2YNBA

Crystal structure of the main protease of coronavirus hku4 in complex with a michael acceptor sg85
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-LIKE PROTEINASE
publication title Inhibitor for the Main Protease of Coronavirus Hku4
rcsb
source organism Tylonycteris bat coronavirus hku4
total genus 87
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2ynbA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ynbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ynbA02
1Q2WA 1BTHH 4K2YA 2P3FH 1YCPM 1WQVH 3O8RA 4GAWA 1WBGB 1TMUH 2IPHA 1UTKA 1UHBB 5BPEA 4BTUB 3TGJE 4WJG2 2SGQE 1JMOH 1XKAC 1DVAH 4I8KA 2NU0E 3RMNH 1ZOMA 3KQBA 2PWXA 9LPRA 1HNEE 5DP4A 2FODA 2BDBA 3SV2H 1C2GA 2BM2A 4JMYA 1RXPA 1D6RA 2F9VA 4K60A 1QGFA 1P11E 2ILNA 3U9AH 1HJ8A 4NCYA 5GXPA 1UVUH 1D3TB 3HKJB 1AB9C 2EI8A 3BTHE 1QURH 4I7YH 1HFDA 1OPHB 4X2XA 1AFEH 1HRTH 2PLXA 4H6SB 3LC5A 1AZ8A 1MAXA 3KQDA 1LHGH 3I77A 1B7XB 1UJ1A 1V2KT 2C90B 4CRGA 5EOKA 2GD4B 2FDAA 4X2VA 3LU9B 1KDQB 1YP9A 4X1PU 3PWCA 3QZQA 1IQGA 1ZMLA 3S7HB 1P57B 1QFKH 1LQEA 2BDGA 3DA9B 5DGJA 1WTHD 4ABEA 4X6NA 1A0JA 4GLYA 1UTMA 4MNWA 1TALA 4YM9A 5LPEA 1L1NA 1C1VH 4YTAA 2GV7A 1NPMA 3ZZ5A 1MQ6A 1AIXH 1BMNH 2OBOA 5AHGH 1P2IA 1QJ6B 2Z7FE 2HNTE 2O9QA 4IMQA 3LDXH 2A5KA 5CE1A 1GI2A 2NU2E 3ZV9A 1DM4B 1MTSA 4O03A 4Y8ZA 9ESTA 1DICA 1UK4A 1GBDA 3A8CA 1XMNB 5A0CA 1ZSJA 1OWJA 2ZGJA 1RIWC 1YPHC 4HGCA 1O2OA 4H42U 1MD8A 3SORA 1ZPZA 1Q31A 1W13U 4KGAA 2J94A 1P06A 1AO5A 3MH4A 3GDUA 3IITA 4DY7B 2CN0H 2F3CE 1E38B 3RC5A 3ZZ9A 3SOSA 3UFAA 1ZTJA 2QIQA 3A80A 1AY6H 1GJBB 3GOVB 3BV9B 3TJVA 1TLDA 2ASUB 3RXIA 1TGSZ 4DIHH 2EC9H 1SMFE 4BOHA 3RXMA 1C2EA 5TJXA 4B2BA 4O97A 3H7OA 1JBUH 4KTUA 4RKOB 2CHAB 3A8AA 1HGTH 2P95A 1C1MA 1IQIA 1DXWA 1W2KH 2WUBA 4Y0YE 1QNJA 1DLEA 1PPEE 5JPMH 2GV6A 3MNXA 1T32A 4CR9A 1LDTT 1NRQH 4SGBE 3NK8A 1O2WA 1AHTH 3RXKA 1FMGA 1SLVB 1VR1H 1FN6A 2TBSA 4KTCA 1A5GH 5DP5A 3S9AA 4F49A 5A2MH 3LGTA 6CHAB 4B2AA 2ZCLP 3PLBA 3S9CA 1BTPA 2FWWA 1TMTH 3SJIA 1S82A 1YKTA 2B0FA 1AVWA 2GKVE 1D6WA 3PO1C 3BF6H 7LPRA 2A32A 5C5NA 1CU1A 1TX8A 2BY9X 2AGIX 3SZNA 3BTEE 3P92A 1H8IH 2PKSC 3N7OA 1EUFA 1HJAC 2XBVA 1NO9H 1AI8H 1F5RA 1P9SA 1GGDB 1KIGH 3TK5A 4XOJA 1IQHA 1RGQA 2ZQ2A 5IYTA 4IC5A 1O2UA 1O2MA 7ESTE 2Y82A 5T6DA 1E36B 1LVYA 1ZPCA 4XE4A 1DSTA 2ZFQH 1TNJA 1C1QA 4MPVA 1ELGA 1GJDB 1SGFA 2HRVA 4AG2A 2B8OH 2HNTC 3SI3H 1DWEH 3GY7A 1A2CH 2YNAA 1EPTC 4JYUH 1JIRA 3BTDE 1HLTH 3E3TA 2BDIA 5L2ZH 2BDHA 3VGCC 1OSSA 1YF4A 1FJSA 5JBBS 4X6MA 1BTYA 3U8TH 1FI8A 4WXIA 3U98H 3UOPA 4GUXA 3SUEA 3NKKA 1ZMJA 2Q6DA 1Y3YA 3BG4C 1KXBA 3ATKA 1TMBH 1CBWB 3GY6A 5DP7A 2ZDLA 1FZZA 2W26A 5JYIA 1XVOA 3VEQB 3ZZ6A 3AW0A 4INHA 2YOLA 5FXLA 4D8NA 1YPKH 4CBOA 1ESAA 3SQEE 2OP9A 1W11U 1GJAB 1P3CA 1XVMA 1C1NA 2P16A 3QGJA 4XBBA 3ITIA 4BXSA 1T4VH 1XUIA 1KLJH 1QR3E 5E0HA 4X6OA 4X0WU 1ZGIA 3NZIA 5L30H 2GT7A 1THRH 2ODPA 2GX4A 1DY9A 1SR5C 1VITG 4K8YA 2GMTB 2OD3B 4ZKRU 3K65B 3V3MA 1NRSH 1EOLA 2R2WU 3F1SB 4NA8A 4D7GA 1ZPBA 3ZVDA 4I8GA 1J14A 3PMHB 1MBQA 1TRYA 3V13A 1A1RA 5FPSA 3L6PA 3LJJA 3A85A 1EJAA 3ZVFA 3RLWH 2FYRA 2HPPH 1C5RA 4ASHA 3RC6A 1NT1A 2PHBA 2VGCC 2VWOA 1Y5BT 2GZ9A 1YPEH 2F9NA 2ANKH 2JH5D 2FMJA 3MU1A 5GWZA 1O5BB 1ARCA 1ELTA 2WV4A 3ZVAA 4UFDH 3RC4A 5DP6A 3RXRA 1P2MA 2BD5A 1C2JA 3EDXB 2QF0A 2GCTB 4AB9A 3ZVGA 3QZRA 1ANBA 2H2ZA 3PB1E 1SGCA 1MTVA 5CHAC 2ZU5A 3SJKA 2O8UA 1V2NT 1BBRH 1SGPE 3GCTG 1V2JT 2ALPA 1WYKA 1EPTA 1JIMA 4MG3A 1KXAA 4LXBH 5GDSH 4AFZA 3BG8A 5HYOA 1HXFH 2TRMA 1KTSB 1NY22 1QQ4A 1FN8A 1LVOA 1K9OE 4LK4A 4MNYA 2VIVA 1K1PA 3U8RH 2PFEA 5FX6A 1PPCE 1EASA 1Y3WA 3SU4A 5C5OA 1C2LA 3DHKH 1O32A 3MFJA 6LPRA 3RXCA 3ELAH 3ATIA 1ELDE 2I6QA 2WINI 2FIRH 2PSYA 2ZA5A 3KCGH 3BTTE 3TJOA 3TVJB 1EJNA 2XC5A 1VITF 1OWDA 1AD8H 4FUDA 1TRMA 2BLVA 2ZC9H 1HAVA 2D26C 1SI5H 3E0PB 1ARBA 4DGJA 1G3DA 3RXEA 1K22H 1GWAA 5C1XA 3DFLA 1O2HA 4IBLH 4CRDA 3M37A 4FUEA 3Q3XA 2B7DH 1SG8B 1UVPA 2VIPA 1PQ8A 1TOMH 4B1TA 1K21H 2AFQB 4CR5A 2Y80A 2ZGHA 4Y8YA 1F0SA 2XNIA 1GI4A 2ZGXH 3RXQA 2WV5A 1HB0B 3O8BA 1W7GH 2ZPSA 2PTCE 1YPJH 2H9TH 1AKSA 1VZQH 3SUDA 4AYYB 3Q00A 1O2LA 2TGDA 2GCHG 1EAXA 5EXMA 3W95A 1ETSH 2BD9A 2BX4A 4CBNA 1F0UA 3TK9A 1NC6A 1W7XH 3E8LA 4X6PA 1A46H 1SQOA 3GCTF 2STBE 2G00A 1O3DA 3PMBB 1VGCB 3M3VA 3A82A 3SUGA 4ABAA 1O3JA 1C5QA 1S0RA 1TAWA 5T3HA 4D9QA 1GJCB 1PJPA 5DJ7A 1OP8A 2Q6FA 4IC6A 5DP9A 2V35A 1AZZA 1SPJA 1S83A 1BOQA 4VGCC 1KXDA 4UFGH 1Z1JA 2AH4X 1XXFA 1TFXA 2J4IA 1J9CH 1YC0A 3MU8A 3SHAH 3BTGE 4DURA 2C8XB 2WPLS 3G01A 3NXPA 5EGMA 3FAOA 4A5TS 5LPRA 2AIQA 4AYVB 4WH8A 2VIQA 1P03A 1T4UH 2CHAC 5FBIA 3SO3A 5PTPA 4ZMAH 4ZXYH 3QTOH 1O35A 1LVMA 2XYAA 1GBTA 2VINA 1QL9A 1DT2A 2ZI2H 1TNLA 5AFYH 1DE7H 3GISB 1A3BH 2CMYA 1W3CA 1UK3A 2P94A 2ZWLH 2O8LA 1Y59T 1EZQA 3BN9A 3RXAA 4XDEA 2HGTH 4D9RA 1BZXE 1GBIA 3T26A 2AGEX 3MNSA 1CQQA 1GG6C 1O3NA 3GCOA 4ZAEA 4ABBA 4YESB 5A09A 1E37B 2ZHWH 4GCHG 4X2YA 3UOUA 2SNVA 1TQ7B 1TX6A 2BLOA 2GCHF 1K1MA 1QRXA 2FLRH 3T5FH 3P6ZB 1AVXA 3GCNA 2BVXH 1NFWA 4PROA 1HAVB 1C1TA 3VB5A 2Q1JA 2ZZUH 4LZ1H 3PTNA 4DIIH 4AGJA 3UNRA 1ANDA 2R9PA 1FUJA 1INCA 4ISNA 1NFUA 2SGEE 3S69A 1MKXK 2GP9B 1O33A 3GCHB 1PQAA 2QXJA 3MNCA 4Q80A 1OYQA 1T8OA 2Z9GA 1BUIA 2OTVA 3SQHE 4AOQA 1VCWA 1NN6A 4Y76A 2VVCA 1CE5A 3R0FA 1NRRH 4KTSA 1V2WT 3JZ1B 1HIAA 1O2TA 4ZHAA 3ATWA 4UDWH 1LHCH 3UNSA 1F7ZA 4CHAB 1C5LH 1O0DH 1ORFA 3A89A 3I29A 4I8JA 3U1JB 4E7NA 2FS8A 2JETC 1BB0B 2HPQH 4R0IA 3K6YA 2PKAB 1D4PB 3STJA 3PYHA 4YLQH 1AVGH 1C5TA 1GCTC 2ZTYA 3DUXH 1GMHF 2A5IA 3RMMH 3QK1A 1F2SE 3M36A 3MI4A 1TONA 1TPPA 3BEFB 1W0ZU 4DJZB 8GCHG 2EI6A 2UUFB 4OS7A 2ZO3H 2JKHA 2R3UA 1CVWH 3S9BA 3EYDA 1GI5A 2BDAA 3SV6A 4BXWA 3VB7A 1EZSC 1VJ9U 5E2PA 1UVOA 3TLOA 1AFQB 1O38A 3P8OA 3Q76A 3NPSA 2SGFE 4JK6A 1LPGB 2WPHS 2ZCHP 4A7IB 1RTKA 3NWUA 4GCHF 2QA9E 2Y7ZA 3SNDA 2BMGB 1EQ9A 1QRZA 1CGHA 3HKIB 4X1QU 5A8XA 1QL8A 1O2IA 3RM0H 2H5CA 1BJUA 3TJUA 1QBOA 4Y8XA 5L2YH 2GGVB 4NWKA 1NU9A 4YT6H 1ELCA 2ZTXA 3GYMA 4ZKSU 4Q7ZA 2SGPE 2ZKSA 4BAKB 3ZVBA 5I46H 4WVPE 4ABHA 5JBCS 1O2RA 1MTWA 1O5AB 3SV7A 1TIOA 4OS4A 1D3PB 1EOJA 2GZ7A 4WMFA 4BTIB 2KAIA 1O31A 1JOUB 2Z6BD 4B74A 1XUHA 2BDYA 3LJOA 1X7AC 3MH7A 4XBCA 5JBAS 1O3KA 3VXFH 1EP6A 2QY0B 3M3TA 1GJ4H 2ZFRH 1P05A 3VXEH 2ZG0H 4NFEA 4NWLA 3SNEA 4ZROA 1JXPA 1Y3UA 1OWIA 1XXDA 5DKMA 4JZIA 2VJ1A 1DOJA 5DG6A 5EU8A 3BEIB 5A8YA 3MWIU 5AVDA 3H7TA 4RKJB 4BANB 2Z3EA 1CA8B 1ZHRA 1G37A 1V2TT 1TB6H 3B23B 1TX7A 2C3SA 4MQAA 3CS0A 2AMDA 2OQ5A 1BTUA 2AMQA 3AAUA 1A7SA 4HZHA 3LGYA 1HAGE 8GCHF 5DO4H 3E91A 3MU0A 1GVLA 1WQSA 3A87A 1PQ7A 4BAOB 4ZKOU 4K8BA 3M7QA 1IQMA 2BD7A 1DX5M 1B0EA 3SGAE 1GBFA 4DOQA 1ZTLA 2OCVB 3VB3A 3UQOA 1UTLM 4GSOA 4AFSA 8ESTE 2XBWA 1VJAU 3PMAB 5LH8A 4DVAU 1L0ZA 1JRTA 2Y81A 4U32A 2H5DA 2AERH 2ZIQH 1EX3A 3PROA 2DE8A 2YNBA 1DWDH 2ZPQA 4B71A 1NS3A 4MLFB 3SBKA 3MOCA 5FCKA 3FZZA 3TIUA 3QUMP 1BJVA 1ELBA 2RCEA 3T62A 1QB1A 1P2QA 1T8LA 3PLKA 1C1SA 4K69A 1YGCH 4ISHH 1M9UA 3A86A 4FU8A 3HGPA 5EQRA 1GBKA 3MO3A 3KNXA 4YOGA 2QF3A 1DITH 1JWTA 3D62A 1GI3A 1P2OA 1FAXA 5FBEA 2P8OC 2TGAA 1A4WH 1V2UT 3TNTA 1O36A 1GBAA 2ZFTA 1FY1A 2FM2A 1QB9A 1UCYE 1ZZZA 2ESTE 3URCA 1ELEE 5AFZH 4GVUA 4MDSA 5E0JA 1P12E 8KME2 3F9GA 1E0FD 1IHTH 5EQQA 1C2MA 1SLWB 1TA6A 3QGNB 1C5MD 4OS6A 1GBJA 4O9VA 1IHSH 3MNBA 3RXDA 4NA7A 1C9TA 3OU0A 1EB1H 1SGDE 4FUHA 4WMDA 2J92A 5F8XA 1H9IE 1BCUH 3DT0H 2ZNKH 1V2MT 3TGKE 6ESTA 1TGCA 2Z3DA 2ZDMA 1DDJA 1OKXA 1O2KA 4E05H 2G51A 2F9UA 1OYTH 2PUQH 4NIWA 4TPIZ 3A8BA 5SGAE 1ABJH 1A0HB 3RM2H 1C4V2 3BTWE 1Y8TA 2R3YA 2ZU1A 1FQ3A 1ZSLA 1SGQE 1C2IA 1C5ZB 4ZH8A 5F03A 3RDZA 1BTXA 1TNKA 1RJXB 1DWBH 2OINA 1TBZH 2A4GA 4IW4E 1Z8RA 2BD8A 1NRNH 1SQTA 3ATMA 3DFJA 1O3PB 3PM3A 4FXGH 1F5KU 2K7XA 1ZMNA 4YT7H 1BRUP 3O8DA 4YOIA 1O2XA 1O2GH 1MU6B 4ISIH 2ZF0H 4TWWA 4ZHLU 3TITA 1AQ7A 1J17T 1FIZA 4TYDA 4XBDA 5EXLA 3ZV8A 4Q2KA 1SLXB 4O3UA 1MAYA 1C5UA 3UY9A 3RLYH 1WAYB 2J95A 3QN7A 1ZSKA 3LONA 1O5DH 5GCHG 5FCRA 4WH6A 2XTTB 3SU2A 1LQDB 1TGBA 3RU4D 2K1QA 1MKWK 4HTCH 3IWMA 3SGQE 3ZYDA 4TY7A 1NZQH 4YO9A 1RTLA 2V3OH 3T29A 2BX3A 1S81A 1IQKA 1BTWA 4Y0ZE 1O2PA 3MYWA 1HDTH 3T28A 2G81E 4CRFA 2VVVA 2AEIH 4JZEH 2A5AA 1UVSH 3A8DA 3ZZCA 3V12A 3MHWU 4TY6A 1O5GH 1A5IA 1EJMA 1TRNA 4MPXA 1H4WA 4X8SH 3M35A 3UQVA 1PPBH 3DD2H 1HJ9A 1ELFA 1AB9B 1CA0C 1V2OT 1V2LT 4TPYA 3BIVH 3TH2H 5AF9H 1MTNC 4NIVA 1PPZA 1AWFH 1D9IA 2ZFPH 2STAE 4FUBA 2VIDA 3KL6A 2FOAA 1MZDA 1SGRE 2BTCE 2FP7B 1YPLH 3RXSA 1TPSA 2HALA 3OX7U 5TCCA 1J15A 3I78A 4NG9H 3CENA 1G2LA 3ODDA 1W0YH 3UR6A 4X1SU 1QCPA 1S0QA 1O3LA 1CSOE 1NM6A 1TBRH 4B73A 1EZUC 4IN2A 1BHXB 3SHCH 4KKDA 1PPFE 1H9HE 2A45B 2VH0A 1MU8B 4HI3A 1SFIA 4NSYA 2V0BA 4QT8C 1AN1E 1FIWA 3AAVA 2QV1A 1H9LB 1KLTA 2XCFA 2FEQH 4UFFH 3Q3YA 3ZYEA 3QO6A 3SU6A 1RIWB 1P8VC 2OXSA 1WOFA 3MTYA 3OTJE 3PWBA 1T7CA 5GCHF 1THPB 5FPYA 1AUTC 4BAHB 2DE9A 2C8ZB 2H9EH 1LMWB 1Z6JH 1VCQA 2AMPA 4BAQB 3A7TA 1O2NA 2ZU4A 3MMGA 3UPEA 4AGKA 3A84A 3P8FA 4NGAH 4BTTB 4D7FA 1C2DA 1ZJDA 4DW2U 2ANWA 3T27A 3AVZA 4YOJA 1GL1A 1HYLA 1N6XA 3QLPH 2FOGA 4CH2B 3SU1A 4ZUHA 2W3KA 3M5MA 3D23A 4KELA 1C1WH 3FP8E 2A7HA 3ESTA 3H5CB 3TGIE 1GBEA 1O2JA 1Y5AT 2QAAA 1OS8A 5C2ZA 5C3NA 4ISLA 5FX5A 2ZGBH 1DS2E 3UR9A 1CGIE 4OGXA 2EA3A 2Y7XA 1TNIA 2SGAA 1C1PA 1LHDH 3TH3H 2G4TA 1LPZB 5DP8A 1MBMA 5ETXA 2XWAA 2Z9LA 1H8DH 2A2XH 1TYNA 4I33A 4A1XA 2QCYA 1GHAG 1O5FH 5I25A 2F83A 1O39A 1QBVH 2LIZA 2UWLA 1GL0E 3EAJA 4FVDA 2FOBA 5E2OA 1FLEE 1P2KA 2GDEH 2ODYB 4JZ1A 4NIXA 2ZFFH 3D49H 5TCAA 1WCZA 1O3AA 1BMLA 2XBYA 1Y3VA 3EE0B 4LZ4B 4ABJA 2XWBI 2Y6TA 1TWXB 3PO1B 2ZHQH 1MKWH 4WY3A 3LH3A 1HAIH 2JH6D 1O5EH 4I8LA 4IN1A 1C2HA 3LIWA 1ZR0A 3BTQE 4AFUA 2PKSB 2RA0A 5EODA 3LOXA 1F92A 1HJAB 1SL3A 2WPMS 5HM9A 2Z9JA 3ODFA 1TE0A 2Y5FA 1PFXC 3SUFA 2FOHA 4NIYA 5FHTA 4RN6A 1UHBA 2FOFA 1ZYOA 1Y3XA 2WPKS 4YLUA 3FP7E 2G52A 2PGBB 1S6FA 2XC0A 4I31A 5F8ZA 1ANEA 1MCTA 1GJ6A 1EAWA 3RP2A 2RA3A 5J4QA 4A92A 3LPRA 1C5VA 2QYIA 2NU1E 4K3JA 4OGYA 5FPTA 1ESBA 2AGGX 1GJ5H 1V2RT 2QGRA 2R0LA 3GY5A 1NU7B 1EPTB 1S6HA 1Z71A 1HPGA 3KF2A 1HBTH 5JB8S 2G55A 2LPRA 1DANH 1ZHPA 2D2DA 2BY5X 1CGJE 1ZJKA 5EG4A 5T6FA 4THNH 3VGCB 1MMJN 1QY6A 2NU4E 4GHTA 1S85A 1PQ5A 1D3DB 1QHRB 2FI5E 1UMAH 1GHYH 5GJ4B 1KDQA 3NCLA 1GHAF 1ABIH 3QX5H 1F5LA 5A0BA 3BG4B 3F68H 6CHAC 1HAHH 1LKBA 1THSH 5K7RA 1OP0A 3IG6B 2ANYA 3OSYA 1Z8JB 2ZHFH 5LGOA 1GI6A 3GYLB 5T6GA 2FS9A 4K1EA 6GCHG 2DUCA 3JZ2B 5DK1A 4X8TH 1U6QA 2ZDKA 1GBLA 1P10A 4R8TB 4Y10E 1OWKA 4AX9H 3E0NB 1GGDC 3SW2B 3M5OA 1IQFA 4XSKU 2VU8E 5IDKA 4B76A 1L1JA 1G2MA 1XUGA 2PUXB 2ZEBA 3GY3A 4MTBA 3F9FA 1C5NH 2TGPZ 1TGTA 1EAIA 3K9XB 1QQUA 5BRRE 2PR3A 1AE8H 4JYTA 1AKSB 3VPKA 3AASA 3KHVA 1SBWA 1O34A 2VGCB 2WYGA 2I6SA 4A6LA 5F6MA 2XW9A 1GVKB 4U30A 1HCGA 2ZGCA 2UUJB 1KSNA 3URDA 5ESBA 3SV9A 1EZXC 3TPIZ 2A1DB 2PSXA 1GHVH 2FOEA 3K2UA 1FPHH 2G5NA 1QJ7B 2VIOA 4X1NU 3LKWA 1NESE 1G9IE 1SGYE 2QC2A 3W94A 2BVSH 3LC3A 3SV8A 1KXCA 1A0LA 1A3EH 3VFEA 5CHAB 1SC8U 3TNSA 2ZDVH 1SHYA 1L2EA 1GHXH 4ISOA 4M7GA 1CBWC 1QBNA 1NROH 1O2YA 4X8VH 1VITH 2FYQA 1B5GH 1HV7A 1GI7B 1SGEE 4AFQA 1MQ5A 5J4SA 3TK6A 1GJ8B 5EQSA 2A2QH 3SGBE 2BD4A 3GY8A 1P2NA 3D65E 2FI3E 1N1LA 4U2WA 3V0XA 4WMEA 3ZZ8A 3RXBA 2D1JA 3LGWA 2J38A 1YYY1 2TPIZ 1SHHB 3P8NA 2UWPA 5A0AE 1W12U 2BVRH 3C1KA 3HATH 1UK2A 1KXFA 1ELVA 2ZP0H 2GMTC 1XX9A 6GCHF 2G5VA 4NZQA 2QXHA 1YCPK 1SOZA 1V2PT 2AIPA 2VNTA 1V6DA 3OY5U 4B75A 3MO9A 2RDLA 1CT0E 1RD3B 1TABE 1MD7A 3K6ZA 1O2ZA 1FPCH 1GBBA 1W8BH 4Y11E 2GT8A 1H1BA 2A7CA 2JH0D 2SFAA 3TJNA 5ESTE 1Y5UT 1C5OH 3PLPA 3A7ZA 3MO6A 5ABWA 1Q3XA 2F9OA 4FUCA 3E90B 3PMJA 2CF8H 4IGDA 1DPOA 1K1NA 2BQ7B 3A81A 2GCTC 1HXEH 5EPNA 2BZ6H 1JRSA 2BDCA 4NSVA 4I32A 2BB4A 1PPGE 1ETRH 4INLA 1FV9A 3ZVEA 3EGKH 1BITA 1O2QA 4K5ZA 4ZHMU 1C1OA 1LTOA 3GDSA 1E35B 2XXLA 1TGNA 3FFGA 1XUFA 3LGIA 1B0FA 2SGDE 4JCNA 7KMEH 1GJ9B 1ZHMA 2QN5T 1HIAB 4NZLA 1EAUA 3RUOA 3OY6U 1S84A 4AG1A 1SQAA 1BA8B 1BTZA 2HLCA 5HXFA 3UUZA 1CHOG 1UCYK 1O3IA 3UTUH 1K2I1 1SB1H 3RXLA 2BOKA 3B9FH 2PV9B 1MKXH 2VWMA 1J16A 1UTPA 3KEEA 1BIOA 4VGCB 1ELAA 1C2FA 1EXFA 3UIRA 3LGVA 1SOTA 2A31A 1UTOA 2R0KA 4FUIA 2WUCA 4Y6DA 1HAXB 2W7SA 2P3UB 2BXTH 2BHGA 4IMZA 4GHQA 3S7KB 3ZZ7A 2FOCA 1C5WB 4FU9A 4Z0KA 3SNCA 2QXIA 1C5XB 1GI8B 1GI0A 2O8MA 3WY8A 3BSQA 2OQUA 1YM0A 4UEHH 1TNHA 2Y5HA 2C4FH 3RMOH 3T25A 2IN2A 4ABFA 1WV7H 2VB0A 5DPAA 2WPIS 1GDQA 2TGTA 2XRCA 1GHWH 1QJ1B 4K1SA 2Q6GA 5JDUB 1G30B 1KTTB 1L4ZA 2ZDNA 1DLKB 4HFPB 4JZDH 3V7TA 2B5TB 4AZ2B 2P3TB 3R3GB 3MU5A 4SGAE 1QIXB 1TQ0B 4X2WA 5FAHA 4UE7H 1BMMH 3VB6A 1P09A 3T2NA 1C5YB 1GG6B 3FP6E 1WUNH 2FO9A 1BBRK 5H4IB 3UWIA 1N8OB 3BEUA 4GPGA 4XFQA 1O5CB 1GVZA 1N6YA 2NWNA 2W3IA 1DSUA 4ABGA 2AYWA 3RXHA 1CO7E 1LKAA 1PYTC 2BY8X 1C1RA 2W7UA 3QWCH 2O8TA 1VGCC 2A7JA 2KAIB 2A4OA 3QTVH 4NFFA 1AUJA 1LHFH 4K1TA 4D76A 4AN7A 2ZPRA 1K1OA 2P93A 1K1IA 2BY6X 4JK5A 2FX6A 1BRAA 4F4OC 1P01A 1J8AA 4IS5A 2C93B 4ZKNU 1BBRE 2H6MA 1F0RA 1HAOH 1SLUB 1CHOF 1NFYA 1O2VA 1T31A 2G4UA 1YCPH 2GVFA 1GBHA 1CT4E 1V2ST 2OC0A 3KQEA 1GI9B 1SGTA 1P2JA 1YPMH 3NUMA 1MCVA 3EQ0H 4JYVH 4CRCA 1YPGH 2A4QA 3RXUA 1QA7A 1BRBE 1BQYA 2O8WA 2Z3CA 1LVBA 5E8EH 4J2YB 1XUJA 2ZU2A 1YLDA 2JETB 1P04A 4Y7AA 2ULLA 3PV4A 4A1TA 5EW1H 1TA2A 1MH0A 4I8HA 3ZZDA 2ANMH 4INKA 4FVBA 2CV3A 1EP5A 3GDVA 1GCTB 1ZRBA 5B6OA 1NFXA 1LCYA 1OWEA 4E06H 1GMDG 3ZZBA 3L33A 1AU8A 2VWLA 3SU3A 2FI4E 2PGQB 3HK6B 2RG3A 3M5LA 1O3BA 1NRPH 3RXPA 1S5SA 1VCPA 2ZDAH 3A7WA 2IOTA 1L4DA 1UTQA 2PTNA 1FAKH 2VVUA 1C4Y2 1HAYB 2PW8H 3KN2A 1TPAE 1YBWA 2OLGA 2C8WB 1BDAA 1C2KA 2OUAA 3RXVA 2QXGA 4FUJA 2BQWB 3F9EA 1IQJA 4O3TA 3Q77A 1CHGA 2FPZA 2Z94A 5C1UA 4OS5A 1W10U 4ABIA 1O3GA 1MUEB 1V2QT 1C5PA 1QRWA 1OP2A 3SJOA 1OWHA 4CRBA 3STIA 4E7RG 5EPYA 2V3HH 4DCDA 5E0GA 3KQCA 2Z9KA 4MNXA 1UCYH 4U01A 1DWCH 1GHZA 1SVPA 2FLBH 3GCHC 4DT7B 2WPJS 1IOEA 1OXGA 3EBNA 2A0QB 5EW2H 3UWJH 1G36A 3A83A 1AGJA 1RRKA 3RXOA 2FZZA 2GZ8A 3M61U 3E1XB 3B8JA 2F91A 4CHAC 3AW1A 3ZZ4A 2ZQ1A 3A7YA 1CT2E 3QDZB 2THFB 2BZAA 2V6NA 3RXTA 1QB6A 1K28D 2HVXA 1GBMA 4YZUA 5HMAA 1WSSH 3CS7A 2FXRA 1ZGVA 2BOHB 1G32B 3MH5A 1FDPA 1KLIH 1O3FA 1GMDF 1QA0A 3F6UH 1IQEA 1DXPA 1AFQC 1EKBB 1F0TA 1WU1A 2HOBA 1KXEA 2Y5GA 3SU0A 2CJIA 5F8TA 1O3HA 5C20A 2XC4A 1GMCG 5HGGA 2LNCA 1MTUA 1SGFG 2BD3A 2ZTZA 3ENSB 1DFPA 4CH8B 4H6TA 3OYPA 3M3SA 1Z6EA 2CXVA 2BLQA 2HWLB 3MU4A 3P17H 4ABDA 3M7UA 2OC1A 1LPKB 1ACBE 3FZDA 1MZAA 1LO6A 3EA7A 1AE5A 1G3BA 4UD9H 1SSXA 3P95A 4MNVA 2ZFSA 2FX4A 4KP0A 2BXUH 3UNQA 1P02A 1RTFB 3F9HA 3FVFB 2VH6A 2XCNA 1L1GA 3VB4A 2CF9H 3L3TA 3ZZ3A 1SGNE 1C4U2 3HGNA 4BAMB 5CMXH 4B2CA 2J9NA 2FOMB 4OS2A 3S0NA 2CGAA 4CRAA 2P59A 4WWYA 1G3EA 2EI7A 1AWHB 5G4BA 1RS0A 2P8OB 1Z1IA 3ATLA 1E34B 4FU7A 1OX1A 1IQLA 2AS9A 3LGUA 1ANCA 2BD2A 4Y7BA 1OOKB 4NA9H 1BHXF 1W14U 2ZU3A 3RXGA 5LPFA 1A61H 2J34A 3RXFA 2ZHDA 5GIBA 4TWYA 1DUAA 1UTNA 4Y79A 1FNIA 3UREA 1FY3A 2FTMA 3GY4A 1GHBG 5K0HA 3SNBA 1GDNA 2J2UA 1XUKA 1Z8IB 3PTBA 4OS1A 3ZZAA 4BNRA 3RU4E 1GBCA 3A7VA 2OC8A 1GPZA 1O3CA 1O37A 1ZTKA 2PKAA 1XKBC 3U69H 2FTLE 1RFNA 1PYTD 1V3XA 3SJ8A 3O8CA 1O30A 3SI4H 2OC7A 3U8OH 3SU5A 1P0SH 8LPRA 1K1LA 1TBQH 4J1YA 3P70B 1GMCF 1EATA 2FESH 1A5HA 3SNAA 2ZCKP 1HUTH 2SNWA 1G3CA 1T8NA 2VWNA 4X8UH 4JZFH 4X1RU 2H1UA 2BYAX 1K1JA 2EEKA 1D3QB 5DP3A 1GDUA 3U1IB 2GDDA 4ESTE 3E6PH 2Z9IA 3BIUH 1C1UH 1HAZB 2F9PA 2VIWA 3Q3KA 7GCHG 2ALVA 1UO6A 3M5NA 3CP7A 1YLCA 5GPIB 5L6NH 2M5TA 2ODQA 4WXVA 5JBTA 2R2MB 1UVTH 2F9BH 2UUKB 2C8YB 1O3EA 4H4FA 5HM2A 3HPTB 1NTPA 4AB8A 1GJ7B 4DG4A 2W5EA 2TIOA 5EXNA 1FY4A 1SGIB 4UFEH 1EB2A 1ID5H 4RSPA 1WTGH 3A88A 4MVNA 1ZRKA 1GMHG 1AMHA 2ZECA 1DUEA 4A1VA 4AORA 4MPUA 1V2VT 3RU4T 3LT3A 3SN8A 1O2SA 4LOYH 2D8WA 1KYNA 2ZHEH 1LHEH 1ETTH 3RMLH 1DY8A 1FY8E 2B9LA 3KIDU 1IAUA 4Z6AH 3KGPA 3EA8A 3TU7H 1QL7A 1HAPH 4FUGA 1N8OC 3P8GA 5JB9S 2UWOA 2BQ6B 1UTJA 1IQNA 1PPHE 1FXYA 1KY9A 4Q7XA 1GCDA 1XM1A 3BTFE 3GICB 5A8ZA 2GTBA 1C5SA 1GHBF 1YPHE 1BRCE 1T8MA 1P3EA 3EA9A 1CA0B 2XBXA 2BLWA 3RXJA 3BTKE 2BY7X 1TOCB 1TNGA 1MTNB 5C1YA 1O3OA 2WYJA 3A7XA 1FONA 1P9UA 2H9HA 3SJ9A 2IJOB 4WF8A 3C27B 1SFQB 2NU3E 2OBQA 5C67A 3FANA 4CREA 1TPOA 3GY2A 3TH4H 4Y71A 1FY5A 4ZXXH 1O3MA 3HK3B 3BTME 1GI1A 1ESTA 2A4RA 3ZVCA 2G8TA 3LH1A 2UUYA 4FUFA 1BMAA 3M7TA 4UONA 1Z8GA 4Q7YA 1ZLRA 3E16B 7GCHF 3MH6A 1Z7KA 1QTFA 1BT7A 2HNTF 4MPWA 1C9PA
chains in the Genus database with same CATH superfamily
1Q2WA 1BTHH 4K2YA 2P3FH 1YCPM 1WQVH 3O8RA 4GAWA 1WBGB 3DCLA 1TMUH 2IPHA 1UTKA 1UHBB 5BPEA 4BTUB 3TGJE 4WJG2 2SGQE 1JMOH 1XKAC 1DVAH 4I8KA 2W6ID 2NU0E 3RMNH 1ZOMA 3KQBA 2PWXA 9LPRA 1HNEE 5DP4A 2FODA 2BDBA 3SV2H 1C2GA 2BM2A 4JMYA 1RXPA 1D6RA 2F9VA 4K60A 1QGFA 1P11E 2ILNA 3U9AH 1HJ8A 1NBMD 4NCYA 5GXPA 1UVUH 1D3TB 3HKJB 1AB9C 2EI8A 3BTHE 1QURH 4I7YH 4P02A 1HFDA 1OPHB 4X2XA 1AFEH 1HRTH 2PLXA 4H6SB 3LC5A 1AZ8A 1MAXA 3KQDA 1LHGH 3I77A 1B7XB 1UJ1A 1V2KT 2C90B 4CRGA 5EOKA 2GD4B 2FDAA 4X2VA 2YMSC 3LU9B 1KDQB 1YP9A 4X1PU 3PWCA 3QZQA 1IQGA 1ZMLA 3S7HB 3UAIC 1P57B 1QFKH 1LQEA 2BDGA 3DA9B 5DGJA 1WTHD 4ABEA 4X6NA 1A0JA 4GLYA 1UTMA 4MNWA 1TALA 4YM9A 5LPEA 1L1NA 1C1VH 4YTAA 2GV7A 1NPMA 3ZZ5A 1MQ6A 1AIXH 1BMNH 2OBOA 3N7DA 5AHGH 1P2IA 1QJ6B 2Z7FE 2HNTE 2O9QA 4IMQA 3LDXH 2A5KA 5CE1A 1GI2A 2NU2E 3ZV9A 1DM4B 1MTSA 4O03A 4Y8ZA 9ESTA 1DICA 1UK4A 1GBDA 3A8CA 1XMNB 5A0CA 1ZSJA 1OWJA 4ASUD 2ZGJA 1RIWC 1YPHC 4HGCA 1O2OA 4H42U 1MD8A 3DSGA 3SORA 1ZPZA 1Q31A 1W13U 4KGAA 2J94A 1P06A 1AO5A 3MH4A 3GDUA 3F3BA 3IITA 4DY7B 2CN0H 2F3CE 2F4LA 1E38B 3RC5A 3ZZ9A 3SOSA 3UFAA 1ZTJA 2QIQA 3A80A 1AY6H 1GJBB 3GOVB 3BV9B 3TJVA 1TLDA 2ASUB 3RXIA 1E1QD 1TGSZ 4DIHH 4AC9A 2EC9H 1SMFE 2WPDD 4BOHA 3RXMA 1C2EA 5KGOA 5TJXA 4B2BA 4O97A 5IK2D 3H7OA 1JBUH 4KTUA 4RKOB 2CHAB 3A8AA 1HGTH 2P95A 1C1MA 1IQIA 1DXWA 1W2KH 2WUBA 4Y0YE 1QNJA 1DLEA 1PPEE 5JPMH 2GV6A 3MNXA 1T32A 4CR9A 1LDTT 1NRQH 4SGBE 3NK8A 1O2WA 1AHTH 3RXKA 1FMGA 1SLVB 1VR1H 1FN6A 2TBSA 4KTCA 5F53A 1A5GH 5DP5A 3S9AA 4F49A 5A2MH 3LGTA 6CHAB 4B2AA 2ZCLP 3PLBA 3S9CA 1BTPA 2FWWA 1TMTH 3OEHD 3SJIA 1S82A 1YKTA 2B0FA 1AVWA 2GKVE 2LELA 1D6WA 3PO1C 3BF6H 7LPRA 3VG8A 2A32A 5C5NA 1CU1A 1TX8A 2BY9X 2AGIX 3SZNA 3BTEE 3P92A 1SQRA 1H8IH 2PKSC 3N7OA 1EUFA 1HJAC 2XBVA 1NO9H 1AI8H 1F5RA 1P9SA 1GGDB 1KIGH 3TK5A 4XOJA 1IQHA 1RGQA 2ZQ2A 5IYTA 4IC5A 1O2UA 1O2MA 7ESTE 2Y82A 5T6DA 1E36B 1LVYA 1ZPCA 4XE4A 1DSTA 2ZFQH 1TNJA 1C1QA 4MPVA 1ELGA 2KZ4A 1GJDB 1SGFA 2HRVA 4AG2A 2B8OH 2HNTC 3SI3H 1DWEH 3GY7A 1A2CH 2YNAA 1EPTC 4JYUH 4TSFD 4TT3D 1JIRA 3BTDE 1HLTH 3E3TA 2BDIA 5L2ZH 2BDHA 5EJLA 3VGCC 3WW7A 1OSSA 1YF4A 1FJSA 5JBBS 3H09A 4X6MA 1BTYA 3U8TH 1FI8A 4WXIA 3U98H 3UOPA 4GUXA 3SUEA 3NKKA 1ZMJA 2Q6DA 1Y3YA 2KM0A 3BG4C 1KXBA 3ATKA 1TMBH 1CBWB 3GY6A 5DP7A 2ZDLA 1FZZA 2W26A 5JYIA 1XVOA 3VEQB 3ZZ6A 3AW0A 4INHA 2YOLA 5FXLA 4D8NA 1YPKH 4CBOA 1ESAA 3SQEE 2OP9A 3EE7A 1W11U 1GJAB 1P3CA 1XVMA 1C1NA 2P16A 3QGJA 4XBBA 3ITIA 4BXSA 1T4VH 1XUIA 1KLJH 1QR3E 5FL7D 5E0HA 4X6OA 4X0WU 1ZGIA 3NZIA 5L30H 2GT7A 1THRH 2ODPA 4Q4LA 2GX4A 1DY9A 1SR5C 1VITG 3SZEA 4K8YA 2GMTB 2OD3B 4ZKRU 3K65B 3V3MA 1NRSH 1EOLA 2R2WU 3F1SB 4NA8A 4D7GA 1ZPBA 3ZVDA 4I8GA 1J14A 3PMHB 1MBQA 1TRYA 3V13A 1A1RA 5FPSA 3L6PA 1OHHD 3LJJA 3A85A 1EJAA 3ZVFA 3RLWH 2FYRA 2HPPH 1C5RA 4ASHA 3RC6A 1NT1A 2PHBA 2VGCC 2VWOA 1Y5BT 2GZ9A 1YPEH 2F9NA 2ANKH 2JH5D 2FMJA 3MU1A 5GWZA 1O5BB 1ARCA 1ELTA 2WV4A 3ZVAA 4UFDH 3RC4A 5DP6A 3RXRA 1P2MA 2BD5A 1C2JA 3EDXB 2QF0A 2GCTB 4AB9A 3ZVGA 3QZRA 1ANBA 2H2ZA 3PB1E 1SGCA 1MTVA 1QZ8A 5CHAC 2ZU5A 3SJKA 4OM9A 2O8UA 1V2NT 1BBRH 1SGPE 3GCTG 1V2JT 2ALPA 1WYKA 1EPTA 1JIMA 4MG3A 1KXAA 4LXBH 5GDSH 4AFZA 3BG8A 5HYOA 3WWBA 1HXFH 3UB0A 4Z1MD 2TRMA 1KTSB 1NY22 1QQ4A 1FN8A 1LVOA 1K9OE 4LK4A 4MNYA 2VIVA 1K1PA 3U8RH 2PFEA 5FX6A 1PPCE 5CDFE 1EASA 1Y3WA 3SU4A 5C5OA 1C2LA 3DHKH 1O32A 3MFJA 3F2HA 6LPRA 3RXCA 3ELAH 3ATIA 1ELDE 2I6QA 2WINI 2FIRH 2PSYA 2ZA5A 3KCGH 3BTTE 4DT4A 2K0QA 3TJOA 3TVJB 1EJNA 2RDEA 2XC5A 1VITF 1OWDA 1AD8H 1YWUA 4FUDA 5KECA 1TRMA 2BLVA 2ZC9H 1HAVA 2D26C 1SI5H 3E0PB 1ARBA 4DGJA 1G3DA 3RXEA 1K22H 1GWAA 5C1XA 3DFLA 1O2HA 4IBLH 4CRDA 3M37A 4FUEA 3Q3XA 2B7DH 1SG8B 2EQNA 1UVPA 2VIPA 1PQ8A 1TOMH 4B1TA 1K21H 2AFQB 4CR5A 2Y80A 2ZGHA 4Y8YA 1F0SA 2XNIA 1GI4A 2ZGXH 3RXQA 2WV5A 1HB0B 3O8BA 1W7GH 3N99A 2ZPSA 2PTCE 1YPJH 2H9TH 1AKSA 1VZQH 3SUDA 2V7QD 4AYYB 2KCYA 3Q00A 1O2LA 2TGDA 2GCHG 1EAXA 5EXMA 3W95A 1ETSH 2BD9A 2BX4A 4CBNA 1F0UA 3TK9A 1NC6A 4RT1A 1W7XH 3WWFA 3E8LA 4X6PA 1A46H 1SQOA 3GCTF 3OE7D 2STBE 2G00A 1O3DA 3PMBB 1VGCB 3M3VA 3A82A 3SUGA 4ABAA 1O3JA 1C5QA 1S0RA 1TAWA 5T3HA 2F43B 4D9QA 1GJCB 1PJPA 5DJ7A 1OP8A 2Q6FA 4IC6A 5DP9A 2V35A 1AZZA 1SPJA 1S83A 1BOQA 4VGCC 1KXDA 4UFGH 1Z1JA 2AH4X 1XXFA 1TFXA 2J4IA 1J9CH 1YC0A 5EIYA 3MU8A 3SHAH 5C17A 3BTGE 4DURA 2C8XB 2WPLS 3G01A 3NXPA 1UW7A 5EGMA 3FAOA 4A5TS 5LPRA 2AIQA 4AYVB 3KQ5A 4WH8A 2VIQA 1P03A 1T4UH 2CHAC 5FBIA 3SO3A 5PTPA 2GJGA 4B6EA 4ZMAH 4ZXYH 3QTOH 1O35A 1LVMA 2XYAA 1GBTA 2VINA 3FO8D 1QL9A 1DT2A 2ZI2H 1S6LA 1TNLA 5AFYH 1DE7H 3GISB 1A3BH 2CMYA 1W3CA 1UK3A 2P94A 2ZWLH 2O8LA 1Y59T 1EZQA 3BN9A 3F0OA 3RXAA 2EY4C 4XDEA 2HGTH 4D9RA 1BZXE 1GBIA 3T26A 2AGEX 3MNSA 1CQQA 1GG6C 1O3NA 3GCOA 4ZAEA 4ABBA 4YESB 5A09A 1E37B 2ZHWH 4GCHG 5C94A 4X2YA 3UOUA 2SNVA 1TQ7B 1TX6A 5C0UA 2BLOA 2GCHF 1K1MA 1QRXA 2FLRH 3T5FH 3P6ZB 1AVXA 3GCNA 2BVXH 1NFWA 4PROA 1HAVB 2JDID 1C1TA 3VB5A 2Q1JA 2ZZUH 4LZ1H 3PTNA 4DIIH 4AGJA 3UNRA 1ANDA 2R9PA 1FUJA 1INCA 4ISNA 1W0JD 1NFUA 2SGEE 3S69A 1MKXK 2GP9B 1O33A 3GCHB 1PQAA 2QXJA 3MNCA 4Q80A 1OYQA 1T8OA 3PRDA 2Z9GA 1BUIA 2OTVA 3SQHE 4AOQA 1VCWA 1NN6A 4Y76A 2VVCA 1CE5A 3R0FA 1NRRH 4KTSA 5T1VA 1V2WT 3JZ1B 1HIAA 1O2TA 4ZHAA 3ATWA 4UDWH 1LHCH 3UNSA 1F7ZA 4CHAB 1C5LH 1O0DH 1ORFA 3A89A 3I29A 3OTPA 4I8JA 3U1JB 4E7NA 4F48B 2FS8A 2JETC 1BB0B 2HPQH 4R0IA 3K6YA 2PKAB 1D4PB 3STJA 3PYHA 4YLQH 1AVGH 1C5TA 1GCTC 2ZTYA 3DUXH 1GMHF 2A5IA 3RMMH 3QK1A 1F2SE 3M36A 3MI4A 1TONA 1TPPA 3BEFB 1W0ZU 4DJZB 8GCHG 2EI6A 2UUFB 4OS7A 2ZO3H 2JKHA 2R3UA 1CVWH 3S9BA 3EYDA 1GI5A 2BDAA 3CNRA 3SV6A 4BXWA 3VB7A 1EZSC 1VJ9U 5E2PA 1UVOA 3TLOA 1AFQB 1O38A 3P8OA 3Q76A 3NPSA 2SGFE 4JK6A 1LPGB 2WPHS 2ZCHP 4A7IB 1RTKA 3NWUA 2M2AA 4GCHF 2QA9E 2Y7ZA 3SNDA 2BMGB 1EQ9A 1QRZA 1CGHA 3HKIB 4X1QU 5A8XA 1QL8A 1O2IA 3RM0H 1MABB 2KCOA 2H5CA 1BJUA 3TJUA 1QBOA 4Y8XA 5L2YH 2GGVB 4NWKA 1NU9A 5CHBA 4YT6H 1ELCA 2ZTXA 3GYMA 4ZKSU 4Q7ZA 2SGPE 2ZKSA 4BAKB 3ZVBA 1KMHB 5I46H 4WVPE 4ABHA 5JBCS 1O2RA 1MTWA 1O5AB 3SV7A 1TIOA 4OS4A 3F0PA 1D3PB 1EOJA 2GZ7A 4WMFA 4BTIB 2KAIA 1O31A 1JOUB 2Z6BD 4B74A 1XUHA 2BDYA 3LJOA 1X7AC 3MH7A 4XBCA 5JBAS 1O3KA 3VXFH 1EP6A 2QY0B 3M3TA 1GJ4H 2ZFRH 1P05A 3VXEH 2ZG0H 4NFEA 4NWLA 3SNEA 4ZROA 1JXPA 1Y3UA 2J98B 1OWIA 1XXDA 5DKMA 4JZIA 2VJ1A 1DOJA 5DG6A 5EU8A 3BEIB 5A8YA 3MWIU 5AVDA 3H7TA 4RKJB 4BANB 2Z3EA 1CA8B 1ZHRA 1G37A 1V2TT 1TB6H 3B23B 1TX7A 2C3SA 4MQAA 3CS0A 2AMDA 2OQ5A 1BTUA 2AMQA 3AAUA 1A7SA 4HZHA 3LGYA 1HAGE 8GCHF 5DO4H 3E91A 3MU0A 2QF5A 1GVLA 1WQSA 3A87A 1PQ7A 4BAOB 4ZKOU 4K8BA 3M7QA 1IQMA 2BD7A 1DX5M 1B0EA 3SGAE 1GBFA 4DOQA 1ZTLA 2OCVB 3VB3A 3UQOA 1UTLM 4GSOA 4AFSA 8ESTE 2XBWA 1VJAU 3PMAB 5LH8A 4DVAU 1L0ZA 1JRTA 2Y81A 4U32A 2H5DA 2AERH 2ZIQH 1EX3A 3PROA 2DE8A 2YNBA 1DWDH 2ZPQA 4B71A 1NS3A 4MLFB 3SBKA 3MOCA 5FCKA 3FZZA 3TIUA 3QUMP 5KEDA 3OAAD 1BJVA 1ELBA 2RCEA 3T62A 1QB1A 1P2QA 1T8LA 3PLKA 1C1SA 4K69A 1YGCH 4ISHH 1M9UA 3A86A 4FU8A 3HGPA 5EQRA 1GBKA 3MO3A 3KNXA 4YOGA 2QF3A 1DITH 1JWTA 3D62A 1GI3A 1P2OA 1FAXA 5FBEA 2P8OC 2TGAA 1A4WH 1V2UT 3TNTA 1O36A 2L6OA 1GBAA 2ZFTA 1FY1A 2FM2A 1QB9A 1UCYE 1ZZZA 2ESTE 3URCA 1ELEE 5AFZH 4GVUA 4MDSA 5E0JA 1P12E 8KME2 3F9GA 1E0FD 1IHTH 5EQQA 1C2MA 1SLWB 1TA6A 3QGNB 3AK5A 1C5MD 4OS6A 1GBJA 4O9VA 1IHSH 3MNBA 3RXDA 4NA7A 1C9TA 3OU0A 1EB1H 1SGDE 4FUHA 4WMDA 2J92A 5F8XA 1H9IE 1BCUH 3DT0H 2J97A 1V2MT 2ZNKH 3TGKE 6ESTA 1TGCA 2Z3DA 5C0TA 2ZDMA 5DN6D 1DDJA 1OKXA 1O2KA 4E05H 2F9UA 2G51A 1OYTH 2PUQH 4NIWA 4TPIZ 3A8BA 5SGAE 1ABJH 1A0HB 3RM2H 1C4V2 3BTWE 1Y8TA 2R3YA 2ZU1A 1FQ3A 1ZSLA 1SGQE 1C2IA 1C5ZB 4ZH8A 1NBME 5F03A 3RDZA 3ZIAD 1BTXA 1TNKA 1RJXB 1DWBH 2OINA 1TBZH 2A4GA 4IW4E 1Z8RA 2BD8A 1NRNH 1SQTA 3ATMA 3DFJA 1O3PB 3PM3A 4FXGH 1F5KU 2K7XA 1ZMNA 4YT7H 1BRUP 3O8DA 4YOIA 1O2XA 1O2GH 1MU6B 4ISIH 2ZF0H 4TWWA 4ZHLU 3TITA 1AQ7A 1J17T 1YY3A 1FIZA 2IJD1 4TYDA 4XBDA 5EXLA 3ZV8A 4Q2KA 1SLXB 4O3UA 1MAYA 1C5UA 3UY9A 3RLYH 1WAYB 2J95A 3QN7A 1ZSKA 3LONA 1O5DH 5GCHG 5FCRA 4WH6A 2XTTB 3SU2A 1LQDB 1TGBA 3RU4D 2K1QA 1MKWK 4HTCH 3IWMA 3SGQE 3ZYDA 4TY7A 1K0HA 1NZQH 4YO9A 1RTLA 2V3OH 3T29A 2BX3A 1S81A 1IQKA 1BTWA 4Y0ZE 1O2PA 3MYWA 1HDTH 3T28A 2G81E 4CRFA 2VVVA 2AEIH 4JZEH 2A5AA 1UVSH 3A8DA 3ZZCA 3V12A 3MHWU 4TY6A 1O5GH 1A5IA 1EJMA 1TRNA 4MPXA 1H4WA 4X8SH 3M35A 3UQVA 1PPBH 3DD2H 1HJ9A 1ELFA 1AB9B 1CA0C 1V2OT 1V2LT 4TPYA 3BIVH 3TH2H 5AF9H 1MTNC 4NIVA 1PPZA 1AWFH 1D9IA 2ZFPH 2STAE 4FUBA 2VIDA 3KL6A 2FOAA 1MZDA 1SGRE 2YMSB 2BTCE 2FP7B 2YMSD 1YPLH 3RXSA 1TPSA 2HALA 3OX7U 5TCCA 1J15A 3I78A 4NG9H 3CENA 1G2LA 3ODDA 1W0YH 3UR6A 4X1SU 1QCPA 1S0QA 1O3LA 1CSOE 1NM6A 1TBRH 4B73A 1EZUC 4IN2A 1BHXB 3SHCH 4KKDA 1PPFE 1WDIA 1H9HE 5EJZA 2A45B 2VH0A 1MU8B 4HI3A 1SFIA 4NSYA 2V0BA 1H8ED 4QT8C 1AN1E 1FIWA 3AAVA 2QV1A 1H9LB 1KLTA 3U28C 2XCFA 3PV2A 2FEQH 4UFFH 3Q3YA 3ZYEA 3QO6A 3SU6A 1RIWB 2KFWA 1P8VC 2OXSA 1WOFA 2OK5A 3MTYA 3OTJE 5EJ1A 3PWBA 1T7CA 5GCHF 1THPB 5FPYA 1AUTC 4BAHB 2DE9A 2C8ZB 2H9EH 1LMWB 1Z6JH 1VCQA 2AMPA 4BAQB 3A7TA 1O2NA 2ZU4A 3MMGA 2WV9A 3UPEA 4AGKA 4XRNA 3A84A 3P8FA 4NGAH 4BTTB 4D7FA 1C2DA 1ZJDA 4DW2U 2ANWA 3T27A 3AVZA 4YOJA 1GL1A 1HYLA 1N6XA 3QLPH 2FOGA 2HVYB 4CH2B 3SU1A 4ZUHA 4I86A 2W3KA 3M5MA 3D23A 4KELA 1C1WH 3FP8E 2A7HA 2WZQA 3ESTA 3H5CB 3TGIE 1GBEA 1O2JA 1Y5AT 1YLNA 2QAAA 3MQKC 1OS8A 5C2ZA 5C3NA 4ISLA 5FX5A 2ZGBH 1DS2E 3UR9A 1CGIE 4OGXA 2EA3A 2Y7XA 1TNIA 2SGAA 1C1PA 1LHDH 3TH3H 2G4TA 1LPZB 5DP8A 1MBMA 5ETXA 2XWAA 2Z9LA 1H8DH 2A2XH 1TYNA 4I33A 4A1XA 2QCYA 1GHAG 1O5FH 5I25A 2XNDD 2F83A 1O39A 1QBVH 2LIZA 2UWLA 1GL0E 3EAJA 4FVDA 2FOBA 5E2OA 1FLEE 1P2KA 2GDEH 2ODYB 4JZ1A 4NIXA 3FN8A 2ZFFH 3D49H 5TCAA 1WCZA 1O3AA 1BMLA 2XBYA 1Y3VA 3EE0B 4LZ4B 4ABJA 2XWBI 2Y6TA 1TWXB 3PO1B 2ZHQH 1MKWH 4WY3A 3LH3A 1HAIH 2JH6D 1O5EH 4I8LA 4IN1A 1C2HA 3LIWA 1ZR0A 3BTQE 4AFUA 2PKSB 2RA0A 5EODA 3LOXA 1F92A 1HJAB 1SL3A 2WPMS 4HG6A 5HM9A 2Z9JA 3DSPA 1TE0A 2Y5FA 3ODFA 1PFXC 3SUFA 2FOHA 4NIYA 4RI0A 5FHTA 4RN6A 1UHBA 2FOFA 1ZYOA 1Y3XA 2WPKS 4YLUA 3FP7E 2G52A 2PGBB 1S6FA 2XC0A 4I31A 5F8ZA 1ANEA 1MCTA 1GJ6A 3FOAA 1EAWA 3RP2A 2RA3A 5J4QA 4A92A 3LPRA 1C5VA 2QYIA 2NU1E 4K3JA 4OGYA 5FPTA 1ESBA 2AGGX 1GJ5H 1V2RT 2QGRA 2R0LA 3GY5A 3OEED 1NU7B 1EPTB 1S6HA 1Z71A 1HPGA 3KF2A 1HBTH 5JB8S 2G55A 2LPRA 1DANH 1ZHPA 2D2DA 2BY5X 1CGJE 1ZJKA 5EG4A 5T6FA 4THNH 3VGCB 1MMJN 1QY6A 2NU4E 4GHTA 1S85A 1PQ5A 1D3DB 1QHRB 2FI5E 1UMAH 1GHYH 5GJ4B 1KDQA 3NCLA 1GHAF 1ABIH 1SKYE 3QX5H 1F5LA 5A0BA 3BG4B 3F68H 6CHAC 1HAHH 1LKBA 1THSH 5K7RA 1OP0A 3IG6B 2ANYA 3OSYA 1Z8JB 2ZHFH 1W0KD 5HIYA 5LGOA 1GI6A 3GYLB 5T6GA 2FS9A 4K1EA 6GCHG 2DUCA 3JZ2B 5DK1A 4X8TH 1U6QA 2ZDKA 1GBLA 1P10A 4R8TB 4Y10E 1OWKA 4AX9H 3E0NB 1GGDC 3SW2B 3M5OA 1IQFA 4XSKU 2VU8E 5IDKA 4B76A 1L1JA 2KR7A 1G2MA 1XUGA 2PUXB 2ZEBA 3GY3A 4MTBA 3F9FA 1C5NH 2TGPZ 1TGTA 1EAIA 3K9XB 1QQUA 5BRRE 2PR3A 1AE8H 4JYTA 1AKSB 4Q63A 3VPKA 3AASA 3KHVA 1SBWA 1O34A 2VGCB 2WYGA 2I6SA 4A6LA 5F6MA 2XW9A 1GVKB 4U30A 1HCGA 2ZGCA 2V3MA 2UUJB 1KSNA 3URDA 5ESBA 3SV9A 1EZXC 3TPIZ 2A1DB 2PSXA 1GHVH 2KX4A 2WSSD 1WXRA 2FOEA 3K2UA 1FPHH 2G5NA 1QJ7B 2VIOA 4X1NU 3LKWA 1NESE 2QE7D 1G9IE 1SGYE 2QC2A 3W94A 2BVSH 3LC3A 3SV8A 1KXCA 1A0LA 1A3EH 3VFEA 5CHAB 1SC8U 3TNSA 2ZDVH 1SHYA 1L2EA 1GHXH 4ISOA 4M7GA 1CBWC 1QBNA 1NROH 1O2YA 4X8VH 1VITH 2FYQA 1B5GH 1HV7A 1GI7B 1SGEE 4F55A 4AFQA 1MQ5A 5J4SA 3TK6A 1GJ8B 5EQSA 2A2QH 3SGBE 2BD4A 3GY8A 1P2NA 3D65E 2FI3E 1N1LA 4U2WA 3V0XA 4WMEA 3ZZ8A 3RXBA 2D1JA 3LGWA 2J38A 1YYY1 2TPIZ 1SHHB 3P8NA 2UWPA 5A0AE 1W12U 2BVRH 3C1KA 3HATH 1UK2A 1KXFA 1ELVA 2ZP0H 2GMTC 1XX9A 6GCHF 2G5VA 4NZQA 2QXHA 1YCPK 1SOZA 1V2PT 2AIPA 2VNTA 1V6DA 3OY5U 4B75A 3MO9A 2RDLA 1CT0E 1RD3B 1TABE 1MD7A 3K6ZA 1O2ZA 1FPCH 1GBBA 1W8BH 4Y11E 2GT8A 1H1BA 2A7CA 2JH0D 2SFAA 3TJNA 5ESTE 1Y5UT 1C5OH 3PLPA 3A7ZA 3MO6A 3PV5A 5ABWA 1Q3XA 2F9OA 4FUCA 3E90B 3PMJA 2CF8H 4IGDA 1DPOA 1K1NA 4ZCNA 2BQ7B 3A81A 2GCTC 1HXEH 5EPNA 2BZ6H 1JRSA 2BDCA 2J5UA 4NSVA 4I32A 2BB4A 1PPGE 1ETRH 4INLA 2JJ1D 1FV9A 3ZVEA 3EGKH 1BITA 2JJ2D 1O2QA 4K5ZA 4ZHMU 1C1OA 1LTOA 3GDSA 1E35B 2XXLA 1TGNA 3FFGA 1XUFA 3LGIA 1B0FA 2SGDE 4JCNA 7KMEH 1GJ9B 1ZHMA 2QN5T 1HIAB 4NZLA 1EAUA 3RUOA 3OY6U 1S84A 4AG1A 1SQAA 1BMFD 1BA8B 1BTZA 2HLCA 5HXFA 3UUZA 1CHOG 1UCYK 1O3IA 3UTUH 1K2I1 1SB1H 2XOKD 3RXLA 2BOKA 3B9FH 2PV9B 1MKXH 2VWMA 1J16A 1UTPA 3KEEA 1BIOA 4VGCB 1ELAA 1C2FA 1EXFA 3UIRA 3LGVA 1SOTA 2A31A 1UTOA 2R0KA 4FUIA 2WUCA 4Y6DA 1HAXB 2KCAA 2W7SA 2P3UB 2BXTH 2BHGA 4IMZA 4GHQA 3S7KB 3ZZ7A 2FOCA 1C5WB 4FU9A 2K8IA 4Z0KA 3SNCA 2QXIA 3W1EA 1C5XB 1GI8B 1GI0A 2O8MA 3WY8A 3BSQA 2OQUA 1YM0A 4UEHH 1TNHA 2Y5HA 2C4FH 3RMOH 3T25A 2IN2A 4ABFA 1WV7H 1EFRD 2VB0A 5DPAA 2WPIS 1GDQA 2TGTA 2XRCA 1GHWH 1QJ1B 4K1SA 2Q6GA 5JDUB 1G30B 1H8HD 1KTTB 1L4ZA 2ZDNA 1DLKB 4HFPB 4JZDH 3V7TA 2B5TB 4AZ2B 2P3TB 3R3GB 3MU5A 4SGAE 4RT0A 1QIXB 1TQ0B 4X2WA 5FAHA 4UE7H 1BMMH 3VB6A 1P09A 3T2NA 1C5YB 1GG6B 3FP6E 1WUNH 2FO9A 1BBRK 5H4IB 3UWIA 1N8OB 3BEUA 4GPGA 4XFQA 1O5CB 1GVZA 1N6YA 2NWNA 2W3IA 1DSUA 4ABGA 2AYWA 3RXHA 1CO7E 5HIZA 1LKAA 1PYTC 2BY8X 1C1RA 2W7UA 4YXWD 3QWCH 2O8TA 1VGCC 2A7JA 2KAIB 2A4OA 3QTVH 5DSFA 4NFFA 1AUJA 1LHFH 4K1TA 4D76A 2RFKC 4AN7A 2ZPRA 1K1OA 2P93A 4ACAA 1K1IA 2BY6X 4JK5A 2FX6A 1BRAA 4F4OC 1P01A 1J8AA 4IS5A 2C93B 4ZKNU 1BBRE 2H6MA 1F0RA 1HAOH 1SLUB 1CHOF 1NFYA 1O2VA 1T31A 2G4UA 1YCPH 2GVFA 1GBHA 1CT4E 1V2ST 2OC0A 3KQEA 1GI9B 1SGTA 1P2JA 1YPMH 3NUMA 1MCVA 3EQ0H 4JYVH 4CRCA 5GNDA 1YPGH 2A4QA 3RXUA 1QA7A 1BRBE 1BQYA 2O8WA 2Z3CA 1LVBA 5E8EH 4J2YB 1XUJA 2ZU2A 1YLDA 2JETB 1P04A 4Y7AA 2ULLA 3PV4A 4A1TA 5EW1H 1TA2A 1MH0A 4I8HA 3ZZDA 2ANMH 4INKA 4FVBA 2CV3A 1EP5A 2QF4A 3GDVA 1GCTB 1ZRBA 5B6OA 1NFXA 1LCYA 1OWEA 4E06H 1GMDG 3PRBA 3ZZBA 3L33A 1AU8A 2VWLA 3SU3A 2FI4E 2PGQB 3HK6B 2RG3A 3M5LA 1O3BA 1NRPH 3RXPA 1S5SA 1VCPA 2ZDAH 3A7WA 2IOTA 1L4DA 1UTQA 2PTNA 1FAKH 2VVUA 1C4Y2 1HAYB 2PW8H 3KN2A 1TPAE 1YBWA 2OLGA 2C8WB 1BDAA 2JIZD 1C2KA 2OUAA 3RXVA 2QXGA 4FUJA 2BQWB 3F9EA 1IQJA 4O3TA 3Q77A 1CHGA 2FPZA 2Z94A 5C1UA 4OS5A 1FX0B 1W10U 4ABIA 1O3GA 4ACBA 1MUEB 1V2QT 1C5PA 1QRWA 1OP2A 2CK3D 3SJOA 1OWHA 4CRBA 3STIA 4E7RG 5EPYA 2V3HH 4DCDA 5E0GA 3KQCA 2Z9KA 4MNXA 1UCYH 4U01A 1DWCH 1GHZA 1SVPA 2FLBH 3GCHC 2IPQX 3N7EA 4DT7B 2WPJS 1IOEA 1OXGA 3EBNA 2A0QB 5EW2H 3UWJH 1G36A 3A83A 1AGJA 1RRKA 3RXOA 2FZZA 2GZ8A 3M61U 3E1XB 3B8JA 2F91A 4CHAC 2VBCA 3AW1A 3ZZ4A 2ZQ1A 3F2FA 3A7YA 1CT2E 3QDZB 2THFB 2BZAA 2V6NA 3RXTA 3FKSD 1QB6A 1K28D 2PP6A 2HVXA 1GBMA 4P00A 4YZUA 5HMAA 1WSSH 3CS7A 2FXRA 1ZGVA 2BOHB 1G32B 3MH5A 1FDPA 1KLIH 1VKYA 1O3FA 1GMDF 1QA0A 3F6UH 1IQEA 1DXPA 1AFQC 1EKBB 1F0TA 1WU1A 2HOBA 1KXEA 2Y5GA 3SU0A 2CJIA 5F8TA 1O3HA 5C20A 2XC4A 1GMCG 5HGGA 4XD7D 2LNCA 1MTUA 1SGFG 2BD3A 2ZTZA 3ENSB 2L74A 1DFPA 4CH8B 4H6TA 3OYPA 3SYJA 3M3SA 1Z6EA 4M9FA 2CXVA 2BLQA 2HWLB 3MU4A 3P17H 4ABDA 3M7UA 1E1RD 2OC1A 1LPKB 3OFND 1ACBE 3FZDA 3NRLA 1MZAA 1LO6A 3EA7A 1AE5A 1G3BA 4UD9H 1SSXA 3KYFA 3P95A 4MNVA 2ZFSA 2FX4A 4KP0A 2BXUH 3UNQA 1P02A 1RTFB 1COWD 3F9HA 3FVFB 3KYGA 2VH6A 2XCNA 1L1GA 3VB4A 2CF9H 3L3TA 3ZZ3A 1SGNE 1C4U2 3HGNA 4BAMB 5CMXH 4B2CA 2J9NA 2FOMB 4OS2A 3S0NA 2CGAA 4CRAA 2P59A 1E79D 4WWYA 1G3EA 2EI7A 1AWHB 5G4BA 1RS0A 2P8OB 1Z1IA 3ATLA 1E34B 4FU7A 1OX1A 1IQLA 2AS9A 3LGUA 1ANCA 2BD2A 4Y7BA 1OOKB 4NA9H 1BHXF 1W14U 2ZU3A 3RXGA 5LPFA 1A61H 2J34A 3RXFA 2ZHDA 5GIBA 4TWYA 1DUAA 2AHME 1UTNA 4Y79A 1FNIA 3UREA 1FY3A 2FTMA 3GY4A 1GHBG 5K0HA 3SNBA 2W6JD 1GDNA 2J2UA 1XUKA 1Z8IB 3PTBA 4OS1A 3ZZAA 4B6FA 4BNRA 3RU4E 1GBCA 3A7VA 2OC8A 1GPZA 1O3CA 1O37A 1ZTKA 2PKAA 1XKBC 3U69H 3GS9A 2FTLE 1RFNA 1PYTD 1V3XA 3SJ8A 3O8CA 1O30A 3SI4H 2OC7A 4FETA 3SU5A 3U8OH 1P0SH 8LPRA 1K1LA 1TBQH 4J1YA 3P70B 1GMCF 1EATA 2FESH 1A5HA 3SNAA 2ZCKP 1HUTH 2SNWA 1G3CA 1T8NA 2VWNA 4X8UH 4JZFH 4X1RU 2BYAX 2H1UA 1K1JA 2EEKA 1D3QB 5DP3A 1GDUA 3U1IB 2GDDA 4ESTE 3E6PH 2Z9IA 3BIUH 1C1UH 1HAZB 2F9PA 2VIWA 3Q3KA 7GCHG 2ALVA 1UO6A 3M5NA 3CP7A 1YLCA 5GPIB 5L6NH 2M5TA 2ODQA 4WXVA 5JBTA 2R2MB 1UVTH 2F9BH 2UUKB 2C8YB 1O3EA 4H4FA 2KCPA 5HM2A 3HPTB 1NTPA 4AB8A 1GJ7B 4DG4A 2W5EA 2TIOA 5EXNA 1FY4A 1SGIB 4UFEH 1EB2A 1ID5H 4RSPA 1WTGH 3A88A 4MVNA 1ZRKA 1GMHG 1AMHA 2ZECA 1DUEA 4A1VA 4AORA 4MPUA 1V2VT 3RU4T 3LT3A 3SN8A 1O2SA 4LOYH 2D8WA 1KYNA 2ZHEH 1LHEH 1ETTH 3RMLH 1DY8A 1FY8E 2B9LA 3KIDU 1IAUA 4Z6AH 3KGPA 3EA8A 3TU7H 1QL7A 1HAPH 4FUGA 1N8OC 3P8GA 2HLDD 2LP6A 5JB9S 2UWOA 2BQ6B 1UTJA 5B6LA 1IQNA 1PPHE 1FXYA 1KY9A 4Q7XA 1GCDA 1XM1A 3BTFE 3GICB 5A8ZA 2GTBA 1C5SA 1GHBF 1YPHE 2J98A 1BRCE 1T8MA 2WHXA 1P3EA 3EA9A 1CA0B 2XBXA 4FOUC 2BLWA 3RXJA 3BTKE 2BY7X 1TOCB 1TNGA 1MTNB 5C1YA 1O3OA 2WYJA 3A7XA 1FONA 1P9UA 2H9HA 3SJ9A 2IJOB 4WF8A 3F2GA 3C27B 1SFQB 2NU3E 2OBQA 5C67A 3FANA 4CREA 1TPOA 3GY2A 3TH4H 4Y71A 1FY5A 4ZXXH 1O3MA 3HK3B 3BTME 1GI1A 1ESTA 2A4RA 3ZVCA 2G8TA 3LH1A 2UUYA 4FUFA 1BMAA 3M7TA 4UONA 1Z8GA 5HKKD 4Q7YA 3DSOA 1ZLRA 3E16B 7GCHF 3MH6A 1Z7KA 1QTFA 1BT7A 2HNTF 4MPWA 1C9PA
chains in the Genus database with same CATH topology
1Q2WA 1BTHH 4K2YA 2P3FH 1YCPM 1WQVH 3O8RA 4GAWA 1WBGB 1TMUH 2IPHA 1UTKA 1UHBB 5BPEA 4BTUB 3TGJE 4WJG2 2SGQE 1JMOH 1XKAC 1DVAH 4I8KA 2NU0E 3RMNH 1ZOMA 3KQBA 2PWXA 9LPRA 1HNEE 5DP4A 2FODA 2BDBA 3SV2H 1C2GA 2BM2A 4JMYA 1RXPA 1D6RA 2F9VA 4K60A 1QGFA 1P11E 2ILNA 3U9AH 1HJ8A 4NCYA 5GXPA 1UVUH 1D3TB 3HKJB 1AB9C 2EI8A 3BTHE 1QURH 4I7YH 1HFDA 1OPHB 4X2XA 1AFEH 1HRTH 2PLXA 4H6SB 3LC5A 1AZ8A 1MAXA 3KQDA 1LHGH 3I77A 1B7XB 1UJ1A 1V2KT 2C90B 4CRGA 5EOKA 2GD4B 2FDAA 4X2VA 3LU9B 1KDQB 1YP9A 4X1PU 3PWCA 3QZQA 1IQGA 1ZMLA 3S7HB 1P57B 1QFKH 1LQEA 2BDGA 3DA9B 5DGJA 1WTHD 4ABEA 4X6NA 1A0JA 4GLYA 1UTMA 4MNWA 1TALA 4YM9A 5LPEA 1L1NA 1C1VH 4YTAA 2GV7A 1NPMA 3ZZ5A 1MQ6A 1AIXH 1BMNH 2OBOA 5AHGH 1P2IA 1QJ6B 2Z7FE 2HNTE 2O9QA 4IMQA 3LDXH 2A5KA 5CE1A 1GI2A 2NU2E 3ZV9A 1DM4B 1MTSA 4O03A 4Y8ZA 9ESTA 1DICA 1UK4A 1GBDA 3A8CA 1XMNB 5A0CA 1ZSJA 1OWJA 2ZGJA 1RIWC 1YPHC 4HGCA 1O2OA 4H42U 1MD8A 3SORA 1ZPZA 1Q31A 1W13U 4KGAA 2J94A 1P06A 1AO5A 3MH4A 3GDUA 3IITA 4DY7B 2CN0H 2F3CE 1E38B 3RC5A 3ZZ9A 3SOSA 3UFAA 1ZTJA 2QIQA 3A80A 1AY6H 1GJBB 3GOVB 3BV9B 3TJVA 1TLDA 2ASUB 3RXIA 1TGSZ 4DIHH 2EC9H 1SMFE 4BOHA 3RXMA 1C2EA 5TJXA 4B2BA 4O97A 3H7OA 1JBUH 4KTUA 4RKOB 2CHAB 3A8AA 1HGTH 2P95A 1C1MA 1IQIA 1DXWA 1W2KH 2WUBA 4Y0YE 1QNJA 1DLEA 1PPEE 5JPMH 2GV6A 3MNXA 1T32A 4CR9A 1LDTT 1NRQH 4SGBE 3NK8A 1O2WA 1AHTH 3RXKA 1FMGA 1SLVB 1VR1H 1FN6A 2TBSA 4KTCA 1A5GH 5DP5A 3S9AA 4F49A 5A2MH 3LGTA 6CHAB 4B2AA 2ZCLP 3PLBA 3S9CA 1BTPA 2FWWA 1TMTH 3SJIA 1S82A 1YKTA 2B0FA 1AVWA 2GKVE 1D6WA 3PO1C 3BF6H 7LPRA 2A32A 5C5NA 1CU1A 1TX8A 2BY9X 2AGIX 3SZNA 3BTEE 3P92A 1H8IH 2PKSC 3N7OA 1EUFA 1HJAC 2XBVA 1NO9H 1AI8H 1F5RA 1P9SA 1GGDB 1KIGH 3TK5A 4XOJA 1IQHA 1RGQA 2ZQ2A 5IYTA 4IC5A 1O2UA 1O2MA 7ESTE 2Y82A 5T6DA 1E36B 1LVYA 1ZPCA 4XE4A 1DSTA 2ZFQH 1TNJA 1C1QA 4MPVA 1ELGA 1GJDB 1SGFA 2HRVA 4AG2A 2B8OH 2HNTC 3SI3H 1DWEH 3GY7A 1A2CH 2YNAA 1EPTC 4JYUH 1JIRA 3BTDE 1HLTH 3E3TA 2BDIA 5L2ZH 2BDHA 3VGCC 1OSSA 1YF4A 1FJSA 5JBBS 4X6MA 1BTYA 3U8TH 1FI8A 4WXIA 3U98H 3UOPA 4GUXA 3SUEA 3NKKA 1ZMJA 2Q6DA 1Y3YA 3BG4C 1KXBA 3ATKA 1TMBH 1CBWB 3GY6A 5DP7A 2ZDLA 1FZZA 2W26A 5JYIA 1XVOA 3VEQB 3ZZ6A 3AW0A 4INHA 2YOLA 5FXLA 4D8NA 1YPKH 4CBOA 1ESAA 3SQEE 2OP9A 1W11U 1GJAB 1P3CA 1XVMA 1C1NA 2P16A 3QGJA 4XBBA 3ITIA 4BXSA 1T4VH 1XUIA 1KLJH 1QR3E 5E0HA 4X6OA 4X0WU 1ZGIA 3NZIA 5L30H 2GT7A 1THRH 2ODPA 2GX4A 1DY9A 1SR5C 1VITG 4K8YA 2GMTB 2OD3B 4ZKRU 3K65B 3V3MA 1NRSH 1EOLA 2R2WU 3F1SB 4NA8A 4D7GA 1ZPBA 3ZVDA 4I8GA 1J14A 3PMHB 1MBQA 1TRYA 3V13A 1A1RA 5FPSA 3L6PA 3LJJA 3A85A 1EJAA 3ZVFA 3RLWH 2FYRA 2HPPH 1C5RA 4ASHA 3RC6A 1NT1A 2PHBA 2VGCC 2VWOA 1Y5BT 2GZ9A 1YPEH 2F9NA 2ANKH 2JH5D 2FMJA 3MU1A 5GWZA 1O5BB 1ARCA 1ELTA 2WV4A 3ZVAA 4UFDH 3RC4A 5DP6A 3RXRA 1P2MA 2BD5A 1C2JA 3EDXB 2QF0A 2GCTB 4AB9A 3ZVGA 3QZRA 1ANBA 2H2ZA 3PB1E 1SGCA 1MTVA 5CHAC 2ZU5A 3SJKA 2O8UA 1V2NT 1BBRH 1SGPE 3GCTG 1V2JT 2ALPA 1WYKA 1EPTA 1JIMA 4MG3A 1KXAA 4LXBH 5GDSH 4AFZA 3BG8A 5HYOA 1HXFH 2TRMA 1KTSB 1NY22 1QQ4A 1FN8A 1LVOA 1K9OE 4LK4A 4MNYA 2VIVA 1K1PA 3U8RH 2PFEA 5FX6A 1PPCE 1EASA 1Y3WA 3SU4A 5C5OA 1C2LA 3DHKH 1O32A 3MFJA 6LPRA 3RXCA 3ELAH 3ATIA 1ELDE 2I6QA 2WINI 2FIRH 2PSYA 2ZA5A 3KCGH 3BTTE 3TJOA 3TVJB 1EJNA 2XC5A 1VITF 1OWDA 1AD8H 4FUDA 1TRMA 2BLVA 2ZC9H 1HAVA 2D26C 1SI5H 3E0PB 1ARBA 4DGJA 1G3DA 3RXEA 1K22H 1GWAA 5C1XA 3DFLA 1O2HA 4IBLH 4CRDA 3M37A 4FUEA 3Q3XA 2B7DH 1SG8B 1UVPA 2VIPA 1PQ8A 1TOMH 4B1TA 1K21H 2AFQB 4CR5A 2Y80A 2ZGHA 4Y8YA 1F0SA 2XNIA 1GI4A 2ZGXH 3RXQA 2WV5A 1HB0B 3O8BA 1W7GH 2ZPSA 2PTCE 1YPJH 2H9TH 1AKSA 1VZQH 3SUDA 4AYYB 3Q00A 1O2LA 2TGDA 2GCHG 1EAXA 5EXMA 3W95A 1ETSH 2BD9A 2BX4A 4CBNA 1F0UA 3TK9A 1NC6A 1W7XH 3E8LA 4X6PA 1A46H 1SQOA 3GCTF 2STBE 2G00A 1O3DA 3PMBB 1VGCB 3M3VA 3A82A 3SUGA 4ABAA 1O3JA 1C5QA 1S0RA 1TAWA 5T3HA 4D9QA 1GJCB 1PJPA 5DJ7A 1OP8A 2Q6FA 4IC6A 5DP9A 2V35A 1AZZA 1SPJA 1S83A 1BOQA 4VGCC 1KXDA 4UFGH 1Z1JA 2AH4X 1XXFA 1TFXA 2J4IA 1J9CH 1YC0A 3MU8A 3SHAH 3BTGE 4DURA 2C8XB 2WPLS 3G01A 3NXPA 5EGMA 3FAOA 4A5TS 5LPRA 2AIQA 4AYVB 4WH8A 2VIQA 1P03A 1T4UH 2CHAC 5FBIA 3SO3A 5PTPA 4ZMAH 4ZXYH 3QTOH 1O35A 1LVMA 2XYAA 1GBTA 2VINA 1QL9A 1DT2A 2ZI2H 1TNLA 5AFYH 1DE7H 3GISB 1A3BH 2CMYA 1W3CA 1UK3A 2P94A 2ZWLH 2O8LA 1Y59T 1EZQA 3BN9A 3RXAA 4XDEA 2HGTH 4D9RA 1BZXE 1GBIA 3T26A 2AGEX 3MNSA 1CQQA 1GG6C 1O3NA 3GCOA 4ZAEA 4ABBA 4YESB 5A09A 1E37B 2ZHWH 4GCHG 4X2YA 3UOUA 2SNVA 1TQ7B 1TX6A 2BLOA 2GCHF 1K1MA 1QRXA 2FLRH 3T5FH 3P6ZB 1AVXA 3GCNA 2BVXH 1NFWA 4PROA 1HAVB 1C1TA 3VB5A 2Q1JA 2ZZUH 4LZ1H 3PTNA 4DIIH 4AGJA 3UNRA 1ANDA 2R9PA 1FUJA 1INCA 4ISNA 1NFUA 2SGEE 3S69A 1MKXK 2GP9B 1O33A 3GCHB 1PQAA 2QXJA 3MNCA 4Q80A 1OYQA 1T8OA 2Z9GA 1BUIA 2OTVA 3SQHE 4AOQA 1VCWA 1NN6A 4Y76A 2VVCA 1CE5A 3R0FA 1NRRH 4KTSA 1V2WT 3JZ1B 1HIAA 1O2TA 4ZHAA 3ATWA 4UDWH 1LHCH 3UNSA 1F7ZA 4CHAB 1C5LH 1O0DH 1ORFA 3A89A 3I29A 4I8JA 3U1JB 4E7NA 2FS8A 2JETC 1BB0B 2HPQH 4R0IA 3K6YA 2PKAB 1D4PB 3STJA 3PYHA 4YLQH 1AVGH 1C5TA 1GCTC 2ZTYA 3DUXH 1GMHF 2A5IA 3RMMH 3QK1A 1F2SE 3M36A 3MI4A 1TONA 1TPPA 3BEFB 1W0ZU 4DJZB 8GCHG 2EI6A 2UUFB 4OS7A 2ZO3H 2JKHA 2R3UA 1CVWH 3S9BA 3EYDA 1GI5A 2BDAA 3SV6A 4BXWA 3VB7A 1EZSC 1VJ9U 5E2PA 1UVOA 3TLOA 1AFQB 1O38A 3P8OA 3Q76A 3NPSA 2SGFE 4JK6A 1LPGB 2WPHS 2ZCHP 4A7IB 1RTKA 3NWUA 4GCHF 2QA9E 2Y7ZA 3SNDA 2BMGB 1EQ9A 1QRZA 1CGHA 3HKIB 4X1QU 5A8XA 1QL8A 1O2IA 3RM0H 2H5CA 1BJUA 3TJUA 1QBOA 4Y8XA 5L2YH 2GGVB 4NWKA 1NU9A 4YT6H 1ELCA 2ZTXA 3GYMA 4ZKSU 4Q7ZA 2SGPE 2ZKSA 4BAKB 3ZVBA 5I46H 4WVPE 4ABHA 5JBCS 1O2RA 1MTWA 1O5AB 3SV7A 1TIOA 4OS4A 1D3PB 1EOJA 2GZ7A 4WMFA 4BTIB 2KAIA 1O31A 1JOUB 2Z6BD 4B74A 1XUHA 2BDYA 3LJOA 1X7AC 3MH7A 4XBCA 5JBAS 1O3KA 3VXFH 1EP6A 2QY0B 3M3TA 1GJ4H 2ZFRH 1P05A 3VXEH 2ZG0H 4NFEA 4NWLA 3SNEA 4ZROA 1JXPA 1Y3UA 1OWIA 1XXDA 5DKMA 4JZIA 2VJ1A 1DOJA 5DG6A 5EU8A 3BEIB 5A8YA 3MWIU 5AVDA 3H7TA 4RKJB 4BANB 2Z3EA 1CA8B 1ZHRA 1G37A 1V2TT 1TB6H 3B23B 1TX7A 2C3SA 4MQAA 3CS0A 2AMDA 2OQ5A 1BTUA 2AMQA 3AAUA 1A7SA 4HZHA 3LGYA 1HAGE 8GCHF 5DO4H 3E91A 3MU0A 1GVLA 1WQSA 3A87A 1PQ7A 4BAOB 4ZKOU 4K8BA 3M7QA 1IQMA 2BD7A 1DX5M 1B0EA 3SGAE 1GBFA 4DOQA 1ZTLA 2OCVB 3VB3A 3UQOA 1UTLM 4GSOA 4AFSA 8ESTE 2XBWA 1VJAU 3PMAB 5LH8A 4DVAU 1L0ZA 1JRTA 2Y81A 4U32A 2H5DA 2AERH 2ZIQH 1EX3A 3PROA 2DE8A 2YNBA 1DWDH 2ZPQA 4B71A 1NS3A 4MLFB 3SBKA 3MOCA 5FCKA 3FZZA 3TIUA 3QUMP 1BJVA 1ELBA 2RCEA 3T62A 1QB1A 1P2QA 1T8LA 3PLKA 1C1SA 4K69A 1YGCH 4ISHH 1M9UA 3A86A 4FU8A 3HGPA 5EQRA 1GBKA 3MO3A 3KNXA 4YOGA 2QF3A 1DITH 1JWTA 3D62A 1GI3A 1P2OA 1FAXA 5FBEA 2P8OC 2TGAA 1A4WH 1V2UT 3TNTA 1O36A 1GBAA 2ZFTA 1FY1A 2FM2A 1QB9A 1UCYE 1ZZZA 2ESTE 3URCA 1ELEE 5AFZH 4GVUA 4MDSA 5E0JA 1P12E 8KME2 3F9GA 1E0FD 1IHTH 5EQQA 1C2MA 1SLWB 1TA6A 3QGNB 1C5MD 4OS6A 1GBJA 4O9VA 1IHSH 3MNBA 3RXDA 4NA7A 1C9TA 3OU0A 1EB1H 1SGDE 4FUHA 4WMDA 2J92A 5F8XA 1H9IE 1BCUH 3DT0H 2ZNKH 1V2MT 3TGKE 6ESTA 1TGCA 2Z3DA 2ZDMA 1DDJA 1OKXA 1O2KA 4E05H 2G51A 2F9UA 1OYTH 2PUQH 4NIWA 4TPIZ 3A8BA 5SGAE 1ABJH 1A0HB 3RM2H 1C4V2 3BTWE 1Y8TA 2R3YA 2ZU1A 1FQ3A 1ZSLA 1SGQE 1C2IA 1C5ZB 4ZH8A 5F03A 3RDZA 1BTXA 1TNKA 1RJXB 1DWBH 2OINA 1TBZH 2A4GA 4IW4E 1Z8RA 2BD8A 1NRNH 1SQTA 3ATMA 3DFJA 1O3PB 3PM3A 4FXGH 1F5KU 2K7XA 1ZMNA 4YT7H 1BRUP 3O8DA 4YOIA 1O2XA 1O2GH 1MU6B 4ISIH 2ZF0H 4TWWA 4ZHLU 3TITA 1AQ7A 1J17T 1FIZA 4TYDA 4XBDA 5EXLA 3ZV8A 4Q2KA 1SLXB 4O3UA 1MAYA 1C5UA 3UY9A 3RLYH 1WAYB 2J95A 3QN7A 1ZSKA 3LONA 1O5DH 5GCHG 5FCRA 4WH6A 2XTTB 3SU2A 1LQDB 1TGBA 3RU4D 2K1QA 1MKWK 4HTCH 3IWMA 3SGQE 3ZYDA 4TY7A 1NZQH 4YO9A 1RTLA 2V3OH 3T29A 2BX3A 1S81A 1IQKA 1BTWA 4Y0ZE 1O2PA 3MYWA 1HDTH 3T28A 2G81E 4CRFA 2VVVA 2AEIH 4JZEH 2A5AA 1UVSH 3A8DA 3ZZCA 3V12A 3MHWU 4TY6A 1O5GH 1A5IA 1EJMA 1TRNA 4MPXA 1H4WA 4X8SH 3M35A 3UQVA 1PPBH 3DD2H 1HJ9A 1ELFA 1AB9B 1CA0C 1V2OT 1V2LT 4TPYA 3BIVH 3TH2H 5AF9H 1MTNC 4NIVA 1PPZA 1AWFH 1D9IA 2ZFPH 2STAE 4FUBA 2VIDA 3KL6A 2FOAA 1MZDA 1SGRE 2BTCE 2FP7B 1YPLH 3RXSA 1TPSA 2HALA 3OX7U 5TCCA 1J15A 3I78A 4NG9H 3CENA 1G2LA 3ODDA 1W0YH 3UR6A