2HOBA

Crystal structure of sars-cov main protease with authentic n and c-termini in complex with a michael acceptor n3
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Production of authentic SARS-CoV M(pro) with enhanced activity: application as a novel tag-cleavage endopeptidase for protein overproduction
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 90
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2hobA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hobA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hobA02
1UCYK 7KMEH 1C5OH 5EPNA 1P2OA 3ZV8A 5A8ZA 3RXBA 1PQ7A 1Q2WA 4X1PU 3MOCA 3QWCH 4K1SA 1GBEA 1O5GH 3AAUA 4AZ2B 4GPGA 2FYRA 1CGHA 1YPEH 5EG4A 2F9BH 4Z6AH 5FPYA 1L1NA 2AMDA 1AWHB 3A89A 1ZHRA 3IG6B 5AF9H 3ZV9A 1DWEH 3VB4A 2BLVA 2BXTH 1UK2A 1GHBF 1ZRKA 3PWBA 3VPKA 3KQBA 2BD9A 1QB6A 1QCPA 4IC6A 3SNAA 1G9IE 1FN8A 3VB3A 4U2WA 2IPHA 2PKSC 3VEQB 2CJIA 3UNRA 3LGIA 1TRNA 2FX6A 1KLJH 1Z71A 1TONA 1GI3A 2A7CA 1JOUB 1KXDA 1ABIH 1MKWK 2BY7X 1C9TA 1FZZA 1PPFE 1QB9A 4WWYA 1TQ0B 4JZ1A 1SC8U 1WU1A 2ZCKP 3ZVEA 2XC5A 4D9QA 2FX4A 2UWOA 1Z1JA 4K3JA 3KL6A 1C4V2 3E91A 5GCHG 3M36A 3TGIE 4AGJA 2R2WU 1A61H 1O32A 3SV2H 3BTEE 5C5NA 1YPHC 2ZHDA 3M7UA 2FOBA 4CRBA 1LVYA 4OGYA 1AZ8A 3RC6A 3T26A 2STBE 4ZXYH 5T6DA 2TGDA 2BTCE 1GVKB 2SNWA 4KP0A 1E0FD 4B76A 3GDUA 2BLQA 4OS5A 3U1IB 2A5IA 4PROA 7ESTE 1CVWH 1F2SE 1GCTB 1T8NA 4LZ1H 1UTLM 1UK3A 1QBVH 4OS4A 4MVNA 3SU2A 2AERH 3QO6A 5G4BA 3VXFH 2PW8H 5C2ZA 3AVZA 2BXUH 3RXEA 3FP7E 1CHOG 1V2ST 1TQ7B 1Y3UA 2J4IA 2O8WA 4R8TB 1BMNH 2NU0E 1EZUC 2QXHA 3LC3A 2BY8X 2GMTC 2VJ1A 2K1QA 4K1EA 3MO9A 2CMYA 1HAYB 4D8NA 4INHA 4OS7A 2V6NA 5GCHF 2GDDA 3ZYDA 1O2LA 1W12U 4SGAE 1KXEA 1ESAA 2C8WB 1U6QA 3GY3A 1K1MA 4X6PA 2Y5GA 1RGQA 2FIRH 4X2YA 3T5FH 3QTOH 1ELGA 1ZZZA 5E0HA 4AG1A 3BEFB 1MAXA 1PYTC 1GBAA 3RXGA 4B73A 1HIAB 1TBRH 3MNBA 1AVGH 1Z6EA 5DG6A 5FX6A 1RTKA 2XXLA 2TGPZ 1FLEE 1OS8A 1Y5AT 1Y3WA 1HLTH 1C1RA 1O3EA 6CHAB 3F9HA 1OWJA 2AFQB 2SGQE 1O5AB 1P2KA 2TGTA 1IOEA 4IC5A 1BQYA 1X7AC 1GHWH 1J8AA 2JH0D 1EASA 2P8OC 1ZOMA 1KIGH 1B0FA 3V13A 4ZROA 2Q6FA 1MTSA 1CHOF 1L1JA 3S7HB 2FPZA 4R0IA 1NTPA 4IBLH 2VGCB 2P3FH 3LGUA 3ODDA 9ESTA 1W13U 1C5SA 5TJXA 3R3GB 1Z6JH 2J2UA 2CF9H 1YCPK 3D49H 2FWWA 3OYPA 2F3CE 1O3HA 1IQLA 3DFJA 4MDSA 3HGNA 2EI8A 3RMOH 2SNVA 4CRFA 3D23A 3SNEA 2W26A 4FUDA 2VWOA 3T62A 3RLWH 1NPMA 2ZFFH 1A3EH 1QJ7B 4K69A 2OD3B 1SHYA 2F9OA 3MU0A 1G36A 1SGEE 1SQTA 4D7GA 2ZGHA 3A80A 1GI9B 2W3IA 1JMOH 1ELEE 3SGBE 4NFEA 1LKBA 1O37A 1AFQB 1EKBB 4CRGA 2PGBB 1PYTD 2R0KA 3RM2H 2F9VA 1C2LA 1GBBA 4KTUA 3VXEH 3PB1E 5JPMH 1QL8A 1JXPA 2QXGA 3VGCB 1GDQA 1AO5A 1TGNA 1ACBE 3SJ8A 1TGCA 4I8HA 1J9CH 4CR5A 3LGTA 1EP5A 3BTGE 3P6ZB 2ZI2H 1AI8H 3ODFA 3A7XA 3L6PA 1ZJDA 2HNTC 3VB6A 5AFZH 1TX7A 2XYAA 1L2EA 4HTCH 2WPKS 5L6NH 3UNSA 1ELAA 1P12E 2PLXA 3GCTG 3RC5A 1LPKB 1VGCC 1KSNA 2BDHA 2GVFA 1TOCB 2BZ6H 4JZEH 1BTPA 1P01A 2QAAA 1O3AA 1HJAC 2PGQB 1UCYE 2TIOA 5EXNA 2QA9E 1CGIE 2EA3A 1LO6A 1K2I1 2R9PA 5GPIB 2PKSB 2QGRA 3QGJA 4QT8C 2WYGA 1DLKB 3Q00A 4WXVA 1QL9A 3ZZ4A 4JZDH 1EOJA 1GJ5H 1QB1A 1F5KU 2BX3A 1TNKA 1T7CA 1W10U 3A81A 8GCHG 2Z7FE 4XE4A 3ZVCA 1P3EA 1GL0E 1S0QA 3FP8E 3TJOA 1QTFA 1K21H 4IMQA 1H9IE 2BZAA 4YOJA 2PR3A 2C93B 2YNBA 2FI3E 1O5FH 1Z8RA 1S82A 4K60A 5GJ4B 1HIAA 1XX9A 1S0RA 1G3DA 1IHSH 1MBMA 4FUGA 3GCTF 1H9LB 2O8MA 2ALVA 2FODA 1T8MA 1YGCH 1AVXA 1O2GH 2Q1JA 2ZNKH 4UFGH 4AGKA 1YF4A 1Z8JB 2JKHA 3STJA 1S5SA 1EZSC 2CF8H 3BG4B 4KTSA 4XDEA 2BQ7B 4A6LA 3AW1A 1GBJA 5K0HA 2G55A 2Q6GA 5AVDA 1B0EA 2ALPA 3K2UA 2M5TA 1SLWB 3RXQA 4DY7B 1TNHA 5L2ZH 2FMJA 7LPRA 3A8AA 1P03A 3E3TA 5JBCS 3TJVA 1GHXH 2BVXH 2WPLS 3RXHA 1GBTA 1W7XH 2ZF0H 1AB9C 1GBFA 1THRH 4MPUA 4ABBA 2A2XH 2FM2A 2QC2A 3ZZDA 3I29A 2STAE 2GMTB 1EP6A 2Z9IA 4ISNA 2QIQA 4U32A 2ZHEH 1A5GH 1MD7A 2HNTF 3URCA 3RXOA 2Z94A 1Z8GA 1LHEH 3AW0A 2TGAA 4YT6H 3SUEA 4ZMAH 1SGIB 4X6NA 3BTME 2P16A 3C1KA 2BDAA 2UUKB 3LGVA 4ZKNU 3K6YA 1DFPA 3KQDA 4JK5A 2BLWA 1QR3E 1MBQA 1EAXA 1LCYA 1TWXB 5DGJA 1HAOH 5JDUB 5IYTA 1P9UA 1THSH 2GT7A 2A0QB 2OP9A 2BX4A 3SJ9A 4BTTB 4ESTE 3PO1B 4TWYA 1THPB 1HB0B 1F0SA 5EOKA 4IW4E 2LPRA 1TPPA 1J15A 3F9FA 1O2ZA 3BV9B 3L33A 3MNXA 3UQOA 1TB6H 1Q31A 1LPZB 1IQEA 1EPTC 3ZZ5A 1ABJH 3K9XB 2ZWLH 2A31A 1A0LA 1NRSH 5JBAS 2FS9A 3MH4A 3HK3B 5EODA 1HFDA 1NU9A 1FY8E 4ZHLU 1EAUA 3MTYA 1TBZH 1Y8TA 1C5LH 3EE0B 1MTNB 3P92A 2A45B 5EQSA 4O3TA 1CGJE 2I6SA 4XBBA 1ZGVA 1AZZA 1AD8H 1BRCE 2BDIA 2ZG0H 2HVXA 1TA6A 3FZZA 4LXBH 1O3LA 2BD7A 3ZVBA 1K22H 2G81E 1ELTA 1OP8A 2ZU2A 1RTFB 4MQAA 1C5ZB 2BB4A 1GHVH 1O3NA 2FI4E 1ZRBA 5BRRE 1FIZA 1Z8IB 1C1NA 3ZYEA 3M7TA 2EC9H 4MPXA 1EB1H 1LDTT 1MQ6A 2IJOB 2XC4A 2ZHQH 4ABDA 1A1RA 1GI8B 1DWDH 1E38B 1TA2A 4Y10E 4JZFH 3UNQA 1AWFH 1HYLA 2A7HA 3TPIZ 2ZCHP 2BVRH 2PKAB 1ZJKA 1GL1A 1OSSA 1TIOA 2OBQA 5LPRA 4X2WA 1P02A 1HAXB 2ZDNA 1BMLA 2QF3A 1BTYA 1C5VA 1LHCH 5F8XA 4MNWA 3M35A 3BTKE 1H1BA 3RXVA 2F9UA 3A7TA 4BTIB 3M5MA 1TGSZ 4CR9A 4LOYH 3MWIU 2Q6DA 5JBBS 1YKTA 1MCTA 1QGFA 2J92A 1TBQH 3VFEA 4UONA 2F91A 1TNGA 4I7YH 3T28A 4ABIA 1G30B 1LHFH 3SUDA 1EAIA 2VIQA 3LH1A 1IHTH 1G37A 2GT8A 2BMGB 1ANDA 3SU1A 6GCHG 2EEKA 1O2XA 3PROA 3QLPH 1MMJN 5LPFA 1ZPBA 3RUOA 1TGBA 2FYQA 3SHCH 4UD9H 1YBWA 3LJOA 1SGCA 8ESTE 4YT7H 1O3BA 1HRTH 1O3OA 1O3PB 3Q76A 1FPHH 2B8OH 3H7OA 1SSXA 1TAWA 4F4OC 2QF0A 1QNJA 1FIWA 1C2MA 4VGCC 4BTUB 1A3BH 1HNEE 1W11U 1GG6C 1TNLA 1BZXE 1INCA 1GJDB 1NRQH 4BAHB 1O3GA 4E06H 3TJUA 3DFLA 3BN9A 3HATH 4E05H 2FESH 4TPIZ 1FUJA 1YPKH 1FN6A 2OLGA 3A7ZA 2H2ZA 4ZKOU 1A0JA 3V3MA 2GV7A 1V6DA 1NT1A 1T4UH 4ABEA 3SV6A 3FFGA 1SFQB 1SGQE 3LDXH 2RG3A 1LMWB 3RP2A 1AB9B 1QA7A 4I8JA 5FBEA 3P70B 1EOLA 5ABWA 6GCHF 3M5NA 4DIHH 1S83A 1HUTH 2FO9A 3K65B 1ORFA 3SHAH 3EA7A 5E2OA 2OQ5A 2ZIQH 2G8TA 1P2MA 5GIBA 3M37A 2A1DB 1TX6A 3HKIB 1ANCA 1FY5A 1LQEA 1O2KA 2LIZA 3BTQE 1HBTH 1UTNA 3MFJA 1HV7A 2GDEH 3QZRA 3WY8A 3TH2H 3EYDA 3M3VA 1O2SA 1P2NA 4JMYA 3NKKA 4THNH 2BHGA 2AIQA 1J16A 5T3HA 1BMMH 2DUCA 1ZSLA 1MZDA 2A4OA 2Y82A 4BAKB 1LHDH 4B2AA 1N8OC 1D3PB 1S84A 4ZH8A 4BXSA 3LGWA 3EDXB 3LIWA 2RDLA 2VIOA 3OY6U 5C5OA 1BJVA 1E37B 4ISLA 1WQSA 1XM1A 2ZU4A 5JB8S 2ZQ1A 5ETXA 3RMMH 4Y0ZE 1Y3VA 6ESTA 1GPZA 1PPZA 2PKAA 2BQ6B 1ARCA 1BBRH 3GDSA 3RU4T 2Z9LA 1DSTA 3D62A 4XFQA 2ZFSA 1AKSA 5DJ7A 1W0ZU 1HPGA 5A0BA 1TABE 2PUQH 1DANH 1HGTH 1GHAG 2OC1A 2UWPA 1YP9A 2B0FA 3SU6A 3RXLA 1GWAA 1NFYA 1UVOA 4Y71A 1O2RA 4UFEH 3KN2A 1BT7A 2C8ZB 3F1SB 1C1UH 1E34B 2PHBA 2ULLA 1SGYE 3PMHB 4OS1A 1S6FA 2ZGBH 1K1OA 4MPWA 1SOZA 2C90B 4MNVA 2ZDLA 1WV7H 3V0XA 3P95A 1O3DA 3BSQA 3V7TA 1XXDA 1H8IH 1W0YH 1CO7E 1NESE 5HM9A 1QBOA 4DJZB 1GI1A 1C1QA 2ZU1A 4HZHA 1GVZA 1WUNH 2ZCLP 3DD2H 3RXPA 1ELFA 3BF6H 3LH3A 4WY3A 1TMUH 1T32A 3UR6A 2FXRA 1KXCA 1GI5A 4FXGH 2QCYA 2TPIZ 2HNTE 2Z3DA 1BTHH 3A86A 3SV9A 2F9NA 1PQ5A 1ZGIA 3BIUH 1GHAF 1AHTH 1MKXH 3RXFA 3SU5A 1VZQH 1TX8A 1EAWA 2BQWB 4H6SB 2C8YB 4NG9H 4WVPE 1V2PT 1QFKH 1O39A 1O2VA 1GCDA 2A4GA 2ODPA 4JZIA 1BA8B 5FPSA 2SFAA 1GBLA 3RXCA 1MQ5A 2XBYA 1AFEH 1XUFA 3BEUA 4NIYA 5DP9A 3QUMP 1BRAA 1Z1IA 3MU1A 2WINI 2UUYA 2VIPA 3RXDA 1AUTC 3P8FA 2QN5T 1S6HA 1UTMA 1DY9A 1M9UA 1BJUA 4Y7AA 4CRAA 3RMLH 1EJNA 3S69A 2AS9A 1C9PA 2GZ9A 4NZQA 1V2JT 3TJNA 1JRSA 3E0NB 3NPSA 2A4QA 1KXAA 3GOVB 1SQAA 2GGVB 3GCOA 3GY4A 1UHBB 3KF2A 1VJ9U 2BY9X 3M5LA 1BBRK 3F9EA 1F7ZA 1SGDE 1UVSH 3R0FA 1MUEB 1CBWC 1GJBB 3SOSA 1FV9A 1DICA 2B9LA 1C5MD 3SQEE 1TNIA 1BOQA 5A09A 1Y5UT 1AE8H 2VH6A 1A2CH 3BTTE 1GGDC 2XCFA 3RXMA 4Y8YA 4HI3A 4K2YA 3PWCA 1GBHA 3SV8A 1O5BB 3KCGH 1SLXB 3GDVA 3BTHE 3C27B 1GHYH 3STIA 4ZHMU 4ABFA 4X1RU 2Y7ZA 2AGEX 2V3OH 4I8KA 1G2LA 1RTLA 1HJ8A 2A5AA 1G3CA 1DITH 1OOKB 1A4WH 2FS8A 2J94A 1BRBE 2FOEA 5FXLA 5E2PA 4FUIA 5E0JA 1P05A 3E6PH 1BIOA 4NIWA 1O5EH 2H9TH 1KXFA 3TGKE 1ZYOA 4X8UH 3NXPA 5FHTA 5EU8A 3A87A 4NWLA 1C2GA 3MU5A 1P9SA 1FAXA 5A0CA 1H9HE 4J1YA 2UWLA 5EQRA 1SGNE 3NCLA 1YM0A 2C4FH 4ABJA 5CHAC 4I8GA 4NIVA 2OC8A 1DX5M 3QDZB 4OS2A 2Y81A 1UK4A 2ANWA 2V35A 2A7JA 2OQUA 4NSYA 2UUFB 2ZDVH 1GI6A 4RSPA 1QJ6B 3MMGA 1NC6A 1DS2E 1S81A 2D2DA 2BVSH 5C67A 1L0ZA 1F0UA 4DOQA 1F92A 2P3UB 4UEHH 5F6MA 1TPAE 2B5TB 5F03A 1P11E 1C1MA 4K1TA 3URDA 2VIDA 2ZDAH 1HDTH 2H9HA 3CP7A 1C5NH 1CA0C 1NROH 1PPBH 2FTMA 4FVBA 4X2VA 1GMHG 4B74A 4NA8A 1FDPA 3V12A 1EZXC 2Y7XA 3UPEA 4GCHF 1NS3A 1IQGA 4AFQA 2FI5E 2LNCA 2PTNA 4ABAA 4INKA 1K1LA 5F8ZA 3A82A 3LONA 2W7SA 5ESTE 2J38A 2VIVA 1SGTA 3LJJA 4NA7A 4BAMB 1DSUA 2BD8A 3LOXA 1QA0A 1P04A 2ODYB 1C5PA 3M61U 4XSKU 2NWNA 1SGRE 3MO3A 2XC0A 2Z9JA 1FJSA 3B9FH 1RJXB 2HALA 1D6RA 3N7OA 3TK6A 4Y8ZA 1O2TA 1D3DB 3OY5U 3M5OA 3SNBA 1MU8B 1O2JA 4CH2B 2EI7A 3UFAA 3UR9A 8LPRA 1HAVB 5DP3A 3EAJA 2Z9GA 2I6QA 1H4WA 3S7KB 3P17H 5B6OA 1GMCF 2HGTH 1AU8A 1NFUA 2VVUA 1FY4A 1GJ7B 3T29A 2ZU3A 1GMHF 1DPOA 1V2LT 1UHBA 5A8XA 4NGAH 2FLBH 1WAYB 2VWMA 4RKJB 1Y3XA 2XBVA 4MNYA 1QIXB 1UVTH 1C2IA 2HRVA 3MH6A 2XBXA 5HMAA 3TH4H 2FLRH 4KGAA 3DT0H 1P10A 3A7WA 1DY8A 2O8UA 2DE9A 4A1VA 2ZQ2A 1DXPA 1K1PA 5FPTA 5DO4H 2PTCE 1SHHB 2WV4A 1YCPM 3GY6A 4BAQB 3S9CA 2ZGXH 3RXIA 1CE5A 3SORA 2SGAA 4FUEA 1RS0A 2QYIA 4GLYA 1P3CA 3GY2A 1DT2A 2TRMA 3LPRA 4ABGA 3T27A 1ELVA 1DLEA 2P8OB 3A8BA 3SJIA 4UE7H 2THFB 2D1JA 1CU1A 3PTNA 1QRZA 5L2YH 3QTVH 4F49A 3UREA 3HPTB 4Y0YE 5GWZA 1WQVH 3TU7H 1IQHA 5EXLA 4D7FA 3KNXA 1OWDA 1XVOA 3ZZ9A 1TGTA 1O2OA 4CBOA 1GJCB 1W3CA 1SVPA 3A8DA 2R3UA 1ZTKA 1BCUH 1EUFA 4AFUA 1O34A 3M3TA 3E0PB 2W5EA 1YPLH 3PMJA 1P06A 3LC5A 3Q3YA 1T4VH 1FONA 1TPOA 1SPJA 2BDBA 4FVDA 1VITG 1BDAA 1CT2E 1UO6A 3JZ2B 4Q80A 3A88A 5FCRA 2BY5X 3SNDA 1IQFA 5C3NA 3SUGA 1O2MA 4A92A 5EW2H 1EZQA 5CMXH 1CBWB 2Z3CA 3QGNB 4B1TA 2J9NA 4KELA 5DP7A 3PLPA 1O2UA 2FP7B 4AFSA 4Q2KA 3HGPA 3RXSA 1C2DA 3GY8A 1VITH 3K6ZA 4SGBE 2ZDKA 4WJG2 5DK1A 1KLTA 2H6MA 2ZFQH 4NWKA 1L4DA 2VINA 3NUMA 2D8WA 1ZSJA 4WMFA 3MYWA 5FX5A 2BOKA 2O8LA 4Y6DA 3ZZ3A 1GDNA 1B7XB 3BEIB 4Y76A 1GCTC 1RRKA 3F6UH 4A1XA 1SI5H 5HYOA 4DCDA 1ELCA 5J4QA 1NN6A 1GJ9B 1V2TT 5T6FA 4MLFB 1BBRE 4CHAC 1ZMJA 4X2XA 1SLUB 2ZO3H 4YESB 1Y3YA 3MH7A 4WXIA 2CHAC 1VJAU 3RU4D 2B7DH 5EXMA 1MAYA 4DW2U 3W95A 1ESBA 1VITF 1FXYA 1O3MA 2C8XB 3QZQA 3SU4A 1O2YA 5TCCA 1AKSB 1GBDA 1GI7B 3EGKH 1TMTH 1O5CB 5AHGH 4FUCA 3SO3A 3E16B 3U8OH 1VGCB 3D65E 4WMDA 3LGYA 2G5NA 4M7GA 1PJPA 1HAVA 1J17T 2H5CA 3RMNH 1HJAB 1SG8B 3H5CB 1HAHH 1XUIA 4MNXA 1BMAA 1O2QA 1ZTLA 2FOCA 1AGJA 5C1UA 3GYLB 1GVLA 1ELBA 1EQ9A 1SGFG 4AG2A 1C2EA 3TNTA 3H7TA 2BD2A 3ZVAA 4KKDA 2HPQH 1A5HA 6CHAC 3SBKA 5DP6A 4AN7A 1C5UA 4K8YA 1CHGA 1GJAB 4IMZA 1D3TB 1NRRH 3GCNA 1O2HA 5AFYH 2VGCC 1C5RA 1FPCH 4X8TH 5FBIA 1WYKA 3RXRA 1N1LA 1TYNA 4JYTA 4K8BA 2P93A 2GP9B 4Z0KA 2G4TA 1YPHE 4BANB 3UOPA 1TRMA 2VU8E 2WPHS 1C5XB 1LTOA 2VWNA 3OU0A 5ESBA 4D9RA 3S9BA 1O2NA 4LK4A 3ZZBA 1UMAH 1OPHB 1XUKA 1NRNH 2V3HH 3S9AA 1BTWA 3BG8A 8KME2 1OXGA 4O03A 1O3JA 1MZAA 4B75A 1FI8A 1IQMA 1ETSH 2Z9KA 2GCHG 4GSOA 1LVBA 1C1VH 2SGFE 1AQ7A 2Z6BD 4ZKSU 3UOUA 2ZKSA 2ZC9H 4A7IB 1AFQC 4OS6A 2GTBA 3VB5A 4YLUA 3ATMA 5CE1A 4TY7A 1D9IA 9LPRA 1TOMH 3M7QA 2ILNA 5JB9S 3VGCC 2ZA5A 2ODQA 2QXIA 3BTDE 3GCHC 3O8CA 1RD3B 4ZUHA 2HOBA 4Q7YA 4DIIH 1C2HA 1DDJA 4LZ4B 2XW9A 4X8SH 4YZUA 4BAOB 1BHXF 2GKVE 2OINA 4ABHA 1WCZA 1V2RT 4DVAU 1C5QA 1P0SH 3P8OA 1XUGA 4NSVA 1TPSA 2A32A 2P95A 3PV4A 1G3BA 3PTBA 3PLKA 1KTTB 2Y6TA 1UTQA 3GYMA 1FY3A 1EJMA 1BB0B 4YOGA 4Y7BA 2V0BA 2C3SA 2GCHF 1DWCH 1NY22 2RA3A 1O31A 2AMQA 1SQOA 2RCEA 4JYUH 3HK6B 1TNJA 1O2IA 2ANMH 4UFDH 1RIWC 3ZZ8A 5C20A 5E8EH 2F83A 3RXTA 2ZECA 2PSYA 1KDQA 3E8LA 2ZGJA 5A2MH 3NZIA 3ATIA 1XKBC 2GZ8A 1P09A 1O3FA 1CT0E 4YLQH 1EPTB 2ZFRH 4BNRA 2ZPQA 3GY7A 4AORA 2Y5FA 2BDYA 5J4SA 3Q3KA 4Y11E 1F0TA 1GDUA 2HWLB 3MHWU 2HLCA 1SR5C 1T8LA 1YCPH 3B23B 1D6WA 4FUHA 4ZKRU 2UUJB 3TK9A 3AASA 3TITA 1T8OA 2ZDMA 1G2MA 5L30H 3LKWA 4FUJA 2CGAA 2WPIS 1LVOA 1XMNB 5E0GA 5A8YA 1E36B 5HGGA 3S0NA 3NWUA 1FMGA 4OGXA 7GCHG 3RXKA 4IGDA 3SN8A 4RKOB 1OWEA 1P2IA 3KGPA 3L3TA 1JIRA 1FAKH 3W94A 1DE7H 2BYAX 1JWTA 4CRDA 1A5IA 4DGJA 1EJAA 3BG4C 1O3CA 2DE8A 4FUBA 4NA9H 2ZTZA 4ZHAA 1K9OE 1W7GH 4A5TS 3M3SA 1GI0A 4CHAB 2ZPSA 1PFXC 1GBIA 1G32B 3MNSA 3UTUH 1JBUH 3RLYH 1ZLRA 3KHVA 4WMEA 4RN6A 2CHAB 1S85A 3LT3A 1YC0A 1OP2A 1GJ6A 4X0WU 4TPYA 3PLBA 2NU3E 2ZFPH 5SGAE 2FOAA 3TIUA 1WSSH 1XUJA 1NM6A 1ZMLA 2AEIH 2AIPA 1UJ1A 1A46H 4NFFA 1LQDB 1BHXB 1A7SA 1CSOE 5T6GA 1UVUH 1LPGB 2GX4A 3UUZA 2G5VA 7GCHF 1E35B 1GMDG 4I33A 1UVPA 1FNIA 3ZZCA 2KAIB 1F5RA 3PMAB 2XWBI 4I31A 3P8NA 1C1WH 1ID5H 4O97A 1YLDA 1HAGE 1ZHPA 1HCGA 2VH0A 1ETTH 1W2KH 3PO1C 1KY9A 1LHGH 3TGJE 2OTVA 1O3IA 2SGPE 4TY6A 2A2QH 1CQQA 3SV7A 1N6XA 1BRUP 1V3XA 1EX3A 1ZMNA 3ATWA 2QY0B 3P8GA 2CN0H 4GHTA 3MNCA 4XBCA 1L4ZA 1RFNA 4MPVA 1ANEA 1QY6A 3G01A 1C4Y2 2J95A 4YO9A 3BIVH 4K5ZA 4E7RG 2AGIX 2YNAA 1C1TA 5DKMA 3SJKA 1G3EA 5HXFA 1GMDF 2AYWA 4B2CA 2G4UA 4Q7XA 4VGCB 3I78A 1MTNC 5JYIA 5LH8A 1GG6B 3FVFB 3OX7U 2H1UA 1NFXA 3U8RH 1HXFH 1AE5A 4HFPB 1GJ8B 4XOJA 1PQAA 5DP8A 3T25A 1NU7B 4X6MA 1CT4E 1NRPH 2ZFTA 4X1QU 5C1XA 1L1GA 2BM2A 4MG3A 5EW1H 4NIXA 1HXEH 2ANYA 3A7YA 1LVMA 1C1PA 1QRWA 1B5GH 2GV6A 2OCVB 4YM9A 4A1TA 5FCKA 2BDCA 4AYVB 2FOMB 3JZ1B 5K7RA 1EPTA 1GJ4H 1WTGH 4DG4A 3EA8A 1PPHE 4U30A 2OBOA 4GCHG 2FOGA 2QXJA 2VVVA 1AUJA 2WV5A 3VB7A 3T2NA 3GCHB 4GAWA 1O0DH 5LGOA 1WOFA 4I32A 1SBWA 1WTHD 3ZZ6A 4H6TA 2JETC 1YPJH 2PV9B 1MKXK 1UTPA 2O9QA 4GUXA 1VCPA 4AOQA 2VB0A 1GI2A 1QBNA 1K1IA 1RXPA 3O8RA 3BTFE 4CBNA 3DUXH 3UQVA 3TLOA 2R2MB 3O8DA 1PPCE 1SLVB 1C5WB 1AIXH 1GI4A 5JBTA 2NU2E 1TALA 4NZLA 1C4U2 1O35A 1SGFA 1YPGH 5I25A 6LPRA 1P2JA 1BTXA 3RU4E 2ZU5A 4CRCA 2PWXA 1QRXA 2ZEBA 3FAOA 3KQEA 1GMCG 1N8OB 1V2KT 3OSYA 4FU7A 1PPGE 1GBCA 1O2PA 1RIWB 3B8JA 2XBWA 3A83A 2YOLA 4X6OA 1UTKA 1V2WT 5DP4A 4ZAEA 4UDWH 4KTCA 1O38A 1SOTA 1QQ4A 1TE0A 1ARBA 2XRCA 2ZHFH 5IDKA 3CS0A 3E1XB 4YOIA 4BXWA 3SI4H 1KTSB 3UWJH 4ASHA 3IITA 2EI6A 3SUFA 3PYHA 3KQCA 1P2QA 1IQKA 3QN7A 2KAIA 1ZPCA 5I46H 2GCTC 2WUCA 3DHKH 1MTWA 1DVAH 1F5LA 2R3YA 1OWKA 2PUXB 5GXPA 1FQ3A 1PPEE 1OYTH 2PSXA 3HKJB 1SFIA 4H42U 1NZQH 4Y8XA 1J14A 5DP5A 4AFZA 4NCYA 4GVUA 3RXJA 1YLCA 1KXBA 4X1SU 3SU3A 3SGAE 2WYJA 2ZGCA 4U01A 3QX5H 4HGCA 1TLDA 1C1OA 1MTVA 2ZP0H 4FU8A 4WF8A 2BOHB 2FZZA 1DWBH 3A8CA 2P3TB 1O33A 3F68H 3U9AH 1YPMH 2JH5D 3U8TH 4I8LA 1AVWA 5HM2A 8GCHF 2W7UA 5EGMA 4IN1A 5PTPA 4AYYB 4IN2A 3QK1A 4XBDA 3MH5A 1ZSKA 1XKAC 3CENA 1T31A 2SGDE 1O36A 1XVMA 1F0RA 4ISIH 2OUAA 3SQHE 3EBNA 2BD5A 1O30A 3ZZAA 1V2VT 2VWLA 2H5DA 3SI3H 1BUIA 3ZVDA 2XTTB 1Y59T 1K1JA 1TRYA 4O9VA 1VR1H 1ZTJA 4Y79A 5EQQA 2ZPRA 4INLA 1MTUA 1O2WA 4AB9A 4J2YB 4DT7B 1MH0A 1ANBA 3UY9A 1VCWA 1FY1A 1HAZB 3UIRA 1BTZA 2J34A 3LU9B 1IAUA 2CV3A 2AMPA 1Z7KA 5EPYA 5TCAA 1C5YB 4ISHH 2FOFA 2G00A 1XUHA 1KLIH 2JH6D 1CA8B 3RDZA 5FAHA 3PM3A 4UFFH 2PFEA 1SB1H 2IN2A 3O8BA 2F9PA 2VNTA 2SGEE 3E90B 3PMBB 2OC7A 1DM4B 1IQJA 3FZDA 1MCVA 2BY6X 4FUFA 4WH6A 1QHRB 1Y5BT 2VVCA 3CS7A 3ZVGA 3ZVFA 2ZTXA 3U98H 3DA9B 5DPAA 3EA9A 4FU9A 1YYY1 1UTOA 3ATKA 1GBKA 4MTBA 4DURA 1DUEA 2NU1E 2AGGX 1GGDB 4TYDA 1ZPZA 5BPEA 1KYNA 1H8DH 4IS5A 3SW2B 2K7XA 4ISOA 3ENSB 1V2OT 1ETRH 1OWHA 2RA0A 4B2BA 2G52A 2H9EH 1V2QT 3FANA 4JK6A 5F8TA 1SL3A 3MU8A 2XWAA 2FTLE 1VCQA 2A4RA 3BTWE 1HJ9A 3GICB 3SGQE 3U1JB 2FOHA 1EB2A 1NO9H 1KDQB 1EATA 1IQIA 1AMHA 4JCNA 3KIDU 2WUBA 1C2KA 1UCYH 1W8BH 3OTJE 2TBSA 4X8VH 1QL7A 4X1NU 2QV1A 1LKAA 3A7VA 4WH8A 4ZXXH 1C2FA 3MI4A 2VIWA 3NK8A 1SGPE 2JETB 3KEEA 5H4IB 4D76A 4BOHA 3RXAA 3Q77A 2P94A 2D26C 5CHAB 3RXUA 3ESTA 1ELDE 2O8TA 1TMBH 3A84A 1D4PB 1EXFA 3A85A 1W14U 3TH3H 2BD3A 1PQ8A 1MD8A 1OP0A 3FP6E 4CH8B 4O3UA 1C2JA 4JYVH 1O5DH 2XNIA 2ESTE 3IWMA 2BD4A 2Y5HA 2CXVA 3TVJB 1A0HB 1K28D 1MU6B 2Z3EA 1JIMA 1BITA 1MKWH 1CA0B 1HAPH 3SNCA 3I77A 1QJ1B 2OXSA 2FDAA 1SMFE 3ITIA 1P8VC 1AY6H 3GISB 3ATLA 3UWIA 1JRTA 1NFWA 3TK5A 4H4FA 4E7NA 1Q3XA 2G51A 1ESTA 3ELAH 1V2MT 1DOJA 4YTAA 1GBMA 2ANKH 1AN1E 1V2UT 1P57B 4Q7ZA 2OC0A 1BTUA 3ZZ7A 1XXFA 2HPPH 1N6YA 2W3KA 4B71A 4CREA 5A0AE 1O3KA 1DUAA 3MO6A 2ASUB 5LPEA 2IOTA 2WPJS 3RC4A 2GCTB 2ZHWH 2XCNA 1OWIA 1OKXA 1IQNA 2Y80A 1ZR0A 1QURH 2P59A 1GHBG 1DXWA 1UTJA 2BDGA 3SZNA 2BLOA 2R0LA 3SJOA 1GHZA 4AB8A 5GDSH 1D3QB 1OYQA 3RM0H 2WPMS 3TNSA 2AH4X 3SU0A 1V2NT 1TFXA 1WBGB 1ZHMA 4TWWA 3EQ0H 3GY5A 3Q3XA 1C1SA 4GHQA 2FEQH 5C1YA 3MU4A 2ZTYA 1QQUA 2ZZUH 4AX9H 3F9GA 1HAIH 1OX1A 1K1NA 1C5TA 3U69H 2A5KA 2GD4B 2GZ7A 3AAVA 2NU4E
chains in the Genus database with same CATH superfamily
1UCYK 7KMEH 1C5OH 5EPNA 1P2OA 3ZV8A 5A8ZA 3RXBA 1PQ7A 1Q2WA 4X1PU 3F0OA 3MOCA 3QWCH 4K1SA 1GBEA 1O5GH 2LP6A 3AAUA 4AZ2B 4GPGA 2FYRA 1CGHA 1YPEH 5EG4A 2F9BH 4Z6AH 5FPYA 1L1NA 2AMDA 1AWHB 3A89A 1E79D 5C17A 1ZHRA 3IG6B 5AF9H 3ZV9A 1DWEH 1EFRD 3VB4A 2BLVA 2BXTH 1UK2A 1GHBF 1ZRKA 3PWBA 3VPKA 3KQBA 3SZEA 2BD9A 1QB6A 1QCPA 4IC6A 3SNAA 1G9IE 1FN8A 3VB3A 4U2WA 2IPHA 2PKSC 3VEQB 2CJIA 3UNRA 3LGIA 1TRNA 2FX6A 1KLJH 2GD4B 1Z71A 1TONA 1GI3A 2A7CA 1JOUB 1KXDA 1ABIH 1MKWK 2BY7X 1C9TA 1FZZA 1PPFE 1QB9A 4WWYA 1TQ0B 4JZ1A 1SC8U 1WU1A 2ZCKP 3WW7A 3ZVEA 2XC5A 4D9QA 2FX4A 2UWOA 1Z1JA 4K3JA 3KL6A 1C4V2 3E91A 5GCHG 3M36A 3TGIE 4AGJA 2R2WU 1A61H 1O32A 3SV2H 3BTEE 1COWD 5C5NA 1YPHC 2ZHDA 3M7UA 4Q4LA 2FOBA 4CRBA 1LVYA 2HLDD 4OGYA 1AZ8A 3RC6A 3T26A 2STBE 4B6EA 4ZXYH 5T6DA 2TGDA 4XD7D 2BTCE 1GVKB 2SNWA 4KP0A 1E0FD 4B76A 3GDUA 2BLQA 4OS5A 3U1IB 2A5IA 4PROA 7ESTE 1CVWH 1F2SE 1GCTB 1T8NA 4LZ1H 1UTLM 1UK3A 1QBVH 4OS4A 4MVNA 3SU2A 2AERH 3QO6A 5G4BA 1NBME 3VXFH 2PW8H 5C2ZA 3AVZA 2BXUH 3RXEA 3FP7E 1CHOG 1V2ST 1TQ7B 1Y3UA 2J4IA 2O8WA 4R8TB 1BMNH 2NU0E 1EZUC 2QXHA 3LC3A 2BY8X 2GMTC 2VJ1A 2K1QA 4K1EA 3MO9A 2CMYA 1HAYB 1S6LA 4D8NA 4INHA 4OS7A 2XOKD 2V6NA 5GCHF 2GDDA 3ZYDA 1O2LA 1W12U 4SGAE 1KXEA 1ESAA 2C8WB 1U6QA 3GY3A 1K1MA 4X6PA 2Y5GA 1RGQA 2FIRH 4X2YA 3T5FH 3QTOH 1ELGA 1ZZZA 5E0HA 5EJZA 4AG1A 3BEFB 1MAXA 1PYTC 1GBAA 3RXGA 4B73A 1HIAB 1TBRH 3MNBA 1E1QD 1AVGH 1Z6EA 2KCOA 5DG6A 5FX6A 1RTKA 2XXLA 2TGPZ 1FLEE 1OS8A 1Y5AT 1Y3WA 1HLTH 1C1RA 1O3EA 1SKYE 6CHAB 3F9HA 1OWJA 2AFQB 2SGQE 1O5AB 1P2KA 2TGTA 1IOEA 4IC5A 1BQYA 1X7AC 1GHWH 1J8AA 2JH0D 1EASA 2P8OC 1ZOMA 1KIGH 1B0FA 3V13A 4ZROA 2Q6FA 1MTSA 1CHOF 1L1JA 3S7HB 2FPZA 4R0IA 1NTPA 4IBLH 2VGCB 2P3FH 3LGUA 3ODDA 9ESTA 1W13U 1C5SA 5TJXA 3R3GB 1Z6JH 2J2UA 2CF9H 2OK5A 1YCPK 3D49H 3FN8A 2FWWA 3OYPA 2F3CE 1O3HA 1IQLA 3DFJA 4MDSA 3HGNA 2EI8A 3RMOH 2SNVA 4CRFA 3D23A 3SNEA 2W26A 4FUDA 2VWOA 3T62A 3RLWH 1NPMA 2ZFFH 1A3EH 1QZ8A 3W1EA 3AK5A 1QJ7B 4K69A 2OD3B 1SHYA 2F9OA 3MU0A 1G36A 1SGEE 1SQTA 4D7GA 2ZGHA 3A80A 1GI9B 2W3IA 1JMOH 1ELEE 3SGBE 1OHHD 4OM9A 2LELA 4NFEA 1LKBA 1O37A 1AFQB 1EKBB 4CRGA 2PGBB 1PYTD 2R0KA 3RM2H 2F9VA 1C2LA 1GBBA 4KTUA 3VXEH 3PB1E 5JPMH 1QL8A 1JXPA 2QXGA 3VGCB 1GDQA 1AO5A 1TGNA 1ACBE 3SJ8A 1TGCA 4I8HA 1J9CH 4CR5A 3LGTA 1EP5A 3BTGE 3P6ZB 2ZI2H 2W6ID 1AI8H 3ODFA 3A7XA 3L6PA 1ZJDA 2HNTC 3VB6A 5AFZH 1TX7A 2XYAA 1L2EA 4HTCH 2WPKS 5L6NH 3UNSA 2QF4A 1ELAA 1P12E 2PLXA 3GCTG 3RC5A 1LPKB 1VGCC 1KSNA 2BDHA 2GVFA 1TOCB 2BZ6H 4JZEH 1BTPA 1P01A 3PRBA 2QAAA 2KX4A 1O3AA 2K0QA 1HJAC 2PGQB 1UCYE 2TIOA 5EXNA 2QA9E 1CGIE 2J97A 2EA3A 1LO6A 1K2I1 2R9PA 5GPIB 2PKSB 2QGRA 3QGJA 4QT8C 2WYGA 1DLKB 3Q00A 4WXVA 5KEDA 1QL9A 3ZZ4A 4JZDH 1EOJA 1GJ5H 1QB1A 1F5KU 2BX3A 1TNKA 1T7CA 1W10U 3A81A 8GCHG 2Z7FE 4XE4A 3ZVCA 1P3EA 1GL0E 1S0QA 4Q63A 3FP8E 3TJOA 1QTFA 1K21H 4IMQA 1H9IE 2BZAA 4YOJA 2PR3A 2C93B 2YNBA 2FI3E 1O5FH 1Z8RA 1S82A 4K60A 5GJ4B 1HIAA 1XX9A 1S0RA 1G3DA 1IHSH 1MBMA 4FUGA 3GCTF 1H9LB 2O8MA 2ALVA 2FODA 1T8MA 1YGCH 1AVXA 1O2GH 2Q1JA 2ZNKH 4UFGH 4AGKA 1YF4A 1Z8JB 2JKHA 3STJA 1S5SA 1EZSC 2CF8H 3BG4B 4KTSA 4XDEA 2BQ7B 4A6LA 3AW1A 1GBJA 5K0HA 2G55A 2Q6GA 5AVDA 1B0EA 2ALPA 3K2UA 2M5TA 1SLWB 3RXQA 4DY7B 1TNHA 4ACAA 2IJD1 5L2ZH 2FMJA 7LPRA 3A8AA 1P03A 3E3TA 5JBCS 3TJVA 1GHXH 2BVXH 2WPLS 3RXHA 1GBTA 1W7XH 2ZF0H 1AB9C 1GBFA 1THRH 4MPUA 4ABBA 2A2XH 2FM2A 2QC2A 3ZZDA 3I29A 2STAE 2GMTB 1EP6A 2Z9IA 4ISNA 2QIQA 4U32A 2ZHEH 5C0UA 1A5GH 1MD7A 2HNTF 3URCA 3RXOA 2Z94A 1Z8GA 1LHEH 3AW0A 2TGAA 4YT6H 3SUEA 4ZMAH 1SQRA 1SGIB 4X6NA 3BTME 2P16A 3C1KA 2BDAA 2UUKB 3LGVA 4RT1A 4ZKNU 2JJ1D 3K6YA 1DFPA 3KQDA 4JK5A 2BLWA 1QR3E 1MBQA 1EAXA 1LCYA 1TWXB 5DGJA 1HAOH 3UB0A 5JDUB 5IYTA 1P9UA 1THSH 2GT7A 2A0QB 2OP9A 2BX4A 3SJ9A 4BTTB 4ESTE 1WXRA 3PO1B 4TWYA 3F2FA 1THPB 1HB0B 1F0SA 5EOKA 4IW4E 2LPRA 1TPPA 1J15A 3F9FA 1O2ZA 4ASUD 3BV9B 3L33A 3MNXA 3UQOA 1TB6H 1Q31A 1LPZB 1IQEA 3PRDA 1EPTC 3ZZ5A 1ABJH 3K9XB 2ZWLH 2A31A 3KYFA 1A0LA 1NRSH 5JBAS 2FS9A 3MH4A 3HK3B 5EODA 1HFDA 1NU9A 1FY8E 4ZHLU 1EAUA 3MTYA 1TBZH 1Y8TA 1C5LH 3EE0B 1MTNB 3P92A 2A45B 5EQSA 4O3TA 1CGJE 2I6SA 4XBBA 1ZGVA 1AZZA 1AD8H 1BRCE 2BDIA 2ZG0H 2GJGA 2HVXA 1TA6A 3N7DA 3FZZA 4LXBH 1O3LA 2BD7A 3ZVBA 1K22H 2G81E 2RFKC 1ELTA 1OP8A 2ZU2A 1RTFB 4MQAA 1C5ZB 2BB4A 1GHVH 1O3NA 2FI4E 1ZRBA 5BRRE 1FIZA 1Z8IB 1C1NA 3ZYEA 3M7TA 2EC9H 4MPXA 1EB1H 1LDTT 1MQ6A 2IJOB 2XC4A 2ZHQH 4ABDA 1A1RA 1GI8B 1DWDH 1E38B 1TA2A 3DSPA 4Y10E 4JZFH 3UNQA 1AWFH 1HYLA 2A7HA 3TPIZ 2ZCHP 2BVRH 2PKAB 1ZJKA 2WV9A 1MABB 1GL1A 1OSSA 1TIOA 2OBQA 5LPRA 4X2WA 1P02A 1HAXB 2ZDNA 1BMLA 2QF3A 1BTYA 1C5VA 1LHCH 5F8XA 4MNWA 3M35A 3BTKE 1H1BA 3RXVA 2F9UA 3A7TA 4BTIB 3M5MA 1TGSZ 4CR9A 2YMSB 4LOYH 3MWIU 2Q6DA 5JBBS 5FL7D 1YKTA 1MCTA 1QGFA 2J92A 4TSFD 1TBQH 3VFEA 4UONA 2F91A 1TNGA 4I7YH 3T28A 4ABIA 1G30B 1LHFH 3SUDA 1EAIA 2VIQA 3LH1A 1IHTH 1G37A 2GT8A 2BMGB 1ANDA 3SU1A 6GCHG 2EEKA 1O2XA 3PROA 3QLPH 1MMJN 5LPFA 1YY3A 1ZPBA 1TGBA 3RUOA 2FYQA 3SHCH 4UD9H 1YBWA 3LJOA 1SGCA 8ESTE 4YT7H 1O3BA 1HRTH 1O3OA 1O3PB 3Q76A 1FPHH 2B8OH 3H7OA 1SSXA 1TAWA 4FOUC 3H09A 4F4OC 2QF0A 1QNJA 1FIWA 1C2MA 4VGCC 4BTUB 1A3BH 1HNEE 1W11U 1GG6C 1TNLA 1BZXE 1INCA 1GJDB 1NRQH 4BAHB 2V3MA 1O3GA 4E06H 3TJUA 3DFLA 3BN9A 3HATH 4E05H 2FESH 4TPIZ 1FUJA 1YPKH 1FN6A 2OLGA 3A7ZA 2H2ZA 4ZKOU 1A0JA 3V3MA 2GV7A 1V6DA 1NT1A 2KCYA 1T4UH 4ABEA 3SV6A 3FFGA 1SFQB 3OFND 1SGQE 3LDXH 2RG3A 1LMWB 3RP2A 1AB9B 1QA7A 4I8JA 2L6OA 5FBEA 2IPQX 1EOLA 3P70B 5ABWA 3U28C 6GCHF 3M5NA 4DIHH 1S83A 1HUTH 2FO9A 3K65B 1ORFA 3SHAH 3EA7A 5E2OA 2OQ5A 2ZIQH 2G8TA 1P2MA 5GIBA 3M37A 2A1DB 3KQ5A 1TX6A 3HKIB 1ANCA 1FY5A 1LQEA 1O2KA 2LIZA 3BTQE 1HBTH 1UTNA 3MFJA 1HV7A 2GDEH 3QZRA 3WY8A 3TH2H 3EYDA 3M3VA 1O2SA 1P2NA 4JMYA 3NKKA 4THNH 2BHGA 2AIQA 1J16A 5T3HA 1BMMH 2DUCA 2F4LA 1ZSLA 1MZDA 2A4OA 1H8HD 2Y82A 4BAKB 1LHDH 4B2AA 1N8OC 1D3PB 1S84A 4ZH8A 4BXSA 3LGWA 2W6JD 3EDXB 3LIWA 2RDLA 2VIOA 3OY6U 5C5OA 1BJVA 1E37B 4ISLA 1WQSA 1XM1A 2ZU4A 5JB8S 4XRNA 2ZQ1A 5ETXA 3RMMH 4Y0ZE 1Y3VA 6ESTA 1GPZA 1PPZA 2PKAA 2BQ6B 1ARCA 1BBRH 5KGOA 3GDSA 3RU4T 2Z9LA 1DSTA 3D62A 4XFQA 2ZFSA 1AKSA 5DJ7A 1W0ZU 1HPGA 5A0BA 1TABE 2PUQH 1DANH 1HGTH 1GHAG 2OC1A 2UWPA 1YP9A 2B0FA 3SU6A 2WHXA 3RXLA 1GWAA 1NFYA 1UVOA 4Y71A 1O2RA 4UFEH 3KN2A 1BT7A 4ACBA 2C8ZB 3F1SB 3FKSD 1C1UH 1E34B 2PHBA 2ULLA 1SGYE 3PMHB 4OS1A 2JDID 1S6FA 2ZGBH 1K1OA 4MPWA 1SOZA 2C90B 4MNVA 2ZDLA 1WV7H 3V0XA 3P95A 1O3DA 3BSQA 3V7TA 1XXDA 1H8IH 1W0YH 1CO7E 1NESE 5HM9A 5DSFA 1QBOA 4DJZB 1GI1A 1C1QA 2ZU1A 4HZHA 1GVZA 1WUNH 2ZCLP 3DD2H 3RXPA 1ELFA 3BF6H 3LH3A 4WY3A 1TMUH 1T32A 3UR6A 2FXRA 1KXCA 5HKKD 1GI5A 4FXGH 2QCYA 2TPIZ 2HNTE 2Z3DA 1BTHH 3A86A 3SV9A 2F9NA 1PQ5A 1ZGIA 3BIUH 1GHAF 3FO8D 1AHTH 1MKXH 3RXFA 3NRLA 3SU5A 1VZQH 1TX8A 1EAWA 2BQWB 4H6SB 2C8YB 4NG9H 4RT0A 4WVPE 1V2PT 1QFKH 1O39A 1O2VA 1GCDA 2A4GA 2ODPA 4JZIA 1BA8B 5FPSA 2SFAA 1GBLA 3RXCA 4F48B 1MQ5A 2XBYA 1AFEH 1XUFA 3BEUA 4NIYA 2PP6A 5DP9A 3QUMP 1BRAA 1Z1IA 3MU1A 2WINI 2UUYA 2VIPA 3RXDA 1AUTC 3P8FA 2QN5T 1S6HA 1UTMA 1DY9A 1M9UA 1BJUA 4Y7AA 4CRAA 3RMLH 1EJNA 3S69A 2AS9A 1C9PA 2GZ9A 4NZQA 1V2JT 3TJNA 1JRSA 3E0NB 3NPSA 2A4QA 1KXAA 3GOVB 1K0HA 1SQAA 2GGVB 3GCOA 3GY4A 1UHBB 3KF2A 1VJ9U 2BY9X 3M5LA 1BBRK 3F9EA 1F7ZA 1SGDE 1UVSH 3R0FA 1MUEB 1KMHB 1YWUA 1CBWC 1GJBB 3SOSA 4DT4A 1FV9A 1DICA 2B9LA 1C5MD 3SQEE 1TNIA 1BOQA 5A09A 1Y5UT 1AE8H 2VH6A 1A2CH 3BTTE 1GGDC 2XCFA 3RXMA 4Y8YA 4HI3A 4K2YA 3PWCA 3F3BA 1GBHA 3SV8A 1O5BB 3KCGH 1SLXB 3GDVA 3BTHE 3C27B 1GHYH 3STIA 4ZHMU 4ABFA 4X1RU 2Y7ZA 2AGEX 2V3OH 4I8KA 1G2LA 1RTLA 1HJ8A 2A5AA 1G3CA 1DITH 1OOKB 1A4WH 2FS8A 2J94A 1BRBE 2FOEA 5FXLA 4P02A 5E2PA 4FUIA 5E0JA 1P05A 3E6PH 1BIOA 4NIWA 1O5EH 2H9TH 1KXFA 3TGKE 1ZYOA 4X8UH 3NXPA 5FHTA 5EU8A 3A87A 4NWLA 1C2GA 3MU5A 1P9SA 4FETA 1FAXA 5A0CA 1H9HE 4J1YA 2UWLA 5EQRA 1SGNE 1W0KD 3NCLA 1YM0A 2C4FH 4ABJA 5CHAC 4I8GA 4NIVA 2OC8A 1DX5M 3DSGA 3QDZB 4OS2A 2Y81A 1UK4A 2ANWA 2V35A 2A7JA 2OQUA 4NSYA 2UUFB 2ZDVH 1GI6A 4RSPA 1QJ6B 3MMGA 1NC6A 1DS2E 1S81A 2D2DA 2BVSH 5C67A 1L0ZA 1F0UA 4DOQA 1F92A 2P3UB 4UEHH 5F6MA 1TPAE 2B5TB 5F03A 1P11E 1C1MA 4K1TA 3URDA 2WPDD 2VIDA 2ZDAH 1HDTH 2H9HA 3CP7A 1C5NH 1CA0C 1NROH 1PPBH 2FTMA 4FVBA 4X2VA 1GMHG 4B74A 4NA8A 1FDPA 3V12A 1EZXC 2Y7XA 3UPEA 3VG8A 4GCHF 1NS3A 1IQGA 4AFQA 2FI5E 2LNCA 2PTNA 4ABAA 4INKA 1K1LA 5F8ZA 3A82A 3LONA 2W7SA 5ESTE 3WWFA 2J38A 2VIVA 1SGTA 3LJJA 4NA7A 4BAMB 1DSUA 2BD8A 1NBMD 1QA0A 3LOXA 1P04A 2ODYB 2RDEA 2KCAA 3OEED 1C5PA 3M61U 4XSKU 2NWNA 1SGRE 3MO3A 2XC0A 2Z9JA 1FJSA 3B9FH 1RJXB 2HALA 1D6RA 3N7OA 3TK6A 4Y8ZA 1O2TA 1D3DB 3OY5U 3M5OA 3SNBA 1MU8B 1O2JA 4CH2B 2EI7A 2CK3D 3UFAA 4I86A 3UR9A 8LPRA 1HAVB 5DP3A 5EIYA 3EAJA 2Z9GA 2I6QA 1H4WA 3S7KB 3P17H 5B6OA 4ZCNA 1GMCF 2HGTH 1AU8A 1NFUA 2VVUA 1FY4A 1GJ7B 3T29A 2ZU3A 3DSOA 1GMHF 1DPOA 1V2LT 1UHBA 5A8XA 4NGAH 2FLBH 1WAYB 2VWMA 3EE7A 4RKJB 1Y3XA 2XBVA 4MNYA 4TT3D 1QIXB 1UVTH 1C2IA 2HRVA 3MH6A 2XBXA 5HMAA 3TH4H 2FLRH 4KGAA 3DT0H 1P10A 3A7WA 1DY8A 2O8UA 2DE9A 4A1VA 2ZQ2A 1DXPA 1K1PA 5FPTA 5DO4H 2PTCE 1SHHB 2WV4A 5CDFE 1YCPM 3GY6A 4BAQB 3S9CA 2ZGXH 3RXIA 1CE5A 3SORA 2SGAA 4FUEA 1RS0A 2QYIA 4GLYA 1P3CA 3GY2A 1DT2A 2TRMA 3LPRA 4ABGA 3T27A 1ELVA 1DLEA 2P8OB 3A8BA 3SJIA 4UE7H 2THFB 2D1JA 1CU1A 3PTNA 1QRZA 5L2YH 3QTVH 4F49A 3UREA 3HPTB 4Y0YE 5GWZA 1WQVH 3TU7H 4P00A 1IQHA 5EXLA 4D7FA 3KNXA 1OWDA 1XVOA 3ZZ9A 1TGTA 1O2OA 4CBOA 1GJCB 1W3CA 1SVPA 3A8DA 2R3UA 1ZTKA 1BCUH 1EUFA 4AFUA 1O34A 5KECA 5C94A 3M3TA 3E0PB 1H8ED 2W5EA 1YPLH 3PMJA 1P06A 3LC5A 3Q3YA 1T4VH 1FONA 1TPOA 1SPJA 2BDBA 4FVDA 1VITG 1BDAA 1CT2E 1UO6A 3JZ2B 4Q80A 3A88A 5FCRA 2BY5X 3SNDA 1IQFA 5C3NA 3SUGA 1O2MA 4A92A 5EW2H 1EZQA 5CMXH 1CBWB 2Z3CA 3QGNB 4B1TA 2J9NA 4KELA 5DP7A 3PLPA 1O2UA 2FP7B 4AFSA 4Q2KA 3HGPA 3RXSA 1C2DA 3GY8A 1VITH 1VKYA 3K6ZA 4SGBE 2ZDKA 4WJG2 5DK1A 1KLTA 2H6MA 2ZFQH 4NWKA 1L4DA 2VINA 3NUMA 1WDIA 2D8WA 1ZSJA 4WMFA 3MYWA 5FX5A 2BOKA 2O8LA 4Y6DA 3ZZ3A 1GDNA 1B7XB 3BEIB 4Y76A 1GCTC 1RRKA 3F6UH 4A1XA 1SI5H 5HYOA 4DCDA 1ELCA 5J4QA 1NN6A 1GJ9B 1V2TT 5T6FA 4MLFB 1BBRE 4CHAC 1ZMJA 4X2XA 1SLUB 2ZO3H 4YESB 1Y3YA 3MH7A 4WXIA 2CHAC 1VJAU 3RU4D 2F43B 2B7DH 5EXMA 1MAYA 4DW2U 3W95A 1ESBA 1VITF 1FXYA 1O3MA 2C8XB 3QZQA 3SU4A 2HVYB 1O2YA 5TCCA 1AKSB 1GBDA 1GI7B 3EGKH 1TMTH 1O5CB 5AHGH 4FUCA 3SO3A 3E16B 3U8OH 1VGCB 3D65E 4WMDA 3LGYA 2G5NA 4M7GA 1PJPA 1HAVA 1J17T 2H5CA 3RMNH 1HJAB 1SG8B 3H5CB 1HAHH 1XUIA 4MNXA 1BMAA 1O2QA 1ZTLA 2FOCA 5C1UA 3GYLB 1GVLA 1ELBA 1EQ9A 1SGFG 4AG2A 1C2EA 3TNTA 3H7TA 2BD2A 3ZVAA 4KKDA 2HPQH 1A5HA 6CHAC 3SBKA 5DP6A 4AN7A 1C5UA 2M2AA 4K8YA 1CHGA 1GJAB 4IMZA 1D3TB 1NRRH 3GCNA 3PV5A 1O2HA 3WWBA 5AFYH 2VGCC 1C5RA 1FPCH 2KR7A 4X8TH 5FBIA 1WYKA 3RXRA 1N1LA 1TYNA 4JYTA 4K8BA 2P93A 3UAIC 2GP9B 4Z0KA 2G4TA 1YPHE 4BANB 3UOPA 1TRMA 2VU8E 2VBCA 1C5XB 2WPHS 1LTOA 2VWNA 3OU0A 5ESBA 4D9RA 3S9BA 1O2NA 4LK4A 3ZZBA 3OE7D 1UMAH 1OPHB 1XUKA 1NRNH 2V3HH 3S9AA 1BTWA 2XNDD 3BG8A 8KME2 1OXGA 4O03A 1O3JA 3N99A 1MZAA 4B75A 4Z1MD 1FI8A 1IQMA 1ETSH 2Z9KA 2GCHG 4GSOA 1LVBA 1C1VH 2SGFE 1AQ7A 2Z6BD 4ZKSU 3UOUA 3MQKC 2ZKSA 2ZC9H 4A7IB 1AFQC 4OS6A 2GTBA 3VB5A 4YLUA 3ATMA 3CNRA 5CE1A 4TY7A 1D9IA 9LPRA 1TOMH 3M7QA 2ILNA 5JB9S 3VGCC 2ZA5A 2ODQA 2QXIA 3BTDE 3GCHC 3O8CA 1RD3B 4ZUHA 2HOBA 4Q7YA 4DIIH 1C2HA 1DDJA 2JIZD 4LZ4B 2XW9A 4X8SH 4YZUA 4BAOB 1BHXF 2GKVE 2OINA 4ABHA 1WCZA 1V2RT 4DVAU 1C5QA 1P0SH 3P8OA 1XUGA 3PV2A 1TPSA 2A32A 3OEHD 4NSVA 2P95A 3PV4A 1G3BA 3PTBA 3PLKA 1KTTB 2Y6TA 1UTQA 3GYMA 1FY3A 1EJMA 1BB0B 4YOGA 4Y7BA 2V0BA 2C3SA 2GCHF 1DWCH 1NY22 1YLNA 2RA3A 5CHBA 3DCLA 1O31A 2AMQA 1SQOA 2RCEA 4JYUH 3HK6B 5GNDA 1TNJA 1O2IA 2ANMH 4UFDH 1RIWC 3ZZ8A 5C20A 5E8EH 2F83A 3RXTA 2ZECA 2PSYA 1KDQA 3E8LA 2ZGJA 5A2MH 3NZIA 3ATIA 1XKBC 2GZ8A 1P09A 1O3FA 1CT0E 4YLQH 2J98A 1EPTB 2ZFRH 4BNRA 2ZPQA 3GY7A 4AORA 2Y5FA 2BDYA 5J4SA 3Q3KA 4Y11E 1F0TA 1GDUA 2HWLB 3MHWU 2HLCA 1SR5C 1T8LA 1YCPH 3B23B 1D6WA 2QF5A 2WZQA 4FUHA 4ZKRU 2UUJB 3TK9A 3AASA 3TITA 1T8OA 2ZDMA 1G2MA 5L30H 3LKWA 4FUJA 2CGAA 2WPIS 1LVOA 1XMNB 5E0GA 5A8YA 1E36B 5HGGA 3S0NA 3NWUA 1FMGA 4OGXA 7GCHG 3RXKA 4IGDA 3SN8A 3F2GA 4RKOB 1OWEA 1P2IA 3KGPA 3L3TA 1JIRA 1FAKH 3F0PA 3W94A 1DE7H 2BYAX 1JWTA 4CRDA 1A5IA 4DGJA 1EJAA 3BG4C 1O3CA 2DE8A 4FUBA 4NA9H 2ZTZA 4ZHAA 1K9OE 1W7GH 4A5TS 3M3SA 1BMFD 1GI0A 4CHAB 2L74A 2ZPSA 3KYGA 1PFXC 1GBIA 1G32B 3MNSA 3UTUH 1JBUH 3RLYH 1ZLRA 3KHVA 4WMEA 4RN6A 2CHAB 4HG6A 1S85A 3LT3A 1YC0A 1OP2A 1GJ6A 4X0WU 4TPYA 3PLBA 2NU3E 2ZFPH 5SGAE 2FOAA 3TIUA 1WSSH 1XUJA 4AC9A 1NM6A 1ZMLA 2AEIH 2AIPA 1UJ1A 1A46H 4NFFA 1LQDB 1BHXB 1A7SA 1CSOE 5T6GA 1UVUH 1LPGB 2GX4A 3UUZA 2G5VA 7GCHF 1E35B 1GMDG 4I33A 1UVPA 1FNIA 3ZZCA 4B6FA 2KAIB 1F5RA 3PMAB 2XWBI 4I31A 3P8NA 1C1WH 1ID5H 4O97A 1YLDA 1HAGE 3F2HA 1ZHPA 1HCGA 2VH0A 1ETTH 1W2KH 3PO1C 1KY9A 1LHGH 3TGJE 2OTVA 1O3IA 2SGPE 4TY6A 2A2QH 1CQQA 3SV7A 1N6XA 1BRUP 1V3XA 1EX3A 1ZMNA 3ATWA 2QY0B 3P8GA 2CN0H 4GHTA 3MNCA 4XBCA 1L4ZA 1RFNA 4MPVA 1ANEA 1QY6A 3G01A 1C4Y2 2J95A 4YO9A 3BIVH 4K5ZA 4E7RG 2AGIX 2YNAA 1C1TA 5DKMA 3SJKA 4YXWD 1G3EA 5HXFA 1GMDF 2AYWA 4B2CA 2G4UA 4Q7XA 4VGCB 4RI0A 3I78A 1MTNC 5JYIA 5LH8A 1GG6B 3FVFB 3OX7U 2H1UA 1NFXA 3U8RH 1HXFH 1AE5A 4HFPB 1GJ8B 4XOJA 1PQAA 5DP8A 3T25A 1NU7B 4X6MA 1CT4E 1NRPH 2ZFTA 4X1QU 5C1XA 1L1GA 2BM2A 4MG3A 5EW1H 4NIXA 1HXEH 2ANYA 3A7YA 1LVMA 1C1PA 1QRWA 1B5GH 2GV6A 2OCVB 4YM9A 4A1TA 5FCKA 2BDCA 4AYVB 2FOMB 3JZ1B 5K7RA 1EPTA 1GJ4H 1WTGH 4DG4A 3EA8A 1PPHE 4U30A 2OBOA 1W0JD 4GCHG 2FOGA 2QXJA 2VVVA 1AUJA 2WV5A 3VB7A 3T2NA 3GCHB 4GAWA 1O0DH 5LGOA 1WOFA 4I32A 2KM0A 3GS9A 5EJ1A 1SBWA 1WTHD 3ZZ6A 4H6TA 2JETC 1YPJH 2PV9B 1MKXK 1UTPA 2O9QA 4GUXA 1VCPA 4AOQA 2VB0A 1GI2A 1QBNA 1K1IA 1RXPA 3O8RA 3BTFE 1FX0B 4CBNA 3DUXH 4F55A 3UQVA 3N7EA 3TLOA 2R2MB 3O8DA 1UW7A 1PPCE 1SLVB 1C5WB 1AIXH 1GI4A 5JBTA 2NU2E 1TALA 4NZLA 1C4U2 1O35A 1SGFA 1YPGH 5I25A 6LPRA 1P2JA 1BTXA 3RU4E 2ZU5A 4CRCA 2PWXA 1QRXA 2ZEBA 3FAOA 3KQEA 2YMSC 1GMCG 1N8OB 1V2KT 3OSYA 4FU7A 1PPGE 1GBCA 1O2PA 1RIWB 3B8JA 2XBWA 3A83A 2YOLA 4X6OA 1UTKA 1V2WT 5DP4A 4ZAEA 3OAAD 4UDWH 4KTCA 1O38A 1SOTA 1QQ4A 1TE0A 1ARBA 2XRCA 2ZHFH 5IDKA 3CS0A 3E1XB 4YOIA 4BXWA 3SI4H 1KTSB 3UWJH 4ASHA 3IITA 2EI6A 3SUFA 3PYHA 3KQCA 1P2QA 1IQKA 3QN7A 2KAIA 1ZPCA 5I46H 2GCTC 2WUCA 3DHKH 1MTWA 1DVAH 1F5LA 2EQNA 2R3YA 1OWKA 2KFWA 2PUXB 5GXPA 1FQ3A 1PPEE 1OYTH 2PSXA 3ZIAD 3HKJB 1SFIA 4H42U 1NZQH 4Y8XA 1J14A 5DP5A 4AFZA 4NCYA 4GVUA 3RXJA 1YLCA 1KXBA 4X1SU 3SU3A 3SGAE 2WYJA 2ZGCA 4U01A 3QX5H 4HGCA 1TLDA 1C1OA 1MTVA 2ZP0H 4FU8A 4WF8A 2BOHB 2FZZA 2KCPA 1DWBH 3A8CA 2P3TB 1O33A 3F68H 3U9AH 1YPMH 2JH5D 3U8TH 4I8LA 1AVWA 5HIYA 5HM2A 8GCHF 2YMSD 2W7UA 5EGMA 4IN1A 5PTPA 4AYYB 4IN2A 3QK1A 4XBDA 3MH5A 1ZSKA 1XKAC 3CENA 1T31A 2SGDE 1O36A 1XVMA 1F0RA 4ISIH 2OUAA 3SQHE 3EBNA 2BD5A 1O30A 3ZZAA 1V2VT 2VWLA 2H5DA 3SI3H 1BUIA 3ZVDA 2XTTB 1Y59T 1K1JA 1TRYA 4O9VA 1VR1H 1ZTJA 4Y79A 5EQQA 2ZPRA 4INLA 1MTUA 1O2WA 4AB9A 4J2YB 4DT7B 1MH0A 1ANBA 3UY9A 1VCWA 1FY1A 5F53A 3SYJA 1E1RD 2AHME 1HAZB 3UIRA 1BTZA 2J34A 3LU9B 1IAUA 2CV3A 2AMPA 1Z7KA 5EPYA 2V7QD 5TCAA 1C5YB 4ISHH 2FOFA 2G00A 1XUHA 1KLIH 5EJLA 2JH6D 1CA8B 2K8IA 3RDZA 5FAHA 3PM3A 4UFFH 2PFEA 1SB1H 2IN2A 3O8BA 2F9PA 2VNTA 2SGEE 3E90B 3PMBB 2OC7A 1DM4B 1IQJA 3FZDA 1MCVA 2BY6X 4FUFA 4WH6A 1QHRB 1Y5BT 2VVCA 3CS7A 3ZVGA 4M9FA 3ZVFA 2ZTXA 3U98H 3DA9B 5DPAA 3EA9A 4FU9A 1YYY1 1UTOA 3ATKA 1GBKA 4MTBA 4DURA 1DUEA 2NU1E 2AGGX 1GGDB 4TYDA 1ZPZA 5IK2D 5BPEA 1KYNA 1H8DH 4IS5A 3SW2B 2K7XA 4ISOA 3ENSB 1V2OT 1ETRH 1OWHA 2RA0A 4B2BA 2G52A 2H9EH 1V2QT 3FANA 4JK6A 5F8TA 1SL3A 3MU8A 2XWAA 2FTLE 5DN6D 1VCQA 2A4RA 3BTWE 1HJ9A 3GICB 3SGQE 3U1JB 2FOHA 1EB2A 2JJ2D 1NO9H 1KDQB 1EATA 1IQIA 1AMHA 4JCNA 3KIDU 2WUBA 1C2KA 1UCYH 1W8BH 3OTJE 2TBSA 4X8VH 1QL7A 4X1NU 2QV1A 1LKAA 2J98B 3A7VA 4WH8A 4ZXXH 1C2FA 3MI4A 2VIWA 3NK8A 1SGPE 2JETB 3KEEA 5H4IB 4D76A 4BOHA 3RXAA 3Q77A 2P94A 2D26C 5CHAB 3RXUA 3ESTA 1ELDE 2O8TA 1TMBH 3A84A 1D4PB 1EXFA 3A85A 1W14U 3TH3H 2BD3A 1PQ8A 1MD8A 1OP0A 3FP6E 4CH8B 4O3UA 1C2JA 4JYVH 1O5DH 2XNIA 2ESTE 3IWMA 2BD4A 2Y5HA 2CXVA 3TVJB 1A0HB 1K28D 1MU6B 2J5UA 2Z3EA 1JIMA 1BITA 3FOAA 1MKWH 1CA0B 1HAPH 3SNCA 3I77A 1QJ1B 2OXSA 2FDAA 2QE7D 1SMFE 3ITIA 5HIZA 1P8VC 1AY6H 3GISB 5B6LA 3ATLA 3UWIA 1JRTA 2EY4C 1NFWA 3TK5A 4H4FA 4E7NA 1Q3XA 2G51A 1ESTA 3ELAH 1V2MT 1DOJA 4YTAA 1GBMA 2ANKH 1AN1E 1V2UT 1P57B 5T1VA 4Q7ZA 2OC0A 1BTUA 3ZZ7A 1XXFA 2HPPH 3OTPA 1N6YA 2W3KA 4B71A 4CREA 5A0AE 1O3KA 1DUAA 3MO6A 2ASUB 5LPEA 2IOTA 2WPJS 3RC4A 2GCTB 2ZHWH 2XCNA 1OWIA 1OKXA 1IQNA 2Y80A 1ZR0A 1QURH 2P59A 1GHBG 2WSSD 1DXWA 1UTJA 2BDGA 3SZNA 2BLOA 2R0LA 3SJOA 1GHZA 4AB8A 5GDSH 1D3QB 1OYQA 3RM0H 2WPMS 3TNSA 2AH4X 3SU0A 1V2NT 5C0TA 1TFXA 1WBGB 1ZHMA 4TWWA 3EQ0H 3GY5A 3Q3XA 1C1SA 4GHQA 2FEQH 5C1YA 2KZ4A 3MU4A 2ZTYA 1QQUA 2ZZUH 4AX9H 3F9GA 1HAIH 1OX1A 1K1NA 1C5TA 3U69H 2A5KA 1AGJA 2GZ7A 3AAVA 2NU4E
chains in the Genus database with same CATH topology
1UCYK 7KMEH 1C5OH 5EPNA 1P2OA 3ZV8A 5A8ZA 3RXBA 1PQ7A 1Q2WA 4X1PU 3MOCA 3QWCH 4K1SA 1GBEA 1O5GH 3AAUA 4AZ2B 4GPGA 2FYRA 1CGHA 1YPEH 5EG4A 2F9BH 4Z6AH 5FPYA 1L1NA 2AMDA 1AWHB 3A89A 1ZHRA 3IG6B 5AF9H 3ZV9A 1DWEH 3VB4A 2BLVA 2BXTH 1UK2A 1GHBF 1ZRKA 3PWBA 3VPKA 3KQBA 2BD9A 1QB6A 1QCPA 4IC6A 3SNAA 1G9IE 1FN8A 3VB3A 4U2WA 2IPHA 2PKSC 3VEQB 2CJIA 3UNRA 3LGIA 1TRNA 2FX6A 1KLJH 1Z71A 1TONA 1GI3A 2A7CA 1JOUB 1KXDA 1ABIH 1MKWK 2BY7X 1C9TA 1FZZA 1PPFE 1QB9A 4WWYA 1TQ0B 4JZ1A 1SC8U 1WU1A 2ZCKP 3ZVEA 2XC5A 4D9QA 2FX4A 2UWOA 1Z1JA 4K3JA 3KL6A 1C4V2 3E91A 5GCHG 3M36A 3TGIE 4AGJA 2R2WU 1A61H 1O32A 3SV2H 3BTEE 5C5NA 1YPHC 2ZHDA 3M7UA 2FOBA 4CRBA 1LVYA 4OGYA 1AZ8A 3RC6A 3T26A 2STBE 4ZXYH 5T6DA 2TGDA 2BTCE 1GVKB 2SNWA 4KP0A 1E0FD 4B76A 3GDUA 2BLQA 4OS5A 3U1IB 2A5IA 4PROA 7ESTE 1CVWH 1F2SE 1GCTB 1T8NA 4LZ1H 1UTLM 1UK3A 1QBVH 4OS4A 4MVNA 3SU2A 2AERH 3QO6A 5G4BA 3VXFH 2PW8H 5C2ZA 3AVZA 2BXUH 3RXEA 3FP7E 1CHOG 1V2ST 1TQ7B 1Y3UA 2J4IA 2O8WA 4R8TB 1BMNH 2NU0E 1EZUC 2QXHA 3LC3A 2BY8X 2GMTC 2VJ1A 2K1QA 4K1EA 3MO9A 2CMYA 1HAYB 4D8NA 4INHA 4OS7A 2V6NA 5GCHF 2GDDA 3ZYDA 1O2LA 1W12U 4SGAE 1KXEA 1ESAA 2C8WB 1U6QA 3GY3A 1K1MA 4X6PA 2Y5GA 1RGQA 2FIRH 4X2YA 3T5FH 3QTOH 1ELGA 1ZZZA 5E0HA 4AG1A 3BEFB 1MAXA 1PYTC 1GBAA 3RXGA 4B73A 1HIAB 1TBRH 3MNBA 1AVGH 1Z6EA 5DG6A 5FX6A 1RTKA 2XXLA 2TGPZ 1FLEE 1OS8A 1Y5AT 1Y3WA 1HLTH 1C1RA 1O3EA 6CHAB 3F9HA 1OWJA 2AFQB 2SGQE 1O5AB 1P2KA 2TGTA 1IOEA 4IC5A 1BQYA 1X7AC 1GHWH 1J8AA 2JH0D 1EASA 2P8OC 1ZOMA 1KIGH 1B0FA 3V13A 4ZROA 2Q6FA 1MTSA 1CHOF 1L1JA 3S7HB 2FPZA 4R0IA 1NTPA 4IBLH 2VGCB 2P3FH 3LGUA 3ODDA 9ESTA 1W13U 1C5SA 5TJXA 3R3GB 1Z6JH 2J2UA 2CF9H 1YCPK 3D49H 2FWWA 3OYPA 2F3CE 1O3HA 1IQLA 3DFJA 4MDSA 3HGNA 2EI8A 3RMOH 2SNVA 4CRFA 3D23A 3SNEA 2W26A 4FUDA 2VWOA 3T62A 3RLWH 1NPMA 2ZFFH 1A3EH 1QJ7B 4K69A 2OD3B 1SHYA 2F9OA 3MU0A 1G36A 1SGEE 1SQTA 4D7GA 2ZGHA 3A80A 1GI9B 2W3IA 1JMOH 1ELEE 3SGBE 4NFEA 1LKBA 1O37A 1AFQB 1EKBB 4CRGA 2PGBB 1PYTD 2R0KA 3RM2H 2F9VA 1C2LA 1GBBA 4KTUA 3VXEH 3PB1E 5JPMH 1QL8A 1JXPA 2QXGA 3VGCB 1GDQA 1AO5A 1TGNA 1ACBE 3SJ8A 1TGCA 4I8HA 1J9CH 4CR5A 3LGTA 1EP5A 3BTGE 3P6ZB 2ZI2H 1AI8H 3ODFA 3A7XA 3L6PA 1ZJDA 2HNTC 3VB6A 5AFZH 1TX7A 2XYAA 1L2EA 4HTCH 2WPKS 5L6NH 3UNSA 1ELAA 1P12E 2PLXA 3GCTG 3RC5A 1LPKB 1VGCC 1KSNA 2BDHA 2GVFA 1TOCB 2BZ6H 4JZEH 1BTPA 1P01A 2QAAA 1O3AA 1HJAC 2PGQB 1UCYE 2TIOA 5EXNA 2QA9E 1CGIE 2EA3A 1LO6A 1K2I1 2R9PA 5GPIB 2PKSB 2QGRA 3QGJA 4QT8C 2WYGA 1DLKB 3Q00A 4WXVA 1QL9A 3ZZ4A 4JZDH 1EOJA 1GJ5H 1QB1A 1F5KU 2BX3A 1TNKA 1T7CA 1W10U 3A81A 8GCHG 2Z7FE 4XE4A 3ZVCA 1P3EA 1GL0E 1S0QA 3FP8E 3TJOA 1QTFA 1K21H 4IMQA 1H9IE 2BZAA 4YOJA 2PR3A 2C93B 2YNBA 2FI3E 1O5FH 1Z8RA 1S82A 4K60A 5GJ4B 1HIAA 1XX9A 1S0RA 1G3DA 1IHSH 1MBMA 4FUGA 3GCTF 1H9LB 2O8MA 2ALVA 2FODA 1T8MA 1YGCH 1AVXA 1O2GH 2Q1JA 2ZNKH 4UFGH 4AGKA 1YF4A 1Z8JB 2JKHA 3STJA 1S5SA 1EZSC 2CF8H 3BG4B 4KTSA 4XDEA 2BQ7B 4A6LA 3AW1A 1GBJA 5K0HA 2G55A 2Q6GA 5AVDA 1B0EA 2ALPA 3K2UA 2M5TA 1SLWB 3RXQA 4DY7B 1TNHA 5L2ZH 2FMJA 7LPRA 3A8AA 1P03A 3E3TA 5JBCS 3TJVA 1GHXH 2BVXH 2WPLS 3RXHA 1GBTA 1W7XH 2ZF0H 1AB9C 1GBFA 1THRH 4MPUA 4ABBA 2A2XH 2FM2A 2QC2A 3ZZDA 3I29A 2STAE 2GMTB 1EP6A 2Z9IA 4ISNA 2QIQA 4U32A 2ZHEH 1A5GH 1MD7A 2HNTF 3URCA 3RXOA 2Z94A 1Z8GA 1LHEH 3AW0A 2TGAA 4YT6H 3SUEA 4ZMAH 1SGIB 4X6NA 3BTME 2P16A 3C1KA 2BDAA 2UUKB 3LGVA 4ZKNU 3K6YA 1DFPA 3KQDA 4JK5A 2BLWA 1QR3E 1MBQA 1EAXA 1LCYA 1TWXB 5DGJA 1HAOH 5JDUB 5IYTA 1P9UA 1THSH 2GT7A 2A0QB 2OP9A 2BX4A 3SJ9A 4BTTB 4ESTE 3PO1B 4TWYA 1THPB 1HB0B 1F0SA 5EOKA 4IW4E 2LPRA 1TPPA 1J15A 3F9FA 1O2ZA 3BV9B 3L33A 3MNXA 3UQOA 1TB6H 1Q31A 1LPZB 1IQEA 1EPTC 3ZZ5A 1ABJH 3K9XB 2ZWLH 2A31A 1A0LA 1NRSH 5JBAS 2FS9A 3MH4A 3HK3B 5EODA 1HFDA 1NU9A 1FY8E 4ZHLU 1EAUA 3MTYA 1TBZH 1Y8TA 1C5LH 3EE0B 1MTNB 3P92A 2A45B 5EQSA 4O3TA 1CGJE 2I6SA 4XBBA 1ZGVA 1AZZA 1AD8H 1BRCE 2BDIA 2ZG0H 2HVXA 1TA6A 3FZZA 4LXBH 1O3LA 2BD7A 3ZVBA 1K22H 2G81E 1ELTA 1OP8A 2ZU2A 1RTFB 4MQAA 1C5ZB 2BB4A 1GHVH 1O3NA 2FI4E 1ZRBA 5BRRE 1FIZA 1Z8IB 1C1NA 3ZYEA 3M7TA 2EC9H 4MPXA 1EB1H 1LDTT 1MQ6A 2IJOB 2XC4A 2ZHQH 4ABDA 1A1RA 1GI8B 1DWDH 1E38B 1TA2A 4Y10E 4JZFH 3UNQA 1AWFH 1HYLA 2A7HA 3TPIZ 2ZCHP 2BVRH 2PKAB 1ZJKA 1GL1A 1OSSA 1TIOA 2OBQA 5LPRA 4X2WA 1P02A 1HAXB 2ZDNA 1BMLA 2QF3A 1BTYA 1C5VA 1LHCH 5F8XA 4MNWA 3M35A 3BTKE 1H1BA 3RXVA 2F9UA 3A7TA 4BTIB 3M5MA 1TGSZ 4CR9A 4LOYH 3MWIU 2Q6DA 5JBBS 1YKTA 1MCTA 1QGFA 2J92A 1TBQH 3VFEA 4UONA 2F91A 1TNGA 4I7YH 3T28A 4ABIA 1G30B 1LHFH 3SUDA 1EAIA 2VIQA 3LH1A 1IHTH 1G37A 2GT8A 2BMGB 1ANDA 3SU1A 6GCHG 2EEKA 1O2XA 3PROA 3QLPH 1MMJN 5LPFA 1ZPBA 3RUOA 1TGBA 2FYQA 3SHCH 4UD9H 1YBWA 3LJOA 1SGCA 8ESTE 4YT7H 1O3BA 1HRTH 1O3OA 1O3PB 3Q76A 1FPHH 2B8OH 3H7OA 1SSXA 1TAWA 4F4OC 2QF0A 1QNJA 1FIWA 1C2MA 4VGCC 4BTUB 1A3BH 1HNEE 1W11U 1GG6C 1TNLA 1BZXE 1INCA 1GJDB 1NRQH 4BAHB 1O3GA 4E06H 3TJUA 3DFLA 3BN9A 3HATH 4E05H 2FESH 4TPIZ 1FUJA 1YPKH 1FN6A 2OLGA 3A7ZA 2H2ZA 4ZKOU 1A0JA 3V3MA 2GV7A 1V6DA 1NT1A 1T4UH 4ABEA 3SV6A 3FFGA 1SFQB 1SGQE 3LDXH 2RG3A 1LMWB 3RP2A 1AB9B 1QA7A 4I8JA 5FBEA 3P70B 1EOLA 5ABWA 6GCHF 3M5NA 4DIHH 1S83A 1HUTH 2FO9A 3K65B 1ORFA 3SHAH 3EA7A 5E2OA 2OQ5A 2ZIQH 2G8TA 1P2MA 5GIBA 3M37A 2A1DB 1TX6A 3HKIB 1ANCA 1FY5A 1LQEA 1O2KA 2LIZA 3BTQE 1HBTH 1UTNA 3MFJA 1HV7A 2GDEH 3QZRA 3WY8A 3TH2H 3EYDA 3M3VA 1O2SA 1P2NA 4JMYA 3NKKA 4THNH 2BHGA 2AIQA 1J16A 5T3HA 1BMMH 2DUCA 1ZSLA 1MZDA 2A4OA 2Y82A 4BAKB 1LHDH 4B2AA 1N8OC 1D3PB 1S84A 4ZH8A 4BXSA 3LGWA 3EDXB 3LIWA 2RDLA 2VIOA 3OY6U 5C5OA 1BJVA 1E37B 4ISLA 1WQSA 1XM1A 2ZU4A 5JB8S 2ZQ1A 5ETXA 3RMMH 4Y0ZE 1Y3VA 6ESTA 1GPZA 1PPZA 2PKAA 2BQ6B 1ARCA 1BBRH 3GDSA 3RU4T 2Z9LA 1DSTA 3D62A 4XFQA 2ZFSA 1AKSA 5DJ7A 1W0ZU 1HPGA 5A0BA 1TABE 2PUQH 1DANH 1HGTH 1GHAG 2OC1A 2UWPA 1YP9A 2B0FA 3SU6A 3RXLA 1GWAA 1NFYA 1UVOA 4Y71A 1O2RA 4UFEH 3KN2A 1BT7A 2C8ZB 3F1SB 1C1UH 1E34B 2PHBA 2ULLA 1SGYE 3PMHB 4OS1A 1S6FA 2ZGBH 1K1OA 4MPWA 1SOZA 2C90B 4MNVA 2ZDLA 1WV7H 3V0XA 3P95A 1O3DA 3BSQA 3V7TA 1XXDA 1H8IH 1W0YH 1CO7E 1NESE 5HM9A 1QBOA 4DJZB 1GI1A 1C1QA 2ZU1A 4HZHA 1GVZA 1WUNH 2ZCLP 3DD2H 3RXPA 1ELFA 3BF6H 3LH3A 4WY3A 1TMUH 1T32A 3UR6A 2FXRA 1KXCA 1GI5A 4FXGH 2QCYA 2TPIZ 2HNTE 2Z3DA 1BTHH 3A86A 3SV9A 2F9NA 1PQ5A 1ZGIA 3BIUH 1GHAF 1AHTH 1MKXH 3RXFA 3SU5A 1VZQH 1TX8A 1EAWA 2BQWB 4H6SB 2C8YB 4NG9H 4WVPE 1V2PT 1QFKH 1O39A 1O2VA 1GCDA 2A4GA 2ODPA 4JZIA 1BA8B 5FPSA 2SFAA 1GBLA 3RXCA 1MQ5A 2XBYA 1AFEH 1XUFA 3BEUA 4NIYA 5DP9A 3QUMP 1BRAA 1Z1IA 3MU1A 2WINI 2UUYA 2VIPA 3RXDA 1AUTC 3P8FA 2QN5T 1S6HA 1UTMA 1DY9A 1M9UA 1BJUA 4Y7AA 4CRAA 3RMLH 1EJNA 3S69A 2AS9A 1C9PA 2GZ9A 4NZQA 1V2JT 3TJNA 1JRSA 3E0NB 3NPSA 2A4QA 1KXAA 3GOVB 1SQAA 2GGVB 3GCOA 3GY4A 1UHBB 3KF2A 1VJ9U 2BY9X 3M5LA 1BBRK 3F9EA 1F7ZA 1SGDE 1UVSH 3R0FA 1MUEB 1CBWC 1GJBB 3SOSA 1FV9A 1DICA 2B9LA 1C5MD 3SQEE 1TNIA 1BOQA 5A09A 1Y5UT 1AE8H 2VH6A 1A2CH 3BTTE 1GGDC 2XCFA 3RXMA 4Y8YA 4HI3A 4K2YA 3PWCA 1GBHA 3SV8A 1O5BB 3KCGH 1SLXB 3GDVA 3BTHE 3C27B 1GHYH 3STIA 4ZHMU 4ABFA 4X1RU 2Y7ZA 2AGEX 2V3OH 4I8KA 1G2LA 1RTLA 1HJ8A 2A5AA 1G3CA 1DITH 1OOKB 1A4WH 2FS8A 2J94A 1BRBE 2FOEA 5FXLA 5E2PA 4FUIA 5E0JA 1P05A 3E6PH 1BIOA 4NIWA 1O5EH 2H9TH 1KXFA 3TGKE 1ZYOA 4X8UH 3NXPA 5FHTA 5EU8A 3A87A 4NWLA 1C2GA 3MU5A 1P9SA 1FAXA 5A0CA 1H9HE 4J1YA 2UWLA 5EQRA 1SGNE 3NCLA 1YM0A 2C4FH 4ABJA 5CHAC 4I8GA 4NIVA 2OC8A 1DX5M 3QDZB 4OS2A 2Y81A 1UK4A 2ANWA 2V35A 2A7JA 2OQUA 4NSYA 2UUFB 2ZDVH 1GI6A 4RSPA 1QJ6B 3MMGA 1NC6A 1DS2E 1S81A 2D2DA 2BVSH 5C67A 1L0ZA 1F0UA 4DOQA 1F92A 2P3UB 4UEHH 5F6MA 1TPAE 2B5TB 5F03A 1P11E 1C1MA 4K1TA 3URDA 2VIDA 2ZDAH 1HDTH 2H9HA 3CP7A 1C5NH 1CA0C 1NROH 1PPBH 2FTMA 4FVBA 4X2VA 1GMHG 4B74A 4NA8A 1FDPA 3V12A 1EZXC 2Y7XA 3UPEA 4GCHF 1NS3A 1IQGA 4AFQA 2FI5E 2LNCA 2PTNA 4ABAA 4INKA 1K1LA 5F8ZA 3A82A 3LONA 2W7SA 5ESTE 2J38A 2VIVA 1SGTA 3LJJA 4NA7A 4BAMB 1DSUA 2BD8A 3LOXA 1QA0A 1P04A 2ODYB 1C5PA 3M61U 4XSKU 2NWNA 1SGRE 3MO3A 2XC0A 2Z9JA 1FJSA 3B9FH 1RJXB 2HALA 1D6RA 3N7OA 3TK6A