2HOBA

Crystal structure of sars-cov main protease with authentic n and c-termini in complex with a michael acceptor n3
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Production of authentic SARS-CoV M(pro) with enhanced activity: application as a novel tag-cleavage endopeptidase for protein overproduction
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 90
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2hobA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hobA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hobA02
3DA9B 1H4WA 2ESTE 2BDIA 1NS3A 5DP6A 3ZYDA 1S5SA 1ZPZA 4IBLH 3UOUA 3F9FA 2HGTH 5EQRA 1O3PB 1RD3B 3GDSA 5JBAS 1G3DA 1FI8A 1L1JA 3GY7A 1WTHD 3VGCC 1DUEA 2P94A 1O5EH 4NCYA 2PR3A 3MOCA 1JXPA 1O3JA 2WPHS 3UOPA 1C2FA 1C5PA 1FJSA 2OINA 3TU7H 2ILNA 1JIMA 3UNQA 2Q6FA 4A5TS 3ATKA 3L33A 4MLFB 4O97A 1EATA 2ANKH 4FU8A 2FZZA 2EI8A 4XBDA 3H7TA 2A7JA 1ZTKA 1D6WA 1C2MA 1L0ZA 1B7XB 1CT2E 4NA7A 3HKIB 1ZTLA 2GMTC 3CENA 3UTUH 1WUNH 3NK8A 3ZZCA 5EW2H 1YPLH 1C1RA 1TALA 4INKA 3VFEA 3E16B 1BMMH 3TK6A 4X1SU 4ESTE 4KTCA 2QIQA 5FPYA 1K1PA 3KQDA 2FS9A 1GPZA 2XCFA 1D9IA 3LOXA 3ATMA 3PMHB 1T8NA 4OS1A 1J15A 1AMHA 2NU0E 1LO6A 4K3JA 4XBCA 1HV7A 1F5KU 4XDEA 4YOJA 4AOQA 2ZFRH 3RLYH 2ZDNA 1TABE 1Y8TA 4MDSA 2NU2E 3K9XB 1H8DH 2FTLE 4JK6A 3I78A 5E2PA 2V3OH 1QY6A 1MU6B 5AF9H 1Z6EA 5A09A 3K2UA 2XTTB 1SLUB 3SNCA 1QB1A 1THRH 1TNGA 4INLA 4GHTA 1EJMA 1FN8A 3M3TA 1AUTC 1A0JA 1GJ6A 1YBWA 2P93A 4AORA 2BVXH 7GCHF 1YYY1 1Y3VA 4NFFA 1ANCA 1AVXA 4H42U 1GJCB 1LDTT 2TGTA 3H5CB 1TWXB 3PMBB 3HK6B 5FPSA 1BRAA 1GHBG 5LPRA 1EPTA 1D3QB 3B23B 1KXAA 2GT8A 3RXPA 1FN6A 2BD7A 4B73A 1O2ZA 1GCTB 3A83A 4FUIA 2OP9A 1W14U 2CGAA 2UWOA 3S9AA 4LZ1H 1GI9B 1C5XB 2DE8A 1VJ9U 6CHAC 4ISNA 5JB8S 1EQ9A 5HMAA 3SGQE 2PKAA 4HZHA 3RXFA 4B2CA 4OS2A 5CE1A 1YPJH 1PPCE 1E38B 1BMLA 4DJZB 4FVDA 4MG3A 1P05A 3RXEA 3SBKA 1C2IA 4INHA 4DG4A 3MWIU 3ZVAA 4B2AA 1HAZB 5HM2A 1AGJA 1IHSH 2FI5E 5AVDA 1CHOG 1WYKA 2GT7A 1BRCE 2ALVA 3M5LA 3NUMA 8KME2 3AW1A 3MO6A 1W12U 1QJ6B 1N6XA 1DWDH 2SGQE 1SSXA 2VIDA 3BG4C 1L1GA 1OYTH 2R3YA 1FY1A 1P2MA 2FWWA 2PKAB 1GHAF 3A7ZA 8GCHF 5LPFA 5DO4H 1TE0A 4DGJA 1C5NH 1HXEH 1G37A 1C1SA 3RXTA 1GMDG 4BTIB 4I8JA 2FOMB 1SGYE 1PPFE 3SUGA 3ZYEA 5B6OA 2H5CA 2B7DH 3ZZ9A 4I8GA 2ANWA 1V2ST 3KHVA 1P0SH 3BTHE 4B71A 1P3EA 1BZXE 3HGPA 2BLOA 5EXMA 4Y8XA 4D7FA 2AGGX 4B1TA 3SUDA 1C1NA 1SGEE 3MI4A 5EQQA 2H9EH 4OS6A 3KNXA 1OYQA 2DE9A 3ZZ5A 3E6PH 3EDXB 1TIOA 2WPKS 1ZTJA 2R3UA 1LHEH 3FFGA 1FMGA 1YCPH 2A4QA 1EB2A 4KGAA 4JYVH 2GVFA 4BAOB 3GISB 4IW4E 2ZG0H 4ZKRU 2ODYB 2GCTB 2NU3E 1WCZA 1A0LA 4HFPB 1XM1A 4AGKA 1O37A 1A5HA 2AYWA 3FP7E 3M7QA 2A1DB 1INCA 3MU8A 4NA9H 1VITF 4Q7XA 3STJA 3BTQE 1ANBA 1SC8U 2G5VA 3SV9A 1UVPA 2Y7XA 4GCHF 4E05H 1LHFH 1P06A 2ZGJA 3O8RA 5LGOA 2ZTYA 2A7HA 4AZ2B 1EB1H 3MH7A 1QTFA 3SV7A 1K1JA 3DHKH 5L2ZH 5L30H 1XXFA 5GDSH 2QAAA 2W3IA 1TB6H 2VGCB 2WPJS 1NTPA 5F03A 1O2TA 2F3CE 3A8AA 1EP5A 1RTFB 2ZF0H 4H4FA 2R9PA 4JK5A 2AFQB 3STIA 1UHBA 3NPSA 1C1OA 5DPAA 4X6MA 1GHVH 2BOKA 4KTUA 1JIRA 1PPGE 1MBMA 2FOEA 3PWBA 1HYLA 2RA0A 3LJOA 4OS4A 1TQ0B 2VWMA 1UHBB 3I77A 3PLKA 3U8TH 3VB7A 3GCTF 1QJ1B 1NFYA 5C5OA 1ESTA 1HAVB 3OY6U 2BQ6B 1LHDH 2BB4A 2Y80A 1ELGA 4R8TB 1NROH 3LIWA 4CH8B 1VGCC 3T27A 1V2UT 5GIBA 1P57B 5C20A 2BOHB 5PTPA 1KXDA 1O2NA 4WXIA 1P02A 4MNYA 4NIVA 1UTOA 3MNSA 1HRTH 3ODFA 4O3TA 4TYDA 2JH0D 2SGDE 4O3UA 3TGKE 1UTQA 3BTWE 1BB0B 5A8XA 2QF0A 1G2LA 3O8DA 1MTUA 3DT0H 2HNTE 2A45B 2J95A 3NKKA 3PROA 3TJNA 1GMHF 1PYTC 1A1RA 1GJAB 1AQ7A 1C2KA 3TH3H 3MTYA 1EZXC 2K1QA 1IOEA 4ZAEA 1C9PA 1D3DB 1GHYH 2A0QB 2WINI 1GBBA 1O5AB 1P12E 4A1TA 4BTUB 4GCHG 1DWBH 4K1EA 3R0FA 1KLIH 1FIZA 2CF9H 1TRNA 4ZH8A 2WPMS 2RDLA 3IITA 2VWLA 1DSUA 1GVKB 1YM0A 4UFFH 4NSYA 1HJ9A 1YF4A 6GCHG 2O9QA 1NM6A 1GWAA 3UUZA 2O8MA 4XBBA 1Z1JA 3BTFE 1TPSA 2J92A 4JZDH 1KXEA 3UQOA 3KQCA 1AI8H 4WXVA 3ATWA 2JETC 3U98H 3SNAA 3SGAE 1NESE 4RKJB 2A4RA 3PYHA 2HVXA 4BAKB 1C4V2 1ELFA 4CR5A 2Y82A 1UVSH 3QTOH 4XOJA 4K60A 1V2RT 3RXHA 1GDUA 1CGJE 5HGGA 3ZZDA 4Y79A 3KN2A 1K21H 1NRSH 4IGDA 4Y7AA 1GBLA 3RC5A 2ASUB 2XCNA 1QBOA 3D62A 4Y7BA 1ZPCA 1IAUA 1O3OA 1GBJA 5DP5A 2R2MB 5TCCA 1QIXB 1UCYE 3VGCB 2AIQA 2Q6DA 1P2OA 4IMZA 2BLVA 4AG1A 1GJ4H 1Z7KA 4ABEA 4ABBA 5HYOA 1MZAA 1LKBA 4FVBA 5L6NH 3BIVH 5JDUB 3PO1B 1IHTH 3ZVBA 4M7GA 4K1TA 3LU9B 1MKXK 2J2UA 2SNWA 6CHAB 2CV3A 3SU4A 5J4SA 5EXNA 4ZMAH 2XBVA 1H9HE 1FDPA 2O8WA 4X6NA 4Y11E 3U69H 1C2DA 2FP7B 1O32A 3P8FA 1RXPA 1RTKA 2FESH 1BUIA 1KLJH 1XUHA 1O30A 3PB1E 1EAXA 3SJ9A 2C8XB 1K1OA 2BVRH 4TY6A 1RGQA 2VIQA 1UTNA 3FZZA 3GYMA 5AFZH 4I8HA 1F2SE 5A0BA 2P95A 4Y10E 4I7YH 1W11U 3SGBE 3TNSA 1A3BH 1GBAA 2P3UB 1C5VA 3RU4D 3DFLA 1CVWH 1PPBH 2AS9A 2FX4A 1TGSZ 5FAHA 3V12A 4X8SH 1NFWA 1HAHH 6GCHF 1HAOH 2ZGXH 1O3GA 3ELAH 3U1JB 1UTLM 2I6QA 1NRRH 1JWTA 2GP9B 5JPMH 4NSVA 2CXVA 2SNVA 3N7OA 3GOVB 1CGIE 5A8YA 3FAOA 1E37B 1SGDE 3ZZ7A 1W13U 2G4TA 1FY5A 1DY8A 5GWZA 1GI5A 5TCAA 1EPTC 2ZIQH 1IQMA 2H6MA 3A7YA 3P8OA 2BHGA 2OBOA 3QWCH 1HXFH 5G4BA 4CRFA 1BITA 1SL3A 1P2IA 2TGDA 1GBHA 3E3TA 1FLEE 1MKWK 2GV7A 2IOTA 5DKMA 4ZHLU 3B9FH 1RIWC 5FX5A 5GCHG 4ISIH 3VB6A 4JMYA 2ZU2A 2BZ6H 1C4Y2 1O39A 2XC0A 2XYAA 5DJ7A 2H9HA 2A5AA 1Z8JB 1BOQA 2FMJA 2ZPSA 3PLBA 4A92A 4CBOA 1PQ5A 1TX6A 4RSPA 3TLOA 2GCTC 1RFNA 1BBRE 3A86A 3AAUA 4THNH 1C2JA 1VITH 4CR9A 1ARCA 5A0AE 1V6DA 4U01A 3RM2H 4B75A 1G30B 1O3KA 2TPIZ 3MU4A 4UD9H 1YCPK 1MTNB 1G3EA 4AB9A 4XSKU 1AVGH 5FX6A 3EBNA 1ELTA 4ISOA 3E91A 3LDXH 2XC5A 4TPYA 1J16A 2Z9LA 2PSXA 1UVOA 3C27B 3TH2H 1C5ZB 2G5NA 1HIAA 1T7CA 3NZIA 3A88A 4Y0ZE 2TGAA 3SU5A 4DIHH 1TPOA 2Z9GA 1AE5A 2PLXA 1CGHA 3LJJA 1V2WT 2AGEX 1EZQA 1FNIA 3CS0A 1MKXH 1XVOA 2J4IA 1T32A 1YP9A 2ZGBH 3A7VA 3EA7A 1FY8E 1CT4E 2FODA 1RTLA 4ABIA 1SOTA 4OGYA 1W0YH 2VWOA 3GCTG 5FCRA 1MCTA 1WV7H 1AUJA 4CRBA 3T5FH 1SB1H 2ZZUH 4U32A 3RMOH 4Q7YA 1KSNA 3SV6A 1GDQA 3ZV8A 1EASA 3Q3YA 1L2EA 1OSSA 5C2ZA 1OWJA 1GGDB 1LVMA 4JZFH 3RXUA 1P04A 1YPHE 2D2DA 3I29A 3RXJA 1ZJKA 4DURA 2XWBI 3BV9B 5DP8A 1AB9C 4ZKOU 1HPGA 1LHGH 2OC0A 3MU0A 1NRNH 1TNLA 2UWPA 1MQ6A 2Z6BD 1WAYB 2A2XH 4ZKSU 2FOCA 1CA0C 1SGNE 4WF8A 1PYTD 1OWEA 2XBYA 4HTCH 5DP7A 2QCYA 1DDJA 1EX3A 1F5RA 2QN5T 1AO5A 1EUFA 2GMTB 4ABDA 4SGBE 2JH6D 3CP7A 4CH2B 5GXPA 2PTNA 4E7NA 4AB8A 4MPUA 1IQIA 4WH6A 4AGJA 1E0FD 5C3NA 1OP2A 3IWMA 1YCPM 3OTJE 3V3MA 5C67A 3L6PA 1ETSH 2GZ7A 2FO9A 1C1VH 3PTNA 1W3CA 4H6TA 1SOZA 8GCHG 4I33A 1TYNA 1NRPH 1V2TT 2FDAA 4OGXA 3BTDE 3MFJA 3H7OA 3BEIB 1KDQB 3ODDA 3Q77A 1QB9A 2F91A 1TA2A 1CQQA 2VB0A 1YPEH 2QYIA 1QQ4A 2QV1A 3DUXH 3RXMA 3KEEA 1MD7A 3RMNH 1T31A 4MNXA 1L4ZA 1ABJH 1XUFA 2OBQA 4NIXA 4WH8A 3VB5A 1C5LH 1ZSJA 1ZZZA 2FOAA 2OD3B 2XRCA 3SNDA 1C1UH 1OWDA 4KELA 4NZQA 1GHZA 1MU8B 1TGCA 3M61U 1QL9A 2AGIX 1LHCH 2FOFA 1BTUA 5CHAC 1O2SA 2FI3E 2GV6A 1C2LA 1KTTB 1SHYA 2UWLA 2OXSA 2WV4A 2EI7A 1VZQH 8ESTE 4CREA 2P16A 3SJKA 2B8OH 3U9AH 2BLWA 1F5LA 1ZR0A 4Y8ZA 2FLRH 3UREA 1B0FA 3ZZ4A 2ALPA 2B5TB 2W7UA 4X1PU 1ZMLA 2CF8H 1ELBA 2AEIH 1EJNA 1C2EA 1PFXC 2GCHF 4VGCC 4LXBH 1GHBF 1O2HA 3QGJA 1GCDA 4HGCA 1YLCA 1BHXF 1FAKH 2A4GA 4AYYB 4I32A 1A61H 2VIOA 7GCHG 1WBGB 1Z6JH 3GY2A 2ZWLH 3TNTA 1HJAC 2A32A 2A7CA 4A1XA 2WYJA 1C1TA 1GJDB 5L2YH 3PWCA 8LPRA 3VB4A 1L1NA 1GBKA 2HNTC 4NA8A 1O5GH 1QURH 3QLPH 1Q31A 4X1NU 1DSTA 4X6OA 1O3NA 2BVSH 3SUFA 2ZDLA 3T25A 4GVUA 3KGPA 1HAVA 1K1IA 1OWHA 1D4PB 1T8OA 2PUXB 4Y6DA 3SU1A 1J14A 2WYGA 1WTGH 2OC1A 2JETB 1EKBB 4F49A 1SGCA 5GPIB 3GY5A 2V0BA 2AERH 2R0KA 4F4OC 3TITA 2C3SA 2ZFQH 1MTVA 1ANDA 5ETXA 2VGCC 2G55A 1O38A 4YZUA 1Y5AT 3LC5A 1GI1A 3DFJA 1VR1H 1GI8B 1XKBC 2GCHG 1HAPH 3BEUA 1HIAB 3VB3A 1PPEE 1SLXB 1XUGA 3ATIA 3PMAB 1N8OC 2IJOB 4XFQA 1O2UA 2PWXA 1AIXH 1AZZA 4GLYA 4CHAC 2BMGB 1SFIA 2C4FH 4K1SA 1NZQH 1AHTH 2HLCA 2Y81A 1P2NA 3UWJH 2QXJA 2KAIB 1ELAA 1P11E 3FVFB 1NFUA 1DX5M 4ABHA 2ZPRA 2H2ZA 4TWWA 1GHXH 2VVUA 2H9TH 1EPTB 5EW1H 3RXKA 1UCYH 5SGAE 1AU8A 3SNEA 3UPEA 4OS5A 2BM2A 5C5NA 1DLEA 1OP8A 2V6NA 1MAYA 4Q7ZA 1BTWA 3RXLA 3W95A 2AMQA 1UK4A 1SGFG 3UNRA 1BTXA 3URCA 4BOHA 2HRVA 4GAWA 1W10U 1OX1A 1TNJA 1CT0E 3A8BA 4Q2KA 1TMTH 3A89A 4I8LA 2IN2A 1ZSLA 2THFB 2J9NA 1A46H 2ZTZA 2Y5GA 1ZHMA 3BTTE 4CRCA 1TX7A 3SQHE 3A7XA 1TBRH 2Y7ZA 3LGVA 4BAHB 1QR3E 2I6SA 1K22H 1A0HB 5FHTA 2D8WA 3TK5A 3UR9A 1GBMA 1LCYA 5DK1A 1GJ8B 2F9NA 1TFXA 4A1VA 1TNIA 1GHWH 1H9LB 2LIZA 1N6YA 2BD4A 2ZFFH 1VCQA 1XKAC 2QY0B 2ANYA 1VCWA 2PKSB 1LPZB 1FPCH 1Y3WA 1UTKA 1GL1A 1CO7E 5EGMA 5AFYH 2VJ1A 4X2YA 3SO3A 3T26A 2ZNKH 1NU9A 4LOYH 3JZ1B 1WQVH 5E0HA 2YOLA 2BD8A 1J9CH 1V2KT 4FUHA 1ZRKA 1P10A 1O3LA 1PQ8A 2VIWA 1SG8B 1KXCA 4FUDA 2BX3A 3Q3KA 1XUKA 3TIUA 4KKDA 2GD4B 1G32B 3M3VA 5EXLA 2C90B 1J8AA 1BMAA 1RIWB 1MTSA 1TX8A 3T29A 1JOUB 2CMYA 1O5CB 2RG3A 2B0FA 4NG9H 3ZZBA 3RLWH 1AB9B 4WMFA 1HDTH 1ESBA 2XXLA 1QJ7B 3Q3XA 1ETTH 1GBFA 1FPHH 4FU7A 4X2VA 1QBVH 1T4UH 1C1PA 4Y8YA 2PV9B 2VVCA 1VJAU 3AAVA 1E36B 3MH4A 4YT7H 1QRXA 3HGNA 1MTNC 2VWNA 3LGUA 1QRWA 4WVPE 1QFKH 1MZDA 4NGAH 1TPPA 1V2PT 5EODA 1MMJN 4D76A 1K9OE 3ZV9A 4DVAU 1DFPA 1FY3A 2Z7FE 3SQEE 4ZHMU 1LPKB 4UFGH 3SZNA 1Z1IA 1WSSH 2ZDKA 1AFQB 2ZHWH 1UJ1A 3RM0H 1CHOF 4ABJA 3P95A 2ZFPH 1QHRB 3UY9A 3PLPA 1ZLRA 4B2BA 4O9VA 1H8IH 2XBWA 4B74A 3M5NA 3MNBA 1O0DH 1YC0A 4X8TH 5CMXH 3QZQA 5EPNA 2STAE 3SHAH 2C8ZB 3V13A 2M5TA 1BCUH 4YT6H 3F1SB 1K2I1 2RCEA 2Y5HA 1RRKA 1LVOA 1D6RA 3QUMP 2TRMA 1O5BB 1SBWA 3D23A 1F0UA 1O2OA 1UTPA 3GY8A 5JBCS 3Q00A 2ULLA 1QA0A 1DT2A 1V2JT 3ZVGA 3P92A 2Z9KA 3KCGH 1GJ5H 4UDWH 1QNJA 1TA6A 4U2WA 3E90B 1TBZH 3E1XB 2H1UA 3LGWA 1BJVA 3HKJB 1MCVA 2EC9H 1HFDA 3M36A 1SGPE 1GJ9B 1HAXB 3PO1C 1BTYA 1THPB 1CA0B 1VITG 1DPOA 3A81A 3QDZB 4AFZA 1SVPA 1EAWA 2GKVE 3VXFH 3ZVCA 1O2GH 1SQTA 2W26A 3UWIA 2VH0A 1Y5BT 4VGCB 2ZDVH 4MNVA 1O2QA 1JMOH 1JRSA 2YNAA 1ID5H 2ZPQA 1JRTA 4ISHH 3ESTA 4FUBA 4WJG2 3QZRA 4Z0KA 1DE7H 1FZZA 1A5GH 2QXGA 4K2YA 3SU0A 1GBTA 2A31A 5A2MH 3E8LA 3PM3A 1OWKA 2ZHEH 1P2QA 3TK9A 2ZCLP 2P3FH 2NU1E 5E0JA 1SGFA 4TY7A 1B0EA 1G3BA 4YLUA 4ISLA 1IQHA 3EGKH 2ZKSA 5I46H 1X7AC 2HNTF 3LT3A 2EEKA 4D9RA 3GY3A 3RXCA 1NY22 1QCPA 3ITIA 4FUCA 1O5DH 4X1QU 3ZVFA 2Z9IA 1WQSA 4AG2A 4E06H 3S7KB 4ZUHA 3NWUA 4X2WA 4NWLA 2ZHDA 1HAGE 3G01A 1UCYK 4ZXYH 2GDDA 4YOGA 5E8EH 3UQVA 3MU1A 4KTSA 1TGNA 4BXWA 1BTPA 3SJIA 3K6ZA 5JBBS 5C1XA 1SGTA 2BD3A 2OC8A 1E35B 1UO6A 4H6SB 3EAJA 3EQ0H 1FY4A 2KAIA 2WV5A 1C5WB 4X8VH 1UVTH 5JB9S 2SGPE 2QXHA 1J17T 1A2CH 3MH5A 1GGDC 3TJUA 2GTBA 4WWYA 1V2OT 1KIGH 3RDZA 1AZ8A 1RJXB 1IQLA 2ZO3H 1SLWB 3SORA 3GCHC 1U6QA 2XWAA 2YNBA 4BAQB 1SGIB 1GI2A 2ANMH 1TRMA 2FXRA 1P9UA 3EE0B 3P17H 1PQAA 3SOSA 1BIOA 1E34B 3VXEH 1WOFA 1IQGA 5HM9A 1AE8H 5BRRE 4X8UH 4X0WU 1RS0A 4FUFA 3SJOA 1EP6A 2ZFSA 1TNKA 5DGJA 4I31A 1C5TA 2ZQ1A 3K65B 3TGIE 1QQUA 1HBTH 1N1LA 3SHCH 1KDQA 1GVLA 1NRQH 3GDUA 1TGBA 3SJ8A 2A2QH 1Y3UA 4QT8C 3PV4A 4CRDA 1LQDB 1S85A 3AASA 3C1KA 5HXFA 1OPHB 1O34A 5F8TA 3VEQB 1O2VA 1TNHA 2OQ5A 3CS7A 1C1MA 1TMBH 2SGFE 4JZIA 4UEHH 2C93B 1LVYA 1PPHE 2F9OA 4IN1A 1Z71A 1AKSA 5J4QA 1HAIH 1Y59T 3A7TA 1EZSC 3BEFB 2VIPA 1N8OB 3MNXA 1GHAG 1KXFA 3MU5A 4CHAB 1GMCG 1QA7A 2FPZA 1GMDF 3LH3A 1K1MA 3ZZ8A 3M7TA 1O3CA 2BDBA 2PTCE 3RU4T 1C5SA 3OX7U 1XMNB 2FEQH 2PSYA 3A85A 4ZKNU 2ODPA 4X6PA 2O8LA 1TRYA 2IPHA 2XNIA 1GG6B 3VPKA 4MPXA 2J38A 3TH4H 4UE7H 1BHXB 3RUOA 1P09A 5CHAB 2HPQH 4CRAA 1O2LA 4D7GA 1KYNA 1HJ8A 1BBRK 3KF2A 2VINA 3IG6B 3OU0A 1TONA 4BANB 3P70B 4MPWA 3M35A 3T62A 4JYUH 4ZXXH 2W7SA 1EOJA 2EA3A 2HOBA 1F0RA 2D26C 1ABIH 3AW0A 1A5IA 1DS2E 1GI7B 2BDCA 2A5IA 3MO9A 4K69A 1FQ3A 1NPMA 3ZZ3A 3MO3A 5EOKA 1Y5UT 4IN2A 1QL7A 3BTGE 1QB6A 2STBE 2QC2A 1HNEE 1LTOA 1NO9H 3S9BA 3BTKE 1LKAA 2WUBA 5E0GA 4LZ4B 3URDA 3BN9A 2FOHA 3RXDA 5JBTA 2PHBA 1G36A 3QO6A 1QRZA 1HJAB 1ZHPA 5F8XA 1H1BA 2QF3A 1C5QA 1GJBB 2NU4E 4FUJA 1TQ7B 5EG4A 4IMQA 2VH6A 4CBNA 4BAMB 2BQ7B 3LKWA 3RXGA 1O3FA 1C1QA 1O2JA 1K28D 5FXLA 2P3TB 1M9UA 1KTSB 1Z8RA 2FYRA 5EQSA 2O8TA 1YLDA 1C1WH 1MH0A 5TJXA 3FP8E 1PPZA 1PQ7A 3A82A 5IYTA 4UFDH 5DP4A 2UUFB 1AWHB 1XXDA 1ZRBA 6ESTA 1S83A 3F6UH 1O3AA 3FANA 2R0LA 2BY9X 9ESTA 1ELCA 1W7XH 3W94A 1IQJA 2CN0H 1L4DA 1DM4B 1DY9A 1G3CA 1O2KA 3TVJB 1CHGA 1C2HA 1SGQE 4NIYA 1ELVA 3BG8A 4PROA 4CRGA 2R2WU 3NCLA 2SFAA 1KY9A 4GSOA 1MTWA 4IS5A 2F9BH 1ESAA 1LVBA 5BPEA 1MD8A 1C2GA 2ZECA 1O3IA 1F92A 3LC3A 1K1LA 2ZC9H 2ZGCA 2BY5X 5FPTA 3GICB 4JYTA 2BQWB 1XUJA 3OY5U 3SU3A 2CHAB 3A7WA 1C9TA 1F0SA 3RMLH 4NFEA 2F9VA 1ZGIA 3RXQA 2AMPA 4R0IA 3T28A 5IDKA 4LK4A 1SI5H 1DWCH 2A4OA 2ZU5A 1V3XA 1UTMA 1NFXA 4K8BA 1GMHG 3GYLB 4RKOB 4YM9A 1P9SA 2GX4A 3BTME 2LPRA 3HPTB 3OSYA 2ZTXA 1OXGA 1GVZA 2NWNA 4MQAA 2FM2A 1UVUH 4JZEH 1HLTH 1VCPA 1NN6A 2Q6GA 1DOJA 1GBDA 3SU2A 1BTZA 4A7IB 6LPRA 3F68H 1AWFH 3M3SA 4I8KA 1ACBE 4U30A 3O8CA 2D1JA 1K1NA 2PW8H 3RP2A 1C4U2 1XVMA 1Y3XA 3KL6A 1YPKH 2OCVB 2BYAX 1W2KH 1OKXA 3F9HA 1S82A 4ASHA 4X1RU 1H9IE 2ZFTA 1CA8B 1YPMH 1IQEA 5H4IB 2ZDMA 1SFQB 5DG6A 2UUKB 5FBEA 3F9EA 4Y76A 3UR6A 1D3TB 1TBQH 2BTCE 5DP3A 1ELEE 2G52A 4D9QA 1BT7A 7KMEH 2P8OC 2FYQA 2SGAA 4FUGA 5EU8A 4XE4A 3ZZ6A 1GCTC 3P8GA 1GDNA 2PGQB 1ZJDA 4MTBA 2Y5FA 5K7RA 4YO9A 1O2XA 2H5DA 2BY7X 1AD8H 1CBWB 1THSH 3F9GA 3V7TA 1O2IA 1BRBE 2J34A 2HALA 2BDAA 2WPIS 1BJUA 3LH1A 4A6LA 3MHWU 3E0NB 3R3GB 3RXSA 1DITH 5A8ZA 2O8UA 3E0PB 1LPGB 1WU1A 2V35A 4ZROA 4DOQA 2VNTA 1O3BA 3EA8A 3LPRA 4Q80A 4K8YA 4JCNA 4UFEH 3S69A 3TJVA 5F6MA 7ESTE 1FXYA 1O2WA 2BD2A 2VIVA 1P03A 1HCGA 3OYPA 1BRUP 1V2NT 4WY3A 1Y3YA 1ZGVA 2G00A 3RXIA 1T8MA 1FUJA 2G8TA 1P01A 1C5MD 2V3HH 5ESTE 1AY6H 3NXPA 1B5GH 3BG4B 3RXBA 3U8OH 1SHHB 1DVAH 2AIPA 2HPPH 4NZLA 1C5OH 3TJOA 3FP6E 4J1YA 5T6GA 3A84A 2PKSC 2F83A 1QBNA 2XBXA 3M37A 1O36A 5FBIA 3V0XA 3M5MA 1BA8B 1C5UA 1GJ7B 2FX6A 1CSOE 3S7HB 4DW2U 3HATH 2BXTH 4E7RG 1ZHRA 1W8BH 1F7ZA 2ZP0H 1DANH 2ZU1A 2BDGA 3ATLA 1YKTA 2QXIA 2Z3DA 1SLVB 4OS7A 2ZU3A 1JBUH 2BD9A 2WPLS 3L3TA 1Q3XA 2GZ8A 1ZYOA 3D65E 2ZEBA 1S6HA 1MBQA 1O3HA 3D49H 2VVVA 2A5KA 3KIDU 4YESB 1AFEH 5JYIA 1T4VH 4MNWA 3RC6A 2F9UA 3SUEA 1CE5A 1BQYA 4WMEA 1P2JA 3QX5H 3MYWA 1A3EH 1EZUC 2PFEA 4X2XA 3GCOA 1V2QT 1LMWB 1ETRH 4KP0A 4YOIA 5F8ZA 5GCHF 4DCDA 1S81A 1TOCB 1Z8IB 1O5FH 4AFUA 1SGRE 5C1UA 1NC6A 1IQNA 2BXUH 3MMGA 1S6FA 2GZ9A 4RN6A 1YPHC 3PMJA 3S9CA 2ZQ2A 1S0QA 1W7GH 2G51A 5DP9A 3UIRA 1TGTA 3S0NA 1DUAA 1TOMH 1AFQC 2FIRH 4FU9A 3A8CA 3BF6H 1XX9A 1V2LT 3BSQA 2ODQA 2C8WB 1XUIA 5LH8A 2ZHQH 3Q76A 2Y6TA 2FOBA 3ZVDA 1ARBA 3HK3B 1AKSB 1FIWA 2OUAA 2ZGHA 4NWKA 4TPIZ 2G4UA 2OC7A 4AYVB 1IQFA 1GI0A 1O35A 1TLDA 3U1IB 1HAYB 5T6DA 1O2RA 7LPRA 3A8DA 4B76A 2PGBB 4MPVA 1TPAE 1DXPA 2BY6X 2P59A 4BNRA 2ZI2H 5I25A 4GPGA 4FUEA 2GGVB 1PJPA 1MKWH 1FONA 3T2NA 3KQEA 1DWEH 2ZHFH 1BBRH 2XW9A 2B9LA 1GG6C 1MAXA 5GJ4B 3KQBA 3RXOA 4YLQH 1UMAH 2Q1JA 4BTTB 1GI3A 2OQUA 4ZHAA 3MH6A 5FCKA 1FAXA 1F0TA 2UUJB 3RU4E 1BMNH 2OTVA 4AFSA 3GY6A 3ENSB 1T8LA 2ZA5A 3UFAA 4O03A 2BDHA 2G81E 1CU1A 3DD2H 4HI3A 1GBIA 2CJIA 1A7SA 3RMMH 4BXSA 2GDEH 3QN7A 3EA9A 1O2YA 5ESBA 4ABGA 3QGNB 1C5RA 2FI4E 2ZCHP 1O33A 1KXBA 1C5YB 1SR5C 1W0ZU 1YPGH 1O31A 1ZMNA 1ZOMA 5AHGH 2K7XA 3SNBA 2CHAC 1D3PB 1OWIA 1EJAA 1GBEA 3QK1A 1EXFA 1ORFA 2PUQH 2ZDAH 2ZCKP 2QA9E 1ZMJA 2EI6A 2FS8A 3LONA 4IC5A 1AN1E 3B8JA 1QGFA 1O2PA 4JZ1A 5LPEA 4ABAA 3BTEE 4K5ZA 1EOLA 2Z9JA 3RC4A 3SI4H 2Z3CA 1S0RA 2FOGA 1ELDE 1SQAA 4DY7B 3SI3H 4AFQA 1O3MA 2XC4A 5T3HA 1TMUH 1DXWA 4MVNA 1DLKB 1EAIA 1GI6A 1GMCF 2WUCA 2QGRA 3EYDA 1FV9A 4SGAE 4IC6A 2Z94A 1BDAA 3M7UA 3P8NA 4AN7A 1NU7B 2Z3EA 1MUEB 4Y71A 5A0CA 4ABFA 2J94A 1MQ5A 3M5OA 2AMDA 2HWLB 1YGCH 3RXVA 4AX9H 5ABWA 1QL8A 1Q2WA 1S84A 2JKHA 3ZVEA 1GBCA 1HGTH 2OLGA 4Z6AH 3P6ZB 1ANEA 9LPRA 3FZDA 1O2MA 3LGYA 4DT7B 2FTMA 1SPJA 3GDVA 3QTVH 3TGJE 3SN8A 4Y0YE 2P8OB 2BX4A 1V2VT 2BZAA 1HB0B 1Z8GA 4J2YB 1SQOA 2AH4X 1NT1A 2TGPZ 3JZ2B 3GCHB 1GL0E 2DUCA 3LGTA 1TAWA 2FLBH 1CBWC 1UK2A 1G2MA 2ZU4A 1EAUA 4GUXA 3RXRA 1BTHH 2SGEE 2JH5D 3U8RH 2UUYA 2TIOA 5E2OA 4DIIH 2W3KA 5K0HA 1P2KA 2RA3A 1KLTA 3GCNA 3PTBA 4WMDA 4TWYA 3RXAA 2W5EA 1ZPBA 1A4WH 4FXGH 3GY4A 4GHQA 2C8YB 1AVWA 3MNCA 1OP0A 3AVZA 3TPIZ 2TBSA 3ZZAA 3A87A 5EPYA 1SMFE 2F9PA 2VU8E 1IQKA 3UNSA 1DICA 1P3CA 4YTAA 1UTJA 1V2MT 1LQEA 5T6FA 1O3EA 4NIWA 1UK3A 1G9IE 2BY8X 3A80A 3BIUH 2LNCA 3SW2B 4D8NA 3LGIA 3O8BA 1O3DA 3SV8A 1ZSKA 1HUTH 4UONA 2BLQA 3SU6A 2BDYA 1OOKB 2BD5A 3WY8A 5C1YA 1OS8A 3K6YA 1VGCB 1GI4A 3SV2H 1P8VC
chains in the Genus database with same CATH superfamily
3DA9B 1H4WA 2ESTE 2BDIA 1NS3A 5DP6A 3ZYDA 1S5SA 1ZPZA 4IBLH 3UOUA 3F9FA 2HGTH 5EQRA 1O3PB 1RD3B 3GDSA 5JBAS 1G3DA 1FI8A 1L1JA 3F3BA 3GY7A 1WTHD 3VGCC 1DUEA 2P94A 1O5EH 4NCYA 2PR3A 3MOCA 1JXPA 1O3JA 2WPHS 3UOPA 1C2FA 1C5PA 1FJSA 2OINA 3TU7H 2ILNA 1JIMA 3UNQA 2Q6FA 4A5TS 3ATKA 3L33A 4MLFB 4O97A 1EATA 2ANKH 3PV2A 4FU8A 2FZZA 2EI8A 4XBDA 3H7TA 2A7JA 1ZTKA 1D6WA 1C2MA 1L0ZA 1B7XB 1CT2E 4NA7A 3HKIB 1ZTLA 2GMTC 3CENA 3UTUH 1WUNH 3NK8A 3ZZCA 5EW2H 1YPLH 1C1RA 1TALA 4INKA 3VFEA 3E16B 1BMMH 3TK6A 4X1SU 4ESTE 4KTCA 2QIQA 5FPYA 1K1PA 3KQDA 2FS9A 1GPZA 2XCFA 1D9IA 3LOXA 3ATMA 3PMHB 1T8NA 4OS1A 1J15A 1AMHA 2NU0E 1LO6A 4K3JA 4XBCA 1HV7A 1F5KU 4XDEA 4YOJA 4AOQA 2ZFRH 3RLYH 2ZDNA 1TABE 1Y8TA 4MDSA 3WWFA 2NU2E 3K9XB 1H8DH 2FTLE 4JK6A 3I78A 5E2PA 2V3OH 1QY6A 1MU6B 5AF9H 1Z6EA 4B6EA 5A09A 3K2UA 2XTTB 1SLUB 3SNCA 1QB1A 1THRH 1TNGA 4INLA 4GHTA 1EJMA 1FN8A 3M3TA 1AUTC 1A0JA 1GJ6A 1YBWA 2P93A 3U28C 4AORA 2BVXH 7GCHF 1YYY1 1Y3VA 4NFFA 1ANCA 1AVXA 4H42U 1GJCB 1LDTT 2TGTA 3H5CB 1TWXB 3PMBB 3HK6B 5FPSA 1BRAA 1GHBG 5LPRA 1EPTA 1D3QB 3B23B 1KXAA 2GT8A 3RXPA 1FN6A 4Q4LA 2BD7A 4B73A 1O2ZA 1GCTB 3A83A 4FUIA 2OP9A 4I86A 1W14U 2CGAA 2UWOA 3S9AA 4LZ1H 1GI9B 1C5XB 2DE8A 1VJ9U 6CHAC 4ISNA 5JB8S 1EQ9A 5HMAA 3SGQE 2PKAA 4HZHA 3RXFA 4RI0A 4B2CA 4OS2A 5CE1A 1YPJH 1PPCE 1E38B 1BMLA 4DJZB 4FVDA 4MG3A 1P05A 3RXEA 3SBKA 1C2IA 4INHA 2QF5A 3MWIU 4DG4A 3ZVAA 4B2AA 1HAZB 5HM2A 1AGJA 1IHSH 2FI5E 1YY3A 5AVDA 1CHOG 1WYKA 2GT7A 1BRCE 2ALVA 3M5LA 3NUMA 8KME2 3AW1A 3MO6A 1W12U 1QJ6B 1N6XA 1DWDH 2J5UA 2SGQE 1SSXA 2VIDA 3BG4C 1L1GA 1OYTH 2R3YA 2WZQA 1FY1A 1P2MA 2FWWA 2PKAB 1GHAF 3A7ZA 1YWUA 8GCHF 5LPFA 5DO4H 1TE0A 4DGJA 1C5NH 1HXEH 1G37A 1C1SA 3RXTA 1GMDG 4BTIB 4I8JA 2FOMB 1SGYE 1PPFE 3SUGA 3ZYEA 5B6OA 2H5CA 2B7DH 3ZZ9A 4I8GA 2ANWA 1V2ST 3KHVA 1P0SH 3BTHE 4B71A 1P3EA 1BZXE 3HGPA 2BLOA 5EXMA 4Y8XA 4D7FA 2AGGX 2V3MA 1BMFD 4B1TA 3SUDA 1C1NA 1SGEE 3MI4A 5EQQA 2H9EH 4OS6A 3KNXA 1OYQA 2DE9A 3ZZ5A 3MQKC 3E6PH 3EDXB 1TIOA 2WPKS 1ZTJA 2R3UA 1LHEH 3FFGA 1FMGA 1YCPH 2A4QA 3GS9A 1EB2A 4KGAA 4JYVH 2GVFA 4BAOB 5KGOA 2JDID 3GISB 4IW4E 2ZG0H 4ZKRU 2ODYB 2GCTB 2NU3E 1WCZA 2QE7D 1A0LA 4HFPB 1XM1A 4AGKA 1O37A 1A5HA 2AYWA 5EJLA 3FP7E 3M7QA 2A1DB 1INCA 3MU8A 4NA9H 1VITF 4Q7XA 3STJA 3BTQE 1ANBA 1SC8U 2G5VA 3SV9A 1UVPA 2Y7XA 4GCHF 4E05H 2K0QA 1LHFH 1P06A 2ZGJA 3O8RA 3OAAD 5LGOA 2ZTYA 2A7HA 4AZ2B 5DN6D 1EB1H 3MH7A 5IK2D 1QTFA 3FKSD 3SV7A 1K1JA 3DHKH 5L2ZH 5L30H 1XXFA 5GDSH 2QAAA 2W3IA 1TB6H 2VGCB 2WPJS 1NTPA 5F03A 1O2TA 2F3CE 3A8AA 1EP5A 1RTFB 2ZF0H 4H4FA 2R9PA 4JK5A 2AFQB 3STIA 1UHBA 3NPSA 1C1OA 5DPAA 4X6MA 2M2AA 1GHVH 2BOKA 4KTUA 1JIRA 1PPGE 1MBMA 2FOEA 3PWBA 1HYLA 2RA0A 3LJOA 4OS4A 1TQ0B 2VWMA 1UHBB 3I77A 3PLKA 3U8TH 3VB7A 3GCTF 1QJ1B 1NFYA 5C5OA 1ESTA 1HAVB 3H09A 2BQ6B 1LHDH 3OY6U 2BB4A 2Y80A 1ELGA 4R8TB 1NROH 3LIWA 4CH8B 1VGCC 3T27A 1V2UT 5GIBA 1P57B 5C20A 2BOHB 5PTPA 1KXDA 1O2NA 4WXIA 1P02A 4MNYA 4NIVA 1UTOA 3MNSA 1HRTH 3ODFA 4O3TA 4TYDA 2JH0D 2SGDE 4O3UA 3TGKE 1UTQA 3BTWE 1BB0B 5A8XA 2QF0A 1G2LA 3AK5A 3O8DA 1MTUA 2AHME 3DT0H 2HNTE 2A45B 2J95A 3NKKA 3PROA 3TJNA 1GMHF 1PYTC 1A1RA 1GJAB 1AQ7A 1C2KA 3TH3H 3MTYA 1EZXC 2K1QA 1IOEA 4ZAEA 1C9PA 1D3DB 1GHYH 2A0QB 2WINI 1GBBA 1O5AB 1P12E 4A1TA 4BTUB 4GCHG 1DWBH 4K1EA 3R0FA 1KLIH 1FIZA 2CF9H 1TRNA 4ZH8A 2WPMS 2RDLA 3IITA 2VWLA 1DSUA 1GVKB 1YM0A 4UFFH 4NSYA 1HJ9A 1YF4A 6GCHG 2O9QA 1NM6A 1GWAA 3UUZA 2O8MA 4XBBA 1Z1JA 3BTFE 1TPSA 2J92A 4JZDH 1KXEA 3UQOA 3KQCA 1H8ED 1AI8H 4WXVA 3ATWA 2JETC 3U98H 3SNAA 3SGAE 1NESE 4RKJB 2A4RA 3PYHA 2HVXA 4BAKB 1C4V2 1ELFA 4CR5A 2Y82A 1UVSH 5DSFA 3QTOH 4TT3D 4XOJA 4K60A 1V2RT 3RXHA 1GDUA 1CGJE 5HGGA 3ZZDA 4Y79A 3KN2A 1K21H 1NRSH 4IGDA 4Y7AA 1GBLA 3RC5A 2ASUB 2XCNA 1QBOA 3D62A 4Y7BA 1ZPCA 1IAUA 1O3OA 1GBJA 5DP5A 2R2MB 5TCCA 5F53A 1QIXB 1UCYE 3VGCB 2AIQA 2Q6DA 1P2OA 4IMZA 2BLVA 4AG1A 2W6JD 1GJ4H 1Z7KA 4ABEA 4ABBA 5HYOA 1MZAA 1LKBA 4FVBA 1W0KD 1VKYA 5L6NH 3BIVH 5JDUB 3PO1B 1IHTH 3ZVBA 4M7GA 4K1TA 3LU9B 1MKXK 2J2UA 2SNWA 4P00A 6CHAB 2CV3A 3SU4A 5J4SA 5EXNA 4ZMAH 2XBVA 1H9HE 1FDPA 2O8WA 4X6NA 4Y11E 3U69H 1C2DA 2FP7B 1O32A 3P8FA 1RXPA 1RTKA 2FESH 1BUIA 1KLJH 1XUHA 1O30A 3PB1E 1EAXA 3SJ9A 2C8XB 1K1OA 2BVRH 4TY6A 1RGQA 2IJD1 2VIQA 1UTNA 3FZZA 1E79D 3KQ5A 3GYMA 5AFZH 4I8HA 1F2SE 5A0BA 2P95A 4Y10E 4I7YH 1W11U 3OEHD 3SGBE 2J98A 3TNSA 1A3BH 1GBAA 2P3UB 1C5VA 3RU4D 2KZ4A 3DFLA 1CVWH 4FETA 1PPBH 2AS9A 2FX4A 1TGSZ 5FAHA 2RFKC 3V12A 4X8SH 1NFWA 1HAHH 6GCHF 1HAOH 2ZGXH 1O3GA 3ELAH 3U1JB 1UTLM 2I6QA 1NRRH 1JWTA 2GP9B 5JPMH 4NSVA 2CXVA 2SNVA 3N7OA 3GOVB 1CGIE 5A8YA 3FAOA 1E37B 1SGDE 3ZZ7A 1W13U 2G4TA 1FY5A 1DY8A 5GWZA 1GI5A 5TCAA 1EPTC 2ZIQH 1IQMA 2H6MA 3A7YA 3P8OA 2BHGA 2OBOA 3QWCH 1HXFH 5G4BA 3DCLA 4CRFA 3UB0A 1BITA 1SL3A 1P2IA 2TGDA 1GBHA 3E3TA 1FLEE 1MKWK 2GV7A 2IOTA 5DKMA 4ZHLU 3B9FH 5EIYA 1RIWC 2CK3D 5FX5A 5GCHG 4ISIH 3VB6A 4JMYA 2ZU2A 2BZ6H 1C4Y2 1O39A 2XC0A 2XYAA 5DJ7A 2H9HA 2A5AA 1Z8JB 1BOQA 2FMJA 2ZPSA 3PLBA 4A92A 4CBOA 1PQ5A 1TX6A 4RSPA 3TLOA 2GCTC 1RFNA 1BBRE 3A86A 3AAUA 4THNH 2VBCA 1C2JA 1VITH 4CR9A 1ARCA 5A0AE 1V6DA 4U01A 3RM2H 4B75A 1G30B 1O3KA 2TPIZ 3MU4A 4UD9H 3OE7D 1YCPK 1MTNB 1G3EA 4AB9A 4XSKU 1AVGH 5FX6A 3EBNA 1ELTA 4ISOA 3E91A 3LDXH 2XC5A 4TPYA 1J16A 2Z9LA 2PSXA 2YMSC 1UVOA 3C27B 3TH2H 1C5ZB 2G5NA 1HIAA 1T7CA 3NZIA 3A88A 4Y0ZE 2TGAA 3SU5A 4DIHH 1TPOA 2Z9GA 1AE5A 2PLXA 1CGHA 3LJJA 1V2WT 2AGEX 1EZQA 1FNIA 3EE7A 3CS0A 3DSPA 2IPQX 1MKXH 1XVOA 2J4IA 1T32A 1YP9A 2ZGBH 3A7VA 2EY4C 3EA7A 4M9FA 1FY8E 1CT4E 2FODA 1RTLA 4ABIA 1SOTA 2WHXA 4OGYA 1W0YH 2VWOA 3GCTG 5FCRA 1MCTA 1WV7H 1AUJA 4CRBA 3T5FH 1SB1H 2ZZUH 4U32A 3RMOH 4Q7YA 1KSNA 3SV6A 1GDQA 3ZV8A 1EASA 3Q3YA 4ASUD 1L2EA 1OSSA 5C2ZA 4FOUC 1OWJA 1GGDB 1LVMA 4JZFH 3RXUA 1P04A 1YPHE 2D2DA 3I29A 3RXJA 1ZJKA 4DURA 2XWBI 3BV9B 5DP8A 1AB9C 4ZKOU 1HPGA 1LHGH 2OC0A 3MU0A 1NRNH 1TNLA 5T1VA 2UWPA 1MQ6A 2Z6BD 1WAYB 2A2XH 4ZKSU 2FOCA 1CA0C 1SGNE 4WF8A 1PYTD 1OWEA 2XBYA 4HTCH 5DP7A 2QCYA 1DDJA 1EX3A 1F5RA 2QN5T 4AC9A 1AO5A 1EUFA 2GMTB 4ABDA 4SGBE 2JH6D 3KYFA 3CP7A 4CH2B 5GXPA 2PTNA 4E7NA 4AB8A 4MPUA 1IQIA 4WH6A 4AGJA 1E0FD 5C3NA 1OP2A 3IWMA 1YCPM 3OTJE 3V3MA 5C67A 3DSOA 3L6PA 1ETSH 2GZ7A 2FO9A 1C1VH 3PTNA 2OK5A 1W3CA 4H6TA 1SOZA 8GCHG 4I33A 1TYNA 1NRPH 1V2TT 2FDAA 4OGXA 3BTDE 3MFJA 3H7OA 3BEIB 1KDQB 3ODDA 3Q77A 1QB9A 2F91A 1TA2A 1CQQA 2VB0A 1YPEH 2QYIA 1QQ4A 2QV1A 3DUXH 3RXMA 3KEEA 1MD7A 3RMNH 4TSFD 1T31A 4MNXA 1L4ZA 1ABJH 2KCAA 1XUFA 1MABB 2OBQA 4NIXA 4WH8A 3VB5A 1C5LH 1ZSJA 1ZZZA 2FOAA 2OD3B 2XRCA 3SNDA 1C1UH 1OWDA 4KELA 4NZQA 1GHZA 1MU8B 1TGCA 3M61U 1QL9A 2AGIX 1LHCH 2FOFA 1BTUA 5CHAC 1O2SA 2FI3E 2WPDD 2GV6A 1C2LA 1KTTB 1SHYA 2UWLA 2OXSA 2WV4A 2EI7A 1VZQH 8ESTE 4CREA 2P16A 3SJKA 2B8OH 3U9AH 3WWBA 2BLWA 1F5LA 1ZR0A 2J97A 2PP6A 4Y8ZA 2FLRH 3UREA 1B0FA 3ZZ4A 3VG8A 2ALPA 2B5TB 2W7UA 4X1PU 1ZMLA 2CF8H 1ELBA 2AEIH 1EJNA 1C2EA 1PFXC 2GCHF 4VGCC 4LXBH 1GHBF 1O2HA 3QGJA 1GCDA 4HGCA 1YLCA 1BHXF 1FAKH 4ZCNA 2A4GA 4AYYB 4I32A 1A61H 2VIOA 7GCHG 1WBGB 1Z6JH 3GY2A 2ZWLH 3TNTA 1HJAC 2A32A 2A7CA 4A1XA 2WYJA 1C1TA 1GJDB 5L2YH 3PWCA 8LPRA 3VB4A 4Q63A 1L1NA 1GBKA 2HNTC 4NA8A 1O5GH 1QURH 4P02A 3QLPH 1Q31A 4X1NU 1DSTA 4X6OA 1O3NA 2BVSH 3SUFA 2ZDLA 3T25A 4GVUA 3KGPA 2GJGA 1HAVA 1K1IA 1OWHA 1D4PB 1T8OA 1K0HA 2PUXB 4Y6DA 1W0JD 3SU1A 1J14A 2WYGA 1WTGH 2OC1A 2JETB 1EKBB 4F49A 1SGCA 5GPIB 3GY5A 2V0BA 2AERH 2LELA 2R0KA 4F4OC 3TITA 2C3SA 2ZFQH 1MTVA 1ANDA 5ETXA 2VGCC 2G55A 1O38A 4YZUA 1Y5AT 3LC5A 1GI1A 3DFJA 1VR1H 1GI8B 1XKBC 2GCHG 1HAPH 3BEUA 1HIAB 3VB3A 1PPEE 1SLXB 1XUGA 3ATIA 3PMAB 4B6FA 1N8OC 2IJOB 4XFQA 1O2UA 2PWXA 1AIXH 1AZZA 4GLYA 4CHAC 2BMGB 1SFIA 2C4FH 4K1SA 2WV9A 1NZQH 1AHTH 2HLCA 2Y81A 1P2NA 3UWJH 2QXJA 2KAIB 1ELAA 1P11E 3FVFB 1NFUA 1DX5M 4ABHA 2ZPRA 2H2ZA 4TWWA 1GHXH 2VVUA 2H9TH 1EPTB 5EW1H 3RXKA 1UCYH 5SGAE 1AU8A 3SNEA 3UPEA 4OS5A 2BM2A 5C5NA 1DLEA 4HG6A 1OP8A 2F43B 2V6NA 1MAYA 4Q7ZA 1BTWA 3RXLA 3W95A 2AMQA 1UK4A 1SGFG 2KCOA 3UNRA 1BTXA 3URCA 4BOHA 2HRVA 4GAWA 1W10U 1OX1A 1TNJA 1CT0E 3A8BA 4Q2KA 1TMTH 3A89A 4I8LA 2IN2A 1ZSLA 1OHHD 2THFB 2J9NA 1A46H 2ZTZA 2Y5GA 3KYGA 1ZHMA 2HVYB 3BTTE 3OTPA 2JJ2D 4CRCA 1TX7A 3SQHE 5EJZA 3A7XA 1TBRH 2Y7ZA 3LGVA 4BAHB 1QR3E 2I6SA 1K22H 1A0HB 5FHTA 2D8WA 3TK5A 3UR9A 1GBMA 1LCYA 5DK1A 1GJ8B 2F9NA 1TFXA 4A1VA 1TNIA 1GHWH 1H9LB 2LIZA 1N6YA 2BD4A 2ZFFH 1VCQA 1XKAC 2QY0B 2ANYA 1VCWA 2PKSB 1LPZB 1FPCH 1Y3WA 1UTKA 1GL1A 1CO7E 5EGMA 4XD7D 5AFYH 2VJ1A 4X2YA 3SO3A 3T26A 2ZNKH 1NU9A 4LOYH 3JZ1B 1WQVH 5E0HA 2YOLA 2BD8A 1J9CH 1V2KT 4FUHA 1ZRKA 1P10A 1O3LA 1PQ8A 2VIWA 1SG8B 1KXCA 4FUDA 2BX3A 3Q3KA 1XUKA 3TIUA 4KKDA 2GD4B 1G32B 3M3VA 5EXLA 2C90B 1J8AA 1BMAA 1RIWB 1MTSA 1TX8A 3T29A 1JOUB 2CMYA 1O5CB 2RG3A 2B0FA 4NG9H 3ZZBA 3RLWH 1AB9B 4WMFA 1HDTH 1ESBA 2XXLA 1QJ7B 3Q3XA 1ETTH 1GBFA 1FPHH 4FU7A 4X2VA 2QF4A 1QBVH 1T4UH 1C1PA 4Y8YA 2PV9B 2VVCA 1VJAU 3AAVA 1E36B 3MH4A 4YT7H 1QRXA 3HGNA 1MTNC 3DSGA 1WDIA 2VWNA 3LGUA 1QRWA 4WVPE 1QFKH 1MZDA 4NGAH 1TPPA 1V2PT 5EODA 1MMJN 4D76A 1K9OE 3ZV9A 4DVAU 1DFPA 1FY3A 2Z7FE 3SQEE 4ZHMU 1LPKB 4UFGH 3SZNA 1Z1IA 1WSSH 2ZDKA 1AFQB 2ZHWH 1UJ1A 3RM0H 1CHOF 4ABJA 3P95A 2ZFPH 3UAIC 1QHRB 3UY9A 3PLPA 1ZLRA 2WSSD 4B2BA 4O9VA 1H8IH 2XBWA 4B74A 3M5NA 3MNBA 1O0DH 1YC0A 4X8TH 5CMXH 3QZQA 5EPNA 2STAE 3SHAH 2C8ZB 3V13A 2M5TA 1BCUH 4YT6H 3F1SB 1K2I1 3F0OA 2RCEA 2Y5HA 1RRKA 1LVOA 1D6RA 3QUMP 2TRMA 1O5BB 1SBWA 3D23A 1F0UA 1O2OA 1UTPA 3GY8A 5JBCS 3Q00A 2ULLA 1QA0A 1DT2A 1V2JT 5HIYA 3ZVGA 3P92A 2Z9KA 3KCGH 1E1RD 1GJ5H 4UDWH 1QNJA 1TA6A 4U2WA 3E90B 1TBZH 3E1XB 2H1UA 3LGWA 3PV5A 1BJVA 4Z1MD 3HKJB 1MCVA 2EC9H 1HFDA 3M36A 1SGPE 1GJ9B 1HAXB 3PO1C 4RT1A 1BTYA 1THPB 1CA0B 1VITG 1DPOA 3A81A 3QDZB 4AFZA 1SVPA 1EAWA 2GKVE 3VXFH 3ZVCA 1O2GH 1SQTA 2W26A 3UWIA 2VH0A 1FX0B 1Y5BT 4VGCB 2ZDVH 4F55A 4MNVA 1O2QA 1JMOH 1JRSA 2YNAA 1ID5H 2ZPQA 1JRTA 4ISHH 3ESTA 4FUBA 4WJG2 3QZRA 4Z0KA 1DE7H 1FZZA 3FOAA 1A5GH 2QXGA 4K2YA 3SU0A 1GBTA 2A31A 5A2MH 3E8LA 3PM3A 1OWKA 2ZHEH 1P2QA 3TK9A 2ZCLP 2P3FH 2NU1E 5E0JA 1SGFA 4TY7A 1B0EA 1G3BA 4YLUA 4ISLA 1IQHA 3EGKH 2ZKSA 5I46H 1X7AC 2HNTF 3LT3A 2EEKA 4D9RA 3GY3A 3NRLA 5C0UA 4RT0A 3RXCA 1NY22 1QCPA 3ITIA 4FUCA 1O5DH 4X1QU 3ZVFA 2Z9IA 3PRBA 1WQSA 5C0TA 4AG2A 4E06H 3S7KB 4ZUHA 3NWUA 4X2WA 4NWLA 2ZHDA 1HAGE 3G01A 1UCYK 4ZXYH 2GDDA 4YOGA 5E8EH 3UQVA 3MU1A 4KTSA 1TGNA 4BXWA 1BTPA 3SJIA 3K6ZA 5JBBS 5C1XA 1SGTA 2BD3A 2OC8A 4DT4A 1E35B 1UO6A 4H6SB 3EAJA 3EQ0H 1FY4A 2KAIA 2WV5A 1C5WB 4X8VH 1UVTH 5JB9S 2SGPE 2QXHA 1J17T 1A2CH 3MH5A 2YMSD 1GGDC 3TJUA 2GTBA 4WWYA 1V2OT 1KIGH 3RDZA 1AZ8A 1RJXB 1IQLA 2ZO3H 2K8IA 1SLWB 3SORA 3GCHC 1U6QA 2XWAA 2YNBA 4BAQB 1SGIB 1GI2A 2ANMH 1TRMA 2FXRA 1P9UA 3EE0B 3P17H 1PQAA 3SOSA 3N7DA 1BIOA 1E34B 3VXEH 1WOFA 1IQGA 5HM9A 1AE8H 5BRRE 4X8UH 4X0WU 1RS0A 4FUFA 3SJOA 1EP6A 2ZFSA 1TNKA 5DGJA 4I31A 1C5TA 2ZQ1A 2KM0A 3K65B 1QQUA 3TGIE 1HBTH 1COWD 1N1LA 3SHCH 5HKKD 1KDQA 1GVLA 1NRQH 3GDUA 3CNRA 1TGBA 3SJ8A 2A2QH 1Y3UA 4QT8C 3PV4A 4CRDA 1LQDB 1S85A 3AASA 3C1KA 5HXFA 1OPHB 1O34A 5F8TA 3VEQB 1O2VA 1TNHA 2OQ5A 3CS7A 1C1MA 1TMBH 2SGFE 4JZIA 4UEHH 2C93B 1LVYA 1PPHE 2F9OA 4ACAA 4IN1A 1Z71A 1AKSA 5J4QA 1HAIH 1Y59T 3A7TA 1EZSC 3BEFB 2VIPA 1N8OB 3MNXA 1GHAG 1KXFA 3MU5A 4CHAB 5CDFE 5GNDA 1GMCG 1QA7A 2FPZA 1GMDF 3LH3A 1K1MA 3ZZ8A 3M7TA 1O3CA 2BDBA 2PTCE 3RU4T 1C5SA 3OX7U 1XMNB 2FEQH 2PSYA 2LP6A 3A85A 1WXRA 4ZKNU 2ODPA 4X6PA 2O8LA 1TRYA 2IPHA 2L74A 2XNIA 1GG6B 2F4LA 3VPKA 4MPXA 2J38A 3TH4H 4UE7H 1BHXB 3RUOA 1P09A 5CHAB 2HPQH 4CRAA 1O2LA 4D7GA 1KYNA 1HJ8A 1BBRK 3KF2A 2VINA 3IG6B 3OU0A 2XNDD 1TONA 4BANB 3P70B 4MPWA 3M35A 3T62A 4JYUH 4ZXXH 2W7SA 1EOJA 2EA3A 2HOBA 1F0RA 2D26C 1ABIH 3AW0A 1A5IA 1DS2E 1GI7B 2BDCA 2A5IA 3MO9A 4K69A 1FQ3A 1NPMA 3ZZ3A 3MO3A 5EOKA 1Y5UT 4IN2A 1QL7A 3BTGE 1QB6A 2STBE 2QC2A 1HNEE 1LTOA 1NO9H 3S9BA 3BTKE 5KEDA 1LKAA 2L6OA 2WUBA 5E0GA 4LZ4B 3URDA 3BN9A 2FOHA 3RXDA 5JBTA 1S6LA 2PHBA 3W1EA 1G36A 3QO6A 1QRZA 1HJAB 1ZHPA 5F8XA 1H1BA 2NU4E 1C5QA 1GJBB 2QF3A 4FUJA 1TQ7B 5EG4A 1E1QD 4IMQA 2VH6A 4CBNA 4BAMB 5CHBA 3FN8A 2BQ7B 3LKWA 3RXGA 1O3FA 1C1QA 1O2JA 1K28D 5FXLA 2P3TB 1M9UA 2FYRA 1KTSB 1Z8RA 5EQSA 2O8TA 1YLDA 3F2HA 1C1WH 1MH0A 5TJXA 3FP8E 1PPZA 1SQRA 1PQ7A 3A82A 5IYTA 2EQNA 2KFWA 4UFDH 5DP4A 2UUFB 1AWHB 1XXDA 1ZRBA 6ESTA 1S83A 3F6UH 1QZ8A 1O3AA 3FANA 2R0LA 2BY9X 9ESTA 1ELCA 1W7XH 3W94A 1IQJA 2CN0H 2KCPA 1L4DA 1DM4B 1DY9A 1G3CA 1O2KA 3TVJB 1CHGA 1C2HA 1SGQE 4NIYA 1ELVA 3BG8A 4PROA 4CRGA 2R2WU 3NCLA 2SFAA 1KY9A 4GSOA 1MTWA 4IS5A 2W6ID 2F9BH 2JJ1D 1ESAA 1LVBA 5BPEA 1MD8A 1C2GA 2ZECA 1O3IA 1F92A 3LC3A 1K1LA 2ZC9H 2ZGCA 2BY5X 5FPTA 3GICB 3N99A 4JYTA 2BQWB 1XUJA 3OY5U 3SU3A 3OFND 2CHAB 3A7WA 1C9TA 1F0SA 2JIZD 1YLNA 3RMLH 4NFEA 2F9VA 1ZGIA 3RXQA 2AMPA 4R0IA 3T28A 5IDKA 4LK4A 1SI5H 1DWCH 2A4OA 2ZU5A 1V3XA 1UTMA 1NFXA 3SZEA 4K8BA 1GMHG 3GYLB 4RKOB 4YM9A 4YXWD 1P9SA 2GX4A 3BTME 2LPRA 3HPTB 3OSYA 2ZTXA 1OXGA 1GVZA 2NWNA 4MQAA 2FM2A 1UVUH 2J98B 4JZEH 1HLTH 1VCPA 1NN6A 2Q6GA 1DOJA 1GBDA 3SU2A 1BTZA 4A7IB 6LPRA 3F68H 1AWFH 3M3SA 4I8KA 1ACBE 4U30A 3O8CA 2D1JA 1K1NA 2PW8H 3RP2A 1C4U2 1XVMA 1Y3XA 3KL6A 1YPKH 2OCVB 2BYAX 1W2KH 1OKXA 3F9HA 1S82A 4ASHA 4X1RU 1H9IE 2ZFTA 1CA8B 4XRNA 1YPMH 1IQEA 5H4IB 2ZDMA 1SFQB 5DG6A 3F2GA 2UUKB 5FBEA 3F9EA 4Y76A 3UR6A 1D3TB 1TBQH 2BTCE 5DP3A 1ELEE 2G52A 4D9QA 1BT7A 7KMEH 2P8OC 2FYQA 2SGAA 4FUGA 5EU8A 4XE4A 3ZZ6A 1GCTC 3P8GA 1GDNA 2PGQB 1ZJDA 4MTBA 2Y5FA 5K7RA 4YO9A 1O2XA 2H5DA 2BY7X 1AD8H 1CBWB 1EFRD 3F9GA 1THSH 3V7TA 1O2IA 1BRBE 2J34A 2HALA 3N7EA 2BDAA 2WPIS 1KMHB 1BJUA 3LH1A 4ACBA 4A6LA 3MHWU 3E0NB 3R3GB 3RXSA 1DITH 5A8ZA 2O8UA 3E0PB 1LPGB 1WU1A 2V35A 4ZROA 4DOQA 2VNTA 5EJ1A 3ZIAD 1O3BA 3EA8A 3LPRA 3F2FA 4Q80A 4K8YA 4JCNA 4UFEH 3S69A 3TJVA 5F6MA 7ESTE 1FXYA 1O2WA 2BD2A 2VIVA 1P03A 1HCGA 3OYPA 1BRUP 1V2NT 4WY3A 1Y3YA 1ZGVA 2G00A 3RXIA 1T8MA 1FUJA 2G8TA 1P01A 1C5MD 2V3HH 5ESTE 3PRDA 1AY6H 3NXPA 1B5GH 3BG4B 3RXBA 3FO8D 2HLDD 3U8OH 1SHHB 1DVAH 2AIPA 2HPPH 4NZLA 1C5OH 3TJOA 3FP6E 4J1YA 5T6GA 3A84A 2PKSC 2F83A 1QBNA 2XBXA 3M37A 1O36A 5FBIA 3V0XA 3M5MA 1BA8B 1C5UA 1GJ7B 2FX6A 3WW7A 1CSOE 3S7HB 4DW2U 3HATH 2BXTH 4E7RG 1ZHRA 1W8BH 1F7ZA 2ZP0H 1DANH 2ZU1A 2BDGA 3ATLA 1YKTA 2QXIA 2Z3DA 1SLVB 4OS7A 2ZU3A 1JBUH 1NBMD 2BD9A 2WPLS 3L3TA 1Q3XA 2GZ8A 1ZYOA 3D65E 2ZEBA 1S6HA 1MBQA 1O3HA 1UW7A 3D49H 2VVVA 2A5KA 3KIDU 4YESB 1AFEH 5JYIA 1T4VH 4MNWA 3RC6A 2F9UA 3SUEA 1CE5A 1BQYA 4WMEA 1P2JA 3QX5H 3MYWA 1A3EH 1EZUC 2PFEA 4X2XA 3GCOA 1V2QT 1LMWB 1ETRH 4KP0A 1SKYE 4YOIA 5F8ZA 5GCHF 2XOKD 3F0PA 4DCDA 1S81A 1TOCB 1Z8IB 1O5FH 4AFUA 1SGRE 5C1UA 1NC6A 1IQNA 2BXUH 3MMGA 1S6FA 2GZ9A 4RN6A 1YPHC 3PMJA 3S9CA 2ZQ2A 1S0QA 1W7GH 2G51A 5DP9A 3UIRA 1TGTA 3S0NA 1DUAA 1TOMH 1AFQC 2FIRH 4FU9A 3A8CA 3BF6H 1XX9A 1V2LT 3BSQA 2ODQA 2C8WB 1XUIA 5LH8A 2ZHQH 3Q76A 2Y6TA 2FOBA 3ZVDA 1ARBA 3HK3B 1AKSB 1FIWA 2OUAA 2ZGHA 4NWKA 4TPIZ 2G4UA 2KR7A 2OC7A 4AYVB 1IQFA 1GI0A 1O35A 1TLDA 3U1IB 1HAYB 5T6DA 1O2RA 7LPRA 3A8DA 4B76A 2PGBB 4MPVA 1TPAE 1DXPA 2BY6X 2P59A 4BNRA 2ZI2H 5I25A 4GPGA 4FUEA 2GGVB 1PJPA 5C17A 1MKWH 1FONA 3T2NA 3KQEA 1DWEH 2ZHFH 1BBRH 2KX4A 2XW9A 5FL7D 2B9LA 1GG6C 1MAXA 5GJ4B 3KQBA 3RXOA 4YLQH 1UMAH 2Q1JA 4BTTB 1GI3A 2OQUA 4ZHAA 3MH6A 5FCKA 1FAXA 1F0TA 2UUJB 3RU4E 5C94A 1BMNH 2OTVA 4AFSA 3GY6A 3ENSB 2KCYA 1T8LA 2ZA5A 3UFAA 4O03A 2BDHA 2G81E 1CU1A 3DD2H 4HI3A 1GBIA 2CJIA 1A7SA 3RMMH 4BXSA 2GDEH 3QN7A 3EA9A 2V7QD 1O2YA 5ESBA 4ABGA 3QGNB 1C5RA 2FI4E 2ZCHP 1O33A 1KXBA 1C5YB 1SR5C 1W0ZU 1YPGH 1O31A 1ZMNA 1ZOMA 5AHGH 2K7XA 3SNBA 2CHAC 4F48B 1D3PB 1OWIA 1EJAA 1GBEA 3QK1A 1EXFA 1ORFA 2PUQH 2ZDAH 2ZCKP 2QA9E 1ZMJA 2EI6A 3OEED 2FS8A 3LONA 4IC5A 1AN1E 3B8JA 1QGFA 1O2PA 4JZ1A 5LPEA 4ABAA 3BTEE 1H8HD 4K5ZA 1EOLA 2Z9JA 3RC4A 3SI4H 2Z3CA 1S0RA 2FOGA 1ELDE 1SQAA 4DY7B 3SI3H 4AFQA 1O3MA 2XC4A 5T3HA 1TMUH 1DXWA 4MVNA 1DLKB 1EAIA 1GI6A 1GMCF 2RDEA 2WUCA 2QGRA 3EYDA 1FV9A 4SGAE 4IC6A 2Z94A 1BDAA 3M7UA 3P8NA 4AN7A 1NU7B 2Z3EA 1MUEB 4Y71A 5A0CA 4ABFA 2J94A 1MQ5A 3M5OA 2AMDA 2HWLB 1YGCH 3RXVA 4AX9H 5ABWA 1NBME 1QL8A 1Q2WA 1S84A 2JKHA 3ZVEA 5B6LA 1GBCA 1HGTH 2OLGA 4Z6AH 3P6ZB 1ANEA 9LPRA 3SYJA 3FZDA 1O2MA 3LGYA 4DT7B 2FTMA 5KECA 1SPJA 3GDVA 3QTVH 3TGJE 3SN8A 4Y0YE 2P8OB 2BX4A 1V2VT 2BZAA 1HB0B 1Z8GA 5HIZA 4J2YB 1SQOA 2AH4X 1NT1A 2TGPZ 3JZ2B 3GCHB 1GL0E 2DUCA 3LGTA 1TAWA 2FLBH 1CBWC 1UK2A 1G2MA 2ZU4A 1EAUA 4GUXA 3RXRA 1BTHH 2SGEE 2JH5D 3U8RH 2UUYA 2TIOA 5E2OA 4DIIH 2W3KA 5K0HA 1P2KA 2RA3A 4OM9A 1KLTA 3GCNA 3PTBA 4WMDA 4TWYA 3RXAA 2W5EA 1ZPBA 1A4WH 4FXGH 3GY4A 4GHQA 2C8YB 1AVWA 3MNCA 1OP0A 3AVZA 3TPIZ 2TBSA 3ZZAA 3A87A 5EPYA 2YMSB 1SMFE 2F9PA 2VU8E 1IQKA 3UNSA 1DICA 1P3CA 4YTAA 1UTJA 1V2MT 1LQEA 5T6FA 1O3EA 4NIWA 1UK3A 1G9IE 2BY8X 3A80A 3BIUH 2LNCA 3SW2B 4D8NA 3LGIA 3O8BA 1O3DA 3SV8A 1ZSKA 1HUTH 4UONA 2BLQA 3SU6A 2BDYA 1OOKB 2BD5A 3WY8A 5C1YA 1OS8A 3K6YA 1VGCB 1GI4A 3SV2H 1P8VC
chains in the Genus database with same CATH topology
3DA9B 1H4WA 2ESTE 2BDIA 1NS3A 5DP6A 3ZYDA 1S5SA 1ZPZA 4IBLH 3UOUA 3F9FA 2HGTH 5EQRA 1O3PB 1RD3B 3GDSA 5JBAS 1G3DA 1FI8A 1L1JA 3GY7A 1WTHD 3VGCC 1DUEA 2P94A 1O5EH 4NCYA 2PR3A 3MOCA 1JXPA 1O3JA 2WPHS 3UOPA 1C2FA 1C5PA 1FJSA 2OINA 3TU7H 2ILNA 1JIMA 3UNQA 2Q6FA 4A5TS 3ATKA 3L33A 4MLFB 4O97A 1EATA 2ANKH 4FU8A 2FZZA 2EI8A 4XBDA 3H7TA 2A7JA 1ZTKA 1D6WA 1C2MA 1L0ZA 1B7XB 1CT2E 4NA7A 3HKIB 1ZTLA 2GMTC 3CENA 3UTUH 1WUNH 3NK8A 3ZZCA 5EW2H 1YPLH 1C1RA 1TALA 4INKA 3VFEA 3E16B 1BMMH 3TK6A 4X1SU 4ESTE 4KTCA 2QIQA 5FPYA 1K1PA 3KQDA 2FS9A 1GPZA 2XCFA 1D9IA 3LOXA 3ATMA 3PMHB 1T8NA 4OS1A 1J15A 1AMHA 2NU0E 1LO6A 4K3JA 4XBCA 1HV7A 1F5KU 4XDEA 4YOJA 4AOQA 2ZFRH 3RLYH 2ZDNA 1TABE 1Y8TA 4MDSA 2NU2E 3K9XB 1H8DH 2FTLE 4JK6A 3I78A 5E2PA 2V3OH 1QY6A 1MU6B 5AF9H 1Z6EA 5A09A 3K2UA 2XTTB 1SLUB 3SNCA 1QB1A 1THRH 1TNGA 4INLA 4GHTA 1EJMA 1FN8A 3M3TA 1AUTC 1A0JA 1GJ6A 1YBWA 2P93A 4AORA 2BVXH 7GCHF 1YYY1 1Y3VA 4NFFA 1ANCA 1AVXA 4H42U 1GJCB 1LDTT 2TGTA 3H5CB 1TWXB 3PMBB 3HK6B 5FPSA 1BRAA 1GHBG 5LPRA 1EPTA 1D3QB 3B23B 1KXAA 2GT8A 3RXPA 1FN6A 2BD7A 4B73A 1O2ZA 1GCTB 3A83A 4FUIA 2OP9A 1W14U 2CGAA 2UWOA 3S9AA 4LZ1H 1GI9B 1C5XB 2DE8A 1VJ9U 6CHAC 4ISNA 5JB8S 1EQ9A 5HMAA 3SGQE 2PKAA 4HZHA 3RXFA 4B2CA 4OS2A 5CE1A 1YPJH 1PPCE 1E38B 1BMLA 4DJZB 4FVDA 4MG3A 1P05A 3RXEA 3SBKA 1C2IA 4INHA 4DG4A 3MWIU 3ZVAA 4B2AA 1HAZB 5HM2A 1AGJA 1IHSH 2FI5E 5AVDA 1CHOG 1WYKA 2GT7A 1BRCE 2ALVA 3M5LA 3NUMA 8KME2 3AW1A 3MO6A 1W12U 1QJ6B 1N6XA 1DWDH 2SGQE 1SSXA 2VIDA 3BG4C 1L1GA 1OYTH 2R3YA 1FY1A 1P2MA 2FWWA 2PKAB 1GHAF 3A7ZA 8GCHF 5LPFA 5DO4H 1TE0A 4DGJA 1C5NH 1HXEH 1G37A 1C1SA 3RXTA 1GMDG 4BTIB 4I8JA 2FOMB 1SGYE 1PPFE 3SUGA 3ZYEA 5B6OA 2H5CA 2B7DH 3ZZ9A 4I8GA 2ANWA 1V2ST 3KHVA 1P0SH 3BTHE 4B71A 1P3EA 1BZXE 3HGPA 2BLOA 5EXMA 4Y8XA 4D7FA 2AGGX 4B1TA 3SUDA 1C1NA 1SGEE 3MI4A 5EQQA 2H9EH 4OS6A 3KNXA 1OYQA 2DE9A 3ZZ5A 3E6PH 3EDXB 1TIOA 2WPKS 1ZTJA 2R3UA 1LHEH 3FFGA 1FMGA 1YCPH 2A4QA 1EB2A 4KGAA 4JYVH 2GVFA 4BAOB 3GISB 4IW4E 2ZG0H 4ZKRU 2ODYB 2GCTB 2NU3E 1WCZA 1A0LA 4HFPB 1XM1A 4AGKA 1O37A 1A5HA 2AYWA 3FP7E 3M7QA 2A1DB 1INCA 3MU8A 4NA9H 1VITF 4Q7XA 3STJA 3BTQE 1ANBA 1SC8U 2G5VA 3SV9A 1UVPA 2Y7XA 4GCHF 4E05H 1LHFH 1P06A 2ZGJA 3O8RA 5LGOA 2ZTYA 2A7HA 4AZ2B 1EB1H 3MH7A 1QTFA 3SV7A 1K1JA 3DHKH 5L2ZH 5L30H 1XXFA 5GDSH 2QAAA 2W3IA 1TB6H 2VGCB 2WPJS 1NTPA 5F03A 1O2TA 2F3CE 3A8AA 1EP5A 1RTFB 2ZF0H 4H4FA 2R9PA 4JK5A 2AFQB 3STIA 1UHBA 3NPSA 1C1OA 5DPAA 4X6MA 1GHVH 2BOKA 4KTUA 1JIRA 1PPGE 1MBMA 2FOEA 3PWBA 1HYLA 2RA0A 3LJOA 4OS4A 1TQ0B 2VWMA 1UHBB 3I77A 3PLKA 3U8TH 3VB7A 3GCTF 1QJ1B 1NFYA 5C5OA 1ESTA 1HAVB 3OY6U 2BQ6B 1LHDH 2BB4A 2Y80A 1ELGA 4R8TB 1NROH 3LIWA 4CH8B 1VGCC 3T27A 1V2UT 5GIBA 1P57B 5C20A 2BOHB 5PTPA 1KXDA 1O2NA 4WXIA 1P02A 4MNYA 4NIVA 1UTOA 3MNSA 1HRTH 3ODFA 4O3TA 4TYDA 2JH0D 2SGDE 4O3UA 3TGKE 1UTQA 3BTWE 1BB0B 5A8XA 2QF0A 1G2LA 3O8DA 1MTUA 3DT0H 2HNTE 2A45B 2J95A 3NKKA 3PROA 3TJNA 1GMHF 1PYTC 1A1RA 1GJAB 1AQ7A 1C2KA 3TH3H 3MTYA 1EZXC 2K1QA 1IOEA 4ZAEA 1C9PA 1D3DB 1GHYH 2A0QB 2WINI 1GBBA 1O5AB 1P12E 4A1TA 4BTUB 4GCHG 1DWBH 4K1EA 3R0FA 1KLIH 1FIZA 2CF9H 1TRNA 4ZH8A 2WPMS 2RDLA 3IITA 2VWLA 1DSUA 1GVKB 1YM0A 4UFFH 4NSYA 1HJ9A 1YF4A 6GCHG 2O9QA 1NM6A 1GWAA 3UUZA 2O8MA 4XBBA 1Z1JA 3BTFE 1TPSA 2J92A 4JZDH 1KXEA 3UQOA 3KQCA 1AI8H 4WXVA 3ATWA 2JETC 3U98H 3SNAA 3SGAE 1NESE 4RKJB 2A4RA 3PYHA 2HVXA 4BAKB 1C4V2 1ELFA 4CR5A 2Y82A 1UVSH 3QTOH 4XOJA 4K60A 1V2RT 3RXHA 1GDUA 1CGJE 5HGGA 3ZZDA 4Y79A 3KN2A 1K21H 1NRSH 4IGDA 4Y7AA 1GBLA 3RC5A 2ASUB 2XCNA 1QBOA 3D62A 4Y7BA 1ZPCA 1IAUA 1O3OA 1GBJA 5DP5A 2R2MB 5TCCA 1QIXB 1UCYE 3VGCB 2AIQA 2Q6DA 1P2OA 4IMZA 2BLVA 4AG1A 1GJ4H 1Z7KA 4ABEA 4ABBA 5HYOA 1MZAA 1LKBA 4FVBA 5L6NH 3BIVH 5JDUB 3PO1B 1IHTH 3ZVBA 4M7GA 4K1TA 3LU9B 1MKXK 2J2UA 2SNWA 6CHAB 2CV3A 3SU4A 5J4SA 5EXNA 4ZMAH 2XBVA 1H9HE 1FDPA 2O8WA 4X6NA 4Y11E 3U69H 1C2DA 2FP7B 1O32A 3P8FA 1RXPA 1RTKA 2FESH 1BUIA 1KLJH 1XUHA 1O30A 3PB1E 1EAXA 3SJ9A 2C8XB 1K1OA 2BVRH 4TY6A 1RGQA 2VIQA 1UTNA 3FZZA 3GYMA 5AFZH 4I8HA 1F2SE 5A0BA 2P95A 4Y10E 4I7YH 1W11U 3SGBE 3TNSA 1A3BH 1GBAA 2P3UB 1C5VA 3RU4D 3DFLA 1CVWH 1PPBH 2AS9A 2FX4A 1TGSZ 5FAHA 3V12A 4X8SH 1NFWA 1HAHH 6GCHF 1HAOH 2ZGXH 1O3GA 3ELAH 3U1JB 1UTLM 2I6QA 1NRRH 1JWTA 2GP9B 5JPMH 4NSVA 2CXVA 2SNVA 3N7OA 3GOVB 1CGIE 5A8YA 3FAOA 1E37B 1SGDE 3ZZ7A 1W13U 2G4TA 1FY5A 1DY8A 5GWZA 1GI5A 5TCAA 1EPTC 2ZIQH 1IQMA 2H6MA 3A7YA 3P8OA 2BHGA 2OBOA 3QWCH 1HXFH 5G4BA 4CRFA 1BITA 1SL3A 1P2IA 2TGDA 1GBHA 3E3TA 1FLEE 1MKWK 2GV7A 2IOTA 5DKMA 4ZHLU 3B9FH 1RIWC 5FX5A 5GCHG 4ISIH 3VB6A 4JMYA 2ZU2A 2BZ6H 1C4Y2 1O39A 2XC0A 2XYAA 5DJ7A 2H9HA 2A5AA 1Z8JB 1BOQA 2FMJA 2ZPSA 3PLBA 4A92A 4CBOA 1PQ5A 1TX6A 4RSPA 3TLOA 2GCTC 1RFNA 1BBRE 3A86A 3AAUA 4THNH 1C2JA 1VITH 4CR9A 1ARCA 5A0AE 1V6DA 4U01A 3RM2H 4B75A 1G30B 1O3KA 2TPIZ 3MU4A 4UD9H 1YCPK 1MTNB 1G3EA 4AB9A 4XSKU 1AVGH 5FX6A 3EBNA 1ELTA 4ISOA 3E91A 3LDXH 2XC5A 4TPYA 1J16A 2Z9LA 2PSXA 1UVOA 3C27B 3TH2H 1C5ZB 2G5NA 1HIAA 1T7CA 3NZIA 3A88A 4Y0ZE 2TGAA 3SU5A 4DIHH 1TPOA 2Z9GA 1AE5A 2PLXA 1CGHA 3LJJA 1V2WT 2AGEX 1EZQA 1FNIA 3CS0A 1MKXH 1XVOA 2J4IA 1T32A 1YP9A 2ZGBH 3A7VA 3EA7A 1FY8E 1CT4E 2FODA 1RTLA 4ABIA 1SOTA 4OGYA 1W0YH 2VWOA 3GCTG 5FCRA 1MCTA 1WV7H 1AUJA 4CRBA 3T5FH 1SB1H 2ZZUH 4U32A 3RMOH 4Q7YA 1KSNA 3SV6A 1GDQA 3ZV8A 1EASA 3Q3YA 1L2EA 1OSSA 5C2ZA 1OWJA 1GGDB 1LVMA 4JZFH 3RXUA 1P04A 1YPHE 2D2DA 3I29A 3RXJA 1ZJKA 4DURA 2XWBI 3BV9B 5DP8A 1AB9C 4ZKOU 1HPGA 1LHGH 2OC0A 3MU0A 1NRNH 1TNLA 2UWPA 1MQ6A 2Z6BD 1WAYB 2A2XH 4ZKSU 2FOCA 1CA0C 1SGNE 4WF8A 1PYTD 1OWEA 2XBYA 4HTCH 5DP7A 2QCYA 1DDJA 1EX3A 1F5RA 2QN5T 1AO5A 1EUFA 2GMTB 4ABDA 4SGBE 2JH6D 3CP7A 4CH2B 5GXPA 2PTNA 4E7NA 4AB8A 4MPUA 1IQIA 4WH6A 4AGJA 1E0FD 5C3NA 1OP2A 3IWMA 1YCPM 3OTJE 3V3MA 5C67A 3L6PA 1ETSH 2GZ7A 2FO9A 1C1VH 3PTNA 1W3CA 4H6TA 1SOZA 8GCHG 4I33A 1TYNA 1NRPH 1V2TT 2FDAA 4OGXA 3BTDE 3MFJA 3H7OA 3BEIB 1KDQB 3ODDA 3Q77A 1QB9A 2F91A 1TA2A 1CQQA 2VB0A 1YPEH 2QYIA 1QQ4A 2QV1A 3DUXH 3RXMA 3KEEA 1MD7A 3RMNH 1T31A 4MNXA 1L4ZA 1ABJH 1XUFA 2OBQA 4NIXA 4WH8A 3VB5A 1C5LH 1ZSJA 1ZZZA 2FOAA 2OD3B 2XRCA 3SNDA 1C1UH 1OWDA 4KELA 4NZQA 1GHZA 1MU8B 1TGCA 3M61U 1QL9A 2AGIX 1LHCH 2FOFA 1BTUA 5CHAC 1O2SA 2FI3E 2GV6A 1C2LA 1KTTB 1SHYA 2UWLA 2OXSA 2WV4A 2EI7A 1VZQH 8ESTE 4CREA 2P16A 3SJKA 2B8OH 3U9AH 2BLWA 1F5LA 1ZR0A 4Y8ZA 2FLRH 3UREA 1B0FA 3ZZ4A 2ALPA 2B5TB 2W7UA 4X1PU 1ZMLA 2CF8H 1ELBA 2AEIH 1EJNA 1C2EA 1PFXC 2GCHF 4VGCC 4LXBH 1GHBF 1O2HA 3QGJA 1GCDA 4HGCA 1YLCA 1BHXF 1FAKH 2A4GA 4AYYB 4I32A 1A61H 2VIOA 7GCHG 1WBGB 1Z6JH 3GY2A 2ZWLH 3TNTA 1HJAC 2A32A 2A7CA 4A1XA 2WYJA 1C1TA 1GJDB 5L2YH 3PWCA 8LPRA 3VB4A 1L1NA 1GBKA 2HNTC 4NA8A 1O5GH 1QURH 3QLPH 1Q31A 4X1NU 1DSTA 4X6OA 1O3NA 2BVSH 3SUFA 2ZDLA 3T25A 4GVUA 3KGPA 1HAVA 1K1IA 1OWHA 1D4PB 1T8OA 2PUXB 4Y6DA 3SU1A 1J14A 2WYGA 1WTGH 2OC1A 2JETB 1EKBB 4F49A 1SGCA 5GPIB 3GY5A 2V0BA 2AERH 2R0KA 4F4OC 3TITA 2C3SA 2ZFQH 1MTVA 1ANDA 5ETXA 2VGCC 2G55A 1O38A 4YZUA 1Y5AT 3LC5A 1GI1A 3DFJA 1VR1H 1GI8B 1XKBC 2GCHG 1HAPH 3BEUA 1HIAB 3VB3A 1PPEE 1SLXB 1XUGA 3ATIA 3PMAB 1N8OC 2IJOB 4XFQA 1O2UA 2PWXA 1AIXH 1AZZA 4GLYA 4CHAC 2BMGB 1SFIA 2C4FH 4K1SA 1NZQH 1AHTH 2HLCA 2Y81A 1P2NA 3UWJH 2QXJA 2KAIB 1ELAA 1P11E 3FVFB 1NFUA 1DX5M 4ABHA 2ZPRA 2H2ZA 4TWWA 1GHXH 2VVUA 2H9TH 1EPTB 5EW1H 3RXKA 1UCYH 5SGAE 1AU8A 3SNEA 3UPEA 4OS5A 2BM2A 5C5NA 1DLEA 1OP8A 2V6NA 1MAYA 4Q7ZA 1BTWA 3RXLA 3W95A 2AMQA 1UK4A 1SGFG 3UNRA 1BTXA 3URCA 4BOHA 2HRVA 4GAWA 1W10U 1OX1A 1TNJA 1CT0E 3A8BA 4Q2KA 1TMTH 3A89A 4I8LA 2IN2A 1ZSLA 2THFB 2J9NA 1A46H 2ZTZA 2Y5GA 1ZHMA 3BTTE 4CRCA 1TX7A 3SQHE 3A7XA 1TBRH 2Y7ZA 3LGVA 4BAHB 1QR3E 2I6SA 1K22H 1A0HB 5FHTA 2D8WA 3TK5A 3UR9A 1GBMA 1LCYA 5DK1A 1GJ8B 2F9NA 1TFXA 4A1VA 1TNIA 1GHWH 1H9LB 2LIZA 1N6YA 2BD4A 2ZFFH 1VCQA 1XKAC 2QY0B 2ANYA 1VCWA 2PKSB 1LPZB 1FPCH 1Y3WA 1UTKA 1GL1A 1CO7E 5EGMA 5AFYH 2VJ1A 4X2YA 3SO3A 3T26A 2ZNKH 1NU9A 4LOYH 3JZ1B 1WQVH 5E0HA 2YOLA 2BD8A 1J9CH 1V2KT 4FUH