2HOBA

Crystal structure of sars-cov main protease with authentic n and c-termini in complex with a michael acceptor n3
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
publication title Production of authentic SARS-CoV M(pro) with enhanced activity: application as a novel tag-cleavage endopeptidase for protein overproduction
pubmed doi rcsb
source organism Sars coronavirus
total genus 90
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2hobA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hobA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hobA02
1JWTA 2XTTB 3ATLA 1ELTA 1LHEH 1O2KA 1SB1H 2IPHA 1JBUH 3SJ8A 4MPXA 2AS9A 3E0PB 1G2MA 5F8ZA 3N7OA 1SFQB 1QY6A 1G32B 1QJ1B 3B23B 3UR9A 1BZXE 1QL8A 4X2XA 3RDZA 4AX9H 3HK6B 8KME2 5E0GA 4UE7H 1BJUA 1DITH 1O5BB 3GY3A 2HNTE 4DIIH 4NSVA 1BMMH 2NWNA 1VJ9U 3UNQA 2H6MA 1GI5A 3PMJA 2ILNA 4X2WA 2KAIA 3KQDA 1YCPK 3A7ZA 3A82A 3V12A 2BXUH 2WV5A 1W2KH 2OD3B 1LCYA 3MU4A 1C5ZB 2D8WA 2BD2A 3DFJA 5CHAC 3WY8A 3RMNH 1UTMA 4YLQH 3A7TA 2ZPRA 1GHVH 2BM2A 2ALVA 1C4V2 1WSSH 2Y7ZA 1FLEE 3RXKA 2C8ZB 1J16A 1KDQA 2Q6FA 4AGKA 1C1TA 1HFDA 1T8MA 1FI8A 1GWAA 2ZFFH 3MI4A 2HNTC 2BD8A 3KN2A 2PHBA 1KSNA 1ETTH 1S83A 1DWEH 2VIOA 3GCOA 4OGYA 2RA0A 3TJVA 1MU8B 4LK4A 3RP2A 1G3DA 3URCA 3TGJE 2KAIB 1SL3A 2OC0A 2TGPZ 3KCGH 2A4QA 1ZZZA 1QGFA 1FJSA 1GI7B 4UFGH 1GPZA 4ISHH 3ATWA 1L1GA 3PB1E 2ZDVH 3F9HA 1AU8A 1D9IA 5EODA 1MD8A 2H9HA 4AZ2B 4I8KA 1TNKA 1AIXH 3D23A 5BRRE 1C4Y2 1KDQB 1UO6A 4B2BA 3VB7A 3MU0A 1W12U 3LPRA 1YPJH 3ELAH 1FDPA 2FTLE 3EA9A 3QZQA 2ZGJA 1PPFE 2ZGXH 2BX3A 2CV3A 4YM9A 3E91A 1WYKA 4GCHG 1FIZA 5C1UA 2PUQH 3SU2A 1K1IA 2XCFA 1IAUA 4UONA 1EKBB 4XSKU 3LIWA 2TBSA 3BV9B 1TABE 1LO6A 4NA8A 4TY7A 1LQEA 1P2OA 1P02A 2WPHS 4HZHA 5ABWA 1OP0A 1DS2E 1ID5H 3EBNA 1C5YB 1J17T 1PYTD 1SGDE 2BMGB 4CHAC 4AFUA 2HPPH 3HK3B 5BPEA 4IBLH 1UTQA 1P09A 3G01A 1BTHH 2AIPA 3GDVA 3ZYEA 3SGBE 2BHGA 2FOCA 2ODPA 4DCDA 1CE5A 2Y81A 1SHHB 2FOMB 1ANEA 4KTCA 2V0BA 3HKIB 1Z8RA 2LIZA 3V3MA 1H8DH 1QB9A 3KIDU 4ABBA 4DJZB 1FIWA 4XE4A 4ABJA 3MH5A 1HAXB 1Y59T 1TGCA 1IQEA 3STJA 3LC3A 1LDTT 3VGCC 2OTVA 5FX5A 1CT2E 1UJ1A 1LKBA 2BOHB 5PTPA 1WOFA 1DXWA 3U1JB 4Y7AA 3ENSB 1C2IA 1X7AC 2C4FH 2ZFQH 2HLCA 3KEEA 1P03A 4A92A 2OCVB 1QA0A 3VB6A 2OBQA 3GCTF 5C67A 1T8NA 2VVVA 1E38B 1NY22 2G00A 3LT3A 4NCYA 3TH2H 4DVAU 2Z94A 2BDAA 1AUTC 1FY4A 2G52A 4ZH8A 5IYTA 1AHTH 3ZVDA 4KGAA 2QA9E 1GVZA 1WUNH 1ELCA 1D6WA 1EB1H 2QYIA 5GCHG 3AVZA 3FFGA 1CGJE 2J92A 2C90B 2ZDNA 3BG8A 1HAPH 1MTSA 1ELVA 1JMOH 1G30B 3PLBA 3SV2H 2Z9GA 5ESTE 1GJ9B 1ZTKA 2WYJA 3ZZ3A 2SFAA 3SU4A 2Q6DA 1LVYA 3A8BA 2GCHF 1O2RA 5ETXA 3D65E 3NCLA 4ZKOU 2ZPQA 1P04A 2WYGA 1TX8A 5T6FA 3S69A 1UHBA 2PSXA 2ANYA 4HGCA 3S0NA 1O3HA 4K1SA 1C2MA 2QY0B 3MO6A 1N1LA 2O8LA 1NPMA 2GV7A 4YZUA 2ZFRH 2ZQ1A 4K8BA 3GY6A 4ZAEA 1C1WH 5DP9A 1RIWC 2A7CA 4K1TA 2FO9A 5GDSH 3RXJA 2BDCA 3A89A 1N8OB 3H5CB 1K1NA 1EJAA 1PYTC 1GMHF 2BVSH 2PGBB 2BOKA 2SGDE 2IJOB 2VWOA 1GDNA 2AIQA 3T28A 3T27A 1DX5M 2BDGA 1C2JA 2BY9X 3UOUA 1W13U 1DFPA 3BTHE 2QCYA 1C2DA 3BG4B 3A83A 4XBBA 2H1UA 1FN8A 3SNDA 1S81A 3BTDE 1DPOA 3F9GA 3P17H 2XRCA 3SV6A 3F68H 4AG1A 1HYLA 1L2EA 3EAJA 1F7ZA 1UHBB 3RC5A 1C2GA 3CP7A 2Z3CA 4ABIA 1YLDA 1YPHE 2F91A 1IQKA 5DP4A 1O30A 3RXPA 4BTTB 1C5TA 1O2NA 2Z9LA 1FUJA 2FESH 1AKSA 8GCHG 3CS7A 3GY5A 2Y7XA 2A7HA 2HRVA 2FXRA 1XKAC 1Y8TA 5GPIB 1HV7A 4ABGA 2FI4E 3BIVH 2FYQA 1MTUA 4BNRA 1BRAA 1P0SH 2WINI 4NZQA 2NU0E 3ATKA 3MOCA 2ESTE 3LC5A 1WAYB 4JYUH 2PFEA 5JBTA 3GOVB 4ISLA 4DIHH 3RXAA 2Q1JA 1FY1A 3DD2H 1YPHC 4IN2A 1IQHA 5LPFA 3M3SA 1EXFA 1HDTH 3GDUA 1NO9H 2PKAA 1A0LA 2C8YB 1O3OA 3SBKA 1C5MD 2QF3A 2FS9A 1C1SA 1AKSB 1O5AB 2Z6BD 4MNWA 2ALPA 4CH2B 1S84A 1ETSH 1F0UA 4B73A 1JIRA 2ZCHP 3A84A 3V0XA 2OQ5A 3PROA 1O2UA 4D9QA 3RXFA 1HPGA 3LGTA 1CBWB 1G9IE 3D62A 3PWBA 1QR3E 2BDIA 1SLVB 2G8TA 1FY5A 1DT2A 1QBOA 4FUIA 2GCHG 3UY9A 4O97A 3SHCH 3RM0H 1JRSA 2C8XB 1MBMA 3A8CA 1KTSB 4X1NU 1W8BH 2F83A 2XBWA 2PKAB 3RXGA 2JH5D 3S9CA 1IQGA 1MTNB 2AGGX 1ZPCA 2FI3E 3OTJE 1TGSZ 3PLPA 1GJ8B 4JZIA 1SMFE 2FWWA 1MKWK 3L3TA 1EQ9A 5FBEA 1TOCB 2ULLA 1P9UA 4Y71A 1GI8B 4RN6A 4WXIA 2RG3A 2WUBA 4WH8A 4YESB 2AEIH 1N6YA 3LJJA 2ZDLA 4U32A 1MAXA 2FOGA 3UFAA 2QXJA 2J95A 1RGQA 3RXSA 1HGTH 4UD9H 4XFQA 2ZPSA 1E37B 1UMAH 5FCRA 1GHBG 1Z1IA 2GT8A 1QA7A 1DWBH 1GBDA 1TOMH 1TBZH 7GCHG 1O3GA 2Z9KA 1PPEE 2ZU3A 1AB9B 1LTOA 3M7QA 4MPVA 2XBVA 1B0EA 2ZDMA 4U30A 4CRDA 2BY6X 2WPKS 4IN1A 2HNTF 1NRSH 3M61U 1FAKH 4VGCB 4ASHA 1XUHA 1UTLM 2EEKA 1AVXA 4X1PU 1O5GH 2CJIA 2FOAA 1GDUA 1GGDC 1D4PB 2UUJB 4KKDA 2GCTC 3NUMA 1EZSC 2XW9A 1ELEE 2A32A 1T32A 5JB9S 1C1NA 3TNTA 1BHXB 3Q3YA 2K1QA 1DM4B 1JOUB 1B0FA 1O3BA 1DWCH 3FZDA 4MVNA 4AFZA 3U69H 1WQSA 1PFXC 5GWZA 3RMOH 1C2HA 1T8LA 2XWAA 1BCUH 1EB2A 1IQNA 2F9VA 4ISOA 1RTKA 1AZZA 3W95A 1P12E 1TYNA 5TCCA 1EASA 3RXTA 5J4SA 1P2KA 3TVJB 1ZMLA 4B75A 2R3YA 1CT4E 2BB4A 1NS3A 5AFZH 3PTNA 1V2VT 4DURA 1BT7A 4ZXXH 4E7RG 2CF8H 1TBRH 3A7YA 2W3KA 1HJAB 4X1QU 2ZCKP 1W7XH 3MU8A 1GJ4H 1AWFH 1P2QA 3NPSA 3QZRA 4OS7A 1V2OT 4B74A 3NK8A 3A88A 1AZ8A 1NESE 3R0FA 2ZEBA 3LH3A 1NRPH 3FANA 1TALA 8ESTE 4OS2A 4A5TS 1CO7E 1SBWA 4CRCA 1TGBA 1U6QA 1CHOG 1SFIA 1GMCG 1AFEH 1O5FH 4ZUHA 1ESAA 1UTPA 3EQ0H 2ZG0H 1O0DH 3QUMP 4CR5A 3P8FA 4NSYA 4OS5A 1VITH 2FI5E 2G5NA 4X2VA 1Q3XA 1FY8E 2ANMH 4IS5A 1YCPH 4GHTA 3KGPA 1LHCH 4MG3A 3BIUH 3TITA 1O2TA 4F49A 1GBJA 1KXFA 1E35B 2C3SA 3IG6B 2YNBA 3SV8A 1O2MA 1NZQH 2H9EH 4I31A 4D8NA 2A4RA 4K3JA 4BTUB 2SNWA 3LGYA 1TBQH 4UFDH 3I77A 1LHDH 3LGUA 3FP6E 4YOGA 4A7IB 1Z71A 2TPIZ 1SQOA 1NTPA 4R8TB 2GDEH 4BAOB 1MKXK 1W0ZU 4INHA 5IDKA 2ZZUH 3UNSA 4KTUA 4D9RA 1ANCA 1W0YH 1NT1A 3BG4C 3F6UH 4INKA 1VGCB 1O5DH 1GG6B 2ZU4A 2UUKB 2FX4A 4FUHA 4KELA 3RXEA 3ZVEA 5A09A 3E0NB 1SGFA 1B5GH 1C5LH 2ZKSA 2ZTYA 2I6SA 5T6DA 5HGGA 3ATMA 2ZGCA 2B9LA 4YT6H 1O3CA 4GUXA 1ELAA 1GJBB 5DKMA 4ZKRU 4JZ1A 5A0AE 5A8YA 2P3UB 3KQBA 3LONA 3SW2B 1SQTA 2D26C 1NU7B 3E6PH 5EG4A 1ESTA 1EAWA 1O38A 1AN1E 4MTBA 5LGOA 3BF6H 1TMTH 2J38A 4MNXA 2B8OH 3AW1A 2A45B 4FUBA 1BITA 1ZRKA 2SNVA 1EZUC 2NU2E 1A0JA 4X8TH 2ZDKA 3KNXA 1O2GH 2ANKH 4NIWA 3SJ9A 4MNYA 2BY7X 3M36A 2B7DH 3QX5H 3R3GB 3O8BA 2DE8A 2AMQA 2OINA 1GMDG 1O2ZA 3RXLA 1EAIA 3H7OA 3I29A 1T4VH 2I6QA 5TJXA 1O31A 1GBKA 1CQQA 2GD4B 3ZZBA 4XOJA 4CRGA 2ZI2H 2Z9IA 3MNSA 1AQ7A 2FEQH 1RJXB 3SQEE 4OGXA 2GT7A 4MNVA 1C5PA 2TGAA 1SVPA 4MDSA 1Y3WA 4XBCA 4ZHLU 2BQ7B 3C1KA 1ZOMA 4UFFH 3BEFB 1FV9A 2W7SA 3SU5A 2PSYA 2BTCE 4H42U 3AASA 2Y5FA 5F6MA 3A8AA 1V2UT 3RXRA 3TPIZ 4BAHB 1HB0B 2R9PA 2OC8A 1EPTA 2GKVE 1SQAA 4I32A 1GI9B 2VH0A 4DW2U 4I8JA 2CF9H 2FLRH 3GCNA 1Y5UT 5I25A 1MTNC 2ZTXA 1UTOA 4BAQB 1P01A 2ZC9H 2K7XA 1CA0B 5TCAA 1P8VC 1O2VA 4X8UH 1VCWA 1M9UA 5HYOA 1W10U 1TX6A 4JMYA 2HOBA 1S82A 4JK6A 1YC0A 1EOLA 1HAGE 4E7NA 1ZSLA 1XUGA 3L33A 4BOHA 4NGAH 2DE9A 3SU1A 3HATH 1PQAA 1GBMA 1BBRH 1KY9A 1CVWH 3BTME 1S5SA 3UTUH 4FVDA 4U01A 1C1PA 1CGIE 1EAUA 1SLWB 2EC9H 2PKSB 3AAVA 3SU0A 1QL7A 1AGJA 1EPTB 3K65B 4YLUA 1DICA 1PQ7A 5FPSA 5J4QA 1CA8B 1P2MA 3ZZ7A 1QJ7B 1AB9C 1GHAF 3MHWU 4UEHH 3RXMA 3UR6A 2SGAA 1C9TA 1GJCB 4O03A 1EJNA 2ASUB 3NKKA 3U8OH 1FY3A 2UWLA 2Z3DA 1E34B 1GJ6A 1YM0A 5E8EH 4CH8B 2BDBA 5AVDA 4BXSA 2BD5A 1E0FD 3A7VA 4NWKA 3K2UA 1KLTA 3FP8E 1C1OA 2H2ZA 4AB8A 4BXWA 2OLGA 5L6NH 2CN0H 1J15A 3LGIA 1TPOA 1GVKB 5EXMA 2OXSA 1HBTH 2XXLA 1BTPA 3SZNA 1C1VH 1O3FA 2IN2A 3QGNB 3C27B 1AO5A 1RXPA 2XBXA 3M35A 5C5NA 1A3BH 3VFEA 4FUDA 1THSH 2C8WB 5B6OA 2G55A 5EW2H 1ZGIA 1C1UH 1O3IA 2ODYB 3SJKA 4E06H 2QXIA 2P16A 3IITA 2Z9JA 9LPRA 1O3AA 4WJG2 2JH0D 4H6TA 2Y6TA 1GHWH 3Q00A 2P94A 3ZVCA 1LQDB 4JK5A 1H9HE 1FNIA 5EXNA 1GBCA 1NFYA 1YPMH 4ABAA 3RLYH 5LPRA 2EI8A 1CGHA 3RM2H 2UWOA 2ZU1A 1DLEA 1O2OA 3EGKH 5DGJA 1GCTB 7ESTE 3S9BA 3RUOA 1BBRE 1C2LA 2BQWB 3P6ZB 3PO1B 5FX6A 3ESTA 1GCDA 1Z6EA 3T2NA 1PPZA 4PROA 4XDEA 5K7RA 2TGDA 3SU6A 2V35A 1IQJA 2AFQB 3O8DA 1D6RA 4YOJA 1Z7KA 3U1IB 3OSYA 3A80A 4BAMB 3IWMA 5I46H 1O2LA 3DA9B 3M5OA 4MPWA 2J2UA 2BDHA 1SGNE 4U2WA 1YF4A 1O36A 3FP7E 1QRWA 1QTFA 2HVXA 1Y3XA 1V2NT 1O2WA 1O5EH 3KHVA 3TU7H 2F3CE 3GDSA 1A1RA 2ZO3H 1S0RA 3U98H 1O3NA 1C2FA 5DJ7A 3TLOA 3SN8A 1SSXA 2B0FA 1ZTJA 3UQVA 3S7HB 5E0JA 2BQ6B 2NU3E 3T25A 4AYVB 1O2JA 1Z8IB 3U9AH 1K21H 1HAOH 1XX9A 4AFSA 4ESTE 3TH3H 4AYYB 2O8MA 5JYIA 1GHAG 1TA6A 1SGPE 2D1JA 3LGWA 1AY6H 1T4UH 4QT8C 2XCNA 4X8SH 3NWUA 5CMXH 5DG6A 3AAUA 2XBYA 5K0HA 1O3EA 1F5KU 1RFNA 2JETB 7KMEH 2VIVA 1GBBA 1ZHRA 1SLXB 1MU6B 3SNBA 2AMDA 1Z6JH 4LXBH 1K9OE 1QB6A 1VGCC 3S7KB 3SORA 3P8OA 1MKWH 4ZKSU 5JDUB 2EA3A 1TNLA 4CR9A 1IOEA 1C1MA 3P92A 3T5FH 1NRQH 3UWJH 4B71A 1QURH 3SGAE 4NA9H 2PWXA 3OU0A 1V2TT 1QQUA 3M3VA 2BZ6H 1S6FA 1XVMA 1OS8A 3QWCH 3GCTG 4JZFH 4ABDA 1HIAA 1NRRH 4ZHAA 5DP6A 2A0QB 1FN6A 1ACBE 2QV1A 5JB8S 4HI3A 1CHGA 4ABHA 1DOJA 1F2SE 1GJAB 1YPGH 2VJ1A 1G36A 1A61H 5A0BA 1O2HA 2P3FH 1V2KT 3O8RA 2G81E 5L2YH 2ZIQH 2WPLS 2XNIA 3QK1A 1PQ5A 4TPYA 3SUEA 2ZQ2A 1TB6H 4JCNA 5C1YA 1ELFA 1XUKA 2AH4X 1EX3A 4ZMAH 1K1PA 2IOTA 5AFYH 2OC1A 4WVPE 1HNEE 2A7JA 2PR3A 5HM2A 3LDXH 3U8TH 3ZVBA 1GJ7B 1TRYA 5C20A 2P93A 1INCA 1NU9A 5F03A 1HIAB 4YO9A 2XYAA 4X6PA 2EI7A 2FDAA 3SJIA 2P8OB 1UVTH 2PLXA 5FPYA 1XXDA 3L6PA 2ZCLP 1F5LA 1GMHG 1RTFB 3PLKA 2ZFTA 4GAWA 1EZQA 1AI8H 1P2JA 3A87A 1TNGA 4FU8A 4NG9H 1RTLA 2J94A 1OXGA 4OS4A 4BANB 1OWHA 2HGTH 3GY2A 3UQOA 2A4OA 8LPRA 4OS1A 1O2YA 5EW1H 3MNXA 2P59A 1G3BA 5FCKA 4NIVA 1GJ5H 2STBE 3F1SB 2A5AA 2XWBI 2FIRH 5CE1A 4Z6AH 2A2XH 1XVOA 1SC8U 1ORFA 1CA0C 3V7TA 4A1XA 3STIA 1ARCA 1QNJA 2PW8H 3MH7A 3ZZAA 2BY8X 1PPHE 1JRTA 5L30H 5EPYA 2SGQE 2ZA5A 5F8XA 2ZHEH 3QN7A 2F9PA 4FU9A 1DWDH 3RXCA 5EGMA 2VWNA 3KL6A 4CHAB 1AFQB 3LH1A 3Q77A 5DO4H 1GI4A 3ZV8A 3F9FA 2VWMA 3E1XB 2PKSC 3OY5U 3SI4H 3RXDA 1SPJA 1K1MA 3T26A 1MCTA 1TQ0B 1DUEA 1GL0E 2FOHA 3A85A 2FOFA 1DE7H 2C93B 2BD4A 1LHFH 1TPPA 1OOKB 1KXBA 5GJ4B 3BTEE 2ZHDA 2A5KA 1TPSA 2FOEA 2NU1E 4FUCA 4Q7YA 1SLUB 1OWJA 1P10A 2FPZA 1MQ5A 3H7TA 1WV7H 3V13A 3SNAA 5HM9A 1UCYH 1ZMJA 1HXEH 1W7GH 5JBAS 2BD7A 1O3JA 1GBFA 1BTUA 4H6SB 4AORA 1KXCA 4FVBA 1EZXC 3TK6A 3MWIU 2PTNA 4R0IA 3OYPA 1L1JA 2Y80A 2ZTZA 1F0RA 1HAHH 3EA7A 2ZHQH 1S85A 4AB9A 1C5VA 3GY8A 5FPTA 2WPJS 3SV9A 3ZZ9A 4HFPB 3VXEH 3RMMH 5GIBA 2H5CA 4H4FA 1XUFA 3UNRA 4A1TA 5T6GA 1GBLA 1QL9A 4MPUA 4K60A 1UVSH 1MH0A 4DGJA 4WY3A 3ZYDA 1OWDA 4GSOA 4F4OC 2GMTB 1LVMA 3M7UA 1PQ8A 2YNAA 1SGCA 1O2SA 4WMEA 3E16B 4Y8ZA 1JIMA 1O3KA 3BTFE 1BOQA 1V6DA 4NA7A 2F9UA 2Y82A 1V2PT 1XM1A 3RXUA 4Y10E 5HMAA 1GCTC 3W94A 3EDXB 1K22H 1OP8A 2GVFA 2R0KA 1LVOA 1MAYA 3GICB 3A7XA 2ZGHA 2A2QH 3QDZB 2GP9B 1DY8A 2CMYA 1QIXB 2FTMA 5E2OA 3K9XB 1ZR0A 5L2ZH 2PV9B 1BHXF 4FU7A 2XC5A 3ITIA 3VB4A 4GLYA 4JZEH 1A5HA 4O3TA 1K1LA 4CRBA 1YPEH 2UWPA 3A86A 1N8OC 3QO6A 2R2MB 1OWIA 3RLWH 1GJDB 1UCYE 5F8TA 4YT7H 1KLIH 1G37A 1KXEA 1WCZA 3GYLB 1YPKH 3SNEA 1LPGB 1MTWA 5LPEA 3TGKE 1TRMA 1GI0A 4Y0YE 3K6ZA 2BZAA 1Y3VA 1HAVA 1MTVA 1ZRBA 3JZ2B 3U8RH 5FAHA 2BD3A 1FAXA 2W26A 3E90B 4Q7ZA 1DSTA 4GCHF 2O9QA 2THFB 4DY7B 1O33A 1O3LA 3TNSA 1PJPA 2R0LA 2FOBA 1HJ9A 1GHZA 1OSSA 4CBNA 2SGPE 1SGQE 1QBVH 1C1QA 3I78A 1BMNH 3RXIA 2BD9A 2VIPA 3TJUA 4WMDA 3SU3A 1ANBA 3QTVH 1O5CB 2JETC 5AF9H 1F0SA 2Z7FE 3P95A 7LPRA 1ARBA 1TNIA 4A6LA 2ODQA 3MNCA 4X2YA 2VIWA 1XUJA 2NU4E 4ZROA 1AE5A 2OP9A 1DLKB 1K1JA 2J9NA 2ZDAH 4Y6DA 1NC6A 3EYDA 3NXPA 1FXYA 1BQYA 1Z8GA 5JBCS 3AW0A 1HAVB 1BRCE 2FLBH 1NRNH 4RSPA 4KP0A 1S0QA 4X1SU 4BTIB 3VEQB 1ETRH 2XC0A 3GY7A 1UK4A 1FONA 2OQUA 4FUEA 2GGVB 1G2LA 2A5IA 1TA2A 3Q3KA 3SO3A 2VH6A 4IMQA 2BXTH 2W7UA 1O3MA 1ZJKA 2CGAA 3BTTE 2W5EA 4UDWH 1K1OA 1J9CH 2AERH 3F9EA 3UPEA 2VGCB 4WF8A 1XXFA 1TGNA 3HGNA 2G5VA 5EQSA 2AMPA 5EU8A 4DG4A 2VU8E 1UK3A 3SNCA 1ELBA 3ZVGA 1OWEA 4ZKNU 1SOTA 1L1NA 1QFKH 2UUFB 2VWLA 1PPGE 1CBWC 1P2IA 2FS8A 1SGEE 1KTTB 2P3TB 2Y5GA 3M7TA 2WV4A 4A1VA 3LJOA 5C1XA 1AUJA 2VIDA 4O3UA 1D3PB 1LVBA 3E3TA 3M5NA 3MTYA 3HGPA 1ZSKA 1BUIA 1BRUP 5GCHF 1Z8JB 2J34A 2P8OC 3MU5A 1BJVA 2M5TA 3GCHB 2ZU5A 4ISNA 1TX7A 3K6YA 1EOJA 2D2DA 2PTCE 4FUGA 2ZNKH 4J1YA 2GX4A 1ZHPA 3ZZ6A 1BTWA 3ZZCA 2Y5HA 2VVCA 5C3NA 2R2WU 1QJ6B 1J8AA 1W14U 1H9IE 1YP9A 2H9TH 1FPCH 1TIOA 5DPAA 3SQHE 1KIGH 4ABFA 3OY6U 2LPRA 4D7FA 2SGEE 1V2QT 1V2RT 1O2IA 5DP7A 5A0CA 2QXHA 3LU9B 5FHTA 1SGIB 2VIQA 3TIUA 1HRTH 1A7SA 3P70B 1MMJN 2F9BH 1UK2A 1H9LB 1UVUH 3DUXH 2Q6GA 2BYAX 5DP8A 4WXVA 3BN9A 4KTSA 1BA8B 5HXFA 4VGCC 2ZF0H 2ZFSA 1SGRE 4ZXYH 1GGDB 1AFQC 4Y8YA 2GCTB 3LKWA 1C2KA 1C4U2 1DUAA 3GYMA 4Y8XA 1E36B 1GHXH 3ZZ8A 2GDDA 1C5NH 1NROH 2BVRH 1J14A 1H8IH 2BLQA 2SGFE 1TQ7B 3NZIA 1C5XB 1GDQA 4K2YA 3ZVFA 1GI6A 2V6NA 4ABEA 3BTWE 1TAWA 4K1EA 4WH6A 2A31A 8GCHF 4X1RU 3FVFB 4XBDA 1D3QB 5A8XA 2ZWLH 4HTCH 1DANH 6CHAB 4TWWA 1DSUA 3KF2A 3LGVA 1ZSJA 3SOSA 1FPHH 1DY9A 4E05H 1O2PA 1TPAE 3QLPH 3EA8A 5G4BA 2P95A 4D76A 2ZP0H 1TFXA 1C5UA 1UTJA 1C1RA 1GL1A 3SJOA 4NFEA 5H4IB 3T29A 4IC6A 1KLJH 1GI2A 2UUYA 1IHSH 1NN6A 1HJAC 2F9OA 4O9VA 3EE0B 3RXBA 2VB0A 1ABIH 2QXGA 1V2JT 5JPMH 1P11E 2ANWA 1UVPA 3E8LA 1ELDE 1TNJA 2FX6A 3ATIA 1A5GH 1OYQA 1EATA 1O2XA 2GZ9A 1EP5A 4Y7BA 2GV6A 2JKHA 1BBRK 1NFUA 1P3CA 2GMTC 3HKJB 1AD8H 4IGDA 2G51A 1OPHB 1F92A 1ABJH 1HAYB 2A1DB 3B9FH 2HPQH 1V3XA 4LOYH 1ZPBA 1Z1JA 3MH4A 3M37A 1V2ST 4IMZA 1BTZA 2CHAB 2FP7B 1K28D 1L4ZA 4CRFA 1H4WA 3TK5A 3KQCA 3GISB 1GI1A 2AYWA 1YPLH 1MZDA 2PUXB 1SOZA 4NFFA 4TPIZ 2XC4A 1W3CA 1AMHA 1UVOA 3UREA 1F5RA 2ZHWH 1PPBH 1L4DA 4NIYA 3BEUA 1SGFG 2G4TA 2F9NA 3RXHA 5DK1A 1OX1A 9ESTA 4B76A 6GCHF 1A3EH 1OKXA 3ZVAA 4YTAA 1QRXA 3T62A 3A8DA 3GY4A 1VZQH 1O34A 2AGEX 1IQLA 3Q76A 2ZGBH 5JBBS 5C5OA 4K5ZA 2G4UA 1C5SA 1GHBF 3FZZA 2CXVA 1TGTA 2QN5T 1Y3UA 1HJ8A 4X8VH 1A4WH 5C2ZA 7GCHF 1GG6C 2J4IA 2W3IA 4ISIH 3SHAH 4TWYA 2AGIX 2PGQB 4I7YH 5A2MH 2YOLA 4K8YA 1FZZA 1YYY1 3M3TA 1THRH 1SI5H 1SR5C 4Y76A 1V2MT 3M5MA 1P06A 4I33A 3URDA 3UOPA 1ZJDA 3MYWA 3SUFA 1HAIH 3OX7U 1HAZB 1WQVH 2TRMA 2R3UA 4LZ4B 1LPZB 5EQQA 4M7GA 4X6OA 4I8HA 1SGYE 3LOXA 2QC2A 1BTXA 3ZZ5A 1AE8H 4Y79A 2JH6D 5CHAB 3MU1A 2FM2A 4I8LA 3CS0A 3ODFA 1TMUH 1A46H 1RRKA 1QQ4A 3BSQA 3HPTB 1QB1A 4UFEH 1WTHD 4X6NA 3UIRA 1N6XA 4X0WU 4FXGH 4Y11E 1BDAA 1TWXB 2OUAA 3MH6A 4TYDA 1V2WT 1FMGA 1KXAA 1VJAU 2ZFPH 4DT7B 1DXPA 5E2PA 1UTNA 3SUGA 4FUJA 1B7XB 3ZV9A 1IQFA 2FMJA 3B8JA 3RXQA 3VXFH 1L0ZA 1YLCA 2STAE 1A0HB 1KYNA 1BMLA 1T7CA 4AFQA 3DFLA 1O32A 2TGTA 1MUEB 3M5LA 2VGCC 3SGQE 3MFJA 3PYHA 3VPKA 1DVAH 1YGCH 1Q31A 4TY6A 2GZ7A 1Q2WA 3DHKH 4Q2KA 1VCQA 6LPRA 1TRNA 2BX4A 1OP2A 1BMAA 1GI3A 2WPMS 1EJMA 1XKBC 3VB3A 1P05A 1EP6A 2RDLA 1T31A 3PM3A 3RXVA 3SV7A 1C5QA 3CENA 1CHOF 1GMCF 1S6HA 5FXLA 4LZ1H 1AVGH 4NIXA 2V3HH 4MLFB 1GBTA 1ZPZA 1G3CA 2BLWA 1P9SA 4AGJA 3D49H 1Y3YA 4B1TA 5DP3A 1IQIA 1HCGA 1EAXA 6GCHG 3GCHC 2LNCA 1LMWB 3MMGA 1THPB 1C9PA 6ESTA 4AN7A 1MBQA 3BTKE 1SHYA 2QIQA 2H5DA 1MD7A 1A5IA 1GVLA 3BTGE 1ZHMA 1DDJA 4GHQA 1SG8B 4INLA 2V3OH 3SUDA 1F0TA 1YKTA 1UTKA 3TJOA 1WTGH 1BB0B 2WUCA 2VNTA 1EPTC 1ZGVA 3MNBA 4NZLA 4B2CA 1ZLRA 3QTOH 2QGRA 3O8CA 1W11U 2FYRA 1VITF 1C5RA 2RA3A 4YOIA 1LHGH 4I8GA 1C5OH 1ZYOA 2O8UA 4JYVH 2B5TB 1HUTH 3VB5A 1NM6A 1JXPA 2O8TA 1GBAA 4SGBE 3RMLH 3RC4A 4BAKB 3BTQE 3VGCB 4DOQA 1O35A 3QGJA 1QRZA 1IHTH 5E0HA 1RD3B 2TIOA 1K2I1 1V2LT 1TMBH 1BRBE 1ZMNA 1BIOA 1KXDA 1MCVA 1P57B 3A7WA 3MO9A 1LPKB 2OC7A 1MKXH 3PMBB 5EQRA 4WWYA 3ODDA 1C5WB 3TJNA 3P8NA 1VR1H 1QHRB 3RC6A 1PPCE 1C2EA 1BTYA 2QF0A 4AOQA 2O8WA 5ESBA 1AVWA 1CT0E 1XMNB 6CHAC 3JZ1B 1T8OA 2BLVA 4JYTA 1TLDA 1Y5AT 2BLOA 3MO3A 4IW4E 1CSOE 1O3DA 1GBIA 2Z3EA 1VCPA 1LKAA 4WMFA 4ZHMU 1TNHA 1P3EA 2FODA 4Y0ZE 4THNH 4FUFA 4SGAE 5SGAE 4Q7XA 2OBOA 3SI3H 1ELGA 2GTBA 2EI6A 3TH4H 2BY5X 1TONA 1H1BA 1GMDF 5A8ZA 3BEIB 1P2NA 4RKJB 4OS6A 5FBIA 1ANDA 1NFWA 1O39A 3RU4D 4X6MA 1CU1A 1D3DB 3PMAB 5T3HA 4AG2A 3UUZA 3ZZDA 2ZECA 3P8GA 1Y5BT 4D7GA 3PO1C 4GVUA 1O37A 1O3PB 1SGTA 1YBWA 1IQMA 4K69A 2A4GA 1GHYH 3UWIA 4RKOB 1ESBA 2ZHFH 1RIWB 1YCPM 3Q3XA 1D3TB 4NWLA 2VINA 5AHGH 3TGIE 1OWKA 5EPNA 4CBOA 5LH8A 4J2YB 3ZZ4A 1QBNA 3PTBA 4IC5A 2CHAC 2RCEA 1EUFA 1WBGB 4MQAA 2DUCA 5DP5A 4Z0KA 1NFXA 4GPGA 3PV4A 2BDYA 1QCPA 5EXLA 3RXOA 1O2QA 1MQ6A 1UCYK 4CRAA 1GBEA 2GZ8A 5EOKA 1G3EA 4B2AA 1ZTLA 3PWCA 2FZZA 2WPIS 3RU4T 1A2CH 1OYTH 1VITG 4CREA 1HXFH 2HWLB 4Q80A 1XUIA 3DT0H 1AWHB 3FAOA 2BVXH 3PMHB 5GXPA 1HLTH 1MZAA 2VVUA 2ZU2A 4JZDH 2QAAA 3S9AA 1GBHA 3TK9A 3KQEA 1FQ3A 1TE0A 2HALA 3A81A 3RU4E 1WU1A 1RS0A
chains in the Genus database with same CATH superfamily
1JWTA 2XTTB 3ATLA 1ELTA 1LHEH 1O2KA 1SB1H 2IPHA 1JBUH 3SJ8A 4MPXA 2AS9A 3E0PB 1G2MA 5F8ZA 3N7OA 1SFQB 1QY6A 1G32B 1QJ1B 3B23B 3UR9A 1BZXE 1QL8A 4X2XA 3RDZA 4AX9H 3HK6B 8KME2 5E0GA 4UE7H 1BJUA 1DITH 1O5BB 3GY3A 3WWBA 4B6FA 2HNTE 4DIIH 4NSVA 3U28C 1BMMH 2NWNA 1VJ9U 3UNQA 2H6MA 1GI5A 3PMJA 2ILNA 4X2WA 2KAIA 2KFWA 3KQDA 1YCPK 1MABB 3A7ZA 3A82A 3V12A 2BXUH 2WV5A 1W2KH 5C17A 2OD3B 1LCYA 3MU4A 1C5ZB 2D8WA 2BD2A 3DFJA 3OTPA 2LP6A 5CHAC 3WY8A 3RMNH 1UTMA 4YLQH 3A7TA 4YXWD 2ZPRA 1GHVH 2BM2A 2ALVA 1C4V2 1WSSH 2Y7ZA 1FLEE 5KECA 3RXKA 2C8ZB 1J16A 3VG8A 1KDQA 2Q6FA 4AGKA 1C1TA 1HFDA 1T8MA 1FI8A 1GWAA 2ZFFH 3MI4A 2HNTC 2BD8A 3KN2A 2PHBA 1KSNA 1ETTH 1S83A 1DWEH 2VIOA 3GCOA 4OGYA 2RA0A 3TJVA 1MU8B 4LK4A 3RP2A 1G3DA 3URCA 3TGJE 2KAIB 1KMHB 1SL3A 2OC0A 2TGPZ 3KCGH 2A4QA 1ZZZA 1QGFA 1FJSA 1GI7B 4F48B 4UFGH 2WSSD 1GPZA 4ISHH 3ATWA 1L1GA 3PB1E 3GS9A 2ZDVH 3F9HA 1AU8A 1D9IA 5EODA 1MD8A 2H9HA 5EJ1A 4AZ2B 4I8KA 1TNKA 2GJGA 1AIXH 3D23A 5BRRE 1C4Y2 1KDQB 1UO6A 4B2BA 3VB7A 3MU0A 1W12U 3LPRA 1YPJH 3ELAH 1FDPA 2FTLE 3EA9A 3QZQA 2ZGJA 1PPFE 2ZGXH 2BX3A 2CV3A 4YM9A 3E91A 1WYKA 4GCHG 1FIZA 5C1UA 2PUQH 3SU2A 1K1IA 2XCFA 1IAUA 4UONA 1EKBB 4XSKU 3LIWA 2TBSA 1UW7A 3BV9B 1TABE 1LO6A 4NA8A 4TY7A 1LQEA 1P2OA 1P02A 2WPHS 4HZHA 5ABWA 5EIYA 1OP0A 1DS2E 1ID5H 3EBNA 1C5YB 1J17T 1PYTD 1SGDE 2BMGB 4CHAC 4AC9A 4AFUA 2HPPH 3HK3B 5BPEA 4IBLH 1UTQA 1P09A 3G01A 1BTHH 2AIPA 3GDVA 3ZYEA 3SGBE 2BHGA 2FOCA 2ODPA 4DCDA 1CE5A 2Y81A 2J98B 2L74A 1SHHB 2FOMB 1ANEA 4KTCA 2V0BA 3HKIB 1Z8RA 2LIZA 3V3MA 1H8DH 1QB9A 3KIDU 4ABBA 4DJZB 1FIWA 4XE4A 4ABJA 3MH5A 1HAXB 1Y59T 1TGCA 1IQEA 3STJA 3LC3A 1LDTT 3VGCC 2OTVA 5FX5A 1CT2E 1UJ1A 1LKBA 2BOHB 5PTPA 1WOFA 4Z1MD 1DXWA 3U1JB 4Y7AA 3ENSB 1C2IA 1X7AC 2C4FH 2ZFQH 2HLCA 3KEEA 1P03A 4A92A 2OCVB 1QA0A 3VB6A 5DN6D 2OBQA 3GCTF 5C67A 2QF4A 1T8NA 2VVVA 1E38B 1NY22 2G00A 3LT3A 4NCYA 3TH2H 4DVAU 2Z94A 2BDAA 1AUTC 1FY4A 2G52A 4ZH8A 5IYTA 1AHTH 3ZVDA 4KGAA 2QA9E 1GVZA 1WUNH 1ELCA 1EFRD 1D6WA 1EB1H 2QYIA 5GCHG 3AVZA 3FFGA 1CGJE 2J92A 2C90B 2ZDNA 3BG8A 1HAPH 1MTSA 1ELVA 1JMOH 1G30B 3PLBA 3SV2H 2Z9GA 5ESTE 1GJ9B 1ZTKA 2WYJA 3ZZ3A 2SFAA 3SU4A 2Q6DA 1LVYA 3A8BA 3ZIAD 2GCHF 1O2RA 5ETXA 3D65E 3NCLA 4ZKOU 2ZPQA 1P04A 2WYGA 1TX8A 5T6FA 3S69A 1UHBA 2PSXA 2ANYA 4HGCA 3S0NA 1O3HA 3DCLA 4K1SA 1C2MA 2QY0B 3MO6A 1N1LA 2O8LA 1NPMA 2GV7A 4YZUA 2ZFRH 2ZQ1A 4K8BA 3GY6A 4ZAEA 1C1WH 5DP9A 1RIWC 2A7CA 4K1TA 2FO9A 5GDSH 3RXJA 2BDCA 3A89A 1N8OB 3H5CB 1K1NA 1EJAA 1YY3A 1PYTC 1GMHF 2BVSH 2PGBB 2BOKA 2SGDE 2IJOB 2VWOA 1GDNA 2AIQA 3T28A 3T27A 1DX5M 2BDGA 1C2JA 2BY9X 3UOUA 1W13U 1DFPA 3BTHE 1FX0B 2QCYA 1C2DA 3BG4B 1YLNA 3A83A 4XBBA 1FN8A 2H1UA 3SNDA 1S81A 3BTDE 1DPOA 3F9GA 3P17H 2XRCA 3SV6A 3F68H 4AG1A 1HYLA 1L2EA 5FL7D 3EAJA 1F7ZA 1UHBB 3RC5A 1C2GA 3CP7A 2Z3CA 4ABIA 1YLDA 1YPHE 2F91A 1IQKA 5DP4A 1O30A 3RXPA 4BTTB 1C5TA 1O2NA 4B6EA 2Z9LA 1FUJA 2FESH 1AKSA 8GCHG 3CS7A 3GY5A 2Y7XA 2A7HA 2HRVA 2FXRA 1XKAC 1Y8TA 5GPIB 1HV7A 2IJD1 4ABGA 3F3BA 2FI4E 3BIVH 2FYQA 1MTUA 4BNRA 1BRAA 1P0SH 2WINI 4NZQA 2NU0E 3ATKA 3MOCA 2KCAA 2ESTE 3LC5A 1WAYB 4JYUH 2PFEA 5JBTA 3GOVB 4ISLA 4DIHH 3RXAA 2Q1JA 1FY1A 3DD2H 1YPHC 4IN2A 1IQHA 5LPFA 3M3SA 1EXFA 1HDTH 3GDUA 1NO9H 2PKAA 1A0LA 2C8YB 1O3OA 3SBKA 1C5MD 2QF3A 3DSGA 2FS9A 1C1SA 1AKSB 1O5AB 2Z6BD 3OE7D 4MNWA 2ALPA 4CH2B 1S84A 2WHXA 1ETSH 1F0UA 4B73A 1JIRA 2ZCHP 1COWD 3A84A 3V0XA 2OQ5A 3PROA 1O2UA 4D9QA 3RXFA 1HPGA 3LGTA 1CBWB 1G9IE 3D62A 3PWBA 1QR3E 2BDIA 1SLVB 3WW7A 2G8TA 1FY5A 1DT2A 1QBOA 3OEED 4FUIA 2GCHG 4HG6A 3UY9A 4O97A 3SHCH 3RM0H 1JRSA 2C8XB 1MBMA 3A8CA 1KTSB 4X1NU 1W8BH 3CNRA 2F83A 2XBWA 2PKAB 3RXGA 2JH5D 2XNDD 3S9CA 1IQGA 1MTNB 2AGGX 1ZPCA 2FI3E 3OTJE 1TGSZ 3PLPA 1GJ8B 4OM9A 4JZIA 1SMFE 2FWWA 1MKWK 3L3TA 1EQ9A 5FBEA 1TOCB 2ULLA 1P9UA 4Y71A 1GI8B 4RN6A 4WXIA 2RG3A 2WUBA 4WH8A 4YESB 2AEIH 1N6YA 3LJJA 1QZ8A 2ZDLA 4U32A 1MAXA 2FOGA 3UFAA 2QXJA 2J95A 1RGQA 3RXSA 1HGTH 3FOAA 4UD9H 4XFQA 2ZPSA 1E37B 1UMAH 5FCRA 1GHBG 1Z1IA 3UB0A 2GT8A 1QA7A 1DWBH 1GBDA 1TOMH 1TBZH 7GCHG 1O3GA 2Z9KA 1PPEE 2ZU3A 1AB9B 1LTOA 3M7QA 1K0HA 3EE7A 4MPVA 2XBVA 1B0EA 2ZDMA 4U30A 4CRDA 2BY6X 2WPKS 4IN1A 2HNTF 1NRSH 3M61U 1E1QD 1FAKH 4VGCB 4ASHA 4M9FA 1XUHA 1UTLM 2EEKA 1AVXA 4X1PU 1O5GH 2CJIA 2FOAA 1GDUA 1GGDC 2LELA 1D4PB 2UUJB 4KKDA 2GCTC 3NUMA 1EZSC 2XW9A 1ELEE 2A32A 1T32A 5JB9S 1C1NA 3TNTA 1BHXB 3Q3YA 2K1QA 1DM4B 1JOUB 1B0FA 1O3BA 1DWCH 3FZDA 4MVNA 4AFZA 3U69H 1WQSA 4ACAA 1PFXC 5GWZA 3RMOH 4XRNA 1C2HA 1T8LA 2XWAA 1BCUH 1EB2A 1IQNA 2F9VA 4ISOA 1RTKA 1AZZA 3W95A 1P12E 1TYNA 3N99A 5TCCA 1EASA 3RXTA 5J4SA 1P2KA 3TVJB 1ZMLA 4B75A 2R3YA 1CT4E 2BB4A 5CDFE 1NS3A 1WXRA 5AFZH 3PTNA 1V2VT 4DURA 1BT7A 2RFKC 4ZXXH 4E7RG 2CF8H 1TBRH 3A7YA 2W3KA 1HJAB 4X1QU 2ZCKP 1W7XH 2JJ2D 3MU8A 1GJ4H 1AWFH 1P2QA 3NPSA 3QZRA 4OS7A 1V2OT 1E79D 4B74A 3NK8A 3A88A 1AZ8A 1NESE 5EJZA 3R0FA 2ZEBA 3LH3A 1NRPH 3FANA 1TALA 8ESTE 4OS2A 4A5TS 1CO7E 1SBWA 4CRCA 1TGBA 1U6QA 1CHOG 1SFIA 1GMCG 1AFEH 1O5FH 4ZUHA 1ESAA 1UTPA 3EQ0H 3FO8D 2ZG0H 1O0DH 3QUMP 4CR5A 3P8FA 4NSYA 4OS5A 1VITH 2FI5E 2G5NA 4X2VA 1Q3XA 1FY8E 2ANMH 2J97A 4IS5A 1YCPH 4GHTA 3KGPA 1LHCH 4MG3A 3BIUH 3TITA 1O2TA 4F49A 1GBJA 1KXFA 1E35B 2C3SA 3IG6B 2YNBA 3SV8A 1O2MA 1NZQH 2H9EH 4I31A 4D8NA 2A4RA 2EY4C 3FKSD 4K3JA 4BTUB 2SNWA 3LGYA 1TBQH 4UFDH 3I77A 1LHDH 3LGUA 3FP6E 4YOGA 4A7IB 1Z71A 2TPIZ 1SQOA 1NTPA 4R8TB 5IK2D 2GDEH 4BAOB 1MKXK 1W0ZU 4INHA 5IDKA 2ZZUH 3UNSA 5DSFA 4KTUA 4D9RA 1ANCA 1W0YH 1NT1A 3BG4C 3F6UH 4INKA 1VGCB 1O5DH 1GG6B 2ZU4A 2UUKB 2FX4A 4FUHA 4KELA 3RXEA 3ZVEA 5A09A 3DSPA 3E0NB 1SGFA 1B5GH 1C5LH 2ZKSA 2ZTYA 2I6SA 5T6DA 5HGGA 3ATMA 2ZGCA 2B9LA 4YT6H 1O3CA 4GUXA 1ELAA 1GJBB 5DKMA 4ZKRU 4JZ1A 5A0AE 5A8YA 2P3UB 3KQBA 3LONA 3SW2B 1SQTA 2D26C 1NU7B 3E6PH 5EG4A 1ESTA 1EAWA 1O38A 1AN1E 4MTBA 5LGOA 3BF6H 1TMTH 2J38A 4MNXA 2B8OH 3AW1A 2A45B 4FUBA 5HIZA 1BITA 1ZRKA 2SNVA 1EZUC 2NU2E 1A0JA 4X8TH 2ZDKA 3KNXA 1O2GH 2ANKH 4NIWA 3SJ9A 4MNYA 2BY7X 3M36A 2B7DH 3QX5H 3R3GB 3O8BA 2DE8A 2AMQA 2OINA 1GMDG 1O2ZA 3RXLA 1EAIA 3H7OA 3I29A 1T4VH 2I6QA 5TJXA 1O31A 1GBKA 1CQQA 2GD4B 3ZZBA 4XOJA 4CRGA 2ZI2H 2Z9IA 3MNSA 1AQ7A 2FEQH 1RJXB 3SQEE 4OGXA 2GT7A 4MNVA 1C5PA 2TGAA 1SVPA 4MDSA 1Y3WA 4XBCA 4ZHLU 3PV2A 2BQ7B 1H8HD 3C1KA 1ZOMA 4UFFH 3BEFB 1FV9A 2W7SA 3SU5A 2PSYA 2BTCE 4H42U 3AASA 2Y5FA 5F6MA 3A8AA 1V2UT 3RXRA 3TPIZ 4BAHB 1HB0B 2R9PA 2OC8A 1EPTA 2GKVE 1SQAA 3F2GA 1GI9B 4I32A 2VH0A 4DW2U 4I8JA 2CF9H 2FLRH 3GCNA 1Y5UT 5I25A 1MTNC 3DSOA 2ZTXA 1UTOA 4BAQB 2L6OA 1P01A 2ZC9H 2K7XA 1CA0B 5TCAA 1P8VC 1O2VA 4X8UH 2RDEA 1VCWA 1M9UA 5HYOA 1W10U 1TX6A 4JMYA 2HOBA 1S82A 4JK6A 1YC0A 5C94A 1EOLA 1HAGE 4E7NA 1ZSLA 1XUGA 3L33A 5T1VA 4BOHA 4FETA 4NGAH 2DE9A 3SU1A 3HATH 1PQAA 1GBMA 1BBRH 1KY9A 1CVWH 3BTME 1S5SA 3UTUH 4FVDA 4U01A 1C1PA 1CGIE 1EAUA 1SLWB 2EC9H 2PKSB 3AAVA 3SU0A 1QL7A 1AGJA 1EPTB 3K65B 4YLUA 1DICA 1PQ7A 5FPSA 5J4QA 2F4LA 1CA8B 1P2MA 3ZZ7A 2V7QD 1QJ7B 1AB9C 1GHAF 3MHWU 4UEHH 3RXMA 3UR6A 2SGAA 1C9TA 2KM0A 1GJCB 4O03A 2YMSB 1EJNA 2ASUB 3NKKA 3U8OH 1FY3A 2UWLA 2Z3DA 1E34B 1GJ6A 1YM0A 5E8EH 4CH8B 2BDBA 5AVDA 4BXSA 2BD5A 1E0FD 3A7VA 4NWKA 3MQKC 3K2UA 1KLTA 3FP8E 1C1OA 2H2ZA 4AB8A 4BXWA 2OLGA 5L6NH 2CN0H 1J15A 3LGIA 1TPOA 1GVKB 5EXMA 2OXSA 1HBTH 2XXLA 1BTPA 3SZNA 1C1VH 1O3FA 2IN2A 3QGNB 3C27B 1AO5A 1RXPA 2XBXA 3M35A 5C5NA 1A3BH 3UAIC 3VFEA 4FUDA 1THSH 2C8WB 5B6OA 2G55A 5EW2H 1NBMD 1ZGIA 1C1UH 1O3IA 2ODYB 3SJKA 4E06H 2QXIA 2P16A 3IITA 2Z9JA 9LPRA 1O3AA 4WJG2 2JH0D 4H6TA 4ASUD 2Y6TA 1GHWH 3Q00A 2P94A 3ZVCA 1WDIA 1LQDB 4JK5A 2V3MA 1H9HE 1FNIA 5EXNA 3F0PA 1GBCA 1NFYA 1YPMH 4ABAA 3RLYH 5LPRA 2EI8A 1CGHA 3RM2H 2UWOA 2ZU1A 1DLEA 1O2OA 3EGKH 3N7EA 5DGJA 1GCTB 7ESTE 3S9BA 4Q4LA 3RUOA 1BBRE 1C2LA 1YWUA 2BQWB 3P6ZB 3PO1B 5FX6A 3ESTA 1GCDA 1Z6EA 3T2NA 2W6JD 1PPZA 4PROA 4XDEA 5K7RA 2TGDA 3SU6A 2V35A 1IQJA 2AFQB 3O8DA 1D6RA 4YOJA 1Z7KA 2KCOA 3OSYA 3U1IB 3A80A 4BAMB 3IWMA 5I46H 1O2LA 3DA9B 3M5OA 4MPWA 2J2UA 2BDHA 1SGNE 4U2WA 1YF4A 1O36A 3FP7E 1QRWA 1QTFA 2HVXA 1Y3XA 1V2NT 1O2WA 1O5EH 3KHVA 3TU7H 2F3CE 3GDSA 1A1RA 2ZO3H 1S0RA 3U98H 1O3NA 1C2FA 5DJ7A 3TLOA 3SN8A 1SSXA 2B0FA 4Q63A 1ZTJA 3UQVA 3S7HB 5E0JA 2BQ6B 2NU3E 3T25A 4AYVB 1O2JA 1Z8IB 3U9AH 1NBME 1K21H 1HAOH 1XX9A 4AFSA 4ESTE 3TH3H 4AYYB 2O8MA 5JYIA 1GHAG 1SKYE 1TA6A 1SGPE 2D1JA 3LGWA 1AY6H 1T4UH 4QT8C 2XCNA 4X8SH 3NWUA 5CMXH 5DG6A 3AAUA 2XBYA 5K0HA 4P02A 4RT0A 1O3EA 3AK5A 1F5KU 1RFNA 4P00A 2JETB 7KMEH 2VIVA 2CK3D 1GBBA 1ZHRA 1SLXB 5C0UA 1MU6B 3SNBA 2AMDA 1Z6JH 4LXBH 1K9OE 1QB6A 1VGCC 3S7KB 3SORA 3P8OA 1MKWH 4ZKSU 5JDUB 3FN8A 2EA3A 1TNLA 4CR9A 1IOEA 2VBCA 1C1MA 3P92A 3T5FH 1NRQH 3UWJH 4B71A 1QURH 3SGAE 4NA9H 2PWXA 3OU0A 1V2TT 1QQUA 3M3VA 2BZ6H 4I86A 1S6FA 1XVMA 1OS8A 3QWCH 3GCTG 4JZFH 4ABDA 1HIAA 1NRRH 4ZHAA 5DP6A 2A0QB 1FN6A 2QF5A 1ACBE 2QV1A 5JB8S 4HI3A 1CHGA 4ABHA 1DOJA 1F2SE 2YMSD 1GJAB 1YPGH 2VJ1A 1G36A 1A61H 2EQNA 4TT3D 5A0BA 1O2HA 2P3FH 1V2KT 3O8RA 2G81E 5L2YH 2ZIQH 2WPLS 2XNIA 3QK1A 1PQ5A 4TPYA 3SUEA 2ZQ2A 1TB6H 4JCNA 5C1YA 1ELFA 1XUKA 2AH4X 1EX3A 4ZMAH 1K1PA 2IOTA 2OK5A 5AFYH 2OC1A 4WVPE 1HNEE 2A7JA 2PR3A 5HM2A 3LDXH 3U8TH 3ZVBA 1GJ7B 1TRYA 5C20A 2P93A 1INCA 1NU9A 5F03A 1HIAB 4YO9A 2XYAA 4X6PA 2EI7A 2FDAA 3SJIA 2P8OB 1UVTH 2PLXA 5FPYA 1XXDA 3L6PA 2ZCLP 1F5LA 1GMHG 1RTFB 3PLKA 2ZFTA 4GAWA 1EZQA 1AI8H 1P2JA 3A87A 1TNGA 4FU8A 4NG9H 1RTLA 2J94A 1OXGA 4OS4A 4BANB 1OWHA 2HGTH 3GY2A 3UQOA 2A4OA 8LPRA 4OS1A 1O2YA 5EW1H 3MNXA 2P59A 1G3BA 5FCKA 4NIVA 1GJ5H 2STBE 3F1SB 2A5AA 1BMFD 2XWBI 2FIRH 5CE1A 4Z6AH 2A2XH 1XVOA 1SC8U 1ORFA 1CA0C 3V7TA 4A1XA 3STIA 1ARCA 1QNJA 2PW8H 3MH7A 3ZZAA 2BY8X 1PPHE 1JRTA 5L30H 3SZEA 5EPYA 2SGQE 2ZA5A 5F8XA 3OAAD 2ZHEH 3QN7A 2F9PA 4FU9A 1DWDH 3RXCA 5EGMA 2VWNA 3KL6A 4CHAB 1AFQB 3LH1A 3Q77A 5DO4H 1GI4A 3ZV8A 3F9FA 2VWMA 3E1XB 2PKSC 3OY5U 3SI4H 3RXDA 3SYJA 1SPJA 1K1MA 3T26A 1MCTA 1TQ0B 1DUEA 1GL0E 2FOHA 3A85A 2FOFA 1DE7H 2C93B 2BD4A 1LHFH 1TPPA 1OOKB 1KXBA 2K0QA 5GJ4B 3BTEE 2ZHDA 2A5KA 1TPSA 2FOEA 2NU1E 4FUCA 4Q7YA 1SLUB 1OWJA 1P10A 2FPZA 1MQ5A 3H7TA 1WV7H 3V13A 3SNAA 5HM9A 1UCYH 1ZMJA 1HXEH 1W7GH 5JBAS 2BD7A 1O3JA 1GBFA 1BTUA 4H6SB 4AORA 1KXCA 4FVBA 1EZXC 3TK6A 3MWIU 2PTNA 4R0IA 3OYPA 1L1JA 2Y80A 2ZTZA 5KEDA 1F0RA 1HAHH 3EA7A 2ZHQH 1S85A 4AB9A 1C5VA 3GY8A 5FPTA 2WPJS 3SV9A 3ZZ9A 4HFPB 3VXEH 3RMMH 5GIBA 2H5CA 4H4FA 1XUFA 3UNRA 4A1TA 2AHME 5T6GA 1GBLA 1QL9A 4MPUA 4K60A 1UVSH 1MH0A 4DGJA 4WY3A 3ZYDA 1OWDA 4GSOA 2JIZD 4F4OC 2GMTB 1LVMA 3M7UA 1PQ8A 2YNAA 1SGCA 1O2SA 4WMEA 3E16B 4Y8ZA 1JIMA 1O3KA 3BTFE 1BOQA 1V6DA 4NA7A 2F9UA 2Y82A 1V2PT 1XM1A 3RXUA 2PP6A 4Y10E 5HMAA 1GCTC 3W94A 3EDXB 1K22H 1OP8A 2GVFA 3F2FA 2R0KA 1LVOA 1MAYA 3GICB 3A7XA 2ZGHA 2A2QH 3QDZB 2GP9B 1DY8A 2CMYA 1QIXB 2FTMA 4RI0A 5E2OA 3K9XB 1ZR0A 5L2ZH 2PV9B 1BHXF 4FU7A 2XC5A 3ITIA 1S6LA 3VB4A 4GLYA 4JZEH 1A5HA 4O3TA 1K1LA 4CRBA 1YPEH 2UWPA 3A86A 2KCPA 1N8OC 3QO6A 2R2MB 1OWIA 3RLWH 1GJDB 4ZCNA 1UCYE 2XOKD 5F8TA 4YT7H 1KLIH 1G37A 1KXEA 1WCZA 3GYLB 1YPKH 3SNEA 1LPGB 1MTWA 5LPEA 3TGKE 1TRMA 1W0KD 1GI0A 4Y0YE 3K6ZA 2BZAA 1Y3VA 1HAVA 1MTVA 1ZRBA 3JZ2B 3WWFA 3U8RH 5FAHA 2BD3A 1FAXA 2W26A 3E90B 4Q7ZA 1DSTA 4GCHF 2O9QA 2THFB 4DY7B 1O33A 1O3LA 3TNSA 1PJPA 5EJLA 2R0LA 2FOBA 1HJ9A 1GHZA 1OSSA 4CBNA 2SGPE 1SGQE 1QBVH 1C1QA 3I78A 1BMNH 3RXIA 2BD9A 2VIPA 3TJUA 4WMDA 3SU3A 1ANBA 3QTVH 1O5CB 2JETC 5AF9H 1F0SA 2Z7FE 3P95A 7LPRA 1ARBA 1TNIA 4A6LA 2ODQA 3MNCA 4X2YA 2VIWA 1XUJA 2NU4E 4ZROA 1AE5A 2OP9A 1DLKB 1K1JA 2J9NA 2ZDAH 2K8IA 4Y6DA 1NC6A 3EYDA 3NXPA 1FXYA 1BQYA 1Z8GA 5JBCS 3AW0A 1HAVB 1BRCE 2FLBH 1NRNH 4RSPA 4KP0A 1S0QA 4X1SU 2QE7D 4BTIB 5B6LA 3VEQB 1ETRH 2XC0A 3GY7A 1UK4A 1FONA 2OQUA 4FUEA 2GGVB 1G2LA 2A5IA 3PRBA 1TA2A 3Q3KA 3SO3A 2VH6A 4IMQA 3W1EA 2BXTH 2W7UA 1O3MA 1ZJKA 2CGAA 3BTTE 2W5EA 4UDWH 1K1OA 1J9CH 2AERH 3F9EA 3UPEA 2VGCB 4WF8A 1XXFA 1TGNA 2J5UA 3HGNA 2G5VA 5EQSA 2AMPA 5EU8A 4DG4A 2VU8E 1UK3A 3SNCA 1ELBA 3ZVGA 1OWEA 4ZKNU 1SOTA 1L1NA 1QFKH 2UUFB 2VWLA 1PPGE 1CBWC 1P2IA 2FS8A 1SGEE 1KTTB 2P3TB 2Y5GA 3M7TA 2WV4A 4A1VA 3LJOA 5C1XA 1AUJA 2VIDA 4O3UA 1D3PB 1LVBA 3E3TA 5HIYA 3M5NA 3MTYA 3HGPA 1ZSKA 1BUIA 1BRUP 5GCHF 2F43B 1Z8JB 2J34A 2P8OC 3MU5A 1BJVA 2M5TA 3GCHB 2ZU5A 4ISNA 1TX7A 3K6YA 1EOJA 2D2DA 2PTCE 4FUGA 2ZNKH 4J1YA 2GX4A 1ZHPA 3F0OA 3ZZ6A 1BTWA 3ZZCA 2Y5HA 2VVCA 5C3NA 2R2WU 1QJ6B 1J8AA 1W14U 1H9IE 1YP9A 2H9TH 4DT4A 1FPCH 1TIOA 2JDID 5DPAA 3SQHE 2J98A 1KIGH 4ABFA 3OY6U 3H09A 2LPRA 4D7FA 2SGEE 1V2QT 1V2RT 1O2IA 3KYGA 5DP7A 5A0CA 2QXHA 3LU9B 5FHTA 1SGIB 2VIQA 3TIUA 1HRTH 1A7SA 3P70B 1MMJN 2F9BH 1UK2A 1H9LB 1UVUH 3DUXH 2Q6GA 2BYAX 5DP8A 4WXVA 3N7DA 3BN9A 4KTSA 1BA8B 5HXFA 4VGCC 2ZF0H 2ZFSA 1SGRE 4ZXYH 1GGDB 1AFQC 4Y8YA 2GCTB 3LKWA 1C2KA 1C4U2 1DUAA 3GYMA 4Y8XA 1E36B 1GHXH 3ZZ8A 2GDDA 1H8ED 1C5NH 1NROH 2BVRH 1J14A 1H8IH 2BLQA 2IPQX 2SGFE 1TQ7B 3NZIA 1C5XB 1GDQA 4K2YA 3KQ5A 3ZVFA 1GI6A 2V6NA 4ABEA 3BTWE 1TAWA 4K1EA 4WH6A 2A31A 8GCHF 4X1RU 3FVFB 4XBDA 1D3QB 5A8XA 2ZWLH 4HTCH 1DANH 6CHAB 4TWWA 2WZQA 1DSUA 3KF2A 3LGVA 1ZSJA 3SOSA 1FPHH 1DY9A 4E05H 1O2PA 1TPAE 3QLPH 3EA8A 5G4BA 2P95A 4D76A 2M2AA 2ZP0H 1TFXA 1C5UA 1UTJA 1C1RA 1GL1A 3SJOA 4NFEA 5H4IB 3T29A 4IC6A 1KLJH 1GI2A 2UUYA 1IHSH 1NN6A 4RT1A 1HJAC 2F9OA 4O9VA 3EE0B 3RXBA 2VB0A 1ABIH 2QXGA 1V2JT 2KR7A 5JPMH 1P11E 2ANWA 1UVPA 3E8LA 1ELDE 1TNJA 2FX6A 3ATIA 1A5GH 1OYQA 1EATA 1O2XA 2GZ9A 1EP5A 4Y7BA 2GV6A 2JKHA 1BBRK 1NFUA 1P3CA 2GMTC 3HKJB 3NRLA 1AD8H 2HLDD 4IGDA 2G51A 1OPHB 1F92A 1ABJH 1HAYB 2A1DB 3B9FH 2HPQH 1V3XA 4LOYH 1ZPBA 1Z1JA 3MH4A 3M37A 1V2ST 4IMZA 1BTZA 2CHAB 2FP7B 1K28D 1L4ZA 4CRFA 1H4WA 3TK5A 3KQCA 3GISB 1GI1A 2AYWA 1YPLH 1MZDA 2PUXB 1SOZA 4NFFA 4TPIZ 2XC4A 1W3CA 1AMHA 1UVOA 3UREA 1F5RA 2ZHWH 1PPBH 1L4DA 4NIYA 3BEUA 1SGFG 2G4TA 2F9NA 3RXHA 5DK1A 1OX1A 9ESTA 4B76A 6GCHF 1A3EH 1OKXA 3ZVAA 4YTAA 1QRXA 3T62A 3A8DA 3GY4A 1VZQH 1O34A 2AGEX 1IQLA 3Q76A 2ZGBH 5JBBS 5C5OA 4K5ZA 2G4UA 1C5SA 2HVYB 1GHBF 3FZZA 2CXVA 1TGTA 2QN5T 1Y3UA 1HJ8A 4X8VH 1A4WH 5C2ZA 7GCHF 1GG6C 2J4IA 2W3IA 2W6ID 4ISIH 3SHAH 4TWYA 2AGIX 2PGQB 4I7YH 5A2MH 2YOLA 4K8YA 1FZZA 1YYY1 4TSFD 3M3TA 1THRH 2KX4A 1SI5H 1SR5C 4Y76A 1V2MT 3M5MA 1P06A 4I33A 3URDA 3UOPA 1ZJDA 3MYWA 3SUFA 1HAIH 3OX7U 1HAZB 1WQVH 2TRMA 2R3UA 4LZ4B 1LPZB 5EQQA 4M7GA 4X6OA 4I8HA 1SGYE 3LOXA 2QC2A 1BTXA 3ZZ5A 1AE8H 4Y79A 2JH6D 5CHAB 3MU1A 2FM2A 4I8LA 3OEHD 3CS0A 3ODFA 1TMUH 5HKKD 1A46H 1RRKA 1QQ4A 3BSQA 3HPTB 4FOUC 1QB1A 4UFEH 1WTHD 4X6NA 5GNDA 3UIRA 1N6XA 4X0WU 4FXGH 4Y11E 1BDAA 1TWXB 2OUAA 3MH6A 4TYDA 1V2WT 1FMGA 1KXAA 1VJAU 2ZFPH 4DT7B 1DXPA 1OHHD 1UTNA 5E2PA 3SUGA 4FUJA 1B7XB 3ZV9A 1IQFA 2FMJA 3B8JA 3RXQA 3VXFH 1L0ZA 1YLCA 2STAE 1SQRA 1A0HB 1KYNA 1BMLA 1T7CA 4AFQA 3DFLA 1O32A 2TGTA 1MUEB 3M5LA 2VGCC 3SGQE 4ACBA 3MFJA 3PYHA 2JJ1D 3VPKA 1DVAH 1YGCH 1Q31A 4TY6A 2WPDD 2GZ7A 1Q2WA 3DHKH 4Q2KA 1VCQA 6LPRA 1TRNA 2BX4A 1OP2A 5C0TA 1BMAA 1GI3A 2WPMS 1EJMA 1XKBC 3OFND 3VB3A 1P05A 1EP6A 2RDLA 1T31A 3PM3A 3RXVA 3SV7A 1C5QA 1VKYA 3CENA 1CHOF 1GMCF 1S6HA 5FXLA 4LZ1H 1AVGH 4NIXA 2V3HH 4MLFB 1GBTA 1ZPZA 1G3CA 2BLWA 1P9SA 4AGJA 3D49H 1Y3YA 4B1TA 3PRDA 5DP3A 1IQIA 1HCGA 1EAXA 6GCHG 3GCHC 2LNCA 1LMWB 3MMGA 1THPB 1E1RD 1C9PA 6ESTA 4AN7A 2KCYA 1MBQA 3BTKE 1SHYA 2QIQA 2H5DA 5CHBA 1MD7A 1A5IA 1GVLA 3BTGE 2WV9A 1ZHMA 1DDJA 4GHQA 1SG8B 4INLA 2V3OH 3SUDA 1F0TA 1YKTA 1UTKA 3TJOA 1WTGH 1BB0B 2WUCA 2VNTA 1EPTC 1ZGVA 3MNBA 4NZLA 4B2CA 1ZLRA 3QTOH 2QGRA 3O8CA 1W11U 2FYRA 1VITF 1C5RA 2RA3A 2YMSC 4YOIA 1LHGH 4I8GA 1C5OH 1ZYOA 2O8UA 4JYVH 2B5TB 1HUTH 3VB5A 1NM6A 1JXPA 2O8TA 1GBAA 5KGOA 4SGBE 3RMLH 3RC4A 4BAKB 3BTQE 3VGCB 4DOQA 1O35A 4XD7D 3QGJA 1QRZA 1IHTH 5E0HA 1RD3B 2TIOA 1K2I1 1V2LT 1TMBH 1BRBE 1ZMNA 1BIOA 1KXDA 1MCVA 1P57B 3A7WA 3MO9A 1LPKB 2OC7A 1MKXH 3PMBB 5EQRA 4WWYA 3ODDA 1C5WB 3TJNA 3P8NA 1VR1H 1QHRB 3RC6A 1PPCE 1C2EA 1BTYA 2QF0A 4AOQA 2O8WA 5ESBA 1AVWA 1CT0E 1XMNB 6CHAC 3JZ1B 1T8OA 2BLVA 4JYTA 1TLDA 1Y5AT 2BLOA 3MO3A 4IW4E 1CSOE 1O3DA 1GBIA 2Z3EA 1VCPA 1LKAA 4WMFA 4ZHMU 1TNHA 1P3EA 2FODA 3PV5A 4Y0ZE 4THNH 4FUFA 4SGAE 5SGAE 4Q7XA 2OBOA 3SI3H 1ELGA 2GTBA 2EI6A 3TH4H 2BY5X 1TONA 1H1BA 1GMDF 5A8ZA 3BEIB 1P2NA 4RKJB 5F53A 4OS6A 5FBIA 1ANDA 1NFWA 1O39A 3RU4D 4X6MA 1CU1A 4F55A 1D3DB 3PMAB 5T3HA 4AG2A 3UUZA 3ZZDA 2ZECA 3P8GA 1Y5BT 4D7GA 3PO1C 4GVUA 1O37A 1O3PB 1SGTA 1YBWA 1IQMA 4K69A 2A4GA 1GHYH 3UWIA 2KZ4A 4RKOB 1ESBA 2ZHFH 1RIWB 1YCPM 3Q3XA 1D3TB 4NWLA 2VINA 5AHGH 3TGIE 1OWKA 5EPNA 4CBOA 5LH8A 4J2YB 3ZZ4A 1QBNA 3PTBA 4IC5A 2CHAC 2RCEA 1EUFA 1WBGB 4MQAA 2DUCA 5DP5A 4Z0KA 1NFXA 4GPGA 3PV4A 2BDYA 1QCPA 5EXLA 3RXOA 1O2QA 1MQ6A 1UCYK 4CRAA 1GBEA 2GZ8A 5EOKA 1G3EA 4B2AA 1ZTLA 3PWCA 2FZZA 2WPIS 3RU4T 1A2CH 1OYTH 1VITG 4CREA 1HXFH 1W0JD 3KYFA 2HWLB 4Q80A 1XUIA 3DT0H 1AWHB 3FAOA 2BVXH 3PMHB 3F2HA 1HLTH 1MZAA 2VVUA 5GXPA 2ZU2A 4JZDH 2QAAA 3S9AA 1GBHA 3TK9A 3KQEA 1FQ3A 1TE0A 2HALA 3A81A 3RU4E 1WU1A 1RS0A
chains in the Genus database with same CATH topology
1JWTA 2XTTB 3ATLA 1ELTA 1LHEH 1O2KA 1SB1H 2IPHA 1JBUH 3SJ8A 4MPXA 2AS9A 3E0PB 1G2MA 5F8ZA 3N7OA 1SFQB 1QY6A 1G32B 1QJ1B 3B23B 3UR9A 1BZXE 1QL8A 4X2XA 3RDZA 4AX9H 3HK6B 8KME2 5E0GA 4UE7H 1BJUA 1DITH 1O5BB 3GY3A 2HNTE 4DIIH 4NSVA 1BMMH 2NWNA 1VJ9U 3UNQA 2H6MA 1GI5A 3PMJA 2ILNA 4X2WA 2KAIA 3KQDA 1YCPK 3A7ZA 3A82A 3V12A 2BXUH 2WV5A 1W2KH 2OD3B 1LCYA 3MU4A 1C5ZB 2D8WA 2BD2A 3DFJA 5CHAC 3WY8A 3RMNH 1UTMA 4YLQH 3A7TA 2ZPRA 1GHVH 2BM2A 2ALVA 1C4V2 1WSSH 2Y7ZA 1FLEE 3RXKA 2C8ZB 1J16A 1KDQA 2Q6FA 4AGKA 1C1TA 1HFDA 1T8MA 1FI8A 1GWAA 2ZFFH 3MI4A 2HNTC 2BD8A 3KN2A 2PHBA 1KSNA 1ETTH 1S83A 1DWEH 2VIOA 3GCOA 4OGYA 2RA0A 3TJVA 1MU8B 4LK4A 3RP2A 1G3DA 3URCA 3TGJE 2KAIB 1SL3A 2OC0A 2TGPZ 3KCGH 2A4QA 1ZZZA 1QGFA 1FJSA 1GI7B 4UFGH 1GPZA 4ISHH 3ATWA 1L1GA 3PB1E 2ZDVH 3F9HA 1AU8A 1D9IA 5EODA 1MD8A 2H9HA 4AZ2B 4I8KA 1TNKA 1AIXH 3D23A 5BRRE 1C4Y2 1KDQB 1UO6A 4B2BA 3VB7A 3MU0A 1W12U 3LPRA 1YPJH 3ELAH 1FDPA 2FTLE 3EA9A 3QZQA 2ZGJA 1PPFE 2ZGXH 2BX3A 2CV3A 4YM9A 3E91A 1WYKA 4GCHG 1FIZA 5C1UA 2PUQH 3SU2A 1K1IA 2XCFA 1IAUA 4UONA 1EKBB 4XSKU 3LIWA 2TBSA 3BV9B 1TABE 1LO6A 4NA8A 4TY7A 1LQEA 1P2OA 1P02A 2WPHS 4HZHA 5ABWA 1OP0A 1DS2E 1ID5H 3EBNA 1C5YB 1J17T 1PYTD 1SGDE 2BMGB 4CHAC 4AFUA 2HPPH 3HK3B 5BPEA 4IBLH 1UTQA 1P09A 3G01A 1BTHH 2AIPA 3GDVA 3ZYEA 3SGBE 2BHGA 2FOCA 2ODPA 4DCDA 1CE5A 2Y81A 1SHHB 2FOMB 1ANEA 4KTCA 2V0BA 3HKIB 1Z8RA 2LIZA 3V3MA 1H8DH 1QB9A 3KIDU 4ABBA 4DJZB 1FIWA 4XE4A 4ABJA 3MH5A 1HAXB 1Y59T 1TGCA 1IQEA 3STJA 3LC3A 1LDTT 3VGCC 2OTVA 5FX5A 1CT2E 1UJ1A 1LKBA 2BOHB 5PTPA 1WOFA 1DXWA 3U1JB 4Y7AA 3ENSB 1C2IA 1X7AC 2C4FH 2ZFQH 2HLCA 3KEEA 1P03A 4A92A 2OCVB 1QA0A 3VB6A 2OBQA 3GCTF 5C67A 1T8NA 2VVVA 1E38B 1NY22 2G00A 3LT3A 4NCYA 3TH2H 4DVAU 2Z94A 2BDAA 1AUTC 1FY4A 2G52A 4ZH8A 5IYTA 1AHTH 3ZVDA 4KGAA 2QA9E 1GVZA 1WUNH 1ELCA 1D6WA 1EB1H 2QYIA 5GCHG 3AVZA 3FFGA 1CGJE 2J92A 2C90B 2ZDNA 3BG8A 1HAPH 1MTSA 1ELVA 1JMOH 1G30B 3PLBA 3SV2H 2Z9GA 5ESTE 1GJ9B 1ZTKA 2WYJA 3ZZ3A 2SFAA 3SU4A 2Q6DA 1LVYA 3A8BA 2GCHF 1O2RA 5ETXA 3D65E 3NCLA 4ZKOU 2ZPQA 1P04A 2WYGA 1TX8A 5T6FA 3S69A 1UHBA 2PSXA 2ANYA 4HGCA 3S0NA 1O3HA 4K1SA 1C2MA 2QY0B 3MO6A 1N1LA 2O8LA 1NPMA 2GV7A 4YZUA 2ZFRH 2ZQ1A 4K8BA 3GY6A 4ZAEA 1C1WH 5DP9A 1RIWC 2A7CA 4K1TA 2FO9A 5GDSH 3RXJA 2BDCA 3A89A 1N8OB 3H5CB 1K1NA 1EJAA 1PYTC 1GMHF 2BVSH 2PGBB 2BOKA 2SGDE 2IJOB 2VWOA 1GDNA 2AIQA 3T28A 3T27A 1DX5M 2BDGA 1C2JA 2BY9X 3UOUA 1W13U 1DFPA 3BTHE 2QCYA 1C2DA 3BG4B 3A83A 4XBBA 2H1UA 1FN8A 3SNDA 1S81A 3BTDE 1DPOA 3F9GA 3P17H 2XRCA 3SV6A 3F68H 4AG1A 1HYLA 1L2EA 3EAJA 1F7ZA 1UHBB 3RC5A 1C2GA 3CP7A 2Z3CA 4ABIA 1YLDA 1YPHE 2F91A 1IQKA 5DP4A 1O30A 3RXPA 4BTTB 1C5TA 1O2NA 2Z9LA 1FUJA 2FESH 1AKSA 8GCHG 3CS7A 3GY5A 2Y7XA 2A7HA 2HRVA 2FXRA 1XKAC 1Y8TA 5GPIB 1HV7A 4ABGA 2FI4E 3BIVH 2FYQA 1MTUA 4BNRA 1BRAA 1P0SH 2WINI 4NZQA 2NU0E 3ATKA 3MOCA 2ESTE 3LC5A 1WAYB 4JYUH 2PFEA 5JBTA 3GOVB 4ISLA 4DIHH 3RXAA 2Q1JA 1FY1A 3DD2H 1YPHC 4IN2A 1IQHA 5LPFA 3M3SA 1EXFA 1HDTH 3GDUA 1NO9H 2PKAA 1A0LA 2C8YB 1O3OA 3SBKA 1C5MD 2QF3A 2FS9A 1C1SA 1AKSB 1O5AB 2Z6BD 4MNWA 2ALPA 4CH2B 1S84A 1ETSH 1F0UA 4B73A 1JIRA 2ZCHP 3A84A 3V0XA 2OQ5A 3PROA 1O2UA 4D9QA 3RXFA 1HPGA 3LGTA 1CBWB 1G9IE 3D62A 3PWBA 1QR3E 2BDIA 1SLVB 2G8TA 1FY5A 1DT2A 1QBOA 4FUIA 2GCHG 3UY9A 4O97A 3SHCH 3RM0H 1JRSA 2C8XB 1MBMA 3A8CA 1KTSB 4X1NU 1W8BH 2F83A 2XBWA 2PKAB 3RXGA 2JH5D 3S9CA 1IQGA 1MTNB 2AGGX 1ZPCA 2FI3E 3OTJE 1TGSZ 3PLPA 1GJ8B 4JZIA 1SMFE 2FWWA 1MKWK 3L3TA 1EQ9A 5FBEA 1TOCB 2ULLA 1P9UA 4Y71A 1GI8B 4RN6A 4WXIA 2RG3A 2WUBA 4WH8A 4YESB 2AEIH 1N6YA 3LJJA 2ZDLA 4U32A 1MAXA 2FOGA 3UFAA 2QXJA 2J95A 1RGQA 3RXSA 1HGTH 4UD9H 4XFQA 2ZPSA 1E37B 1UMAH 5FCRA 1GHBG 1Z1IA 2GT8A 1QA7A 1DWBH 1GBDA 1TOMH 1TBZH 7GCHG 1O3GA 2Z9KA 1PPEE 2ZU3A 1AB9B 1LTOA 3M7QA 4MPVA 2XBVA 1B0EA 2ZDMA 4U30A 4CRDA 2BY6X 2WPKS 4IN1A 2HNTF 1NRSH 3M61U 1FAKH 4VGCB 4ASHA 1XUHA 1UTLM 2EEKA 1AVXA 4X1PU 1O5GH 2CJIA 2FOAA 1GDUA 1GGDC 1D4PB 2UUJB 4KKDA 2GCTC 3NUMA 1EZSC 2XW9A 1ELEE 2A32A 1T32A 5JB9S 1C1NA 3TNTA 1BHXB 3Q3YA 2K1QA 1DM4B 1JOUB 1B0FA 1O3BA 1DWCH 3FZDA 4MVNA 4AFZA 3U69H 1WQSA 1PFXC 5GWZA 3RMOH 1C2HA 1T8LA 2XWAA 1BCUH 1EB2A 1IQNA 2F9VA 4ISOA 1RTKA 1AZZA 3W95A 1P12E 1TYNA 5TCCA 1EASA 3RXTA 5J4SA 1P2KA 3TVJB 1ZMLA 4B75A 2R3YA 1CT4E 2BB4A 1NS3A 5AFZH 3PTNA 1V2VT 4DURA 1BT7A 4ZXXH 4E7RG 2CF8H 1TBRH 3A7YA 2W3KA 1HJAB 4X1QU 2ZCKP 1W7XH 3MU8A 1GJ4H 1AWFH 1P2QA 3NPSA 3QZRA 4OS7A 1V2OT 4B74A 3NK8A 3A88A 1AZ8A 1NESE 3R0FA 2ZEBA 3LH3A 1NRPH 3FANA 1TALA 8ESTE 4OS2A 4A5TS 1CO7E 1SBWA 4CRCA 1TGBA 1U6QA 1CHOG 1SFIA 1GMCG 1AFEH 1O5FH 4ZUHA 1ESAA 1UTPA 3EQ0H 2ZG0H 1O0DH 3QUMP 4CR5A 3P8FA 4NSYA 4OS5A 1VITH 2FI5E 2G5NA 4X2VA 1Q3XA 1FY8E 2ANMH 4IS5A 1YCPH 4GHTA 3KGPA 1LHCH 4MG3A 3BIUH 3TITA 1O2TA 4F49A 1GBJA 1KXFA 1E35B 2C3SA 3IG6B 2YNBA 3SV8A 1O2MA 1NZQH 2H9EH 4I31A 4D8NA 2A4RA 4K3JA 4BTUB 2SNWA 3LGYA 1TBQH 4UFDH 3I77A 1LHDH 3LGUA 3FP6E 4YOGA 4A7IB 1Z71A 2TPIZ 1SQOA 1NTPA 4R8TB 2GDEH 4BAOB 1MKXK 1W0ZU 4INHA 5IDKA 2ZZUH 3UNSA 4KTUA 4D9RA 1ANCA 1W0YH 1NT1A 3BG4C 3F6UH 4INKA 1VGCB 1O5DH 1GG6B 2ZU4A 2UUKB 2FX4A 4FUHA 4KELA 3RXEA 3ZVEA 5A09A 3E0NB 1SGFA 1B5GH 1C5LH 2ZKSA 2ZTYA 2I6SA 5T6DA 5HGGA 3ATMA 2ZGCA 2B9LA 4YT6H 1O3CA 4GUXA 1ELAA 1GJBB 5DKMA 4ZKRU 4JZ1A 5A0AE 5A8YA 2P3UB 3KQBA 3LONA 3SW2B 1SQTA 2D26C 1NU7B 3E6PH 5EG4A 1ESTA 1EAWA 1O38A 1AN1E 4MTBA 5LGOA 3BF6H 1TMTH 2J38A 4MNXA 2B8OH 3AW1A 2A45B 4FUBA 1BITA 1ZRKA 2SNVA 1EZUC 2NU2E 1A0JA 4X8TH 2ZDKA 3KNXA 1O2GH 2ANKH 4NIWA 3SJ9A 4MNYA 2BY7X 3M36A 2B7DH 3QX5H 3R3GB 3O8BA 2DE8A 2AMQA 2OINA 1GMDG 1O2ZA 3RXLA 1EAIA 3H7OA 3I29A 1T4VH 2I6QA 5TJXA 1O31A 1GBKA 1CQQA 2GD4B 3ZZBA 4XOJA 4CRGA 2ZI2H 2Z9IA 3MNSA 1AQ7A 2FEQH 1RJXB 3SQEE 4OGXA 2GT7A 4MNVA 1C5PA 2TGAA 1SVPA 4MDSA 1Y3WA 4XBCA 4ZHLU 2BQ7B 3C1KA 1ZOMA 4UFFH 3BEFB 1FV9A 2W7SA 3SU5A 2PSYA 2BTCE 4H42U 3AASA 2Y5FA 5F6MA 3A8AA 1V2UT 3RXRA 3TPIZ 4BAHB 1HB0B 2R9PA 2OC8A 1EPTA 2GKVE 1SQAA 4I32A 1GI9B 2VH0A 4DW2U 4I8JA 2CF9H 2FLRH 3GCNA 1Y5UT 5I25A 1MTNC 2ZTXA 1UTOA 4BAQB 1P01A 2ZC9H 2K7XA 1CA0B 5TCAA 1P8VC 1O2VA 4X8UH 1VCWA 1M9UA 5HYOA 1W10U 1TX6A 4JMYA 2HOBA 1S82A 4JK6A 1YC0A 1EOLA 1HAGE 4E7NA 1ZSLA 1XUGA 3L33A 4BOHA 4NGAH 2DE9A 3SU1A 3HATH 1PQAA 1GBMA 1BBRH 1KY9A 1CVWH 3BTME 1S5SA 3UTUH 4FVDA 4U01A 1C1PA 1CGIE 1EAUA 1SLWB 2EC9H 2PKSB 3AAVA 3SU0A 1QL7A 1AGJA 1EPTB 3K65B 4YLUA 1DICA 1PQ7A 5FPSA 5J4QA 1CA8B 1P2MA 3ZZ7A 1QJ7B 1AB9C 1GHAF 3MHWU 4UEHH 3RXMA 3UR6A 2SGAA 1C9TA 1GJCB 4O03A 1EJNA 2ASUB 3NKKA 3U8OH 1FY3A 2UWLA 2Z3DA 1E34B 1GJ6A 1YM0A 5E8EH 4CH8B 2BDBA 5AVDA 4BXSA 2BD5A 1E0FD 3A7VA 4NWKA 3K2UA 1KLTA 3FP8E 1C1OA 2H2ZA 4AB8A 4BXWA 2OLGA 5L6NH 2CN0H 1J15A 3LGIA 1TPOA 1GVKB 5EXMA 2OXSA 1HBTH 2XXLA 1BTPA 3SZNA 1C1VH 1O3FA 2IN2A 3QGNB 3C27B 1AO5A 1RXPA 2XBXA 3M35A 5C5NA 1A3BH 3VFEA 4FUDA 1THSH 2C8WB 5B6OA 2G55A 5EW2H 1ZGIA 1C1UH 1O3IA 2ODYB 3SJKA 4E06H 2QXIA 2P16A 3IITA 2Z9JA 9LPRA 1O3AA 4WJG2 2JH0D 4H6TA 2Y6TA 1GHWH 3Q00A 2P94A 3ZVCA 1LQDB 4JK5A 1H9HE 1FNIA 5EXNA 1GBCA 1NFYA 1YPMH 4ABAA 3RLYH 5LPRA 2EI8A 1CGHA 3RM2H 2UWOA 2ZU1A 1DLEA 1O2OA 3EGKH 5DGJA 1GCTB 7ESTE 3S9BA 3RUOA 1BBRE 1C2LA 2BQWB 3P6ZB 3PO1B 5FX6A 3ESTA 1GCDA 1Z6EA 3T2NA 1PPZA 4PROA 4XDEA 5K7RA 2TGDA 3SU6A 2V35A 1IQJA 2AFQB 3O8DA 1D6RA 4YOJA 1Z7KA 3U1IB 3OSYA 3A80A 4BAMB 3IWMA 5I46H 1O2LA 3DA9B 3M5OA 4MPWA 2J2UA 2BDHA 1SGNE 4U2WA 1YF4A 1O36A 3FP7E 1QRWA 1QTFA 2HVXA 1Y3XA 1V2NT 1O2WA 1O5EH 3KHVA 3TU7H 2F3CE 3GDSA 1A1RA 2ZO3H 1S0RA 3U98H 1O3NA 1C2FA 5DJ7A 3TLOA 3SN8A 1SSXA 2B0FA 1ZTJA 3UQVA 3S7HB 5E0JA 2BQ6B 2NU3E 3T25A 4AYVB 1O2JA 1Z8IB 3U9AH 1K21H 1HAOH 1XX9A 4AFSA 4ESTE 3TH3H 4AYYB 2O8MA 5JYIA 1GHAG 1TA6A 1SGPE 2D1JA 3LGWA 1AY6H 1T4UH 4QT8C 2XCNA 4X8SH 3NWUA 5CMXH 5DG6A 3AAUA 2XBYA 5K0HA 1O3EA 1F5KU 1RFNA 2JETB 7KMEH 2VIVA 1GBBA 1ZHRA 1SLXB 1MU6B 3SNBA 2AMDA 1Z6JH 4LXBH 1K9OE 1QB6A 1VGCC 3S7KB 3SORA 3P8OA 1MKWH 4ZKSU 5JDUB 2EA3A 1TNLA 4CR9A 1IOEA 1C1MA 3P92A 3T5FH