AMPA 3VGCC 1SGEE 3LGVA 3F2FA 6ESTA 4ISLA 4THNH 1GDNA 1O33A 1EPTC 1P2OA 1ZJDA 5E0JA 2XWAA 5EU8A 2ILNA 1GHAG 4DVAU 3A7VA 3MFJA 2CJIA 1O2GH 3TVJB 3RXKA 1BTWA 2Z94A 3K2UA 1KLIH 1LHFH 2AEIH 1D6WA 1UVUH 2ESTE 5EIYA 1ESAA 3E0NB 4MDSA 1C5MD 4Z0KA 3A7WA 2WPJS 1F0TA 2Q1JA 1F2SE 1IQKA 1BMMH 3SO3A 2FM2A 1CT2E 1TMBH 3I77A 2XYAA 1PPEE 2UUJB 5F8XA 1Z71A 2C93B 2CHAC 2W3KA 3F9FA 5HIZA 3QDZB 1TOMH 5H4IB 1LHDH 2QA9E 2GV7A 5HM9A 1ARCA 1C1NA 1ZHPA 3M5OA 5GXPA 1O3KA 1A0HB 2C8YB 4B1TA 1CO7E 4RI0A 2ODPA 2M2AA 3HKJB 1O2JA 1YLNA 3VB5A 1N6YA 4I33A 3RDZA 3LIWA 3S7KB 1FMGA 2J98B 4B6FA 4ZHLU 1RXPA 3TJVA 1AI8H 2H2ZA 1QA7A 3QZRA 1QJ1B 3FOAA 1W0YH 4OS1A 1T8OA 2J95A 2RFKC 2OC8A 1DLEA 2B0FA 3RXGA 3BG4B 2VVCA 4UE7H 1PPFE 1F5LA 1O3NA 1Z6EA 1P57B 4DURA 1KXDA 4RSPA 2ZU3A 1IQGA 4MPUA 3GCTG 1ZGVA 3VFEA 1C5VA 3W1EA 4IGDA 2A5AA 3NXPA 3DCLA 4Q4LA 3N99A 4CR5A 5GIBA 5ESBA 2HALA 1FJSA 1NFWA 3MI4A 3ZZBA 4FU7A 1GCTC 2TBSA 3IG6B 4I8HA 2PR3A 1TE0A 1E34B 1RS0A 3T5FH 1EB1H 4TYDA 2VNTA 1O3DA 2J4IA 1A61H 1DWDH 3MU1A 1BBRH 1TOCB 4B2AA 1OP0A 5EOKA 2C4FH
chains in the Genus database with same CATH topology
2FI3E 1AHTH 4TY6A 1O3BA 1YPKH 1FONA 2QXIA 4ABBA 5ABWA 3ATMA 3GCNA 3TGJE 4IN1A 1RTFB 3JZ2B 1Z6JH 1V2KT 3A84A 1CA0C 3SJ8A 1O39A 1GJ4H 1EJMA 1V3XA 1SGPE 3BEUA 2ZZUH 3PMJA 2A31A 2R0LA 1NROH 2ULLA 1XUFA 1DOJA 1G2LA 1IQEA 1NT1A 1IQJA 2FS9A 1LVYA 1T8LA 1ESBA 2SGDE 3FZDA 2ZFRH 4ABGA 1H8IH 1SQOA 3BTQE 1C4U2 2BQ7B 2Q6GA 1GMHG 1O31A 4Y7AA 1WQVH 2BD9A 1VGCC 1DVAH 1OXGA 1C2EA 2C90B 3V12A 3L6PA 3GY3A 2HPQH 2JKHA 2BOKA 3UUZA 1UTNA 2BD4A 1KXFA 5EODA 1RJXB 1HAXB 1F0UA 4MPVA 1O3JA 5DO4H 3RXBA 1K1PA 1FY3A 1GMDG 5HGGA 1MAYA 3PTBA 4B2BA 2ZCLP 3SORA 4BAMB 5JYIA 1TONA 4Y71A 1TWXB 1C4Y2 4UFGH 3RXTA 3K6YA 2RG3A 1GG6B 3ZVEA 2GCHG 2HWLB 4MNVA 1A2CH 4Q2KA 1TALA 2QAAA 1TNJA 1GHXH 1D9IA 3T2NA 3O8RA 1BB0B 2FLRH 1GBLA 2Z3CA 1MD8A 1Y3YA 1GCDA 1DXWA 4X2YA 5K0HA 2P95A 2ZQ1A 3TK9A 5GDSH 5AVDA 2A7HA 1ZPZA 1Y5BT 1QURH 5DKMA 3M5MA 2B9LA 1DUEA 1FI8A 1HJ8A 4J1YA 1EZUC 2WYJA 1C1RA 5FX5A 2JETC 2CF9H 1T8NA 3OSYA 1ANBA 4OS7A 2ZU5A 1WTHD 1C5TA 1MCVA 4Q7ZA 2FOEA 1J17T 2IJOB 3STIA 5K7RA 3MOCA 1S6FA 2SGFE 1K1NA 1O2VA 4SGAE 1QRWA 5HXFA 1ANCA 4K3JA 1DWCH 2CF8H 3M7QA 4ABJA 1HGTH 1ZMJA 1ETRH 2UUKB 3UR6A 1XM1A 2P8OB 3ATIA 2FEQH 1E38B 2I6QA 1T8MA 1QR3E 3M5LA 4I7YH 2BD7A 9LPRA 2VWLA 2V6NA 4NZLA 2VWOA 4U30A 3BTTE 3A83A 4BTTB 2WPMS 5FCRA 1WYKA 4OS4A 1NRNH 3UOUA 2Y82A 1ELDE 1XMNB 5F8ZA 2C8ZB 2BXUH 4KTSA 1KYNA 2FTMA 2OQ5A 2R3YA 4B75A 1D3DB 1Z8GA 2ZDKA 2ZFTA 4GAWA 4BAQB 4Y6DA 1FAKH 2QIQA 2O8LA 2TGDA 3HGPA 1KTTB 4MTBA 1VITH 1GI0A 3A7XA 1G3BA 1NFYA 3CP7A 1BHXF 4I31A 3GISB 1UCYH 2WV5A 5LH8A 1BUIA 1TMTH 2BY6X 2BZ6H 3LGYA 1ZPBA 1CT0E 1QRZA 2BMGB 5DJ7A 3ZZ3A 5JB9S 1EOJA 1HDTH 1KXBA 2CN0H 1GBHA 2Y80A 4XFQA 2XCNA 2H5CA 1V2OT 2J9NA 4JZFH 1EOLA 5BRRE 1BTUA 1S0QA 3BTHE 4UFEH 4NIXA 1SMFE 3TJUA 3B8JA 2FI4E 4OGXA 2FX4A 4GUXA 3VXFH 4CR9A 1TPSA 3SU5A 1QTFA 3DHKH 3R0FA 1FQ3A 1EATA 3RC5A 1QBOA 2ZGHA 3HGNA 1S83A 4ZHMU 2ZDAH 4I32A 1GBDA 2WV4A 1BMNH 3QZQA 3SGAE 2AGIX 2ALVA 3MNBA 1C2HA 1O2RA 3TH2H 1GDQA 3SJOA 2QGRA 5EXMA 1P2KA 3O8CA 3P17H 3KGPA 2W7UA 1P11E 2VGCC 5E0HA 3RU4D 1QB1A 1HPGA 1AB9C 1KXEA 2V35A 4DJZB 3MU0A 3ZZ4A 3RLWH 5CMXH 2W26A 2FXRA 3Q3YA 2GZ8A 1GHVH 2B8OH 3LT3A 2G52A 3BV9B 1C1QA 1G36A 1TMUH 2ZGBH 4PROA 3ENSB 3TH4H 3QGJA 4NIWA 4RKJB 3TITA 1FY8E 3OU0A 1OX1A 2VH0A 5DP3A 1HAIH 3T28A 1SOZA 3GDSA 2G81E 2A2XH 2GD4B 5E2OA 6LPRA 1WBGB 1YLDA 2ZEBA 3LKWA 1AO5A 4A92A 1O2HA 1ELTA 3P70B 4Y76A 5A0CA 3MHWU 1S85A 3K6ZA 3MH7A 1NZQH 5C3NA 1MQ6A 1YF4A 1HNEE 2WUBA 1LPKB 5GCHF 4X8SH 3SNCA 3TIUA 2PWXA 3VB7A 1KSNA 3FVFB 4JCNA 3LJJA 1QY6A 1ANDA 5JBCS 1MTNB 4YOIA 3BTWE 1IQLA 5A0BA 1M9UA 4Y8XA 1THPB 2R9PA 1C1WH 3DFJA 1QB6A 4JZ1A 1THSH 2ZCKP 1UTMA 1K22H 1SGDE 1EZQA 1QQUA 2Z6BD 3H5CB 2XNIA 3B9FH 2FMJA 5SGAE 1EB2A 1K21H 1FN6A 1HYLA 3RXRA 1GBFA 1T7CA 1THRH 3T62A 3NPSA 4AX9H 1O5AB 1TRMA 2FIRH 4WMFA 5E0GA 1GBBA 3A7YA 1OYQA 3KL6A 1ZMLA 1GHYH 2FOFA 2FS8A 4X1NU 4E7RG 1ELVA 3FZZA 1NU7B 3TH3H 1RD3B 1PPCE 1UVTH 4ABEA 4GLYA 1YCPK 2ZHWH 1P06A 5G4BA 1MH0A 1WU1A 2ZO3H 3BG4C 2AGEX 2BVXH 1ELGA 1TX7A 1O3HA 1LVBA 4I8LA 2GTBA 1VITF 5EQRA 2YNAA 2FOGA 1ZHMA 1D4PB 2BZAA 4NWKA 2D2DA 3ODFA 2BTCE 1GI6A 4XDEA 1HXFH 3F68H 4WH6A 4E06H 2Y7ZA 1MZDA 1AVGH 4ABHA 1TBRH 2ZPSA 4FU8A 2A1DB 3E16B 4O03A 3SOSA 1B7XB 3DT0H 3BN9A 1EPTA 2Z3DA 1SQAA 2VIOA 1DDJA 1Q2WA 3SV2H 2G51A 1V2QT 2F9PA 2F83A 3W95A 4CH2B 2UWLA 1P3EA 2VIPA 3U1IB 1MU8B 4XOJA 1ACBE 3ZVFA 1P2JA 3GY7A 1CHOF 1GJ5H 2BQWB 4ISNA 1ZSJA 1UMAH 1TIOA 2H9TH 2CGAA 1PQ7A 1CT4E 1XUGA 2BLOA 2LPRA 4XBDA 1ELBA 5IYTA 2PTNA 3OY5U 1W13U 3I78A 1S0RA 2AIQA 1FIWA 3LPRA 3TJNA 1F5RA 3U8OH 1MD7A 3LGTA 2QY0B 2PKAA 1GVLA 1W7GH 3NWUA 5T6GA 3MO6A 4NG9H 3RU4T 4FUEA 2FWWA 3E90B 4MNXA 1QBNA 3Q3KA 4Q80A 1TPAE 1L2EA 1MKWH 3P92A 4AFZA 1C5YB 2BY7X 1C1TA 1LVOA 1SGRE 2PGBB 2TIOA 2PUQH 1AD8H 4NFFA 2BVSH 1MKXH 1GDUA 5GCHG 4MQAA 2A4GA 4AG2A 1C5QA 2GX4A 2VU8E 3GYMA 2G55A 2GGVB 3SV7A 4GSOA 1ABIH 1TFXA 2Z9LA 1O2KA 1MU6B 1S82A 1JXPA 2AMDA 4FUBA 3SU2A 1TNHA 3SUFA 1GJ9B 4LOYH 3RXLA 2FODA 4WMDA 1WAYB 1GG6C 1NESE 4OS5A 1C9PA 2HPPH 5GWZA 1S84A 3ZV8A 5EQQA 4AN7A 4BXWA 1A46H 4JK5A 5LGOA 5A0AE 3M61U 2TRMA 3ODDA 1GJ7B 2FYQA 1K1IA 1BMAA 1P2NA 2ODYB 4ZH8A 1FY4A 2ZECA 3RM2H 1Y59T 4ABIA 5A8YA 3TGKE 5JBTA 1TAWA 3A85A 2ZGCA 3STJA 4CRBA 1SLUB 1D3TB 1C1PA 2QCYA 3BTFE 2QXGA 2OC7A 1ZR0A 3P8NA 1AY6H 3LU9B 3SU0A 1BA8B 2H6MA 1B5GH 3OX7U 3R3GB 1MCTA 4FVBA 3OTJE 4B74A 1SGQE 3S69A 3UPEA 1FV9A 1SB1H 1GI2A 2R3UA 2W3IA 4DCDA 1GBEA 2C8XB 3SU3A 5DPAA 4B71A 2BYAX 1LVMA 1GHBG 1CSOE 3MYWA 1YM0A 1C1VH 2P93A 2DE9A 3BTEE 1Q31A 3UQVA 5ESTE 1HFDA 1B0EA 4ISIH 1RIWC 3LC3A 3BSQA 4NCYA 2QC2A 4X6PA 2P3UB 1VR1H 4AOQA 1AFQC 3UQOA 1C2KA 1LKAA 1QJ6B 1BBRE 1O5EH 2ZHQH 1BTZA 5AFZH 1GWAA 1H8DH 4X6OA 3CENA 1UK4A 4CHAB 3ATKA 1SQTA 1EZXC 3SNAA 1NN6A 1DWEH 1L4DA 2BVRH 2AMQA 1E37B 1JRTA 1C2LA 2RCEA 1TX8A 1WCZA 5C1UA 3SHAH 3O8DA 2CXVA 4Y11E 3UNQA 1ORFA 4Y79A 1HLTH 5T3HA 2STAE 3Q77A 1UVSH 1HXEH 3FP7E 2QXJA 5F6MA 1UHBA 3A82A 1TQ7B 1IAUA 3D62A 4X1RU 3LGWA 1V2MT 1G2MA 3BTKE 4MPWA 1XXDA 1EP6A 2A2QH 2ZFPH 4X6NA 5EQSA 1OWDA 1MMJN 1ETTH 1ARBA 3ATWA 2BX4A 3PWBA 4UDWH 3AAUA 1UVOA 3M36A 1SGCA 4GCHF 5AFYH 1A0LA 1V2UT 2R2WU 4SGBE 1T32A 1BQYA 1O36A 4WXIA 3SUGA 4FUDA 1K1MA 1XVOA 1YBWA 4NA8A 1G30B 1Q3XA 2PLXA 4MLFB 3SU4A 2GMTB 1TPPA 2EC9H 1SFIA 4I8JA 1JIMA 2Z7FE 1G9IE 2AS9A 2ZI2H 1MBMA 2JH0D 3UTUH 1OWHA 1Y5UT 1W8BH 3AAVA 1CGJE 3LC5A 1C2GA 1OWIA 3S7HB 2ANMH 2BHGA 4U01A 4AB9A 4CRDA 4BNRA 2H5DA 1H4WA 1Y5AT 3SNEA 3AVZA 1BDAA 2FPZA 1K2I1 4A5TS 2PW8H 3EQ0H 3RXMA 1ELAA 5CHAB 2K1QA 2XBYA 2EEKA 1HIAA 1O5FH 2PKSB 4Y8YA 2YNBA 1O3IA 1O2LA 1C1OA 1EUFA 3RP2A 3QGNB 1YC0A 1S5SA 1DITH 2Y5GA 2FOAA 2AYWA 3L33A 3CS7A 1J14A 2PHBA 5EG4A 4LZ1H 8KME2 3U8TH 4AB8A 3A7TA 2VINA 4BAOB 1HJ9A 5FPTA 1FZZA 1DANH 3LGUA 2LNCA 3GY2A 5I46H 1GI1A 5C5NA 1BMLA 1OP2A 1AN1E 1BTHH 1SHHB 3H7TA 3GDVA 1GJAB 1C5UA 3LONA 4ZKSU 1FPCH 1UK3A 1LO6A 3SNBA 1LTOA 3LDXH 3EDXB 4D7FA 1V2NT 4B2CA 1YPHE 1K28D 1UJ1A 2GT7A 1LHGH 2A7CA 3A80A 2D8WA 2ZGJA 3HPTB 3PM3A 1GBAA 3E3TA 2UUYA 6GCHF 4CBNA 1D3PB 1P12E 2BY9X 4A7IB 1Y3UA 1QL7A 1O2SA 4HI3A 1YCPM 1BRBE 4Y0ZE 1BJVA 1UTPA 4O9VA 7GCHF 5A2MH 4DW2U 3MO3A 1CBWB 4YO9A 1PPHE 3TK5A 2BD2A 1V2RT 1ETSH 2FP7B 2O8UA 4FXGH 3GCHB 3D65E 4TWWA 3HK6B 1YPMH 2ODQA 2GP9B 3VGCB 3PB1E 2BX3A 3M5NA 3UIRA 1ZLRA 5ETXA 7LPRA 1O2IA 1EPTB 2Y7XA 2BDYA 3P8GA 3PTNA 3TU7H 4D9QA 4NGAH 2RDLA 1BBRK 2HGTH 2A5IA 3BTGE 2W5EA 3GY8A 1HBTH 1LPZB 1NS3A 3QK1A 4K1EA 1YP9A 4M7GA 1HAZB 3URCA 1PQ5A 2VB0A 2R2MB 5DP8A 1WUNH 2FZZA 1C5SA 1OP8A 4X8TH 3RU4E 1Z1JA 2XC0A 3SGBE 2G4UA 2ZU1A 4GCHG 3VB3A 2A4OA 3ZZ6A 1LDTT 3Q00A 1XKAC 2EI7A 3NZIA 5A09A 2ZFFH 3EGKH 3KHVA 4D7GA 1E36B 2GKVE 1AVXA 1ZGIA 3QLPH 4AGKA 4UEHH 1TGNA 1Z1IA 4JZDH 3KEEA 4NSYA 2EI8A 1TNGA 2CHAB 2ZKSA 7KMEH 1EKBB 3TJOA 3ITIA 1EASA 2PKAB 4NFEA 4FUFA 4XE4A 1PPGE 3NKKA 1VJ9U 2BDCA 2W7SA 3MNSA 3DD2H 2FOCA 3SN8A 3M3VA 4K8YA 4X6MA 1L1NA 3P95A 1RRKA 3PMHB 1GJ6A 4NA7A 3SUDA 2V3OH 4CRGA 2OLGA 4LK4A 1EZSC 1O2UA 5L6NH 3TNTA 1ZOMA 4Z6AH 2ASUB 2SFAA 1XUJA 1ZTKA 1ZMNA 1D6RA 1FDPA 5TCCA 1O2PA 1GI4A 1BT7A 2FLBH 1HAGE 1P9SA 4ZHAA 3GY6A 4QT8C 3RMNH 2ZP0H 2GVFA 1O2WA 1EP5A 1O32A 3FP6E 1G37A 5EXNA 1GCTB 3SUEA 3PWCA 5LPRA 3KIDU 8LPRA 1GJCB 1AWFH 1VJAU 1GJ8B 3EA9A 3VPKA 1Y3VA 4H42U 4WF8A 4JK6A 1GBJA 3SV9A 1SLXB 1HCGA 3SJKA 1MQ5A 1MTVA 1O5BB 2JH6D 2AERH 3T26A 2Z3EA 3PLBA 1ZHRA 2G5VA 4BOHA 4X1SU 2SGAA 4AG1A 1GGDB 1QCPA 3EA8A 5L2YH 2BDHA 2VWNA 2OBOA 3N7OA 3SHCH 4MPXA 1TRYA 2PSXA 1P03A 1WTGH 2QN5T 2ZIQH 3UWIA 1SI5H 4CRFA 4JYVH 2ANWA 2OQUA 1HRTH 2H9EH 1OPHB 3SV6A 3RM0H 3W94A 1P05A 7GCHG 1FXYA 4ZXYH 1NRSH 1SGTA 1T4VH 1AQ7A 1DSUA 3A8BA 4OS2A 2ZTYA 3MTYA 1W14U 5DK1A 4ISOA 1LQEA 2NU2E 4I8GA 4IBLH 1C9TA 1O3PB 3O8BA 5FBEA 4ZKOU 4JZEH 3DUXH 3A8DA 1WV7H 3SQEE 4A6LA 5EPNA 1OWJA 3E1XB 2HRVA 2BDIA 4F4OC 1TGCA 3E6PH 4NSVA 2OXSA 3AW1A 5C20A 2V3HH 3RXSA 2F91A 5C1YA 1LMWB 2ZHFH 2FDAA 5F03A 3TPIZ 2BOHB 4CH8B 1S6HA 5HM2A 2OUAA 4J2YB 2AH4X 4E05H 2OC1A 4MNWA 1Z8JB 1IHSH 1O3CA 2FOMB 4IMQA 1UHBB 3A89A 1OOKB 3A81A 1QL9A 3A86A 1O34A 1ZSLA 1SLVB 2AIPA 5JBAS 1BRAA