2HOBA

Crystal structure of sars-cov main protease with authentic n and c-termini in complex with a michael acceptor n3
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Production of authentic SARS-CoV M(pro) with enhanced activity: application as a novel tag-cleavage endopeptidase for protein overproduction
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 90
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2hobA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hobA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hobA02
1UMAH 1TMBH 1XUJA 1AVXA 3CP7A 1ZJKA 3EGKH 4K1SA 3RXPA 3PMAB 2JKHA 2HRVA 1G32B 3TH3H 4MQAA 1RTFB 4JZIA 4NSVA 3E90B 4Y8XA 3GDSA 4X8UH 3F9GA 3UNQA 1NRNH 2FMJA 2PFEA 3GYMA 1O2UA 1SLWB 2HPPH 2Z94A 1TFXA 5T6GA 2ANMH 1YKTA 5EQRA 4AX9H 2BDIA 3GICB 1GI5A 2F9UA 2Q6DA 1Q31A 1SGFG 1SGNE 1Y3UA 3TPIZ 5E8EH 1TRNA 1HJ9A 1XUGA 1J16A 1EAWA 1FY4A 4A6LA 5GXPA 1EAXA 3ZZ7A 2CV3A 1BIOA 4GCHG 1NPMA 4WMEA 1RXPA 1EJAA 1BZXE 2BD4A 4KP0A 3AVZA 2EI6A 2JETC 3KHVA 1EPTC 2ZI2H 3DHKH 4NG9H 5DJ7A 4FUFA 2OCVB 1MQ6A 1ETTH 5F03A 2YOLA 1MTUA 2PWXA 1TBZH 1A5IA 3T5FH 1GG6C 1QJ6B 2BDAA 1SLXB 3A7WA 3A7TA 1A4WH 4ABAA 4RSPA 4Q2KA 1DWDH 1O2YA 7KMEH 1NU7B 3BSQA 3VEQB 5JPMH 1GBDA 2BLQA 3RXIA 1BRCE 1PJPA 1TNGA 1G2LA 1E0FD 3EBNA 1BTHH 1LPZB 3SJKA 1L2EA 1QR3E 2ILNA 5DGJA 1IQKA 3MNBA 1QA0A 2FX4A 4HFPB 3SUGA 4X2VA 5ESTE 3MH6A 1WQVH 3OSYA 1P03A 1C1TA 3V12A 2WV5A 1CVWH 1C5SA 4D76A 1BHXB 1AY6H 2XYAA 3MH7A 1TMUH 2FYRA 2VVUA 1MTVA 1XXFA 4JYVH 2BZAA 1P57B 1SB1H 2GKVE 4MPVA 1C2MA 1A3BH 2ANKH 4KELA 2WUCA 3TK5A 4I8KA 1EJNA 2ZWLH 2J9NA 3AAVA 1TONA 3BTGE 2GV6A 1F5LA 2BM2A 6GCHF 2CMYA 1ZPBA 1EB1H 1PPEE 3TGJE 1HAIH 1BT7A 3MNSA 3MYWA 4TPYA 1D3TB 2QIQA 5EW2H 3RLYH 1O3IA 1TWXB 4IGDA 3RP2A 1F5KU 1E34B 1OS8A 1FNIA 1QGFA 1GCDA 1P04A 1LO6A 4MG3A 1T8MA 2BD7A 2FODA 3A7YA 3Q3KA 1C4U2 3SNAA 1GVLA 2JETB 1GBCA 5EQSA 1GVZA 1VZQH 2YNAA 1C9TA 1HXFH 3L3TA 4O3TA 4CRDA 1P12E 5A8YA 1C5VA 4DURA 5DP9A 3I29A 2UUKB 4B2BA 4AGKA 6GCHG 1QB6A 2SGPE 3TGIE 3SNEA 2Y7XA 1K1PA 1TA2A 1OSSA 2FZZA 2CF8H 1UTNA 1SQTA 1T8LA 3D49H 1C1NA 4OGXA 1F0RA 1XKAC 3SHCH 1JXPA 1OP8A 4X2YA 2P8OC 1N6XA 3BEIB 1P01A 1TPSA 1V2RT 1CT2E 3GDVA 4X1NU 1FDPA 1HJAC 1OXGA 1SOTA 2OINA 4KTSA 3P17H 1GCTB 1ELAA 1YBWA 5AHGH 5C1YA 1C2KA 4GSOA 1LHDH 2LIZA 4WXVA 4MPWA 4UFEH 1PYTC 4FUCA 2AMDA 1BMNH 3SV7A 2IN2A 5FAHA 3UNSA 2M5TA 9LPRA 4BANB 3KL6A 4THNH 1OYQA 4Y0YE 1C5NH 3GCHC 1BTXA 4ZKOU 2BLOA 1JIRA 1YPEH 1TPOA 2AFQB 3BTFE 2PKAB 1TMTH 4YOJA 1A1RA 1CSOE 1ZRBA 1ZTLA 4IC6A 1MTNB 2J34A 3U1JB 3BEUA 3IG6B 1TGNA 3GCOA 2PKSB 3SJIA 1ZTJA 2A2QH 1UTJA 1D9IA 2ZC9H 4GVUA 4UFDH 1Z8JB 1O2GH 4ABDA 4X8TH 1E36B 1TGBA 3E16B 3A8DA 3RMMH 5SGAE 1S0RA 1IHSH 4Q7YA 1P0SH 1AB9B 3TJUA 3V13A 3OU0A 3Q3YA 1PPBH 1UCYE 2ZFRH 2Y5GA 3W94A 3DFJA 3GOVB 3GCHB 3RXFA 1BTPA 4GPGA 3SU3A 1BTZA 2ZHQH 5HM2A 1D4PB 1YF4A 2GVFA 1MTNC 1C4V2 5GDSH 3L33A 2K7XA 1SLUB 1SGRE 4MPUA 2HNTC 4HTCH 3BG4C 1BJUA 2FLRH 1LVMA 1MZAA 1ELTA 5EXMA 4F4OC 1SFIA 3PTBA 4U2WA 1NRSH 1AWFH 1CHGA 1TIOA 3LGIA 2ZDLA 1IAUA 2Y81A 5FX5A 3TH2H 2VINA 1EAIA 1HLTH 1BA8B 1T32A 2W3IA 1RD3B 3LU9B 4BAMB 4AFZA 4WMFA 3K9XB 2Q6GA 2PSXA 4IC5A 1GMDG 2ZGXH 1C5RA 2G8TA 1UVTH 2ZCLP 4ISHH 1ZPZA 2GX4A 1O2VA 1ZGIA 1ANEA 5J4QA 5JBCS 1KYNA 1GDQA 3PYHA 3QUMP 2TPIZ 1GI1A 2FLBH 2VH6A 1Z7KA 1C1QA 4O3UA 1A0LA 3QDZB 3VB4A 1V2NT 1ELVA 2PTCE 4A92A 4UD9H 1AKSB 1UK4A 2Z9KA 2BQWB 2ALPA 1C5TA 1T4UH 1YPHC 4OS5A 2ODYB 2SGEE 4YT6H 1NTPA 5F8TA 1EAUA 1M9UA 4Z6AH 5C5OA 1YCPK 3RC5A 2FTMA 1DY9A 1CA0C 4BXSA 1UK2A 1BHXF 1JRSA 1LHGH 3M5LA 1V2LT 2A4OA 4CHAC 3EA7A 1OWDA 2ZFTA 1ANDA 2PTNA 2ZU1A 4ZAEA 1PQ8A 1RTLA 5E0JA 2UWLA 1HAZB 1W13U 1QY6A 3NUMA 2XCNA 4F49A 5EOKA 1B0FA 1Z8GA 2Z9JA 2BYAX 3LGVA 1WQSA 3GCTF 2YNBA 3F9FA 2A32A 3SV9A 1AE8H 2FEQH 3A8BA 2XXLA 4UEHH 4UE7H 5DP8A 3ZYEA 3S9BA 3RXHA 2HVXA 4O9VA 3N7OA 1C1PA 4IMZA 3FZZA 4ZKRU 1RS0A 3VXEH 4CRFA 1D6RA 1D3DB 1YPHE 1ZGVA 3O8RA 3IITA 1GJ6A 1MKXH 4D9RA 4LOYH 1OOKB 1EXFA 1WCZA 1G3EA 3TGKE 3MFJA 3TITA 1GDNA 1GJ7B 4FUDA 3RMOH 4ESTE 2TGTA 2VVVA 5I46H 1DLEA 1Y5UT 4AB9A 4Y8ZA 4ABFA 1EOJA 2UUYA 2ZA5A 3BTDE 3L6PA 3GY7A 1PQ7A 1XUIA 4ABEA 1FUJA 1O3KA 3UWIA 1UTOA 2BY8X 1AGJA 2RDLA 4JZDH 2J92A 1NU9A 4CHAB 1XUHA 1SGTA 3ENSB 4TY7A 1RTKA 4UDWH 3H7TA 2ZHDA 3BTHE 4BOHA 3A7ZA 1TRYA 1C1WH 3MU1A 1K1IA 1MKXK 4FU9A 2EC9H 3RU4E 1PPZA 1RIWB 2W7UA 2WPJS 2J2UA 2UUFB 3S69A 1K2I1 4XBBA 4B2AA 3PMJA 5L2ZH 1EASA 3MO3A 1JIMA 4IS5A 2W7SA 3LJJA 3QO6A 1K28D 1D3PB 3GY5A 4HZHA 3ZV9A 1O38A 1QA7A 2HALA 3TNSA 4X1RU 3VXFH 1GI6A 1YGCH 2EI8A 1F0TA 1DUEA 4FXGH 2H6MA 5E2OA 1LQDB 3LONA 1TNIA 2W26A 3LGWA 4FUGA 2QXIA 1S84A 1RGQA 1C2HA 2Z3DA 3PLKA 1QJ7B 3AW1A 2BD9A 1FI8A 1YPKH 2OC1A 2R0LA 1EKBB 3A8CA 1NO9H 4CREA 1A0JA 2ZKSA 1EP5A 1AZZA 2P3FH 2ZGCA 3I78A 2F9NA 2UUJB 2BY9X 1A3EH 4XDEA 1UCYH 2FTLE 2FOCA 2STAE 1DE7H 1VCWA 2OD3B 3SJOA 1GBKA 4FVDA 6LPRA 1A46H 1SGDE 1SHHB 2BY5X 2FM2A 5HMAA 1VITG 1JRTA 1QRXA 1EX3A 5GCHG 1OPHB 4DY7B 3PV4A 1DY8A 2VIQA 1GHBG 2ZGJA 3H7OA 4Z0KA 1DS2E 4WF8A 1TBRH 3ZZ5A 2ESTE 2Z3CA 1ABIH 2FXRA 2EEKA 2OC7A 1DVAH 2ZFPH 1O2OA 1B7XB 4FUBA 1GWAA 2CJIA 2AMPA 2A7JA 3KQEA 1LHCH 2ZIQH 1OWEA 1O33A 2Q6FA 1EZQA 1YPMH 1C1OA 1ETSH 3GY3A 3SOSA 2XWBI 2R2MB 2D8WA 2V35A 1IQJA 4X1QU 3OX7U 2VJ1A 3AW0A 2BQ7B 1OP2A 1GI8B 2VIPA 3BTTE 4RKJB 3M37A 1O3GA 2GMTC 3QK1A 3V7TA 1H1BA 5T3HA 4D7FA 1T31A 2R0KA 4B75A 2CHAC 1GJCB 1K1JA 4KTUA 1GGDB 2FOEA 7LPRA 4Q80A 1BOQA 4QT8C 2OQUA 1ELFA 4JZ1A 1NRRH 5JBAS 1GJAB 2G55A 1V2PT 4LK4A 1O3PB 4ZKSU 5DKMA 1GCTC 1C2LA 1GI4A 1MUEB 2TGPZ 1XUKA 4FUIA 1QFKH 4LZ4B 1NFYA 3TK9A 3R0FA 5JB8S 2BY6X 4H4FA 8GCHG 1G3DA 1SGEE 3K6YA 1MTWA 4XBCA 4ZHMU 4ZHAA 4HI3A 3RXMA 3UIRA 3ZYDA 3PWBA 4WH8A 5EPNA 2RG3A 1TX6A 1FN6A 1BRBE 4AORA 6CHAC 1KLTA 3QZRA 2VIOA 2TGDA 1KXEA 3ATIA 1GHXH 1A5HA 4YO9A 4X1SU 1HBTH 1QQ4A 3BTQE 1Z1IA 1XXDA 2A0QB 2C8XB 1NROH 4I8GA 1YM0A 3P8GA 1BITA 1MAYA 1G9IE 4CBNA 1GMCG 1C1UH 4U32A 1TAWA 3PWCA 4A1XA 3E91A 2Z3EA 3ELAH 1ZHMA 4AOQA 3T26A 3QGJA 2BD5A 1GBHA 2ZNKH 1O2PA 4MNYA 5TJXA 1HIAB 3TH4H 2ZPRA 4ZROA 1TNJA 5C5NA 1C2FA 1FPHH 1V2MT 2OC0A 1LVOA 1AFEH 3K65B 2FDAA 2Y5FA 3M7UA 1O37A 1SQAA 2GD4B 1O31A 2BXUH 4X1PU 3VB7A 4ISOA 4NWLA 1SMFE 1CGHA 5GWZA 1NS3A 5HXFA 2FOAA 4ZUHA 4YESB 1P2IA 4X6OA 2ZEBA 3RUOA 3STJA 2R2WU 1UTPA 1GBEA 5C3NA 1F7ZA 1DT2A 2QF0A 3Q3XA 4X2WA 4GUXA 2PKAA 3ZZ9A 1P2OA 1BRAA 4CR5A 2R3UA 4YTAA 1TGCA 1ANBA 1AE5A 2PR3A 3FAOA 2SNWA 3ATMA 2R3YA 1QBVH 1UTKA 2SGQE 4OS2A 2KAIB 4XFQA 3RXRA 1C4Y2 1AUTC 4E05H 4D8NA 1N6YA 3UREA 1D3QB 2D2DA 1OWKA 2VH0A 3TJNA 1UJ1A 4Y6DA 4J1YA 3DFLA 1Z6EA 1KY9A 2LPRA 1OP0A 1YCPH 1P2JA 5GJ4B 2C3SA 4M7GA 1NRQH 3RXQA 2W3KA 3SV8A 2BDBA 4A1VA 4K8BA 1KTSB 4Q7XA 2PV9B 3O8DA 1JWTA 4UONA 1CT4E 2LNCA 4CH8B 2HLCA 1A7SA 1O2LA 2WINI 3MNXA 5I25A 1KXFA 5JDUB 2GT8A 1EQ9A 2AEIH 1LKAA 2ZECA 4FUHA 8ESTE 1AFQC 4H42U 3M61U 1QCPA 1BRUP 1YC0A 5A0BA 1EUFA 1ZMJA 2ASUB 3P6ZB 2C4FH 4JMYA 3HK6B 3H5CB 1P2MA 1ELCA 3SJ8A 1W10U 1RFNA 4ASHA 5DP3A 1V2QT 1P3CA 1H4WA 1TALA 3EDXB 2ZDMA 4YM9A 1GJ4H 4X2XA 1ELGA 4HGCA 1GVKB 3A83A 2O8MA 4AYVB 4KGAA 1UO6A 1AUJA 2QYIA 2A4GA 3FFGA 1FV9A 4DT7B 1KXAA 3HKJB 3KEEA 5EGMA 3M3SA 1BJVA 2I6QA 2BXTH 1QBNA 2GDEH 2J94A 4INKA 3U69H 2ZQ1A 4JYUH 4D9QA 4I7YH 3IWMA 5F8ZA 1GHZA 3ZV8A 4YZUA 3MH5A 2ODQA 1V2TT 3OY6U 2FI5E 2ZTXA 4DCDA 1S85A 1BMMH 1KDQA 3U8OH 1O5FH 2Y82A 1C5WB 4E7RG 1SFQB 3MU5A 3F9EA 1BBRK 2A5IA 1FLEE 1UVPA 4TWWA 5EQQA 3UQVA 1OWHA 2TIOA 4B1TA 1EB2A 4I31A 3A85A 2GTBA 1XVOA 2A7CA 1L1GA 3DD2H 4K60A 2Z9IA 1DFPA 2C93B 1NFXA 5DP4A 3URCA 3TU7H 2B7DH 3ESTA 4OS4A 2ZU2A 1L4DA 1O2IA 1LMWB 4WJG2 2ZFFH 1BUIA 1HDTH 1A2CH 3F68H 2GP9B 3M5OA 1GBAA 4TPIZ 1GMDF 1AZ8A 3RU4D 1TLDA 1LTOA 3Q77A 3ODDA 1AQ7A 1P2QA 4ZHLU 5K7RA 4YOIA 4MNVA 3LC3A 2BDHA 1F0SA 1AI8H 1O2QA 3LC5A 3E6PH 4WVPE 4ABGA 4XSKU 3BG8A 3V3MA 4XE4A 3F6UH 5ETXA 3SU5A 1CT0E 4B74A 3NKKA 1PPHE 3PLPA 1TQ7B 2FOHA 1WV7H 2BX4A 3O8CA 2F91A 2PLXA 2DE8A 1GPZA 1Y3YA 1C1SA 1Y5AT 1HAPH 3LIWA 2ANWA 1O3HA 2PUQH 2CF9H 1C5UA 1ZOMA 2VB0A 3V0XA 3VGCC 4I32A 4AYYB 1DM4B 1F92A 4K69A 1BTWA 3TVJB 3D23A 1HV7A 2ZGBH 2BX3A 2C90B 4E06H 2WPMS 1YPJH 1SSXA 3KQCA 3RXBA 1HRTH 1IOEA 1ZSLA 3RM2H 1KDQB 7GCHG 1IQIA 1BQYA 1ORFA 2OBOA 3HATH 1H9HE 1V3XA 4JYTA 4WMDA 5C20A 2J95A 1JBUH 2QF3A 1V2ST 5L2YH 1KIGH 1A0HB 4Y0ZE 3SNCA 1P9UA 5HM9A 2HOBA 1AU8A 2P93A 3UUZA 4R0IA 2PW8H 4Y71A 2AGEX 3FVFB 1P2NA 1YLCA 4AFUA 2BD3A 1JMOH 1TQ0B 3AASA 2TGAA 3I77A 2BLVA 3CENA 1EZUC 1GJDB 1W0ZU 5DG6A 3QWCH 3ZVGA 6ESTA 3UPEA 1Z8RA 1S83A 4ZXXH 1CO7E 1WU1A 3T27A 1GHBF 2V0BA 3M35A 5HGGA 3Q76A 1QQUA 1NM6A 4GAWA 4R8TB 3T28A 1V2OT 1MBQA 3LJOA 4OGYA 3RXSA 1QHRB 1C2EA 1GHWH 4B2CA 2BOHB 2EA3A 3SUDA 2GCHG 3U98H 4BAHB 1O5BB 1DXWA 4K5ZA 5FXLA 5AFYH 1XUFA 4NSYA 1AVWA 1PPGE 3UY9A 1T7CA 4MLFB 4CR9A 5LH8A 3NZIA 4AN7A 2Q1JA 2Y6TA 1LVBA 3STIA 2G52A 3S9CA 3E1XB 1SOZA 2O8LA 3RXKA 2XBVA 1FPCH 2A4RA 4DIIH 3QN7A 3E0PB 2B8OH 5EXLA 4RN6A 2VIVA 3UOUA 2NU0E 1O3MA 1KLIH 4WH6A 2BVXH 2Y5HA 2OQ5A 2O8TA 5LPFA 3RXOA 3BG4B 4CRCA 4DOQA 5T6FA 1GJ5H 5JBBS 1SI5H 2Y7ZA 1V2JT 3HK3B 2FS8A 3A88A 1INCA 1WTHD 2P8OB 4SGAE 3LGYA 2WYJA 3SQEE 1DWEH 1VITH 2QXGA 3A7XA 5F8XA 2AS9A 1W11U 1MMJN 1HAYB 2FOGA 4BAKB 5DP7A 3SUFA 1H9LB 5FCKA 1EZXC 2Z6BD 1SQOA 3SV2H 5FX6A 1G2MA 4FU8A 1SGIB 2XNIA 1XMNB 3KNXA 3GCNA 2OLGA 4BTUB 3RXGA 3M7TA 1LHEH 1W2KH 1TGSZ 3LKWA 1U6QA 3LDXH 4X6MA 5BPEA 3T62A 4JCNA 5LPRA 1YYY1 1ZMLA 4UFGH 4MNWA 1UTQA 3RXCA 2NU4E 2GZ7A 5TCCA 2FO9A 3MU0A 3RM0H 2H9EH 3PO1C 5AVDA 1NZQH 3KQBA 2BLWA 1KXBA 1UVSH 5A2MH 1O2ZA 1F0UA 3GDUA 1ZHPA 1FAXA 1FY1A 3NXPA 5FPTA 3QTVH 1J14A 2CGAA 3MU4A 4GHQA 1DLKB 3OYPA 4TY6A 1GBLA 3BF6H 3C27B 2PUXB 4GCHF 5ABWA 1HXEH 2AGGX 6CHAB 1VR1H 5A8ZA 1O36A 2DE9A 3EA9A 2XBYA 2VNTA 1N1LA 3NCLA 4A7IB 1S6FA 1Z8IB 2H2ZA 1MD7A 5DP6A 3LPRA 1HFDA 4AG1A 1VJAU 4WWYA 4MNXA 1Q3XA 4VGCB 3SU0A 4Q7ZA 1AIXH 1EP6A 1TNHA 1TBQH 2ULLA 3JZ1B 1NFUA 2JH0D 1G3BA 3ZZ8A 1K21H 1NFWA 1QRWA 3ZZCA 1G30B 1P09A 2GV7A 2FOFA 3ZZDA 4GHTA 3KIDU 3RXTA 2AIPA 2WPKS 4ABHA 3O8BA 3LGUA 2ZPQA 4H6TA 1GBBA 3BIUH 4AB8A 3MU8A 1SL3A 1O34A 3M7QA 2SNVA 4OS7A 2IOTA 3BIVH 2VU8E 5EPYA 1DUAA 1LKBA 1W0YH 3T2NA 1BMAA 3A82A 4BTIB 2XBXA 1FZZA 3EQ0H 1DPOA 1GI3A 1K22H 5C1XA 1K1MA 1GHYH 3FP8E 1FN8A 5DO4H 3KF2A 4Y11E 1VJ9U 3HGPA 1O3CA 2BVRH 1AD8H 1UHBB 1A61H 1SHYA 5E0GA 4Y76A 2QA9E 2QAAA 2STBE 3BTME 1BMLA 3Q00A 4A1TA 1KLJH 1IQNA 2PKSC 2AYWA 1O3OA 2GDDA 2GMTB 3ZZ4A 5IYTA 1P8VC 1IQGA 2Y80A 2VGCC 2BVSH 1MTSA 1TPPA 1Q2WA 3ZVDA 1AB9C 2OTVA 2J4IA 4YLUA 4MPXA 1WOFA 3GY6A 1LDTT 4FU7A 1HCGA 3SNDA 1P11E 1GMCF 1ZPCA 2C8YB 2DUCA 1C5ZB 4JZEH 2OP9A 1ESBA 2GT7A 1DICA 1W14U 1SR5C 1T8OA 1TA6A 2ZQ2A 3JZ2B 4BAOB 1TGTA 5A0AE 5CMXH 1CBWC 4H6SB 3M3TA 2FESH 1SG8B 2ZDAH 5FCRA 1EZSC 3W95A 1QL7A 1MKWH 3DT0H 4I33A 1LQEA 3B9FH 1Z6JH 3MTYA 3RXDA 3C1KA 1KTTB 1DWCH 1MD8A 2OC8A 4OS1A 1OYTH 1V2VT 1QB9A 3UWJH 4X8VH 5EG4A 3K6ZA 1C5LH 1T4VH 3S7HB 3GISB 4U30A 1KXCA 4B73A 3ODFA 3DUXH 1B0EA 3HKIB 1MZDA 1O3JA 4VGCC 2HWLB 3ZVFA 4K1TA 1MBMA 1O3DA 2KAIA 2AIQA 1L0ZA 2BZ6H 1H8DH 2FWWA 2ALVA 4NCYA 3A89A 1BBRE 5E2PA 1LHFH 3SNBA 3EAJA 1CGIE 4MVNA 3BTEE 1GHAG 2GCTC 4NFFA 1WAYB 1IQEA 4UFFH 4NIYA 1L1NA 4ZMAH 1UCYK 4XOJA 2G4UA 1EPTA 3D65E 5JYIA 5ESBA 3GY2A 3MH4A 4BAQB 1GG6B 1N8OB 4BXWA 3ZZBA 4IN2A 5C2ZA 5JBTA 2BY7X 3SBKA 1EOLA 2FYQA 1HAOH 1MCTA 2JH6D 2RA0A 2F9VA 4DW2U 1O5GH 3LH3A 3KQDA 1ZLRA 1HJAB 3SW2B 3P8NA 1TRMA 3KN2A 2ZU4A 1ZTKA 1HAXB 3M5NA 1ZRKA 3U9AH 2WPLS 2A1DB 1MKWK 5FPYA 1ZYOA 5A09A 1MH0A 1XKBC 2F9PA 2J38A 3MI4A 2BDCA 3M5MA 1O5EH 5LPEA 2XC4A 3G01A 2O8WA 4NIXA 5CHAB 8LPRA 1O32A 1A5GH 5G4BA 3KCGH 1C2JA 4J2YB 1J17T 3LT3A 1HAGE 1MU6B 2V6NA 1Y3VA 3P95A 2B5TB 2G81E 3P92A 4TWYA 4AZ2B 2ZFQH 2C8WB 1V2KT 2XC5A 3SN8A 1ZR0A 2K1QA 2Z9LA 1AHTH 1GJ9B 1S0QA 1O2KA 3MMGA 4ISNA 4XBDA 1H9IE 5EXNA 2UWOA 2QGRA 3SQHE 1ELEE 2ZF0H 3RXLA 1FAKH 5J4SA 1BB0B 2A7HA 3CS0A 2QC2A 4JZFH 1RIWC 2AH4X 3TJOA 1HAHH 3P70B 2CN0H 2TRMA 3FZDA 2PHBA 1GJ8B 1SBWA 4INHA 1ACBE 3A84A 2BQ6B 2ZHFH 2P3UB 3RXEA 1ZSJA 4NWKA 3MO6A 2ZU3A 4I8HA 3U8TH 4LZ1H 1FXYA 3PB1E 1P3EA 1C5MD 3SV6A 4K8YA 3ZZ6A 3BTWE 4I8JA 1O30A 1RJXB 4YOGA 1QURH 3RMNH 1IQLA 2GZ9A 1CGJE 1HAVA 3VB6A 4NA7A 1Z1JA 4X8SH 5PTPA 1Y5BT 1PPFE 2G00A 1ARCA 1ESTA 8KME2 3LOXA 4ZH8A 4CRAA 1E37B 3RC6A 1Y59T 1GL0E 4FVBA 1Y8TA 2BD8A 1EJMA 1YLDA 1AVGH 3QGNB 1UVUH 1AFQB 2PGBB 3MHWU 5CE1A 7GCHF 3GY8A 1GI9B 2F3CE 1VCQA 2F9BH 3PM3A 4Y8YA 1J15A 3UR9A 1CHOG 3HPTB 1MU8B 1XVMA 1O2RA 2SFAA 3NWUA 1T8NA 3SGQE 4DGJA 1FONA 2H9TH 1F5RA 3TJVA 1OWIA 4AGJA 1O35A 5C67A 1C2DA 1VCPA 1GL1A 4K1EA 2HPQH 2HGTH 3TK6A 1BTUA 1L1JA 3RXJA 1CA8B 2FI3E 3A80A 4Y7BA 1HB0B 1ZSKA 1P02A 3RLWH 2VVCA 5A0CA 4PROA 3SI3H 1TOCB 1IQMA 3SZNA 1DANH 4AG2A 4RKOB 4SGBE 4D7GA 1NN6A 4B76A 4IW4E 1XM1A 2C8ZB 1DSTA 2NWNA 3ZVCA 1QRZA 1W8BH 1O3EA 1O3LA 2BMGB 1CHOF 4WXIA 3R3GB 1KXDA 5H4IB 2W5EA 3QLPH 1ESAA 2SGAA 1GI2A 1PQ5A 1NRPH 2A4QA 3UNRA 1O39A 4BNRA 1AKSA 3PROA 3SGBE 1PPCE 2VIDA 1THRH 4YT7H 1C5XB 3FP7E 1PYTD 3U1IB 1ETRH 8GCHF 3SO3A 2P59A 2QV1A 1YP9A 3SHAH 1OX1A 2P16A 4K2YA 2A5KA 5A8XA 3E8LA 3P8OA 1G3CA 3MOCA 1TB6H 3VPKA 1F2SE 9ESTA 1BCUH 2SGFE 3HGNA 1QNJA 3PMHB 1P06A 2XW9A 1ZJDA 2H5DA 5AF9H 1DITH 2ZU5A 1FIWA 2GGVB 2AGIX 4ABIA 5LGOA 1DXPA 3WY8A 4A5TS 3ZZAA 3LGTA 1UVOA 1PQAA 2RCEA 4X0WU 2ZCKP 1UTMA 2V3HH 5GPIB 4LXBH 4MDSA 1ABJH 1QIXB 1S82A 1WYKA 1GGDC 3UQOA 3SU6A 1CE5A 1O3FA 1LVYA 2OUAA 4CBOA 1O2WA 3BV9B 1C5YB 2PSYA 1SGQE 1V2UT 1UTLM 2SGDE 4Y79A 5FPSA 3RXUA 4NIWA 4DG4A 2ODPA 4ISIH 1Z71A 2XBWA 5GIBA 5FBEA 1O2TA 1NY22 3B8JA 1HAVB 3EYDA 1E38B 2GCHF 1GBJA 1V2WT 1K1OA 1K9OE 1MCVA 1BBRH 1MQ5A 3M36A 1W3CA 1WSSH 1Y3XA 4FUJA 1X7AC 3DA9B 4O03A 1GDUA 2XC0A 5CHAC 1S81A 3QX5H 4B71A 3E3TA 2A2XH 3MWIU 1S6HA 2ZHEH 2FIRH 3EE0B 3VFEA 1SC8U 2WPIS 1O5CB 2A5AA 1C9PA 2IJOB 1B5GH 4IN1A 2H1UA 3URDA 1AMHA 2BB4A 1LPKB 1VGCC 5FHTA 2G5NA 1QL9A 2FS9A 1LPGB 3NK8A 2QCYA 3SGAE 2P94A 1W7GH 1NC6A 1J9CH 4MTBA 2QXJA 1QJ1B 4OS6A 1GBFA 3SI4H 4K3JA 1TOMH 1ZHRA 1TNKA 1CBWB 1O3NA 4CRBA 1SVPA 1GI7B 2HNTF 2QY0B 3UR6A 4I8LA 1SGPE 2ZZUH 3S7KB 1TPAE 1THPB 3QTOH 2G5VA 3UFAA 3S9AA 1NESE 1SPJA 2F83A 5DP5A 2G4TA 5C1UA 2B9LA 2H9HA 2VWMA 4WY3A 2JH5D 1FY3A 7ESTE 2A45B 1GHAF 2ZDNA 2ZG0H 2RA3A 4BTTB 2BD2A 3D62A 5HYOA 3A81A 4ZXYH 3MNCA 2XCFA 3A8AA 1OWJA 1O2HA 2BHGA 2IPHA 3LH1A 5DK1A 1C1MA 2P3TB 3AAUA 3K2UA 1FMGA 4GLYA 2I6SA 1S5SA 3EA8A 1EATA 1VGCB 4IBLH 1GJBB 1SGFA 1SGCA 2EI7A 2AERH 1C5QA 2VIWA 5GCHF 2CXVA 2ZGHA 1QTFA 1ELDE 2XWAA 2Z7FE 1DWBH 2OXSA 1THSH 4FUEA 1TX8A 2WUBA 3SU2A 1CQQA 2FOBA 1N8OC 1XX9A 2D26C 1H8IH 1GMHF 1DX5M 1C1VH 1TX7A 4AFQA 1D6WA 4TYDA 1HJ8A 3TIUA 3M3VA 1UK3A 1GHVH 1GBIA 2OBQA 4E7NA 1O2SA 4IMQA 4NGAH 2XRCA 3GY4A 3U8RH 2VWOA 1QBOA 2ZDKA 3FANA 3BTKE 1ANCA 2UWPA 5EU8A 2WV4A 1W12U 1K1NA 2NU2E 4NZQA 3UOPA 1HPGA 1O3AA 4KTCA 5DPAA 3PTNA 1VITF 1QL8A 2D1JA 2F9OA 1O2XA 2THFB 2ZO3H 1GBMA 1AO5A 1GMHG 3FP6E 1TNLA 4CRGA 1FIZA 1ZMNA 5T6DA 1KSNA 1O5DH 2ANYA 2FX6A 1IQHA 5E0HA 2Z9GA 1ARBA 3TLOA 4O97A 4X6NA 4NA8A 5FBIA 2ZDVH 4INLA 2GZ8A 3SUEA 5TCAA 4Y7AA 2ZTYA 1K1LA 1DDJA 1EPTB 1HYLA 1FY5A 4NIVA 4Y10E 3S0NA 2ZFSA 3CS7A 2H5CA 3MO9A 2ZP0H 3A7VA 1W7XH 1JOUB 2NU1E 2BDGA 3T29A 2WPHS 3ZVEA 3VB3A 1TYNA 4ZKNU 1J8AA 2VGCB 5EW1H 3OTJE 2AMQA 1YCPM 1RRKA 2FI4E 4JK5A 3TNTA 3SU4A 1BTYA 1AWHB 3F1SB 3E0NB 3RU4T 3SJ9A 2ZPSA 2QN5T 1LCYA 5B6OA 3SU1A 4DVAU 1V6DA 4KKDA 4CH2B 1P2KA 3RXVA 3ZVAA 1CU1A 3OY5U 1BDAA 1O2JA 1C5OH 1L4ZA 1SGYE 1TE0A 2FOMB 2VWNA 2ZCHP 1C2IA 1FJSA 4DJZB 1WUNH 2FPZA 3ATKA 2R9PA 1HIAA 1P9SA 1P05A 2ZHWH 1O2MA 1FQ3A 2XTTB 3RC4A 1C1RA 1TABE 5L30H 4U01A 4NFEA 1NT1A 3KGPA 4YLQH 5IDKA 2A31A 5F6MA 2O8UA 3ATLA 4ISLA 4ABBA 1DSUA 1SLVB 2TBSA 3B23B 3ATWA 1E35B 3QZQA 5BRRE 1IHTH 3ZVBA 4DIHH 3P8FA 5L6NH 2O9QA 3T25A 3RMLH 1C5PA 2B0FA 2GCTB 2BOKA 3GCTG 3F9HA 1FY8E 2ZTZA 3ITIA 1MAXA 3BEFB 3A86A 2CHAB 1GI0A 5EODA 1DOJA 3NPSA 5K0HA 1CA0B 2G51A 2P95A 2QXHA 1O0DH 1GBTA 4AFSA 3RXAA 1OKXA 4NZLA 1WTGH 2FP7B 1O2NA 1Y3WA 3ZZ3A 3GYLB 1UHBA 1PFXC 1P10A 4NA9H 1O5AB 3VGCB 2HNTE 2VWLA 1HGTH 5AFZH 3A87A 1IQFA 2BTCE 1HUTH 1ID5H 1YPGH 3PMBB 4JK6A 1ZZZA 1G36A 1HNEE 3RDZA 1G37A 2WYGA 2BDYA 5JB9S 2NU3E 3BN9A 1AN1E 3PO1B 2V3OH 3SORA 1YPLH 3PLBA 1O3BA 1ELBA 1C2GA 3UTUH 4X6PA 3VB5A 2PGQB 1QB1A 4ABJA 1WBGB
chains in the Genus database with same CATH superfamily
1UMAH 1TMBH 1XUJA 1AVXA 3CP7A 1ZJKA 3EGKH 4K1SA 3RXPA 3PMAB 2JKHA 2HRVA 1G32B 3TH3H 4MQAA 1RTFB 4JZIA 4NSVA 3E90B 2HVYB 4Y8XA 3GDSA 4X8UH 3F9GA 3UNQA 1NRNH 2FMJA 2PFEA 3GYMA 2YMSD 1O2UA 1SLWB 2HPPH 2Z94A 1TFXA 5T6GA 2ANMH 1YKTA 5EQRA 4AX9H 2BDIA 3GICB 2HLDD 1GI5A 2F9UA 2Q6DA 1Q31A 3F2HA 1SGFG 1SGNE 1Y3UA 3TPIZ 5E8EH 1TRNA 3OEED 1HJ9A 1XUGA 1J16A 1EAWA 1FY4A 4A6LA 5EIYA 1EAXA 5GXPA 3ZZ7A 2CV3A 1BIOA 4GCHG 1NPMA 4WMEA 2M2AA 1RXPA 1EJAA 3WWBA 1BZXE 2BD4A 4KP0A 3AVZA 2EI6A 4TT3D 2JETC 3KHVA 1EPTC 2ZI2H 3DHKH 2QF5A 4NG9H 5DJ7A 4FUFA 2OCVB 1MQ6A 1ETTH 5F03A 2YOLA 1MTUA 2PWXA 1TBZH 1A5IA 3T5FH 1GG6C 1QJ6B 4ACBA 2BDAA 1SLXB 3A7WA 3A7TA 1A4WH 4ABAA 4RSPA 4Q2KA 1DWDH 1O2YA 7KMEH 1NU7B 3BSQA 3VEQB 5JPMH 1GBDA 2BLQA 3RXIA 1BRCE 1KMHB 1PJPA 2IJD1 1TNGA 1G2LA 3PRBA 1E0FD 3EBNA 1BTHH 1LPZB 3SJKA 1L2EA 1QR3E 2ILNA 5DGJA 1IQKA 3MNBA 1QA0A 2FX4A 4HFPB 3SUGA 4X2VA 5ESTE 3MH6A 1WQVH 3OSYA 1P03A 1C1TA 3V12A 2WV5A 1CVWH 1C5SA 4D76A 1BHXB 3N7EA 1AY6H 2XYAA 3MH7A 1TMUH 2FYRA 2VVUA 1MTVA 1XXFA 4JYVH 2BZAA 1P57B 1SB1H 2GKVE 4MPVA 1C2MA 3H09A 1A3BH 2ANKH 4KELA 2WUCA 3GS9A 4I8KA 3TK5A 1EJNA 2ZWLH 2J9NA 3AAVA 3AK5A 1TONA 3BTGE 2GV6A 1F5LA 2BM2A 6GCHF 2CMYA 1ZPBA 5C0TA 1EB1H 1PPEE 2K8IA 3TGJE 1HAIH 1BT7A 3MNSA 3MYWA 4TPYA 1D3TB 2QIQA 5EW2H 3RLYH 1O3IA 1TWXB 4IGDA 3RP2A 1F5KU 1E34B 1OS8A 1FNIA 1QGFA 1GCDA 1P04A 1LO6A 4MG3A 1T8MA 2BD7A 2FODA 3A7YA 3Q3KA 1C4U2 3SNAA 1GVLA 2JETB 1GBCA 5C17A 5EQSA 2JJ1D 1GVZA 1VZQH 2YNAA 1C9TA 1HXFH 3L3TA 4O3TA 4CRDA 1P12E 5A8YA 1C5VA 4Q63A 4DURA 5DP9A 1OHHD 2UUKB 3I29A 4AGKA 4B2BA 6GCHG 1QB6A 2SGPE 3TGIE 3SNEA 2Y7XA 1K1PA 1TA2A 1OSSA 2FZZA 2CF8H 1UTNA 1SQTA 1T8LA 3D49H 1C1NA 4OGXA 1F0RA 1XKAC 3SHCH 1JXPA 1OP8A 4X2YA 2P8OC 5F53A 1N6XA 3BEIB 1P01A 1TPSA 1V2RT 1CT2E 3GDVA 4X1NU 1FDPA 1HJAC 1OXGA 1SOTA 2OINA 4KTSA 3P17H 1GCTB 1ELAA 1YBWA 5AHGH 5C1YA 1C2KA 4GSOA 1LHDH 3KYFA 2LIZA 2XOKD 4WXVA 4MPWA 4UFEH 1PYTC 4FUCA 2AMDA 1BMNH 3SV7A 2IN2A 5FAHA 3UNSA 2M5TA 9LPRA 1H8HD 4BANB 3KL6A 4THNH 1OYQA 4FETA 4Y0YE 1C5NH 3GCHC 1BTXA 4ZKOU 2BLOA 1JIRA 1YPEH 4Q4LA 1TPOA 2AFQB 3BTFE 1TMTH 2PKAB 4YOJA 1A1RA 1CSOE 1S6LA 1ZRBA 1ZTLA 4IC6A 1MTNB 3ZIAD 2J34A 3U1JB 3BEUA 3IG6B 1TGNA 3GCOA 1YWUA 2PKSB 3SJIA 1ZTJA 2A2QH 1UTJA 1D9IA 2ZC9H 4GVUA 4UFDH 1Z8JB 1O2GH 4ABDA 4X8TH 1E36B 1TGBA 3E16B 3A8DA 3RMMH 5SGAE 1S0RA 1IHSH 4Q7YA 1P0SH 1AB9B 3TJUA 3V13A 3OU0A 4HG6A 3Q3YA 1PPBH 1UCYE 2ZFRH 2Y5GA 3DSOA 3DFJA 3W94A 3GOVB 3GCHB 3RXFA 1BTPA 4GPGA 3SU3A 3UAIC 1BTZA 2ZHQH 5HM2A 1D4PB 2KCYA 1YF4A 2GVFA 1MTNC 1C4V2 5GDSH 3L33A 2K7XA 5KGOA 1SLUB 1SGRE 4MPUA 3U28C 2HNTC 4HTCH 3BG4C 1BJUA 2FLRH 1LVMA 1MZAA 1ELTA 5EXMA 4F4OC 5HIYA 2F4LA 1SFIA 3PTBA 4U2WA 1NRSH 1AWFH 1CHGA 1TIOA 3LGIA 2ZDLA 1IAUA 2Y81A 5FX5A 3TH2H 2VINA 1EAIA 1HLTH 1BA8B 1T32A 2W3IA 1RD3B 3LU9B 2LP6A 4BAMB 4AFZA 4WMFA 3K9XB 2Q6GA 2PSXA 4IC5A 1GMDG 2ZGXH 1C5RA 2G8TA 1UVTH 2ZCLP 4ISHH 1ZPZA 2GX4A 1O2VA 1ZGIA 1ANEA 5J4QA 5JBCS 1KYNA 3WW7A 1GDQA 3PYHA 3QUMP 2TPIZ 3EE7A 1GI1A 2FLBH 2VH6A 1Z7KA 1C1QA 3WWFA 4O3UA 1A0LA 3QDZB 3VB4A 1V2NT 1ELVA 2PTCE 4A92A 4UD9H 1AKSB 1UK4A 2Z9KA 2BQWB 2ALPA 1C5TA 1T4UH 1YPHC 4OS5A 2ODYB 2SGEE 4YT6H 1NTPA 5F8TA 1EAUA 1M9UA 1MABB 4Z6AH 5C5OA 1YCPK 3RC5A 2FTMA 1DY9A 1CA0C 4BXSA 1UK2A 1BHXF 1JRSA 1LHGH 3M5LA 1V2LT 2A4OA 4CHAC 5C94A 3EA7A 1OWDA 2ZFTA 1ANDA 2PTNA 2ZU1A 4ZAEA 1PQ8A 1RTLA 5E0JA 2UWLA 1HAZB 1W13U 1QY6A 3NUMA 1BMFD 2XCNA 4F49A 5EOKA 1B0FA 1Z8GA 2Z9JA 2BYAX 3LGVA 1WQSA 3GCTF 2YNBA 3F9FA 2A32A 3SV9A 1AE8H 2FEQH 3A8BA 2XXLA 4UEHH 4UE7H 5DP8A 3ZYEA 3S9BA 3RXHA 2HVXA 4O9VA 3N7OA 1C1PA 1H8ED 4IMZA 3FZZA 4ZKRU 1RS0A 3VXEH 4CRFA 1D6RA 1D3DB 1YPHE 1ZGVA 3O8RA 3IITA 1GJ6A 1MKXH 4D9RA 4LOYH 1OOKB 1EXFA 1WCZA 1G3EA 3TGKE 3MFJA 3TITA 1GDNA 1GJ7B 4YXWD 4FUDA 3RMOH 4ESTE 2TGTA 2VVVA 5I46H 1DLEA 1Y5UT 4AB9A 2K0QA 4Y8ZA 4ABFA 1EOJA 2UUYA 2ZA5A 3BTDE 3L6PA 3GY7A 1PQ7A 1XUIA 4ABEA 3VG8A 1FUJA 1O3KA 3UWIA 3F0OA 1UTOA 2BY8X 1AGJA 2RDLA 4JZDH 2J92A 1NU9A 4CHAB 1XUHA 1SGTA 3ENSB 4TY7A 1RTKA 4UDWH 3H7TA 2ZHDA 3BTHE 4BOHA 3A7ZA 1TRYA 1C1WH 3MU1A 1K1IA 1MKXK 4FU9A 2EC9H 3RU4E 1PPZA 1RIWB 3F2GA 2W7UA 2WPJS 2J2UA 2UUFB 3S69A 1K2I1 4XBBA 4B2AA 3PMJA 5L2ZH 1EASA 3F3BA 3MO3A 1JIMA 4IS5A 2W7SA 3LJJA 3QO6A 1K28D 1D3PB 3GY5A 4HZHA 3ZV9A 1O38A 1QA7A 2HALA 3TNSA 4X1RU 3VXFH 1GI6A 1YGCH 2EI8A 1F0TA 1DUEA 4FXGH 2H6MA 5E2OA 1LQDB 3LONA 1TNIA 2W26A 3LGWA 4FUGA 2QXIA 1S84A 1RGQA 1C2HA 2Z3DA 3PLKA 1QJ7B 3AW1A 2BD9A 1FI8A 1YPKH 2OC1A 2R0LA 1EKBB 3A8CA 1NO9H 4CREA 1A0JA 2ZKSA 1EP5A 1AZZA 2EY4C 2P3FH 2ZGCA 3I78A 2F9NA 2UUJB 2BY9X 1A3EH 4XDEA 1UCYH 2FTLE 2FOCA 2STAE 1DE7H 1VCWA 2OD3B 2GJGA 3SJOA 1GBKA 4FVDA 1WDIA 6LPRA 1A46H 1SGDE 1SHHB 2BY5X 3PRDA 2FM2A 5HMAA 1VITG 1JRTA 1QRXA 1VKYA 1EX3A 4TSFD 5GCHG 5HIZA 1OPHB 4DY7B 3PV4A 1DY8A 2VIQA 1GHBG 2ZGJA 3H7OA 5DN6D 4Z0KA 1DS2E 3CNRA 4WF8A 1TBRH 3ZZ5A 2ESTE 2Z3CA 1ABIH 2FXRA 2EEKA 2OC7A 1DVAH 2ZFPH 1O2OA 1B7XB 4FUBA 1GWAA 2CJIA 2AMPA 2A7JA 3KQEA 1LHCH 2ZIQH 1OWEA 1O33A 2Q6FA 1EZQA 1YPMH 1C1OA 1ETSH 3GY3A 3SOSA 2XWBI 2R2MB 2D8WA 2V35A 1IQJA 4X1QU 3OX7U 2VJ1A 3AW0A 1W0JD 1QZ8A 2BQ7B 1OP2A 1GI8B 2VIPA 3BTTE 4RKJB 3M37A 1O3GA 2GMTC 3QK1A 3V7TA 1H1BA 5T3HA 4D7FA 1T31A 4M9FA 2R0KA 4B75A 2CHAC 1GJCB 1K1JA 4KTUA 1GGDB 2FOEA 7LPRA 2QF4A 4Q80A 1BOQA 4QT8C 2OQUA 1ELFA 4JZ1A 1NRRH 5JBAS 1GJAB 2G55A 1V2PT 4LK4A 2IPQX 1O3PB 4ZKSU 4F48B 5DKMA 1GCTC 1C2LA 1GI4A 1MUEB 2TGPZ 1XUKA 4FUIA 1QFKH 4LZ4B 1NFYA 3TK9A 3R0FA 5JB8S 2BY6X 4H4FA 8GCHG 1G3DA 1SGEE 2RDEA 3K6YA 1MTWA 3FO8D 4XBCA 4ZHMU 4ZHAA 4HI3A 3RXMA 3UIRA 3OAAD 3ZYDA 3PWBA 4WH8A 5EPNA 2RG3A 1TX6A 1FN6A 1BRBE 4AORA 6CHAC 1KLTA 3QZRA 2VIOA 2TGDA 1KXEA 3ATIA 1GHXH 1A5HA 4YO9A 4X1SU 1HBTH 1QQ4A 3BTQE 1Z1IA 1XXDA 2A0QB 2C8XB 1NROH 4I8GA 1YM0A 3P8GA 1BITA 1MAYA 1UW7A 1G9IE 4CBNA 1GMCG 1C1UH 4U32A 1TAWA 3PWCA 4A1XA 3E91A 2Z3EA 3ELAH 1E79D 1ZHMA 4AOQA 3T26A 3QGJA 2BD5A 1GBHA 2ZNKH 1O2PA 4MNYA 5TJXA 1HIAB 3TH4H 2ZPRA 4ZROA 1TNJA 5C5NA 1C2FA 2WSSD 2VBCA 1FPHH 1V2MT 2OC0A 3PV5A 1LVOA 1AFEH 3K65B 2FDAA 2Y5FA 3M7UA 4ACAA 2JJ2D 1O37A 1SQAA 2GD4B 1O31A 2BXUH 4X1PU 3VB7A 4ISOA 4NWLA 1SMFE 1CGHA 3KQ5A 5GWZA 4I86A 1NS3A 5HXFA 2FOAA 4ZUHA 4YESB 1P2IA 4X6OA 2ZEBA 3RUOA 3STJA 2R2WU 1UTPA 1GBEA 2JDID 5C3NA 1F7ZA 1DT2A 2QF0A 3Q3XA 4X2WA 4GUXA 2PKAA 3ZZ9A 1P2OA 1BRAA 4CR5A 2J5UA 2R3UA 4YTAA 1TGCA 1ANBA 1AE5A 2PR3A 3FAOA 2SNWA 3ATMA 2R3YA 1QBVH 1UTKA 2SGQE 4OS2A 2KAIB 4XFQA 3RXRA 1C4Y2 1AUTC 4E05H 5CDFE 4D8NA 1N6YA 3UREA 1D3QB 2D2DA 1OWKA 2VH0A 3TJNA 1UJ1A 4Y6DA 4J1YA 3DFLA 1Z6EA 1KY9A 2LPRA 1OP0A 1YCPH 1P2JA 5GJ4B 2C3SA 4M7GA 1NRQH 3RXQA 1FX0B 2W3KA 3SV8A 2BDBA 4A1VA 4K8BA 1KTSB 2WZQA 2PV9B 4Q7XA 3O8DA 1JWTA 4UONA 1CT4E 2LNCA 4CH8B 2HLCA 1A7SA 4P00A 1O2LA 2WINI 3MNXA 5I25A 1KXFA 5JDUB 2GT8A 1EQ9A 2AEIH 1LKAA 2ZECA 4FUHA 8ESTE 1AFQC 4H42U 3M61U 1QCPA 1BRUP 1YC0A 1YY3A 5A0BA 1EUFA 1ZMJA 2ASUB 3P6ZB 2C4FH 4JMYA 3HK6B 3H5CB 1P2MA 1ELCA 3SJ8A 1W10U 1RFNA 4ASHA 5DP3A 1V2QT 1P3CA 2KR7A 1H4WA 1TALA 2V3MA 3EDXB 2ZDMA 4YM9A 1K0HA 1GJ4H 4X2XA 1ELGA 4HGCA 1GVKB 3A83A 2O8MA 4AYVB 4KGAA 1UO6A 5DSFA 1AUJA 2QYIA 2A4GA 3FFGA 1FV9A 4RI0A 4DT7B 1NBME 1KXAA 3HKJB 3KEEA 5EGMA 3M3SA 1BJVA 2I6QA 2BXTH 1QBNA 2GDEH 2J94A 4INKA 3U69H 2ZQ1A 4JYUH 4D9QA 4I7YH 3IWMA 5F8ZA 1GHZA 3ZV8A 4YZUA 1W0KD 2ODQA 1V2TT 3MH5A 3OY6U 2FI5E 2ZTXA 3N7DA 4DCDA 1S85A 1BMMH 1KDQA 3U8OH 1O5FH 2Y82A 1C5WB 4E7RG 1SFQB 3MU5A 3F9EA 1BBRK 2A5IA 1FLEE 1UVPA 4TWWA 3OE7D 5EQQA 3UQVA 1OWHA 2TIOA 4B1TA 1EB2A 4I31A 3A85A 2GTBA 1XVOA 2A7CA 1L1GA 2KX4A 3DD2H 4K60A 2Z9IA 1DFPA 2C93B 1NFXA 5DP4A 3URCA 3TU7H 2B7DH 3ESTA 4OS4A 2ZU2A 1L4DA 1O2IA 1LMWB 4WJG2 2ZFFH 1BUIA 3W1EA 1HDTH 1A2CH 3F68H 2GP9B 4RT0A 2L74A 3M5OA 1GBAA 4TPIZ 1GMDF 1AZ8A 3RU4D 1TLDA 1LTOA 3Q77A 3ODDA 1AQ7A 1P2QA 4ZHLU 5K7RA 4YOIA 4MNVA 3LC3A 2BDHA 1F0SA 1AI8H 1O2QA 3LC5A 3E6PH 4WVPE 4ABGA 4XSKU 3BG8A 3V3MA 4XE4A 3F6UH 5ETXA 3SU5A 1CT0E 4B74A 3NKKA 1PPHE 3PLPA 1TQ7B 2FOHA 1WV7H 2BX4A 3O8CA 2F91A 2PLXA 2DE8A 1GPZA 1Y3YA 1C1SA 1Y5AT 1HAPH 3LIWA 2ANWA 1O3HA 2PUQH 2CF9H 1C5UA 1ZOMA 2VB0A 3V0XA 3VGCC 4I32A 4AYYB 1DM4B 1F92A 4K69A 4OM9A 1BTWA 3TVJB 3D23A 1HV7A 2ZGBH 2BX3A 2C90B 4E06H 2WPMS 1YPJH 1SSXA 3KQCA 3RXBA 1HRTH 3DSGA 1IOEA 1ZSLA 3RM2H 1KDQB 7GCHG 1IQIA 1BQYA 1ORFA 2OBOA 3HATH 1H9HE 1V3XA 4JYTA 4WMDA 5C20A 2J95A 1JBUH 2QF3A 1V2ST 5L2YH 1KIGH 1A0HB 4Y0ZE 3SNCA 1P9UA 5HM9A 2HOBA 1AU8A 2P93A 3UUZA 4R0IA 2J98B 2PW8H 4Y71A 2AGEX 3FVFB 1P2NA 1YLCA 4AFUA 2BD3A 1JMOH 1TQ0B 3AASA 2TGAA 3I77A 5T1VA 2BLVA 3CENA 1EZUC 1GJDB 1W0ZU 2KCOA 5DG6A 3QWCH 3ZVGA 6ESTA 3UPEA 1Z8RA 5IK2D 1S83A 4ZXXH 1CO7E 1WU1A 3T27A 1GHBF 2V0BA 3M35A 5HGGA 2CK3D 3Q76A 1QQUA 1NM6A 4GAWA 4R8TB 3T28A 1V2OT 1MBQA 3LJOA 4OGYA 3RXSA 1QHRB 1C2EA 1GHWH 4B2CA 2BOHB 2EA3A 3SUDA 2GCHG 3U98H 4BAHB 1O5BB 1DXWA 4K5ZA 5FXLA 3MQKC 5AFYH 1XUFA 4NSYA 1AVWA 2LELA 1PPGE 2JIZD 3UY9A 1T7CA 4MLFB 4CR9A 5LH8A 3NZIA 4AN7A 2Q1JA 2Y6TA 1LVBA 3STIA 2G52A 3S9CA 3E1XB 1SOZA 2O8LA 2V7QD 3RXKA 2XBVA 1FPCH 2A4RA 4DIIH 3QN7A 2PP6A 3E0PB 2B8OH 5EXLA 4RN6A 2VIVA 3UOUA 2NU0E 1O3MA 1KLIH 4WH6A 2BVXH 2Y5HA 2OQ5A 2O8TA 5LPFA 3RXOA 5EJLA 3BG4B 4CRCA 4DOQA 5T6FA 1GJ5H 5JBBS 1SI5H 2Y7ZA 1V2JT 3HK3B 2FS8A 3A88A 1INCA 1WTHD 2P8OB 4SGAE 3LGYA 2WYJA 3SQEE 1DWEH 1VITH 2QXGA 3A7XA 5F8XA 4AC9A 4DT4A 2EQNA 2AS9A 1W11U 1MMJN 1HAYB 2FOGA 4BAKB 5DP7A 3SUFA 1H9LB 5FCKA 1EZXC 2Z6BD 1SQOA 3SV2H 5FX6A 1G2MA 4FU8A 1SGIB 2XNIA 1XMNB 3KNXA 3GCNA 2OLGA 4BTUB 3RXGA 3M7TA 1LHEH 1W2KH 1TGSZ 2AHME 1U6QA 3LDXH 3LKWA 4X6MA 5BPEA 3T62A 4JCNA 5LPRA 1YYY1 1ZMLA 4UFGH 4MNWA 1UTQA 3RXCA 2NU4E 2GZ7A 3NRLA 5TCCA 2FO9A 3MU0A 3RM0H 2H9EH 3PO1C 5AVDA 1NZQH 3KQBA 2BLWA 1KXBA 1UVSH 5A2MH 1O2ZA 1F0UA 3GDUA 1ZHPA 1FAXA 1FY1A 3NXPA 5FPTA 3QTVH 1J14A 2CGAA 3MU4A 4GHQA 1DLKB 3OYPA 4TY6A 1GBLA 3BF6H 3C27B 2PUXB 4GCHF 5ABWA 1HXEH 2W6ID 2AGGX 6CHAB 1VR1H 5A8ZA 1O36A 2DE9A 4B6EA 3EA9A 4P02A 2XBYA 2VNTA 1N1LA 3NCLA 4A7IB 1S6FA 1Z8IB 3SZEA 2H2ZA 1MD7A 5DP6A 3LPRA 5EJZA 1HFDA 3FN8A 1VJAU 4AG1A 4WWYA 4MNXA 5EJ1A 1Q3XA 4VGCB 3SU0A 4Q7ZA 1AIXH 1EP6A 1TNHA 1TBQH 2ULLA 3JZ1B 1NFUA 2JH0D 1G3BA 3ZZ8A 1K21H 1NFWA 1QRWA 3ZZCA 1G30B 1P09A 2GV7A 2FOFA 3ZZDA 4GHTA 3KIDU 3RXTA 2AIPA 2WPKS 5C0UA 4ABHA 3O8BA 3LGUA 2ZPQA 4H6TA 1GBBA 3BIUH 4AB8A 3MU8A 4F55A 1SL3A 1O34A 3M7QA 2SNVA 4OS7A 2IOTA 3BIVH 2VU8E 5EPYA 1DUAA 1LKBA 1W0YH 3T2NA 4XD7D 1BMAA 3A82A 4BTIB 2XBXA 1FZZA 3EQ0H 1DPOA 1GI3A 1K22H 5C1XA 1K1MA 1GHYH 3FP8E 1FN8A 5DO4H 3KF2A 4Y11E 1VJ9U 3HGPA 1O3CA 2BVRH 1AD8H 1UHBB 1A61H 1SHYA 5E0GA 4Y76A 2QA9E 2QAAA 2STBE 3BTME 1BMLA 3Q00A 4A1TA 2L6OA 1KLJH 1IQNA 2AYWA 2PKSC 1O3OA 2GDDA 2GMTB 3ZZ4A 5IYTA 1P8VC 1IQGA 2Y80A 2VGCC 2BVSH 1MTSA 1TPPA 1Q2WA 3ZVDA 1AB9C 2OTVA 2J4IA 4YLUA 4MPXA 1WOFA 3GY6A 1LDTT 4FU7A 1HCGA 3SNDA 1P11E 1GMCF 1ZPCA 2C8YB 2DUCA 1C5ZB 4JZEH 2OP9A 1ESBA 2GT7A 1DICA 1W14U 1SR5C 1T8OA 1TA6A 2ZQ2A 3JZ2B 4BAOB 1TGTA 5A0AE 5CMXH 1CBWC 4H6SB 3M3TA 2FESH 1SG8B 2ZDAH 5FCRA 1EZSC 3W95A 1QL7A 1MKWH 3DT0H 4I33A 2WPDD 1LQEA 2W6JD 3B9FH 1Z6JH 3MTYA 3RXDA 3C1KA 1KTTB 1DWCH 1MD8A 2OC8A 4OS1A 1OYTH 1V2VT 1QB9A 3UWJH 4X8VH 5EG4A 3K6ZA 1C5LH 1T4VH 3S7HB 3GISB 4U30A 1KXCA 4B73A 3ODFA 3DUXH 1B0EA 3HKIB 1MZDA 1O3JA 4VGCC 2HWLB 3ZVFA 4K1TA 1MBMA 1O3DA 2KAIA 2AIQA 1L0ZA 2BZ6H 1H8DH 2FWWA 2ALVA 4NCYA 3A89A 1BBRE 5E2PA 1LHFH 3SNBA 3EAJA 1CGIE 4MVNA 3BTEE 1GHAG 2GCTC 4NFFA 1WAYB 1IQEA 4UFFH 5KEDA 4NIYA 1L1NA 2OK5A 4ZMAH 1UCYK 4XOJA 2G4UA 1EPTA 3D65E 5JYIA 5ESBA 3GY2A 3MH4A 4BAQB 1GG6B 1N8OB 4BXWA 3ZZBA 4IN2A 5C2ZA 5JBTA 2BY7X 3SBKA 1EOLA 2FYQA 1HAOH 1MCTA 2JH6D 2RA0A 2F9VA 4DW2U 1O5GH 3LH3A 3KQDA 1ZLRA 1HJAB 3SW2B 3P8NA 1TRMA 3KN2A 2ZU4A 1ZTKA 1HAXB 3M5NA 1ZRKA 3U9AH 2WPLS 2A1DB 1MKWK 5FPYA 1ZYOA 5A09A 1MH0A 1XKBC 1COWD 2F9PA 2J38A 3MI4A 2BDCA 3M5MA 1O5EH 5LPEA 2XC4A 3G01A 2O8WA 4NIXA 5CHAB 8LPRA 1O32A 1A5GH 3KYGA 5G4BA 3KCGH 1C2JA 4J2YB 1J17T 3LT3A 1HAGE 1MU6B 2V6NA 1Y3VA 3P95A 2B5TB 2G81E 3P92A 4TWYA 4AZ2B 2ZFQH 2C8WB 1V2KT 2XC5A 3SN8A 1ZR0A 2K1QA 2Z9LA 1AHTH 1GJ9B 1S0QA 1O2KA 3MMGA 4ISNA 4XBDA 1H9IE 5EXNA 2UWOA 2QGRA 3SQHE 3PV2A 1ELEE 1YLNA 2ZF0H 3RXLA 1FAKH 5J4SA 1BB0B 2A7HA 3CS0A 2QC2A 4JZFH 1E1QD 1RIWC 2AH4X 3TJOA 1HAHH 1E1RD 3P70B 2CN0H 2TRMA 3FZDA 2PHBA 1GJ8B 1SBWA 4INHA 1ACBE 3A84A 4B6FA 2BQ6B 2ZHFH 2F43B 2P3UB 3RXEA 1ZSJA 4NWKA 3MO6A 2ZU3A 4I8HA 3U8TH 3DSPA 4LZ1H 1FXYA 3PB1E 1P3EA 1C5MD 3SV6A 4K8YA 3ZZ6A 3BTWE 4I8JA 1O30A 1RJXB 4YOGA 1QURH 3RMNH 1IQLA 2GZ9A 1CGJE 1HAVA 3VB6A 4NA7A 1Z1JA 4X8SH 5PTPA 1Y5BT 1PPFE 2KCAA 2G00A 1ARCA 1ESTA 8KME2 3LOXA 4ZH8A 4CRAA 1E37B 3RC6A 1Y59T 1GL0E 4FVBA 1Y8TA 2BD8A 1EJMA 1YLDA 1AVGH 3QGNB 1UVUH 1AFQB 2PGBB 3MHWU 5CE1A 7GCHF 3GY8A 1GI9B 2F3CE 1VCQA 2KZ4A 2F9BH 3OFND 3PM3A 4Y8YA 1J15A 3UR9A 1CHOG 3HPTB 1MU8B 1XVMA 1O2RA 2SFAA 3NWUA 1T8NA 3SGQE 4DGJA 1FONA 2H9TH 1F5RA 3TJVA 1OWIA 4AGJA 3FOAA 1O35A 5C67A 1EFRD 1C2DA 1VCPA 1GL1A 4K1EA 2HPQH 2HGTH 3TK6A 1BTUA 1L1JA 3RXJA 1CA8B 2FI3E 3A80A 4Y7BA 1HB0B 1ZSKA 1P02A 3RLWH 2VVCA 5A0CA 4PROA 3SI3H 1TOCB 1IQMA 3SZNA 1DANH 4AG2A 4RKOB 4SGBE 4D7GA 1NN6A 4B76A 4IW4E 1XM1A 2C8ZB 1DSTA 2NWNA 3ZVCA 1QRZA 1W8BH 1O3EA 1O3LA 2BMGB 1CHOF 4WXIA 3R3GB 1KXDA 5H4IB 2W5EA 3QLPH 1ESAA 2SGAA 1GI2A 1PQ5A 1NRPH 2A4QA 3UNRA 1O39A 4BNRA 1AKSA 3PROA 3SGBE 1PPCE 2VIDA 1THRH 4YT7H 1C5XB 3FP7E 3UB0A 1PYTD 3U1IB 1ETRH 8GCHF 2QE7D 3SO3A 2P59A 2QV1A 1YP9A 3SHAH 1OX1A 2P16A 4K2YA 2A5KA 5A8XA 3E8LA 3P8OA 1G3CA 3MOCA 1TB6H 3VPKA 1F2SE 9ESTA 1BCUH 2SGFE 3HGNA 1QNJA 3PMHB 1P06A 2XW9A 1ZJDA 2H5DA 5GNDA 5AF9H 1DITH 2ZU5A 1FIWA 2GGVB 2AGIX 4ABIA 5LGOA 1DXPA 3WY8A 4A5TS 3ZZAA 3LGTA 1UVOA 1PQAA 2RCEA 4X0WU 2ZCKP 1UTMA 2V3HH 5GPIB 4LXBH 4MDSA 1ABJH 1QIXB 1S82A 1WYKA 1GGDC 3UQOA 3SU6A 2YMSC 4ZCNA 1CE5A 1O3FA 1LVYA 2OUAA 4CBOA 1O2WA 3BV9B 1C5YB 2PSYA 1SGQE 1V2UT 1UTLM 2SGDE 4Y79A 5FPSA 3RXUA 4NIWA 4DG4A 2ODPA 2WHXA 4ISIH 1Z71A 2XBWA 5GIBA 5FBEA 1O2TA 1NY22 3B8JA 1HAVB 3EYDA 1E38B 2GCHF 1GBJA 1V2WT 1K1OA 1K9OE 1MCVA 1SKYE 1BBRH 1MQ5A 2YMSB 3M36A 1W3CA 1WSSH 1Y3XA 4FUJA 1X7AC 3DA9B 4O03A 1GDUA 2XC0A 5CHAC 1S81A 3QX5H 4B71A 3E3TA 2A2XH 3MWIU 1S6HA 2ZHEH 2FIRH 3EE0B 3VFEA 1SC8U 2WPIS 1O5CB 2A5AA 1C9PA 2IJOB 1B5GH 4IN1A 2H1UA 3URDA 1AMHA 2BB4A 1LPKB 1VGCC 5FHTA 2G5NA 1QL9A 2FS9A 1LPGB 3NK8A 2QCYA 3SGAE 2P94A 1W7GH 4Z1MD 1NC6A 1J9CH 4MTBA 2KFWA 2QXJA 1QJ1B 4OS6A 1GBFA 3SI4H 4K3JA 1TOMH 2J97A 1ZHRA 1TNKA 1CBWB 1O3NA 4CRBA 3N99A 1SVPA 3F0PA 1GI7B 2HNTF 2QY0B 3UR6A 4I8LA 1SGPE 2ZZUH 3S7KB 3DCLA 1TPAE 1THPB 3QTOH 2G5VA 3UFAA 3S9AA 1NESE 1SPJA 2F83A 4ASUD 5DP5A 2G4TA 5C1UA 2B9LA 2H9HA 2VWMA 4WY3A 2JH5D 1FY3A 7ESTE 2A45B 1GHAF 2ZDNA 2ZG0H 2RA3A 5HKKD 4BTTB 2BD2A 3D62A 5HYOA 3A81A 4ZXYH 3MNCA 2XCFA 3A8AA 1OWJA 2KCPA 1O2HA 2BHGA 2IPHA 3LH1A 5DK1A 1C1MA 2P3TB 3AAUA 3K2UA 1FMGA 4GLYA 2I6SA 1S5SA 3EA8A 1EATA 1VGCB 4IBLH 1GJBB 1SGFA 5KECA 1SGCA 2EI7A 2AERH 1C5QA 3F2FA 2VIWA 5GCHF 2CXVA 2ZGHA 1QTFA 1ELDE 2XWAA 2Z7FE 1DWBH 2OXSA 1THSH 4FUEA 1TX8A 2WUBA 3SU2A 1CQQA 1SQRA 2FOBA 1N8OC 1XX9A 2D26C 1H8IH 1GMHF 1DX5M 1C1VH 1TX7A 4AFQA 1D6WA 4TYDA 1HJ8A 3TIUA 3M3VA 1UK3A 1GHVH 1GBIA 2OBQA 4E7NA 1O2SA 4IMQA 4NGAH 2XRCA 3GY4A 3U8RH 2VWOA 1QBOA 2ZDKA 3FANA 3BTKE 1ANCA 2UWPA 5EU8A 2WV4A 1W12U 1K1NA 2NU2E 4NZQA 3FKSD 3UOPA 1HPGA 1O3AA 4KTCA 5DPAA 3PTNA 1VITF 1QL8A 2D1JA 2F9OA 1O2XA 2THFB 2ZO3H 1GBMA 1AO5A 1GMHG 3FP6E 1TNLA 4CRGA 1FIZA 1ZMNA 5T6DA 1KSNA 1O5DH 2ANYA 2FX6A 1IQHA 5E0HA 2Z9GA 1ARBA 3TLOA 4O97A 4X6NA 4NA8A 5FBIA 2ZDVH 4INLA 2GZ8A 4RT1A 3SUEA 5TCAA 4Y7AA 2ZTYA 1K1LA 1DDJA 1EPTB 1HYLA 3OEHD 1FY5A 4NIVA 4Y10E 3S0NA 2ZFSA 3CS7A 2RFKC 2H5CA 3MO9A 3OTPA 2ZP0H 3A7VA 1W7XH 1JOUB 2NU1E 2BDGA 3T29A 2WPHS 3ZVEA 3VB3A 1TYNA 4ZKNU 1J8AA 2VGCB 5EW1H 3OTJE 2AMQA 1YCPM 1RRKA 2FI4E 4JK5A 3TNTA 3SU4A 1BTYA 1AWHB 3F1SB 3E0NB 3RU4T 3SJ9A 2ZPSA 2QN5T 1LCYA 5B6OA 3SU1A 4DVAU 4XRNA 1V6DA 4KKDA 4CH2B 1P2KA 3RXVA 3ZVAA 1CU1A 3OY5U 1BDAA 1O2JA 1C5OH 1L4ZA 1SGYE 1TE0A 2FOMB 2VWNA 2ZCHP 1C2IA 1FJSA 5FL7D 4DJZB 1WUNH 2FPZA 3ATKA 2R9PA 1HIAA 1P9SA 1P05A 2ZHWH 1O2MA 1FQ3A 2XTTB 3RC4A 1C1RA 1TABE 5L30H 4FOUC 4U01A 4NFEA 1NT1A 3KGPA 4YLQH 5IDKA 2KM0A 2A31A 2O8UA 5F6MA 3ATLA 4ISLA 4ABBA 1DSUA 1SLVB 2WV9A 1NBMD 2TBSA 3B23B 3ATWA 1E35B 3QZQA 5BRRE 1IHTH 3ZVBA 4DIHH 3P8FA 5L6NH 2O9QA 3T25A 3RMLH 1C5PA 2B0FA 2GCTB 2BOKA 3GCTG 3F9HA 1FY8E 2ZTZA 3ITIA 1MAXA 3BEFB 2XNDD 3A86A 1WXRA 3SYJA 2CHAB 1GI0A 5EODA 1DOJA 3NPSA 5K0HA 1CA0B 2G51A 2P95A 2QXHA 1O0DH 1GBTA 4AFSA 3RXAA 1OKXA 4NZLA 1WTGH 2FP7B 1O2NA 1Y3WA 3ZZ3A 3GYLB 1UHBA 1PFXC 1P10A 4NA9H 1O5AB 3VGCB 2HNTE 2VWLA 1HGTH 5AFZH 3A87A 2J98A 1IQFA 2BTCE 1HUTH 1ID5H 1YPGH 3PMBB 4JK6A 1ZZZA 1G36A 5B6LA 1HNEE 3RDZA 1G37A 5CHBA 2WYGA 2BDYA 5JB9S 2NU3E 3BN9A 1AN1E 3PO1B 2V3OH 3SORA 1YPLH 3PLBA 1O3BA 1ELBA 1C2GA 3UTUH 4X6PA 3VB5A 2PGQB 1QB1A 4ABJA 1WBGB
chains in the Genus database with same CATH topology
1UMAH 1TMBH 1XUJA 1AVXA 3CP7A 1ZJKA 3EGKH 4K1SA 3RXPA 3PMAB 2JKHA 2HRVA 1G32B 3TH3H 4MQAA 1RTFB 4JZIA 4NSVA 3E90B 4Y8XA 3GDSA 4X8UH 3F9GA 3UNQA 1NRNH 2FMJA 2PFEA 3GYMA 1O2UA 1SLWB 2HPPH 2Z94A 1TFXA 5T6GA 2ANMH 1YKTA 5EQRA 4AX9H 2BDIA 3GICB 1GI5A 2F9UA 2Q6DA 1Q31A 1SGFG 1SGNE 1Y3UA 3TPIZ 5E8EH 1TRNA 1HJ9A 1XUGA 1J16A 1EAWA 1FY4A 4A6LA 5GXPA 1EAXA 3ZZ7A 2CV3A 1BIOA 4GCHG 1NPMA 4WMEA 1RXPA 1EJAA 1BZXE 2BD4A 4KP0A 3AVZA 2EI6A 2JETC 3KHVA 1EPTC 2ZI2H 3DHKH 4NG9H 5DJ7A 4FUFA 2OCVB 1MQ6A 1ETTH 5F03A 2YOLA 1MTUA 2PWXA 1TBZH 1A5IA 3T5FH 1GG6C 1QJ6B 2BDAA 1SLXB 3A7WA 3A7TA 1A4WH 4ABAA 4RSPA 4Q2KA 1DWDH 1O2YA 7KMEH 1NU7B 3BSQA 3VEQB 5JPMH 1GBDA 2BLQA 3RXIA 1BRCE 1PJPA 1TNGA 1G2LA 1E0FD 3EBNA 1BTHH 1LPZB 3SJKA 1L2EA 1QR3E 2ILNA 5DGJA 1IQKA 3MNBA 1QA0A 2FX4A 4HFPB 3SUGA 4X2VA 5ESTE 3MH6A 1WQVH 3OSYA 1P03A 1C1TA 3V12A 2WV5A 1CVWH 1C5SA 4D76A 1BHXB 1AY6H 2XYAA 3MH7A 1TMUH 2FYRA 2VVUA 1MTVA 1XXFA 4JYVH 2BZAA 1P57B 1SB1H 2GKVE 4MPVA 1C2MA 1A3BH 2ANKH 4KELA 2WUCA 3TK5A 4I8KA 1EJNA 2ZWLH 2J9NA 3AAVA 1TONA 3BTGE 2GV6A 1F5LA 2BM2A 6GCHF 2CMYA 1ZPBA 1EB1H 1PPEE 3TGJE 1HAIH 1BT7A 3MNSA 3MYWA 4TPYA 1D3TB 2QIQA 5EW2H 3RLYH 1O3IA 1TWXB 4IGDA 3RP2A 1F5KU 1E34B 1OS8A 1FNIA 1QGFA 1GCDA 1P04A 1LO6A 4MG3A 1T8MA 2BD7A 2FODA 3A7YA 3Q3KA 1C4U2 3SNAA 1GVLA 2JETB 1GBCA 5EQSA 1GVZA 1VZQH 2YNAA 1C9TA 1HXFH 3L3TA 4O3TA 4CRDA 1P12E 5A8YA 1C5VA 4DURA 5DP9A 3I29A 2UUKB 4B2BA 4AGKA 6GCHG 1QB6A 2SGPE 3TGIE 3SNEA 2Y7XA 1K1PA 1TA2A 1OSSA 2FZZA 2CF8H 1UTNA 1SQTA 1T8LA 3D49H 1C1NA 4OGXA 1F0RA 1XKAC 3SHCH 1JXPA 1OP8A 4X2YA 2P8OC 1N6XA 3BEIB 1P01A 1TPSA 1V2RT 1CT2E 3GDVA 4X1NU 1FDPA 1HJAC 1OXGA 1SOTA 2OINA 4KTSA 3P17H 1GCTB 1ELAA 1YBWA 5AHGH 5C1YA 1C2KA 4GSOA 1LHDH 2LIZA 4WXVA 4MPWA 4UFEH 1PYTC 4FUCA 2AMDA 1BMNH 3SV7A 2IN2A 5FAHA 3UNSA 2M5TA 9LPRA 4BANB 3KL6A 4THNH 1OYQA 4Y0YE 1C5NH 3GCHC 1BTXA 4ZKOU 2BLOA 1JIRA 1YPEH 1TPOA 2AFQB 3BTFE 2PKAB 1TMTH 4YOJA 1A1RA 1CSOE 1ZRBA 1ZTLA 4IC6A 1MTNB 2J34A 3U1JB 3BEUA 3IG6B 1TGNA 3GCOA 2PKSB 3SJIA 1ZTJA 2A2QH 1UTJA 1D9IA 2ZC9H 4GVUA 4UFDH 1Z8JB 1O2GH 4ABDA 4X8TH 1E36B 1TGBA 3E16B 3A8DA 3RMMH 5SGAE 1S0RA 1IHSH 4Q7YA 1P0SH 1AB9B 3TJUA 3V13A 3OU0A 3Q3YA 1PPBH 1UCYE 2ZFRH 2Y5GA 3W94A 3DFJA 3GOVB 3GCHB 3RXFA 1BTPA 4GPGA 3SU3A 1BTZA 2ZHQH 5HM2A 1D4PB 1YF4A 2GVFA 1MTNC 1C4V2 5GDSH 3L33A 2K7XA 1SLUB 1SGRE 4MPUA 2HNTC 4HTCH 3BG4C 1BJUA 2FLRH 1LVMA 1MZAA 1ELTA 5EXMA 4F4OC 1SFIA 3PTBA 4U2WA 1NRSH 1AWFH 1CHGA 1TIOA 3LGIA 2ZDLA 1IAUA 2Y81A 5FX5A 3TH2H 2VINA 1EAIA 1HLTH 1BA8B 1T32A 2W3IA 1RD3B 3LU9B 4BAMB 4AFZA 4WMFA 3K9XB 2Q6GA 2PSXA 4IC5A 1GMDG 2ZGXH 1C5RA 2G8TA 1UVTH 2ZCLP 4ISHH 1ZPZA 2GX4A 1O2VA 1ZGIA 1ANEA 5J4QA 5JBCS 1KYNA 1GDQA 3PYHA 3QUMP 2TPIZ 1GI1A 2FLBH 2VH6A 1Z7KA 1C1QA 4O3UA 1A0LA 3QDZB 3VB4A 1V2NT 1ELVA 2PTCE 4A92A 4UD9H 1AKSB 1UK4A 2Z9KA 2BQWB 2ALPA 1C5TA 1T4UH 1YPHC 4OS5A 2ODYB 2SGEE 4YT6H 1NTPA 5F8TA 1EAUA 1M9UA 4Z6AH 5C5OA 1YCPK 3RC5A 2FTMA 1DY9A 1CA0C 4BXSA 1UK2A 1BHXF 1JRSA 1LHGH 3M5LA 1V2LT 2A4OA 4CHAC 3EA7A 1OWDA 2ZFTA 1ANDA 2PTNA 2ZU1A 4ZAEA 1PQ8A 1RTLA 5E0JA 2UWLA 1HAZB 1W13U 1QY6A 3NUMA 2XCNA 4F49A 5EOKA 1B0FA 1Z8GA 2Z9JA 2BYAX 3LGVA 1WQSA 3GCTF 2YNBA 3F9FA 2A32A 3SV9A 1AE8H 2FEQH 3A8BA 2XXLA 4UEHH 4UE7H 5DP8A 3ZYEA 3S9BA 3RXHA 2HVXA 4O9VA 3N7OA 1C1PA 4IMZA 3FZZA 4ZKRU 1RS0A 3VXEH 4CRFA 1D6RA 1D3DB 1YPHE 1ZGVA 3O8RA 3IITA 1GJ6A 1MKXH 4D9RA 4LOYH 1OOKB 1EXFA 1WCZA 1G3EA 3TGKE 3MFJA 3TITA 1GDNA 1GJ7B 4FUDA 3RMOH 4ESTE 2TGTA 2VVVA 5I46H 1DLEA 1Y5UT 4AB9A 4Y8ZA 4ABFA 1EOJA 2UUYA 2ZA5A 3BTDE 3L6PA 3GY7A 1PQ7A 1XUIA 4ABEA 1FUJA 1O3KA 3UWIA 1UTOA 2BY8X 1AGJA 2RDLA 4JZDH 2J92A 1NU9A 4CHAB 1XUHA 1SGTA 3ENSB 4TY7A 1RTKA 4UDWH 3H7TA 2ZHDA 3BTHE 4BOHA 3A7ZA 1TRYA 1C1WH 3MU1A 1K1IA 1MKXK 4FU9A 2EC9H 3RU4E 1PPZA 1RIWB 2W7UA 2WPJS 2J2UA 2UUFB 3S69A 1K2I1 4XBBA 4B2AA 3PMJA 5L2ZH 1EASA 3MO3A 1JIMA 4IS5A 2W7SA 3LJJA 3QO6A 1K28D 1D3PB 3GY5A 4HZHA 3ZV9A 1O38A 1QA7A 2HALA 3TNSA 4X1RU 3VXFH 1GI6A 1YGCH 2EI8A 1F0TA 1DUEA 4FXGH 2H6MA 5E2OA 1LQDB 3LONA 1TNIA 2W26A 3LGWA 4FUGA 2QXIA 1S84A 1RGQA 1C2HA 2Z3DA 3PLKA 1QJ7B 3AW1A 2BD9A 1FI8A 1YPKH 2OC1A 2R0LA 1EKBB 3A8CA 1NO9H 4CREA 1A0JA 2ZKSA 1EP5A 1AZZA 2P3FH 2ZGCA 3I78A 2F9NA 2UUJB 2BY9X 1A3EH 4XDEA 1UCYH 2FTLE 2FOCA 2STAE 1DE7H 1VCWA 2OD3B 3SJOA 1GBKA 4FVDA 6LPRA 1A46H 1SGDE 1SHHB 2BY5X 2FM2A 5HMAA 1VITG 1JRTA 1QRXA 1EX3A 5GCHG 1OPHB 4DY7B 3PV4A 1DY8A 2VIQA 1GHBG 2ZGJA 3H7OA 4Z0KA 1DS2E 4WF8A 1TBRH 3ZZ5A 2ESTE 2Z3CA 1ABIH 2FXRA 2EEKA 2OC7A 1DVAH 2ZFPH 1O2OA 1B7XB 4FUBA 1GWAA 2CJIA 2AMPA 2A7JA 3KQEA 1LHCH 2ZIQH 1OWEA 1O33A 2Q6FA 1EZQA 1YPMH 1C1OA 1ETSH 3GY3A 3SOSA 2XWBI 2R2MB 2D8WA 2V35A 1IQJA 4X1QU 3OX7U 2VJ1A 3AW0A 2BQ7B 1OP2A 1GI8B 2VIPA 3BTTE 4RKJB 3M37A 1O3GA 2GMTC 3QK1A 3V7TA 1H1BA 5T3HA 4D7FA 1T31A 2R0KA 4B75A 2CHAC 1GJCB 1K1JA 4KTUA 1GGDB 2FOEA 7LPRA 4Q80A 1BOQA 4QT8C 2OQUA 1ELFA 4JZ1A 1NRRH 5JBAS 1GJAB 2G55A 1V2PT 4LK4A 1O3PB 4ZKSU 5DKMA 1GCTC 1C2LA 1GI4A 1MUEB 2TGPZ 1XUKA 4FUIA 1QFKH 4LZ4B 1NFYA 3TK9A 3R0FA 5JB8S 2BY6X 4H4FA 8GCHG 1G3DA 1SGEE 3K6YA 1MTWA 4XBCA 4ZHMU 4ZHAA 4HI3A 3RXMA 3UIRA 3ZYDA 3PWBA 4WH8A 5EPNA 2RG3A 1TX6A 1FN6A 1BRBE 4AORA 6CHAC 1KLTA 3QZRA 2VIOA 2TGDA 1KXEA 3ATIA 1GHXH 1A5HA 4YO9A 4X1SU 1HBTH 1QQ4A 3BTQE 1Z1IA 1XXDA 2A0QB 2C8XB 1NROH 4I8GA 1YM0A 3P8GA 1BITA 1MAYA 1G9IE 4CBNA 1GMCG 1C1UH 4U32A 1TAWA 3PWCA 4A1XA 3E91A 2Z3EA 3ELAH 1ZHMA 4AOQA 3T26A 3QGJA 2BD5A 1GBHA 2ZNKH 1O2PA 4MNYA 5TJXA 1HIAB 3TH4H 2ZPRA 4ZROA 1TNJA 5C5NA 1C2FA 1FPHH 1V2MT 2OC0A 1LVOA 1AFEH 3K65B 2FDAA 2Y5FA 3M7UA 1O37A 1SQAA 2GD4B 1O31A 2BXUH 4X1PU 3VB7A 4ISOA 4NWLA 1SMFE 1CGHA 5GWZA 1NS3A 5HXFA 2FOAA 4ZUHA 4YESB 1P2IA 4X6OA 2ZEBA 3RUOA 3STJA 2R2WU 1UTPA 1GBEA 5C3NA 1F7ZA 1DT2A 2QF0A 3Q3XA 4X2WA 4GUXA 2PKAA 3ZZ9A 1P2OA 1BRAA 4CR5A 2R3UA 4YTAA 1TGCA 1ANBA 1AE5A 2PR3A 3FAOA 2SNWA 3ATMA 2R3YA 1QBVH 1UTKA 2SGQE 4OS2A 2KAIB 4XFQA 3RXRA 1C4Y2 1AUTC 4E05H 4D8NA 1N6YA 3UREA 1D3QB 2D2DA 1OWKA 2VH0A 3TJNA 1UJ1A 4Y6DA 4J1YA 3DFLA 1Z6EA 1KY9A 2LPRA 1OP0A 1YCPH 1P2JA 5GJ4B 2C3SA 4M7GA 1NRQH 3RXQA 2W3KA 3SV8A 2BDBA 4A1VA 4K8BA 1KTSB 4Q7XA 2PV9B 3O8DA 1JWTA 4UONA 1CT4E 2LNCA 4CH8B 2HLCA 1A7SA 1O2LA 2WINI 3MNXA 5I25A 1KXFA 5JDUB 2GT8A 1EQ9A 2AEIH 1LKAA 2ZECA 4FUHA 8ESTE 1AFQC 4H42U 3M61U 1QCPA 1BRUP 1YC0A 5A0BA 1EUFA 1ZMJA 2ASUB 3P6ZB 2C4FH 4JMYA 3HK6B 3H5CB 1P2MA 1ELCA 3SJ8A 1W10U 1RFNA 4ASHA 5DP3A 1V2QT 1P3CA 1H4WA 1TALA 3EDXB 2ZDMA 4YM9A 1GJ4H 4X2XA 1ELGA 4HGCA 1GVKB 3A83A 2O8MA 4AYVB 4KGAA 1UO6A 1AUJA 2QYIA 2A4GA 3FFGA 1FV9A 4DT7B 1KXAA 3HKJB 3KEEA 5EGMA 3M3SA 1BJVA 2I6QA 2BXTH 1QBNA 2GDEH 2J94A 4INKA 3U69H 2ZQ1A 4JYUH 4D9QA 4I7YH 3IWMA 5F8ZA 1GHZA 3ZV8A 4YZUA 3MH5A 2ODQA 1V2TT 3OY6U 2FI5E 2ZTXA 4DCDA 1S85A 1BMMH 1KDQA 3U8OH 1O5FH 2Y82A 1C5WB 4E7RG 1SFQB 3MU5A 3F9EA 1BBRK 2A5IA 1FLEE 1UVPA 4TWWA 5EQQA 3UQVA 1OWHA 2TIOA 4B1TA 1EB2A 4I31A 3A85A 2GTBA 1XVOA 2A7CA 1L1GA 3DD2H 4K60A 2Z9IA 1DFPA 2C93B 1NFXA 5DP4A 3URCA 3TU7H 2B7DH 3ESTA 4OS4A 2ZU2A 1L4DA 1O2IA 1LMWB 4WJG2 2ZFFH 1BUIA 1HDTH 1A2CH 3F68H 2GP9B 3M5OA 1GBAA 4TPIZ 1GMDF 1AZ8A 3RU4D 1TLDA 1LTOA 3Q77A 3ODDA 1AQ7A 1P2QA 4ZHLU 5K7RA 4YOIA 4MNVA 3LC3A 2BDHA 1F0SA 1AI8H 1O2QA 3LC5A 3E6PH 4WVPE 4ABGA 4XSKU 3BG8A 3V3MA 4XE4A 3F6UH 5ETXA 3SU5A 1CT0E 4B74A 3NKKA 1PPHE 3PLPA 1TQ7B 2FOHA 1WV7H 2BX4A 3O8CA 2F91A 2PLXA 2DE8A 1GPZA 1Y3YA 1C1SA 1Y5AT 1HAPH 3LIWA 2ANWA 1O3HA 2PUQH 2CF9H 1C5UA 1ZOMA 2VB0A 3V0XA 3VGCC 4I32A 4AYYB 1DM4B 1F92A 4K69A 1BTWA 3TVJB 3D23A 1HV7A 2ZGBH 2BX3A 2C90B 4E06H 2WPMS 1YPJH 1SSXA 3KQCA 3RXBA 1HRTH 1IOEA 1ZSLA 3RM2H 1KDQB 7GCHG 1IQIA 1BQYA 1ORFA 2OBOA 3HATH 1H9HE 1V3XA 4JYTA 4WMDA 5C20A 2J95A 1JBUH 2QF3A 1V2ST 5L2YH 1KIGH 1A0HB 4Y0ZE 3SNCA 1P9UA 5HM9A 2HOBA 1AU8A 2P93A 3UUZA 4R0IA 2PW8H 4Y71A 2AGEX 3FVFB 1P2NA 1YLCA 4AFUA 2BD3A 1JMOH 1TQ0B 3AASA 2TGAA 3I77A 2BLVA 3CENA 1EZUC 1GJDB 1W0ZU 5DG6A 3QWCH 3ZVGA 6ESTA 3UPEA 1Z8RA 1S83A 4ZXXH 1CO7