2HOBA

Crystal structure of sars-cov main protease with authentic n and c-termini in complex with a michael acceptor n3
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Production of authentic SARS-CoV M(pro) with enhanced activity: application as a novel tag-cleavage endopeptidase for protein overproduction
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 90
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2hobA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hobA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hobA02
3VPKA 2ZU4A 1GI2A 1O2OA 3G01A 2ZHFH 1Z8RA 2THFB 3BN9A 4YM9A 1K1MA 2P8OB 1W0ZU 3R0FA 4ESTE 3SNBA 1E36B 1O2ZA 2A7CA 1HAHH 1P2MA 1O5CB 2AMDA 4NWKA 2EEKA 5HYOA 1GHZA 1C2IA 4MQAA 4O97A 3ZVEA 4ABDA 1Y59T 1CHGA 3TGJE 2VJ1A 1SQAA 4PROA 1LPZB 1A5IA 2OC1A 2P93A 1ZJDA 4FU9A 1JRSA 1QR3E 1GJBB 2ZGBH 1TBZH 1FV9A 1GJDB 3SBKA 3O8DA 2W3KA 1AWFH 2A7JA 4NIWA 4Y8ZA 1BTUA 2OTVA 1P03A 1O3HA 3P8GA 3TNTA 1O5AB 1FPHH 4X2YA 5J4SA 2A2XH 1AD8H 2H9TH 3LH3A 4HI3A 1OWDA 1AE8H 2VWNA 4AZ2B 2FODA 4D8NA 1LKBA 1C2EA 3RXVA 1GI4A 3JZ2B 1FI8A 4X6PA 1O2PA 5F8ZA 3SJ9A 2H6MA 2SGFE 3GCNA 3LIWA 5AHGH 2ALVA 2BX4A 1GMDF 2WPKS 5A09A 1L1GA 1KLTA 1O3MA 4O03A 3P6ZB 3SNEA 1QGFA 3F9HA 1ZR0A 4ISNA 3CP7A 4BAHB 2A1DB 2ODYB 1Z6JH 1SGCA 3OX7U 4JYTA 1GHXH 3PB1E 4XE4A 3MU4A 1LQDB 1DWBH 3EE0B 1IQIA 2AMQA 1O39A 3QZQA 1DLEA 1CVWH 1O5DH 3PTNA 3F6UH 4X8VH 2XCFA 2OC7A 1MCTA 2PGQB 2FX6A 5GJ4B 5GPIB 3VXEH 1K1PA 3DHKH 4B74A 1UJ1A 1EZUC 1O5GH 4NFEA 1O2JA 2A4RA 1QHRB 3RXAA 4F4OC 3HGPA 6CHAC 1EASA 3RXQA 1P8VC 2H5CA 1IQEA 5DP4A 2XXLA 1VCWA 2UWLA 1BJUA 5I46H 2GDDA 4A1XA 4B1TA 2ZF0H 1PPGE 2GX4A 1TPPA 4WMEA 4E7RG 2HRVA 1J17T 4J2YB 5TCCA 4AFSA 1Y5UT 3GCHC 1O33A 4ZKOU 4BTIB 4Y76A 1TRMA 4ISOA 1BUIA 3MH6A 1KSNA 5C3NA 1GMDG 4K5ZA 3GY4A 1JRTA 4DW2U 1P11E 1HJAB 1WTGH 2QYIA 4I8HA 1WYKA 1O3NA 1JIMA 1EKBB 1NZQH 2ZFTA 1LPKB 1QA0A 1YPHE 4O9VA 2FI5E 3A7WA 5EU8A 3H7TA 1DVAH 2KAIB 2CV3A 3VB7A 1DFPA 5FXLA 1HBTH 3RMMH 1XUFA 1T7CA 4MPWA 3MHWU 3RXHA 2AEIH 1YPJH 1O3PB 1NC6A 3B8JA 3AAUA 1Y5BT 1RXPA 3RXCA 1MKXH 1S6FA 1MKWK 1YCPK 1NS3A 3M5OA 4ABJA 1BOQA 4AGJA 1P05A 4IBLH 3ZZ7A 1NU9A 1SC8U 3DD2H 3Q3YA 3GY5A 2IJOB 4ABFA 3EA8A 3RU4E 3V13A 4RKOB 3TGKE 2QF0A 5E0HA 1H9IE 1W8BH 1AWHB 4JZIA 3M5NA 1ELBA 1ORFA 3A87A 3QK1A 2C8YB 2ZDNA 1GHAG 1A7SA 2OBQA 1AB9C 3RM0H 1TX8A 2GV6A 1GBCA 1MD7A 1CT2E 2FI3E 2VH0A 4NA9H 3SW2B 3ZVAA 1C2HA 1V2RT 1ZPBA 5AFZH 1TWXB 4BAOB 1GJ9B 1O3JA 2VU8E 2SGAA 3UWIA 4AGKA 1LVMA 4ZHLU 4Q7ZA 3SQEE 2W26A 2CHAC 2F9VA 1ANEA 3ENSB 3KQEA 1C2KA 2JKHA 1O3LA 4BAKB 2O8MA 2G52A 1ID5H 3RP2A 4NA8A 3TLOA 3SV9A 1GCTC 1PYTD 4INKA 1BMNH 2SNWA 2D2DA 3B23B 2QXJA 5AFYH 1D3QB 2PUXB 1UK2A 1DY8A 2FTLE 4THNH 1Q2WA 2BDIA 2OQ5A 3STJA 4XDEA 1C5WB 2R9PA 3MNSA 3P17H 2BDGA 1YPMH 2XNIA 1CGJE 1GJ7B 1GBMA 2I6QA 1OP0A 1HCGA 2LNCA 1TGNA 3RDZA 1YGCH 1GI8B 4OS4A 1DXWA 3NUMA 3KIDU 1CA0C 1YLDA 4I8LA 4ZHMU 5C1UA 1BCUH 1BRAA 1XVOA 5LPEA 1QY6A 3QDZB 1HRTH 3E90B 1GHBG 2BZAA 3K9XB 1GHVH 5EPNA 4ZUHA 1G3EA 3A7VA 1IQMA 2BD4A 1CQQA 2B0FA 1V2ST 4I8JA 3U1JB 1RTLA 3RLYH 4RKJB 5E2OA 3P92A 5H4IB 3ZV8A 1V2JT 3PO1B 1MU8B 3FP7E 1F2SE 1O2TA 4KGAA 3K2UA 7LPRA 1G9IE 1EB2A 1K1NA 1XUJA 3GISB 1TABE 4AX9H 1ESBA 5CHAB 3RXPA 2XYAA 1BQYA 2BDYA 4IMZA 3A81A 2ANYA 1O36A 4UONA 2F9NA 1BB0B 2Z7FE 1P02A 3A80A 2VWOA 3DA9B 5A8XA 1P06A 3UUZA 2ZHWH 3TITA 1ANCA 4XBBA 2HPPH 3A7TA 1GDQA 1PPHE 1SGIB 2WPMS 3D49H 2A5KA 1ELAA 1EOLA 1BDAA 2JH5D 1O38A 1LKAA 2GKVE 3W94A 1FLEE 1ANBA 1GJ6A 5FPTA 1C2DA 3TK5A 3SV7A 4DY7B 4TY6A 1JXPA 1IQGA 3A8CA 1P9UA 5FHTA 4Y71A 1BIOA 4MG3A 2A45B 2O8TA 4Y7AA 5DP8A 1Y3WA 3UR9A 1SGRE 4LXBH 2Q6GA 3VXFH 3LONA 1ZRBA 5C2ZA 2FOEA 4FUFA 2R2MB 1O3EA 4UFGH 5GIBA 1O2YA 1OX1A 1GBLA 2VIQA 2GZ8A 2ZNKH 1KXFA 1Y3UA 1P2IA 1LHCH 4VGCB 1GDNA 2BQWB 5PTPA 1TGTA 3S9AA 2QV1A 2V0BA 1GMCF 4GCHF 4DIHH 4U01A 1XX9A 5LH8A 3M3TA 1RIWC 3PMHB 4ABBA 5ABWA 2AYWA 5EW1H 3PTBA 2PKSB 2SGDE 1C5XB 3SQHE 2OP9A 3C27B 1AHTH 1FY4A 4OGYA 1AKSB 2ZFRH 4Z6AH 2BDAA 4NGAH 4Y0ZE 2R0KA 1BRBE 2A5AA 1G30B 3M7TA 4ZROA 4OS2A 5K7RA 2BYAX 4D7FA 4NWLA 1B7XB 2QGRA 2BXUH 1G2MA 5DKMA 1QNJA 2BMGB 1NFWA 2GCTB 5L6NH 2Z3DA 3L6PA 1TRYA 3BIVH 3ODDA 1P3CA 2EI8A 2YOLA 1P01A 2ZU3A 3PLPA 3ZZDA 4I32A 2H2ZA 1PYTC 2PKSC 1GBKA 1RS0A 1GI6A 4D9RA 2CXVA 2H5DA 1ESAA 5C67A 5EODA 3A88A 1GI7B 3SUEA 8LPRA 1GMCG 3KHVA 4GCHG 1XUHA 4AYVB 4AG1A 4B2AA 4UEHH 4ISHH 1GHYH 1AFQB 1AE5A 3FZDA 5HM2A 2GCTC 1HIAA 3ATKA 4E06H 1OYQA 4AG2A 2A31A 2F9OA 2W5EA 1Y3YA 2J4IA 1MH0A 4FUCA 1U6QA 2J92A 3BEFB 3MYWA 3LGVA 6ESTA 1KDQB 2ZGHA 1YF4A 1UK3A 2OD3B 1TOMH 3EA7A 3BTKE 1EXFA 4BNRA 2FLRH 3GYLB 1SHHB 2ZDMA 3GY2A 2VVUA 1TE0A 4X8TH 1GBDA 1LVOA 1AFQC 1O3FA 2WINI 1XXFA 2Y7ZA 3FP6E 1UVPA 4WXVA 1T4UH 2C3SA 1QJ7B 4BANB 4GSOA 4TWWA 3UNRA 1TONA 1C5QA 3NXPA 4K69A 1O0DH 2VIWA 2AIQA 3AW1A 3BSQA 2ZTZA 3UNSA 2QF3A 1YP9A 5IYTA 1DS2E 5AF9H 1C1PA 1NU7B 1THSH 2BDCA 3LPRA 1SGEE 3EA9A 3K6ZA 1GDUA 3ZZ9A 2J94A 4DJZB 2ZG0H 3E1XB 4X2VA 3ZYDA 1Y3XA 4KTUA 4LOYH 2FOHA 1UVUH 1UTLM 1P9SA 1GBIA 4OGXA 2ULLA 1GJ5H 1H9HE 3MO3A 4JCNA 3HKJB 1WQVH 1NRPH 1NT1A 1KY9A 3M5LA 1MMJN 3E91A 3RXBA 1S84A 4HGCA 2XC5A 4U32A 5DP5A 2ZDVH 3RXUA 3Q3XA 5JBBS 1QBOA 1HJ8A 1SPJA 1FY1A 3RUOA 3IG6B 2DUCA 1DDJA 1V2TT 1W11U 3RM2H 3SU6A 1AU8A 3E0PB 1GG6C 2QA9E 4H4FA 3E6PH 1SLXB 1W12U 4HZHA 3RXFA 1UTNA 1CT4E 4WF8A 4KKDA 5GDSH 2V6NA 2ZGCA 1H8IH 4YOJA 1A3BH 3T2NA 5E8EH 1TNLA 1TNJA 2XW9A 3SUDA 2XBWA 1WCZA 1O3BA 2PHBA 5I25A 4X1NU 2G00A 4GAWA 4YLUA 2K1QA 4YT6H 1O32A 2ZHQH 2Y81A 4Q7YA 3IITA 1EZSC 2ZA5A 4CRFA 5EXMA 1TBQH 3TGIE 2GDEH 4TPYA 1SHYA 1P0SH 1F92A 3SNCA 2GD4B 3SORA 5CE1A 8KME2 1Z8GA 1AIXH 3LOXA 1O3OA 1SBWA 3GDSA 1E37B 1G32B 3U8RH 3HK3B 1OYTH 4Q7XA 4B75A 4D7GA 1O3AA 1NRRH 3BTME 2FOGA 4U30A 2BY8X 1BTWA 3ODFA 3LDXH 1QFKH 3K65B 1PPZA 4A5TS 4WXIA 4NIXA 3ATMA 1TGSZ 1P57B 3TJNA 3M7QA 4K60A 1ELVA 1AZZA 1OWHA 3LGUA 1V2NT 1UCYH 1SLUB 1ZMJA 2C93B 2OUAA 3C1KA 2ZGJA 4TWYA 3ZYEA 3SJ8A 3M3SA 4WMFA 3CS7A 1PQ8A 1J9CH 4WH8A 1ZHPA 1ZPCA 2BHGA 3OYPA 3BTTE 1O2NA 5EQRA 2QC2A 3SNAA 4INHA 1HGTH 1NRNH 3S9BA 1NRSH 6LPRA 2FO9A 2Z6BD 3HPTB 1O2WA 4INLA 1LDTT 3E0NB 1N6YA 3VB3A 4AFUA 1FQ3A 2ZEBA 1C2FA 5FBEA 2VIDA 1S83A 3LC3A 4K8YA 2TBSA 2ANKH 3UR6A 4B2BA 5LPRA 3A85A 1C1SA 1QA7A 7GCHG 2WUCA 1QL7A 6GCHF 4KTCA 3UOPA 1O3DA 1BTPA 2ZCKP 5L2ZH 1QJ1B 4TYDA 1N6XA 2BXTH 5HM9A 2VIPA 1K1IA 1QURH 4BTTB 1EB1H 1AQ7A 1IQFA 6CHAB 2R3YA 4MTBA 2Z9KA 2BLVA 3T62A 2FOFA 1T8OA 3RU4D 3MNXA 1D3DB 2DE8A 1HXEH 2WV5A 2B9LA 2XTTB 1V2OT 4JMYA 4X6OA 1F5LA 1C5TA 1G3DA 3GCHB 3BG4B 3RXKA 4ZKRU 1DICA 3M37A 5GXPA 2Y6TA 2GGVB 9LPRA 2BY5X 1SGTA 1GL0E 2FYRA 1TPOA 4K3JA 5F8XA 4FU8A 3P8NA 4MVNA 1C1UH 4CR5A 4DG4A 1AVXA 2OC0A 6GCHG 2ANWA 2BD5A 4XBDA 2WYGA 3PMAB 3URCA 4FUGA 4AB9A 3BG4C 3SU5A 3H5CB 5JPMH 2FEQH 1TPSA 2FP7B 1DXPA 2D1JA 5FPSA 3ZVGA 1TNKA 2ZKSA 4NFFA 1RTKA 7KMEH 1C4Y2 4FVDA 3T5FH 4X1SU 3HK6B 1LCYA 1ARCA 3SUFA 3LC5A 5L30H 1GBBA 3VB6A 5JBCS 2FESH 3A7XA 3F1SB 4I31A 2FI4E 3RMOH 2FTMA 5E0GA 1C1OA 4FU7A 3OSYA 4OS1A 1GVKB 1GMHF 3Q76A 2GZ7A 1O37A 1MAYA 1TLDA 2VB0A 2ZQ1A 1AB9B 1CGHA 4KELA 2G5NA 1GJ8B 3SI3H 1BITA 1QQ4A 3KEEA 1L4ZA 3SNDA 5F6MA 2Q6DA 1GBAA 3RXIA 1FNIA 1KXCA 1T8MA 4HFPB 2CHAB 5K0HA 1TMTH 1DE7H 3GCTF 4GUXA 5A0AE 3O8RA 1OWEA 4MPUA 3SV2H 2P3TB 1HB0B 1SGFA 1ELTA 1MAXA 3V12A 2BLWA 3RXEA 2NU1E 1HAVA 3T27A 1GBJA 1GCTB 2J95A 1IQNA 3OY6U 1SI5H 3L33A 3UWJH 4ZMAH 1WOFA 4FUJA 2F9BH 4MNVA 2RA3A 2HGTH 2GV7A 2Z3EA 3V0XA 3MU0A 1O2GH 2GZ9A 3DUXH 2CF8H 3PLKA 3AAVA 1ZHMA 1ZHRA 1YPHC 4Z0KA 1HV7A 1GMHG 1D6WA 1GI0A 1W10U 1EJNA 4JZDH 1DITH 2ZI2H 1QIXB 2RCEA 1FONA 1O2SA 3MTYA 1MKXK 1CA0B 1LMWB 1BZXE 2AGIX 1RJXB 2VWLA 2TGPZ 1SGDE 1SOTA 4X0WU 3RXTA 1EOJA 2PKAA 2BLOA 3MNCA 3N7OA 2AIPA 4ZHAA 1DY9A 1VCPA 3SZNA 4AN7A 1ZSJA 3GY8A 1BHXF 1TYNA 2ZDLA 5JB8S 3QTVH 2ZDAH 2ZFFH 2XCNA 3LGIA 1NM6A 3E8LA 2WYJA 5EQQA 1MTUA 1V2KT 3U1IB 2SNVA 3BEUA 3UPEA 2SFAA 1BT7A 1Y5AT 1TX6A 2PSYA 2AERH 1SLVB 3QWCH 4CRAA 1ELFA 5ESBA 4A7IB 1N8OC 1O3CA 5JB9S 4YO9A 4ABIA 3SN8A 1HIAB 1BTZA 4DOQA 1LHDH 1NROH 1CGIE 1GJ4H 1VITH 1BBRH 1S5SA 3SO3A 2BDBA 2BVSH 1DSUA 3TIUA 1TNIA 1VJAU 4X8SH 2Z9JA 2NU2E 3F9EA 1SGPE 2FS9A 2A5IA 1QJ6B 1BRCE 4JK6A 3Q77A 4MNWA 1NRQH 3NCLA 2Q6FA 1QBVH 2HVXA 1TB6H 1UCYE 4K1TA 1DM4B 4QT8C 1UHBA 1JMOH 1S0RA 3TJOA 1WAYB 3A8AA 2J38A 1BJVA 1IQKA 3NZIA 2CN0H 1F7ZA 2JETC 1GBHA 1O2KA 3S69A 3D65E 2GT7A 2BVXH 1ABJH 1HAZB 1C5YB 3MNBA 1L4DA 1ZGIA 2BDHA 1B5GH 4X6NA 1RIWB 2BX3A 2Y80A 3GY6A 2Z3CA 1C1TA 1OWJA 2HLCA 3KN2A 3UREA 4X1PU 2LIZA 1O31A 4CREA 1VITF 3EYDA 1YPGH 1TFXA 1DWCH 1KXAA 3VFEA 1Z6EA 1YBWA 4RN6A 1XKAC 1C2JA 1IOEA 1YLCA 3LGWA 3VGCC 4LZ4B 4J1YA 1CT0E 2QXGA 1MZAA 3OU0A 1KXDA 2B8OH 1LHGH 2ZC9H 2W7SA 1ETSH 1FY5A 3R3GB 3TK6A 1AO5A 2Y7XA 5C1XA 2ODQA 2VVVA 1AVWA 2AH4X 1FN8A 4B71A 1V2MT 1ZJKA 1ZSKA 3LT3A 1E0FD 1NFYA 5HGGA 1S81A 4BAMB 1V2QT 2B7DH 3S7KB 1S85A 2UUJB 1ZGVA 2WPJS 3UY9A 1GBFA 1HPGA 2G51A 2M5TA 4DURA 3S0NA 2Z9GA 3PM3A 3MWIU 4WJG2 3M5MA 1VJ9U 2UUKB 3EBNA 3PROA 3FVFB 3ZVFA 5EW2H 3T29A 1O30A 1GBEA 1S6HA 2EI7A 2ZFPH 2HALA 4Q2KA 4OS5A 1RD3B 1THRH 1O2LA 4BOHA 2ZCHP 2BOHB 1AY6H 3BTWE 4X6MA 2ZTXA 3ZVDA 4FVBA 3TVJB 1SGFG 4DCDA 4JZ1A 3QN7A 3RMNH 1UK4A 4D9QA 5CMXH 2FOCA 1PPEE 3KCGH 2FPZA 2PTCE 3I78A 4AFQA 2BVRH 1FAKH 3E16B 3W95A 2FIRH 1A5HA 1LO6A 5FX6A 2ZU2A 4ZAEA 3A7YA 4LZ1H 3SGQE 2FWWA 5EOKA 4Y8XA 3RLWH 3EGKH 4MNXA 2HNTE 4FXGH 3MO6A 3UIRA 1WSSH 2ANMH 4TPIZ 4I7YH 1C1WH 1C5PA 1ELDE 2QAAA 1SB1H 1GCDA 1P04A 2FOBA 1UTMA 1PFXC 2ZWLH 2P59A 1F0TA 1ZTJA 2TGAA 5T6DA 1P2KA 1JIRA 3SI4H 4YT7H 4MDSA 4YZUA 1HAYB 1QRZA 1ZTKA 3ATIA 4SGAE 1MTVA 3MU8A 1GI9B 2TGTA 4CRDA 2NU4E 4IW4E 1G36A 1LHEH 1Z8IB 3I77A 2OQUA 5C20A 1XMNB 1INCA 2IOTA 2OINA 1G3BA 1Z1JA 1HAGE 2ZHDA 4Y11E 3ESTA 1F0UA 2YNBA 2PFEA 1GG6B 2XWAA 1F0RA 1SGQE 2WUBA 5HMAA 1FXYA 3MH7A 2CJIA 1MD8A 1DWDH 2ZDKA 3TH2H 4NSYA 2F9UA 3SHCH 3SUGA 2H1UA 4WWYA 1PQ7A 1E34B 3SU1A 1JOUB 3MI4A 5TCAA 1NFXA 5DJ7A 5F8TA 1KLIH 3SHAH 4YTAA 3SU3A 4NIVA 1AMHA 3LKWA 2NWNA 2YNAA 1SR5C 3DFJA 1C5ZB 3KL6A 4TY7A 2GMTC 1AUJA 3KQCA 1SL3A 2XC4A 3MH5A 3QZRA 1FMGA 1L0ZA 1CA8B 1K1LA 1VR1H 3MO9A 3RXGA 1FUJA 1GI1A 1OOKB 3VB4A 2VGCB 5A2MH 3AVZA 3UTUH 1O3GA 1THPB 3JZ1B 3P95A 5A0BA 1TPAE 3TJUA 1W7XH 2FXRA 4IC5A 1EATA 4MPXA 2BY6X 3STIA 1J14A 4H6SB 4R8TB 1GJCB 3Q3KA 1XKBC 3FP8E 4ZH8A 1A5GH 1LQEA 3U8TH 3GICB 5EXLA 1F0SA 3TH3H 1SGYE 1ZPZA 2ZU5A 1V2UT 2ILNA 3LU9B 1EPTC 1O2QA 2O8LA 1AI8H 2AGGX 4I8GA 4K8BA 1C5SA 4U2WA 3MMGA 1FN6A 4ZXXH 4XOJA 5A0CA 3VB5A 1P2JA 1BTYA 4K2YA 4ZKNU 4B73A 2XWBI 2VGCC 1E35B 3U69H 3CENA 3PMJA 1DSTA 2BD8A 4ISIH 2TGDA 1BBRE 2FM2A 4CH2B 4O3UA 3TJVA 1SSXA 1YC0A 3BTQE 3ELAH 1VGCC 5DPAA 2VIVA 1IHTH 2NU0E 1EZXC 4ISLA 2QXIA 3SV6A 1SFQB 4WVPE 4CRGA 4R0IA 2XRCA 3ZZBA 1Z8JB 3EAJA 5B6OA 5E0JA 4JZFH 2K7XA 1V3XA 3GCOA 3M3VA 1BMMH 5EPYA 2LPRA 3PWCA 3D23A 1V2PT 2AFQB 2TRMA 2I6SA 3LH1A 2A4OA 1CSOE 2ZTYA 2PV9B 3SJKA 1QRXA 3KGPA 3TK9A 1MTNC 1OWIA 1PPFE 2PW8H 3SU2A 4KTSA 1ETRH 1NTPA 2ZIQH 2XBXA 1T4VH 4I8KA 4Y79A 1YPLH 1MQ6A 3CS0A 3TPIZ 5LGOA 1HAXB 1AUTC 1TNHA 4GHTA 2W7UA 4DVAU 2GP9B 1S0QA 1HAVB 1V6DA 2C8XB 3QTOH 1KDQA 1PPCE 3A82A 3ITIA 3KNXA 1ZZZA 1O2HA 1UVSH 5DP3A 2FZZA 5J4QA 3T25A 1CE5A 4GVUA 4NCYA 1QCPA 1CO7E 5DP9A 2P94A 4O3TA 1E38B 1EZQA 2HWLB 1ELEE 1W7GH 1DOJA 1ESTA 1LHFH 1K22H 1V2VT 1GBTA 4KP0A 5IDKA 1ZTLA 1YCPM 4AB8A 3P8FA 1O5EH 4XSKU 1IHSH 4AFZA 2P8OC 1GJAB 3UQVA 1FJSA 1KXBA 3V7TA 1AN1E 1TALA 2SGEE 5DP7A 1O34A 3AASA 1T8NA 1UCYK 2GT8A 1O2XA 4Y6DA 1PQ5A 1SLWB 2PKAB 1FAXA 2EA3A 3GOVB 1EPTA 1F5RA 3EDXB 1A3EH 1GWAA 2JH0D 3ZZ8A 2BLQA 2C8WB 1H9LB 2VIOA 4CH8B 1SVPA 3GY7A 1UO6A 2G55A 3RXRA 3FZZA 3AW0A 2VVCA 1HUTH 1LPGB 5EG4A 5T3HA 2A4GA 1DT2A 3LGYA 2FX4A 4FUHA 1NESE 1QB6A 3A89A 1HAOH 1LVBA 2ZP0H 3LGTA 1G2LA 1HNEE 3HATH 3D62A 1MQ5A 3PYHA 3RC6A 3TNSA 4UDWH 1ZLRA 1YCPH 1MKWH 1XM1A 1O3KA 4HTCH 2Z9IA 5JBTA 1CU1A 1HDTH 4IS5A 3ZZ3A 3SU0A 1GGDB 4M7GA 5FBIA 2ZO3H 1OXGA 1HAPH 3ATLA 3BF6H 1DX5M 3QLPH 3O8BA 4WH6A 1NY22 2RDLA 2UUYA 4X2WA 5FX5A 1AVGH 2A7HA 4OS6A 2V3OH 1UTQA 4E05H 2Z9LA 1QL9A 4NIYA 1UHBB 3MOCA 5T6FA 3P8OA 4B76A 1C1RA 3ZZ5A 3GDVA 3ZZAA 4AOQA 4BAQB 5G4BA 2PUQH 1ZSLA 4F49A 2XBYA 1C9TA 1GGDC 1GHAF 2A2QH 2ODPA 2OC8A 1D9IA 1Q31A 1WV7H 5ETXA 3Q00A 1GHWH 1QQUA 1C2GA 1MUEB 5C5OA 1C4V2 2D26C 1UTKA 8GCHF 5A8ZA 1ANDA 1C5OH 1ZRKA 3PWBA 3PV4A 1O2VA 2NU3E 5C1YA 3S7HB 1C4U2 1BTHH 1A0LA 2ESTE 1B0EA 3T28A 3MU5A 2OCVB 1O35A 2BQ6B 1GL1A 3BG8A 3ZZ6A 1D3PB 1GPZA 2V3HH 5LPFA 2P3FH 3RU4T 3NWUA 5GCHF 1HJAC 1L1NA 2IPHA 1UVOA 1EAUA 1K21H 1QRWA 3UFAA 4ZKSU 3E3TA 2WV4A 4CBNA 2F91A 2P3UB 2PSXA 4NZLA 4I33A 4X2XA 5A8YA 4BTUB 1P2NA 3HKIB 2D8WA 4NG9H 5DG6A 1QB1A 3QGNB 1K2I1 1YPEH 1ZMLA 2H9HA 3QUMP 3F9GA 1G3CA 1DWEH 3ZVBA 2O8UA 4YLQH 4YOIA 4SGBE 1L2EA 1Z7KA 2ZU1A 3QX5H 1T32A 1RRKA 2HNTF 3NPSA 2ZPSA 3RMLH 4A1TA 4JYUH 1WBGB 1AZ8A 1JWTA 1IQHA 1VCQA 1TAWA 2G5VA 1RGQA 1TBRH 1FY3A 1O5FH 2BZ6H 3ZZCA 8GCHG 3BIUH 2P95A 1GHBF 1SQOA 5AVDA 3GCTG 1N8OB 2CF9H 2FYQA 2ZFQH 1TX7A 3LJJA 1C5VA 5EQSA 1FPCH 5GCHG 2RA0A 3RC4A 1Y8TA 2F83A 2BTCE 3SGAE 4XBCA 2OBOA 4RSPA 2W3IA 4H6TA 2BD7A 2STBE 1A4WH 3FFGA 1C5LH 1C1QA 2BD2A 1PQAA 2SGPE 3HGNA 2BB4A 4UFDH 1FIZA 4YOGA 4Y10E 5JDUB 4Q80A 4WMDA 1TA6A 4A6LA 5HXFA 1TIOA 1D3TB 2G4UA 2BM2A 1YKTA 3F9FA 2R2WU 5ESTE 4D76A 1D4PB 5GWZA 4ABEA 1DUEA 1TNGA 4UE7H 2QXHA 1O2UA 1ARBA 2VWMA 5DO4H 3URDA 2QIQA 1S82A 1LTOA 2PTNA 2JETB 3BTHE 3PMBB 1XUGA 1MTWA 1ABIH 2FDAA 4FUEA 5TJXA 1QTFA 1C2MA 3ZZ4A 2QCYA 1LVYA 2G81E 1ACBE 1KIGH 3KQDA 4Y7BA 2P16A 1W13U 2ZZUH 1GI5A 1JBUH 1UVTH 1W2KH 4GLYA 1C1NA 1C2LA 3SU4A 4FUDA 4NZQA 1P09A 1IQLA 4DIIH 5FCRA 2AMPA 1TOCB 1C1MA 2FLBH 2AS9A 3SJOA 4CBOA 2QN5T 2BD9A 1HJ9A 2KAIA 1OKXA 1P3EA 1H4WA 3VGCB 2ZPRA 2Z94A 2VH6A 2C8ZB 3FAOA 4IN1A 2O9QA 2ZECA 3RXOA 1Z1IA 2F9PA 1VZQH 4MNYA 1PPBH 1M9UA 3PO1C 2OLGA 4ASHA 1EP6A 2J2UA 2C4FH 1C1VH 3O8CA 2PWXA 1BBRK 5CHAC 1RTFB 1EUFA 4NSVA 3A84A 2RG3A 1AGJA 4AYYB 3M35A 1ZOMA 1Z71A 5EGMA 2FOAA 3OTJE 4WY3A 3RXMA 4X1QU 5EXNA 1OP2A 1K28D 5FAHA 2TIOA 1W0YH 1KTSB 4FUIA 3ZVCA 4MPVA 4IGDA 2FMJA 1XUIA 2JH6D 1SGNE 4B2CA 1WUNH 1DLKB 1MBQA 4CRBA 2GTBA 4JK5A 3NKKA 2BY7X 3RXJA 2QY0B 1FY8E 4X1RU 1J8AA 1H1BA 2G8TA 1BMLA 1DANH 1HFDA 2STAE 2WPLS 1BTXA 3MH4A 1X7AC 3T26A 3UNQA 1N1LA 2FOMB 4A1VA 1WTHD 5SGAE 2GVFA 3H7OA 1IQJA 3GY3A 2BD3A 2WPIS 4E7NA 3V3MA 1GVLA 1ZYOA 1TQ7B 3RC5A 1VITG 1EAXA 1DUAA 5DK1A 4NA7A 1TRNA 1C5MD 4UFFH 3K6YA 2ALPA 1EQ9A 1O5BB 1V2LT 4JZEH 4OS7A 4VGCC 1NPMA 3PLBA 1YPKH 1K9OE 1C5UA 4GPGA 1QL8A 1UTPA 1XXDA 2G4TA 3A8BA 1A2CH 1T8LA 4BXSA 3UQOA 3EQ0H 1FDPA 1KTTB 3I29A 1D6RA 2CGAA 2F3CE 2EC9H 2UUFB 4CHAB 2PLXA 3SJIA 4ABHA 1SQTA 1A0HB 1P10A 2EI6A 5DGJA 1BMAA 1ELCA 4ZXYH 3KQBA 1HXFH 1OSSA 1EP5A 1TGCA 3SGBE 3U9AH 2CMYA 3F68H 1YYY1 2TPIZ 2HPQH 5F03A 1PJPA 1SMFE 3BTDE 1MZDA 3QO6A 1H8DH 4XFQA 5BPEA 1V2WT 2BY9X 3SOSA 4K1SA 2PGBB 3RXSA 1ZMNA 4DT7B 4CHAC 3MFJA 3VEQB 1A61H 1C5NH 1C9PA 7ESTE 2Y5FA 1TA2A 3MU1A 1A1RA 3BEIB 1HLTH 3IWMA 4LK4A 5L2YH 5FPYA 1AFEH 1W3CA 1ELGA 1O2RA 2Q1JA 1G37A 3A83A 1EX3A 2VINA 5FCKA 1UTOA 1WQSA 3DFLA 1CHOF 2R0LA 1XUKA 5T6GA 2O8WA 3DT0H 2GMTB 2Y5HA 4YESB 1IAUA 5DP6A 4UD9H 1P12E 1HYLA 1QB9A 3NK8A 1GI3A 4MLFB 1OS8A 2VNTA 1MU6B 3GYMA 3M36A 4IC6A 2ZQ2A 1EAWA 2ZHEH 2C90B 2Y5GA 4IMQA 1XVMA 1TQ0B 2WPHS 4AORA 1BA8B 3U98H 5C5NA 4K1EA 2B5TB 8ESTE 1ETTH 1MBMA 4BXWA 1HAIH 1NFUA 3WY8A 1TMUH 1OP8A 1TMBH 2A0QB 3S9CA 1BHXB 1KXEA 2HNTC 1EPTB 2AGEX 2GCHF 1YM0A 3P70B 4GHQA 1CBWB 1Y3VA 2PR3A 1MTSA 4Y0YE 2DE9A 1WU1A 2XBVA 1SFIA 2R3UA 1OWKA 4UFEH 1EJAA 1RFNA 1OPHB 3GDUA 3RXLA 1F5KU 3B9FH 1CHOG 1FIWA 2BQ7B 1BRUP 1GVZA 2ZCLP 3BTFE 1TGBA 3U8OH 1B0FA 1A46H 1K1JA 1VGCB 2XC0A 4DGJA 2ZFSA 2J34A 1T31A 3TU7H 2SGQE 1P2QA 1Q3XA 1KYNA 3BV9B 3RXDA 1K1OA 3A7ZA 1DPOA 3LJOA 1CBWC 1EAIA 1UTJA 1AKSA 2ZGXH 3ZV9A 1UMAH 4ABGA 1NN6A 3ATWA 1O2MA 5JYIA 1SOZA 2ZPQA 1FZZA 4A92A 3BTEE 2FS8A 1A0JA 4X8UH 1NO9H 4JYVH 1MTNB 4IN2A 3A8DA 3M7UA 3SV8A 5BRRE 2A4QA 3TH4H 2GCHG 1O2IA 4CRCA 1J16A 3QGJA 2ASUB 2V35A 3FANA 4Y8YA 3A86A 2H9EH 1QBNA 2Y82A 1SG8B 3OY5U 2J9NA 2IN2A 2OXSA 5JBAS 2HOBA 1J15A 4CR9A 1W14U 4H42U 1L1JA 1C5RA 2BOKA 3UOUA 5E2PA 2UWOA 1O3IA 1MCVA 7GCHF 9ESTA 4ABAA 3BTGE 1EJMA 1KLJH 1P2OA 3M61U 4FUBA 3L3TA 2A32A 3KF2A 2UWPA
chains in the Genus database with same CATH superfamily
3VPKA 2ZU4A 1GI2A 1O2OA 3G01A 2ZHFH 1Z8RA 2THFB 3BN9A 4YM9A 1K1MA 2P8OB 1W0ZU 3R0FA 2LELA 4ESTE 3SNBA 1E36B 1O2ZA 2A7CA 1HAHH 1P2MA 1O5CB 2AMDA 4NWKA 2EEKA 5HYOA 1GHZA 1C2IA 4MQAA 4O97A 3ZVEA 4ABDA 1Y59T 1CHGA 3TGJE 2VJ1A 2F43B 1SQAA 4PROA 1LPZB 1VKYA 1A5IA 2OC1A 2P93A 3OEED 1ZJDA 4FU9A 1JRSA 1QR3E 3MQKC 1GJBB 5EJLA 2ZGBH 1TBZH 1FV9A 1GJDB 3SBKA 3O8DA 2W3KA 1AWFH 2A7JA 4NIWA 4Y8ZA 1BTUA 2V7QD 2OTVA 1P03A 1O3HA 3P8GA 3TNTA 1O5AB 1FPHH 4X2YA 5J4SA 2A2XH 1AD8H 2H9TH 3LH3A 4HI3A 1OWDA 1AE8H 2VWNA 4AZ2B 2FODA 4D8NA 1LKBA 1C2EA 3RXVA 1GI4A 3JZ2B 1FI8A 4X6PA 1O2PA 5F8ZA 3SJ9A 2H6MA 2SGFE 3GCNA 3LIWA 5AHGH 2ALVA 2BX4A 1GMDF 2WPKS 5A09A 1L1GA 1KLTA 1O3MA 4O03A 3P6ZB 3SNEA 1QGFA 3F9HA 1ZR0A 4ISNA 3CP7A 4BAHB 2A1DB 2ODYB 1Z6JH 1SGCA 3OX7U 4JYTA 2QF4A 1GHXH 3PB1E 4XE4A 3MU4A 1LQDB 3KYFA 1DWBH 3EE0B 1IQIA 2AMQA 1O39A 3QZQA 1DLEA 1CVWH 1O5DH 3PTNA 3F6UH 4X8VH 2XCFA 2OC7A 1MCTA 2PGQB 2FX6A 5GJ4B 5GPIB 3VXEH 1K1PA 3DHKH 4B74A 5C17A 1UJ1A 1EZUC 1O5GH 4NFEA 1O2JA 2A4RA 1QHRB 3RXAA 4F4OC 3HGPA 6CHAC 1EASA 3RXQA 1P8VC 2H5CA 1IQEA 5DP4A 2XXLA 1VCWA 2UWLA 1BJUA 5I46H 2GDDA 4A1XA 4B1TA 2ZF0H 1PPGE 2GX4A 1TPPA 4WMEA 1NBME 4E7RG 2HRVA 1J17T 4J2YB 3W1EA 5TCCA 4AFSA 1Y5UT 3GCHC 1O33A 4ZKOU 4BTIB 4Y76A 2KCAA 1TRMA 4ISOA 1BUIA 3MH6A 1KSNA 5C3NA 1GMDG 4K5ZA 3GY4A 1JRTA 4DW2U 1P11E 1HJAB 1WTGH 2QYIA 4I8HA 1WYKA 1O3NA 1JIMA 1EKBB 1NZQH 2ZFTA 1LPKB 1QA0A 1YPHE 4O9VA 2FI5E 3A7WA 5EU8A 3H7TA 1DVAH 2KAIB 2CV3A 3VB7A 1DFPA 5FXLA 1HBTH 3RMMH 1XUFA 1T7CA 4MPWA 3MHWU 3RXHA 2AEIH 1YPJH 5F53A 1O3PB 5HKKD 1NC6A 3B8JA 3AAUA 1Y5BT 1RXPA 3RXCA 5B6LA 1MKXH 1S6FA 1MKWK 1YCPK 1NS3A 2WPDD 3M5OA 4ABJA 1BOQA 4AGJA 1P05A 4IBLH 3ZZ7A 1NU9A 1SC8U 3DD2H 3Q3YA 3GY5A 2IJOB 4ABFA 3EA8A 3RU4E 3V13A 4RKOB 3TGKE 2QF0A 5E0HA 1E1RD 1H9IE 1W8BH 1AWHB 4JZIA 3M5NA 1ELBA 1ORFA 3A87A 3QK1A 2C8YB 2ZDNA 1GHAG 1A7SA 2OBQA 1AB9C 3RM0H 1TX8A 2GV6A 1GBCA 1MD7A 1CT2E 2FI3E 2KX4A 2VH0A 4NA9H 3SW2B 3ZVAA 1C2HA 1V2RT 1ZPBA 5AFZH 1TWXB 4BAOB 1GJ9B 3OFND 1O3JA 2VU8E 2SGAA 3UWIA 4AGKA 1LVMA 4ZHLU 4Q7ZA 3SQEE 2W26A 2CHAC 2F9VA 1ANEA 3ENSB 3KQEA 1C2KA 2JKHA 1O3LA 4BAKB 2O8MA 2G52A 1ID5H 3RP2A 4NA8A 3TLOA 2J98B 3SV9A 1GCTC 1PYTD 4INKA 1BMNH 2SNWA 2D2DA 3B23B 2QXJA 3FO8D 5AFYH 2GJGA 1D3QB 2PUXB 1UK2A 2HLDD 5IK2D 1DY8A 2FTLE 4THNH 2KFWA 1Q2WA 2BDIA 2OQ5A 3STJA 4XDEA 1C5WB 2R9PA 3MNSA 3P17H 2BDGA 5EJ1A 1YPMH 2XNIA 1CGJE 1GJ7B 1GBMA 2I6QA 1OP0A 1HCGA 2LNCA 1TGNA 3RDZA 3F2FA 1YGCH 1GI8B 4OS4A 2IPQX 1DXWA 3NUMA 1YY3A 1CA0C 1YLDA 3KIDU 4I8LA 4ZHMU 1BCUH 5C1UA 1BRAA 1XVOA 5LPEA 1QY6A 3QDZB 1HRTH 3E90B 1GHBG 2BZAA 1KMHB 1GHVH 3K9XB 5EPNA 4ZUHA 1G3EA 3A7VA 1IQMA 2BD4A 2PP6A 1CQQA 2B0FA 1V2ST 4I8JA 3U1JB 1RTLA 3RLYH 4RKJB 5E2OA 3P92A 5H4IB 3ZV8A 1V2JT 3PO1B 1MU8B 3FP7E 1F2SE 1O2TA 4KGAA 3K2UA 7LPRA 1G9IE 1EB2A 1K1NA 1XUJA 3GISB 1TABE 4AX9H 4DT4A 1ESBA 5CHAB 3RXPA 2XYAA 1BQYA 2BDYA 4IMZA 3A81A 2ANYA 1O36A 4UONA 2F9NA 1BB0B 2Z7FE 1P02A 3A80A 2VWOA 3DA9B 5A8XA 1P06A 3UUZA 2ZHWH 3TITA 1ANCA 4XBBA 2HPPH 3A7TA 1GDQA 1PPHE 1SGIB 2WPMS 3D49H 2A5KA 1ELAA 1EOLA 1BDAA 2JH5D 1O38A 3N99A 1LKAA 2GKVE 3W94A 1FLEE 1ANBA 1GJ6A 5FPTA 1C2DA 3TK5A 3SV7A 4DY7B 4TY6A 1JXPA 3FN8A 1IQGA 3A8CA 1P9UA 5FHTA 4Y71A 1BIOA 4MG3A 2A45B 2O8TA 4Y7AA 5DP8A 1Y3WA 3UR9A 1SGRE 4LXBH 2Q6GA 3VXFH 3LONA 1ZRBA 5C2ZA 2FOEA 4FUFA 2R2MB 1O3EA 4UFGH 5GIBA 1O2YA 1OX1A 1GBLA 2VIQA 2GZ8A 2ZNKH 1KXFA 1Y3UA 1P2IA 1LHCH 2CK3D 4VGCB 1GDNA 4F48B 2BQWB 5PTPA 3N7EA 1TGTA 3S9AA 2QV1A 2V0BA 1GMCF 4GCHF 4DIHH 4U01A 1XX9A 5LH8A 3M3TA 1RIWC 3PMHB 4ABBA 5ABWA 2AYWA 5EW1H 3PTBA 2PKSB 2SGDE 1C5XB 3SQHE 2OP9A 3C27B 1AHTH 1FY4A 4OGYA 1AKSB 2ZFRH 4Z6AH 2BDAA 4NGAH 4Y0ZE 2R0KA 1BRBE 5C0UA 2A5AA 1G30B 3M7TA 4ZROA 4OS2A 5K7RA 2BYAX 4D7FA 3GS9A 4NWLA 1B7XB 2QGRA 2BXUH 1G2MA 5DKMA 1QNJA 2BMGB 1NFWA 2GCTB 4TSFD 5L6NH 2Z3DA 3L6PA 1TRYA 3BIVH 3ODDA 1P3CA 2EI8A 2YOLA 1P01A 2KCOA 2ZU3A 3PLPA 3ZZDA 4I32A 2H2ZA 2RFKC 1PYTC 2PKSC 1GBKA 1RS0A 1GI6A 4D9RA 2CXVA 2H5DA 1ESAA 5C67A 2AHME 5EODA 3A88A 1GI7B 3SUEA 8LPRA 1GMCG 3KHVA 4GCHG 1XUHA 4AYVB 4AG1A 4B2AA 4UEHH 4ISHH 1GHYH 1AFQB 1AE5A 3FZDA 5HM2A 2GCTC 1HIAA 3ATKA 4E06H 1OYQA 4AG2A 2A31A 2F9OA 2W5EA 1Y3YA 2J4IA 1MH0A 4FUCA 3UAIC 1U6QA 2J92A 3BEFB 3MYWA 3LGVA 3OTPA 6ESTA 1KDQB 2ZGHA 1YF4A 1UK3A 2OD3B 1TOMH 2WHXA 3EA7A 3BTKE 5KEDA 1EXFA 4BNRA 2FLRH 3GYLB 1SHHB 2ZDMA 3GY2A 2VVUA 1TE0A 4X8TH 1GBDA 1LVOA 1AFQC 1O3FA 2WINI 2YMSB 2WSSD 1XXFA 2Y7ZA 3FP6E 1UVPA 4WXVA 1T4UH 2C3SA 1QJ7B 2EY4C 1FX0B 4BANB 4GSOA 4TWWA 3UNRA 1TONA 1C5QA 3NXPA 4K69A 1O0DH 2VIWA 2AIQA 3AW1A 3BSQA 2ZTZA 1UW7A 3UNSA 2QF3A 1YP9A 5IYTA 1DS2E 5AF9H 1C1PA 1NU7B 1THSH 2BDCA 3SYJA 3LPRA 1SGEE 3EA9A 3NRLA 3K6ZA 1GDUA 3ZZ9A 2J94A 4DJZB 2ZG0H 3E1XB 4X2VA 3WW7A 3ZYDA 1Y3XA 4KTUA 4LOYH 2FOHA 1UVUH 1UTLM 5C94A 1P9SA 1GBIA 4OGXA 2ULLA 1GJ5H 1H9HE 3MO3A 4JCNA 3U28C 3HKJB 1WQVH 1NRPH 1NT1A 1KY9A 3M5LA 1MMJN 3E91A 3RXBA 1S84A 4HGCA 2XC5A 4U32A 2L6OA 5DP5A 2ZDVH 3RXUA 3Q3XA 5JBBS 1QBOA 1HJ8A 1SPJA 1FY1A 3RUOA 3IG6B 2DUCA 1DDJA 1V2TT 1W11U 3RM2H 3SU6A 4I86A 1AU8A 3E0PB 1GG6C 2QA9E 4H4FA 3E6PH 4FOUC 1SLXB 1W12U 4HZHA 3RXFA 1UTNA 1CT4E 4WF8A 4KKDA 5GDSH 2V6NA 2ZGCA 1H8IH 4YOJA 1A3BH 3T2NA 5E8EH 1TNLA 1TNJA 2XW9A 3SUDA 2XBWA 1WCZA 1O3BA 2PHBA 5I25A 4X1NU 2G00A 4GAWA 4YLUA 2K1QA 4YT6H 1O32A 2ZHQH 1S6LA 2Y81A 4Q7YA 3IITA 1EZSC 2ZA5A 3PRBA 4CRFA 5EXMA 1TBQH 3TGIE 1WDIA 2GDEH 4TPYA 1SHYA 1P0SH 1F92A 3SNCA 2GD4B 3SORA 5CE1A 8KME2 1Z8GA 1AIXH 3LOXA 1O3OA 1SBWA 3GDSA 1E37B 1G32B 3U8RH 3HK3B 1OYTH 4Q7XA 4B75A 4D7GA 1O3AA 1NRRH 3BTME 2FOGA 4U30A 2BY8X 1BTWA 3ODFA 3LDXH 4ZCNA 1QFKH 3K65B 1PPZA 4A5TS 4WXIA 2VBCA 4NIXA 3ATMA 1TGSZ 1P57B 3TJNA 3M7QA 4K60A 1ELVA 1AZZA 1OWHA 3LGUA 1V2NT 1UCYH 1SLUB 1ZMJA 2C93B 2OUAA 3C1KA 2ZGJA 4TWYA 1NBMD 3ZYEA 3SJ8A 3M3SA 4WMFA 3CS7A 1PQ8A 1J9CH 1OHHD 1ZHPA 4WH8A 1ZPCA 2BHGA 3OYPA 3BTTE 1O2NA 3AK5A 5EQRA 2QC2A 3SNAA 4INHA 1HGTH 1NRNH 3S9BA 1NRSH 6LPRA 2FO9A 2Z6BD 3HPTB 1O2WA 4INLA 1LDTT 3E0NB 1N6YA 3VB3A 4AFUA 1FQ3A 2ZEBA 1C2FA 5FBEA 2JIZD 2VIDA 1S83A 3LC3A 4K8YA 2TBSA 2ANKH 1WXRA 3UR6A 4B2BA 5LPRA 3A85A 1C1SA 1QA7A 7GCHG 2WUCA 1QL7A 2KCPA 6GCHF 4KTCA 3UOPA 1O3DA 1BTPA 2ZCKP 5L2ZH 1QJ1B 4TYDA 1N6XA 2BXTH 5HM9A 2VIPA 1K1IA 1QURH 4BTTB 1EB1H 1AQ7A 1IQFA 6CHAB 2R3YA 4MTBA 2Z9KA 2BLVA 3T62A 2FOFA 1T8OA 3RU4D 3MNXA 1D3DB 2DE8A 1HXEH 2WV5A 2B9LA 2XTTB 1V2OT 4JMYA 4X6OA 1F5LA 1C5TA 1G3DA 3GCHB 3BG4B 3RXKA 2K8IA 4ZKRU 1DICA 3M37A 5DN6D 5GXPA 2Y6TA 2GGVB 9LPRA 2BY5X 1SGTA 1GL0E 2FYRA 1TPOA 4K3JA 5F8XA 4FU8A 3P8NA 4MVNA 1C1UH 5C0TA 4CR5A 4DG4A 1AVXA 2OC0A 6GCHG 2ANWA 2BD5A 4XBDA 2WYGA 3PMAB 3URCA 4FUGA 4AB9A 3BG4C 3SU5A 3N7DA 3H5CB 2KZ4A 5JPMH 2FEQH 1TPSA 2FP7B 1DXPA 2D1JA 5FPSA 3ZVGA 5KECA 1TNKA 2ZKSA 4NFFA 1RTKA 7KMEH 1E79D 1C4Y2 4FVDA 3T5FH 4X1SU 3HK6B 1LCYA 1ARCA 3SUFA 3LC5A 5L30H 1GBBA 3VB6A 5JBCS 2FESH 3A7XA 3F1SB 4I31A 2FI4E 3RMOH 2FTMA 5E0GA 1C1OA 4FU7A 3OSYA 4OS1A 1GVKB 1GMHF 3Q76A 2GZ7A 1O37A 1MAYA 1TLDA 2VB0A 2ZQ1A 1AB9B 3DSOA 1CGHA 4KELA 2G5NA 1GJ8B 3SI3H 1BITA 1QQ4A 3KEEA 1L4ZA 3SNDA 5F6MA 2Q6DA 1GBAA 3RXIA 1FNIA 1KXCA 1T8MA 4HFPB 2CHAB 5K0HA 1TMTH 1DE7H 3GCTF 4GUXA 5A0AE 3O8RA 1OWEA 4MPUA 3SV2H 2P3TB 1HB0B 1SGFA 1ELTA 1MAXA 3V12A 2BLWA 3RXEA 2NU1E 1HAVA 3T27A 1GBJA 1GCTB 3PV5A 2J95A 1IQNA 3OY6U 1SI5H 3L33A 3UWJH 4ZMAH 1WOFA 4FUJA 2F9BH 4MNVA 2RA3A 2HGTH 2GV7A 2Z3EA 3V0XA 3MU0A 1O2GH 2GZ9A 3DUXH 2CF8H 3PLKA 3AAVA 1ZHMA 1ZHRA 1YPHC 4Z0KA 1HV7A 1GMHG 1D6WA 1GI0A 3EE7A 1W10U 1EJNA 4JZDH 1DITH 2ZI2H 1QIXB 2RCEA 1FONA 1O2SA 2WV9A 3MTYA 1MKXK 1CA0B 1LMWB 1BZXE 2AGIX 3F0OA 1RJXB 2VWLA 2TGPZ 1SGDE 1SOTA 4X0WU 3RXTA 1EOJA 2PKAA 4TT3D 1YLNA 2BLOA 3MNCA 3N7OA 2AIPA 4ZHAA 1DY9A 1VCPA 3SZNA 4AN7A 1ZSJA 2JDID 3GY8A 1BHXF 1TYNA 2ZDLA 3DCLA 5JB8S 3QTVH 4RT1A 2ZDAH 2ZFFH 2XCNA 3LGIA 1NM6A 3E8LA 2WYJA 5EQQA 1MTUA 1V2KT 3U1IB 2SNVA 3BEUA 3UPEA 2SFAA 1BT7A 1Y5AT 1TX6A 2PSYA 2AERH 1SLVB 3QWCH 4CRAA 1ELFA 5ESBA 4A7IB 1N8OC 1O3CA 5JB9S 4YO9A 4ABIA 3SN8A 1HIAB 1BTZA 4DOQA 1LHDH 1NROH 1CGIE 4Z1MD 3KQ5A 1GJ4H 1VITH 1BBRH 1S5SA 3SO3A 2BDBA 2BVSH 1DSUA 3TIUA 1TNIA 1VJAU 4X8SH 4ACBA 2Z9JA 2NU2E 3F9EA 1SGPE 2FS9A 2A5IA 1QJ6B 1BRCE 4JK6A 3Q77A 4MNWA 1NRQH 3NCLA 2Q6FA 1QBVH 2HVXA 4RT0A 1TB6H 1UCYE 4K1TA 1DM4B 4QT8C 1UHBA 1JMOH 1S0RA 4B6FA 3TJOA 1WAYB 2WZQA 3A8AA 2J38A 1BJVA 1IQKA 3NZIA 2CN0H 2KCYA 3DSGA 1F7ZA 2JETC 1GBHA 1O2KA 3S69A 2W6ID 3D65E 2GT7A 2BVXH 1ABJH 1HAZB 1C5YB 3MNBA 1L4DA 1ZGIA 2BDHA 1B5GH 4X6NA 1RIWB 2BX3A 2Y80A 3GY6A 2Z3CA 1C1TA 1OWJA 2HLCA 3KN2A 2YMSD 3UREA 4X1PU 2LIZA 3F3BA 1O31A 4CREA 1EFRD 1VITF 3EYDA 1YPGH 1TFXA 1DWCH 1KXAA 3VFEA 1Z6EA 1YBWA 4RN6A 1XKAC 1C2JA 1IOEA 1YLCA 3LGWA 3VGCC 4LZ4B 4J1YA 1CT0E 2QXGA 1MZAA 3OU0A 1KXDA 2B8OH 1LHGH 2ZC9H 2W7SA 1ETSH 1FY5A 3R3GB 3TK6A 3H09A 2XOKD 1AO5A 2Y7XA 5C1XA 2ODQA 2VVVA 1AVWA 2AH4X 1FN8A 4P02A 4B71A 1V2MT 1ZJKA 1ZSKA 3LT3A 1E0FD 1NFYA 5HGGA 1S81A 4BAMB 1V2QT 2B7DH 3S7KB 2XNDD 1S85A 2UUJB 1ZGVA 2WPJS 3UY9A 1GBFA 1HPGA 2G51A 2M5TA 4DURA 3S0NA 2Z9GA 3PM3A 3MWIU 4YXWD 4WJG2 3M5MA 1VJ9U 2UUKB 3EBNA 3PROA 3FVFB 3ZVFA 5EW2H 3T29A 1O30A 1GBEA 1S6HA 2EI7A 2ZFPH 2HALA 4Q2KA 4OS5A 1RD3B 1THRH 1O2LA 4BOHA 2ZCHP 2BOHB 1AY6H 3BTWE 4X6MA 2ZTXA 3ZVDA 4FVBA 3TVJB 1SGFG 4DCDA 4JZ1A 3QN7A 3RMNH 1UK4A 4D9QA 5CMXH 2FOCA 3CNRA 1PPEE 3KCGH 2FPZA 2PTCE 3I78A 4AFQA 2BVRH 1FAKH 4ASUD 3E16B 3W95A 2FIRH 1A5HA 1LO6A 5FX6A 2ZU2A 4ZAEA 3A7YA 4LZ1H 3SGQE 2FWWA 5EOKA 4Y8XA 3RLWH 3EGKH 4MNXA 2HNTE 4FXGH 3MO6A 3UIRA 1WSSH 2ANMH 2JJ2D 4TPIZ 4I7YH 1C1WH 1C5PA 1ELDE 2QAAA 1SB1H 1GCDA 1P04A 2FOBA 3ZIAD 1UTMA 1PFXC 2ZWLH 2P59A 1F0TA 1ZTJA 2TGAA 5T6DA 3OAAD 1P2KA 1JIRA 3SI4H 4YT7H 4MDSA 4YZUA 1HAYB 1QRZA 1ZTKA 3ATIA 4SGAE 1MTVA 3MU8A 1GI9B 3UB0A 2TGTA 4CRDA 2NU4E 4IW4E 1G36A 1LHEH 1Z8IB 3I77A 2OQUA 3PV2A 5C20A 1XMNB 1INCA 2IOTA 2OINA 1G3BA 1Z1JA 1HAGE 2ZHDA 4Y11E 3ESTA 1F0UA 2YNBA 3F2GA 2PFEA 1GG6B 2XWAA 1F0RA 1SGQE 2WUBA 5HMAA 1FXYA 3MH7A 2CJIA 1MD8A 1DWDH 2ZDKA 3TH2H 4NSYA 2F9UA 3SHCH 3SUGA 2H1UA 4WWYA 4HG6A 1PQ7A 1E34B 3SU1A 1JOUB 3MI4A 5TCAA 1NFXA 5DJ7A 5F8TA 1KLIH 4RI0A 3SHAH 4YTAA 3SU3A 4NIVA 1AMHA 3LKWA 2NWNA 2YNAA 1SR5C 3DFJA 1C5ZB 3FKSD 3KL6A 4TY7A 2GMTC 1AUJA 3KQCA 1SL3A 2XC4A 3MH5A 3QZRA 1FMGA 1L0ZA 1CA8B 1K1LA 1VR1H 3MO9A 3RXGA 1FUJA 1GI1A 1OOKB 3VB4A 2VGCB 5A2MH 3AVZA 1COWD 3UTUH 1O3GA 1THPB 3JZ1B 3P95A 5A0BA 1TPAE 3TJUA 1W7XH 2FXRA 4IC5A 1EATA 4MPXA 2BY6X 3STIA 1J14A 4H6SB 4R8TB 1GJCB 3Q3KA 1XKBC 3FP8E 4ZH8A 1A5GH 1LQEA 3U8TH 3GICB 5EXLA 1F0SA 1SKYE 3TH3H 1SGYE 1ZPZA 2ZU5A 1V2UT 2ILNA 3LU9B 1EPTC 1O2QA 2O8LA 1AI8H 2AGGX 4I8GA 4K8BA 1C5SA 4U2WA 3MMGA 1FN6A 4ZXXH 4XOJA 5A0CA 3VB5A 1P2JA 1BTYA 4K2YA 4FETA 4ZKNU 2XWBI 2VGCC 4B73A 1E35B 3U69H 3CENA 3PMJA 1DSTA 2BD8A 4ISIH 2TGDA 1BBRE 2FM2A 4CH2B 4O3UA 3TJVA 1SSXA 1YC0A 3BTQE 3ELAH 1VGCC 5DPAA 2VIVA 1IHTH 2NU0E 1EZXC 4ISLA 2QXIA 3SV6A 1SFQB 4WVPE 4CRGA 4R0IA 2XRCA 3ZZBA 1Z8JB 3EAJA 5B6OA 5E0JA 4JZFH 2K7XA 1V3XA 3GCOA 3M3VA 1BMMH 1W0KD 5EPYA 2LPRA 3PWCA 3D23A 1V2PT 2AFQB 2TRMA 2I6SA 3LH1A 2A4OA 1CSOE 2ZTYA 2PV9B 3SJKA 1QRXA 3KGPA 3TK9A 1MTNC 1OWIA 1PPFE 2PW8H 3SU2A 4KTSA 1ETRH 1NTPA 2ZIQH 2XBXA 1T4VH 4I8KA 4Y79A 1YPLH 2M2AA 1MQ6A 3CS0A 3TPIZ 5LGOA 1HAXB 1AUTC 3WWFA 1TNHA 4GHTA 2W7UA 4DVAU 2GP9B 1S0QA 1HAVB 1V6DA 2C8XB 3QTOH 1KDQA 1PPCE 3A82A 3ITIA 3KNXA 1ZZZA 1O2HA 5CHBA 1UVSH 5DP3A 2FZZA 5J4QA 3T25A 1CE5A 4GVUA 4NCYA 1QCPA 1CO7E 5DP9A 2P94A 4O3TA 3VG8A 1E38B 1EZQA 2HWLB 1ELEE 1W7GH 1DOJA 1ESTA 1LHFH 1K22H 1V2VT 1GBTA 4KP0A 5IDKA 1ZTLA 1YCPM 4AB8A 3P8FA 1O5EH 4XSKU 1IHSH 4AFZA 2P8OC 1GJAB 3UQVA 1FJSA 1KXBA 3V7TA 1AN1E 1TALA 2SGEE 5KGOA 4XRNA 5DP7A 1O34A 3AASA 3FOAA 1T8NA 1UCYK 2GT8A 1O2XA 4Y6DA 4XD7D 1PQ5A 1SLWB 2PKAB 1FAXA 3PRDA 2EA3A 3GOVB 1EPTA 1F5RA 3EDXB 1A3EH 1GWAA 2JH0D 3ZZ8A 2BLQA 2C8WB 1H9LB 2VIOA 4CH8B 1SVPA 3GY7A 1UO6A 2G55A 3RXRA 3FZZA 3AW0A 2VVCA 1HUTH 1LPGB 5EG4A 5T3HA 2A4GA 1DT2A 3LGYA 2FX4A 4FUHA 1NESE 1QB6A 3A89A 1HAOH 1LVBA 2KR7A 2ZP0H 3LGTA 1G2LA 1HNEE 3HATH 3D62A 1MQ5A 3PYHA 3RC6A 3TNSA 4UDWH 1ZLRA 1YCPH 1MKWH 5T1VA 1XM1A 1O3KA 4HTCH 2Z9IA 5JBTA 1CU1A 1HDTH 4IS5A 3ZZ3A 3SU0A 1GGDB 4M7GA 5FBIA 2ZO3H 1OXGA 1HAPH 3ATLA 3BF6H 1DX5M 3QLPH 3O8BA 1BMFD 2RDEA 4WH6A 1NY22 2RDLA 2UUYA 4X2WA 5FX5A 5EIYA 1AVGH 2A7HA 2HVYB 4OS6A 2V3OH 1UTQA 4E05H 2Z9LA 1QL9A 4NIYA 1UHBB 3MOCA 5T6FA 3P8OA 4B76A 1C1RA 3WWBA 3ZZ5A 3GDVA 3ZZAA 4AOQA 4BAQB 5G4BA 2PUQH 1ZSLA 4F49A 2XBYA 1C9TA 1GGDC 1GHAF 1QZ8A 2A2QH 2ODPA 2OC8A 1D9IA 1Q31A 1WV7H 5ETXA 3Q00A 1GHWH 1QQUA 1C2GA 1MUEB 5C5OA 1C4V2 2D26C 1UTKA 2OK5A 8GCHF 5A8ZA 1ANDA 1C5OH 1ZRKA 3PWBA 3PV4A 1O2VA 2NU3E 5C1YA 3S7HB 1C4U2 1BTHH 1A0LA 2ESTE 1B0EA 3OE7D 3T28A 3MU5A 2J5UA 2OCVB 1O35A 2BQ6B 1GL1A 3BG8A 3ZZ6A 1D3PB 1GPZA 2V3HH 5LPFA 2P3FH 3RU4T 3NWUA 5GCHF 1HJAC 1L1NA 2IPHA 1UVOA 1EAUA 1K21H 1QRWA 3UFAA 4ZKSU 3E3TA 2WV4A 4AC9A 4CBNA 2F91A 2P3UB 2PSXA 4NZLA 4Q63A 4I33A 4X2XA 5A8YA 4BTUB 1P2NA 3HKIB 2D8WA 4NG9H 5DG6A 1QB1A 3QGNB 1K2I1 1YPEH 1ZMLA 2H9HA 2W6JD 3QUMP 3F9GA 1G3CA 1DWEH 3ZVBA 2O8UA 4YLQH 4YOIA 4SGBE 1L2EA 3OEHD 1Z7KA 2ZU1A 3QX5H 1T32A 1RRKA 2HNTF 3NPSA 2ZPSA 3RMLH 4A1TA 4JYUH 1WBGB 1AZ8A 1JWTA 2KM0A 1IQHA 1VCQA 1TAWA 2G5VA 1RGQA 1TBRH 1FY3A 1O5FH 2BZ6H 3ZZCA 8GCHG 3BIUH 2P95A 1GHBF 1SQOA 5AVDA 3GCTG 1N8OB 2CF9H 2FYQA 2ZFQH 1TX7A 3LJJA 1C5VA 5EQSA 1FPCH 2QF5A 5GCHG 2RA0A 3RC4A 1Y8TA 2F83A 2BTCE 3SGAE 4XBCA 2OBOA 4RSPA 2W3IA 4H6TA 2BD7A 1W0JD 1H8ED 2STBE 1A4WH 3FFGA 1C5LH 1C1QA 2BD2A 1PQAA 2SGPE 3HGNA 2BB4A 4UFDH 1FIZA 4YOGA 4Y10E 5JDUB 4Q80A 5FL7D 3SZEA 2V3MA 4WMDA 1TA6A 4A6LA 5HXFA 1TIOA 1D3TB 2G4UA 2BM2A 2EQNA 1YKTA 3F9FA 2R2WU 5ESTE 4D76A 1D4PB 5GWZA 4ABEA 1DUEA 1TNGA 2JJ1D 2QXHA 4UE7H 1O2UA 1ARBA 2VWMA 5DO4H 3URDA 2QIQA 1S82A 1LTOA 2PTNA 2JETB 3BTHE 3PMBB 1XUGA 1MTWA 1ABIH 2FDAA 2QE7D 4FUEA 5TJXA 1QTFA 1C2MA 3ZZ4A 2QCYA 1LVYA 2G81E 1ACBE 1KIGH 3KQDA 4Y7BA 2P16A 1H8HD 1W13U 1YWUA 2ZZUH 1GI5A 1JBUH 1UVTH 1W2KH 4GLYA 1C1NA 1C2LA 3SU4A 4FUDA 4NZQA 1P09A 1IQLA 4DIIH 3DSPA 5FCRA 2AMPA 1TOCB 1C1MA 2FLBH 2AS9A 3SJOA 4CBOA 2QN5T 2BD9A 1HJ9A 2KAIA 1OKXA 1P3EA 1H4WA 3VGCB 2ZPRA 2Z94A 2VH6A 2C8ZB 3FAOA 4IN1A 2O9QA 2ZECA 3RXOA 1Z1IA 5GNDA 2F9PA 1VZQH 4MNYA 1PPBH 1M9UA 3PO1C 2OLGA 4ASHA 1EP6A 2J2UA 2C4FH 1C1VH 3O8CA 2PWXA 1BBRK 5CHAC 1RTFB 1EUFA 4NSVA 3A84A 2RG3A 1AGJA 4AYYB 3M35A 1ZOMA 1Z71A 5EGMA 2FOAA 3OTJE 4WY3A 3RXMA 4X1QU 5EXNA 1OP2A 1K28D 4F55A 5FAHA 2TIOA 4P00A 1W0YH 1KTSB 4FUIA 3ZVCA 4MPVA 4IGDA 2FMJA 1XUIA 2JH6D 1SGNE 4B2CA 1WUNH 1K0HA 1DLKB 1MBQA 4CRBA 2GTBA 4JK5A 3NKKA 2BY7X 3RXJA 2QY0B 1FY8E 4X1RU 1J8AA 1H1BA 2G8TA 1BMLA 1E1QD 1DANH 1HFDA 2STAE 2WPLS 1BTXA 3MH4A 1X7AC 3T26A 3UNQA 1N1LA 2FOMB 5HIZA 4OM9A 1WTHD 4A1VA 5SGAE 2GVFA 3H7OA 1IQJA 3GY3A 2BD3A 2WPIS 4E7NA 3V3MA 1GVLA 1ZYOA 1TQ7B 2J98A 3RC5A 1VITG 1EAXA 1DUAA 5DK1A 4NA7A 1TRNA 5CDFE 1C5MD 4UFFH 3K6YA 2ALPA 1EQ9A 1O5BB 1V2LT 4JZEH 4OS7A 4VGCC 1NPMA 3PLBA 1YPKH 1K9OE 1C5UA 4GPGA 1QL8A 1UTPA 1XXDA 2G4TA 3A8BA 1A2CH 1T8LA 4BXSA 3UQOA 3EQ0H 1FDPA 1KTTB 3I29A 2F4LA 1D6RA 2CGAA 2F3CE 2EC9H 2UUFB 4CHAB 2PLXA 3SJIA 4ABHA 1SQTA 1A0HB 1P10A 2EI6A 3KYGA 5DGJA 1BMAA 1ELCA 4ZXYH 3KQBA 1HXFH 1OSSA 1EP5A 1TGCA 3SGBE 3U9AH 2CMYA 3F68H 1YYY1 2TPIZ 2HPQH 5F03A 1PJPA 1SMFE 3BTDE 1MZDA 3QO6A 1H8DH 4XFQA 5BPEA 1V2WT 2BY9X 2LP6A 3SOSA 4ACAA 4K1SA 2PGBB 4M9FA 3RXSA 1ZMNA 4DT7B 4CHAC 3MFJA 3VEQB 1A61H 1C5NH 1C9PA 7ESTE 2Y5FA 1TA2A 3MU1A 1A1RA 3BEIB 1HLTH 3IWMA 4LK4A 5L2YH 5FPYA 1AFEH 1W3CA 1ELGA 1O2RA 2Q1JA 1G37A 3A83A 1EX3A 2VINA 5FCKA 1UTOA 1WQSA 3DFLA 1CHOF 2R0LA 1XUKA 5T6GA 2O8WA 3DT0H 2GMTB 2Y5HA 4YESB 1IAUA 5DP6A 4UD9H 1P12E 1HYLA 1QB9A 3NK8A 1GI3A 4MLFB 1OS8A 2VNTA 1MU6B 3GYMA 3M36A 4IC6A 2ZQ2A 1EAWA 2ZHEH 2C90B 2Y5GA 4IMQA 1XVMA 1TQ0B 2WPHS 4AORA 1BA8B 4Q4LA 3U98H 5C5NA 4K1EA 2B5TB 8ESTE 1ETTH 1MBMA 4BXWA 1HAIH 1NFUA 3WY8A 1TMUH 1OP8A 1TMBH 2A0QB 3S9CA 1BHXB 4B6EA 2YMSC 1SQRA 1KXEA 2HNTC 1EPTB 2AGEX 2GCHF 1YM0A 3P70B 2J97A 4GHQA 1CBWB 1Y3VA 2PR3A 1MTSA 4Y0YE 2DE9A 1WU1A 2XBVA 1SFIA 2R3UA 1OWKA 4UFEH 1EJAA 1RFNA 1OPHB 3GDUA 3RXLA 1F5KU 2K0QA 3B9FH 1CHOG 1FIWA 2BQ7B 1BRUP 1GVZA 2ZCLP 3BTFE 1TGBA 3U8OH 1B0FA 1A46H 1K1JA 1VGCB 2XC0A 3F0PA 4DGJA 2ZFSA 2J34A 1MABB 5DSFA 1T31A 3TU7H 2SGQE 1P2QA 1Q3XA 1KYNA 3BV9B 3RXDA 1K1OA 3A7ZA 1DPOA 3LJOA 1CBWC 1EAIA 1UTJA 1AKSA 2ZGXH 3ZV9A 1UMAH 4ABGA 1NN6A 3ATWA 1O2MA 5JYIA 1SOZA 2ZPQA 1FZZA 4A92A 3BTEE 2FS8A 1A0JA 2IJD1 4X8UH 1NO9H 4JYVH 1MTNB 2L74A 4IN2A 3A8DA 3M7UA 3SV8A 5BRRE 2A4QA 3TH4H 2GCHG 1O2IA 5EJZA 4CRCA 1J16A 3QGJA 3F2HA 2ASUB 2V35A 3FANA 4Y8YA 3A86A 2H9EH 1QBNA 2Y82A 1SG8B 3OY5U 2J9NA 2IN2A 2OXSA 5JBAS 5HIYA 2HOBA 1J15A 4CR9A 1W14U 4H42U 1L1JA 1C5RA 2BOKA 3UOUA 5E2PA 2UWOA 1O3IA 1MCVA 7GCHF 9ESTA 4ABAA 3BTGE 1EJMA 1KLJH 1P2OA 3M61U 4FUBA 3L3TA 2A32A 3KF2A 2UWPA
chains in the Genus database with same CATH topology
3VPKA 2ZU4A 1GI2A 1O2OA 3G01A 2ZHFH 1Z8RA 2THFB 3BN9A 4YM9A 1K1MA 2P8OB 1W0ZU 3R0FA 4ESTE 3SNBA 1E36B 1O2ZA 2A7CA 1HAHH 1P2MA 1O5CB 2AMDA 4NWKA 2EEKA 5HYOA 1GHZA 1C2IA 4MQAA 4O97A 3ZVEA 4ABDA 1Y59T 1CHGA 3TGJE 2VJ1A 1SQAA 4PROA 1LPZB 1A5IA 2OC1A 2P93A 1ZJDA 4FU9A 1JRSA 1QR3E 1GJBB 2ZGBH 1TBZH 1FV9A 1GJDB 3SBKA 3O8DA 2W3KA 1AWFH 2A7JA 4NIWA 4Y8ZA 1BTUA 2OTVA 1P03A 1O3HA 3P8GA 3TNTA 1O5AB 1FPHH 4X2YA 5J4SA 2A2XH 1AD8H 2H9TH 3LH3A 4HI3A 1OWDA 1AE8H 2VWNA 4AZ2B 2FODA 4D8NA 1LKBA 1C2EA 3RXVA 1GI4A 3JZ2B 1FI8A 4X6PA 1O2PA 5F8ZA 3SJ9A 2H6MA 2SGFE 3GCNA 3LIWA 5AHGH 2ALVA 2BX4A 1GMDF 2WPKS 5A09A 1L1GA 1KLTA 1O3MA 4O03A 3P6ZB 3SNEA 1QGFA 3F9HA 1ZR0A 4ISNA 3CP7A 4BAHB 2A1DB 2ODYB 1Z6JH 1SGCA 3OX7U 4JYTA 1GHXH 3PB1E 4XE4A 3MU4A 1LQDB 1DWBH 3EE0B 1IQIA 2AMQA 1O39A 3QZQA 1DLEA 1CVWH 1O5DH 3PTNA 3F6UH 4X8VH 2XCFA 2OC7A 1MCTA 2PGQB 2FX6A 5GJ4B 5GPIB 3VXEH 1K1PA 3DHKH 4B74A 1UJ1A 1EZUC 1O5GH 4NFEA 1O2JA 2A4RA 1QHRB 3RXAA 4F4OC 3HGPA 6CHAC 1EASA 3RXQA 1P8VC 2H5CA 1IQEA 5DP4A 2XXLA 1VCWA 2UWLA 1BJUA 5I46H 2GDDA 4A1XA 4B1TA 2ZF0H 1PPGE 2GX4A 1TPPA 4WMEA 4E7RG 2HRVA 1J17T 4J2YB 5TCCA 4AFSA 1Y5UT 3GCHC 1O33A 4ZKOU 4BTIB 4Y76A 1TRMA 4ISOA 1BUIA 3MH6A 1KSNA 5C3NA 1GMDG 4K5ZA 3GY4A 1JRTA 4DW2U 1P11E 1HJAB 1WTGH 2QYIA 4I8HA 1WYKA 1O3NA 1JIMA 1EKBB 1NZQH 2ZFTA 1LPKB 1QA0A 1YPHE 4O9VA 2FI5E 3A7WA 5EU8A 3H7TA 1DVAH 2KAIB 2CV3A 3VB7A 1DFPA 5FXLA 1HBTH 3RMMH 1XUFA 1T7CA 4MPWA 3MHWU 3RXHA 2AEIH 1YPJH 1O3PB 1NC6A 3B8JA 3AAUA 1Y5BT 1RXPA 3RXCA 1MKXH 1S6FA 1MKWK 1YCPK 1NS3A 3M5OA 4ABJA 1BOQA 4AGJA 1P05A 4IBLH 3ZZ7A 1NU9A 1SC8U 3DD2H 3Q3YA 3GY5A 2IJOB 4ABFA 3EA8A 3RU4E 3V13A 4RKOB 3TGKE 2QF0A 5E0HA 1H9IE 1W8BH 1AWHB 4JZIA 3M5NA 1ELBA 1ORFA 3A87A 3QK1A 2C8YB 2ZDNA 1GHAG 1A7SA 2OBQA 1AB9C 3RM0H 1TX8A 2GV6A 1GBCA 1MD7A 1CT2E 2FI3E 2VH0A 4NA9H 3SW2B 3ZVAA 1C2HA 1V2RT 1ZPBA 5AFZH 1TWXB 4BAOB 1GJ9B 1O3JA 2VU8E 2SGAA 3UWIA 4AGKA 1LVMA 4ZHLU 4Q7ZA 3SQEE 2W26A 2CHAC 2F9VA 1ANEA 3ENSB 3KQEA 1C2KA 2JKHA 1O3LA 4BAKB 2O8MA 2G52A 1ID5H 3RP2A 4NA8A 3TLOA 3SV9A 1GCTC 1PYTD 4INKA 1BMNH 2SNWA 2D2DA 3B23B 2QXJA 5AFYH 1D3QB 2PUXB 1UK2A 1DY8A 2FTLE 4THNH 1Q2WA 2BDIA 2OQ5A 3STJA 4XDEA 1C5WB 2R9PA 3MNSA 3P17H 2BDGA 1YPMH 2XNIA 1CGJE 1GJ7B 1GBMA 2I6QA 1OP0A 1HCGA 2LNCA 1TGNA 3RDZA 1YGCH 1GI8B 4OS4A 1DXWA 3NUMA 3KIDU 1CA0C 1YLDA 4I8LA 4ZHMU 5C1UA 1BCUH 1BRAA 1XVOA 5LPEA 1QY6A 3QDZB 1HRTH 3E90B 1GHBG 2BZAA 3K9XB 1GHVH 5EPNA 4ZUHA 1G3EA 3A7VA 1IQMA 2BD4A 1CQQA 2B0FA 1V2ST 4I8JA 3U1JB 1RTLA 3RLYH 4RKJB 5E2OA 3P92A 5H4IB 3ZV8A 1V2JT 3PO1B 1MU8B 3FP7E 1F2SE 1O2TA 4KGAA 3K2UA 7LPRA 1G9IE 1EB2A 1K1NA 1XUJA 3GISB 1TABE 4AX9H 1ESBA 5CHAB 3RXPA 2XYAA 1BQYA 2BDYA 4IMZA 3A81A 2ANYA 1O36A 4UONA 2F9NA 1BB0B 2Z7FE 1P02A 3A80A 2VWOA 3DA9B 5A8XA 1P06A 3UUZA 2ZHWH 3TITA 1ANCA 4XBBA 2HPPH 3A7TA 1GDQA 1PPHE 1SGIB 2WPMS 3D49H 2A5KA 1ELAA 1EOLA 1BDAA 2JH5D 1O38A 1LKAA 2GKVE 3W94A 1FLEE 1ANBA 1GJ6A 5FPTA 1C2DA 3TK5A 3SV7A 4DY7B 4TY6A 1JXPA 1IQGA 3A8CA 1P9UA 5FHTA 4Y71A 1BIOA 4MG3A 2A45B 2O8TA 4Y7AA 5DP8A 1Y3WA 3UR9A 1SGRE 4LXBH 2Q6GA 3VXFH 3LONA 1ZRBA 5C2ZA 2FOEA 4FUFA 2R2MB 1O3EA 4UFGH 5GIBA 1O2YA 1OX1A 1GBLA 2VIQA 2GZ8A 2ZNKH 1KXFA 1Y3UA 1P2IA 1LHCH 4VGCB 1GDNA 2BQWB 5PTPA 1TGTA 3S9AA 2QV1A 2V0BA 1GMCF 4GCHF 4DIHH 4U01A 1XX9A 5LH8A 3M3TA 1RIWC 3PMHB 4ABBA 5ABWA 2AYWA 5EW1H 3PTBA 2PKSB 2SGDE 1C5XB 3SQHE 2OP9A 3C27B 1AHTH 1FY4A 4OGYA 1AKSB 2ZFRH 4Z6AH 2BDAA 4NGAH 4Y0ZE 2R0KA 1BRBE 2A5AA 1G30B 3M7TA 4ZROA 4OS2A 5K7RA 2BYAX 4D7FA 4NWLA 1B7XB 2QGRA 2BXUH 1G2MA 5DKMA 1QNJA 2BMGB 1NFWA 2GCTB 5L6NH 2Z3DA 3L6PA 1TRYA 3BIVH 3ODDA 1P3CA 2EI8A 2YOLA 1P01A 2ZU3A 3PLPA 3ZZDA 4I32A 2H2ZA 1PYTC 2PKSC 1GBKA 1RS0A 1GI6A 4D9RA 2CXVA 2H5DA 1ESAA 5C67A 5EODA 3A88A 1GI7B 3SUEA 8LPRA 1GMCG 3KHVA 4GCHG 1XUHA 4AYVB 4AG1A 4B2AA 4UEHH 4ISHH 1GHYH 1AFQB 1AE5A 3FZDA 5HM2A 2GCTC 1HIAA 3ATKA 4E06H 1OYQA 4AG2A 2A31A 2F9OA 2W5EA 1Y3YA 2J4IA 1MH0A 4FUCA 1U6QA 2J92A 3BEFB 3MYWA 3LGVA 6ESTA 1KDQB 2ZGHA 1YF4A 1UK3A 2OD3B 1TOMH 3EA7A 3BTKE 1EXFA 4BNRA 2FLRH 3GYLB 1SHHB 2ZDMA 3GY2A 2VVUA 1TE0A 4X8TH 1GBDA 1LVOA 1AFQC 1O3FA 2WINI 1XXFA 2Y7ZA 3FP6E 1UVPA 4WXVA 1T4UH 2C3SA 1QJ7B 4BANB 4GSOA 4TWWA 3UNRA 1TONA 1C5QA 3NXPA 4K69A 1O0DH 2VIWA 2AIQA 3AW1A 3BSQA 2ZTZA 3UNSA 2QF3A 1YP9A 5IYTA 1DS2E 5AF9H 1C1PA 1NU7B 1THSH 2BDCA 3LPRA 1SGEE 3EA9A 3K6ZA 1GDUA 3ZZ9A 2J94A 4DJZB 2ZG0H 3E1XB 4X2VA 3ZYDA 1Y3XA 4KTUA 4LOYH 2FOHA 1UVUH 1UTLM 1P9SA 1GBIA 4OGXA 2ULLA 1GJ5H 1H9HE 3MO3A 4JCNA 3HKJB 1WQVH 1NRPH 1NT1A 1KY9A 3M5LA 1MMJN 3E91A 3RXBA 1S84A 4HGCA 2XC5A 4U32A 5DP5A 2ZDVH 3RXUA 3Q3XA 5JBBS 1QBOA 1HJ8A 1SPJA 1FY1A 3RUOA 3IG6B 2DUCA 1DDJA 1V2TT 1W11U 3RM2H 3SU6A 1AU8A 3E0PB 1GG6C 2QA9E 4H4FA 3E6PH 1SLXB 1W12U 4HZHA 3RXFA 1UTNA 1CT4E 4WF8A 4KKDA 5GDSH 2V6NA 2ZGCA 1H8IH 4YOJA 1A3BH 3T2NA 5E8EH 1TNLA 1TNJA 2XW9A 3SUDA 2XBWA 1WCZA 1O3BA 2PHBA 5I25A 4X1NU 2G00A 4GAWA 4YLUA 2K1QA 4YT6H 1O32A 2ZHQH 2Y81A 4Q7YA 3IITA 1EZSC 2ZA5A 4CRFA 5EXMA 1TBQH 3TGIE 2GDEH 4TPYA 1SHYA 1P0SH 1F92A 3SNCA 2GD4B 3SORA 5CE1A 8KME2 1Z8GA 1AIXH 3LOXA 1O3OA 1SBWA 3GDSA 1E37B 1G32B 3U8RH 3HK3B 1OYTH 4Q7XA 4B75A 4D7GA 1O3AA 1NRRH 3BTME 2FOGA 4U30A 2BY8X 1BTWA 3ODFA 3LDXH 1QFKH 3K65B 1PPZA 4A5TS 4WXIA 4NIXA 3ATMA 1TGSZ 1P57B 3TJNA 3M7QA 4K60A 1ELVA 1AZZA 1OWHA 3LGUA 1V2NT 1UCYH 1SLUB 1ZMJA 2C93B 2OUAA 3C1KA 2ZGJA 4TWYA 3ZYEA 3SJ8A 3M3SA 4WMFA 3CS7A 1PQ8A 1J9CH 4WH8A 1ZHPA 1ZPCA 2BHGA 3OYPA 3BTTE 1O2NA 5EQRA 2QC2A 3SNAA 4INHA 1HGTH 1NRNH 3S9BA 1NRSH 6LPRA 2FO9A 2Z6BD 3HPTB 1O2WA 4INLA 1LDTT 3E0NB 1N6YA 3VB3A 4AFUA 1FQ3A 2ZEBA 1C2FA 5FBEA 2VIDA 1S83A 3LC3A 4K8YA 2TBSA 2ANKH 3UR6A 4B2BA 5LPRA 3A85A 1C1SA 1QA7A 7GCHG 2WUCA 1QL7A 6GCHF 4KTCA 3UOPA 1O3DA 1BTPA 2ZCKP 5L2ZH 1QJ1B 4TYDA 1N6XA 2BXTH 5HM9A 2VIPA 1K1IA 1QURH 4BTTB 1EB1H 1AQ7A 1IQFA 6CHAB 2R3YA 4MTBA 2Z9KA 2BLVA 3T62A 2FOFA 1T8OA 3RU4D 3MNXA 1D3DB 2DE8A 1HXEH 2WV5A 2B9LA 2XTTB 1V2OT 4JMYA 4X6OA 1F5LA 1C5TA 1G3DA 3GCHB 3BG4B 3RXKA 4ZKRU 1DICA 3M37A 5GXPA 2Y6TA 2GGVB 9LPRA 2BY5X 1SGTA 1GL0E 2FYRA 1TPOA 4K3JA 5F8XA 4FU8A 3P8NA 4MVNA 1C1UH 4CR5A 4DG4A 1AVXA 2OC0A 6GCHG 2ANWA 2BD5A 4XBDA 2WYGA 3PMAB 3URCA 4FUGA 4AB9A 3BG4C 3SU5A 3H5CB 5JPMH 2FEQH 1TPSA 2FP7B 1DXPA 2D1JA 5FPSA 3ZVGA 1TNKA 2ZKSA 4NFFA 1RTKA 7KMEH 1C4Y2 4FVDA 3T5FH 4X1SU 3HK6B 1LCYA 1ARCA 3SUFA 3LC5A 5L30H 1GBBA 3VB6A 5JBCS 2FESH 3A7XA 3F1SB 4I31A 2FI4E 3RMOH 2FTMA 5E0GA 1C1OA 4FU7A 3OSYA 4OS1A 1GVKB 1GMHF 3Q76A 2GZ7A 1O37A 1MAYA 1TLDA 2VB0A 2ZQ1A 1AB9B 1CGHA 4KELA 2G5NA 1GJ8B 3SI3H 1BITA 1QQ4A 3KEEA 1L4ZA 3SNDA 5F6MA 2Q6DA 1GBAA 3RXIA 1FNIA 1KXCA 1T8MA 4HFPB 2CHAB 5K0HA 1TMTH 1DE7H 3GCTF 4GUXA 5A0AE 3O8RA 1OWEA 4MPUA 3SV2H 2P3TB 1HB0B 1SGFA 1ELTA 1MAXA 3V12A 2BLWA 3RXEA 2NU1E 1HAVA 3T27A 1GBJA 1GCTB 2J95A 1IQNA 3OY6U 1SI5H 3L33A 3UWJH 4ZMAH 1WOFA 4FUJA 2F9BH 4MNVA 2RA3A 2HGTH 2GV7A 2Z3EA 3V0XA 3MU0A 1O2GH 2GZ9A 3DUXH 2CF8H 3PLKA 3AAVA 1ZHMA 1ZHRA 1YPHC 4Z0KA 1HV7A 1GMHG 1D6WA 1GI0A 1W10U 1EJNA 4JZDH 1DITH 2ZI2H 1QIXB 2RCEA 1FONA 1O2SA 3MTYA 1MKXK 1CA0B 1LMWB 1BZXE 2AGIX 1RJXB 2VWLA 2TGPZ 1SGDE 1SOTA 4X0WU 3RXTA 1EOJA 2PKAA 2BLOA 3MNCA 3N7OA 2AIPA 4ZHAA 1DY9A 1VCPA 3SZNA 4AN7A 1ZSJA 3GY8A 1BHXF 1TYNA 2ZDLA 5JB8S 3QTVH 2ZDAH 2ZFFH 2XCNA 3LGIA 1NM6A 3E8LA 2WYJA 5EQQA 1MTUA 1V2KT 3U1IB 2SNVA 3BEUA 3UPEA 2SFAA 1BT7A 1Y5AT 1TX6A 2PSYA 2AERH 1SLVB 3QWCH 4CRAA 1ELFA 5ESBA 4A7IB 1N8OC 1O3CA 5JB9S 4YO9A 4ABIA 3SN8A 1HIAB 1BTZA 4DOQA 1LHDH 1NROH 1CGIE 1GJ4H 1VITH 1BBRH 1S5SA 3SO3A 2BDBA 2BVSH 1DSUA 3TIUA 1TNIA 1VJAU 4X8SH 2Z9JA 2NU2E 3F9EA 1SGPE 2FS9A 2A5IA 1QJ6B 1BRCE 4JK6A 3Q77A 4MNWA 1NRQH 3NCLA 2Q6FA 1QBVH 2HVXA 1TB6H 1UCYE 4K1TA 1DM4B 4QT8C 1UHBA 1JMOH 1S0RA 3TJOA 1WAYB 3A8AA 2J38A 1BJVA 1IQKA 3NZIA 2CN0H 1F7ZA 2JETC 1GBHA 1O2KA 3S69A 3D65E 2GT7A 2BVXH 1ABJH 1HAZB 1C5YB 3MNBA 1L4DA 1ZGIA 2BDHA 1B5GH 4X6NA 1RIWB 2BX3A 2Y80A 3GY6A 2Z3CA 1C1TA 1OWJA 2HLCA 3KN2A 3UREA 4X1PU