4AFSA

Human chymase - fynomer complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
226
structure length
226
Chain Sequence
b'IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 54
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afsA02
4H6SB 2A4OA 1SGIB 3T29A 3T25A 3MI4A 3ZVGA 1LQDB 1GHVH 1LVYA 3MNXA 5E0JA 3KQDA 3DUXH 2OD3B 1TABE 1G32B 4FVDA 4JMYA 2EI6A 1P01A 4IMQA 3UIRA 3LGVA 4X1NU 1Z7KA 1IQNA 1XVMA 5A09A 5T6DA 3K6YA 4LZ4B 1O33A 4XBCA 3GICB 2GD4B 5JB8S 1TQ7B 2BQ7B 3SJOA 3MH6A 4B2CA 4ZXXH 1PPGE 1SLXB 1Z1IA 4MTBA 1C1UH 6CHAC 1UMAH 2J95A 1EATA 3DHKH 3VXEH 3SUEA 2FI3E 2SGQE 5L2ZH 1BA8B 2PSYA 1S0RA 4GCHF 2ZKSA 2DUCA 2HNTC 4DG4A 3PROA 1IQFA 1VR1H 5EPNA 1MKWH 1EOLA 2FLBH 4NIVA 1C9TA 3P8GA 3BTWE 4ISOA 3UTUH 1GBBA 2OC1A 3RC4A 2CHAC 2H2ZA 1FAXA 1EAXA 2Z9KA 3D23A 4O3UA 1D3TB 3TJOA 7LPRA 4JZEH 3R3GB 1DWEH 1J14A 2ZO3H 4XFQA 1V2JT 2SGFE 1CHOF 1YBWA 3NPSA 4UD9H 1DLKB 3OY6U 2HNTE 1BRCE 4IMZA 1O5DH 3PMAB 5ABWA 2FOHA 2OQ5A 1ZRKA 1IQGA 1GBKA 1KTTB 1FY1A 3O8RA 1FUJA 4AB8A 2VVUA 4CREA 3A85A 2G8TA 5FX6A 3SQEE 4Y71A 1FONA 3Q3XA 3F9EA 3BEIB 1GJDB 1TB6H 4FUEA 4Y0ZE 1RIWC 3V13A 2G4UA 1K1OA 2RA0A 1B0EA 1C1VH 1L1JA 2VGCC 2JH6D 3HKIB 2FM2A 4B76A 2FTMA 3GDVA 1MTWA 2PV9B 1C2DA 3GDSA 1WSSH 1XXDA 2FMJA 1HV7A 3PMHB 1C9PA 3PMJA 1AQ7A 5TCAA 1LPKB 4JZFH 1TE0A 3TITA 5SGAE 3LONA 1YPLH 1ABJH 1UTMA 3A86A 1LVOA 1HIAB 1CQQA 3ITIA 4FVBA 2WUCA 1J8AA 4K69A 1FN8A 1ZMJA 5DP3A 3ZZ7A 3BTFE 1QL8A 2A7HA 1AMHA 5GCHG 2HALA 1KXBA 1KXAA 3PO1C 1N6XA 2FI5E 4X1PU 1LO6A 3LH3A 1TOMH 3RXAA 2HPQH 2QN5T 4XOJA 2J2UA 3TVJB 1BB0B 2FX6A 1Z6EA 1UK4A 1SGFG 3N7OA 1DT2A 1SGFA 1A46H 1P11E 1YYY1 3LGYA 4YTAA 2A45B 8KME2 3KF2A 1O3JA 1W3CA 2Y80A 3E0NB 1GMHG 1TPSA 1W2KH 3ZVEA 1EOJA 2OC0A 1Z1JA 3A88A 1O2TA 5GXPA 4UFEH 4ESTE 3PO1B 1UTKA 4IN2A 4JZ1A 4ABEA 3M36A 1NESE 1TBRH 2H9EH 2ZDKA 2ZFSA 3A8DA 1TFXA 2WUBA 2AYWA 2VIOA 1SGNE 2NU0E 4UFGH 1MTVA 3SOSA 3QZRA 1SG8B 6GCHF 1XUFA 1C2EA 2ANKH 3BTHE 2TRMA 5G4BA 1ORFA 3VGCC 5GPIB 4MNVA 1LHDH 1V6DA 2Y5FA 1Y3YA 1DOJA 2Z9GA 2VH0A 2ZWLH 4AFZA 2ZTYA 3OU0A 1C2IA 1ZHRA 4ZXYH 1DXPA 1NY22 1O2KA 5CHAB 1P2JA 1O3BA 4WJG2 1C1OA 1MD8A 1C2JA 1BCUH 3CS7A 5EPYA 3S7HB 2TIOA 4CRBA 1E35B 3B8JA 1AZ8A 3ESTA 3P95A 1SLWB 1P04A 3MH5A 3E3TA 1C5NH 1THRH 1T8LA 3RXIA 3RU4T 1SBWA 3MTYA 2GCHG 1BTYA 1O2WA 1INCA 1Y3VA 1O3HA 1MD7A 1GHYH 2R3YA 1TQ0B 1QNJA 3LT3A 4ABHA 3PYHA 1K1NA 3E16B 1PQ8A 1SGYE 1ESTA 1CGHA 1LPGB 2ALVA 1HYLA 1BDAA 3MH4A 1MKXH 4A7IB 1DY9A 4NFEA 1Z8RA 3QGNB 3HATH 4INKA 1BRAA 3TJNA 1DSTA 3ZVBA 3O8DA 1O39A 3FVFB 1O36A 1W11U 4OS6A 5A0BA 4ABAA 3EE0B 2ZU2A 4D9QA 1C1WH 4SGBE 1AHTH 2A0QB 1F7ZA 2Z3DA 1UCYE 4B75A 1YPHE 3UOUA 1DWCH 1TGSZ 1Q31A 4AGJA 1AN1E 3LDXH 4K1EA 1P8VC 2BXTH 2AEIH 1TALA 2R3UA 1EZSC 3V0XA 1SB1H 1GDUA 1IQKA 3MNSA 1A5GH 1FY8E 2VVVA 1LDTT 1W7GH 1C5OH 1PJPA 1QRXA 5EODA 1TPPA 1NFWA 5E2OA 1AVGH 1C1PA 2ZC9H 1C2MA 2ZF0H 2ZFFH 2G81E 1ARBA 1C5RA 1GMCG 2ZPSA 5C5OA 3EQ0H 1L4DA 2RA3A 1ZHMA 2ZP0H 1GMDF 4JK5A 1O3FA 4I31A 2GMTC 3SU0A 1UTPA 1FQ3A 1O5CB 1EXFA 1XVOA 2WPIS 1BTZA 2EI7A 1GJAB 3CP7A 3GY2A 1JMOH 1N8OC 1IQEA 5EW2H 4Y8YA 2OCVB 4YZUA 2ZFRH 3M61U 1AE8H 3EGKH 2FOAA 2P16A 2W26A 1C2FA 1MAYA 2B9LA 2VIWA 3UY9A 1HPGA 3DD2H 4ABDA 1XKAC 5EQQA 2UWPA 2XYAA 3NCLA 1QJ1B 2G55A 2W3KA 4RN6A 4FUDA 2AS9A 3RXMA 1H9HE 3GISB 3U8RH 1F92A 4ZKNU 3PLBA 1KY9A 2QF0A 1X7AC 2GMTB 1VJAU 2GCTB 1TRNA 1GHWH 1NO9H 3STJA 1N8OB 1CU1A 5IYTA 4GVUA 1A3BH 3DFJA 3SUDA 1O35A 1FY4A 2J38A 1E0FD 1P2NA 3RC5A 1QHRB 4X1SU 5T3HA 4Z0KA 2B7DH 3TGKE 2BZAA 1HNEE 5EQSA 1EJAA 3D65E 1ELFA 4TY7A 1NRRH 3LC5A 4X2VA 1CBWB 1L1NA 3W95A 1S84A 1C2KA 2GZ7A 4KP0A 2BDIA 2FOCA 3SO3A 1GBEA 1FMGA 1F5RA 4XBDA 5JDUB 1CT4E 5B6OA 3E6PH 3PTBA 1GG6C 1VGCC 3MO3A 2BD4A 1O3GA 3RXVA 1ZMLA 3TJUA 1GBDA 4X2XA 2WPKS 1KTSB 4MNXA 1TLDA 4Z6AH 3FP6E 3V3MA 5DP9A 1EKBB 4AG2A 2VJ1A 1C4Y2 1O3MA 1LVBA 5ESBA 3WY8A 4UFFH 1HDTH 5FBEA 7GCHF 1GG6B 1GDNA 2C8ZB 2ODYB 2YNBA 5F03A 2J94A 1W13U 2FO9A 3O8BA 3LPRA 1VITH 1Z8GA 1A2CH 2ZHWH 1V2OT 3BEFB 1C5VA 1OPHB 2BVRH 1OXGA 1EAUA 4FUJA 2B5TB 3VPKA 1SSXA 3ATWA 5FBIA 3P8OA 1CSOE 2O8UA 4BAMB 4OGYA 1BJVA 4FUGA 2PKSC 3A7ZA 3SU2A 1SC8U 2A7CA 4CH8B 1BMLA 2O8WA 1UTJA 2BD7A 3SJIA 1GHBG 2NWNA 4ABBA 1A0HB 4HFPB 1ZJDA 1YCPH 3TNTA 3V12A 1JRTA 2BY8X 1QGFA 3STIA 2J92A 1TMUH 3ENSB 1DSUA 1RTFB 1RS0A 3BV9B 5BRRE 1TMTH 1AU8A 1FDPA 1O5EH 5FXLA 2JETC 2AMQA 4K1TA 2F83A 1HJ9A 1TA6A 3SJ8A 1OSSA 4FUBA 3S9AA 1CA8B 4FU9A 3QGJA 4DIIH 2PW8H 2O8TA 3LGUA 4GSOA 1YGCH 3RXPA 2ZGBH 3BTDE 5DP8A 2H5CA 5C67A 1G3EA 2V0BA 1QB6A 4MVNA 1ANBA 1MQ5A 5CMXH 1AUJA 1B5GH 2Z3EA 2Q6DA 1BTHH 3FP8E 2XBXA 1UCYK 2ZDVH 1V2QT 5C3NA 1RD3B 1UHBB 1QA7A 4X6PA 3KQEA 5TJXA 3SJKA 1L0ZA 4Y11E 3NK8A 1HAIH 2P3UB 1MQ6A 1YPKH 3QUMP 1WQVH 1GI1A 5JB9S 1OP0A 5FCRA 1HLTH 1EJMA 4Q2KA 3T27A 1HBTH 1RXPA 3RDZA 2WPMS 1ZOMA 1QL7A 4ZROA 2SGEE 5J4SA 1XUGA 2PKAB 3QO6A 1RTLA 1O0DH 1THSH 2FZZA 1ELBA 3SU3A 2THFB 5TCCA 3HPTB 3U98H 3P8NA 2R2MB 2F3CE 3O8CA 5DKMA 1GJBB 1ABIH 1Y5BT 2V6NA 3MWIU 1HFDA 1ELTA 1QJ6B 2ZHEH 4PROA 1LTOA 4IW4E 1BJUA 1GDQA 4YESB 2BY9X 2FIRH 1TNKA 1HAGE 2BZ6H 1TGNA 3UR9A 1HUTH 1NFUA 1F0SA 1O3NA 2Y5GA 1TNIA 2VINA 3RMMH 3VB4A 2D2DA 2F9BH 2BMGB 2AIPA 1CGJE 1MZDA 3TK5A 4BXSA 1GI7B 1MBQA 3ELAH 1EASA 4WF8A 3OTJE 3SZNA 1TRMA 2P93A 3A83A 4WH8A 1QL9A 3RXLA 3LGTA 4THNH 4Y8ZA 4NWKA 3VB3A 3HK3B 3RMNH 4K3JA 5A8YA 2G52A 1UVSH 1ZZZA 1O2IA 2HWLB 2TBSA 1P57B 2P94A 2QYIA 3RXFA 4BTTB 5AVDA 1OYTH 5GCHF 1UCYH 5A0CA 1GJ4H 1GJCB 2Q1JA 1D6WA 3SUFA 2XWAA 1GJ5H 4RSPA 1VITG 4A6LA 2YNAA 4D76A 1GJ9B 1PPFE 1KLIH 1TPOA 4MNYA 2C93B 1F0UA 2D1JA 3BIUH 3UQOA 3BTGE 2A4GA 3AAUA 1GMHF 3M3VA 2FP7B 3OX7U 1WYKA 1TX6A 3RP2A 1K1LA 1C5SA 1V2WT 1MTUA 4NWLA 3MMGA 4Y79A 3H5CB 2TPIZ 5FPTA 2B8OH 1GI3A 2XNIA 4K8BA 4NA9H 4Y8XA 4ZKRU 1NU7B 1BMMH 1H1BA 1AKSB 1P2MA 1C1QA 4AX9H 4VGCC 2A2QH 2VB0A 3EA9A 4ZHLU 4FU7A 4ZAEA 3TU7H 1QRZA 3F68H 4H4FA 2KAIA 2XBVA 4YT6H 3UNQA 1M9UA 1MH0A 1O3DA 2SNWA 2JKHA 4K1SA 1O2MA 1ARCA 2RG3A 1EB1H 1D9IA 1K2I1 2BX4A 3A89A 1MCTA 2BD2A 1OWIA 2RDLA 1QIXB 4Y10E 4WMFA 2Q6GA 3L6PA 3M5OA 3MU5A 3OYPA 4WWYA 1LHFH 3FFGA 4INLA 3LC3A 3M3TA 4OS1A 4BNRA 4JYUH 2PTCE 2OTVA 9LPRA 2ZTZA 1HRTH 5AFYH 2C3SA 1IHSH 3A84A 5JBCS 3ODFA 4SGAE 4VGCB 2PTNA 3L3TA 1ANDA 4HZHA 2GCHF 1L1GA 4AZ2B 1UVTH 3MU4A 5DJ7A 5HM2A 1TGBA 1KDQA 3BTME 1C1TA 4B2AA 1AUTC 1TNLA 2GZ8A 3RXEA 1G30B 4CRAA 3G01A 1UK2A 4D7GA 1BZXE 2BD5A 4ISHH 1O2NA 1S6HA 1A5HA 1YLCA 3HK6B 3RM2H 1MTNC 3Q3YA 1O2VA 5C5NA 3U8TH 3JZ1B 4KKDA 1AFQC 4LOYH 1JOUB 1UJ1A 1UTQA 1XX9A 5C1YA 4ABGA 1YP9A 2OQUA 3T5FH 5J4QA 1EZXC 1EZQA 2BLVA 1QBOA 3MU0A 5T6FA 1XXFA 1QB9A 1DUAA 1GHXH 2VNTA 3ZZ8A 2J9NA 1AB9B 1AZZA 1C5UA 2VWLA 1WUNH 4E7NA 5CE1A 2XC0A 1MTNB 2BD3A 1UVPA 2ZFQH 3S7KB 4NZLA 3GCNA 1AFQB 4WY3A 2WPLS 1TBZH 1NRQH 1H4WA 1P9SA 3SV8A 1KLJH 3OSYA 1TPAE 1GMCF 1P3EA 2FYRA 1ELEE 4CRFA 2ZDNA 1TAWA 4JZDH 5CHAC 1V2NT 2Z9JA 2F9VA 2F9OA 1Z71A 2C8WB 3SUGA 1SOTA 1BBRE 1SQTA 4ISIH 4MPXA 1V3XA 3UNRA 1O2GH 1BT7A 4JYVH 4AB9A 1E36B 2GDDA 1KDQB 1G3CA 1RRKA 1VCQA 2BVSH 1TNHA 1FPCH 1NFXA 1W8BH 3Q00A 1A1RA 4OS2A 3ZZBA 2FDAA 1FJSA 1LKBA 5AFZH 1EUFA 1T8OA 3GY4A 4TWYA 2NU3E 2ANWA 1DICA 1XUHA 3FZZA 2OBQA 2C90B 1K21H 1O3LA 2ZQ1A 1NU9A 1AD8H 1V2VT 4X1RU 1AIXH 2Z3CA 1W0YH 1H9LB 5C1UA 1PYTD 3V7TA 3ZYDA 1C1SA 2WYJA 1KXDA 1SFQB 2AGIX 3SGBE 2BDCA 3VEQB 1TGTA 1P9UA 1QTFA 1KYNA 1ETRH 4MQAA 2PSXA 1PPEE 2QGRA 1DDJA 1AO5A 1QQ4A 1ELAA 2BDGA 1QA0A 2VWMA 4Y7BA 3H7OA 3P92A 4J2YB 1TBQH 3A87A 2Q6FA 3RXRA 1NPMA 3QTVH 2OINA 1P02A 1SMFE 1EPTA 4ZKOU 1N1LA 1UTNA 3RXCA 2BDBA 1O30A 1S82A 2STAE 2FXRA 3SV9A 1F0RA 5EW1H 4RKJB 2PUQH 4X2WA 4X8TH 5GDSH 1CO7E 5K7RA 3A7TA 3KCGH 1P2OA 4DJZB 1QBVH 2NU4E 2BY6X 1J17T 3W94A 3AW0A 5L2YH 3A7VA 3TJVA 4I8LA 1LKAA 1LCYA 3GCHB 3QX5H 2B0FA 2ZGXH 4Y76A 1BOQA 1DANH 1EB2A 5EQRA 4OS4A 1SFIA 1SGTA 1OP2A 4IC5A 1OYQA 3HKJB 3R0FA 1F5KU 4FUCA 4X8VH 5JPMH 1O31A 4K8YA 4U30A 3KIDU 1ESBA 4A5TS 2XBYA 1FV9A 4FUHA 1TONA 1GBMA 1HXEH 3S0NA 2GCTC 3AAVA 1GHBF 1LHEH 3MH7A 4KGAA 4CR5A 1V2KT 1SGRE 3PB1E 3KNXA 3ZVCA 1UVUH 1C4V2 1CT2E 3SU6A 2QCYA 2ZGJA 4NZQA 2EA3A 3A8CA 4TPIZ 2HOBA 3VB7A 4JK6A 4NG9H 5L30H 4HGCA 4ISLA 2A32A 2ZPQA 3I29A 1QBNA 2GV7A 3SV2H 1CBWC 1TMBH 2AERH 3LU9B 3RXSA 1JRSA 1E34B 1HAYB 1TNJA 2H5DA 4X6OA 3BTQE 1Z6JH 3T26A 2JH0D 3AW1A 3GY6A 1SQAA 3RUOA 1WCZA 4NCYA 2Y7ZA 3UWJH 3ATLA 3M7TA 4XDEA 2Z9LA 3EA8A 4XBBA 1CVWH 4Y7AA 1FNIA 1Q3XA 4X0WU 1NTPA 1JIMA 1NRSH 2F9PA 3HGPA 3RXOA 3P17H 3ODDA 3RXQA 1DY8A 3SORA 1C5MD 1MBMA 3SJ9A 1W12U 1PYTC 5C1XA 1GL0E 2QV1A 1D6RA 1P12E 4U01A 5HXFA 4HI3A 4BOHA 4UONA 1GJ8B 5I46H 4K60A 3SI4H 1T4UH 1ELGA 1FY3A 4CRGA 3B23B 2CMYA 1O5BB 1W7XH 2WPHS 5F8TA 2Y5HA 4B1TA 1DVAH 1LHCH 3GCOA 1LVMA 3D49H 3E0PB 3QTOH 1FIZA 3KEEA 1A0LA 1HAVA 3RXTA 5LPRA 1GHAG 2ZU3A 1CA0C 1XUKA 2UWLA 5FHTA 1O5FH 2XCFA 4WH6A 1V2TT 1XM1A 1V2PT 2CV3A 2AGEX 1C5ZB 4ZMAH 1BBRK 3UPEA 3I78A 1PQ5A 1GGDC 3UUZA 4ASHA 2BXUH 4OGXA 1B0FA 3TH3H 4X8UH 1O38A 3SW2B 4ISNA 3VB5A 3BTEE 3SU5A 4UEHH 1SVPA 3OY5U 5DGJA 1OKXA 2FOFA 1KLTA 4YOGA 2GT7A 5DP4A 2QY0B 3UREA 2FESH 3PLKA 2OC7A 3LH1A 4MPUA 1ZTJA 3RLWH 1C5QA 1CGIE 1CA0B 4UDWH 2ASUB 3SU1A 5DP5A 1SOZA 2A5IA 1UO6A 3IWMA 1IHTH 3ZVDA 1GGDB 1GL1A 2FOGA 1HAPH 5GJ4B 1FI8A 1ZSLA 1DLEA 1AE5A 1WOFA 1CE5A 1YM0A 1SHHB 1D3PB 4AN7A 1SGCA 3JZ2B 1MCVA 1KXEA 2QA9E 1O5AB 1Y5UT 4AG1A 3E8LA 1GI5A 4D7FA 4J1YA 4M7GA 3NKKA 2HNTF 4HTCH 4ABIA 3VXFH 2ZECA 3RXKA 2Z9IA 1GBLA 3BG4B 4NIXA 5DP6A 1ESAA 3RXDA 1VITF 1B7XB 1P2QA 2FI4E 1YCPM 4NFFA 1C2HA 1K1MA 1HJ8A 1O2UA 2G00A 1H8DH 5EXMA 1FY5A 1C2GA 2ZZUH 1SLVB 2W5EA 1O2LA 4GPGA 3L33A 3FZDA 1GJ6A 1GCTC 3URCA 1OWHA 3S69A 1WTGH 3TPIZ 2WYGA 2G51A 5C20A 1YPJH 3RXHA 2A5AA 1ZYOA 1ELDE 1QR3E 5A2MH 3M35A 1BBRH 2BX3A 3P70B 1P05A 1H9IE 2EEKA 3BN9A 1BUIA 1G36A 1KIGH 4F4OC 1O2YA 1P09A 2STBE 5JBAS 1DE7H 4KELA 3GDUA 1O2HA 1GBIA 2FOBA 2FOMB 4DW2U 1GCTB 4MG3A 4U32A 3U8OH 2HPPH 1ZGIA 4KTCA 1AI8H 1BTWA 2VWOA 1GBJA 1RJXB 1UTOA 3MOCA 1YLDA 3TNSA 1EAIA 1SPJA 2BLWA 1ACBE 4WMEA 1BTPA 3F9GA 2AMDA 4TYDA 1MZAA 2QXHA 2XC5A 1T4VH 4B71A 3UQVA 1ZGVA 1PQ7A 1GCDA 4I7YH 4NIYA 5IDKA 1VCPA 4DURA 1ID5H 4B74A 3GOVB 1MU6B 4WXVA 1XMNB 2P8OB 3E1XB 5C2ZA 1BMAA 1K1IA 3LKWA 3KHVA 2R0LA 5JBTA 2YOLA 1LHGH 2ZCKP 1D3QB 1N6YA 3ZZAA 2UUFB 2BY7X 2J4IA 3U1IB 1O2SA 1MKWK 1T8MA 1LMWB 2VWNA 3FP7E 5I25A 4KTUA 5GWZA 3SNDA 1Y59T 3SN8A 1P3CA 3ZZ9A 2ODPA 1P0SH 1FLEE 3M5MA 1V2MT 1YPMH 2GV6A 2Y82A 3E91A 2R0KA 4A92A 1MU8B 1O37A 1BTXA 1FZZA 1V2ST 2AFQB 3DT0H 3SHAH 1BHXF 4E05H 3MFJA 2FOEA 1J15A 1PQAA 5ETXA 1O3OA 1NFYA 1U6QA 3LGIA 1D4PB 1ANCA 4GHTA 2GZ9A 4UE7H 2OXSA 1D3DB 3A8BA 2ZIQH 3ZV8A 1C1RA 1NN6A 4IBLH 4CHAB 1FAKH 4MLFB 3UOPA 1QJ7B 2F9UA 2QXJA 2TGAA 1SGPE 2SGPE 2CGAA 2G4TA 3EAJA 4YLQH 2ZFPH 1TWXB 1UTLM 1EX3A 4DVAU 1VZQH 4LK4A 3M5LA 4NSVA 5EOKA 1K28D 1T32A 5LH8A 3BEUA 3GCTG 3D62A 3SGQE 2H9HA 2ODQA 3MYWA 1MTSA 4AFUA 2HLCA 2Z94A 3UFAA 2ZU4A 2Y6TA 2FLRH 3UWIA 1K1JA 2BDYA 3BG8A 3ZVAA 1VCWA 2GT8A 2VVCA 4I8KA 1O3PB 2V35A 2ZEBA 2CJIA 4X2YA 5JBBS 1HIAA 2XXLA 8GCHG 2C8XB 4O03A 3VB6A 3RLYH 1BQYA 4MPWA 4YLUA 1DS2E 2ZI2H 4DY7B 5LPEA 3BIVH 1QRWA 6CHAB 5GIBA 4ZHAA 3SV7A 1GBFA 3BTKE 4CRCA 3HGNA 1ELCA 1NC6A 3LJOA 4JYTA 3T28A 4NIWA 1C5XB 2GVFA 1V2UT 2ZG0H 3EA7A 1OWJA 2TGDA 1O2OA 3M7UA 1KSNA 2UUKB 1G9IE 5DG6A 2BD9A 1MAXA 1TX8A 1K22H 3TIUA 2O8LA 1AB9C 4BAQB 1GI9B 4I8GA 3SBKA 2XC4A 4GAWA 4DOQA 2CHAB 1SGQE 1THPB 1SHYA 1XUIA 3SGAE 2P3TB 1ANEA 2P59A 5EGMA 3PLPA 1GPZA 3PTNA 3T62A 3F9FA 3QK1A 1P2KA 1TX7A 2R2WU 2FODA 1FN6A 1ZHPA 4AORA 1NZQH 1L4ZA 1WQSA 3K9XB 1SGDE 4BXWA 4NSYA 4DT7B 2I6SA 1T7CA 3TGJE 3LIWA 1GWAA 1PPZA 2XWBI 1IQHA 1SQOA 5A0AE 3LGWA 9ESTA 2BQ6B 1IQIA 2A2XH 5L6NH 1JIRA 1WAYB 2KAIB 1PFXC 2A1DB 3Q77A 4X6NA 3P6ZB 1ZLRA 1PPHE 1RIWB 1E38B 7KMEH 4FUFA 4AFSA 1OWDA 1OS8A 3NWUA 2VGCB 2HRVA 1WU1A 4I32A 1HJAC 3RMLH 3TH4H 1DWDH 2D26C 1YC0A 1UVOA 1TGCA 8ESTE 1Y3XA 1C5WB 2XTTB 1MKXK 3KQBA 3NUMA 3ZZ6A 5F6MA 4BAKB 1HAOH 1O34A 3KL6A 4TPYA 2ANMH 2ZHFH 1S85A 3ZZCA 2O9QA 4Q7ZA 5JYIA 2ULLA 2QC2A 3ATIA 3QLPH 1SI5H 2SGAA 1TA2A 3TH2H 4Q80A 3ZV9A 4GCHG 1HJAB 1V2RT 4TWWA 7ESTE 2BB4A 3SI3H 4JZIA 3GYMA 1O3IA 1K1PA 1E37B 4Y0YE 1C1MA 4FUIA 1YKTA 1GBAA 1ZJKA 1HAXB 3QDZB 3A7XA 2BVXH 1AWFH 3UR6A 3EDXB 2ZNKH 3QZQA 3FANA 4UFDH 3NXPA 4GLYA 1NRNH 2H6MA 1F0TA 1O5GH 2FX4A 5E0HA 1ZMNA 1IQLA 5FPYA 4AYYB 4LXBH 5E2PA 1FPHH 2HGTH 1C5PA 1CHOG 2ZDLA 1G3DA 2FS9A 3Q76A 5LPFA 4A1XA 1BHXB 2GKVE 4R0IA 1FXYA 1GI6A 2ZU1A 1NT1A 1VJ9U 1BRUP 1W10U 3CENA 4NGAH 3PWBA 3MO6A 1GI4A 3SHCH 5FCKA 1QCPA 1YPGH 4DCDA 3VGCB 4FXGH 1OX1A 2FWWA 5E8EH 1SR5C 1Y8TA 2PUXB 1S5SA 3GCHC 5ESTE 3RXUA 2FTLE 2PHBA 3NZIA 2A31A 1YPHC 3ATMA 1O2QA 5PTPA 1K9OE 3RMOH 1HAZB 5HMAA 2A4RA 1S81A 1GHAF 3GY5A 1NS3A 2BM2A 2BTCE 1BTUA 1OWEA 2ANYA 5F8XA 4KTSA 1TIOA 4Q7YA 1DPOA 1LQEA 3U9AH 1O32A 2ALPA 3SNCA 3Q3KA 1GVZA 1ETSH 2AGGX 2ZU5A 4Y6DA 2UWOA 1AWHB 5EXNA 4D9RA 3TGIE 4I8JA 3AVZA 1AGJA 1AY6H 1NROH 1HXFH 4IN1A 4INHA 5E0GA 4LZ1H 5FAHA 2W3IA 1EQ9A 1KXFA 2QXGA 2O8MA 1WBGB 1GHZA 1C1NA 2PR3A 4K5ZA 4H42U 4ABJA 1RTKA 3QWCH 5AF9H 4B73A 1A61H 2Z6BD 4D8NA 1EAWA 2A4QA 2IPHA 2P95A 5HYOA 4ZKSU 1KXCA 1CT0E 3P8FA 2RCEA 2V3OH 4Q7XA 4BAOB 2SFAA 4BAHB 3TLOA 1EPTC 2ZDAH 4WMDA 2PWXA 2XCNA 2PFEA 2QXIA 3TK9A 4XSKU 1G2MA 2BLQA 3ZZ3A 1S0QA 4AGKA 2GP9B 3C1KA 4CBNA 2BY5X 1P2IA 2H9TH 2ZQ2A 4A1VA 4O3TA 4YM9A 1DM4B 2VH6A 3BTTE 3S9BA 5AHGH 3RU4D 2C4FH 1IAUA 4GUXA 3MO9A 3PWCA 1S83A 2F9NA 2SGDE 2ZA5A 3URDA 6GCHG 5F8ZA 1P10A 4FU8A 1F2SE 1EPTB 2W7SA 1EJNA 3SV6A 2H1UA 3SQHE 4BANB 1T8NA 4R8TB 1HGTH 1P03A 2K1QA 2EC9H 3QN7A 2IJOB 1O2XA 1A0JA 1GVKB 1O3AA 2QF3A 4ZH8A 1ZR0A 2DE9A 2GGVB 2R9PA 1TYNA 2JH5D 1EP5A 1HB0B 1O2PA 3DA9B 3FAOA 1SL3A 4CH2B 3AASA 1J9CH 3E90B 2GDEH 1DUEA 1YCPK 8LPRA 4IS5A 1BITA 1Z8IB 2FYQA 3VFEA 1C5LH 3ZZDA 3A81A 1C4U2 1ZTKA 2Y7XA 3GY3A 2Z7FE 1GBHA 1P06A 2OP9A 3A82A 5HM9A 2G5NA 1IQJA 2BD8A 3MU8A 3U69H 4ABFA 2ZGHA 3F1SB 4AOQA 1PPCE 1RGQA 1ZPCA 4IGDA 1BIOA 4I8HA 2BYAX 3KN2A 1OOKB 3K2UA 2A7JA 2C8YB 3SNAA 4YOJA 1LPZB 1H8IH 2BDHA 2UUYA 1TRYA 4NA8A 3ATKA 3ZYEA 1S6FA 2XW9A 3SNBA 2PGQB 1ZTLA 1GI0A 1O2JA 4QT8C 4X8SH 4RKOB 3C27B 4MNWA 4O97A 1GI8B 2BQWB 6ESTA 1C5YB 1TNGA 1G37A 1NRPH 2BDAA 1W14U 2CF8H 1A7SA 2WV4A 3BF6H 3GY8A 3H7TA 5DP7A 1BMNH 3MU1A 5BPEA 1J16A 3CS0A 2CXVA 5K0HA 4CBOA 4MPVA 2ZCHP 4TY6A 1DXWA 1A3EH 4I33A 1VGCB 4A1TA 4DGJA 1ZRBA 1IQMA 3GY7A 2ZPRA 3BG4C 1A4WH 2VIVA 2OUAA 1SLUB 1UHBA 3B9FH 2ZHQH 2QAAA 4IC6A 2TGPZ 4E06H 5EU8A 4F49A 1NM6A 2FEQH 1EP6A 3IG6B 1YPEH 2W7UA 5EXLA 1AVXA 5DO4H 2IN2A 2CN0H 1C2LA 5DPAA 1GMDG 4DIHH 4NA7A 5EG4A 1QFKH 1GI2A 4OS5A 3A7YA 3ZZ4A 2FS8A 4ZUHA 2AIQA 1DX5M 2V3HH 2OLGA 2CF9H 2VIDA 2PKAA 4CRDA 1OP8A 3F9HA 1QURH 3RXBA 1ZSJA 5H4IB 1Y3UA 1GJ7B 2GTBA 1T31A 3LJJA 3PMBB 3DFLA 2A5KA 2OC8A 2SNVA 2ZFTA 3GYLB 3I77A 5DK1A 4X1QU 1Y3WA 4XE4A 1HAVB 1QB1A 1RFNA 1XKBC 1HCGA 1WV7H 1MUEB 1SGEE 2EI8A 2ZHDA 3RXJA 2ILNA 2PKSB 2I6QA 1O3EA 1C5TA 1L2EA 3S9CA 1O3CA 4YO9A 1UK3A 2FPZA 1EZUC 4WXIA 2XBWA 4O9VA 2UUJB 1A5IA 3GCTF 4WVPE 1F5LA 2BOKA 5LGOA 1O3KA 2LPRA 4YOIA 2BLOA 3M5NA 2P8OC 3K6ZA 2PGBB 3UNSA 4B2BA 2DE8A 2QIQA 3MNCA 3RU4E 1PPBH 3MHWU 4MDSA 3RXGA 3M7QA 3BSQA 1ELVA 2AMPA 2J34A 3KGPA 4X6MA 1AFEH 4E7RG 1YF4A 1Q2WA 1GBCA 2JETB 3MNBA 5T6GA 2ZGCA 3A8AA 8GCHF 1O2ZA 2PLXA 1QQUA 3F6UH 3RM0H 4K2YA 5A8XA 3A7WA 4ZHMU 2GX4A 1W0ZU 2HVXA 1ZSKA 1BRBE 2VIQA 3ZZ5A 4CR9A 5A8ZA 1ETTH 1O2RA 4U2WA 1JWTA 1AVWA 1WTHD 2TGTA 1JBUH 3TK6A 2OBOA 1JXPA 2WV5A 3ZVFA 2BOHB 3U1JB 1G2LA 3SNEA 1DITH 1ZPZA 4AYVB 2ZDMA 6LPRA 4YT7H 2VU8E 3M37A 3LOXA 1GBTA 1GVLA 3PM3A 5FX5A 7GCHG 2Y81A 3K65B 1MMJN 4BTIB 3A80A 3SU4A 1DFPA 1OWKA 2XRCA 5HGGA 1CHGA 3T2NA 1DWBH 3KQCA 2BHGA 4AFQA 1Z8JB 4JCNA 2ESTE 3PV4A 1AKSA 1ZPBA 2NU2E 2WINI 3EYDA 2D8WA 2AH4X 3IITA 4GHQA 1HAHH 1XUJA 2NU1E 2ZCLP 3M3SA 4OS7A 5FPSA 4CHAC 2P3FH 4H6TA 3RC6A 2M5TA 2G5VA 2WPJS 1FIWA 2IOTA 1Y5AT 1QY6A 1V2LT 1G3BA 4BTUB 2ZTXA 2F91A 1IOEA 2VIPA 1TOCB 2LNCA
chains in the Genus database with same CATH superfamily
4H6SB 2A4OA 1SGIB 3T29A 3T25A 3MI4A 2JJ2D 3ZVGA 1LQDB 1GHVH 1LVYA 3MNXA 5E0JA 3KQDA 3DUXH 2OD3B 1TABE 1G32B 4FVDA 4JMYA 2EI6A 1P01A 2YMSD 4IMQA 3UIRA 3LGVA 4X1NU 1YY3A 1Z7KA 1IQNA 1XVMA 5A09A 5T6DA 3K6YA 4LZ4B 1O33A 4XBCA 3GICB 2GD4B 5JB8S 1TQ7B 2BQ7B 3SJOA 3MH6A 4B2CA 4ZXXH 1PPGE 1SLXB 1Z1IA 4MTBA 1C1UH 6CHAC 1UMAH 2J95A 1EATA 3DHKH 3VXEH 3SUEA 2FI3E 2SGQE 5L2ZH 1BA8B 2PSYA 1S0RA 4GCHF 2ZKSA 2DUCA 2HNTC 2RFKC 4DG4A 3PROA 2W6JD 1IQFA 1VR1H 5EPNA 1MKWH 1EOLA 2FLBH 4NIVA 1C9TA 3P8GA 3BTWE 4ISOA 3UTUH 1GBBA 2OC1A 3RC4A 2CHAC 2H2ZA 1FAXA 1EAXA 2Z9KA 1SKYE 3D23A 2J97A 4O3UA 1D3TB 3TJOA 7LPRA 3OAAD 4JZEH 3R3GB 1DWEH 1J14A 2WZQA 2ZO3H 1OHHD 1V2JT 4XFQA 2SGFE 1CHOF 1YBWA 3NPSA 4UD9H 1DLKB 3OY6U 2HNTE 1BRCE 2L74A 4IMZA 1O5DH 3PMAB 5ABWA 2FOHA 2OQ5A 1ZRKA 1IQGA 1GBKA 1KTTB 4AC9A 1FY1A 3O8RA 1FUJA 2JIZD 4AB8A 2VVUA 4CREA 3A85A 2G8TA 5FX6A 3SQEE 4Y71A 1FONA 3Q3XA 3F9EA 3BEIB 2WHXA 1GJDB 1TB6H 4FUEA 4Y0ZE 1RIWC 3V13A 2G4UA 1K1OA 2RA0A 1B0EA 1C1VH 1L1JA 2VGCC 2JH6D 3HKIB 2FM2A 4B76A 2FTMA 3GDVA 1MTWA 2PV9B 1C2DA 3GDSA 1WSSH 1XXDA 2FMJA 1HV7A 3PMHB 1C9PA 3PMJA 1AQ7A 5TCAA 1LPKB 4JZFH 1TE0A 3TITA 5SGAE 3LONA 1YPLH 1ABJH 1UTMA 3A86A 1LVOA 1HIAB 1CQQA 3ITIA 4FVBA 2WUCA 1J8AA 4K69A 1FN8A 1ZMJA 5DP3A 3ZZ7A 3BTFE 1QL8A 2A7HA 1AMHA 5GCHG 2HALA 1KXBA 1KXAA 3PO1C 1N6XA 2FI5E 5B6LA 4X1PU 1LO6A 3LH3A 1TOMH 3RXAA 2HPQH 2QN5T 4XOJA 2J2UA 3TVJB 2YMSC 1BB0B 3OEHD 2FX6A 1Z6EA 1UK4A 1SGFG 3N7OA 1DT2A 1SGFA 1A46H 1P11E 1YYY1 3LGYA 4YTAA 2A45B 8KME2 3KF2A 1O3JA 1W3CA 2Y80A 3E0NB 1GMHG 1TPSA 1W2KH 3ZVEA 1EOJA 2OC0A 1Z1JA 4HG6A 2IJD1 3A88A 1O2TA 5GXPA 4UFEH 4ESTE 3PO1B 1UTKA 4IN2A 4JZ1A 4ABEA 3M36A 1NESE 1TBRH 2H9EH 2ZDKA 2ZFSA 3A8DA 1TFXA 2WUBA 2AYWA 2VIOA 1SGNE 2NU0E 4UFGH 1MTVA 3UB0A 3SOSA 2YMSB 3QZRA 1SG8B 6GCHF 1XUFA 1C2EA 2ANKH 3BTHE 3KQ5A 2TRMA 5G4BA 1ORFA 3VGCC 5GPIB 4MNVA 1LHDH 1V6DA 2Y5FA 1Y3YA 1DOJA 2Z9GA 2VH0A 2ZWLH 4AFZA 2ZTYA 3OU0A 1C2IA 1WXRA 1QZ8A 1ZHRA 4ZXYH 1DXPA 1NY22 3U28C 1O2KA 5CHAB 1P2JA 2EQNA 1O3BA 4WJG2 1C1OA 1MD8A 1C2JA 1BCUH 3CS7A 5EPYA 3S7HB 2TIOA 1E1QD 4CRBA 1E35B 3B8JA 3WW7A 1AZ8A 3ESTA 3P95A 1SLWB 1P04A 3MH5A 3E3TA 1C5NH 1THRH 1T8LA 3RXIA 3RU4T 1SBWA 3MTYA 2GCHG 1BTYA 1O2WA 1INCA 1Y3VA 1O3HA 1MD7A 1GHYH 2R3YA 1TQ0B 1QNJA 3LT3A 4ABHA 3PYHA 1K1NA 3E16B 1PQ8A 1SGYE 1ESTA 1CGHA 4RT0A 1LPGB 2ALVA 1HYLA 1BDAA 3MH4A 1MKXH 4A7IB 1DY9A 4NFEA 1Z8RA 3QGNB 3HATH 4INKA 1BRAA 3TJNA 1DSTA 3ZVBA 3O8DA 1O39A 3FVFB 1O36A 1W11U 4OS6A 5A0BA 4ABAA 3EE0B 2ZU2A 4D9QA 1C1WH 4SGBE 1AHTH 2A0QB 1F7ZA 2Z3DA 3VG8A 1UCYE 4B75A 1YPHE 4RI0A 3UOUA 1DWCH 1TGSZ 1Q31A 4AGJA 1AN1E 3LDXH 4K1EA 1P8VC 2BXTH 2AEIH 1TALA 2R3UA 1EZSC 3V0XA 1SB1H 3NRLA 1GDUA 1IQKA 3MNSA 1A5GH 1FY8E 2VVVA 1LDTT 1W7GH 1C5OH 1PJPA 1QRXA 5EODA 1TPPA 1NFWA 5E2OA 4B6EA 1AVGH 1C1PA 2ZC9H 1C2MA 2ZF0H 2ZFFH 2G81E 1ARBA 1C5RA 1GMCG 2ZPSA 5C5OA 3EQ0H 1L4DA 2RA3A 1ZHMA 2ZP0H 1GMDF 4JK5A 1O3FA 4I31A 2GMTC 3SU0A 1UTPA 1FQ3A 1O5CB 2QF5A 1EXFA 1XVOA 2WPIS 1BTZA 2EI7A 1GJAB 3CP7A 3GY2A 1JMOH 1N8OC 4P02A 1IQEA 5EW2H 4Y8YA 2OCVB 4YZUA 2ZFRH 3M61U 1AE8H 3OTPA 3EGKH 2FOAA 2P16A 2W26A 4OM9A 5IK2D 1C2FA 1MAYA 2B9LA 2VIWA 3UY9A 1HPGA 3DD2H 4ABDA 1XKAC 5EQQA 2UWPA 2XYAA 3NCLA 1QJ1B 2G55A 2W3KA 4RN6A 4FUDA 2AS9A 3RXMA 1H9HE 3GISB 3U8RH 1F92A 4ZKNU 3PLBA 1KY9A 2QF0A 1X7AC 2GMTB 1VJAU 2GCTB 1TRNA 1GHWH 1NO9H 3STJA 1N8OB 1CU1A 5IYTA 5DN6D 4GVUA 1A3BH 3DFJA 3SUDA 1O35A 1FY4A 2J38A 1E0FD 1P2NA 3RC5A 1QHRB 4X1SU 5T3HA 4Z0KA 2B7DH 3TGKE 2BZAA 1HNEE 5EQSA 1EJAA 3D65E 1ELFA 4TY7A 1NRRH 3LC5A 4X2VA 1CBWB 1L1NA 3W95A 1S84A 1C2KA 2GZ7A 4KP0A 2BDIA 2FOCA 3SO3A 1GBEA 2VBCA 1FMGA 1F5RA 5T1VA 4XBDA 5JDUB 1CT4E 5B6OA 3E6PH 3PTBA 1GG6C 1VGCC 3MO3A 5C0TA 2BD4A 1O3GA 3RXVA 1ZMLA 3TJUA 1GBDA 4X2XA 2JDID 2WPKS 1KTSB 4MNXA 1TLDA 4Z6AH 3FP6E 3V3MA 5DP9A 1EKBB 3FOAA 4AG2A 2VJ1A 1C4Y2 1O3MA 1LVBA 5ESBA 3WY8A 4UFFH 1HDTH 2WPDD 2IPQX 5FBEA 7GCHF 1GG6B 1GDNA 2C8ZB 2ODYB 2YNBA 5F03A 2J94A 1W13U 2FO9A 3O8BA 3LPRA 1VITH 1Z8GA 1A2CH 2ZHWH 1V2OT 3BEFB 1C5VA 1OPHB 2BVRH 1OXGA 1EAUA 4FUJA 2B5TB 3VPKA 1SSXA 3ATWA 5FBIA 3P8OA 2XNDD 1CSOE 2O8UA 4BAMB 4OGYA 1BJVA 4FUGA 2PKSC 3A7ZA 3SU2A 1SC8U 2A7CA 4CH8B 1BMLA 2WV9A 2O8WA 3DSGA 1UTJA 2BD7A 3SJIA 1GHBG 2NWNA 4ABBA 1A0HB 4HFPB 1ZJDA 1YCPH 3TNTA 5KGOA 3V12A 1JRTA 1SQRA 2BY8X 1QGFA 3STIA 4FOUC 2J92A 1TMUH 3ENSB 1DSUA 1RTFB 1RS0A 3BV9B 5BRRE 1TMTH 1AU8A 1FDPA 3FKSD 5HKKD 1O5EH 5FXLA 2JETC 2AMQA 4K1TA 2F83A 5EIYA 1H8HD 1HJ9A 1TA6A 3SJ8A 1OSSA 4DT4A 4FUBA 3S9AA 1CA8B 2KM0A 4FU9A 3QGJA 4DIIH 2PW8H 2O8TA 3LGUA 4GSOA 1YGCH 3RXPA 2ZGBH 3BTDE 5DP8A 2H5CA 5C67A 1G3EA 2V0BA 1QB6A 4MVNA 1ANBA 1MQ5A 5CMXH 1AUJA 1B5GH 2Z3EA 2Q6DA 1BTHH 3WWBA 3FP8E 2XBXA 1UCYK 4B6FA 2ZDVH 1V2QT 2CK3D 5C3NA 1RD3B 1UHBB 1QA7A 4X6PA 3KQEA 5TJXA 3SJKA 1L0ZA 3F0PA 4Y11E 3NK8A 1HAIH 2P3UB 1MQ6A 1YPKH 3QUMP 1WQVH 1GI1A 5JB9S 1OP0A 2F4LA 5FCRA 1HLTH 1EJMA 4Q2KA 3T27A 1HBTH 1RXPA 3RDZA 2WPMS 1ZOMA 1QL7A 4ZROA 2SGEE 5J4SA 1XUGA 2PKAB 3QO6A 1RTLA 1O0DH 1THSH 2FZZA 1ELBA 3SU3A 2THFB 5TCCA 3HPTB 1W0JD 3P8NA 3U98H 2R2MB 2F3CE 3O8CA 5DKMA 1GJBB 1ABIH 1Y5BT 2V6NA 1S6LA 3MWIU 1HFDA 1ELTA 1QJ6B 2ZHEH 4PROA 1LTOA 4IW4E 1BJUA 1GDQA 4YESB 2BY9X 2FIRH 1TNKA 1HAGE 2BZ6H 1TGNA 3UR9A 1HUTH 1NFUA 1F0SA 4ZCNA 1O3NA 2Y5GA 1TNIA 2VINA 3RMMH 3VB4A 2D2DA 2F9BH 2BMGB 2AIPA 1CGJE 1MZDA 3TK5A 4BXSA 1GI7B 1MBQA 3ELAH 1EASA 4WF8A 3OTJE 2OK5A 3SZNA 1TRMA 2P93A 3A83A 4WH8A 1QL9A 3RXLA 3LGTA 4THNH 4Y8ZA 4NWKA 3VB3A 3HK3B 3RMNH 4K3JA 5A8YA 2G52A 1UVSH 1ZZZA 1O2IA 3GS9A 2HWLB 2TBSA 1P57B 2P94A 3ZIAD 2QYIA 3RXFA 4BTTB 5AVDA 1OYTH 5GCHF 1UCYH 5A0CA 1GJCB 2Q1JA 1D6WA 3SUFA 2XWAA 1GJ5H 4RSPA 1VITG 4A6LA 2YNAA 2KX4A 4D76A 1GJ9B 1PPFE 1KLIH 1TPOA 4MNYA 2C93B 1F0UA 2D1JA 3BIUH 3UQOA 3BTGE 2A4GA 3AAUA 1GMHF 3M3VA 2FP7B 3OX7U 1WYKA 1TX6A 3RP2A 1K1LA 1C5SA 1V2WT 1MTUA 4NWLA 3MMGA 4Y79A 3H5CB 2TPIZ 5FPTA 2B8OH 1GI3A 2XNIA 3AK5A 4K8BA 4NA9H 4Y8XA 4ZKRU 1NU7B 1BMMH 1H1BA 1AKSB 1P2MA 1C1QA 3W1EA 4AX9H 4VGCC 2A2QH 2VB0A 3EA9A 4ZHLU 4Q4LA 4FU7A 4ZAEA 3TU7H 1QRZA 3F68H 4H4FA 2KAIA 2XBVA 4YT6H 3UNQA 1M9UA 1MH0A 1O3DA 2SNWA 2JKHA 2AHME 4K1SA 1O2MA 1ARCA 2RG3A 1EB1H 1D9IA 1K2I1 2BX4A 3A89A 1MCTA 2BD2A 1OWIA 2RDLA 1QIXB 4Y10E 4WMFA 2Q6GA 3L6PA 3M5OA 3MU5A 3OYPA 4WWYA 1LHFH 3FFGA 4INLA 3LC3A 3M3TA 4OS1A 4BNRA 4JYUH 2PTCE 2OTVA 9LPRA 2ZTZA 1HRTH 5AFYH 2C3SA 1IHSH 3A84A 5JBCS 3ODFA 4SGAE 4VGCB 2PTNA 3L3TA 1ANDA 4HZHA 2GCHF 1L1GA 4AZ2B 1UVTH 3MU4A 5DJ7A 5HM2A 1TGBA 1KDQA 3BTME 1C1TA 4B2AA 1AUTC 1TNLA 2GZ8A 3RXEA 1G30B 4CRAA 3G01A 1UK2A 2JJ1D 1BZXE 4D7GA 2BD5A 3N7EA 4ISHH 1O2NA 1S6HA 1A5HA 1YLCA 3HK6B 3RM2H 1MTNC 3Q3YA 1O2VA 4F48B 5DSFA 5C5NA 3U8TH 3JZ1B 4KKDA 1AFQC 4LOYH 1JOUB 1UJ1A 2EY4C 1UTQA 1XX9A 5C1YA 4ABGA 1YP9A 2M2AA 2OQUA 3T5FH 5J4QA 1EZXC 5CHBA 1EZQA 2BLVA 1QBOA 3MU0A 5T6FA 1XXFA 1QB9A 1DUAA 1GHXH 2VNTA 3ZZ8A 2J9NA 1AB9B 1AZZA 1C5UA 2VWLA 1WUNH 4E7NA 5CE1A 2XC0A 1MTNB 2BD3A 1UVPA 2ZFQH 3S7KB 4NZLA 3GCNA 1AFQB 4WY3A 2WPLS 4Q63A 1TBZH 1NRQH 1H4WA 1P9SA 3SV8A 1KLJH 3OSYA 1TPAE 1GMCF 1P3EA 5F53A 2FYRA 1ELEE 2HLDD 4CRFA 2ZDNA 1TAWA 4JZDH 5HIYA 5CHAC 1V2NT 2Z9JA 2F9VA 2F9OA 1Z71A 2C8WB 3SUGA 1SOTA 1BBRE 1SQTA 4ISIH 4MPXA 1V3XA 3UNRA 1O2GH 1BT7A 4JYVH 4AB9A 1E36B 2GDDA 1KDQB 1G3CA 1RRKA 1VCQA 2BVSH 1TNHA 1FPCH 1NFXA 1W8BH 3Q00A 1A1RA 4OS2A 3ZZBA 2FDAA 1FJSA 1LKBA 5AFZH 1EUFA 5EJZA 1T8OA 3GY4A 3PV5A 5GNDA 4TWYA 2NU3E 2ANWA 2LELA 1DICA 1XUHA 3FZZA 2OBQA 2C90B 4XD7D 1K21H 1O3LA 2ZQ1A 1NU9A 1AD8H 1V2VT 4X1RU 1AIXH 2Z3CA 1W0YH 1H9LB 5C1UA 4TSFD 1PYTD 3V7TA 3ZYDA 1C1SA 2WYJA 5C17A 1KXDA 1SFQB 2AGIX 3SGBE 2BDCA 3VEQB 1TGTA 1P9UA 1QTFA 1KYNA 1ETRH 4MQAA 2PSXA 1PPEE 2QGRA 1DDJA 1AO5A 1QQ4A 1ELAA 2BDGA 1QA0A 2VWMA 4Y7BA 3H7OA 3P92A 4J2YB 1TBQH 3A87A 2Q6FA 3RXRA 4ASUD 1NPMA 3QTVH 2OINA 1P02A 1SMFE 1EPTA 2XOKD 4ZKOU 1N1LA 1UTNA 3RXCA 2BDBA 1O30A 1S82A 2STAE 2FXRA 3SV9A 1F0RA 5EW1H 4RKJB 3F2GA 2PUQH 4X2WA 4X8TH 5GDSH 1CO7E 5K7RA 3A7TA 3KCGH 1P2OA 4DJZB 1QBVH 2NU4E 2BY6X 1J17T 3W94A 3AW0A 5L2YH 3A7VA 3TJVA 4I8LA 1LKAA 1LCYA 3GCHB 3QX5H 2B0FA 2ZGXH 4Y76A 1BOQA 1DANH 4XRNA 1EB2A 3F0OA 5EQRA 4OS4A 1SFIA 1SGTA 2K8IA 1OP2A 4IC5A 1OYQA 3HKJB 3R0FA 1F5KU 4FUCA 4X8VH 5JPMH 1O31A 4K8YA 4U30A 3KIDU 1ESBA 4A5TS 2XBYA 1FV9A 4FUHA 1TONA 1GBMA 1HXEH 3S0NA 2GCTC 3WWFA 3AAVA 1GHBF 1LHEH 3MH7A 4KGAA 4CR5A 1V2KT 1SGRE 3PB1E 3KNXA 3PRBA 3ZVCA 5C94A 1UVUH 1C4V2 1CT2E 3SU6A 4TT3D 2QCYA 2ZGJA 4NZQA 2EA3A 3A8CA 4TPIZ 2HOBA 3VB7A 4JK6A 4NG9H 5L30H 4HGCA 4ISLA 2A32A 2ZPQA 3I29A 1QBNA 2GV7A 3SV2H 1CBWC 1TMBH 1NBMD 2AERH 3LU9B 3RXSA 1JRSA 1E34B 1HAYB 1TNJA 2H5DA 4X6OA 3BTQE 1Z6JH 3T26A 2JH0D 3AW1A 3GY6A 1SQAA 3RUOA 1WCZA 4NCYA 2Y7ZA 3UWJH 3ATLA 3M7TA 4XDEA 2Z9LA 3EA8A 4XBBA 1CVWH 4Y7AA 1FNIA 1Q3XA 4X0WU 1NTPA 1JIMA 1NRSH 2F9PA 3HGPA 3RXOA 3P17H 3ODDA 4M9FA 3RXQA 1DY8A 3SORA 1C5MD 1MBMA 3SJ9A 1E1RD 1W12U 1PYTC 5C1XA 1GL0E 2QV1A 1D6RA 1P12E 4U01A 5HXFA 2F43B 4HI3A 4BOHA 4UONA 1GJ8B 5I46H 4K60A 3SI4H 1T4UH 1ELGA 1FY3A 4CRGA 1W0KD 3B23B 2CMYA 1O5BB 1W7XH 2WPHS 5F8TA 2Y5HA 4B1TA 1DVAH 1LHCH 3GCOA 1LVMA 3D49H 3E0PB 3QTOH 1FIZA 3KEEA 1A0LA 1HAVA 3RXTA 5LPRA 1GHAG 2ZU3A 1CA0C 1XUKA 2UWLA 5FHTA 3OE7D 1O5FH 2XCFA 4WH6A 1V2TT 5HIZA 1XM1A 1V2PT 2CV3A 2AGEX 1C5ZB 4ZMAH 1BBRK 3UPEA 3I78A 1PQ5A 1GGDC 3UUZA 4ASHA 2BXUH 2KCAA 4OGXA 1B0FA 3TH3H 4X8UH 1O38A 3SW2B 4ISNA 3VB5A 3BTEE 3SU5A 4UEHH 1SVPA 3OY5U 5DGJA 1OKXA 2FOFA 1KLTA 4YOGA 2GT7A 5DP4A 2QY0B 3UREA 2FESH 3PLKA 2OC7A 3LH1A 4MPUA 1ZTJA 3RLWH 3H09A 1C5QA 1CGIE 1CA0B 4UDWH 2ASUB 3SU1A 5DP5A 3FO8D 1SOZA 2A5IA 1UO6A 3IWMA 2WSSD 1IHTH 3ZVDA 1GGDB 1GL1A 2FOGA 1HAPH 5GJ4B 1FI8A 1ZSLA 2QF4A 1DLEA 1AE5A 1WOFA 1CE5A 1YM0A 1SHHB 1D3PB 4AN7A 1SGCA 3JZ2B 1MCVA 1KXEA 2QA9E 1O5AB 1Y5UT 4AG1A 3E8LA 1GI5A 2KZ4A 4J1YA 4D7FA 4M7GA 5KECA 3NKKA 2HNTF 4HTCH 4ABIA 3VXFH 2ZECA 3RXKA 2Z9IA 1GBLA 3BG4B 4NIXA 5DP6A 1ESAA 3RXDA 1VITF 1B7XB 1P2QA 2FI4E 2RDEA 1YCPM 4NFFA 1C2HA 1K1MA 1HJ8A 1O2UA 2G00A 1H8DH 5EXMA 1FY5A 1C2GA 2ZZUH 1SLVB 2W5EA 2KCPA 1O2LA 4GPGA 1H8ED 3L33A 3FZDA 1GJ6A 1GCTC 3URCA 1OWHA 3S69A 1WTGH 3TPIZ 2WYGA 2G51A 5C20A 1YPJH 3RXHA 2A5AA 1ZYOA 1ELDE 1QR3E 3SYJA 5A2MH 3M35A 1BBRH 2BX3A 3P70B 1P05A 1H9IE 3PV2A 2EEKA 3BN9A 1BUIA 1G36A 1KIGH 1NBME 4F4OC 1O2YA 1P09A 2STBE 5JBAS 1DE7H 4KELA 4RT1A 1E79D 3GDUA 1O2HA 1GBIA 2FOBA 2FOMB 4DW2U 1GCTB 4MG3A 4U32A 3U8OH 2HPPH 1ZGIA 4KTCA 1AI8H 1BTWA 2VWOA 1GBJA 1RJXB 1UTOA 3MOCA 1YLDA 3TNSA 1EAIA 1SPJA 2BLWA 1ACBE 4WMEA 1BTPA 3F9GA 2AMDA 4TYDA 1MZAA 2QXHA 2XC5A 1T4VH 4B71A 3UQVA 1ZGVA 1PQ7A 1GCDA 1FX0B 4I7YH 4NIYA 5IDKA 1VCPA 4DURA 1ID5H 4B74A 3GOVB 1MU6B 4WXVA 1XMNB 2P8OB 3E1XB 5C2ZA 4I86A 1BMAA 2W6ID 1K1IA 3LKWA 3KHVA 2R0LA 5JBTA 2YOLA 1LHGH 2GJGA 2ZCKP 1D3QB 1N6YA 3ZZAA 2UUFB 2BY7X 2J4IA 3U1IB 1O2SA 1MKWK 1T8MA 1LMWB 2VWNA 3FP7E 5I25A 4KTUA 5GWZA 3SNDA 1Y59T 3SN8A 3F2HA 1P3CA 3ZZ9A 2ODPA 1KMHB 1P0SH 1FLEE 3M5MA 1V2MT 1YPMH 2GV6A 2Y82A 3E91A 2R0KA 4A92A 1MU8B 1O37A 1BTXA 1FZZA 1V2ST 2AFQB 3DT0H 3SHAH 1BHXF 1COWD 4E05H 3MFJA 2FOEA 1J15A 1PQAA 5ETXA 1O3OA 1NFYA 1U6QA 3LGIA 1D4PB 1ANCA 4GHTA 2GZ9A 4UE7H 1D3DB 2OXSA 3A8BA 2ZIQH 3ZV8A 1C1RA 1NN6A 4IBLH 4CHAB 1FAKH 4MLFB 3UOPA 3FN8A 1QJ7B 2F9UA 2QXJA 2TGAA 1SGPE 2SGPE 2CGAA 2G4TA 3EAJA 3EE7A 4YLQH 2ZFPH 1TWXB 1UTLM 1EX3A 4DVAU 1VZQH 4LK4A 3M5LA 4NSVA 5EOKA 1K28D 1T32A 5LH8A 3BEUA 3GCTG 3D62A 3SGQE 3DSOA 2H9HA 2ODQA 3MYWA 1MTSA 4AFUA 2HLCA 2Z94A 5C0UA 3UFAA 2ZU4A 2Y6TA 2FLRH 3UWIA 1EFRD 1K1JA 2BDYA 3BG8A 3ZVAA 1VCWA 2GT8A 2VVCA 4I8KA 1O3PB 2V35A 2ZEBA 2CJIA 4X2YA 5JBBS 1HIAA 2XXLA 8GCHG 2C8XB 4O03A 3VB6A 3RLYH 1BQYA 4MPWA 4YLUA 1DS2E 2ZI2H 4DY7B 5LPEA 3BIVH 1QRWA 5EJ1A 6CHAB 2KCYA 5GIBA 4ZHAA 3SV7A 4F55A 1GBFA 3BTKE 4CRCA 3HGNA 2KR7A 1ELCA 1NC6A 3LJOA 4JYTA 1BMFD 3T28A 4NIWA 1C5XB 2GVFA 1V2UT 2ZG0H 3EA7A 1OWJA 2TGDA 1O2OA 3M7UA 1KSNA 2LP6A 2UUKB 1G9IE 5DG6A 2BD9A 1MAXA 1TX8A 1K22H 3TIUA 2O8LA 1AB9C 4BAQB 1GI9B 4I8GA 3SBKA 2XC4A 4GAWA 4DOQA 2CHAB 1SGQE 1THPB 1SHYA 1XUIA 3SGAE 2P3TB 1ANEA 2P59A 3N99A 5EGMA 3PLPA 1GPZA 3PTNA 3T62A 3F9FA 3QK1A 1P2KA 1TX7A 2R2WU 3UAIC 2FODA 1FN6A 1ZHPA 4AORA 1NZQH 1L4ZA 1WQSA 3K9XB 1SGDE 4BXWA 4NSYA 4DT7B 2I6SA 1T7CA 3TGJE 3LIWA 1GWAA 1PPZA 2XWBI 1IQHA 1SQOA 5A0AE 3LGWA 9ESTA 2BQ6B 1IQIA 2A2XH 5L6NH 1JIRA 1WAYB 2KAIB 1PFXC 2A1DB 3Q77A 4X6NA 5CDFE 3P6ZB 1ZLRA 1K0HA 1PPHE 1RIWB 1E38B 7KMEH 4FUFA 4AFSA 1OWDA 1OS8A 3NWUA 2VGCB 2HRVA 1WU1A 4I32A 1HJAC 3RMLH 3TH4H 1DWDH 2D26C 1YC0A 1UVOA 1TGCA 8ESTE 1Y3XA 1C5WB 2XTTB 1MKXK 3DCLA 3KQBA 3NUMA 3ZZ6A 5F6MA 4BAKB 1HAOH 1O34A 3KL6A 4TPYA 2ANMH 2ZHFH 1S85A 3ZZCA 2O9QA 4Q7ZA 5JYIA 2ULLA 2QC2A 3ATIA 3QLPH 1SI5H 2SGAA 1TA2A 3TH2H 4Q80A 3ZV9A 4GCHG 1HJAB 1V2RT 4TWWA 7ESTE 2BB4A 3SI3H 4JZIA 3GYMA 1O3IA 1K1PA 1E37B 4Y0YE 1C1MA 4FUIA 1YKTA 1GBAA 1ZJKA 1HAXB 3QDZB 3A7XA 2BVXH 1AWFH 3UR6A 3EDXB 2ZNKH 3QZQA 3FANA 4UFDH 3NXPA 4GLYA 1NRNH 2H6MA 1F0TA 1O5GH 2FX4A 5E0HA 1ZMNA 1IQLA 5FPYA 4AYYB 4LXBH 5E2PA 1FPHH 2HGTH 1C5PA 1CHOG 2ZDLA 1G3DA 2FS9A 3Q76A 5LPFA 4A1XA 1BHXB 2GKVE 4R0IA 1FXYA 1GI6A 2ZU1A 1NT1A 1VJ9U 1BRUP 1W10U 3CENA 4NGAH 3PWBA 3MO6A 1GI4A 3SHCH 5FCKA 1QCPA 1YPGH 1WDIA 4DCDA 3VGCB 4FXGH 1OX1A 2FWWA 5E8EH 1SR5C 1Y8TA 2PUXB 1S5SA 3GCHC 5ESTE 3RXUA 2FTLE 2PHBA 3NZIA 2A31A 1YPHC 3ATMA 1O2QA 5PTPA 1K9OE 3RMOH 1HAZB 5HMAA 2A4RA 1S81A 1GHAF 3GY5A 1NS3A 2BM2A 2BTCE 1BTUA 1OWEA 2ANYA 5F8XA 4KTSA 1TIOA 4Q7YA 1DPOA 1LQEA 3U9AH 1O32A 2ALPA 3SNCA 3Q3KA 1GVZA 4ACAA 1ETSH 2AGGX 2ZU5A 4Y6DA 2UWOA 1AWHB 5EXNA 4D9RA 3TGIE 4I8JA 3AVZA 1AGJA 1AY6H 1NROH 1HXFH 4IN1A 4INHA 5E0GA 4LZ1H 5FAHA 2W3IA 1EQ9A 1KXFA 2QXGA 2O8MA 1WBGB 1GHZA 1C1NA 2PR3A 4K5ZA 4H42U 4ABJA 1RTKA 3QWCH 5AF9H 4B73A 3N7DA 1A61H 2Z6BD 4D8NA 1EAWA 2A4QA 2IPHA 2P95A 2L6OA 5HYOA 4ZKSU 1KXCA 1UW7A 1CT0E 3P8FA 2RCEA 2V3OH 4Q7XA 4BAOB 2SFAA 4BAHB 3TLOA 1EPTC 2ZDAH 4WMDA 2PWXA 4P00A 2XCNA 2PFEA 2QXIA 3TK9A 4ACBA 4XSKU 5KEDA 1G2MA 2BLQA 3ZZ3A 1S0QA 4AGKA 2GP9B 3C1KA 4CBNA 2BY5X 1P2IA 2H9TH 2ZQ2A 4A1VA 4O3TA 4YM9A 2J98A 1DM4B 2VH6A 3BTTE 3S9BA 5AHGH 3RU4D 2C4FH 1IAUA 4GUXA 3MO9A 3PWCA 1S83A 2F9NA 2SGDE 2ZA5A 3URDA 6GCHG 2J5UA 5F8ZA 2HVYB 1P10A 4FU8A 1F2SE 1EPTB 2W7SA 1EJNA 4FETA 3SV6A 1MABB 2KCOA 2H1UA 3SQHE 4BANB 1T8NA 4R8TB 1HGTH 1P03A 2K1QA 2EC9H 3QN7A 2IJOB 1O2XA 1A0JA 1GVKB 1O3AA 2QF3A 4ZH8A 1ZR0A 2DE9A 2GGVB 2R9PA 1TYNA 2JH5D 1EP5A 1HB0B 1O2PA 3DA9B 3FAOA 1SL3A 3F2FA 4CH2B 3AASA 1J9CH 3E90B 2GDEH 1DUEA 1YCPK 8LPRA 4IS5A 1BITA 3PRDA 1Z8IB 2FYQA 3VFEA 1C5LH 3ZZDA 3A81A 1C4U2 1ZTKA 2Y7XA 3GY3A 2Z7FE 1GBHA 1P06A 2OP9A 3A82A 5HM9A 2G5NA 1IQJA 2BD8A 3MU8A 3U69H 4ABFA 2ZGHA 3F1SB 4AOQA 2V7QD 1PPCE 1RGQA 1ZPCA 4IGDA 1BIOA 4I8HA 2BYAX 3KN2A 1OOKB 3K2UA 2A7JA 2C8YB 3SNAA 4YOJA 1LPZB 1H8IH 2BDHA 2UUYA 1TRYA 4NA8A 3ATKA 3ZYEA 1S6FA 2XW9A 3SNBA 2PGQB 1ZTLA 1GI0A 1O2JA 4QT8C 4X8SH 4RKOB 2J98B 3C27B 4MNWA 4O97A 1GI8B 2BQWB 6ESTA 1C5YB 1TNGA 1G37A 1NRPH 2BDAA 1W14U 2CF8H 1A7SA 2WV4A 3BF6H 3F3BA 3GY8A 3H7TA 5DP7A 1BMNH 3MU1A 5BPEA 1J16A 3CS0A 2CXVA 3MQKC 5K0HA 4CBOA 4MPVA 2ZCHP 4TY6A 1DXWA 1A3EH 4I33A 1VGCB 4A1TA 4DGJA 1ZRBA 1IQMA 3GY7A 4Z1MD 2ZPRA 3BG4C 1A4WH 2VIVA 2OUAA 1SLUB 1UHBA 3B9FH 2KFWA 2ZHQH 2QAAA 4IC6A 2TGPZ 4E06H 5EU8A 4F49A 1NM6A 2FEQH 1EP6A 3IG6B 1YPEH 2W7UA 5EXLA 1AVXA 5DO4H 2IN2A 2CN0H 1C2LA 5DPAA 1GMDG 2K0QA 4DIHH 4NA7A 5EG4A 3KYFA 1QFKH 1GI2A 4OS5A 3A7YA 3ZZ4A 2FS8A 4ZUHA 2AIQA 1DX5M 2V3HH 2OLGA 2CF9H 2VIDA 2PKAA 4CRDA 1OP8A 3F9HA 1QURH 3RXBA 1ZSJA 5H4IB 1Y3UA 1GJ7B 1VKYA 2GTBA 3KYGA 1T31A 3LJJA 3PMBB 3DFLA 2A5KA 2OC8A 2SNVA 2ZFTA 3GYLB 3I77A 5DK1A 4X1QU 1Y3WA 4XE4A 1HAVB 1QB1A 3SZEA 1RFNA 1XKBC 1HCGA 1WV7H 1MUEB 1SGEE 2EI8A 2ZHDA 3RXJA 2ILNA 2PKSB 2I6QA 1O3EA 1C5TA 1L2EA 3S9CA 1O3CA 4YO9A 1UK3A 2FPZA 1EZUC 4WXIA 2XBWA 2V3MA 3DSPA 4O9VA 2UUJB 1A5IA 3GCTF 4WVPE 1F5LA 2BOKA 5LGOA 1O3KA 2LPRA 4YOIA 2BLOA 3M5NA 2P8OC 3K6ZA 2PGBB 3UNSA 4B2BA 2DE8A 2QIQA 1YWUA 3MNCA 1PPBH 3RU4E 3MHWU 4MDSA 3RXGA 3M7QA 3BSQA 1ELVA 2AMPA 2J34A 3KGPA 4X6MA 1AFEH 4E7RG 1YF4A 3OEED 1Q2WA 1GBCA 2JETB 3MNBA 5T6GA 2ZGCA 3A8AA 4YXWD 8GCHF 1O2ZA 2PLXA 1QQUA 3CNRA 3F6UH 3RM0H 4K2YA 5A8XA 3A7WA 4ZHMU 2GX4A 1W0ZU 2HVXA 1ZSKA 1BRBE 2LNCA 2VIQA 3ZZ5A 4CR9A 1ETTH 5A8ZA 1O2RA 4U2WA 1JWTA 1AVWA 1WTHD 2TGTA 1JBUH 3TK6A 2OBOA 1JXPA 2WV5A 3ZVFA 2BOHB 3U1JB 1G2LA 3SNEA 1DITH 1ZPZA 4AYVB 2ZDMA 3OFND 6LPRA 4YT7H 2VU8E 3M37A 3LOXA 1GBTA 1GVLA 3PM3A 5FX5A 7GCHG 2Y81A 3K65B 1MMJN 4BTIB 3A80A 3SU4A 1DFPA 1OWKA 1YLNA 2XRCA 5HGGA 5FL7D 1CHGA 3T2NA 1DWBH 3KQCA 2BHGA 4AFQA 1Z8JB 4JCNA 2ESTE 3PV4A 1AKSA 1ZPBA 2NU2E 2WINI 3EYDA 2D8WA 2AH4X 3IITA 4GHQA 1HAHH 1XUJA 2NU1E 2ZCLP 3M3SA 4OS7A 2QE7D 5FPSA 4CHAC 2P3FH 4H6TA 3RC6A 2M5TA 2G5VA 2WPJS 1FIWA 2IOTA 2PP6A 1Y5AT 1QY6A 1V2LT 1G3BA 4BTUB 2ZTXA 5EJLA 2F91A 1IOEA 2VIPA 1TOCB 1GJ4H
chains in the Genus database with same CATH topology
4H6SB 2A4OA 1SGIB 3T29A 3T25A 3MI4A 3ZVGA 1LQDB 1GHVH 1LVYA 3MNXA 5E0JA 3KQDA 3DUXH 2OD3B 1TABE 1G32B 4FVDA 4JMYA 2EI6A 1P01A 4IMQA 3UIRA 3LGVA 4X1NU 1Z7KA 1IQNA 1XVMA 5A09A 5T6DA 3K6YA 4LZ4B 1O33A 4XBCA 3GICB 2GD4B 5JB8S 1TQ7B 2BQ7B 3SJOA 3MH6A 4B2CA 4ZXXH 1PPGE 1SLXB 1Z1IA 4MTBA 1C1UH 6CHAC 1UMAH 2J95A 1EATA 3DHKH 3VXEH 3SUEA 2FI3E 2SGQE 5L2ZH 1BA8B 2PSYA 1S0RA 4GCHF 2ZKSA 2DUCA 2HNTC 4DG4A 3PROA 1IQFA 1VR1H 5EPNA 1MKWH 1EOLA 2FLBH 4NIVA 1C9TA 3P8GA 3BTWE 4ISOA 3UTUH 1GBBA 2OC1A 3RC4A 2CHAC 2H2ZA 1FAXA 1EAXA 2Z9KA 3D23A 4O3UA 1D3TB 3TJOA 7LPRA 4JZEH 3R3GB 1DWEH 1J14A 2ZO3H 4XFQA 1V2JT 2SGFE 1CHOF 1YBWA 3NPSA 4UD9H 1DLKB 3OY6U 2HNTE 1BRCE 4IMZA 1O5DH 3PMAB 5ABWA 2FOHA 2OQ5A 1ZRKA 1IQGA 1GBKA 1KTTB 1FY1A 3O8RA 1FUJA 4AB8A 2VVUA 4CREA 3A85A 2G8TA 5FX6A 3SQEE 4Y71A 1FONA 3Q3XA 3F9EA 3BEIB 1GJDB 1TB6H 4FUEA 4Y0ZE 1RIWC 3V13A 2G4UA 1K1OA 2RA0A 1B0EA 1C1VH 1L1JA 2VGCC 2JH6D 3HKIB 2FM2A 4B76A 2FTMA 3GDVA 1MTWA 2PV9B 1C2DA 3GDSA 1WSSH 1XXDA 2FMJA 1HV7A 3PMHB 1C9PA 3PMJA 1AQ7A 5TCAA 1LPKB 4JZFH 1TE0A 3TITA 5SGAE 3LONA 1YPLH 1ABJH 1UTMA 3A86A 1LVOA 1HIAB 1CQQA 3ITIA 4FVBA 2WUCA 1J8AA 4K69A 1FN8A 1ZMJA 5DP3A 3ZZ7A 3BTFE 1QL8A 2A7HA 1AMHA 5GCHG 2HALA 1KXBA 1KXAA 3PO1C 1N6XA 2FI5E 4X1PU 1LO6A 3LH3A 1TOMH 3RXAA 2HPQH 2QN5T 4XOJA 2J2UA 3TVJB 1BB0B 2FX6A 1Z6EA 1UK4A 1SGFG 3N7OA 1DT2A 1SGFA 1A46H 1P11E 1YYY1 3LGYA 4YTAA 2A45B 8KME2 3KF2A 1O3JA 1W3CA 2Y80A 3E0NB 1GMHG 1TPSA 1W2KH 3ZVEA 1EOJA 2OC0A 1Z1JA 3A88A 1O2TA 5GXPA 4UFEH 4ESTE 3PO1B 1UTKA 4IN2A 4JZ1A 4ABEA 3M36A 1NESE 1TBRH 2H9EH 2ZDKA 2ZFSA 3A8DA 1TFXA 2WUBA 2AYWA 2VIOA 1SGNE 2NU0E 4UFGH 1MTVA 3SOSA 3QZRA 1SG8B 6GCHF 1XUFA 1C2EA 2ANKH 3BTHE 2TRMA 5G4BA 1ORFA 3VGCC 5GPIB 4MNVA 1LHDH 1V6DA 2Y5FA 1Y3YA 1DOJA 2Z9GA 2VH0A 2ZWLH 4AFZA 2ZTYA 3OU0A 1C2IA 1ZHRA 4ZXYH 1DXPA 1NY22 1O2KA 5CHAB 1P2JA 1O3BA 4WJG2 1C1OA 1MD8A 1C2JA 1BCUH 3CS7A 5EPYA 3S7HB 2TIOA 4CRBA 1E35B 3B8JA 1AZ8A 3ESTA 3P95A 1SLWB 1P04A 3MH5A 3E3TA 1C5NH 1THRH 1T8LA 3RXIA 3RU4T 1SBWA 3MTYA 2GCHG 1BTYA 1O2WA 1INCA 1Y3VA 1O3HA 1MD7A 1GHYH 2R3YA 1TQ0B 1QNJA 3LT3A 4ABHA 3PYHA 1K1NA 3E16B 1PQ8A 1SGYE 1ESTA 1CGHA 1LPGB 2ALVA 1HYLA 1BDAA 3MH4A 1MKXH 4A7IB 1DY9A 4NFEA 1Z8RA 3QGNB 3HATH 4INKA 1BRAA 3TJNA 1DSTA 3ZVBA 3O8DA 1O39A 3FVFB 1O36A 1W11U 4OS6A 5A0BA 4ABAA 3EE0B 2ZU2A 4D9QA 1C1WH 4SGBE 1AHTH 2A0QB 1F7ZA 2Z3DA 1UCYE 4B75A 1YPHE 3UOUA 1DWCH 1TGSZ 1Q31A 4AGJA 1AN1E 3LDXH 4K1EA 1P8VC 2BXTH 2AEIH 1TALA 2R3UA 1EZSC 3V0XA 1SB1H 1GDUA 1IQKA 3MNSA 1A5GH 1FY8E 2VVVA 1LDTT 1W7GH 1C5OH 1PJPA 1QRXA 5EODA 1TPPA 1NFWA 5E2OA 1AVGH 1C1PA 2ZC9H 1C2MA 2ZF0H 2ZFFH 2G81E 1ARBA 1C5RA 1GMCG 2ZPSA 5C5OA 3EQ0H 1L4DA 2RA3A 1ZHMA 2ZP0H 1GMDF 4JK5A 1O3FA 4I31A 2GMTC 3SU0A 1UTPA 1FQ3A 1O5CB 1EXFA 1XVOA 2WPIS 1BTZA 2EI7A 1GJAB 3CP7A 3GY2A 1JMOH 1N8OC 1IQEA 5EW2H 4Y8YA 2OCVB 4YZUA 2ZFRH 3M61U 1AE8H 3EGKH 2FOAA 2P16A 2W26A 1C2FA 1MAYA 2B9LA 2VIWA 3UY9A 1HPGA 3DD2H 4ABDA 1XKAC 5EQQA 2UWPA 2XYAA 3NCLA 1QJ1B 2G55A 2W3KA 4RN6A 4FUDA 2AS9A 3RXMA 1H9HE 3GISB 3U8RH 1F92A 4ZKNU 3PLBA 1KY9A 2QF0A 1X7AC 2GMTB 1VJAU 2GCTB 1TRNA 1GHWH 1NO9H 3STJA 1N8OB 1CU1A 5IYTA 4GVUA 1A3BH 3DFJA 3SUDA 1O35A 1FY4A 2J38A 1E0FD 1P2NA 3RC5A 1QHRB 4X1SU 5T3HA 4Z0KA 2B7DH 3TGKE 2BZAA 1HNEE 5EQSA 1EJAA 3D65E 1ELFA 4TY7A 1NRRH 3LC5A 4X2VA 1CBWB 1L1NA 3W95A 1S84A 1C2KA 2GZ7A 4KP0A 2BDIA 2FOCA 3SO3A 1GBEA 1FMGA 1F5RA 4XBDA 5JDUB 1CT4E 5B6OA 3E6PH 3PTBA 1GG6C 1VGCC 3MO3A 2BD4A 1O3GA 3RXVA 1ZMLA 3TJUA 1GBDA 4X2XA 2WPKS 1KTSB 4MNXA 1TLDA 4Z6AH 3FP6E 3V3MA 5DP9A 1EKBB 4AG2A 2VJ1A 1C4Y2 1O3MA 1LVBA 5ESBA 3WY8A 4UFFH 1HDTH 5FBEA 7GCHF 1GG6B 1GDNA 2C8ZB 2ODYB 2YNBA 5F03A 2J94A 1W13U 2FO9A 3O8BA 3LPRA 1VITH 1Z8GA 1A2CH 2ZHWH 1V2OT 3BEFB 1C5VA 1OPHB 2BVRH 1OXGA 1EAUA 4FUJA 2B5TB 3VPKA 1SSXA 3ATWA 5FBIA 3P8OA 1CSOE 2O8UA 4BAMB 4OGYA 1BJVA 4FUGA 2PKSC 3A7ZA 3SU2A 1SC8U 2A7CA 4CH8B 1BMLA 2O8WA 1UTJA 2BD7A 3SJIA 1GHBG 2NWNA 4ABBA 1A0HB 4HFPB 1ZJDA 1YCPH 3TNTA 3V12A 1JRTA 2BY8X 1QGFA 3STIA 2J92A 1TMUH 3ENSB 1DSUA 1RTFB 1RS0A 3BV9B 5BRRE 1TMTH 1AU8A 1FDPA 1O5EH 5FXLA 2JETC 2AMQA 4K1TA 2F83A 1HJ9A 1TA6A 3SJ8A 1OSSA 4FUBA 3S9AA 1CA8B 4FU9A 3QGJA 4DIIH 2PW8H 2O8TA 3LGUA 4GSOA 1YGCH 3RXPA 2ZGBH 3BTDE 5DP8A 2H5CA 5C67A 1G3EA 2V0BA 1QB6A 4MVNA 1ANBA 1MQ5A 5CMXH 1AUJA 1B5GH 2Z3EA 2Q6DA 1BTHH 3FP8E 2XBXA 1UCYK 2ZDVH 1V2QT 5C3NA 1RD3B 1UHBB 1QA7A 4X6PA 3KQEA 5TJXA 3SJKA 1L0ZA 4Y11E 3NK8A 1HAIH 2P3UB 1MQ6A 1YPKH 3QUMP 1WQVH 1GI1A 5JB9S 1OP0A 5FCRA 1HLTH 1EJMA 4Q2KA 3T27A 1HBTH 1RXPA 3RDZA 2WPMS 1ZOMA 1QL7A 4ZROA 2SGEE 5J4SA 1XUGA 2PKAB 3QO6A 1RTLA 1O0DH 1THSH 2FZZA 1ELBA 3SU3A 2THFB 5TCCA 3HPTB 3U98H 3P8NA 2R2MB 2F3CE 3O8CA 5DKMA 1GJBB 1ABIH 1Y5BT 2V6NA 3MWIU 1HFDA 1ELTA 1QJ6B 2ZHEH 4PROA 1LTOA 4IW4E 1BJUA 1GDQA 4YESB 2BY9X 2FIRH 1TNKA 1HAGE 2BZ6H 1TGNA 3UR9A 1HUTH 1NFUA 1F0SA 1O3NA 2Y5GA 1TNIA 2VINA 3RMMH 3VB4A 2D2DA 2F9BH 2BMGB 2AIPA 1CGJE 1MZDA 3TK5A 4BXSA 1GI7B 1MBQA 3ELAH 1EASA 4WF8A 3OTJE 3SZNA 1TRMA 2P93A 3A83A 4WH8A 1QL9A 3RXLA 3LGTA 4THNH 4Y8ZA 4NWKA 3VB3A 3HK3B 3RMNH 4K3JA 5A8YA 2G52A 1UVSH 1ZZZA 1O2IA 2HWLB 2TBSA 1P57B 2P94A 2QYIA 3RXFA 4BTTB 5AVDA 1OYTH 5GCHF 1UCYH 5A0CA 1GJ4H 1GJCB 2Q1JA 1D6WA 3SUFA 2XWAA 1GJ5H 4RSPA 1VITG 4A6LA 2YNAA 4D76A 1GJ9B 1PPFE 1KLIH 1TPOA 4MNYA 2C93B 1F0UA 2D1JA 3BIUH 3UQOA 3BTGE 2A4GA 3AAUA 1GMHF 3M3VA 2FP7B 3OX7U 1WYKA 1TX6A 3RP2A 1K1LA 1C5SA 1V2WT 1MTUA 4NWLA 3MMGA 4Y79A 3H5CB 2TPIZ 5FPTA 2B8OH 1GI3A 2XNIA 4K8BA 4NA9H 4Y8XA 4ZKRU 1NU7B 1BMMH 1H1BA 1AKSB 1P2MA 1C1QA 4AX9H 4VGCC 2A2QH 2VB0A 3EA9A 4ZHLU 4FU7A 4ZAEA 3TU7H 1QRZA 3F68H 4H4FA 2KAIA 2XBVA 4YT6H 3UNQA 1M9UA 1MH0A 1O3DA 2SNWA 2JKHA 4K1SA 1O2MA 1ARCA 2RG3A 1EB1H 1D9IA 1K2I1 2BX4A 3A89A 1MCTA 2BD2A 1OWIA 2RDLA 1QIXB 4Y10E 4WMFA 2Q6GA 3L6PA 3M5OA 3MU5A 3OYPA 4WWYA 1LHFH 3FFGA 4INLA 3LC3A 3M3TA 4OS1A 4BNRA 4JYUH 2PTCE 2OTVA 9LPRA 2ZTZA 1HRTH 5AFYH 2C3SA 1IHSH 3A84A 5JBCS 3ODFA 4SGAE 4VGCB 2PTNA 3L3TA 1ANDA 4HZHA 2GCHF 1L1GA 4AZ2B 1UVTH 3MU4A 5DJ7A 5HM2A 1TGBA 1KDQA 3BTME 1C1TA 4B2AA 1AUTC 1TNLA 2GZ8A 3RXEA 1G30B 4CRAA 3G01A 1UK2A 4D7GA 1BZXE 2BD5A 4ISHH 1O2NA 1S6HA 1A5HA 1YLCA 3HK6B 3RM2H 1MTNC 3Q3YA 1O2VA 5C5NA 3U8TH 3JZ1B 4KKDA 1AFQC 4LOYH 1JOUB 1UJ1A 1UTQA 1XX9A 5C1YA 4ABGA 1YP9A 2OQUA 3T5FH 5J4QA 1EZXC 1EZQA 2BLVA 1QBOA 3MU0A 5T6FA 1XXFA 1QB9A 1DUAA 1GHXH 2VNTA 3ZZ8A 2J9NA 1AB9B 1AZZA 1C5UA 2VWLA 1WUNH 4E7NA 5CE1A 2XC0A 1MTNB 2BD3A 1UVPA 2ZFQH 3S7KB 4NZLA 3GCNA 1AFQB 4WY3A 2WPLS 1TBZH 1NRQH 1H4WA 1P9SA 3SV8A 1KLJH 3OSYA 1TPAE 1GMCF 1P3EA 2FYRA 1ELEE 4CRFA 2ZDNA 1TAWA 4JZDH 5CHAC 1V2NT 2Z9JA 2F9VA 2F9OA 1Z71A 2C8WB 3SUGA 1SOTA 1BBRE 1SQTA 4ISIH 4MPXA 1V3XA 3UNRA 1O2GH 1BT7A 4JYVH 4AB9A 1E36B 2GDDA 1KDQB 1G3CA 1RRKA 1VCQA 2BVSH 1TNHA 1FPCH 1NFXA 1W8BH 3Q00A 1A1RA 4OS2A 3ZZBA 2FDAA 1FJSA 1LKBA 5AFZH 1EUFA 1T8OA 3GY4A 4TWYA 2NU3E 2ANWA 1DICA 1XUHA 3FZZA 2OBQA 2C90B 1K21H 1O3LA 2ZQ1A 1NU9A 1AD8H 1V2VT 4X1RU 1AIXH 2Z3CA 1W0YH 1H9LB 5C1UA 1PYTD 3V7TA 3ZYDA 1C1SA 2WYJA 1KXDA 1SFQB 2AGIX 3SGBE 2BDCA 3VEQB 1TGTA 1P9UA 1QTFA 1KYNA 1ETRH 4MQAA 2PSXA 1PPEE 2QGRA 1DDJA 1AO5A 1QQ4A 1ELAA 2BDGA 1QA0A 2VWMA 4Y7BA 3H7OA 3P92A 4J2YB 1TBQH 3A87A 2Q6FA 3RXRA 1NPMA 3QTVH 2OINA 1P02A 1SMFE 1EPTA 4ZKOU 1N1LA 1UTNA 3RXCA 2BDBA 1O30A 1S82A 2STAE 2FXRA 3SV9A 1F0RA 5EW1H 4RKJB 2PUQH 4X2WA 4X8TH 5GDSH 1CO7E 5K7RA 3A7TA 3KCGH 1P2OA 4DJZB 1QBVH 2NU4E 2BY6X 1J17T 3W94A 3AW0A 5L2YH 3A7VA 3TJVA 4I8LA 1LKAA 1LCYA 3GCHB 3QX5H 2B0FA 2ZGXH 4Y76A 1BOQA 1DANH 1EB2A 5EQRA 4OS4A 1SFIA 1SGTA 1OP2A 4IC5A 1OYQA 3HKJB 3R0FA 1F5KU 4FUCA 4X8VH 5JPMH 1O31A 4K8YA 4U30A 3KIDU 1ESBA 4A5TS 2XBYA 1FV9A 4FUHA 1TONA 1GBMA 1HXEH 3S0NA 2GCTC 3AAVA 1GHBF 1LHEH 3MH7A 4KGAA 4CR5A 1V2KT 1SGRE 3PB1E 3KNXA 3ZVCA 1UVUH 1C4V2 1CT2E 3SU6A 2QCYA 2ZGJA 4NZQA 2EA3A 3A8CA 4TPIZ 2HOBA 3VB7A 4JK6A 4NG9H 5L30H 4HGCA 4ISLA 2A32A 2ZPQA 3I29A 1QBNA 2GV7A 3SV2H 1CBWC 1TMBH 2AERH 3LU9B 3RXSA 1JRSA 1E34B 1HAYB 1TNJA 2H5DA 4X6OA