2YNBA

Crystal structure of the main protease of coronavirus hku4 in complex with a michael acceptor sg85
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-LIKE PROTEINASE
publication title Inhibitor for the Main Protease of Coronavirus Hku4
rcsb
source organism Tylonycteris bat coronavirus hku4
molecule tags Hydrolase
total genus 87
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2ynbA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ynbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ynbA02
4UFGH 2WPMS 1ESBA 4GCHG 3P17H 1ELBA 4MVNA 4YOGA 4UFFH 5FPTA 1BBRK 4F4OC 5EW1H 2Z6BD 1GHZA 5H4IB 2F9VA 1ANCA 2VJ1A 2ZGJA 1SSXA 1CO7E 2ZPRA 4AGJA 1SFQB 1B5GH 2BM2A 1K21H 3BIUH 5EXNA 4AYYB 3CP7A 5SGAE 2FODA 2FOMB 1HAVA 5A0CA 1SPJA 2ZCHP 2BVRH 5TCAA 4GHTA 1N6YA 1V2QT 1EJMA 1YPHC 3EDXB 4O03A 3UOPA 1F0SA 2BVSH 3RC6A 1XM1A 4H6TA 1HJAB 1Z1IA 1UK2A 2R3YA 1BTYA 2F83A 8KME2 1GBIA 5FBIA 1V2UT 3NXPA 5DK1A 3EGKH 4BAMB 1HAVB 2XBWA 2VINA 3A7XA 2FWWA 3UQVA 5AF9H 2ALVA 1MKXH 3A83A 1LPKB 1CQQA 3SN8A 1J15A 1B7XB 3K2UA 3SV7A 3GCTG 1ETSH 3UPEA 1L1GA 2BB4A 1L4ZA 5C3NA 2STBE 4IMZA 2ZFQH 3MU1A 1O2TA 2OINA 1TGNA 2V3HH 1E37B 1KLIH 4JYTA 4LXBH 1MD7A 3BEFB 2CF8H 2O9QA 4WH6A 1MUEB 1A5IA 4K3JA 1ZSKA 1O2ZA 3SUFA 4E7NA 1S0QA 1NRPH 1QA7A 4X6MA 4UONA 2FYQA 5TCCA 1UTJA 1O3EA 4BXSA 3SNBA 4DGJA 1Y8TA 1BJUA 2GX4A 2PR3A 1AI8H 4DY7B 2LIZA 1SGIB 5JB9S 1PQ7A 2NWNA 1BMNH 3GICB 1AUJA 1G3CA 3T2NA 5EG4A 2LPRA 2BD8A 4ISIH 1GJCB 4NZQA 5EXLA 1O5FH 1UJ1A 4THNH 5EPNA 1C5OH 3GDUA 5FAHA 1Y59T 1UTKA 1JRSA 2BD4A 4I31A 1QBVH 1S85A 3KQCA 3SOSA 2KAIB 2BDIA 2ZECA 4JK6A 4ISHH 4I8KA 1C5PA 2H9HA 2WPJS 1PYTC 2XRCA 2QF0A 5F6MA 1THPB 3L33A 4A92A 2OUAA 3M5OA 3A86A 3RXOA 4AG1A 1EP5A 1O2GH 3A82A 3RM2H 3MU0A 1UCYH 4FUIA 2BD5A 1SOTA 2VB0A 1BIOA 1AFQB 1DLEA 3P8FA 1CT0E 1W10U 5ABWA 1SHYA 3RXLA 3GISB 5A8ZA 3VB4A 2GTBA 2F9NA 3BTDE 2AFQB 1HRTH 3M7TA 1S82A 4KTUA 3UREA 5FHTA 3MYWA 5JBBS 3EA8A 1SB1H 2Z94A 3FFGA 1BMAA 2D26C 3QO6A 5GCHG 3GCNA 4WWYA 2GCTB 3QTOH 4X1SU 1GJ9B 1V2KT 4A6LA 2RDLA 1KLJH 2AEIH 1OKXA 5E0HA 4OGXA 4AFUA 3BG8A 2PKSB 1W8BH 2FS9A 1AFEH 3SJ9A 4WMEA 4CH2B 1QR3E 1O3CA 1C5ZB 1PQAA 1WQSA 3MNCA 1MD8A 3E6PH 2GZ7A 2QAAA 1THSH 1GHXH 2BLWA 4GUXA 2GKVE 1K1PA 5DP6A 2Q6FA 5T6FA 2A45B 1P01A 2BVXH 3NK8A 3TPIZ 2TGAA 1GBLA 3TJNA 2ODPA 2BY9X 3HGNA 3FANA 2BYAX 1YF4A 1D9IA 2RG3A 4TWWA 2NU4E 1FAKH 4Y10E 1IHSH 3E91A 1A3BH 4JMYA 1VCQA 3SI4H 5CHAC 1DVAH 1GJAB 1HYLA 4WVPE 3W94A 4X8VH 1YC0A 3M35A 2G5NA 4X0WU 1FY1A 3SV9A 3T62A 4U01A 2AYWA 1QB1A 2J34A 1KDQB 1G37A 1GHVH 1ABJH 1O2JA 1AO5A 1ZGIA 2A2QH 2WYJA 1LHCH 1BRUP 4ZKRU 4KTCA 1J14A 5T6GA 1O2VA 1NU7B 2XNIA 1ZOMA 2I6QA 3H7OA 4BAKB 1BJVA 2BD7A 4WY3A 1P02A 4OGYA 1BCUH 1EZXC 2V0BA 5PTPA 2ZHEH 3KIDU 1GBAA 2GZ9A 1FIZA 3RXDA 1V2VT 2AMQA 2QV1A 1XXDA 1SL3A 1GI8B 4F49A 2UUJB 3LGYA 3OTJE 3BN9A 4WF8A 1MAYA 1BBRH 1A2CH 3SNAA 2FXRA 3GYMA 3VFEA 3GDVA 4FUEA 4X1NU 1TQ7B 1G3BA 4CRBA 1DY9A 1V2LT 4TPYA 1F5KU 4KELA 1DICA 4K1SA 1GMDF 1L2EA 2A7JA 2C90B 3I78A 4K1TA 1UHBB 1C2DA 4FUJA 1DUEA 1RTLA 1SGFA 2FI3E 2G4UA 1FPHH 3E1XB 3NPSA 1ANDA 2FX6A 1BRCE 4TPIZ 2O8MA 4FUFA 4YT7H 3OY6U 2CGAA 2R2WU 4Y0YE 1K1IA 4XBDA 1C2KA 2B8OH 1P06A 3QUMP 2ZFRH 2FI4E 1GJDB 1G3EA 1GWAA 4K8BA 3C1KA 3K6ZA 1S5SA 1O31A 1C1PA 3STJA 3SNEA 5I25A 1AD8H 1U6QA 2VGCC 3PMHB 4AOQA 7ESTE 2OC1A 1O5BB 2ZTYA 2ANMH 4XBBA 5DP7A 4DJZB 4XSKU 2FMJA 1KXEA 1EZQA 4B73A 2DE8A 2F9PA 3LT3A 2OTVA 1RFNA 3ATMA 3F9HA 3UIRA 3M3TA 4R8TB 3EA7A 1ELCA 3BTQE 3VGCC 1DSUA 5LPRA 2H2ZA 4IN1A 3SU3A 3SV8A 1A46H 1P03A 3OY5U 5G4BA 2QC2A 3PMAB 1IQKA 4DT7B 4YZUA 1TBRH 1SGQE 1EZSC 1MCVA 1UCYE 1ETTH 1DT2A 1HJ8A 3MFJA 1F0TA 2H1UA 1YPMH 2Y5GA 1AQ7A 1RIWC 1MTNC 2BTCE 2FP7B 3MO3A 1DWCH 2ZKSA 3MHWU 4HFPB 3PV4A 2OBOA 4B74A 1V6DA 1HJ9A 3S9AA 1JIMA 1SBWA 1ACBE 1XVOA 1VGCB 2UUKB 1RD3B 4GAWA 1CHGA 4ESTE 2XWAA 2BD9A 4KTSA 1JBUH 4ABEA 1TMUH 1NT1A 3MO6A 3Q00A 4HTCH 1UTOA 3ESTA 3PM3A 3SHCH 4YTAA 2C8WB 5IYTA 1O2KA 1QRZA 1NROH 3U98H 5EU8A 4J1YA 1AB9B 2IOTA 1ZGVA 1T8LA 1HGTH 3M3SA 3D65E 4K2YA 5HYOA 3GOVB 1DE7H 1Z8JB 1HJAC 3N7OA 1EATA 4H4FA 2WYGA 4FVDA 1LHGH 4K8YA 1IQJA 3PWCA 4FXGH 3WY8A 5DG6A 2PV9B 4E05H 5C5NA 1W7XH 3LH1A 4I8LA 5K0HA 4DIHH 1ZYOA 1TNGA 4NA8A 5GDSH 1SGPE 1XX9A 3LJOA 5AFYH 3RM0H 5DP4A 2R3UA 4B71A 1O39A 2ULLA 2XBYA 2ZU5A 1CGIE 1IQGA 5HXFA 2A4RA 1PPHE 2OQUA 5FPYA 3SZNA 1BQYA 2R2MB 1IQLA 3SGBE 1O3FA 1CGJE 4A1TA 4X8SH 1Z8RA 1C2FA 2AGIX 2M5TA 1J9CH 3RXHA 1MTVA 1KSNA 3GY7A 1YYY1 1O5CB 2ASUB 1MBMA 2GD4B 3KN2A 1K2I1 4TY7A 5EW2H 1QCPA 1PPBH 2PUXB 4Y0ZE 3SU0A 1SQAA 1ARCA 1H1BA 2ZQ1A 2O8UA 2A4GA 2OLGA 3Q76A 4NGAH 5A09A 2GT7A 2P16A 1EUFA 1FV9A 1TNJA 2A0QB 5GWZA 1O3NA 3SJOA 1O33A 1CA0B 3B8JA 4HI3A 3TH2H 1NRRH 1BA8B 1HAPH 2STAE 4X2WA 1QHRB 1C2JA 1GDUA 1TGBA 1E38B 4YOJA 1AY6H 3MNSA 1EX3A 1IQIA 1BBRE 1YPKH 1LKAA 2A5AA 2RA0A 1V2TT 1K1NA 1FY3A 1HB0B 4Y7BA 1Y3YA 4Z6AH 3QDZB 1MTSA 1QRWA 3ZV9A 1V2ST 3M36A 4INLA 1FPCH 1C5QA 4Y6DA 2ESTE 3H7TA 4KP0A 4OS7A 3ZVAA 2RA3A 1ARBA 3E16B 3EBNA 3UY9A 4Y8ZA 1NESE 1ZJDA 1AFQC 3M37A 1EKBB 5EQQA 1C5NH 1FUJA 2W5EA 3RMLH 5CMXH 3SNDA 1O3MA 1DANH 3TJVA 1HXFH 3RXTA 2ZPSA 4NIWA 3RMMH 1C1TA 3E8LA 3LGWA 2WPIS 3KQBA 3TK9A 2XTTB 2WPLS 3E3TA 1YPEH 1OS8A 1TPPA 1ZLRA 1FN6A 3MI4A 1GBCA 2Q1JA 1QJ6B 2Y5HA 4LK4A 2GCTC 4E7RG 2BX4A 3HK3B 1EP6A 5A2MH 1MKWK 3F9EA 2XXLA 3MTYA 2HWLB 2DE9A 1O3AA 1FY4A 1O2UA 2BOKA 3SU4A 2PKSC 3GY2A 3KQDA 1GJ8B 1FQ3A 1GBJA 2A4OA 1ZPCA 3SW2B 1AVWA 3MH6A 2Y7XA 1G32B 3SU5A 5EXMA 2NU3E 1RTKA 4Y8YA 2JKHA 1HFDA 1VITF 3F68H 3QGJA 4IN2A 3UQOA 1O5GH 4AFSA 1TRYA 4ABBA 3RU4D 1NU9A 1NRSH 1QB9A 3VB3A 1PPCE 3F9GA 3I29A 2FYRA 5GIBA 3O8RA 2CXVA 5EODA 3M7QA 1ANBA 1GI3A 2Q6GA 2XC4A 1S0RA 2C8XB 4K1EA 4LZ1H 1Z71A 6GCHG 1O3LA 2AMDA 4MNXA 4KKDA 4D9RA 2O8WA 4XBCA 2W7SA 4ZKSU 1XXFA 1NS3A 2J9NA 1C2LA 4JCNA 2BD2A 2IJOB 1TBZH 3SGAE 1IAUA 1GL0E 3ZVBA 5I46H 3QWCH 1TE0A 3RXRA 2WPKS 1AUTC 3U8TH 4ISNA 1EQ9A 1UVTH 3ZVDA 3BTKE 1SLWB 1FMGA 3ZZ3A 1BRBE 3V7TA 1O32A 4A1VA 1GVZA 3EQ0H 1UTMA 4ISLA 3P8GA 2GP9B 1LMWB 1SOZA 3SGQE 2J2UA 1TPAE 1AWHB 1A7SA 1GCTB 3RXCA 1GHWH 1P09A 3RXKA 2OP9A 1GHAF 3U1JB 1W0YH 3BTGE 1TNKA 2ZA5A 3FP6E 3KQEA 2P8OB 3EA9A 3SHAH 3U69H 1EB1H 5HMAA 2OC7A 3U8OH 1HAIH 1YM0A 5GPIB 3HKJB 4INKA 4XOJA 5DP3A 3PROA 4MPWA 1EAWA 3SJ8A 3LOXA 4H6SB 2HLCA 8ESTE 1J8AA 3SUEA 1T31A 2K1QA 3QLPH 3ZZCA 2OC0A 2A4QA 3V13A 4ISOA 2CF9H 3DUXH 3UNQA 1BZXE 2AS9A 4MPUA 2BDGA 2YOLA 1A1RA 1WV7H 3L6PA 5BPEA 5L2YH 3TH4H 4YM9A 2C4FH 5IDKA 5ETXA 1KXCA 2J94A 1T8OA 1Y3WA 1SGNE 3S9CA 4Q7XA 4CH8B 3RLYH 2TGDA 1THRH 3TK6A 3SU6A 2AH4X 1O35A 1SQOA 2KAIA 1BTXA 1INCA 1C1SA 1ORFA 3E0NB 1O30A 5DGJA 4CHAB 4GSOA 1GI9B 3ZZ8A 3TK5A 4TY6A 2Y80A 2XBVA 5A8XA 1XKAC 1NPMA 1DUAA 1C5MD 2UUFB 2VWOA 1C5VA 3RXEA 1KYNA 1C5SA 1O2SA 3RU4E 4MDSA 1ELTA 1AZ8A 1O2RA 2TIOA 1DXWA 4MPXA 2EI8A 1P2OA 1UK4A 1GL1A 1T4UH 1PPGE 1O3KA 4NFFA 3VB5A 2B9LA 1W11U 4AFQA 2FOGA 3RXGA 1UTLM 4NWKA 3T5FH 1GMHF 4U30A 4BTUB 2FESH 1SLUB 2GV7A 1ELDE 1FI8A 1V2NT 2SGDE 2QXJA 1V2MT 1P11E 4IMQA 2SNVA 3MNBA 3VPKA 4GPGA 4WH8A 4MTBA 4CRFA 3BEIB 2D8WA 2VIQA 2ZC9H 1EZUC 4D9QA 1Y3VA 3G01A 4X1QU 3LGUA 2ZFSA 3S7HB 3LKWA 1LVMA 3M61U 4IGDA 4ZH8A 1VGCC 4VGCB 3LC5A 4E06H 1IQEA 2QCYA 1OXGA 2ZU4A 3NZIA 3ELAH 2FTLE 2ZGCA 4YLUA 2ZDAH 4Q7YA 1N6XA 2BDBA 1GDNA 1P2IA 2AGEX 2HALA 2OBQA 4AFZA 1KXFA 3CENA 2TBSA 1BITA 1E0FD 3ZZ9A 4M7GA 3FP8E 3OSYA 1HAHH 1AB9C 3ODDA 3MU8A 3GY4A 1YBWA 2PGBB 2VWLA 1TABE 1W12U 1GJ4H 3K65B 1MTUA 4JZIA 3SV6A 1O3IA 1O2YA 1P3EA 9ESTA 2WUBA 5F8TA 4ZXXH 3UWIA 1GG6B 1A0LA 3ZVGA 2D1JA 3TH3H 1RGQA 1KY9A 1P57B 1UVOA 1C9PA 1HAGE 2F9OA 3S9BA 1Q3XA 1S84A 1KDQA 1HDTH 1T8NA 2A7CA 4SGBE 4WXVA 2FOAA 2QGRA 4FU8A 1TPSA 1YLCA 3A88A 1SFIA 4ZAEA 1VITG 1C5RA 1MKWH 1TQ0B 4O3UA 2WV5A 5C1UA 1C4Y2 5GXPA 1TOCB 4GHQA 1F5LA 4FUCA 3MU4A 2VIWA 2FOHA 1FN8A 1SHHB 3VXFH 3BG4B 1D3PB 3LC3A 1LVYA 2ZIQH 1E34B 4AX9H 4OS2A 5T6DA 1EJNA 4DIIH 2PWXA 1ZHPA 4XFQA 4UFEH 5ESBA 2A1DB 1W3CA 5HM2A 1AN1E 3F9FA 1UVSH 4JYUH 1C1MA 1CA0C 4FUBA 1MBQA 5GJ4B 3A8BA 2H5CA 1DX5M 3OYPA 2EI6A 3PMJA 1MMJN 1ZMNA 2QXGA 2PGQB 4ZKOU 2BQ6B 2GDDA 1C2EA 2ZEBA 1UHBA 1J17T 2Z7FE 2BQ7B 3U8RH 1P12E 3LONA 1OWDA 2A5IA 1MQ6A 1SGTA 1NRNH 1TA2A 7LPRA 2OXSA 1N8OB 1O36A 4OS1A 1IQHA 3UNRA 2BOHB 1SMFE 1YPLH 1GHAG 1L0ZA 1RRKA 2GVFA 3Q77A 4IS5A 3URCA 4DCDA 1D6WA 1EAIA 2B7DH 2JH6D 1GJ7B 1CE5A 3RC5A 1UTNA 1ZSJA 2ILNA 1YCPK 4J2YB 3RXMA 2P59A 1HNEE 2UUYA 2FEQH 1L1JA 2FO9A 3RXVA 4BXWA 5EPYA 1P0SH 1ELGA 3SQHE 2Q6DA 1HAOH 3RXIA 1BT7A 5FX5A 2VU8E 1C9TA 3D62A 3SNCA 1V2PT 4JZ1A 2HNTE 1YCPM 2VNTA 3S7KB 1TRNA 1NY22 3HPTB 1C1UH 2Y81A 1FIWA 3TJOA 1TALA 3Q3KA 2NU1E 1SVPA 4AN7A 2H9TH 4WMDA 1FY5A 1NO9H 1ZR0A 1LHEH 1TNHA 1IOEA 4ABGA 4FU7A 2XBXA 6GCHF 3AAVA 2V35A 1QBNA 1BTZA 1RS0A 1O2HA 1WQVH 2ZDVH 3ZVCA 2GV6A 3KCGH 3MNXA 4RKJB 2J4IA 4FUGA 1MU6B 1F5RA 1Z8GA 2VIOA 2WUCA 1GJBB 1XUIA 1ESTA 1FONA 4IBLH 1BHXF 1EB2A 3P92A 2EC9H 1AIXH 1H9IE 1DPOA 1MCTA 5A0BA 3STIA 4NZLA 2BY6X 1HIAB 2CHAB 3PO1B 2BLVA 1O2IA 4NA9H 2BX3A 1QL7A 5JYIA 3D23A 1GMHG 1QIXB 1MQ5A 2G4TA 1C4V2 1GHBF 5AHGH 5C20A 4NSVA 2GDEH 2ZDKA 3DFLA 3MOCA 3ZZAA 2P95A 1GBEA 1GBBA 1E36B 2P3TB 1LPZB 2SNWA 3TITA 1WTHD 1GI2A 3S0NA 1YLDA 5DP9A 2VIPA 3KHVA 1XMNB 4IC5A 1HCGA 4RN6A 1HLTH 5F03A 2ANYA 2FM2A 3U9AH 1PYTD 2OD3B 1RXPA 2XCFA 3ATKA 4ZHAA 2AIQA 1IQNA 1T8MA 5JPMH 2XCNA 1GCTC 3GY5A 1H9LB 2ZU1A 3HK6B 3MWIU 5F8XA 4ABIA 2B5TB 1ZHRA 1C5YB 2QF3A 2P8OC 3TU7H 1VR1H 4BAOB 3SJIA 1GBMA 3RLWH 2NU2E 1CGHA 2HVXA 3W95A 4LZ4B 2UWOA 2HPQH 3O8BA 1V2RT 3AAUA 3RXFA 4BTTB 2PHBA 1O3HA 4X2XA 3GCOA 1P2JA 5FXLA 3SI3H 4DG4A 2A32A 1XUHA 5EQSA 4AZ2B 2SGFE 5C1XA 3T27A 1GI4A 5AVDA 3BTFE 2PKAB 2Z3CA 1EOLA 1NFUA 4YO9A 1B0FA 1HAXB 4RKOB 4ABJA 1ELEE 2JETB 3P95A 1RJXB 1O34A 1V2JT 3KGPA 1EASA 2RCEA 4BNRA 1EOJA 1ZRBA 3ZZ6A 3A81A 3NUMA 4ZMAH 2F9UA 5L30H 1DITH 1VCPA 4BAHB 3RXJA 1IHTH 4Y8XA 1CBWB 1KIGH 2ZF0H 2R0KA 1GBFA 4UDWH 4CHAC 3KNXA 4NSYA 4NIXA 4X2YA 3T25A 2FX4A 4TWYA 1GI5A 2Z9KA 1QFKH 1OWJA 1Q31A 2BLQA 3UR6A 4Y11E 2BY8X 1HAZB 1QTFA 3M3VA 4I7YH 2HNTC 4UEHH 1O2PA 5K7RA 2AERH 1H4WA 1EAXA 3LH3A 4GLYA 4INHA 1DSTA 2BDAA 1UMAH 2G5VA 4FUHA 2EEKA 3V3MA 1ELFA 3L3TA 1O37A 4MNYA 1MU8B 1QY6A 2XC5A 1OWHA 3ZVEA 6ESTA 2BXTH 3RDZA 1LQEA 3FAOA 4PROA 2GCHF 1AVXA 2BMGB 1SI5H 2ZFTA 2GZ8A 5DO4H 1TAWA 1SGDE 4MPVA 4AB8A 2AMPA 4GVUA 4O9VA 7GCHG 1C2IA 1TPOA 3RXSA 5E0GA 1FDPA 1G2LA 1A0JA 1GPZA 1YP9A 4X6PA 1T32A 1DWDH 2UWLA 5LGOA 3P8NA 4CREA 1UK3A 4VGCC 3CS0A 1WTGH 4ZKNU 2F3CE 2CMYA 3RMOH 1BOQA 5F8ZA 1NC6A 5JBAS 3TNTA 5L6NH 2HPPH 3PLBA 1AE8H 3GYLB 4Y7AA 6LPRA 1AHTH 1A5GH 2EI7A 1P2NA 2QXHA 5C1YA 1TX6A 1OWIA 4KGAA 3ZZ4A 7KMEH 2BDHA 2ALPA 1KTSB 3PB1E 1YCPH 2O8LA 4AGKA 1DWEH 2SGQE 5DKMA 2FOCA 3A8CA 5J4SA 3RC4A 2HRVA 2GGVB 1SGCA 3S69A 2FI5E 1UVUH 1QB6A 3MO9A 1PQ5A 1CU1A 1AKSB 1GG6C 1SGEE 1O5DH 3F6UH 4OS4A 5DPAA 3LIWA 3VEQB 3FVFB 1BHXB 3URDA 1VCWA 3QGNB 3RUOA 3QZRA 1FNIA 3RXBA 1EPTB 1YPGH 2EA3A 2VVVA 4QT8C 2XYAA 6CHAB 1TNLA 1O0DH 1OWEA 1S6FA 4AB9A 4FVBA 2G81E 1ANEA 1F0UA 4NWLA 4AG2A 1ZHMA 1CHOF 1WUNH 1D6RA 3ZZDA 5EGMA 3ZVFA 1C5LH 1ZRKA 2XWBI 4UD9H 1ZZZA 3BG4C 1TRMA 2BDYA 3NKKA 1XUJA 3QZQA 2G00A 1JOUB 2SFAA 1FY8E 3QX5H 1MZDA 1FZZA 3TJUA 3V12A 4X8UH 4ZHMU 1W14U 1C1NA 1J16A 1GHBG 2C8ZB 4B2BA 2G55A 8GCHF 4HGCA 3SJKA 4OS6A 2ZHFH 2FLRH 2W3KA 1AMHA 3ENSB 1YPJH 3SUDA 1GI6A 4H42U 2PLXA 1CVWH 4YOIA 3RXUA 2ZGXH 3LGVA 1SGYE 4UFDH 1D3TB 3TGJE 3E0PB 1FXYA 1IQMA 1TMTH 1N8OC 2ODYB 1XUGA 5FCRA 1UO6A 3EAJA 2BY7X 2G52A 1YKTA 1X7AC 2TRMA 2ZGBH 3IWMA 1BUIA 5JDUB 1ZTKA 3M5NA 1Y5UT 2GMTB 1ZJKA 2VWNA 3HGPA 4JZEH 5FX6A 1SG8B 1QQUA 1JXPA 3A7WA 2XW9A 1WSSH 3I77A 2BXUH 1DLKB 3KEEA 1B0EA 3HKIB 3AW0A 1EJAA 3ZZ7A 1P2KA 2QN5T 2G51A 1GGDB 1KTTB 3UFAA 2J38A 1Y5AT 3Q3YA 1G30B 2ZDMA 4B1TA 3TGKE 1FLEE 1TWXB 3PLPA 2BLOA 4OS5A 1KXDA 3SUGA 4CRDA 2VVCA 4O3TA 1CT4E 1Q2WA 4I8JA 3A80A 9LPRA 1MH0A 3SBKA 1TGSZ 3A7TA 1A5HA 4FUDA 3A84A 1C5UA 5E8EH 1DFPA 2HOBA 4Z0KA 2VH0A 3FZZA 2FOFA 3RP2A 2Z3EA 3O8CA 3SU1A 3BIVH 4Q7ZA 4MG3A 4CBOA 3RXPA 2JH0D 1OOKB 4NFEA 2FS8A 2JH5D 1TONA 1M9UA 3GCHB 2A7HA 2W26A 1QQ4A 1ESAA 1O3GA 1E35B 1GVLA 1V3XA 1BTUA 2BQWB 3HATH 3LPRA 2P94A 1QL9A 1GI7B 1O2MA 2CHAC 2BDCA 3PO1C 2QY0B 4B2AA 2ZQ2A 3A85A 2YNAA 1PPEE 3AASA 1GDQA 3QN7A 1QURH 3T29A 2ZCLP 2ZTZA 1O5EH 1XUKA 2ZHWH 5J4QA 3BSQA 4DVAU 2BD3A 5FBEA 1D3DB 1C2GA 1OYTH 2ZTXA 5CE1A 1C2MA 4SGAE 2GCHG 1GCDA 2ZCKP 1V2WT 1PPZA 1VITH 2H6MA 1KXBA 1LVBA 3K9XB 3R3GB 1EXFA 4CR9A 1P2MA 2DUCA 1G3DA 3LGTA 1LHFH 5FCKA 2THFB 3P8OA 1NFWA 1GJ5H 4ABHA 1L1NA 1S6HA 4O97A 1DY8A 3PYHA 1ID5H 3GY6A 1AVGH 2FOBA 3A8DA 2FDAA 1AU8A 3JZ2B 1OX1A 3KF2A 4ABFA 1TMBH 3RXQA 3ITIA 2QYIA 2H5DA 1Z8IB 2J92A 4MLFB 2V6NA 2ANKH 4X2VA 1K28D 4CRCA 1W0ZU 3TIUA 2WPHS 3PTNA 4I8GA 2ZU2A 1DXPA 2P3UB 1ZMJA 3IG6B 1WBGB 1TFXA 1AE5A 3A87A 2R0LA 4DW2U 1TGCA 2Y5FA 2BHGA 3F1SB 5E2OA 1T7CA 2ZU3A 1TBQH 3UNSA 2IN2A 3AW1A 1FJSA 3EYDA 5LH8A 1Z6EA 5E0JA 1A4WH 5L2ZH 3PTBA 2CV3A 1N1LA 1TLDA 1A3EH 5JB8S 2JETC 1A61H 1C1OA 4K5ZA 1GVKB 3B23B 2A5KA 3MH4A 1H9HE 1RTFB 3ATIA 5C5OA 1JIRA 1P2QA 1TOMH 2GT8A 1SC8U 1O3BA 4B75A 1AWFH 1C1WH 1VJ9U 1CBWC 1CHOG 2VIVA 2ZO3H 2FPZA 3B9FH 1G2MA 3A7ZA 1F92A 1GJ6A 3BTHE 1O2XA 2OQ5A 3KL6A 3A7VA 4K60A 1LCYA 2W3IA 3FP7E 1DDJA 1ELAA 1QNJA 1TYNA 2C3SA 3A89A 4I33A 1LVOA 4UE7H 1Y3UA 1KLTA 1O3OA 3M5MA 1C2HA 4JZDH 5JBCS 5DP8A 7GCHF 4U2WA 8GCHG 1TX8A 1WAYB 1HUTH 1WOFA 2A2XH 2SGEE 1WU1A 3LDXH 3GDSA 3UTUH 3M5LA 1QBOA 3CS7A 1GBTA 3QK1A 3DD2H 1QJ7B 1PQ8A 1XVMA 3EE0B 3SU2A 1O2WA 5E2PA 1W7GH 1SLXB 2Z3DA 5C2ZA 4NIVA 4ZXYH 1P10A 1SQTA 3Q3XA 1LTOA 1NFXA 1AZZA 1NM6A 2C93B 5TJXA 8LPRA 4NCYA 2I6SA 3P70B 3RU4T 1LHDH 1YGCH 5A0AE 1GMCF 1BB0B 3MMGA 3NWUA 2H9EH 1C1VH 1OPHB 1HV7A 1O3JA 1D3QB 2SGPE 4MNVA 1K1JA 2Y6TA 3AVZA 2VVUA 1Y3XA 1K1OA 4D7GA 2ZDNA 2BY5X 1Z1JA 4WXIA 4D8NA 3SQEE 4CRAA 4BTIB 2PTCE 4FU9A 3PWBA 2ZWLH 1MTWA 5ESTE 1S81A 1HIAA 1CA8B 1S83A 5HM9A 1H8DH 2IPHA 4MQAA 3TGIE 3RXAA 4HZHA 4CR5A 3BTME 2G8TA 2FOEA 1K9OE 1FAXA 1ELVA 1KXAA 2D2DA 3O8DA 1K1MA 2K7XA 1C1QA 1CSOE 1QA0A 1LPGB 3LJJA 1GHYH 1ETRH 2SGAA 4XE4A 1PJPA 3ATLA 1SGFG 2W7UA 4A7IB 1SLVB 1NTPA 1G9IE 1WCZA 1K22H 3MH5A 1EPTC 1C4U2 2ZFFH 4GCHF 6CHAC 3A8AA 4X1RU 1P9UA 2BZ6H 4LOYH 3V0XA 1G36A 2ZGHA 5LPEA 1BTPA 1XUFA 1O38A 4BOHA 2ODQA 1K1LA 1V2OT 3M7UA 1VZQH 3LGIA 1JRTA 2Z9IA 3BEUA 4JZFH 4NIYA 5FPSA 4RSPA 3MU5A 2QIQA 3NCLA 1UTQA 3VB7A 1SR5C 1JMOH 1QL8A 1TNIA 3U1IB 3GY8A 4YT6H 1TIOA 1MKXK 3DFJA 3C27B 5EQRA 2Z9JA 1OSSA 5C67A 2Z9LA 3TNSA 2J95A 1TB6H 2Z9GA 5DP5A 2PKAA 1Z6JH 1EAUA 4ASHA 4I8HA 2A31A 4Y76A 4AORA 1T4VH 1C5WB 1BDAA 1HAYB 3UR9A 4Y71A 4IC6A 2QA9E 4X6OA 5JBTA 4YESB 3ATWA 1TGTA 1OWKA 1HBTH 3ZZ5A 3GCTF 3ZYEA 4YLQH 1W2KH 3ZYDA 3DHKH 3JZ1B 1F7ZA 4WJG2 4B76A 2B0FA 1P05A 3R0FA 4WMFA 3BTEE 1LQDB 2PW8H 2PFEA 1LO6A 2GMTC 3BTWE 4XDEA 1ZMLA 1LKBA 4A1XA 3UWJH 2F91A 4ABDA 1P9SA 1DOJA 4X8TH 3OX7U 1BTWA 1C1RA 1GGDC 4JK5A 1IQFA 2HGTH 5LPFA 1YPHE 4X6NA 2VH6A 1D4PB 3GY3A 5CHAB 3RMNH 4TYDA 1ZPZA 2WINI 3PLKA 5AFZH 3DA9B 2NU0E 4ZROA 1O2LA 1ZTLA 1F2SE 1DS2E 1BRAA 1GBDA 1BMMH 1C5XB 3SO3A 2ZDLA 4Y79A 2ZFPH 1F0RA 1UCYK 1ABIH 1Y5BT 1ZTJA 1QJ1B 1GI1A 2QXIA 4JYVH 2TGPZ 2FTMA 4ZHLU 3E90B 4AYVB 1CT2E 2LNCA 3H5CB 2ZNKH 4IW4E 3TVJB 1VJAU 2OC8A 1O2QA 3SORA 5DJ7A 1LDTT 4A5TS 1H8IH 3A7YA 2ZHQH 3IITA 2HNTF 1BTHH 3UOUA 1O5AB 5BRRE 2C8YB 3T26A 3BTTE 3GCHC 1MAXA 4Q2KA 5T3HA 2P93A 2FIRH 2P3FH 2UWPA 4BANB 2WV4A 4B2CA 1OYQA 5B6OA 3SV2H 1TX7A 1OP8A 1PPFE 5GCHF 4K69A 2ZP0H 4ABAA 3ZV8A 1O3PB 3D49H 4BAQB 1OP2A 1A0HB 4Q80A 3VB6A 2ZHDA 4NA7A 1XKBC 4CBNA 2ZPQA 2TPIZ 1P04A 2CN0H 4CRGA 1O3DA 3MH7A 1NRQH 2V3OH 2TGTA 5HGGA 1HXEH 5EOKA 1AKSA 2OCVB 1NN6A 3DT0H 1L4DA 1GMDG 1Z7KA 1ZSLA 1GBKA 1GMCG 1EPTA 1QRXA 1TA6A 2VGCB 4DOQA 2FZZA 1O2OA 1NFYA 3FZDA 1AGJA 2AIPA 1SGRE 3TLOA 4D76A 2PSXA 2PTNA 1C5TA 3QTVH 2BZAA 4X1PU 4DURA 3BF6H 2R9PA 3VGCB 1UVPA 1MZAA 1P8VC 2FLBH 3LU9B 1W13U 2ZZUH 3ODFA 2YNBA 1HPGA 2VIDA 1BMLA 1JWTA 4I32A 2ANWA 2ZI2H 1DM4B 1OP0A 1UTPA 3ZZBA 2XC0A 1P3CA 2VWMA 2AGGX 2ZG0H 3K6YA 1QGFA 2CJIA 2Y82A 3BV9B 1O2NA 1RIWB 1MTNB 4MNWA 4U32A 3P6ZB 3OU0A 3PMBB 1DWBH 2PUQH 3UUZA 4R0IA 3VXEH 1NZQH 4NG9H 2F9BH 1ZPBA 1GBHA 1PFXC 1WYKA 4ZUHA 1GI0A 5A8YA 2Y7ZA 4D7FA 2PSYA 2O8TA 3T28A
chains in the Genus database with same CATH superfamily
4UFGH 2WPMS 1ESBA 3KYFA 4GCHG 1KMHB 3P17H 1ELBA 4MVNA 4YOGA 4UFFH 5FPTA 1BBRK 4F4OC 5EW1H 2Z6BD 1GHZA 5H4IB 2F9VA 1ANCA 2VJ1A 2ZGJA 1SSXA 1CO7E 2ZPRA 4AGJA 1SFQB 1B5GH 2BM2A 1K21H 3BIUH 5EXNA 4AYYB 3CP7A 5SGAE 2FODA 2FOMB 1HAVA 5A0CA 1SPJA 2ZCHP 2BVRH 5TCAA 4GHTA 1N6YA 1V2QT 1EJMA 1YPHC 3EDXB 5CDFE 4O03A 3UOPA 1F0SA 2BVSH 3RC6A 1XM1A 4H6TA 1HJAB 1Z1IA 1UK2A 2R3YA 1BTYA 2F83A 8KME2 1GBIA 5FBIA 1V2UT 3NXPA 5DK1A 3EGKH 4BAMB 1HAVB 2XBWA 2VINA 3A7XA 2FWWA 3UQVA 5AF9H 2ALVA 1MKXH 3A83A 1LPKB 1CQQA 3SN8A 1J15A 1B7XB 3K2UA 3SV7A 3GCTG 1ETSH 3UPEA 1L1GA 2BB4A 1L4ZA 5C3NA 2STBE 4IMZA 2ZFQH 3MU1A 1O2TA 2OINA 1TGNA 2V3HH 1E37B 1KLIH 4JYTA 4LXBH 1MD7A 3BEFB 2CF8H 2O9QA 4WH6A 1MUEB 1A5IA 4K3JA 1ZSKA 1O2ZA 3SUFA 4E7NA 3MQKC 1S0QA 1NRPH 1QA7A 4X6MA 4UONA 2FYQA 5TCCA 1UTJA 2KFWA 1O3EA 4BXSA 3SNBA 4DGJA 3DSOA 1Y8TA 1BJUA 5C0TA 2GX4A 2PR3A 1AI8H 4DY7B 2LIZA 1SGIB 5JB9S 1PQ7A 2NWNA 1BMNH 3GICB 1AUJA 1G3CA 3T2NA 3OTPA 2LPRA 2BD8A 4ISIH 1GJCB 4NZQA 5EG4A 5EXLA 1O5FH 1UJ1A 4THNH 5EPNA 1C5OH 3GDUA 5FAHA 1Y59T 1UTKA 1JRSA 2BD4A 4I31A 1QBVH 1S85A 5B6LA 3KQCA 3SOSA 2KAIB 2BDIA 2ZECA 4JK6A 4ISHH 4Z1MD 4I8KA 1C5PA 2H9HA 2WPJS 5HKKD 1PYTC 2XRCA 2QF0A 5F6MA 1THPB 3L33A 4RT1A 4A92A 2OUAA 3M5OA 3A86A 3RXOA 4AG1A 1EP5A 1O2GH 3A82A 3RM2H 3MU0A 1UCYH 4FUIA 2BD5A 2K8IA 1SOTA 2VB0A 1BIOA 1AFQB 1DLEA 3P8FA 1CT0E 1W10U 5ABWA 1SHYA 3RXLA 3GISB 5A8ZA 3VB4A 2WZQA 2GTBA 2F9NA 3BTDE 2AFQB 1HRTH 3M7TA 5FL7D 1S82A 4KTUA 3UREA 1BMFD 5FHTA 3MYWA 5JBBS 3EA8A 1SB1H 2Z94A 3FFGA 1BMAA 2D26C 3QO6A 5GCHG 3GCNA 4WWYA 2GCTB 2HLDD 3QTOH 4X1SU 1GJ9B 1V2KT 4A6LA 2RDLA 1KLJH 2AEIH 1OKXA 5E0HA 4OGXA 4AFUA 3BG8A 2PKSB 1W8BH 2FS9A 1AFEH 3SJ9A 4WMEA 4CH2B 1QR3E 1O3CA 2XNDD 2HVYB 1C5ZB 1PQAA 1WQSA 3MNCA 1MD8A 3E6PH 2GZ7A 2QAAA 1THSH 1GHXH 2BLWA 4GUXA 2GKVE 1K1PA 5DP6A 2Q6FA 5T6FA 2A45B 1P01A 2BVXH 3NK8A 2L74A 3TPIZ 2TGAA 1GBLA 3TJNA 2ODPA 2BY9X 3HGNA 3FANA 2BYAX 1YF4A 3UAIC 1D9IA 2RG3A 4TWWA 2NU4E 1FAKH 4Y10E 1IHSH 3E91A 1A3BH 4JMYA 1VCQA 2PP6A 3SI4H 5CHAC 1DVAH 1GJAB 1HYLA 4WVPE 3W94A 4X8VH 1YC0A 3M35A 2G5NA 4X0WU 1FY1A 3SV9A 3T62A 4U01A 2AYWA 1QB1A 2J34A 1KDQB 1G37A 2V3MA 1GHVH 4ACAA 1ABJH 5DSFA 1O2JA 1AO5A 1ZGIA 2A2QH 2WYJA 5T1VA 1LHCH 1BRUP 4ZKRU 4KTCA 3WWBA 1J14A 5T6GA 1O2VA 1NU7B 3F2FA 2XNIA 1ZOMA 2I6QA 3H7OA 4BAKB 1BJVA 2BD7A 4WY3A 1P02A 4OGYA 1BCUH 1EZXC 2V0BA 5PTPA 3SZEA 2ZHEH 3KIDU 1GBAA 2GZ9A 1FIZA 3RXDA 1V2VT 2AMQA 2QV1A 1XXDA 1SL3A 1GI8B 4F49A 2UUJB 3LGYA 3OTJE 3BN9A 4WF8A 1MAYA 1BBRH 1A2CH 3SNAA 2FXRA 2EQNA 3GYMA 3VFEA 3GDVA 4FUEA 4X1NU 1TQ7B 4M9FA 1G3BA 4CRBA 1DY9A 1V2LT 4TPYA 1F5KU 4KELA 1DICA 4K1SA 1GMDF 1L2EA 2A7JA 2C90B 3I78A 2JJ2D 4K1TA 1UHBB 1C2DA 4FUJA 1DUEA 1RTLA 3F0OA 1SGFA 2FI3E 2G4UA 1FPHH 3E1XB 3NPSA 1ANDA 2FX6A 1BRCE 4TPIZ 2O8MA 4FUFA 2M2AA 4YT7H 3OY6U 2CGAA 2R2WU 4Y0YE 1K1IA 4XBDA 1C2KA 2B8OH 1P06A 3QUMP 2ZFRH 2FI4E 1GJDB 1G3EA 1GWAA 4K8BA 3C1KA 3K6ZA 1S5SA 4FOUC 1O31A 1C1PA 3STJA 3SNEA 5I25A 1AD8H 1U6QA 2VGCC 3PMHB 4AOQA 7ESTE 2OC1A 1O5BB 2ZTYA 2ANMH 4XBBA 5DP7A 4DJZB 4XSKU 2FMJA 1KXEA 1EZQA 4B73A 2DE8A 2F9PA 3LT3A 2OTVA 1RFNA 3ATMA 3F9HA 3UIRA 3M3TA 4R8TB 4I86A 3EA7A 1ELCA 3BTQE 3VGCC 1DSUA 5LPRA 2H2ZA 4IN1A 3SU3A 3SV8A 1A46H 1P03A 3OY5U 5G4BA 2QC2A 3PMAB 1IQKA 4DT7B 4YZUA 1TBRH 4F55A 1SGQE 1EZSC 1MCVA 1UCYE 1ETTH 1DT2A 1HJ8A 3MFJA 4XRNA 1F0TA 1YPMH 2H1UA 2Y5GA 1AQ7A 1RIWC 1MTNC 2BTCE 2FP7B 3MO3A 3N7DA 1DWCH 2ZKSA 3MHWU 4HFPB 3PV4A 2OBOA 4B74A 1V6DA 1HJ9A 3S9AA 1JIMA 1SBWA 1ACBE 1XVOA 1VGCB 2UUKB 1RD3B 4GAWA 1CHGA 4ESTE 2XWAA 2BD9A 4KTSA 1JBUH 4ABEA 1TMUH 1NT1A 3MO6A 3Q00A 4HTCH 1UTOA 3ESTA 3PM3A 3SHCH 4YTAA 2C8WB 5IYTA 1O2KA 1QRZA 1NROH 3U98H 5EU8A 2CK3D 4J1YA 1AB9B 2IOTA 1ZGVA 1T8LA 1HGTH 3M3SA 3D65E 4K2YA 5HYOA 3GOVB 1DE7H 1Z8JB 1HJAC 3N7OA 1EATA 4H4FA 4F48B 2WYGA 4FVDA 1LHGH 4K8YA 1IQJA 3PWCA 4OM9A 4FXGH 3WY8A 5DG6A 2PV9B 4E05H 5C5NA 1W7XH 3FOAA 3LH1A 4I8LA 5K0HA 4DIHH 1ZYOA 1TNGA 4NA8A 5GDSH 1SGPE 1XX9A 3LJOA 5AFYH 3RM0H 5DP4A 2R3UA 4B71A 1O39A 2ULLA 2XBYA 2ZU5A 1CGIE 1IQGA 5HXFA 2A4RA 1PPHE 2OQUA 5FPYA 3SZNA 1BQYA 3N99A 2R2MB 1IQLA 3SGBE 1O3FA 1CGJE 4A1TA 4X8SH 1Z8RA 1C2FA 2AGIX 2M5TA 1J9CH 3RXHA 1MTVA 1KSNA 3GY7A 1YYY1 1O5CB 2ASUB 1MBMA 2GD4B 3KN2A 1K2I1 4TY7A 5EW2H 1E79D 1QCPA 1PPBH 2PUXB 4Y0ZE 3SU0A 1SQAA 1ARCA 1H1BA 2ZQ1A 2O8UA 2A4GA 2OLGA 3Q76A 4NGAH 5A09A 2GT7A 2P16A 1EUFA 1FV9A 1TNJA 2A0QB 5GWZA 1O3NA 3SJOA 1O33A 1CA0B 2F43B 4HI3A 3B8JA 3TH2H 1NRRH 1BA8B 1HAPH 2STAE 4X2WA 1QHRB 1C2JA 1GDUA 1TGBA 1E38B 4YOJA 1AY6H 3MNSA 1EX3A 1IQIA 1BBRE 1YPKH 1LKAA 4Q63A 2A5AA 2RA0A 2KR7A 3PRBA 1V2TT 1K1NA 1FY3A 1HB0B 4Y7BA 1Y3YA 4Z6AH 2JDID 3QDZB 1MTSA 1QRWA 3ZV9A 1V2ST 3M36A 4INLA 1FPCH 1C5QA 4Y6DA 2ESTE 2YMSB 3H7TA 1H8HD 4KP0A 4OS7A 3ZIAD 2RA3A 3ZVAA 1ARBA 3E16B 3EBNA 3UY9A 4Y8ZA 1NESE 1ZJDA 1AFQC 3M37A 1EKBB 5EQQA 1C5NH 1FUJA 2W5EA 3RMLH 5CMXH 3SNDA 1O3MA 1DANH 3TJVA 1HXFH 3RXTA 2ZPSA 4NIWA 3RMMH 2JJ1D 1C1TA 3E8LA 3LGWA 2WPIS 3KQBA 2KX4A 3TK9A 2XTTB 2WPLS 5EIYA 3E3TA 1YPEH 1OS8A 1TPPA 1ZLRA 1FN6A 1SQRA 1GBCA 3MI4A 2Q1JA 1QJ6B 2Y5HA 4LK4A 2GCTC 4E7RG 3H09A 2BX4A 3HK3B 1EP6A 5A2MH 1MKWK 3F9EA 2XXLA 3MTYA 2HWLB 2DE9A 4TSFD 1O3AA 1FY4A 1O2UA 2BOKA 3SU4A 3VG8A 2PKSC 3GY2A 3KQDA 1GJ8B 1FQ3A 1GBJA 2A4OA 1ZPCA 3SW2B 1AVWA 3MH6A 2Y7XA 1G32B 3SU5A 5EXMA 2NU3E 3OFND 1RTKA 4Y8YA 2JKHA 1HFDA 1VITF 3F68H 3QGJA 4IN2A 3UQOA 1O5GH 4AFSA 1TRYA 4ABBA 3RU4D 1NU9A 1NRSH 1QB9A 3VB3A 1PPCE 3F9GA 3I29A 2FYRA 5GIBA 3O8RA 2CXVA 5EODA 3M7QA 1ANBA 1GI3A 5C0UA 2Q6GA 2XC4A 1S0RA 2C8XB 4K1EA 4LZ1H 1Z71A 6GCHG 1O3LA 2AMDA 4MNXA 4KKDA 4D9RA 2O8WA 4XBCA 2W7SA 4ZKSU 1XXFA 1NS3A 2J9NA 1C2LA 4JCNA 2BD2A 2IJOB 1TBZH 3SGAE 1IAUA 1GL0E 3ZVBA 5I46H 3QWCH 3OAAD 1TE0A 3RXRA 2WPKS 1AUTC 3U8TH 4ISNA 1EQ9A 1UVTH 3ZVDA 1YLNA 3BTKE 1SLWB 1FMGA 3ZZ3A 1BRBE 3V7TA 1O32A 4A1VA 1GVZA 3EQ0H 1UTMA 4ISLA 3P8GA 2GP9B 1LMWB 1SOZA 4TT3D 3SGQE 2J2UA 1TPAE 1AWHB 1A7SA 1GCTB 3RXCA 1GHWH 1P09A 3RXKA 2OP9A 1GHAF 3U1JB 1W0YH 3BTGE 1TNKA 2ZA5A 3FP6E 3KQEA 2P8OB 3EA9A 3SHAH 3F0PA 2WHXA 3U69H 1EB1H 5HMAA 2OC7A 3U8OH 1HAIH 3KQ5A 1YM0A 5GPIB 3HKJB 4INKA 4XOJA 5DP3A 3PROA 4MPWA 1EAWA 3SJ8A 3LOXA 4H6SB 2HLCA 8ESTE 1J8AA 3SUEA 1T31A 2J97A 2K1QA 3QLPH 3ZZCA 2OC0A 2A4QA 3V13A 4ISOA 2CF9H 3DUXH 3UNQA 1BZXE 2AS9A 4MPUA 2BDGA 2YOLA 1K0HA 1A1RA 1WV7H 3L6PA 5BPEA 5L2YH 3TH4H 4YM9A 2C4FH 5IDKA 5ETXA 1KXCA 2J94A 1T8OA 1Y3WA 1SGNE 3S9CA 4Q7XA 4CH8B 3RLYH 2TGDA 1THRH 3TK6A 3SU6A 2AH4X 1O35A 1SQOA 2KAIA 1BTXA 1INCA 4RI0A 1C1SA 1ORFA 2LP6A 3E0NB 1O30A 5DGJA 4CHAB 4GSOA 1GI9B 3ZZ8A 3TK5A 4TY6A 2Y80A 2XBVA 5A8XA 1XKAC 1NPMA 1DUAA 1C5MD 2UUFB 2VWOA 1C5VA 3RXEA 1KYNA 1C5SA 1O2SA 3RU4E 4MDSA 1E1QD 1AZ8A 1ELTA 1O2RA 2TIOA 1DXWA 4MPXA 2EI8A 1P2OA 1UK4A 1GL1A 1T4UH 1PPGE 1O3KA 4NFFA 3VB5A 2B9LA 1W11U 4AFQA 2FOGA 3RXGA 1UTLM 4NWKA 3T5FH 1GMHF 4U30A 4BTUB 2FESH 1SLUB 2GV7A 1ELDE 1FI8A 1V2NT 2SGDE 2QXJA 1V2MT 1P11E 4IMQA 2SNVA 3OEED 3MNBA 3VPKA 4GPGA 4WH8A 4MTBA 4CRFA 3BEIB 2D8WA 2VIQA 2ZC9H 1EZUC 4D9QA 1Y3VA 3G01A 4X1QU 3LGUA 2ZFSA 3S7HB 3LKWA 1LVMA 3WW7A 3M61U 4IGDA 3DCLA 4ZH8A 1VGCC 4VGCB 3LC5A 4E06H 1IQEA 2QCYA 1OXGA 2ZU4A 3NZIA 3ELAH 2FTLE 2ZGCA 4YLUA 2ZDAH 4Q7YA 1N6XA 2BDBA 5F53A 1GDNA 2KCPA 1P2IA 1COWD 2AGEX 2HALA 2OBQA 4AFZA 1KXFA 3CENA 2TBSA 1BITA 1E0FD 3ZZ9A 4M7GA 3FP8E 3OSYA 1HAHH 1AB9C 3ODDA 3MU8A 3GY4A 1YBWA 2PGBB 2VWLA 3CNRA 1TABE 1W12U 1GJ4H 3K65B 1MTUA 4JZIA 3SV6A 1O3IA 1O2YA 1P3EA 9ESTA 2WUBA 5F8TA 4ZXXH 3UWIA 1GG6B 1A0LA 3ZVGA 2D1JA 3TH3H 1RGQA 1KY9A 1P57B 1UVOA 1C9PA 1HAGE 2F9OA 3S9BA 1Q3XA 1S84A 1KDQA 1HDTH 1T8NA 2A7CA 4SGBE 4WXVA 2FOAA 2QGRA 4FU8A 1TPSA 1YLCA 3A88A 1SFIA 4ZAEA 1VITG 1C5RA 1MKWH 1TQ0B 4O3UA 2WV5A 5C1UA 1C4Y2 5GXPA 1TOCB 4GHQA 1F5LA 4FUCA 3MU4A 2VIWA 2FOHA 1FN8A 1SHHB 3VXFH 3BG4B 1D3PB 3LC3A 1LVYA 3OEHD 2ZIQH 1E34B 4AX9H 3NRLA 4OS2A 5T6DA 1EJNA 4DIIH 2PWXA 1ZHPA 4XFQA 4UFEH 5ESBA 2A1DB 1W3CA 5HM2A 1AN1E 3F9FA 1UVSH 4JYUH 1C1MA 1CA0C 4FUBA 1MBQA 5GJ4B 3A8BA 2H5CA 1DX5M 3OYPA 2EI6A 3PMJA 1MMJN 1ZMNA 2QXGA 2PGQB 4ZKOU 2BQ6B 2GDDA 3SYJA 1C2EA 2ZEBA 1UHBA 1J17T 3UB0A 2Z7FE 2BQ7B 3U8RH 1P12E 3LONA 1OWDA 2A5IA 1MQ6A 3FO8D 1SGTA 1NRNH 1TA2A 7LPRA 2OXSA 3PV2A 1N8OB 2OK5A 1O36A 4OS1A 1IQHA 3UNRA 2BOHB 1SMFE 1YPLH 1GHAG 1L0ZA 1RRKA 2GVFA 3Q77A 4IS5A 3URCA 4DCDA 1D6WA 1EAIA 2B7DH 2JH6D 1GJ7B 1CE5A 3RC5A 1UTNA 2YMSC 1ZSJA 2ILNA 1YCPK 4J2YB 3RXMA 2P59A 1HNEE 2UUYA 2FEQH 1L1JA 2FO9A 3RXVA 4BXWA 5EPYA 1P0SH 1ELGA 3SQHE 2Q6DA 1HAOH 3RXIA 1BT7A 5FX5A 2VU8E 3GS9A 4ACBA 1C9TA 1W0KD 3D62A 3SNCA 1V2PT 4JZ1A 2HNTE 1YCPM 2VNTA 3S7KB 1TRNA 1NY22 3HPTB 1C1UH 2Y81A 1FIWA 3TJOA 1TALA 3Q3KA 2NU1E 1SVPA 2L6OA 4AN7A 2H9TH 4WMDA 1FY5A 1NO9H 1ZR0A 1LHEH 1TNHA 1IOEA 4ABGA 4FU7A 2XBXA 6GCHF 3AAVA 2V35A 1QBNA 1BTZA 1RS0A 1O2HA 1WQVH 2ZDVH 3ZVCA 2GV6A 3KCGH 4HG6A 3MNXA 4RKJB 2J4IA 4FUGA 1MU6B 2WV9A 1F5RA 1Z8GA 2VIOA 2WUCA 1GJBB 1XUIA 1ESTA 1FONA 4IBLH 1BHXF 1EB2A 3P92A 5KEDA 2EC9H 1AIXH 1H9IE 1DPOA 1MCTA 5A0BA 3STIA 4NZLA 2BY6X 1HIAB 2CHAB 3PO1B 2BLVA 1O2IA 2W6JD 4NA9H 2BX3A 1QL7A 5JYIA 3D23A 1GMHG 1QIXB 1MQ5A 2G4TA 1C4V2 1GHBF 2KZ4A 5AHGH 2RFKC 5C20A 4NSVA 2GDEH 2ZDKA 3DFLA 3MOCA 3ZZAA 2P95A 1GBEA 1GBBA 1E36B 2P3TB 1LPZB 2SNWA 3TITA 1WTHD 1GI2A 3S0NA 1YLDA 5DP9A 2VIPA 3KHVA 1XMNB 4IC5A 1HCGA 4RN6A 2F4LA 3WWFA 1HLTH 5F03A 2ANYA 2FM2A 3U9AH 1PYTD 2OD3B 1RXPA 2XCFA 3ATKA 4ZHAA 2AIQA 1IQNA 1T8MA 5JPMH 2XCNA 1GCTC 5KGOA 1FX0B 3GY5A 1H9LB 2ZU1A 3HK6B 3MWIU 5F8XA 4ABIA 2B5TB 1ZHRA 1C5YB 2W6ID 2QF3A 2P8OC 3F3BA 3TU7H 1VR1H 4BAOB 3SJIA 1GBMA 3RLWH 2NU2E 1CGHA 2HVXA 3W95A 4LZ4B 2UWOA 2HPQH 3FKSD 1V2RT 3O8BA 3AAUA 3RXFA 4BTTB 1W0JD 2PHBA 1O3HA 4X2XA 3GCOA 1P2JA 5FXLA 3SI3H 4DG4A 2QE7D 2A32A 1XUHA 2KCYA 5EQSA 4AZ2B 2SGFE 5C1XA 3T27A 1GI4A 2XOKD 5AVDA 3BTFE 2PKAB 2Z3CA 1EOLA 1NFUA 4YO9A 1B0FA 1HAXB 4RKOB 4ABJA 1ELEE 2JETB 5CHBA 3P95A 2VBCA 1RJXB 1O34A 1V2JT 3KGPA 1EASA 2RCEA 4BNRA 1EOJA 1ZRBA 3ZZ6A 3A81A 3NUMA 4ZMAH 2F9UA 5L30H 1DITH 1VCPA 4BAHB 3RXJA 1IHTH 4Y8XA 1CBWB 1KIGH 2ZF0H 2R0KA 1GBFA 4UDWH 4CHAC 3KNXA 4NSYA 4NIXA 4X2YA 3T25A 2FX4A 4TWYA 1GI5A 2Z9KA 1QFKH 1OWJA 1Q31A 2BLQA 3UR6A 4Y11E 2BY8X 1HAZB 1QTFA 3M3VA 4I7YH 2HNTC 4UEHH 1O2PA 5K7RA 2AERH 1H4WA 1EAXA 3LH3A 4GLYA 4INHA 1DSTA 2BDAA 1UMAH 2G5VA 4FUHA 2EEKA 3EE7A 3V3MA 1ELFA 3L3TA 1O37A 4MNYA 1MU8B 1QY6A 4Q4LA 2J98A 2XC5A 1OWHA 3ZVEA 6ESTA 2BXTH 3RDZA 1LQEA 3FAOA 4PROA 2GCHF 1AVXA 2BMGB 1SI5H 1NBME 2ZFTA 2GZ8A 5DO4H 1TAWA 1SGDE 4MPVA 4AB8A 2AMPA 1QZ8A 4GVUA 4O9VA 7GCHG 1C2IA 1TPOA 3RXSA 4YXWD 5E0GA 1FDPA 1G2LA 1A0JA 1GPZA 1YP9A 4X6PA 1T32A 1DWDH 5C17A 1YWUA 2J98B 2UWLA 5LGOA 3P8NA 4CREA 1UK3A 4VGCC 3CS0A 1WTGH 4ZKNU 2F3CE 2CMYA 3RMOH 1BOQA 5F8ZA 1NC6A 5JBAS 3TNTA 5L6NH 2HPPH 3PLBA 1AE8H 3GYLB 4Y7AA 6LPRA 1AHTH 1A5GH 2EI7A 1P2NA 2QXHA 5C1YA 1TX6A 1OWIA 4KGAA 3ZZ4A 7KMEH 2BDHA 2ALPA 1KTSB 3PB1E 1YCPH 2O8LA 4AGKA 1DWEH 2SGQE 5DKMA 2FOCA 2AHME 3A8CA 5J4SA 3RC4A 2HRVA 2GGVB 1SGCA 3S69A 2YMSD 2FI5E 1UVUH 5KECA 1QB6A 3MO9A 1PQ5A 1CU1A 1AKSB 1GG6C 1SGEE 1O5DH 3F6UH 4OS4A 5DPAA 3LIWA 3VEQB 3FVFB 1BHXB 3URDA 4B6FA 1VCWA 3QGNB 3RUOA 3QZRA 1FNIA 3RXBA 1EPTB 1YPGH 2EA3A 2VVVA 4QT8C 2XYAA 6CHAB 1TNLA 1O0DH 1OWEA 1S6FA 4AB9A 4FVBA 2G81E 3F2HA 1ANEA 1F0UA 4NWLA 4AG2A 1ZHMA 1CHOF 3DSPA 1WUNH 1D6RA 3ZZDA 5EGMA 3ZVFA 1C5LH 1ZRKA 2XWBI 4UD9H 1ZZZA 3BG4C 4DT4A 1TRMA 2BDYA 3NKKA 1XUJA 3QZQA 2G00A 1JOUB 2SFAA 1FY8E 3QX5H 1MZDA 1FZZA 3TJUA 3V12A 4X8UH 4ZHMU 1W14U 1C1NA 1J16A 1GHBG 2C8ZB 4B2BA 2G55A 8GCHF 4HGCA 3SJKA 4OS6A 2ZHFH 2FLRH 2W3KA 1AMHA 3ENSB 1YPJH 3SUDA 1GI6A 4H42U 2PLXA 1CVWH 4YOIA 3RXUA 2ZGXH 3LGVA 1SGYE 4UFDH 1D3TB 3TGJE 3E0PB 1FXYA 1IQMA 1TMTH 1N8OC 2ODYB 1XUGA 5FCRA 1UO6A 3EAJA 2BY7X 2G52A 1YKTA 1X7AC 2TRMA 2ZGBH 3IWMA 1BUIA 5JDUB 1ZTKA 3M5NA 1Y5UT 2GMTB 1ZJKA 2VWNA 3HGPA 4JZEH 5FX6A 1SG8B 1QQUA 1JXPA 3A7WA 2XW9A 1WSSH 3I77A 2BXUH 1DLKB 3KEEA 1B0EA 3HKIB 3AW0A 1EJAA 3ZZ7A 1P2KA 1OHHD 2G51A 2QN5T 1GGDB 1KTTB 3UFAA 2J38A 1WXRA 1Y5AT 3Q3YA 1G30B 2ZDMA 4B1TA 5HIYA 3TGKE 1FLEE 1TWXB 3PLPA 2BLOA 4OS5A 1KXDA 3SUGA 2JIZD 4CRDA 2VVCA 4O3TA 1CT4E 1Q2WA 4I8JA 3A80A 9LPRA 1MH0A 3SBKA 1TGSZ 3A7TA 1A5HA 4FUDA 4FETA 3W1EA 1EFRD 3A84A 1C5UA 5E8EH 1DFPA 2HOBA 4Z0KA 2VH0A 3FZZA 2FOFA 3RP2A 2Z3EA 3O8CA 3SU1A 3BIVH 4Q7ZA 4MG3A 4CBOA 3RXPA 2JH0D 1OOKB 1S6LA 4NFEA 2FS8A 2JH5D 1TONA 1M9UA 3GCHB 2A7HA 2W26A 1QQ4A 1ESAA 1O3GA 1E35B 1GVLA 1V3XA 1BTUA 2BQWB 3HATH 3LPRA 2P94A 1QL9A 1GI7B 1O2MA 2CHAC 2BDCA 3PO1C 2QY0B 3PRDA 2ZQ2A 4B2AA 3A85A 2YNAA 1PPEE 3AASA 1GDQA 3QN7A 1QURH 3T29A 2ZCLP 2ZTZA 1O5EH 3DSGA 1XUKA 2ZHWH 5J4QA 5EJLA 2KM0A 3BSQA 4DVAU 2BD3A 5FBEA 5C94A 1D3DB 1C2GA 1OYTH 2ZTXA 5CE1A 1C2MA 4SGAE 2GCHG 1GCDA 2ZCKP 4B6EA 1V2WT 1PPZA 1VITH 2H6MA 3F2GA 1KXBA 1E1RD 1LVBA 3K9XB 3R3GB 3FN8A 1EXFA 4CR9A 1P2MA 2DUCA 1G3DA 1VKYA 3LGTA 1LHFH 5FCKA 2THFB 3P8OA 1NFWA 1GJ5H 1WDIA 4ABHA 1L1NA 1S6HA 4O97A 1DY8A 3PYHA 1ID5H 3GY6A 1AVGH 2FOBA 3A8DA 2FDAA 1AU8A 1H8ED 3JZ2B 1OX1A 3KF2A 4ABFA 1TMBH 3RXQA 3ITIA 2QYIA 4RT0A 2H5DA 1Z8IB 2J92A 4MLFB 2V6NA 2ANKH 4X2VA 1K28D 4CRCA 1W0ZU 3TIUA 2WPHS 3PTNA 4I8GA 2ZU2A 1DXPA 2P3UB 1ZMJA 3IG6B 1WBGB 1TFXA 1AE5A 3A87A 2R0LA 4DW2U 2WPDD 1TGCA 2Y5FA 2BHGA 3F1SB 5E2OA 1T7CA 2ZU3A 1TBQH 3UNSA 2IN2A 3AW1A 1FJSA 3EYDA 5LH8A 1Z6EA 5E0JA 1A4WH 5L2ZH 3PTBA 2CV3A 1N1LA 1TLDA 1A3EH 5JB8S 2JETC 2RDEA 5DN6D 1A61H 1C1OA 4K5ZA 1GVKB 3B23B 2A5KA 3MH4A 1H9HE 1RTFB 3ATIA 5C5OA 1JIRA 1P2QA 1TOMH 2GT8A 1SC8U 2V7QD 1O3BA 4B75A 1AWFH 3U28C 1C1WH 1VJ9U 1CBWC 2WSSD 1CHOG 2VIVA 2ZO3H 2FPZA 3B9FH 1G2MA 3A7ZA 1F92A 1GJ6A 3BTHE 1O2XA 2OQ5A 3KL6A 3A7VA 4K60A 1LCYA 2W3IA 3FP7E 1DDJA 1ELAA 1QNJA 2IJD1 1TYNA 2C3SA 3A89A 4I33A 1LVOA 4UE7H 1Y3UA 1KLTA 1O3OA 3M5MA 1UW7A 3PV5A 1C2HA 4JZDH 5JBCS 5DP8A 7GCHF 4U2WA 8GCHG 1TX8A 1WAYB 1HUTH 1WOFA 2A2XH 2SGEE 1WU1A 3LDXH 3GDSA 3UTUH 3M5LA 1QBOA 3CS7A 1GBTA 3QK1A 3DD2H 1QJ7B 1PQ8A 1XVMA 3EE0B 3SU2A 1O2WA 5E2PA 1W7GH 1SLXB 2Z3DA 5C2ZA 4NIVA 4ZXYH 1P10A 1SQTA 3Q3XA 1LTOA 1NFXA 1AZZA 1NM6A 2C93B 5TJXA 8LPRA 4NCYA 2I6SA 3P70B 5EJZA 3RU4T 4XD7D 1LHDH 1YGCH 5A0AE 1GMCF 1BB0B 3MMGA 3NWUA 2H9EH 1C1VH 1OPHB 1HV7A 1O3JA 1D3QB 2SGPE 4MNVA 1K1JA 2Y6TA 3AVZA 2VVUA 1Y3XA 1K1OA 4D7GA 2ZDNA 2BY5X 1Z1JA 4WXIA 4D8NA 3SQEE 4CRAA 4BTIB 2PTCE 4FU9A 3PWBA 2ZWLH 1MTWA 5ESTE 1S81A 1HIAA 1CA8B 1S83A 5HM9A 1H8DH 2IPHA 4MQAA 3TGIE 3RXAA 4HZHA 4CR5A 3BTME 2G8TA 2FOEA 1K9OE 1FAXA 1ELVA 1KXAA 2D2DA 3O8DA 1K1MA 2K7XA 1C1QA 1CSOE 1QA0A 1LPGB 3LJJA 1GHYH 1ETRH 2SGAA 4XE4A 1PJPA 3ATLA 1SGFG 2W7UA 4A7IB 1SLVB 1NTPA 1G9IE 1WCZA 1K22H 3MH5A 1EPTC 1C4U2 2ZFFH 4GCHF 6CHAC 3A8AA 4X1RU 1P9UA 4ASUD 2BZ6H 4LOYH 3V0XA 1G36A 5EJ1A 2ZGHA 5LPEA 1BTPA 1XUFA 1O38A 4BOHA 2ODQA 5GNDA 1K1LA 1V2OT 3M7UA 1VZQH 3LGIA 1JRTA 2Z9IA 1NBMD 3BEUA 4JZFH 4P02A 4NIYA 5FPSA 4RSPA 3MU5A 2QIQA 3OE7D 3NCLA 1UTQA 3VB7A 1SR5C 1JMOH 1QL8A 1TNIA 3U1IB 3GY8A 3KYGA 4YT6H 1TIOA 1MKXK 3DFJA 3C27B 2J5UA 5EQRA 2Z9JA 1OSSA 4P00A 5C67A 2Z9LA 3TNSA 2J95A 1TB6H 2Z9GA 5DP5A 2PKAA 2QF4A 1Z6JH 1EAUA 4ASHA 4I8HA 2A31A 4Y76A 4AORA 1T4VH 1C5WB 1BDAA 1HAYB 2KCAA 4Y71A 3UR9A 4IC6A 2QA9E 4X6OA 5JBTA 4YESB 3ATWA 1TGTA 1OWKA 1HBTH 3ZZ5A 3GCTF 3ZYEA 4YLQH 1W2KH 3ZYDA 3DHKH 3JZ1B 1F7ZA 4WJG2 4B76A 2B0FA 1P05A 3R0FA 4WMFA 3BTEE 1LQDB 1SKYE 2PFEA 2PW8H 1LO6A 2GMTC 3BTWE 4XDEA 1ZMLA 1LKBA 4A1XA 3UWJH 1MABB 2F91A 4ABDA 1P9SA 1DOJA 4X8TH 3OX7U 1BTWA 1C1RA 1GGDC 4JK5A 1IQFA 2HGTH 5LPFA 5HIZA 1YPHE 4X6NA 3AK5A 2VH6A 1D4PB 3GY3A 5CHAB 3RMNH 4TYDA 1ZPZA 2WINI 3PLKA 5AFZH 3DA9B 2NU0E 4ZROA 1O2LA 1ZTLA 1F2SE 1DS2E 1BRAA 1GBDA 1BMMH 1C5XB 3SO3A 2ZDLA 4Y79A 2ZFPH 1F0RA 1UCYK 1ABIH 1Y5BT 1ZTJA 2QF5A 1QJ1B 2KCOA 1GI1A 2QXIA 4JYVH 2TGPZ 2FTMA 4ZHLU 3E90B 4AYVB 1CT2E 2LNCA 3H5CB 2ZNKH 4IW4E 3TVJB 1VJAU 2OC8A 2IPQX 1O2QA 3SORA 5DJ7A 1LDTT 4A5TS 1H8IH 3A7YA 2ZHQH 3IITA 2HNTF 1BTHH 3UOUA 1O5AB 5BRRE 2C8YB 3T26A 3BTTE 3GCHC 1MAXA 4Q2KA 5T3HA 2P93A 2FIRH 2P3FH 2UWPA 4BANB 2WV4A 4B2CA 1OYQA 5IK2D 5B6OA 3SV2H 1TX7A 1OP8A 1PPFE 4AC9A 5GCHF 4K69A 2ZP0H 4ABAA 3ZV8A 1O3PB 3D49H 4BAQB 1OP2A 1A0HB 4Q80A 3VB6A 2ZHDA 4NA7A 1XKBC 4CBNA 2ZPQA 2LELA 2TPIZ 1P04A 4ZCNA 2CN0H 4CRGA 1O3DA 3MH7A 1NRQH 2V3OH 2GJGA 2TGTA 1HXEH 5EOKA 5HGGA 1AKSA 2OCVB 1NN6A 3DT0H 1L4DA 1GMDG 1Z7KA 1ZSLA 2EY4C 1GBKA 1GMCG 1EPTA 1QRXA 1TA6A 2VGCB 4DOQA 2FZZA 1O2OA 1NFYA 3FZDA 1YY3A 1AGJA 2AIPA 1SGRE 3TLOA 4D76A 2PSXA 2PTNA 1C5TA 3QTVH 2BZAA 4X1PU 4DURA 3BF6H 2R9PA 3VGCB 1UVPA 1MZAA 3N7EA 1P8VC 2FLBH 3LU9B 1W13U 2ZZUH 3ODFA 2YNBA 1HPGA 2VIDA 1BMLA 1JWTA 4I32A 2ANWA 2ZI2H 1DM4B 1OP0A 1UTPA 2K0QA 2XC0A 3ZZBA 1P3CA 2VWMA 2AGGX 2ZG0H 3K6YA 1QGFA 2CJIA 2Y82A 3BV9B 1O2NA 1RIWB 1MTNB 4MNWA 4U32A 3P6ZB 3OU0A 3PMBB 1DWBH 2PUQH 3UUZA 4R0IA 3VXEH 1NZQH 4NG9H 2F9BH 1ZPBA 1GBHA 1PFXC 1WYKA 4ZUHA 1GI0A 5A8YA 2Y7ZA 4D7FA 2PSYA 2O8TA 3T28A
chains in the Genus database with same CATH topology
4UFGH 2WPMS 1ESBA 4GCHG 3P17H 1ELBA 4MVNA 4YOGA 4UFFH 5FPTA 1BBRK 4F4OC 5EW1H 2Z6BD 1GHZA 5H4IB 2F9VA 1ANCA 2VJ1A 2ZGJA 1SSXA 1CO7E 2ZPRA 4AGJA 1SFQB 1B5GH 2BM2A 1K21H 3BIUH 5EXNA 4AYYB 3CP7A 5SGAE 2FODA 2FOMB 1HAVA 5A0CA 1SPJA 2ZCHP 2BVRH 5TCAA 4GHTA 1N6YA 1V2QT 1EJMA 1YPHC 3EDXB 4O03A 3UOPA 1F0SA 2BVSH 3RC6A 1XM1A 4H6TA 1HJAB 1Z1IA 1UK2A 2R3YA 1BTYA 2F83A 8KME2 1GBIA 5FBIA 1V2UT 3NXPA 5DK1A 3EGKH 4BAMB 1HAVB 2XBWA 2VINA 3A7XA 2FWWA 3UQVA 5AF9H 2ALVA 1MKXH 3A83A 1LPKB 1CQQA 3SN8A 1J15A 1B7XB 3K2UA 3SV7A 3GCTG 1ETSH 3UPEA 1L1GA 2BB4A 1L4ZA 5C3NA 2STBE 4IMZA 2ZFQH 3MU1A 1O2TA 2OINA 1TGNA 2V3HH 1E37B 1KLIH 4JYTA 4LXBH 1MD7A 3BEFB 2CF8H 2O9QA 4WH6A 1MUEB 1A5IA 4K3JA 1ZSKA 1O2ZA 3SUFA 4E7NA 1S0QA 1NRPH 1QA7A 4X6MA 4UONA 2FYQA 5TCCA 1UTJA 1O3EA 4BXSA 3SNBA 4DGJA 1Y8TA 1BJUA 2GX4A 2PR3A 1AI8H 4DY7B 2LIZA 1SGIB 5JB9S 1PQ7A 2NWNA 1BMNH 3GICB 1AUJA 1G3CA 3T2NA 5EG4A 2LPRA 2BD8A 4ISIH 1GJCB 4NZQA 5EXLA 1O5FH 1UJ1A 4THNH 5EPNA 1C5OH 3GDUA 5FAHA 1Y59T 1UTKA 1JRSA 2BD4A 4I31A 1QBVH 1S85A 3KQCA 3SOSA 2KAIB 2BDIA 2ZECA 4JK6A 4ISHH 4I8KA 1C5PA 2H9HA 2WPJS 1PYTC 2XRCA 2QF0A 5F6MA 1THPB 3L33A 4A92A 2OUAA 3M5OA 3A86A 3RXOA 4AG1A 1EP5A 1O2GH 3A82A 3RM2H 3MU0A 1UCYH 4FUIA 2BD5A 1SOTA 2VB0A 1BIOA 1AFQB 1DLEA 3P8FA 1CT0E 1W10U 5ABWA 1SHYA 3RXLA 3GISB 5A8ZA 3VB4A 2GTBA 2F9NA 3BTDE 2AFQB 1HRTH 3M7TA 1S82A 4KTUA 3UREA 5FHTA 3MYWA 5JBBS 3EA8A 1SB1H 2Z94A 3FFGA 1BMAA 2D26C 3QO6A 5GCHG 3GCNA 4WWYA 2GCTB 3QTOH 4X1SU 1GJ9B 1V2KT 4A6LA 2RDLA 1KLJH 2AEIH 1OKXA 5E0HA 4OGXA 4AFUA 3BG8A 2PKSB 1W8BH 2FS9A 1AFEH 3SJ9A 4WMEA 4CH2B 1QR3E 1O3CA 1C5ZB 1PQAA 1WQSA 3MNCA 1MD8A 3E6PH 2GZ7A 2QAAA 1THSH 1GHXH 2BLWA 4GUXA 2GKVE 1K1PA 5DP6A 2Q6FA 5T6FA 2A45B 1P01A 2BVXH 3NK8A 3TPIZ 2TGAA 1GBLA 3TJNA 2ODPA 2BY9X 3HGNA 3FANA 2BYAX 1YF4A 1D9IA 2RG3A 4TWWA 2NU4E 1FAKH 4Y10E 1IHSH 3E91A 1A3BH 4JMYA 1VCQA 3SI4H 5CHAC 1DVAH 1GJAB 1HYLA 4WVPE 3W94A 4X8VH 1YC0A 3M35A 2G5NA 4X0WU 1FY1A 3SV9A 3T62A 4U01A 2AYWA 1QB1A 2J34A 1KDQB 1G37A 1GHVH 1ABJH 1O2JA 1AO5A 1ZGIA 2A2QH 2WYJA 1LHCH 1BRUP 4ZKRU 4KTCA 1J14A 5T6GA 1O2VA 1NU7B 2XNIA 1ZOMA 2I6QA 3H7OA 4BAKB 1BJVA 2BD7A 4WY3A 1P02A 4OGYA 1BCUH 1EZXC 2V0BA 5PTPA 2ZHEH 3KIDU 1GBAA 2GZ9A 1FIZA 3RXDA 1V2VT 2AMQA 2QV1A 1XXDA 1SL3A 1GI8B 4F49A 2UUJB 3LGYA 3OTJE 3BN9A 4WF8A 1MAYA 1BBRH 1A2CH 3SNAA 2FXRA 3GYMA 3VFEA 3GDVA 4FUEA 4X1NU 1TQ7B 1G3BA 4CRBA 1DY9A 1V2LT 4TPYA 1F5KU 4KELA 1DICA 4K1SA 1GMDF 1L2EA 2A7JA 2C90B 3I78A 4K1TA 1UHBB 1C2DA 4FUJA 1DUEA 1RTLA 1SGFA 2FI3E 2G4UA 1FPHH 3E1XB 3NPSA 1ANDA 2FX6A 1BRCE 4TPIZ 2O8MA 4FUFA 4YT7H 3OY6U 2CGAA 2R2WU 4Y0YE 1K1IA 4XBDA 1C2KA 2B8OH 1P06A 3QUMP 2ZFRH 2FI4E 1GJDB 1G3EA 1GWAA 4K8BA 3C1KA 3K6ZA 1S5SA 1O31A 1C1PA 3STJA 3SNEA 5I25A 1AD8H 1U6QA 2VGCC 3PMHB 4AOQA 7ESTE 2OC1A 1O5BB 2ZTYA 2ANMH 4XBBA 5DP7A 4DJZB 4XSKU 2FMJA 1KXEA 1EZQA 4B73A 2DE8A 2F9PA 3LT3A 2OTVA 1RFNA 3ATMA 3F9HA 3UIRA 3M3TA 4R8TB 3EA7A 1ELCA 3BTQE 3VGCC 1DSUA 5LPRA 2H2ZA 4IN1A 3SU3A 3SV8A 1A46H 1P03A 3OY5U 5G4BA 2QC2A 3PMAB 1IQKA 4DT7B 4YZUA 1TBRH 1SGQE 1EZSC 1MCVA 1UCYE 1ETTH 1DT2A 1HJ8A 3MFJA 1F0TA 2H1UA 1YPMH 2Y5GA 1AQ7A 1RIWC 1MTNC 2BTCE 2FP7B 3MO3A 1DWCH 2ZKSA 3MHWU 4HFPB 3PV4A 2OBOA 4B74A 1V6DA 1HJ9A 3S9AA 1JIMA 1SBWA 1ACBE 1XVOA 1VGCB 2UUKB 1RD3B 4GAWA 1CHGA 4ESTE 2XWAA 2BD9A 4KTSA 1JBUH 4ABEA 1TMUH 1NT1A 3MO6A 3Q00A 4HTCH 1UTOA 3ESTA 3PM3A 3SHCH 4YTAA 2C8WB 5IYTA 1O2KA 1QRZA 1NROH 3U98H 5EU8A 4J1YA 1AB9B 2IOTA 1ZGVA 1T8LA 1HGTH 3M3SA 3D65E 4K2YA 5HYOA 3GOVB 1DE7H 1Z8JB 1HJAC 3N7OA 1EATA 4H4FA 2WYGA 4FVDA 1LHGH 4K8YA 1IQJA 3PWCA 4FXGH 3WY8A 5DG6A 2PV9B 4E05H 5C5NA 1W7XH 3LH1A 4I8LA 5K0HA 4DIHH 1ZYOA 1TNGA 4NA8A 5GDSH 1SGPE 1XX9A 3LJOA 5AFYH 3RM0H 5DP4A 2R3UA 4B71A 1O39A 2ULLA 2XBYA 2ZU5A 1CGIE 1IQGA 5HXFA 2A4RA 1PPHE 2OQUA 5FPYA 3SZNA 1BQYA 2R2MB 1IQLA 3SGBE 1O3FA 1CGJE 4A1TA 4X8SH 1Z8RA 1C2FA 2AGIX 2M5TA 1J9CH 3RXHA 1MTVA 1KSNA 3GY7A 1YYY1 1O5CB 2ASUB 1MBMA 2GD4B 3KN2A 1K2I1 4TY7A 5EW2H 1QCPA 1PPBH 2PUXB 4Y0ZE 3SU0A 1SQAA 1ARCA 1H1BA 2ZQ1A 2O8UA 2A4GA 2OLGA 3Q76A 4NGAH 5A09A 2GT7A 2P16A 1EUFA 1FV9A 1TNJA 2A0QB 5GWZA 1O3NA 3SJOA 1O33A 1CA0B 3B8JA 4HI3A 3TH2H 1NRRH 1BA8B 1HAPH 2STAE 4X2WA 1QHRB 1C2JA 1GDUA 1TGBA 1E38B 4YOJA 1AY6H 3MNSA 1EX3A 1IQIA 1BBRE 1YPKH 1LKAA 2A5AA 2RA0A 1V2TT 1K1NA 1FY3A 1HB0B 4Y7BA 1Y3YA 4Z6AH 3QDZB 1MTSA 1QRWA 3ZV9A 1V2ST 3M36A 4INLA 1FPCH 1C5QA 4Y6DA 2ESTE 3H7TA 4KP0A 4OS7A 3ZVAA 2RA3A 1ARBA 3E16B 3EBNA 3UY9A 4Y8ZA 1NESE 1ZJDA 1AFQC 3M37A 1EKBB 5EQQA 1C5NH 1FUJA 2W5EA 3RMLH 5CMXH 3SNDA 1O3MA 1DANH 3TJVA 1HXFH 3RXTA 2ZPSA 4NIWA 3RMMH 1C1TA 3E8LA 3LGWA 2WPIS 3KQBA 3TK9A 2XTTB 2WPLS 3E3TA 1YPEH 1OS8A 1TPPA 1ZLRA 1FN6A 3MI4A 1GBCA 2Q1JA 1QJ6B 2Y5HA 4LK4A 2GCTC 4E7RG 2BX4A 3HK3B 1EP6A 5A2MH 1MKWK 3F9EA 2XXLA 3MTYA 2HWLB 2DE9A 1O3AA 1FY4A 1O2UA 2BOKA 3SU4A 2PKSC 3GY2A 3KQDA 1GJ8B 1FQ3A 1GBJA 2A4OA 1ZPCA 3SW2B 1AVWA 3MH6A 2Y7XA 1G32B 3SU5A 5EXMA 2NU3E 1RTKA 4Y8YA 2JKHA 1HFDA 1VITF 3F68H 3QGJA 4IN2A 3UQOA 1O5GH 4AFSA 1TRYA 4ABBA 3RU4D 1NU9A 1NRSH 1QB9A 3VB3A 1PPCE 3F9GA 3I29A 2FYRA 5GIBA 3O8RA 2CXVA 5EODA 3M7QA 1ANBA 1GI3A 2Q6GA 2XC4A 1S0RA 2C8XB 4K1EA 4LZ1H 1Z71A 6GCHG 1O3LA 2AMDA 4MNXA 4KKDA 4D9RA 2O8WA 4XBCA 2W7SA 4ZKSU 1XXFA 1NS3A 2J9NA 1C2LA 4JCNA 2BD2A 2IJOB 1TBZH 3SGAE 1IAUA 1GL0E 3ZVBA 5I46H 3QWCH 1TE0A 3RXRA 2WPKS 1AUTC 3U8TH 4ISNA 1EQ9A 1UVTH 3ZVDA 3BTKE 1SLWB 1FMGA 3ZZ3A 1BRBE 3V7TA 1O32A 4A1VA 1GVZA 3EQ0H 1UTMA 4ISLA 3P8GA 2GP9B 1LMWB 1SOZA 3SGQE 2J2UA 1TPAE 1AWHB 1A7SA 1GCTB 3RXCA 1GHWH 1P09A 3RXKA 2OP9A 1GHAF 3U1JB 1W0YH 3BTGE 1TNKA 2ZA5A 3FP6E 3KQEA 2P8OB 3EA9A 3SHAH 3U69H 1EB1H 5HMAA 2OC7A 3U8OH 1HAIH 1YM0A 5GPIB 3HKJB 4INKA 4XOJA 5DP3A 3PROA 4MPWA 1EAWA 3SJ8A 3LOXA 4H6SB 2HLCA 8ESTE 1J8AA 3SUEA 1T31A 2K1QA 3QLPH 3ZZCA 2OC0A 2A4QA 3V13A 4ISOA 2CF9H 3DUXH 3UNQA 1BZXE 2AS9A 4MPUA 2BDGA 2YOLA 1A1RA 1WV7H 3L6PA 5BPEA 5L2YH 3TH4H 4YM9A 2C4FH 5IDKA 5ETXA 1KXCA 2J94A 1T8OA 1Y3WA 1SGNE 3S9CA 4Q7XA 4CH8B 3RLYH 2TGDA 1THRH 3TK6A 3SU6A 2AH4X 1O35A 1SQOA 2KAIA 1BTXA 1INCA 1C1SA 1ORFA 3E0NB 1O30A 5DGJA 4CHAB 4GSOA 1GI9B 3ZZ8A 3TK5A 4TY6A 2Y80A 2XBVA 5A8XA 1XKAC 1NPMA 1DUAA 1C5MD 2UUFB 2VWOA 1C5VA 3RXEA 1KYNA 1C5SA 1O2SA 3RU4E 4MDSA 1ELTA 1AZ8A 1O2RA 2TIOA 1DXWA 4MPXA 2EI8A 1P2OA 1UK4A 1GL1A 1T4UH 1PPGE 1O3KA 4NFFA 3VB5A 2B9LA 1W11U 4AFQA 2FOGA 3RXGA 1UTLM 4NWKA 3T5FH 1GMHF 4U30A 4BTUB 2FESH 1SLUB 2GV7A 1ELDE 1FI8A 1V2NT 2SGDE 2QXJA 1V2MT 1P11E 4IMQA 2SNVA 3MNBA 3VPKA 4GPGA 4WH8A 4MTBA 4CRFA 3BEIB 2D8WA 2VIQA 2ZC9H 1EZUC 4D9QA 1Y3VA 3G01A 4X1QU 3LGUA 2ZFSA 3S7HB 3LKWA 1LVMA 3M61U 4IGDA 4ZH8A 1VGCC 4VGCB 3LC5A 4E06H 1IQEA 2QCYA 1OXGA 2ZU4A 3NZIA 3ELAH 2FTLE 2ZGCA 4YLUA 2ZDAH 4Q7YA 1N6XA 2BDBA 1GDNA 1P2IA 2AGEX 2HALA 2OBQA 4AFZA 1KXFA 3CENA 2TBSA 1BITA 1E0FD 3ZZ9A 4M7GA 3FP8E 3OSYA 1HAHH 1AB9C 3ODDA 3MU8A 3GY4A 1YBWA 2PGBB 2VWLA 1TABE 1W12U 1GJ4H 3K65B 1MTUA 4JZIA 3SV6A 1O3IA 1O2YA 1P3EA 9ESTA 2WUBA 5F8TA 4ZXXH 3UWIA 1GG6B 1A0LA 3ZVGA 2D1JA 3TH3H 1RGQA 1KY9A 1P57B 1UVOA 1C9PA 1HAGE 2F9OA 3S9BA 1Q3XA 1S84A 1KDQA 1HDTH 1T8NA 2A7CA 4SGBE 4WXVA 2FOAA 2QGRA 4FU8A 1TPSA 1YLCA 3A88A 1SFIA 4ZAEA 1VITG 1C5RA 1MKWH 1TQ0B 4O3UA 2WV5A 5C1UA 1C4Y2 5GXPA 1TOCB 4GHQA 1F5LA 4FUCA 3MU4A 2VIWA 2FOHA 1FN8A 1SHHB 3VXFH 3BG4B 1D3PB 3LC3A 1LVYA 2ZIQH 1E34B 4AX9H 4OS2A 5T6DA 1EJNA 4DIIH 2PWXA 1ZHPA 4XFQA 4UFEH 5ESBA 2A1DB 1W3CA 5HM2A 1AN1E 3F9FA 1UVSH 4JYUH 1C1MA 1CA0C 4FUBA 1MBQA 5GJ4B 3A8BA 2H5CA 1DX5M 3OYPA 2EI6A 3PMJA 1MMJN 1ZMNA 2QXGA 2PGQB 4ZKOU 2BQ6B 2GDDA 1C2EA 2ZEBA 1UHBA 1J17T 2Z7FE 2BQ7B 3U8RH 1P12E 3LONA 1OWDA 2A5IA 1MQ6A 1SGTA 1NRNH 1TA2A 7LPRA 2OXSA 1N8OB 1O36A 4OS1A 1IQHA 3UNRA 2BOHB 1SMFE 1YPLH 1GHAG 1L0ZA 1RRKA 2GVFA 3Q77A 4IS5A 3URCA 4DCDA 1D6WA 1EAIA 2B7DH 2JH6D 1GJ7B 1CE5A 3RC5A 1UTNA 1ZSJA 2ILNA 1YCPK 4J2YB 3RXMA 2P59A 1HNEE 2UUYA 2FEQH 1L1JA 2FO9A 3RXVA 4BXWA 5EPYA 1P0SH 1ELGA 3SQHE 2Q6DA 1HAOH 3RXIA 1BT7A