1O3IA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3iA02
5HXFA 1EKBB 4NA7A 3SV9A 3UNQA 3MNSA 1C2GA 6GCHF 1MKXH 1TOMH 2ZGJA 5A0CA 1MBMA 1HAOH 2P8OC 5EW1H 7GCHG 4OS7A 1TOCB 1F0SA 1GI8B 1O31A 1BMNH 3MU5A 1ZOMA 1DE7H 2ZFSA 4A1VA 2OC7A 3GCHC 3L6PA 1V2LT 5DP4A 5FCKA 1YPMH 1YLDA 1IQHA 3UR9A 2IN2A 1QL9A 1EUFA 2QAAA 3ZZ9A 1PPFE 3MU0A 3RMOH 3M7TA 4CH2B 4Y8XA 1E35B 5JBTA 1PPBH 1GBHA 3DFLA 2GKVE 1J14A 1XUKA 3OY5U 2TIOA 4RN6A 1F0UA 5JBBS 3BG4C 1ORFA 1AFEH 1XVMA 2CJIA 2FMJA 4ABDA 1HAXB 1RD3B 5DKMA 2TGAA 1P2OA 2QN5T 2J9NA 3SV2H 1Z8JB 1GMCF 1BTXA 2XBWA 1O3HA 2A5KA 2PUQH 3M3TA 1TGTA 5A2MH 5ABWA 4ZKSU 2Z9LA 4FUEA 1QTFA 2CXVA 4DCDA 1NC6A 3GCNA 1HAPH 1SSXA 1QQUA 4OS5A 2ZDNA 4DIIH 5JYIA 2ZC9H 4CR9A 1SOZA 8GCHF 1O2WA 1MKXK 1TNIA 1GHAF 4ZH8A 4AGJA 2W5EA 1O36A 1MZDA 1ABIH 4OS4A 3SU1A 1NRRH 3KIDU 2V6NA 8ESTE 3MH4A 4H6SB 1O5DH 2PKAA 1KY9A 1TGBA 2R3YA 1D6WA 2D26C 3H7OA 2ZGCA 1O0DH 1C5MD 2ZTXA 4IBLH 4DT7B 1ABJH 2ZIQH 4NWKA 2AH4X 3SU3A 2BLWA 1GI2A 1DSTA 2AYWA 3TK5A 2ZHDA 2VNTA 2BQWB 2BQ6B 1W2KH 4IC5A 4JZDH 1FMGA 1MTNC 3OX7U 4AFSA 2O8TA 2AMDA 1GI3A 1OYTH 2GVFA 2ZDMA 1P11E 4ASHA 4DJZB 3DFJA 4X2WA 1GBLA 2C8ZB 3CS0A 1UVTH 1WYKA 1WSSH 3V13A 1T4VH 1NZQH 1ANCA 4BAHB 1UTJA 1HIAA 1ZTKA 2SNWA 4X6NA 2A1DB 2ZCHP 1TGNA 4K60A 4ABFA 2P8OB 4X6MA 3RXPA 1A0LA 1FUJA 1HAZB 3K9XB 2PLXA 1QFKH 3GCHB 3ZV9A 2ZG0H 1AO5A 5EODA 1Y59T 3Q76A 1TYNA 4FVDA 1N6YA 1BTZA 1EJNA 2WUCA 3SNDA 1ELGA 2ZPSA 1QIXB 1UK2A 2F9NA 2ZU4A 5A09A 3TJUA 1EPTC 4NIYA 3OY6U 1GHVH 3Q3YA 2OQUA 3BTTE 3JZ1B 1EOLA 4I32A 3EE0B 1BITA 1GG6C 1F92A 1TIOA 1CGIE 1TA2A 1ZGVA 3BG4B 1GCTC 3PMAB 3MNBA 3KEEA 2STBE 1E36B 3EA7A 1O2XA 4TYDA 4K69A 1ELEE 5C1XA 1OWIA 2ANMH 3KQEA 2ZU1A 3QGNB 4ABHA 2FESH 3LGIA 1TPAE 3QO6A 1SHHB 4YLUA 1EJAA 3GY8A 2ILNA 3TVJB 3UREA 5FBIA 1NFUA 2BD4A 3QZQA 1W13U 3SGAE 1W7GH 2BY9X 3PM3A 3RXDA 1XVOA 4X2YA 4XE4A 1TMTH 2F9UA 4JZEH 4B71A 4ABJA 1IQIA 4ISNA 1L4ZA 1GVZA 2JH5D 3ZZ4A 2AGIX 4NZLA 3M61U 1AHTH 2G8TA 4INHA 4E7NA 1NY22 4Y10E 2XC0A 3QDZB 3AAVA 1O3NA 2SGQE 3ZYEA 3UY9A 2UUFB 3S9AA 3SU6A 4NZQA 2P3TB 4UD9H 2BLQA 1XXDA 3TNSA 2UUKB 1BTPA 4X2VA 1ZHMA 1NO9H 3SV8A 1DS2E 2SGDE 4ZHLU 3CS7A 4XBBA 1OPHB 4MG3A 4Q7YA 5C3NA 2ZEBA 2BY8X 1WBGB 2VWMA 4MNXA 4X6PA 1EZSC 1C9TA 3VB7A 1FN6A 1ZJKA 4M7GA 3SUEA 1NRPH 1GVKB 1S85A 1A0JA 4CREA 4XSKU 1BRBE 4A6LA 2VIPA 1XUFA 1GBEA 1O2YA 3RC4A 5JDUB 3SQHE 1QB6A 1L1NA 1O3CA 4ISHH 4X1RU 3LGWA 3TNTA 5J4QA 1H1BA 1QJ7B 5FX5A 3TIUA 1AZZA 3E90B 3KF2A 1CO7E 4YLQH 1H9LB 1P01A 2GCHF 1YPHC 1UHBB 4U01A 4Q7ZA 5EXLA 2VH6A 3EYDA 1A46H 1UTKA 3SI4H 4JK5A 2RG3A 4UE7H 2ZCKP 3A7TA 2V35A 1P03A 3R3GB 5C5OA 1UO6A 1B0FA 3NXPA 1GMDG 1LVBA 8LPRA 4NWLA 3A81A 1YM0A 3KL6A 3P6ZB 5FAHA 1PQAA 1TA6A 1JOUB 2GT7A 3K6ZA 4D9RA 2HWLB 1FPCH 3EQ0H 1C5NH 5DP8A 2BDGA 1GJCB 2OC8A 1EPTB 4A1XA 4B2BA 1HAVB 3DHKH 1KXEA 1H9HE 3RU4D 2UWLA 4GLYA 1FIWA 1K21H 1GG6B 3TJOA 3E0NB 3SQEE 1C2IA 1MCVA 5C1YA 1GCTB 1QGFA 5SGAE 1FY1A 2Z3CA 2Z3EA 3G01A 3SU0A 1BUIA 2B9LA 3RXFA 3NUMA 3ZVAA 1MQ6A 1UTLM 1P2NA 1P12E 2GDEH 2QIQA 1ZSJA 1GDUA 3ATLA 3F6UH 1YPHE 1ZYOA 1DICA 3GDSA 5DP9A 2HPQH 2ALPA 1OYQA 1UTOA 4YO9A 1JIRA 1SVPA 2BDCA 2BD7A 1THPB 3A84A 2D2DA 2BDBA 2G00A 3MH5A 1DUAA 3A8AA 4TWWA 6LPRA 4O9VA 4Y7AA 1YKTA 2D1JA 4JMYA 3LDXH 1NRNH 2PSXA 2D8WA 3GY7A 1GPZA 3B8JA 3KQCA 1BTWA 1BBRE 4NG9H 3VB3A 1TMUH 4TY7A 3SV6A 3P70B 1WV7H 1TRNA 2OD3B 1MAYA 4UFFH 1P2IA 5FBEA 1TGSZ 3GDUA 3IWMA 2C90B 4DVAU 3KN2A 1PFXC 1BHXB 2PFEA 4AGKA 4NSYA 2BMGB 4K1TA 2O8MA 1GBBA 2TBSA 4AOQA 5K7RA 4KGAA 3U1IB 5GWZA 1RJXB 2K1QA 1UJ1A 2H5CA 3RXQA 1AY6H 1VJ9U 2FI4E 2VIQA 5JPMH 1O39A 2OINA 3V0XA 5JB9S 5L2YH 1GI7B 2B7DH 7LPRA 2OUAA 3C27B 2SGPE 1SGQE 2ZTYA 2C4FH 3AVZA 1KXDA 3BTDE 1FN8A 1V2PT 1XUGA 2FP7B 1THSH 1SI5H 2XBXA 3PMHB 3QLPH 3BTKE 2FEQH 4KELA 3EAJA 2RCEA 3P92A 5HYOA 2HPPH 5L2ZH 1TPOA 1GI9B 1QURH 1SFQB 4Y6DA 1T8LA 4MDSA 3UFAA 3U8OH 1W11U 3ZZ7A 4A92A 1AWFH 1BQYA 1SPJA 1TRMA 2A4OA 2QXJA 3ODDA 2C8XB 1DANH 1HAYB 4LXBH 1QL8A 2BOKA 2GGVB 2GCTC 3VPKA 4IGDA 4DURA 1OP2A 1Z71A 2CMYA 1LHDH 2VJ1A 3A88A 4JZIA 1ZMLA 3A7YA 1LPZB 1EJMA 4CBNA 3RU4T 1AKSA 4YT7H 2GZ9A 5LGOA 2G52A 2JETC 2VGCC 1C5YB 3TH2H 1QR3E 3FP7E 3UIRA 3UUZA 1RIWC 5C1UA 1OWJA 3ZVBA 1ELBA 1FDPA 1GBDA 3SZNA 1KXBA 1D4PB 2BVXH 5T3HA 3VXEH 2BTCE 2OC0A 2ESTE 3S9BA 4A1TA 1VJAU 1GBCA 1S0RA 1BRAA 4X1SU 1P8VC 1C9PA 1LVOA 1PPEE 1G30B 4K2YA 3EDXB 3K2UA 3O8DA 1F5LA 2BDHA 1W10U 4X1NU 2BD5A 1PQ8A 2ZPRA 3S7HB 2VIVA 3BF6H 3K6YA 2GT8A 2BHGA 3K65B 3T62A 2ZGBH 4U32A 1MTWA 2SGAA 3RC6A 2AS9A 1FI8A 3PWCA 4YM9A 3HK3B 2XWBI 1TPPA 3A83A 3LC3A 1QB9A 2C3SA 2BD2A 4UONA 3RM2H 1V6DA 2ODQA 3AW1A 4FUIA 2BD8A 5EW2H 1GMHG 1O33A 1FY5A 1ZLRA 4E06H 1LPGB 1BTHH 1NRSH 5J4SA 4AB8A 1G2LA 4YZUA 4ABEA 2VVUA 1AE5A 1FY8E 1X7AC 3RMLH 1MU8B 2ZO3H 3FANA 9LPRA 3RXBA 1J8AA 2BVRH 4I8LA 2Y7XA 1O34A 3BV9B 2QXIA 1G9IE 2R9PA 1KSNA 2A7CA 1NESE 3LGUA 5TCAA 5GDSH 2TGPZ 5A0AE 1P10A 2I6SA 2QYIA 3GISB 1TNGA 2AIQA 3AASA 4OGYA 2ZU3A 2DE9A 1Q31A 4GSOA 2J2UA 1GI1A 5FPYA 3HK6B 4ZHMU 3LC5A 3V3MA 2V0BA 4ABGA 2TRMA 3E3TA 1MH0A 1EAWA 1MQ5A 4MPXA 2GV6A 1QJ6B 3BN9A 3QX5H 2ZWLH 4WMFA 4K1SA 2Q6FA 2PR3A 1O35A 1ETTH 4Z0KA 1ZJDA 2WV5A 1IAUA 1V2UT 1FV9A 1V2JT 1KDQB 3T26A 3M36A 3ZZ8A 5E0HA 1SGRE 1IHSH 5DP5A 4RKOB 3SJIA 1VGCC 2HOBA 5L6NH 4Q2KA 4NFFA 1P9UA 2Q6GA 1O3GA 3ZZ5A 1N1LA 4HTCH 1XUHA 2I6QA 5T6DA 1V2NT 4WH6A 5EXMA 1LQDB 3L3TA 1O38A 1EQ9A 3RXUA 1GJ7B 2PHBA 1UVOA 4K8BA 2Q1JA 3MFJA 4NIWA 1D3TB 1VITF 5DP6A 3A87A 1EP6A 4NIXA 2PKAB 1LMWB 4A5TS 2P94A 1O3FA 4GAWA 1GI5A 1GBIA 3SV7A 3M37A 1A0HB 1O3JA 2A45B 1QRZA 2GCTB 4OGXA 3GCOA 1K1JA 3RXVA 1K9OE 2J38A 1OP0A 5EPNA 4PROA 2Z3DA 2GMTC 1VITH 3E6PH 4K8YA 1SLVB 2ZFRH 1DITH 1P02A 4MVNA 1B5GH 2JETB 2VGCB 1ZPCA 3D65E 3RXCA 1DWEH 1RIWB 2ZU2A 2Z9IA 4OS2A 1AU8A 1BDAA 1T4UH 2QF0A 3AW0A 1HLTH 2B8OH 1GHBF 3LJJA 3PLKA 3T27A 5F8ZA 3O8BA 3PROA 1K22H 2XC4A 1GMDF 3SN8A 4BXWA 1GJ4H 1O32A 2XXLA 4ABBA 2PWXA 4KTCA 3A82A 3T2NA 2FYQA 3TJNA 1C1QA 1D3PB 3I77A 4FU8A 3VXFH 1OWDA 5DJ7A 4F49A 1CA8B 5HMAA 1SGFG 2FS8A 2GX4A 2WINI 1BRCE 3A8CA 2FXRA 1EP5A 1C1NA 5GCHG 2BQ7B 1Z8RA 4GUXA 4JYTA 3RXRA 4K3JA 3SI3H 1YPGH 4JZFH 3VB6A 1DXPA 1IQLA 4CH8B 1PPCE 1V2KT 2CF8H 3EA8A 3SOSA 2OTVA 1GJ8B 4BAKB 2BY7X 2HALA 2O9QA 1JRTA 4Y0ZE 1RRKA 1Y5AT 1MU6B 2BZAA 2QXHA 4D7FA 2UWOA 4B2CA 1T31A 2HNTC 1SGCA 3RXGA 4CR5A 5JBAS 1S81A 1YCPM 3UQVA 2ZQ1A 2VWOA 1O2UA 3QTOH 1O2PA 4ZMAH 1O2TA 2PTNA 2QCYA 2B5TB 1KLIH 2VIOA 1UTNA 4TPIZ 1F5RA 4I7YH 3Q00A 3SO3A 1YF4A 3FP6E 2G4UA 2FTMA 4ISOA 1V3XA 1YC0A 3URDA 1GHXH 2ANWA 4BAMB 3LKWA 1UCYE 3FAOA 1MBQA 2FZZA 1IQFA 1VGCB 1ZRKA 1EB1H 1YPKH 2THFB 1O3KA 3PMBB 1UK4A 4D7GA 3GCTF 3HKJB 1C5SA 3SUFA 4TY6A 5E2OA 4O3TA 4R0IA 3NWUA 4INKA 1UTPA 1ELAA 3JZ2B 2XCFA 5JB8S 4TPYA 1FNIA 3STIA 3PV4A 3A7XA 1P57B 1SGTA 1S83A 1RFNA 1CA0C 4Y8ZA 1WTGH 2HNTE 2R0LA 2FX4A 1MZAA 1ACBE 4AYYB 1DDJA 1O2RA 1SB1H 5EPYA 2GP9B 2GMTB 4B74A 4WJG2 3R0FA 1CU1A 3KNXA 2VINA 2A7JA 1TX7A 2W26A 1DPOA 1N8OC 1O2KA 3GYMA 1V2QT 3E8LA 1GJDB 1ZSKA 1BMAA 1C2LA 1ZZZA 2CV3A 1FY3A 2G51A 2SGFE 1INCA 1EAIA 2BZ6H 3FZDA 1YCPH 4CRFA 4Y0YE 1A5IA 5GPIB 1W12U 1FJSA 4FXGH 1DWDH 3T29A 4LZ4B 1B0EA 1A61H 4BTUB 1RTLA 4UDWH 3P8GA 1TABE 1ELCA 2AGGX 2XBYA 3SGQE 3M3VA 1XXFA 1IQJA 1G36A 2P3FH 1BMMH 4R8TB 6CHAC 5T6GA 3UNRA 3MH6A 2SGEE 2TGDA 2R0KA 1HJ8A 4YOJA 2F3CE 4DY7B 2H9EH 1IQGA 1WAYB 3P17H 8KME2 3HATH 1L4DA 3I29A 1HUTH 3SUDA 5DG6A 2ZHQH 1TGCA 5DP7A 1O3AA 2EI8A 1GL1A 1OP8A 2ZDVH 1O3DA 1YLCA 1GHZA 3LH1A 1O2HA 4Q7XA 1O2IA 4CRDA 3EA9A 1V2RT 2Y5FA 1YYY1 1TE0A 2WPJS 2CF9H 4AORA 2V3OH 4CRCA 3ZYDA 1EXFA 2JH0D 2Z7FE 4YTAA 2UUYA 1J17T 2EI7A 1HPGA 3ESTA 3QUMP 1P9SA 5A0BA 1A1RA 2OCVB 2WV4A 4HFPB 1MTSA 2BDIA 1TWXB 2WPHS 5A8ZA 1K1MA 5EQSA 3FP8E 5GXPA 1C2FA 1C5QA 2OLGA 1K1NA 1AVXA 3MNCA 1CSOE 2A5AA 2BY6X 3SJKA 3DT0H 1TNLA 4B75A 1RGQA 4WF8A 3TJVA 4FU7A 4ZXXH 2Z94A 2BDAA 2EEKA 3MOCA 3E91A 2FOGA 5E0JA 1IOEA 2W3KA 5DO4H 1EAUA 1ARBA 3LU9B 1PYTD 1F2SE 3GY5A 1DT2A 2F9PA 1NFXA 1H8DH 4Y7BA 1LHFH 2IJOB 1DWBH 3B23B 1K1PA 3BTHE 3NPSA 2FI3E 2FS9A 1CA0B 3U69H 3OSYA 3CENA 3DUXH 2WYJA 4TWYA 4WXIA 1JXPA 1TONA 2ULLA 2ODPA 1C2MA 2VB0A 1TX8A 1GBFA 3MYWA 1NTPA 1LKAA 6GCHG 4ESTE 3D62A 4INLA 1O2VA 1WTHD 2FOCA 3A80A 1C5XB 2DUCA 3WY8A 1N8OB 3M7UA 2DE8A 2LNCA 7GCHF 5HGGA 1GWAA 2AEIH 1MAXA 3A8DA 1ANDA 3QGJA 1TBZH 2VWNA 4ISLA 4FUCA 3BTME 2UUJB 1TALA 2RA0A 3TPIZ 3V12A 2CN0H 4SGAE 1C5ZB 1DOJA 3RM0H 1G3BA 3TK9A 1QNJA 4XBCA 1T8NA 4MNWA 3Q77A 5AVDA 4Y79A 2H9HA 2KAIB 3NZIA 1IQKA 1T7CA 1ESBA 1AFQC 4Y8YA 2ZTZA 2ZNKH 1O2GH 2O8UA 2W3IA 1E37B 1JBUH 1GBJA 2XCNA 3URCA 1SOTA 2RDLA 3M3SA 6CHAB 3A7VA 5ESTE 1ELDE 3MO6A 3VFEA 4Y71A 1GCDA 2GV7A 3E0PB 2HVXA 2UWPA 5G4BA 1QHRB 1P3EA 3SBKA 4XDEA 1GMCG 3E16B 3NCLA 3SNAA 4H4FA 4H6TA 1KIGH 4I8JA 1PQ7A 1GJBB 2ZFFH 2PTCE 2P59A 2ZFPH 4WXVA 1O2MA 2EI6A 1C2JA 4KTUA 3TLOA 1U6QA 4WWYA 1ID5H 3W94A 2AFQB 2FTLE 1FQ3A 1SGNE 4HI3A 1O2NA 2PW8H 2XTTB 2PGBB 8GCHG 3MO9A 4I31A 5A8XA 1T8MA 2BD9A 1GHAG 4NA8A 1T8OA 1Y3VA 3ATIA 1WQSA 4JK6A 4XOJA 2G4TA 1ZPZA 3STJA 3UNSA 1HXEH 1MCTA 4MPVA 3H7TA 3Q3XA 3UTUH 3MWIU 1Y3WA 3BSQA 1VZQH 3GOVB 3UOPA 3HKIB 3LGTA 2SNVA 4GCHG 3D49H 2ZHWH 1SQAA 1XMNB 4MLFB 1SQTA 3KQBA 3FZZA 1AE8H 1JMOH 3RLYH 1UHBA 1Q2WA 1NM6A 4NA9H 3ATKA 1BJUA 5GIBA 3LOXA 3ZZ6A 1HXFH 3E1XB 1MKWH 2FI5E 4NGAH 3HGPA 5CHAB 1SL3A 1C1MA 1ZR0A 2F9BH 1ELTA 3BTWE 1EB2A 1GVLA 2WPKS 1ELVA 4AFQA 1HFDA 5BRRE 1W14U 1O5EH 2A32A 3ELAH 1CGJE 3M5LA 4X8UH 1EPTA 1FY4A 1V2ST 3H5CB 1HAVA 3PLBA 3ZVDA 1G37A 1P3CA 1CBWC 1WQVH 3NK8A 1EZXC 1ZMNA 1XX9A 2ZDLA 1HCGA 1PPGE 3TU7H 4AFUA 4LZ1H 4BAQB 3RDZA 3PB1E 1CHGA 1OOKB 2PUXB 2GZ7A 2VWLA 1ZTLA 3RXTA 1JRSA 4Y76A 3U8RH 1AFQB 1TBQH 4X6OA 2QY0B 1K1OA 1NPMA 3GICB 1J9CH 1UTQA 1O5BB 1TX6A 5B6OA 2ZECA 2ZP0H 5FCRA 1ESAA 2A4QA 1FPHH 2H2ZA 2A4RA 1LO6A 2O8WA 4YESB 1ZGIA 4MNVA 1Y3YA 1F0RA 1UVSH 1AVGH 1S0QA 5F6MA 1DVAH 1LVYA 4LK4A 1AQ7A 2G5NA 3SJ9A 2BVSH 1XKBC 2Y5HA 3VGCB 4QT8C 1OSSA 4FUBA 4B1TA 1MKWK 4UFEH 1HYLA 3I78A 3SJ8A 3V7TA 2VIWA 1O30A 3ATWA 1BCUH 3F1SB 4I8HA 1AMHA 1F7ZA 1BTUA 1V2VT 1HV7A 4WH8A 3RXMA 1IHTH 5IYTA 3LPRA 1OWHA 1L1JA 1TNHA 2H5DA 2H9TH 1NROH 3BEIB 3CP7A 1O5CB 1SMFE 1MTVA 1NU9A 4GPGA 1PYTC 1AVWA 1SG8B 1C5PA 1SC8U 4WY3A 2P16A 1ANEA 1LVMA 1ZMJA 1GBMA 5L30H 2AMQA 1RTFB 1BTYA 3SHAH 5LH8A 1HAIH 1DLKB 1PJPA 5C67A 4WMEA 1O2ZA 3VEQB 5JBCS 1S6FA 1BB0B 1K28D 1TQ0B 3ZZAA 3U1JB 2FX6A 1PPZA 1GI6A 1SQOA 1AWHB 1NT1A 2Y82A 2C8WB 1K1IA 1V2TT 2IPHA 4MTBA 1GBAA 1P04A 4VGCC 4CRGA 1C4V2 2GD4B 4ZAEA 1HNEE 1QJ1B 3RXLA 5LPRA 2QF3A 5DP3A 2F91A 2G81E 5EGMA 5LPFA 2NWNA 1D3DB 1GJAB 3OTJE 2YOLA 5C20A 3GDVA 3RXHA 2BDYA 1P2KA 2OP9A 3F9GA 1V2WT 3PWBA 1GI0A 1YPJH 4B73A 2GCHG 3VB4A 1UCYH 4WMDA 2OXSA 3Q3KA 1V2OT 2BLVA 3SW2B 1CBWB 4D8NA 2HNTF 1AGJA 1H4WA 1C2DA 3LGYA 1IQMA 1QRWA 3C1KA 3LONA 1HJAC 3T28A 3MH7A 4IS5A 2W7UA 4OS6A 1ZRBA 1A5GH 4Y11E 3FVFB 3S69A 2Y80A 1E34B 4ABIA 2RA3A 5H4IB 1HIAB 3BTQE 1C1WH 2A5IA 4O03A 3UPEA 5PTPA 3ZVGA 3M35A 2F9OA 4IN2A 1BT7A 4B76A 3AAUA 1M9UA 5FHTA 1LPKB 3BTGE 1V2MT 1ELFA 3PO1C 2O8LA 5FPSA 2XW9A 1ZHRA 3SGBE 1L0ZA 3RU4E 1HJ9A 3SU4A 1Z6EA 1D9IA 1Y3XA 4BANB 2ZI2H 4AZ2B 4BTTB 1THRH 4DW2U 4K1EA 2NU3E 2Z9GA 5GJ4B 2PGQB 1TNJA 1FIZA 4IMQA 3M5OA 3M5MA 1WCZA 2Z9JA 3KQDA 4AX9H 3PTBA 1Z1IA 4X1PU 2TPIZ 1FONA 2AMPA 1KXFA 3SNCA 1C5OH 4AYVB 1TNKA 2VVCA 2FPZA 3GY2A 4AFZA 1C5VA 1YPEH 1W3CA 2A4GA 1O5FH 3LJOA 1BOQA 1HGTH 2CGAA 3RLWH 1KDQA 2NU1E 2QA9E 1C2KA 1UCYK 2AERH 1TPSA 4X1QU 2HGTH 2A0QB 4BNRA 1ETSH 1GHYH 1A4WH 1SGFA 2FOFA 2GTBA 3QWCH 1LQEA 1KXAA 4THNH 2QC2A 4DG4A 1SGEE 1ETRH 3QZRA 1Q3XA 3DD2H 1HAGE 1AIXH 4JYVH 3LT3A 1GGDC 4MQAA 4SGBE 2CHAC 3ZZ3A 1G3EA 4AG2A 1P05A 2JKHA 5EQRA 1SBWA 3LGVA 1YGCH 1P2MA 4KTSA 4GCHF 4RKJB 4VGCB 5AFYH 1G3CA 3ZVCA 4D76A 2FDAA 3D23A 2J95A 1DM4B 1GDQA 1QBVH 3S0NA 2F9VA 3A85A 3A7ZA 3RXOA 1KTTB 1SR5C 1QA0A 5HM2A 1J16A 3GY3A 4YOIA 2J4IA 2HLCA 3LH3A 2ZHFH 3RXSA 1A5HA 1SGDE 4MNYA 2XYAA 1CHOG 1NN6A 3L33A 1OKXA 5F03A 2FLRH 1BZXE 1VCPA 1KXCA 3QN7A 4K5ZA 4XFQA 2PKSC 4U30A 1HJAB 4J1YA 1O3BA 2FWWA 1BHXF 4MPWA 1AUJA 1DXWA 4BXSA 1RXPA 1A3BH 2ZA5A 2IOTA 3TH3H 2XNIA 3EGKH 7ESTE 1T32A 1TLDA 4GVUA 2FLBH 3OYPA 5EOKA 2ZHEH 5EXNA 1EZUC 1HAHH 1QBNA 5EG4A 2WPIS 2ZQ2A 4FUJA 1CT0E 3PO1B 4E05H 3TGKE 1QBOA 1DUEA 3T5FH 1RTKA 1O2SA 4FVBA 1BIOA 1O3EA 4RSPA 6ESTA 2XWAA 1W8BH 5AFZH 1GI4A 2NU4E 1Z1JA 1OXGA 2PV9B 1P0SH 2ASUB 3MU1A 5ETXA 4ABAA 1O2LA 3A89A 1GMHF 4I8KA 2QV1A 4IMZA 2ODYB 1OWEA 1C5RA 4LOYH 5A8YA 1O3MA 3BG8A 2H1UA 7KMEH 2GDDA 2ZKSA 4MPUA 1KLTA 2OC1A 3RP2A 1AUTC 1BMLA 1O2OA 3ZZBA 1XM1A 3B9FH 1D3QB 3DA9B 1GJ6A 1TAWA 3F68H 3PLPA 1WUNH 2WPMS 2J92A 1GL0E 1W7XH 1CT2E 1A3EH 1JWTA 2P3UB 1TB6H 1Z8GA 3UWJH 3BTEE 1SHYA 3MU4A 1AD8H 1EOJA 4F4OC 4ZUHA 4OS1A 2Z9KA 3GY6A 1DY8A 3M5NA 3RXKA 4B2AA 1AZ8A 1UVPA 2ZU5A 3P8FA 5FX6A 1MMJN 3IITA 3RMNH 2EC9H 1YCPK 2G5VA 1ARCA 1TMBH 1B7XB 2QGRA 1SGIB 1TRYA 2FOEA 4IW4E 1GGDB 4J2YB 3RMMH 2CHAB 1O3IA 3QTVH 4BOHA 3O8RA 3HPTB 3SUGA 1BBRH 1QQ4A 4X8SH 2FM2A 3TH4H 4ISIH 2A31A 5DPAA 4JZ1A 1CVWH 1TBRH 4ZHAA 1F0TA 2EA3A 3MO3A 1QRXA 4YT6H 2R3UA 1VITG 3RUOA 1C1TA 1MTNB 1QCPA 1QA7A 5CHAC 1S82A 3HGNA 3UOUA 3SJOA 4ZXYH 2J94A 1LTOA 2VVVA 3KCGH 4Q80A 1LHCH 2ANYA 5K0HA 3PMJA 5TJXA 5C2ZA 2GZ8A 1VCQA 3ZVEA 2FOHA 3F9EA 2YNAA 1DFPA 3ITIA 1C1UH 3P95A 4I8GA 1BA8B 2H6MA 2PKSB 3W95A 4GHTA 1F5KU 1PPHE 1YP9A 5EQQA 3UWIA 1G3DA 3MU8A 1Z6JH 1EX3A 1MUEB 5E0GA 1Y5BT 2ANKH 2BB4A 2B0FA 1C5LH 1GHBG 4NCYA 2Q6DA 1KLJH 2TGTA 1UVUH 2STAE 2FIRH 5FXLA 4AN7A 3SNBA 2Y5GA 3KHVA 3O8CA 2AGEX 1C5UA 3MMGA 1GJ9B 1CGHA 1FAKH 3A86A 1P2JA 1UMAH 3F9HA 1P09A 1VCWA 2BX4A 1K2I1 3ZZDA 1AKSB 1E0FD 1O2JA 2BLOA 1DX5M 4O97A 3RXEA 1AN1E 1DY9A 3A8BA 1IQNA 4IC6A 1OX1A 1O3OA 1O37A 5BPEA 1BBRK 2F83A 1O5GH 1SGPE 4O3UA 2JH6D 2OBOA 2R2WU 3VGCC 3KGPA 4FUDA 4HZHA 2C93B 3N7OA 5GCHF 1C2HA 4XBDA 2J34A 2P93A 4NSVA 2BM2A 3BIVH 1XKAC 1MTUA 1C1PA 4JCNA 3T25A 4UEHH 1Y8TA 2ZCLP 1HDTH 1G32B 1J15A 1BJVA 2Y81A 1ZTJA 4KP0A 1Y5UT 1EZQA 4DOQA 5ESBA 1HRTH 5EU8A 2ZFQH 1KYNA 2A2QH 3ENSB 1HB0B 1OWKA 4FUFA 2ZDKA 4E7RG 1A2CH 3SNEA 1YBWA 2WPLS 1NFYA 1C4Y2 1UTMA 2YNBA 1O3LA 2BD3A 3MI4A 4JYUH 3QK1A 1C1RA 3BTFE 2Y6TA 2BY5X 1SLXB 4A7IB 2FOMB 4UFGH 5HM9A 1DWCH 2A2XH 1L2EA 3P8NA 1AB9C 1ANBA 1G2MA 3ATMA 3GCTG 3GY4A 1SGYE 4WVPE 4Z6AH 1ZHPA 1GBKA 1EATA 1O2QA 4X8VH 1GHWH 2VU8E 5CE1A 1QY6A 4YOGA 2FO9A 4ZKRU 3VB5A 4CHAC 1SLUB 5T6FA 2PSYA 2V3HH 1CQQA 4X2XA 1E38B 1AI8H 2ZDAH 2XRCA 1LDTT 1IQEA 1LHEH 3BEUA 1QL7A 1C5WB 2ZGXH 1EAXA 5E8EH 2ZGHA 2WYGA 2KAIA 3P8OA 4CRAA 1OS8A 2R2MB 2XBVA 3NKKA 1NFWA 1WU1A 1N6XA 1C1SA 1CE5A 1C2EA 1S5SA 1GDNA 3RC5A 1CHOF 3UR6A 5AF9H 2ZPQA 1SFIA 1ESTA 1XUIA 1NS3A 4D9QA 2ZZUH 1O3PB 3TITA 3RXJA 3IG6B 3SORA 2A7HA 1H8IH 3PYHA 2FOBA 5I46H 2VIDA 2NU2E 2Z6BD 1MD8A 3A7WA 3ZV8A 3TGJE 1Z8IB 1YPLH 2LPRA 4H42U 1FAXA 1ZPBA 5DGJA 1TFXA 3GYLB 3M7QA 1SLWB 1S84A 4FUHA 4ZROA 5CMXH 2ZFTA 1C1OA 1C1VH 1KTSB 1K1LA 4BAOB 1DLEA 2XC5A 1P2QA 2BXTH 4HGCA 2BX3A 2HRVA 3BEFB 4DIHH 1S6HA 2M5TA 2AIPA 5TCCA 4IN1A 1LHGH 5I25A 5DK1A 5C5NA 1C4U2 2FOAA 4AG1A 2FODA 1EASA 4DGJA 4NFEA 2BOHB 3F9FA 2VH0A 5LPEA 1NU7B 1CT4E 4CRBA 1A7SA 4KKDA 1O5AB 2W7SA 3U9AH 1C5TA 1P06A 4NIVA 3SU2A 3MNXA 2ZF0H 3PTNA 1VR1H 4FUGA 4ZKNU 2BXUH 3U98H 4ZKOU 1BRUP 1NRQH 5F8TA 4BTIB 1HBTH 1GJ5H 2C8YB 2Y7ZA 3ZVFA 9ESTA 2OBQA 3SU5A 4U2WA 4CBOA 4GHQA 1JIMA 1W0YH 1H9IE 3SHCH 1FZZA 1ZSLA 1RS0A 4I33A 1MD7A 1LCYA 1W0ZU 3LIWA 2SFAA 3UQOA 1TQ7B 4FU9A 2QXGA 1FXYA 1AB9B 3U8TH 1XUJA 4X8TH 3BIUH 2WUBA 3RXIA 3S9CA 2ALVA 3TGIE 1DSUA 5AHGH 5E2PA 3OU0A 4X0WU 3MHWU 3MTYA 4CHAB 1Z7KA 2BYAX 1QB1A 2G55A 5IDKA 2P95A 3ZZCA 1D6RA 5F8XA 4AB9A 5FPTA 1LKBA 1Y3UA 1GBTA 1WOFA 2OQ5A 3FFGA 1PQ5A 1UK3A 1FLEE 3RXAA 1L1GA 3TK6A 4UFDH 3ODFA 2NU0E 2FYRA 3S7KB
chains in the Genus database with same CATH superfamily
5HXFA 1EKBB 2J5UA 4NA7A 3UNQA 3SV9A 3MNSA 1C2GA 6GCHF 1MKXH 1TOMH 2ZGJA 5A0CA 1MBMA 1HAOH 2P8OC 5EW1H 7GCHG 4OS7A 1TOCB 1F0SA 1GI8B 1O31A 1BMNH 3F0PA 3MU5A 1ZOMA 1DE7H 2ZFSA 3F0OA 4A1VA 2OC7A 3GCHC 3L6PA 1V2LT 5DP4A 5FCKA 1YPMH 1YLDA 1IQHA 3UR9A 2IN2A 1QL9A 1EUFA 2EQNA 2QAAA 3ZZ9A 1PPFE 3MU0A 3RMOH 3M7TA 4CH2B 4Y8XA 1E35B 5JBTA 1PPBH 1GBHA 3DFLA 2GKVE 1J14A 1XUKA 3OY5U 2TIOA 4RN6A 1F0UA 5JBBS 3BG4C 1ORFA 1AFEH 1XVMA 2CJIA 2FMJA 4ABDA 1HAXB 1RD3B 1S6LA 5DKMA 2TGAA 1P2OA 2QN5T 2J9NA 3SV2H 1Z8JB 2KCAA 1GMCF 1BTXA 2XBWA 1O3HA 2A5KA 2PUQH 3M3TA 1TGTA 5A2MH 5ABWA 4M9FA 2JIZD 4ZKSU 2Z9LA 4FUEA 1QTFA 2CXVA 4DCDA 1NC6A 3GCNA 1HAPH 1SSXA 3UB0A 1QQUA 4OS5A 2ZDNA 4DIIH 5JYIA 2ZC9H 4CR9A 1SOZA 8GCHF 1O2WA 1MKXK 1TNIA 1GHAF 4ZH8A 4AGJA 2W5EA 1O36A 1MZDA 1ABIH 4OS4A 3SU1A 1NRRH 2L6OA 3KIDU 2V6NA 8ESTE 3MH4A 4H6SB 1O5DH 2PKAA 1KY9A 1TGBA 2R3YA 1D6WA 2D26C 3H7OA 2ZGCA 1O0DH 1C5MD 2ZTXA 4IBLH 4DT7B 1ABJH 3KYGA 2ZIQH 4NWKA 5KEDA 2AH4X 3SU3A 2BLWA 1GI2A 1DSTA 2AYWA 3TK5A 2ZHDA 2VNTA 2BQWB 2BQ6B 5FL7D 1W2KH 4IC5A 4JZDH 1FMGA 1MTNC 3OX7U 4AFSA 2O8TA 2AMDA 1GI3A 1OYTH 2GVFA 2ZDMA 1P11E 1NBME 4ASHA 4DJZB 3DFJA 4X2WA 1GBLA 2C8ZB 3CS0A 1UVTH 1WYKA 5C0TA 1WSSH 3V13A 1T4VH 4P00A 1NZQH 1ANCA 4BAHB 1UTJA 1HIAA 1ZTKA 2SNWA 4X6NA 2A1DB 3MQKC 1MABB 2ZCHP 1TGNA 3VG8A 4K60A 4ABFA 2P8OB 4X6MA 3RXPA 2J98B 1A0LA 1FUJA 1HAZB 2F43B 3K9XB 2PLXA 1QFKH 3GCHB 3ZV9A 2ZG0H 1AO5A 5EODA 1Y59T 5EIYA 3Q76A 1TYNA 4FVDA 1N6YA 1BTZA 3WWBA 1EJNA 2WUCA 3SNDA 1ELGA 2ZPSA 1QIXB 1UK2A 2F9NA 2ZU4A 5A09A 3TJUA 1EPTC 4NIYA 3OY6U 1GHVH 3Q3YA 2OQUA 3BTTE 3JZ1B 1EOLA 4I32A 3EE0B 1BITA 1GG6C 1F92A 1TIOA 1CGIE 1TA2A 1ZGVA 3BG4B 1GCTC 3PMAB 3MNBA 3KEEA 1W0KD 2STBE 1E36B 3EA7A 1O2XA 1E79D 4TYDA 4K69A 1ELEE 5C1XA 1OWIA 2ANMH 3KQEA 2ZU1A 3QGNB 4ABHA 2FESH 3LGIA 1TPAE 4B6EA 3QO6A 1SHHB 4YLUA 1EJAA 3GY8A 2ILNA 3TVJB 3UREA 5FBIA 1NFUA 2BD4A 3QZQA 1W13U 3SGAE 1W7GH 2BY9X 3PM3A 5C17A 3RXDA 1XVOA 4X2YA 4XE4A 1TMTH 2F9UA 4JZEH 4B71A 4ABJA 1IQIA 4ISNA 1L4ZA 1GVZA 2JH5D 3ZZ4A 2AGIX 2V3MA 4NZLA 3M61U 1AHTH 2G8TA 4INHA 4E7NA 1NY22 4Y10E 2XC0A 5HKKD 4Q4LA 3QDZB 3AAVA 1O3NA 3OAAD 2SGQE 3ZYEA 3UY9A 2UUFB 3S9AA 1K0HA 3SU6A 4NZQA 2P3TB 4UD9H 2BLQA 1XXDA 3TNSA 2UUKB 1BTPA 4X2VA 1ZHMA 1NO9H 3SV8A 1DS2E 2SGDE 4ZHLU 3CS7A 2XOKD 4XBBA 1OPHB 4MG3A 4Q7YA 5C3NA 2ZEBA 2BY8X 1WBGB 2VWMA 4MNXA 4X6PA 1EZSC 1C9TA 3VB7A 1FN6A 1ZJKA 3N7EA 4M7GA 3SUEA 1NRPH 4F55A 1GVKB 1S85A 1A0JA 4CREA 4XSKU 1BRBE 4A6LA 2VIPA 1XUFA 1GBEA 1O2YA 3RC4A 5JDUB 3SQHE 1QB6A 1L1NA 1O3CA 4ISHH 4X1RU 3LGWA 3TNTA 5J4QA 1H1BA 1QJ7B 5FX5A 3TIUA 1AZZA 3E90B 2GJGA 3KF2A 1CO7E 4YLQH 1H9LB 1P01A 2GCHF 1YPHC 1UHBB 4U01A 3PV5A 4Q7ZA 2VH6A 5EXLA 2VBCA 3EYDA 1A46H 1UTKA 3SI4H 4JK5A 2L74A 2RG3A 4UE7H 2ZCKP 3A7TA 2V35A 1P03A 3R3GB 5C5OA 1UO6A 1B0FA 3NXPA 1GMDG 1LVBA 8LPRA 4NWLA 3A81A 1YM0A 3KL6A 3P6ZB 5FAHA 1PQAA 1TA6A 1JOUB 2GT7A 3K6ZA 4D9RA 2HWLB 1FPCH 3EQ0H 1C5NH 5DP8A 2BDGA 1GJCB 2OC8A 1EPTB 2JDID 2WHXA 2M2AA 4A1XA 4B2BA 1HAVB 3DHKH 1KXEA 1H9HE 3RU4D 2UWLA 4GLYA 1FIWA 1K21H 1GG6B 3TJOA 1E1QD 3E0NB 3SQEE 1C2IA 1MCVA 5C1YA 1GCTB 1QGFA 5SGAE 1FY1A 4XD7D 2Z3CA 2Z3EA 3G01A 3SU0A 1BUIA 2B9LA 3RXFA 3NUMA 5EJLA 3ZVAA 1MQ6A 1UTLM 1P2NA 2KZ4A 1P12E 2GDEH 2QIQA 1ZSJA 1GDUA 3ATLA 3F6UH 5DSFA 1YPHE 1ZYOA 1DICA 3GDSA 5DP9A 2WSSD 2HPQH 2ALPA 1OYQA 1VKYA 1UTOA 4YO9A 1JIRA 1SVPA 2BDCA 2BD7A 1THPB 3A84A 2D2DA 2BDBA 2G00A 3MH5A 1DUAA 3A8AA 4TWWA 6LPRA 4O9VA 4Y7AA 1YKTA 2D1JA 4JMYA 3LDXH 1NRNH 2PSXA 2D8WA 3GY7A 1GPZA 3B8JA 3KQCA 1BTWA 1BBRE 4NG9H 3VB3A 1TMUH 4TY7A 3SV6A 3P70B 1WV7H 1TRNA 2OD3B 1MAYA 4UFFH 1P2IA 5FBEA 1TGSZ 3GDUA 3N99A 3IWMA 2C90B 4DVAU 3KN2A 1PFXC 1BHXB 2PFEA 4AGKA 4NSYA 2BMGB 4K1TA 2O8MA 1GBBA 2TBSA 4AOQA 5K7RA 4KGAA 3U1IB 5GWZA 1RJXB 2K1QA 5B6LA 1UJ1A 2H5CA 3RXQA 1AY6H 1VJ9U 2FI4E 2VIQA 5JPMH 1O39A 2OINA 3V0XA 5JB9S 5L2YH 1GI7B 2B7DH 7LPRA 2OUAA 3C27B 2SGPE 1SGQE 2ZTYA 2C4FH 3AVZA 1KXDA 3BTDE 1FN8A 1V2PT 1XUGA 2FP7B 1THSH 1SI5H 2XBXA 3PMHB 3QLPH 3BTKE 2FEQH 4KELA 3EAJA 2RCEA 4TSFD 3P92A 5HYOA 2HPPH 5L2ZH 1TPOA 1GI9B 1QURH 1SFQB 4Y6DA 1T8LA 4MDSA 3UFAA 2JJ2D 1W11U 3U8OH 3ZZ7A 4A92A 1AWFH 1BQYA 1SPJA 1TRMA 2A4OA 2QXJA 3ODDA 3AK5A 2C8XB 1DANH 5C0UA 1HAYB 4LXBH 1QL8A 2BOKA 2GGVB 2GCTC 3VPKA 5CDFE 2QE7D 4IGDA 4DURA 1OP2A 1Z71A 2CMYA 1LHDH 2VJ1A 3A88A 4JZIA 1ZMLA 3A7YA 1LPZB 1EJMA 4CBNA 3RU4T 1AKSA 4YT7H 2GZ9A 5LGOA 2G52A 2JETC 2VGCC 1C5YB 3TH2H 1QR3E 3FP7E 3UIRA 3UUZA 1RIWC 5C1UA 1OWJA 3ZVBA 4ASUD 1ELBA 1FDPA 1GBDA 3SZNA 1KXBA 1D4PB 2BVXH 5T3HA 3VXEH 2BTCE 2OC0A 2ESTE 3F3BA 3S9BA 2KFWA 4A1TA 1VJAU 1GBCA 1S0RA 1BRAA 4X1SU 1P8VC 1C9PA 1LVOA 1PPEE 1G30B 4K2YA 3EDXB 3K2UA 3O8DA 1F5LA 2BDHA 1W10U 4X1NU 2BD5A 3KYFA 1PQ8A 2ZPRA 3S7HB 2VIVA 3BF6H 3K6YA 2GT8A 2BHGA 3K65B 3T62A 2ZGBH 4U32A 1MTWA 2SGAA 3RC6A 2AS9A 1FI8A 3PWCA 4YM9A 3HK3B 2XWBI 1TPPA 3A83A 3LC3A 1QB9A 2C3SA 2BD2A 4UONA 3RM2H 1V6DA 2ODQA 3AW1A 4FUIA 2BD8A 5EW2H 1GMHG 1O33A 4RT0A 1FY5A 1ZLRA 4E06H 1LPGB 5IK2D 1BTHH 1NRSH 5J4SA 4AB8A 1G2LA 4YZUA 4ABEA 2VVUA 1AE5A 1FY8E 1X7AC 3RMLH 1MU8B 2ZO3H 3FANA 9LPRA 3RXBA 1J8AA 2BVRH 4I8LA 2Y7XA 1O34A 3BV9B 2QXIA 1G9IE 3FKSD 2R9PA 2KR7A 2WPDD 1KSNA 2A7CA 1NESE 3LGUA 5TCAA 5GDSH 2TGPZ 5A0AE 1P10A 2I6SA 2QYIA 3GISB 1TNGA 2AIQA 3AASA 4OGYA 2ZU3A 2DE9A 1Q31A 4GSOA 2J2UA 1GI1A 5FPYA 3HK6B 4ZHMU 3LC5A 3V3MA 2V0BA 4ABGA 2TRMA 3E3TA 1MH0A 1W0JD 1EAWA 1MQ5A 4MPXA 2GV6A 1QJ6B 3BN9A 3QX5H 2ZWLH 4WMFA 4K1SA 2Q6FA 2PR3A 1O35A 1ETTH 4Z0KA 1ZJDA 2WV5A 1IAUA 1V2UT 1FV9A 1V2JT 1KDQB 3T26A 3M36A 3ZZ8A 5E0HA 1SGRE 1IHSH 5DP5A 4RKOB 3SJIA 1VGCC 2HOBA 5L6NH 3OE7D 4Q2KA 4NFFA 1P9UA 2Q6GA 1O3GA 3ZZ5A 1N1LA 4HTCH 1XUHA 2I6QA 5T6DA 1V2NT 4WH6A 5EXMA 1LQDB 3L3TA 1O38A 1EQ9A 3RXUA 1GJ7B 2PHBA 1UVOA 4K8BA 2Q1JA 3MFJA 4NIWA 1D3TB 1VITF 5DP6A 3A87A 1EP6A 4NIXA 2PKAB 1LMWB 4A5TS 2P94A 3F2FA 1O3FA 4GAWA 1GI5A 1GBIA 3SV7A 3M37A 2K8IA 1A0HB 1O3JA 2A45B 1QRZA 2GCTB 4OGXA 3GCOA 1K1JA 3RXVA 1K9OE 2J38A 1OP0A 5EPNA 4PROA 2Z3DA 2GMTC 1VITH 3E6PH 4K8YA 1SLVB 2ZFRH 1DITH 1P02A 4MVNA 1B5GH 2JETB 2VGCB 5HIZA 1ZPCA 3D65E 3RXCA 1DWEH 1RIWB 2ZU2A 2Z9IA 4OS2A 1AU8A 1BDAA 1T4UH 2QF0A 3AW0A 1HLTH 2B8OH 1GHBF 3LJJA 3PLKA 4RI0A 3T27A 5F8ZA 3O8BA 3PROA 1K22H 2XC4A 1GMDF 3SN8A 4BXWA 1GJ4H 1O32A 2K0QA 2XXLA 4ABBA 2PWXA 4KTCA 3A82A 3T2NA 2FYQA 3TJNA 1C1QA 1D3PB 3I77A 4FU8A 3VXFH 1OWDA 5DJ7A 4F49A 1CA8B 5HMAA 1SGFG 2FS8A 1YY3A 2GX4A 2WINI 1BRCE 3A8CA 2FXRA 1EP5A 1C1NA 5GCHG 2BQ7B 1Z8RA 4GUXA 4JYTA 3RXRA 4K3JA 3SI3H 1YPGH 4JZFH 2KCOA 3VB6A 1DXPA 1IQLA 4CH8B 1PPCE 1V2KT 3ZIAD 2CF8H 3EA8A 3SOSA 2OTVA 1GJ8B 4BAKB 2BY7X 2HALA 2O9QA 1JRTA 4Y0ZE 2QF5A 1RRKA 1Y5AT 1MU6B 2BZAA 2QXHA 4D7FA 2UWOA 4B2CA 1T31A 2HNTC 1SGCA 3RXGA 1EFRD 4CR5A 1S81A 5JBAS 1YCPM 3UQVA 2ZQ1A 2VWOA 1O2UA 3QTOH 2PP6A 2LELA 1O2PA 4ZMAH 1O2TA 2PTNA 2QCYA 2B5TB 2OK5A 3WWFA 1KLIH 2VIOA 1UTNA 4TPIZ 1F5RA 4I7YH 3Q00A 3SO3A 1YF4A 3FP6E 2G4UA 5CHBA 2FTMA 4ISOA 1V3XA 1YC0A 3URDA 1GHXH 2ANWA 4BAMB 3LKWA 1UCYE 3FAOA 1MBQA 2FZZA 1IQFA 1VGCB 1ZRKA 1EB1H 1YPKH 2THFB 1O3KA 3PMBB 1UK4A 4D7GA 5F53A 1SKYE 3GCTF 3HKJB 1C5SA 3SUFA 4TY6A 5E2OA 4O3TA 4R0IA 4F48B 3NWUA 4INKA 1UTPA 1ELAA 3JZ2B 2XCFA 5JB8S 4OM9A 4TPYA 1FNIA 3STIA 3PV4A 3A7XA 1P57B 1SGTA 1S83A 1RFNA 1CA0C 4Y8ZA 1WTGH 2HNTE 3OEHD 2LP6A 2R0LA 2FX4A 1MZAA 1ACBE 4AYYB 1DDJA 3DSGA 1O2RA 1SB1H 5EPYA 2GP9B 2GMTB 2RDEA 4B74A 4WJG2 3R0FA 1CU1A 3KNXA 2VINA 2A7JA 1TX7A 2W26A 1DPOA 1N8OC 1O2KA 3GYMA 1V2QT 3E8LA 1GJDB 1ZSKA 1BMAA 1C2LA 1ZZZA 2CV3A 1FY3A 2G51A 2SGFE 1INCA 1EAIA 2BZ6H 3FZDA 1YCPH 4CRFA 5KECA 4Y0YE 1A5IA 5GPIB 1W12U 1FJSA 4FXGH 1DWDH 3T29A 4LZ4B 1B0EA 1A61H 4BTUB 1RTLA 4UDWH 3P8GA 1TABE 1ELCA 2AGGX 2XBYA 3SGQE 3M3VA 1XXFA 1IQJA 1G36A 2P3FH 1BMMH 4R8TB 6CHAC 5T6GA 3UNRA 3MH6A 2SGEE 2TGDA 2R0KA 1HJ8A 4YOJA 2F3CE 4HG6A 4DY7B 2H9EH 1IQGA 1WAYB 3P17H 8KME2 3HATH 1L4DA 3I29A 1HUTH 3SUDA 5DG6A 2ZHQH 1TGCA 5DP7A 1O3AA 2EI8A 1GL1A 1OP8A 2ZDVH 1O3DA 1YLCA 1GHZA 3LH1A 1O2HA 4Q7XA 1O2IA 4CRDA 3EA9A 1V2RT 2Y5FA 1YYY1 1TE0A 2WPJS 2CF9H 4AORA 2V3OH 4CRCA 3ZYDA 1EXFA 2JH0D 2Z7FE 4YTAA 2UUYA 1J17T 2EI7A 1HPGA 3ESTA 3QUMP 1P9SA 2EY4C 5A0BA 1A1RA 2OCVB 2WV4A 4HFPB 1MTSA 2BDIA 1E1RD 1TWXB 2WPHS 5EJ1A 5A8ZA 1K1MA 5EQSA 3FP8E 5GXPA 1C2FA 1C5QA 2OLGA 1K1NA 1AVXA 3MNCA 1CSOE 2A5AA 2BY6X 3SJKA 3DT0H 1TNLA 4B75A 1RGQA 4WF8A 3TJVA 4FU7A 4ZXXH 2Z94A 2BDAA 4FOUC 2EEKA 3MOCA 4ACBA 3E91A 2FOGA 5E0JA 1IOEA 2W3KA 5DO4H 1EAUA 1ARBA 3LU9B 1PYTD 2J98A 1F2SE 3GY5A 1DT2A 2F9PA 1NFXA 1H8DH 4Y7BA 1LHFH 2IJOB 1DWBH 3W1EA 3B23B 1K1PA 3BTHE 3NPSA 2FI3E 2FS9A 1CA0B 3U69H 3OSYA 3CENA 3DUXH 2WYJA 4TWYA 4WXIA 1JXPA 1TONA 2ULLA 2JJ1D 1C2MA 2ODPA 2VB0A 1TX8A 1GBFA 3MYWA 1NTPA 1LKAA 6GCHG 4ESTE 3D62A 4INLA 1O2VA 1WTHD 2FOCA 4YXWD 3A80A 1C5XB 2DUCA 3WY8A 1N8OB 3M7UA 2DE8A 2LNCA 7GCHF 5HGGA 1GWAA 2AEIH 1MAXA 3A8DA 1ANDA 3QGJA 1TBZH 2VWNA 4ISLA 4FUCA 3BTME 2YMSD 2UUJB 1TALA 2RA0A 3TPIZ 3V12A 2CN0H 4SGAE 1C5ZB 1DOJA 3RM0H 1G3BA 3TK9A 1QNJA 4XBCA 1T8NA 4MNWA 3Q77A 5AVDA 4Y79A 2H9HA 2KAIB 3NZIA 1IQKA 1T7CA 5EJZA 1ESBA 1AFQC 4Y8YA 2ZTZA 2ZNKH 1O2GH 2O8UA 2XNDD 2W3IA 1E37B 1JBUH 1GBJA 2XCNA 3URCA 1SOTA 2RDLA 3M3SA 2IJD1 6CHAB 3A7VA 5ESTE 1ELDE 3MO6A 3VFEA 4Y71A 1GCDA 2GV7A 3E0PB 2HVXA 2UWPA 5G4BA 1QHRB 1P3EA 3SBKA 4XDEA 1GMCG 3E16B 3NCLA 3SNAA 4H4FA 4H6TA 1KIGH 4I8JA 1PQ7A 1GJBB 2ZFFH 2PTCE 2P59A 2ZFPH 4WXVA 1O2MA 2EI6A 1C2JA 4KTUA 3TLOA 1U6QA 4WWYA 1ID5H 3W94A 2AFQB 2FTLE 1FQ3A 1SGNE 4HI3A 1O2NA 2PW8H 2XTTB 2PGBB 8GCHG 3MO9A 4I31A 5A8XA 1T8MA 2BD9A 1GHAG 4NA8A 1T8OA 1Y3VA 3ATIA 1WQSA 4JK6A 4XOJA 2G4TA 1ZPZA 3STJA 3UNSA 1HXEH 1MCTA 4MPVA 4FETA 3H7TA 3Q3XA 3UTUH 3MWIU 1Y3WA 3BSQA 1VZQH 3GOVB 3UOPA 3HKIB 3LGTA 2SNVA 4GCHG 3D49H 2ZHWH 1SQAA 1XMNB 4MLFB 5GNDA 1SQTA 3KQBA 3FZZA 2AHME 1AE8H 1JMOH 3RLYH 1UHBA 1Q2WA 1NM6A 1COWD 4NA9H 1NBMD 3ATKA 1BJUA 5GIBA 3LOXA 3ZZ6A 1HXFH 3E1XB 1MKWH 2FI5E 4NGAH 3HGPA 5CHAB 1SL3A 1C1MA 1ZR0A 2F9BH 1ELTA 3BTWE 1EB2A 1GVLA 2WPKS 1ELVA 4AFQA 1HFDA 5BRRE 1W14U 1O5EH 2A32A 3ELAH 1CGJE 3M5LA 4X8UH 1EPTA 1FY4A 1V2ST 3H5CB 1HAVA 3PLBA 3ZVDA 1G37A 1P3CA 1CBWC 1WQVH 3NK8A 1EZXC 1ZMNA 1XX9A 2ZDLA 1HCGA 1PPGE 3TU7H 4AFUA 4LZ1H 4BAQB 3RDZA 3PB1E 1CHGA 1OOKB 4RT1A 2PUXB 2GZ7A 2VWLA 1ZTLA 3RXTA 1JRSA 4I86A 3OTPA 4Y76A 4B6FA 3U8RH 1AFQB 1TBQH 4X6OA 2QY0B 1K1OA 1NPMA 1BMFD 1WDIA 3GICB 1J9CH 1UTQA 1O5BB 1TX6A 5B6OA 2ZECA 2ZP0H 5FCRA 1ESAA 2A4QA 1FPHH 2H2ZA 2A4RA 1LO6A 2O8WA 4YESB 5C94A 1ZGIA 4MNVA 1Y3YA 1F0RA 1UVSH 1AVGH 1S0QA 5F6MA 1DVAH 1LVYA 4LK4A 1AQ7A 2G5NA 2CK3D 3SJ9A 2BVSH 1XKBC 2Y5HA 3VGCB 4QT8C 1OSSA 4FUBA 4B1TA 1MKWK 4UFEH 1HYLA 3I78A 3SJ8A 3SZEA 3V7TA 2VIWA 1O30A 3ATWA 1BCUH 3F1SB 4I8HA 1AMHA 1F7ZA 1BTUA 1V2VT 1HV7A 4WH8A 3RXMA 1IHTH 5IYTA 3LPRA 1OWHA 1L1JA 1TNHA 2H5DA 2H9TH 1NROH 3BEIB 3CP7A 1O5CB 1SMFE 1MTVA 1NU9A 4GPGA 1PYTC 1AVWA 1SG8B 1C5PA 1SC8U 4WY3A 2P16A 1ANEA 1LVMA 4ACAA 1ZMJA 1GBMA 5L30H 2AMQA 1RTFB 1BTYA 5T1VA 3SHAH 5LH8A 3U28C 1HAIH 1DLKB 1PJPA 5C67A 4WMEA 1O2ZA 3VEQB 5JBCS 1S6FA 1BB0B 1K28D 1TQ0B 3ZZAA 3U1JB 1QZ8A 2FX6A 1PPZA 1GI6A 1SQOA 1AWHB 1NT1A 2Y82A 2C8WB 1K1IA 1V2TT 2IPHA 4MTBA 1GBAA 1P04A 4VGCC 4CRGA 1C4V2 2GD4B 4ZAEA 1HNEE 1QJ1B 3RXLA 5LPRA 2QF3A 5DP3A 4AC9A 2F91A 2G81E 5EGMA 5LPFA 2NWNA 3DCLA 1D3DB 1GJAB 3OTJE 2YOLA 5C20A 3GDVA 3RXHA 2BDYA 1P2KA 2OP9A 3F9GA 1V2WT 3PWBA 1GI0A 3N7DA 1YPJH 3NRLA 4B73A 2GCHG 3VB4A 1UCYH 4WMDA 2OXSA 3Q3KA 1V2OT 2BLVA 3SW2B 1CBWB 4D8NA 2HNTF 1AGJA 1H4WA 1C2DA 3LGYA 1IQMA 1QRWA 3C1KA 3F2GA 2V7QD 3LONA 1HJAC 3T28A 3MH7A 4TT3D 4IS5A 2W7UA 4OS6A 1ZRBA 1A5GH 4Y11E 3FVFB 3S69A 2Y80A 1E34B 4ABIA 2RA3A 5H4IB 1HIAB 3BTQE 1C1WH 2A5IA 4O03A 3UPEA 5PTPA 3ZVGA 3M35A 2KM0A 2F9OA 4IN2A 1BT7A 4B76A 3AAUA 1M9UA 5FHTA 1LPKB 3BTGE 1V2MT 1ELFA 3PO1C 2O8LA 5FPSA 2XW9A 1ZHRA 3SGBE 1L0ZA 3RU4E 1HJ9A 3SU4A 1SQRA 1Z6EA 1D9IA 1Y3XA 4BANB 2ZI2H 4AZ2B 4BTTB 1THRH 4DW2U 4K1EA 2NU3E 2Z9GA 5GJ4B 2PGQB 1TNJA 1FIZA 4IMQA 3M5OA 3M5MA 1WCZA 2Z9JA 3KQDA 4AX9H 3PTBA 1Z1IA 4X1PU 2TPIZ 4DT4A 1FONA 2AMPA 1KXFA 3SNCA 1C5OH 4AYVB 1TNKA 2VVCA 2FPZA 3GY2A 4AFZA 1C5VA 1YPEH 1W3CA 2A4GA 1O5FH 3LJOA 1BOQA 1HGTH 2CGAA 3RLWH 1KDQA 2NU1E 2QA9E 1C2KA 1UCYK 2AERH 1TPSA 4X1QU 2HGTH 2A0QB 4BNRA 1ETSH 1GHYH 1A4WH 1SGFA 2FOFA 2GTBA 3QWCH 1LQEA 1KXAA 4THNH 2QC2A 4DG4A 1SGEE 1ETRH 3QZRA 1WXRA 1Q3XA 3DD2H 1HAGE 1AIXH 4JYVH 3LT3A 1YWUA 1GGDC 4MQAA 4SGBE 2CHAC 3ZZ3A 3OFND 1G3EA 4AG2A 1P05A 2JKHA 5EQRA 1SBWA 3LGVA 1YGCH 1P2MA 4KTSA 4GCHF 4RKJB 4VGCB 5AFYH 1G3CA 3ZVCA 4D76A 3CNRA 2FDAA 4ZCNA 3D23A 2J95A 1DM4B 5KGOA 1GDQA 2YMSB 1QBVH 3S0NA 2F9VA 3A85A 3A7ZA 3RXOA 1KTTB 1SR5C 1QA0A 5HM2A 1J16A 3GY3A 4YOIA 2J4IA 2HLCA 3LH3A 2ZHFH 3RXSA 1A5HA 1SGDE 4MNYA 2XYAA 1CHOG 1NN6A 3L33A 1OKXA 5F03A 2FLRH 1BZXE 1VCPA 3FOAA 1KXCA 4P02A 3QN7A 4K5ZA 4XFQA 2PKSC 4U30A 1HJAB 4J1YA 1O3BA 2FWWA 1BHXF 4MPWA 1AUJA 1DXWA 4BXSA 1RXPA 4Z1MD 1A3BH 2ZA5A 2IOTA 3TH3H 2XNIA 3EGKH 7ESTE 1T32A 1TLDA 4GVUA 2FLBH 3OYPA 5EOKA 2ZHEH 5EXNA 1EZUC 1HAHH 1QBNA 5EG4A 2WPIS 2ZQ2A 4FUJA 1CT0E 3PO1B 4E05H 3TGKE 1QBOA 1DUEA 3T5FH 1RTKA 1O2SA 1KMHB 3KQ5A 2QF4A 4FVBA 1BIOA 1O3EA 4RSPA 6ESTA 2XWAA 1W8BH 5AFZH 1GI4A 2NU4E 1Z1JA 1OXGA 2PV9B 1P0SH 2ASUB 3MU1A 5ETXA 4ABAA 1O2LA 3A89A 1GMHF 4I8KA 2QV1A 4IMZA 2ODYB 1OWEA 1C5RA 4LOYH 5A8YA 1O3MA 3BG8A 2H1UA 7KMEH 2GDDA 2ZKSA 2KCPA 4MPUA 1KLTA 2OC1A 1UW7A 3RP2A 1AUTC 1BMLA 1O2OA 3ZZBA 1XM1A 3B9FH 1D3QB 3H09A 3DA9B 1GJ6A 1TAWA 3F68H 3PLPA 1WUNH 2WPMS 2J92A 1GL0E 3FO8D 1W7XH 1CT2E 1A3EH 1JWTA 2P3UB 1TB6H 1Z8GA 3UWJH 3BTEE 1SHYA 3MU4A 1AD8H 1EOJA 4F4OC 4ZUHA 4OS1A 2Z9KA 3GY6A 1DY8A 3M5NA 3RXKA 4B2AA 3DSOA 1AZ8A 1UVPA 2ZU5A 3P8FA 5FX6A 1MMJN 3IITA 3RMNH 2EC9H 1YCPK 2G5VA 1ARCA 1TMBH 1B7XB 2QGRA 1SGIB 1TRYA 2FOEA 4IW4E 1GGDB 4J2YB 3RMMH 2CHAB 1O3IA 3QTVH 4BOHA 3O8RA 3HPTB 3SUGA 1BBRH 1QQ4A 4X8SH 2FM2A 3TH4H 4ISIH 2A31A 5DPAA 4JZ1A 1CVWH 1TBRH 4ZHAA 1F0TA 2EA3A 3MO3A 3PRBA 2W6ID 1QRXA 4YT6H 2R3UA 1VITG 3RUOA 1C1TA 1MTNB 1QCPA 1QA7A 5CHAC 1S82A 3HGNA 3UOUA 3SJOA 4ZXYH 3DSPA 3GS9A 2J94A 1LTOA 2VVVA 3KCGH 4Q80A 1LHCH 2ANYA 5K0HA 3PRDA 3PMJA 5TJXA 5C2ZA 2GZ8A 1VCQA 3ZVEA 2FOHA 3F9EA 2YNAA 1DFPA 3ITIA 1C1UH 3P95A 4I8GA 1BA8B 2H6MA 2PKSB 5HIYA 3W95A 4GHTA 1F5KU 1PPHE 1YP9A 5EQQA 3UWIA 1G3DA 3MU8A 1Z6JH 1EX3A 1MUEB 5E0GA 3WW7A 1Y5BT 2ANKH 2BB4A 2B0FA 1C5LH 1GHBG 4NCYA 2Q6DA 1KLJH 2TGTA 1UVUH 2STAE 1OHHD 2FIRH 5FXLA 4AN7A 3SNBA 2Y5GA 2WZQA 3KHVA 3O8CA 2AGEX 1YLNA 3SYJA 1C5UA 3MMGA 1GJ9B 1CGHA 1FAKH 3A86A 1P2JA 1UMAH 3F9HA 1P09A 1VCWA 3UAIC 2BX4A 1K2I1 3ZZDA 1AKSB 1E0FD 1O2JA 2BLOA 1DX5M 4O97A 3RXEA 1AN1E 1DY9A 3A8BA 1IQNA 4IC6A 1OX1A 1O3OA 1O37A 5BPEA 1BBRK 2F83A 1O5GH 1SGPE 4O3UA 2JH6D 2OBOA 2R2WU 3VGCC 3KGPA 4FUDA 4HZHA 2C93B 3N7OA 5GCHF 1H8ED 1C2HA 4XBDA 2J34A 2P93A 4NSVA 2BM2A 3BIVH 1XKAC 1MTUA 1C1PA 4JCNA 3T25A 4UEHH 1Y8TA 2ZCLP 1HDTH 1G32B 1J15A 1BJVA 2Y81A 1ZTJA 4KP0A 1Y5UT 1EZQA 4DOQA 5ESBA 1HRTH 5EU8A 2ZFQH 1KYNA 2A2QH 3ENSB 1HB0B 1OWKA 4FUFA 2ZDKA 4E7RG 1A2CH 3SNEA 1YBWA 2WPLS 1NFYA 1C4Y2 1UTMA 2YNBA 1O3LA 2BD3A 3MI4A 4JYUH 3QK1A 1C1RA 3BTFE 2Y6TA 2BY5X 1SLXB 4A7IB 2FOMB 4UFGH 5HM9A 1DWCH 2A2XH 1L2EA 2IPQX 3P8NA 1AB9C 1ANBA 1G2MA 3ATMA 3GCTG 3GY4A 1SGYE 4WVPE 4Z6AH 1ZHPA 1GBKA 1EATA 1O2QA 2W6JD 4X8VH 1GHWH 2VU8E 5CE1A 1QY6A 4YOGA 2FO9A 4ZKRU 3VB5A 4CHAC 1SLUB 5T6FA 2PSYA 2V3HH 2J97A 2WV9A 1CQQA 4X2XA 1E38B 1AI8H 3OEED 2ZDAH 2XRCA 1LDTT 1IQEA 1LHEH 3F2HA 3BEUA 1QL7A 1C5WB 2ZGXH 2HVYB 1EAXA 5E8EH 2ZGHA 2WYGA 2KAIA 3EE7A 3P8OA 4CRAA 1OS8A 2R2MB 2XBVA 3NKKA 1NFWA 1WU1A 1N6XA 1C1SA 1CE5A 1C2EA 1S5SA 1GDNA 3RC5A 1CHOF 3UR6A 5AF9H 2ZPQA 3FN8A 1SFIA 1ESTA 1XUIA 1NS3A 4D9QA 2ZZUH 1O3PB 3TITA 3RXJA 3IG6B 3SORA 2A7HA 2KCYA 5DN6D 1H8IH 3PYHA 2KX4A 2FOBA 5I46H 2VIDA 2NU2E 2Z6BD 1MD8A 3A7WA 3ZV8A 3TGJE 1Z8IB 1YPLH 2LPRA 4H42U 1FAXA 1ZPBA 5DGJA 1TFXA 3GYLB 3M7QA 1SLWB 1S84A 4FUHA 4ZROA 5CMXH 4XRNA 2ZFTA 1C1OA 1C1VH 1KTSB 1K1LA 4BAOB 1DLEA 2XC5A 1P2QA 2BXTH 4HGCA 2BX3A 2HRVA 3BEFB 4DIHH 1S6HA 2M5TA 2AIPA 5TCCA 4IN1A 1LHGH 5I25A 5DK1A 5C5NA 1C4U2 2FOAA 4AG1A 2FODA 1EASA 4DGJA 4NFEA 2BOHB 3F9FA 2VH0A 5LPEA 1NU7B 1CT4E 4CRBA 1A7SA 4KKDA 1O5AB 2W7SA 3U9AH 1C5TA 1P06A 4NIVA 3SU2A 3MNXA 2ZF0H 3PTNA 1VR1H 4FUGA 4ZKNU 2BXUH 3U98H 4ZKOU 1BRUP 1NRQH 5F8TA 4BTIB 1HBTH 1GJ5H 2C8YB 2Y7ZA 3ZVFA 9ESTA 2OBQA 3SU5A 4U2WA 4CBOA 4GHQA 1JIMA 1H8HD 1W0YH 1H9IE 4Q63A 3SHCH 1FZZA 1ZSLA 1RS0A 4I33A 1MD7A 1LCYA 1W0ZU 3LIWA 2SFAA 3UQOA 1TQ7B 4FU9A 2QXGA 1FXYA 1AB9B 3U8TH 3PV2A 1XUJA 4X8TH 3BIUH 2WUBA 3RXIA 3S9CA 2ALVA 2YMSC 3TGIE 1DSUA 5AHGH 5E2PA 3OU0A 4X0WU 3MHWU 3MTYA 4CHAB 1Z7KA 2BYAX 1FX0B 2F4LA 1QB1A 2HLDD 2G55A 5IDKA 2P95A 3ZZCA 1D6RA 5F8XA 4AB9A 5FPTA 1LKBA 1Y3UA 1GBTA 1WOFA 2OQ5A 3FFGA 1PQ5A 2RFKC 1UK3A 1FLEE 3RXAA 1L1GA 3TK6A 4UFDH 3ODFA 2NU0E 2FYRA 3S7KB
chains in the Genus database with same CATH topology
5HXFA 1EKBB 4NA7A 3SV9A 3UNQA 3MNSA 1C2GA 6GCHF 1MKXH 1TOMH 2ZGJA 5A0CA 1MBMA 1HAOH 2P8OC 5EW1H 7GCHG 4OS7A 1TOCB 1F0SA 1GI8B 1O31A 1BMNH 3MU5A 1ZOMA 1DE7H 2ZFSA 4A1VA 2OC7A 3GCHC 3L6PA 1V2LT 5DP4A 5FCKA 1YPMH 1YLDA 1IQHA 3UR9A 2IN2A 1QL9A 1EUFA 2QAAA 3ZZ9A 1PPFE 3MU0A 3RMOH 3M7TA 4CH2B 4Y8XA 1E35B 5JBTA 1PPBH 1GBHA 3DFLA 2GKVE 1J14A 1XUKA 3OY5U 2TIOA 4RN6A 1F0UA 5JBBS 3BG4C 1ORFA 1AFEH 1XVMA 2CJIA 2FMJA 4ABDA 1HAXB 1RD3B 5DKMA 2TGAA 1P2OA 2QN5T 2J9NA 3SV2H 1Z8JB 1GMCF 1BTXA 2XBWA 1O3HA 2A5KA 2PUQH 3M3TA 1TGTA 5A2MH 5ABWA 4ZKSU 2Z9LA 4FUEA 1QTFA 2CXVA 4DCDA 1NC6A 3GCNA 1HAPH 1SSXA 1QQUA 4OS5A 2ZDNA 4DIIH 5JYIA 2ZC9H 4CR9A 1SOZA 8GCHF 1O2WA 1MKXK 1TNIA 1GHAF 4ZH8A 4AGJA 2W5EA 1O36A 1MZDA 1ABIH 4OS4A 3SU1A 1NRRH 3KIDU 2V6NA 8ESTE 3MH4A 4H6SB 1O5DH 2PKAA 1KY9A 1TGBA 2R3YA 1D6WA 2D26C 3H7OA 2ZGCA 1O0DH 1C5MD 2ZTXA 4IBLH 4DT7B 1ABJH 2ZIQH 4NWKA 2AH4X 3SU3A 2BLWA 1GI2A 1DSTA 2AYWA 3TK5A 2ZHDA 2VNTA 2BQWB 2BQ6B 1W2KH 4IC5A 4JZDH 1FMGA 1MTNC 3OX7U 4AFSA 2O8TA 2AMDA 1GI3A 1OYTH 2GVFA 2ZDMA 1P11E 4ASHA 4DJZB 3DFJA 4X2WA 1GBLA 2C8ZB 3CS0A 1UVTH 1WYKA 1WSSH 3V13A 1T4VH 1NZQH 1ANCA 4BAHB 1UTJA 1HIAA 1ZTKA 2SNWA 4X6NA 2A1DB 2ZCHP 1TGNA 4K60A 4ABFA 2P8OB 4X6MA 3RXPA 1A0LA 1FUJA 1HAZB 3K9XB 2PLXA 1QFKH 3GCHB 3ZV9A 2ZG0H 1AO5A 5EODA 1Y59T 3Q76A 1TYNA 4FVDA 1N6YA 1BTZA 1EJNA 2WUCA 3SNDA 1ELGA 2ZPSA 1QIXB 1UK2A 2F9NA 2ZU4A 5A09A 3TJUA 1EPTC 4NIYA 3OY6U 1GHVH 3Q3YA 2OQUA 3BTTE 3JZ1B 1EOLA 4I32A 3EE0B 1BITA 1GG6C 1F92A 1TIOA 1CGIE 1TA2A 1ZGVA 3BG4B 1GCTC 3PMAB 3MNBA 3KEEA 2STBE 1E36B 3EA7A 1O2XA 4TYDA 4K69A 1ELEE 5C1XA 1OWIA 2ANMH 3KQEA 2ZU1A 3QGNB 4ABHA 2FESH 3LGIA 1TPAE 3QO6A 1SHHB 4YLUA 1EJAA 3GY8A 2ILNA 3TVJB 3UREA 5FBIA 1NFUA 2BD4A 3QZQA 1W13U 3SGAE 1W7GH 2BY9X 3PM3A 3RXDA 1XVOA 4X2YA 4XE4A 1TMTH 2F9UA 4JZEH 4B71A 4ABJA 1IQIA 4ISNA 1L4ZA 1GVZA 2JH5D 3ZZ4A 2AGIX 4NZLA 3M61U 1AHTH 2G8TA 4INHA 4E7NA 1NY22 4Y10E 2XC0A 3QDZB 3AAVA 1O3NA 2SGQE 3ZYEA 3UY9A 2UUFB 3S9AA 3SU6A 4NZQA 2P3TB 4UD9H 2BLQA 1XXDA 3TNSA 2UUKB 1BTPA 4X2VA 1ZHMA 1NO9H 3SV8A 1DS2E 2SGDE 4ZHLU 3CS7A 4XBBA 1OPHB 4MG3A 4Q7YA 5C3NA 2ZEBA 2BY8X 1WBGB 2VWMA 4MNXA 4X6PA 1EZSC 1C9TA 3VB7A 1FN6A 1ZJKA 4M7GA 3SUEA 1NRPH 1GVKB 1S85A 1A0JA 4CREA 4XSKU 1BRBE 4A6LA 2VIPA 1XUFA 1GBEA 1O2YA 3RC4A 5JDUB 3SQHE 1QB6A 1L1NA 1O3CA 4ISHH 4X1RU 3LGWA 3TNTA 5J4QA 1H1BA 1QJ7B 5FX5A 3TIUA 1AZZA 3E90B 3KF2A 1CO7E 4YLQH 1H9LB 1P01A 2GCHF 1YPHC 1UHBB 4U01A 4Q7ZA 5EXLA 2VH6A 3EYDA 1A46H 1UTKA 3SI4H 4JK5A 2RG3A 4UE7H 2ZCKP 3A7TA 2V35A 1P03A 3R3GB 5C5OA 1UO6A 1B0FA 3NXPA 1GMDG 1LVBA 8LPRA 4NWLA 3A81A 1YM0A 3KL6A 3P6ZB 5FAHA 1PQAA 1TA6A 1JOUB 2GT7A 3K6ZA 4D9RA 2HWLB 1FPCH 3EQ0H 1C5NH 5DP8A 2BDGA 1GJCB 2OC8A 1EPTB 4A1XA 4B2BA 1HAVB 3DHKH 1KXEA 1H9HE 3RU4D 2UWLA 4GLYA 1FIWA 1K21H 1GG6B 3TJOA 3E0NB 3SQEE 1C2IA 1MCVA 5C1YA 1GCTB 1QGFA 5SGAE 1FY1A 2Z3CA 2Z3EA 3G01A 3SU0A 1BUIA 2B9LA 3RXFA 3NUMA 3ZVAA 1MQ6A 1UTLM 1P2NA 1P12E 2GDEH 2QIQA 1ZSJA 1GDUA 3ATLA 3F6UH 1YPHE 1ZYOA 1DICA 3GDSA 5DP9A 2HPQH 2ALPA 1OYQA 1UTOA 4YO9A 1JIRA 1SVPA 2BDCA 2BD7A 1THPB 3A84A 2D2DA 2BDBA 2G00A 3MH5A 1DUAA 3A8AA 4TWWA 6LPRA 4O9VA 4Y7AA 1YKTA 2D1JA 4JMYA 3LDXH 1NRNH 2PSXA 2D8WA 3GY7A 1GPZA 3B8JA 3KQCA 1BTWA 1BBRE 4NG9H 3VB3A 1TMUH 4TY7A 3SV6A 3P70B 1WV7H 1TRNA 2OD3B 1MAYA 4UFFH 1P2IA 5FBEA 1TGSZ 3GDUA 3IWMA 2C90B 4DVAU 3KN2A 1PFXC 1BHXB 2PFEA 4AGKA 4NSYA 2BMGB 4K1TA 2O8MA 1GBBA 2TBSA 4AOQA 5K7RA 4KGAA 3U1IB 5GWZA 1RJXB 2K1QA 1UJ1A 2H5CA 3RXQA 1AY6H 1VJ9U 2FI4E 2VIQA 5JPMH 1O39A 2OINA 3V0XA 5JB9S 5L2YH 1GI7B 2B7DH 7LPRA 2OUAA 3C27B 2SGPE 1SGQE 2ZTYA 2C4FH 3AVZA 1KXDA 3BTDE 1FN8A 1V2PT 1XUGA 2FP7B 1THSH 1SI5H 2XBXA 3PMHB 3QLPH 3BTKE 2FEQH 4KELA 3EAJA 2RCEA 3P92A 5HYOA 2HPPH 5L2ZH 1TPOA 1GI9B 1QURH 1SFQB 4Y6DA 1T8LA 4MDSA 3UFAA 3U8OH 1W11U 3ZZ7A 4A92A 1AWFH 1BQYA 1SPJA 1TRMA 2A4OA 2QXJA 3ODDA 2C8XB 1DANH 1HAYB 4LXBH 1QL8A 2BOKA 2GGVB 2GCTC 3VPKA 4IGDA 4DURA 1OP2A 1Z71A 2CMYA 1LHDH 2VJ1A 3A88A 4JZIA 1ZMLA 3A7YA 1LPZB 1EJMA 4CBNA 3RU4T 1AKSA 4YT7H 2GZ9A 5LGOA 2G52A 2JETC 2VGCC 1C5YB 3TH2H 1QR3E 3FP7E 3UIRA 3UUZA 1RIWC 5C1UA 1OWJA 3ZVBA 1ELBA 1FDPA 1GBDA 3SZNA 1KXBA 1D4PB 2BVXH 5T3HA 3VXEH 2BTCE 2OC0A 2ESTE 3S9BA 4A1TA 1VJAU 1GBCA 1S0RA 1BRAA 4X1SU 1P8VC 1C9PA 1LVOA 1PPEE 1G30B 4K2YA 3EDXB 3K2UA 3O8DA 1F5LA 2BDHA 1W10U 4X1NU 2BD5A 1PQ8A 2ZPRA 3S7HB 2VIVA 3BF6H 3K6YA 2GT8A 2BHGA 3K65B 3T62A 2ZGBH 4U32A 1MTWA 2SGAA 3RC6A 2AS9A 1FI8A 3PWCA 4YM9A 3HK3B 2XWBI 1TPPA 3A83A 3LC3A 1QB9A 2C3SA 2BD2A 4UONA 3RM2H 1V6DA 2ODQA 3AW1A 4FUIA 2BD8A 5EW2H 1GMHG 1O33A 1FY5A 1ZLRA 4E06H 1LPGB 1BTHH 1NRSH 5J4SA 4AB8A 1G2LA 4YZUA 4ABEA 2VVUA 1AE5A 1FY8E 1X7AC 3RMLH 1MU8B 2ZO3H 3FANA 9LPRA 3RXBA 1J8AA 2BVRH 4I8LA 2Y7XA 1O34A 3BV9B 2QXIA 1G9IE 2R9PA 1KSNA 2A7CA 1NESE 3LGUA 5TCAA 5GDSH 2TGPZ 5A0AE 1P10A 2I6SA 2QYIA 3GISB 1TNGA 2AIQA 3AASA 4OGYA 2ZU3A 2DE9A 1Q31A 4GSOA 2J2UA 1GI1A 5FPYA 3HK6B 4ZHMU 3LC5A 3V3MA 2V0BA 4ABGA 2TRMA 3E3TA 1MH0A 1EAWA 1MQ5A 4MPXA 2GV6A 1QJ6B 3BN9A 3QX5H 2ZWLH 4WMFA 4K1SA 2Q6FA 2PR3A 1O35A 1ETTH 4Z0KA 1ZJDA 2WV5A 1IAUA 1V2UT 1FV9A 1V2JT 1KDQB 3T26A 3M36A 3ZZ8A 5E0HA 1SGRE 1IHSH 5DP5A 4RKOB 3SJIA 1VGCC 2HOBA 5L6NH 4Q2KA 4NFFA 1P9UA 2Q6GA 1O3GA 3ZZ5A 1N1LA 4HTCH 1XUHA 2I6QA 5T6DA 1V2NT 4WH6A 5EXMA 1LQDB 3L3TA 1O38A 1EQ9A 3RXUA 1GJ7B 2PHBA 1UVOA 4K8BA 2Q1JA 3MFJA 4NIWA 1D3TB 1VITF 5DP6A 3A87A 1EP6A 4NIXA 2PKAB 1LMWB 4A5TS 2P94A 1O3FA 4GAWA 1GI5A 1GBIA 3SV7A 3M37A 1A0HB 1O3JA 2A45B 1QRZA 2GCTB 4OGXA 3GCOA 1K1JA 3RXVA 1K9OE 2J38A 1OP0A 5EPNA 4PROA 2Z3DA 2GMTC 1VITH 3E6PH 4K8YA 1SLVB 2ZFRH 1DITH 1P02A 4MVNA 1B5GH 2JETB 2VGCB 1ZPCA 3D65E 3RXCA 1DWEH 1RIWB 2ZU2A 2Z9IA 4OS2A 1AU8A 1BDAA 1T4UH 2QF0A 3AW0A 1HLTH 2B8OH 1GHBF 3LJJA 3PLKA 3T27A 5F8ZA 3O8BA 3PROA 1K22H 2XC4A 1GMDF 3SN8A 4BXWA 1GJ4H 1O32A 2XXLA 4ABBA 2PWXA 4KTCA 3A82A 3T2NA 2FYQA 3TJNA 1C1QA 1D3PB 3I77A 4FU8A 3VXFH 1OWDA 5DJ7A 4F49A 1CA8B 5HMAA 1SGFG 2FS8A 2GX4A 2WINI 1BRCE 3A8CA 2FXRA 1EP5A 1C1NA 5GCHG 2BQ7B 1Z8RA 4GUXA 4JYTA 3RXRA 4K3JA 3SI3H 1YPGH 4JZFH 3VB6A 1DXPA 1IQLA 4CH8B 1PPCE 1V2KT 2CF8H 3EA8A 3SOSA 2OTVA 1GJ8B 4BAKB 2BY7X 2HALA 2O9QA 1JRTA 4Y0ZE 1RRKA 1Y5AT 1MU6B 2BZAA 2QXHA 4D7FA 2UWOA 4B2CA 1T31A 2HNTC 1SGCA 3RXGA 4CR5A 5JBAS 1S81A 1YCPM 3UQVA 2ZQ1A 2VWOA 1O2UA 3QTOH 1O2PA 4ZMAH 1O2TA 2PTNA 2QCYA 2B5TB 1KLIH 2VIOA 1UTNA 4TPIZ 1F5RA 4I7YH 3Q00A 3SO3A 1YF4A 3FP6E 2G4UA 2FTMA 4ISOA 1V3XA 1YC0A 3URDA 1GHXH 2ANWA 4BAMB 3LKWA 1UCYE 3FAOA 1MBQA 2FZZA 1IQFA 1VGCB 1ZRKA 1EB1H 1YPKH 2THFB 1O3KA 3PMBB 1UK4A 4D7GA 3GCTF 3HKJB 1C5SA 3SUFA 4TY6A 5E2OA 4O3TA 4R0IA 3NWUA 4INKA 1UTPA 1ELAA 3JZ2B 2XCFA 5JB8S 4TPYA 1FNIA 3STIA 3PV4A 3A7XA 1P57B 1SGTA 1S83A 1RFNA 1CA0C 4Y8ZA 1WTGH 2HNTE 2R0LA 2FX4A 1MZAA 1ACBE 4AYYB 1DDJA 1O2RA 1SB1H 5EPYA 2GP9B 2GMTB 4B74A 4WJG2 3R0FA 1CU1A 3KNXA 2VINA 2A7JA 1TX7A 2W26A 1DPOA 1N8OC 1O2KA 3GYMA 1V2QT 3E8LA 1GJDB 1ZSKA 1BMAA 1C2LA 1ZZZA 2CV3A 1FY3A 2G51A 2SGFE 1INCA 1EAIA 2BZ6H 3FZDA 1YCPH 4CRFA 4Y0YE 1A5IA 5GPIB 1W12U 1FJSA 4FXGH 1DWDH 3T29A 4LZ4B 1B0EA 1A61H 4BTUB 1RTLA 4UDWH 3P8GA 1TABE 1ELCA 2AGGX 2XBYA 3SGQE 3M3VA 1XXFA 1IQJA 1G36A 2P3FH 1BMMH 4R8TB 6CHAC 5T6GA 3UNRA 3MH6A 2SGEE 2TGDA 2R0KA 1HJ8A 4YOJA 2F3CE 4DY7B 2H9EH 1IQGA 1WAYB 3P17H 8KME2 3HATH 1L4DA 3I29A 1HUTH 3SUDA 5DG6A 2ZHQH 1TGCA 5DP7A 1O3AA 2EI8A 1GL1A 1OP8A 2ZDVH 1O3DA 1YLCA 1GHZA 3LH1A 1O2HA 4Q7XA 1O2IA 4CRDA 3EA9A 1V2RT 2Y5FA 1YYY1 1TE0A 2WPJS 2CF9H 4AORA 2V3OH 4CRCA 3ZYDA 1EXFA 2JH0D 2Z7FE 4YTAA 2UUYA 1J17T 2EI7A 1HPGA 3ESTA 3QUMP 1P9SA 5A0BA 1A1RA 2OCVB 2WV4A 4HFPB 1MTSA 2BDIA 1TWXB 2WPHS 5A8ZA 1K1MA 5EQSA 3FP8E 5GXPA 1C2FA 1C5QA 2OLGA 1K1NA 1AVXA 3MNCA 1CSOE 2A5AA 2BY6X 3SJKA 3DT0H 1TNLA 4B75A 1RGQA 4WF8A 3TJVA 4FU7A 4ZXXH 2Z94A 2BDAA 2EEKA 3MOCA 3E91A 2FOGA 5E0JA 1IOEA 2W3KA 5DO4H 1EAUA 1ARBA 3LU9B 1PYTD 1F2SE 3GY5A 1DT2A 2F9PA 1NFXA 1H8DH 4Y7BA 1LHFH 2IJOB 1DWBH 3B23B 1K1PA 3BTHE 3NPSA 2FI3E 2FS9A 1CA0B 3U69H 3OSYA 3CENA 3DUXH 2WYJA