1O3IA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3iA02
1AKSA 1C2DA 3RM2H 1N8OB 2A4RA 5F8ZA 4ABFA 2ZFSA 1A3EH 1A61H 1SQOA 1TMUH 2OUAA 2AMQA 2F83A 2QY0B 2R2MB 1HAVA 7GCHG 1K1JA 1EZQA 1GI0A 1CHGA 1TGNA 4MNWA 1TLDA 2A4OA 1C1WH 3GCNA 4A92A 1EPTC 1GHBG 2FS9A 1ETSH 3SGQE 1DT2A 1GBEA 5GCHG 2R0KA 2RA3A 2Z6BD 1C5MD 3S9BA 3M7QA 4MQAA 3PMAB 4XBBA 4BXWA 1J17T 1FY3A 1EAUA 3KQEA 1KTSB 3A80A 1O3EA 1P09A 1GDUA 1D4PB 1O39A 1EB2A 1O3OA 2PGBB 4CHAB 2XBXA 2UUKB 1NTPA 1ELBA 3ZZ5A 1H9IE 3EA7A 1MAXA 1UK4A 2ZNKH 3U69H 1OWHA 4BOHA 1GBAA 1SC8U 2Y80A 2DE9A 1O5DH 1AIXH 3FAOA 3OY5U 1MKWH 5LPFA 4CR9A 2UWPA 3Q3YA 1TNKA 1A5HA 1MD7A 2PUQH 2ZDAH 3SGBE 3F68H 1Y3YA 4KTSA 2QCYA 1HRTH 4CRDA 3SBKA 1P11E 1GI7B 2FIRH 1TBQH 1Q31A 1C4U2 1CT4E 1ETTH 1AO5A 2Y7XA 1C5YB 1ID5H 3SJOA 3MMGA 2WPLS 4B1TA 1PPGE 2GZ7A 4MPUA 4BNRA 3KNXA 4A5TS 5T3HA 1SOTA 3MHWU 1QGFA 2BTCE 3SOSA 2Z3CA 1L1NA 1P2OA 3VB3A 4B2AA 1ORFA 4DW2U 1S6HA 5HM9A 2ZPQA 1LKAA 1FPCH 4AFUA 1ZSLA 4ISIH 1PQ8A 2ANWA 2ZDMA 4ABDA 4NFEA 5C1UA 4AB8A 2VNTA 2J94A 3L33A 3VGCC 3LDXH 1W0YH 2J92A 2C93B 1EZXC 5PTPA 1V2VT 1FJSA 1TOCB 1MTWA 2BD4A 2O8LA 5A8ZA 1NY22 2XRCA 3I77A 3TH2H 2Z3EA 3SJ8A 1JRSA 1EX3A 2CMYA 2Y5HA 2QN5T 1XVMA 4YZUA 3K6ZA 4YLQH 2OLGA 1SGEE 3BTFE 3QUMP 1UHBB 2FLRH 3OTJE 4RN6A 1C4Y2 1W11U 1VZQH 1EAIA 7LPRA 1WQSA 3NWUA 5EXLA 1HIAA 1UHBA 1ZPZA 1OOKB 1YP9A 1SGYE 2GT8A 2W3IA 1ZMJA 1D3PB 1NC6A 4IN1A 2G51A 1S83A 1O30A 5BPEA 4H6SB 1C1QA 1GJ4H 2IOTA 1EZUC 1O2XA 3GY8A 4BAHB 1YPKH 1YLDA 3TH4H 1O2UA 3S7KB 2Y7ZA 3QZRA 3OU0A 1PPEE 1WTGH 3ZV8A 4BTIB 4I33A 1XUHA 2A4GA 4WMEA 3F9FA 2P95A 1GMHF 3SU2A 2TGAA 1MCTA 3PV4A 1NESE 1ZSJA 1JMOH 1AU8A 3MNCA 4FUJA 4IBLH 1NFUA 1V3XA 4Z6AH 5ABWA 1T4VH 1IQKA 3MTYA 1DM4B 2KAIB 1PQ5A 2GVFA 4I8HA 2BY8X 3BG8A 1BBRK 2ZKSA 1P02A 4GAWA 4HGCA 4MVNA 1TRNA 2A7CA 2XCFA 4JZDH 1ANBA 1S0RA 1C1OA 3QDZB 3M5MA 3RXQA 4GHQA 1CE5A 1ZJKA 1KSNA 3B9FH 4MDSA 1VJ9U 2ULLA 3TGIE 3LJJA 3NXPA 2H6MA 3EAJA 4AGJA 1P04A 3JZ2B 3HPTB 4AN7A 3U1JB 1K21H 1QL7A 4U32A 5GDSH 3A81A 2UWOA 1ZLRA 3RU4E 1HDTH 2ZP0H 1GI3A 1O2RA 1SGFA 1UTPA 3KQCA 1THRH 3P8GA 1HAIH 3U8TH 3BTGE 5E0HA 4K8BA 5DK1A 3ZZAA 3B8JA 2OQ5A 3A7ZA 4DY7B 5EU8A 1TX7A 2PLXA 1TNGA 4X1PU 2RDLA 3E8LA 2A7JA 2SGEE 2PTNA 2V0BA 4K3JA 3GY5A 4J1YA 1O0DH 3BG4B 4FUGA 5GWZA 2ZCLP 3HGNA 1G3DA 1ZRKA 1O37A 4CRCA 3VXFH 3A83A 1FY5A 5EW2H 3KQDA 3Q00A 1S82A 4HI3A 1QRWA 8GCHF 2ZHDA 4K69A 1KLIH 3BSQA 2AGGX 2LNCA 2O8UA 3QGNB 2CHAC 5B6OA 1P8VC 1TA6A 1TMTH 1UTOA 1DVAH 3D23A 4UFGH 4TYDA 3M7UA 6ESTA 4F4OC 2R3YA 2ZU3A 1BT7A 3BF6H 2OP9A 3FP6E 3M5OA 3QO6A 4HZHA 3O8BA 1T8LA 3BEIB 2ZDVH 2C8ZB 1GMDG 1OYQA 4K2YA 1NO9H 1AMHA 5LPEA 1L4ZA 4Y11E 3ELAH 2DUCA 3CS0A 1OP2A 3OX7U 1LVOA 3K2UA 1XM1A 2GP9B 3PWBA 2FX6A 1JBUH 1SLXB 4YTAA 1A1RA 2OBQA 1KIGH 2ZEBA 2VINA 1MU8B 1DS2E 4ZHAA 2ZCHP 1A2CH 1ELFA 1ELCA 4ZHLU 1GBJA 1TRYA 5L30H 5C1YA 4IMZA 3TGJE 2FYQA 2D2DA 1LHDH 2PSYA 1THPB 2BQ6B 1W12U 1ZRBA 2R2WU 3F9GA 4JZIA 5EXNA 3A86A 1PPZA 3PWCA 1KXCA 1TPOA 1NU7B 5C5NA 3EA8A 3ZZ8A 1IQIA 3RXTA 1XXDA 1QQUA 4X8VH 1O32A 1UTJA 2YNBA 6GCHF 5CHAC 1TPPA 2WYJA 1K1OA 1GJBB 2P8OB 2ZFPH 2ZTXA 4Y7AA 1GBIA 3LPRA 4WVPE 2FWWA 1O3CA 2VJ1A 1LMWB 3UY9A 4ZHMU 1SB1H 1ZGVA 3F9EA 3UIRA 3RC4A 2ZIQH 5GIBA 1C5OH 2TPIZ 3GY2A 4FVBA 3E6PH 5FCRA 3ZVBA 1Q3XA 1OWJA 1V2RT 2TGTA 2ZPRA 2Z9JA 1O2GH 1D9IA 1KYNA 1CBWB 1UTLM 3I29A 3RXFA 3N7OA 1HUTH 3P92A 1O2ZA 2QAAA 3NUMA 1C5TA 3MU4A 4IC6A 1C5PA 4NZQA 1TA2A 2F3CE 2G81E 3RM0H 1LQDB 1F5KU 5L6NH 3OYPA 1P10A 1D3DB 4X1NU 3QTOH 3FANA 1FI8A 1O2MA 3ZVEA 1W3CA 1CU1A 4ISLA 1MH0A 4XFQA 4TY7A 3RMMH 3EGKH 3RXRA 1Y59T 1YGCH 4B75A 1EKBB 2FI5E 2VVUA 1Y5BT 1RD3B 4U2WA 3TVJB 3ATLA 5K0HA 1O31A 3RLYH 2DE8A 1XUGA 1CQQA 2QA9E 3SO3A 4UONA 2ZU4A 1GBLA 1IOEA 2AMDA 1DSTA 1P9SA 1K1IA 1TNHA 1MTNC 1UTQA 5C5OA 4CRGA 1P03A 4BXSA 1O2QA 1F0TA 2W5EA 1S5SA 4I8LA 1NPMA 5JB9S 3ZZCA 1HAZB 3TLOA 1F5RA 1QRZA 9LPRA 2F9PA 3TK6A 5DPAA 3F1SB 4E05H 1GG6B 1GJCB 4RKJB 3U9AH 4BAQB 4H4FA 2PKAA 1BMAA 5EOKA 5GPIB 2FOAA 1SL3A 1YKTA 1MZDA 2ODYB 1DSUA 1Y3VA 3UPEA 3S7HB 4WY3A 4CREA 2BY9X 2FOMB 3R0FA 1SLUB 1SBWA 2QXGA 1TRMA 5L2YH 2PUXB 2OQUA 1GGDB 1LHEH 5EQQA 1FN6A 1TGSZ 4IGDA 2ODPA 1WBGB 1O3NA 3U8OH 5JBTA 1SQAA 4JK6A 1QB6A 1ESAA 3VB4A 1KXFA 5AFYH 2O8WA 1NZQH 1SLVB 2UUJB 3WY8A 3E16B 4UE7H 4DVAU 5DG6A 1O2TA 5EXMA 3UTUH 3SUFA 8ESTE 3FZDA 4X8UH 4Q80A 1BBRE 1TNLA 2ZU1A 3E3TA 4UDWH 1FQ3A 3RXVA 1NRSH 2BD3A 1EB1H 4O9VA 1HFDA 1TMBH 5F8XA 2A32A 2ZTZA 3UWIA 1EPTB 1P2MA 1QCPA 2C3SA 1GMCF 3B23B 4Y76A 4NIYA 1YPMH 1BTYA 2BD2A 2FTMA 4OGXA 1V2QT 1WQVH 1BTXA 1Y5UT 3M5LA 1WSSH 1GI4A 1N6XA 3C1KA 2HPQH 1F92A 1G2MA 3GY3A 4NA8A 4HFPB 2FTLE 2FX4A 1ELAA 1GBHA 2Z94A 1QB9A 1MKXK 1MTVA 3GCTF 1PYTC 3SJIA 3AW1A 2FI4E 1AZZA 3BTDE 1JXPA 1QR3E 2I6SA 3VFEA 2STBE 3LGVA 3KCGH 4GCHG 3BEFB 1NFWA 2GD4B 1RRKA 2IN2A 2PKSC 1UK2A 1VCQA 4KTCA 3RXBA 1G2LA 1B0FA 4FVDA 5T6GA 2AIQA 1C5SA 4ASHA 1Y3WA 3SNAA 2WUBA 1GBMA 1XUIA 1O3DA 4D7GA 1O3IA 1QBNA 1KXDA 2ILNA 1KXAA 1MBMA 4AYVB 5DP5A 2XWBI 3SV8A 3CENA 5DP8A 1Y3UA 3V7TA 2P3FH 5AVDA 1SFIA 2FOBA 2QXJA 1PPHE 2FS8A 4GLYA 3GCHB 1EQ9A 1OX1A 3ATIA 1Z6JH 5DP3A 5FX5A 4LZ1H 1AE8H 1O2LA 1TPSA 5HMAA 1C2KA 4OS1A 1KXBA 2G4TA 5DP9A 2D1JA 1XVOA 1FAXA 4ZAEA 1NU9A 1RIWC 1QB1A 3P8FA 1ZYOA 4OS5A 2GMTB 1ZMLA 3VGCB 3RMNH 1V2UT 4VGCB 3UR9A 2GKVE 4DOQA 6LPRA 2BDGA 2UUFB 4CBOA 1J8AA 2VIVA 1C5QA 3FFGA 2C4FH 1AGJA 3ZVDA 1BOQA 4D9QA 1L0ZA 1ARBA 1QRXA 2H2ZA 3W94A 1O33A 2ZQ2A 1HXFH 5EG4A 4THNH 1N6YA 1PQ7A 5EQSA 3IWMA 2BMGB 3K9XB 3Q77A 2BY5X 1QA7A 3CP7A 3VB5A 3K6YA 1SGIB 3UR6A 2R0LA 1XUFA 3O8DA 4TWWA 1P06A 3JZ1B 3SU1A 1FY4A 1TNIA 1OPHB 2CV3A 4X6NA 4B2CA 1UO6A 4CH2B 1DLKB 4NGAH 3S69A 2G55A 4TPIZ 2P93A 1CSOE 3M7TA 4FUBA 1O5CB 1UK3A 1EATA 3RMLH 2AH4X 1WYKA 4Q7XA 2HGTH 1EJAA 1G3EA 3UNRA 3MNXA 1K1LA 2GDEH 1T7CA 3RXIA 1MUEB 3PMBB 1XKBC 4MPVA 5ESTE 4CRFA 2EC9H 3A84A 5DKMA 3ZVFA 3T28A 3BTQE 2QGRA 1A7SA 1B5GH 3SU5A 3LGYA 1G37A 4INHA 4ESTE 1GHZA 4Y0ZE 4CH8B 2OC1A 3MFJA 3KIDU 3E0PB 2M5TA 4PROA 2QXIA 2YOLA 4NCYA 3BTTE 2QC2A 2RCEA 3F9HA 3ZZ3A 5JBAS 1JOUB 1THSH 4INLA 4CRAA 1BIOA 1GCTC 4OS7A 3M5NA 4MPWA 2BD8A 2JETB 1K28D 1ZR0A 1AFQC 3EA9A 1C1SA 3T62A 5DP4A 5C2ZA 1TYNA 1FY8E 2ZA5A 4U01A 2NU2E 4ABJA 1EAXA 1BZXE 2A4QA 5K7RA 5GJ4B 2SNVA 5FBEA 1V2WT 1N1LA 4FUDA 4D8NA 1SGPE 3CS7A 1BQYA 4AYYB 1HB0B 1OP0A 1DY9A 1S85A 2C90B 1TWXB 3M3SA 1SOZA 1F2SE 1MZAA 1TBRH 2XNIA 1P2QA 3E1XB 1OS8A 3ATWA 1O2OA 3P8NA 2ZO3H 3U98H 2CGAA 1DFPA 1GHVH 1TALA 2A0QB 4DIHH 1VGCC 2FO9A 1CGIE 3U1IB 6CHAB 2QYIA 2XCNA 3ODFA 3UOPA 1H4WA 4UEHH 1C1RA 1TAWA 2ZGBH 2PHBA 2VH0A 3ITIA 5EW1H 2GZ9A 3S9AA 1OSSA 1C5UA 3E0NB 3PLBA 1W10U 8LPRA 2VGCC 1BHXF 2Y5GA 2F9UA 3LGWA 3FP7E 2VWMA 3M36A 1C2JA 2B5TB 1HLTH 5JDUB 1C1PA 3BTME 1EASA 2P3TB 2ZF0H 1ELTA 1A5GH 3PMHB 4RKOB 2BLOA 2ANMH 1T8OA 2FESH 3A8DA 5CMXH 4J2YB 3SORA 5AHGH 3URDA 4SGBE 4FU8A 2A1DB 4I8JA 1KY9A 1Z71A 4TWYA 1GI6A 4JYTA 1N8OC 3GYMA 1G36A 1GI8B 1H1BA 3I78A 1SGNE 3QN7A 1QY6A 3SHCH 1HAHH 2YNAA 2BXUH 3MH7A 2G00A 4FU9A 4BAOB 2W7UA 3LKWA 1EJNA 4NZLA 5TCCA 1GDQA 1BBRH 2WV4A 3SNBA 3LGUA 4BANB 4YOJA 3BEUA 3MH6A 1RXPA 1VITF 3V3MA 3P6ZB 5A8XA 1GHWH 2BZAA 4NA7A 3AASA 3TNSA 1F0UA 1SG8B 2NWNA 3VPKA 2A5IA 2OBOA 1FMGA 4A7IB 5CHAB 4B71A 3DFLA 2ZGXH 2KAIA 4XBDA 1D6RA 1Z8IB 1BJUA 4H42U 1VR1H 2OD3B 1ARCA 4CHAC 4AG1A 3H5CB 2VVCA 1BTWA 2TGDA 2ZGCA 4FUHA 2WYGA 1V2KT 1DDJA 2Z7FE 1ANCA 2F9OA 3SI3H 3SQEE 1ZTJA 7GCHF 1O2HA 2BY6X 4E7NA 5GXPA 4FUFA 3GISB 2VIOA 1BRCE 4KKDA 1SR5C 2G4UA 2THFB 1C1UH 3A7YA 5IDKA 1GHBF 1TX8A 1K1PA 2TIOA 3A8BA 5J4QA 5GCHF 3DT0H 2FDAA 1NROH 1GBFA 4JZEH 5F6MA 1ELGA 2W3KA 4WMDA 1SGDE 4X6OA 2V3HH 3L3TA 4A1VA 4BAMB 4AG2A 4OS6A 2GV6A 3SW2B 4IMQA 2BHGA 2BD7A 3M37A 4X2YA 1UVSH 4FXGH 1CGHA 3RXHA 5E0GA 3K65B 3TH3H 4OGYA 1E35B 5AFZH 1W7XH 2H5CA 3SN8A 3V0XA 4Q2KA 3A7TA 4ZXYH 2A45B 3LJOA 1UTKA 2GCHG 4X6MA 1C2LA 1IQJA 4X8SH 2BLWA 3QK1A 3PO1B 1CHOF 1HAPH 1K1NA 1LO6A 5HGGA 1Z1JA 3SNDA 3LC5A 3ODDA 1GHAF 1NM6A 2BQWB 4IW4E 4YOGA 5EPNA 5FPYA 1P05A 1ZJDA 1AVGH 3ZV9A 2QIQA 3UUZA 1L1JA 1UVUH 5CE1A 2GCTB 1O2WA 1ZPBA 1Y3XA 1ZGIA 3GY6A 1EAWA 1C2GA 3P70B 4A6LA 1TBZH 3RXLA 3NPSA 1VCWA 2XBVA 1U6QA 1YCPK 1TFXA 1FNIA 3M3TA 2C8WB 3ATMA 3SQHE 1GVZA 3M61U 2FLBH 2VVVA 4NA9H 1CVWH 1WU1A 4NWLA 4YOIA 2D8WA 3SU3A 3KGPA 1GL0E 3TNTA 1ABJH 4AX9H 1HJ9A 4ISOA 4XSKU 4YESB 1MBQA 3RXKA 2PGQB 1AN1E 5DGJA 1BUIA 1RTLA 2AERH 1H9LB 1QTFA 5I46H 2G5VA 2ZGHA 1ZHPA 5JBCS 3RMOH 1KDQB 2O8TA 2GTBA 4FU7A 3SZNA 1VJAU 4NIVA 5A09A 1ELDE 3AAUA 3UNQA 3PTBA 5FAHA 1P2NA 1G3BA 1RFNA 2ZFTA 3A87A 3UQVA 1BMMH 2CF9H 2F9NA 4XE4A 1YPHE 2Z9GA 1IQHA 4ABHA 1T4UH 1K9OE 2AFQB 4FUEA 2ODQA 1SGFG 1W7GH 1UTNA 4X6PA 1UTMA 2XBWA 1C1NA 1DE7H 3H7OA 4YT7H 3TGKE 2A7HA 2XC5A 3HK6B 2FI3E 4CRBA 2EA3A 2FXRA 1V2MT 4MPXA 1O34A 2HNTE 3H7TA 1NRQH 1A4WH 1V6DA 7KMEH 1HJAC 2ZFFH 3GY7A 1BHXB 1TIOA 2HNTC 3Q3XA 1V2OT 2PKSB 1WOFA 1C5NH 2GDDA 4I32A 1HAOH 4Y8YA 1ESTA 3A7XA 4Q7ZA 1JIMA 4YO9A 4UD9H 4Y6DA 1CA8B 2Y81A 3KF2A 1CGJE 4QT8C 2BDAA 1A46H 1RS0A 2FOCA 1GHXH 1TQ7B 1SLWB 3BG4C 4Y8XA 1O3MA 1JRTA 3UFAA 2PSXA 4AGKA 1C2MA 1O3HA 2FM2A 2WPMS 3RXCA 4BTTB 1LCYA 1CA0B 1YPEH 2VIWA 3RC5A 1FIWA 4Y71A 2OC7A 1QHRB 1C9PA 1BJVA 1NN6A 3M35A 1T8MA 5EQRA 3MU0A 4ZXXH 3ZVGA 3SI4H 1RIWB 3KQBA 2PR3A 5T6FA 1MMJN 1ZOMA 3SJKA 1O2KA 2FZZA 1LVMA 2C8XB 3RXMA 9ESTA 1UCYK 1UVPA 1DWBH 1KTTB 2ZU2A 2Z9LA 2CJIA 1ANDA 5EGMA 5LGOA 2R9PA 1LPGB 1WAYB 2VWOA 3BTWE 2ALVA 3TJNA 5LPRA 1C2IA 3VB6A 2AMPA 1EUFA 1LHCH 1XX9A 2G5NA 1ZMNA 1JWTA 3DHKH 3SU4A 3TK9A 4R0IA 4ABAA 1DITH 1G3CA 2BVRH 1TGTA 1H8IH 1UMAH 2AEIH 5JBBS 2XWAA 1QNJA 4LOYH 3C27B 1E34B 5L2ZH 2OC0A 3GYLB 3VB7A 2BXTH 4JCNA 1SFQB 4WMFA 1O3JA 3T26A 3LIWA 1BDAA 2OINA 2BDIA 3RXPA 1ACBE 5TCAA 2FOGA 1HJ8A 1DXWA 3P95A 1MKXH 1NS3A 4Y0YE 2PFEA 1GMDF 4JYVH 1EPTA 1SHHB 1RTFB 3RXJA 2Y6TA 4ABEA 3MU8A 4Y10E 1V2TT 2H9HA 3T5FH 1ZTLA 2BVXH 1FUJA 1TX6A 3S0NA 5A0BA 2PW8H 2V35A 3AW0A 1PFXC 2B0FA 1OKXA 4GSOA 2NU4E 4NSVA 2SNWA 3NCLA 1FONA 3SNCA 5E8EH 2BB4A 2TGPZ 1BA8B 2NU1E 4O97A 4MLFB 4K1TA 1HAXB 2ZGJA 3EDXB 4GUXA 1CBWC 1Y5AT 1LDTT 3W95A 2NU0E 2P59A 1P2KA 1MTUA 4KTUA 1GCTB 1KLJH 4XBCA 1AFQB 2ZZUH 2I6QA 2SFAA 3A89A 4WH8A 1A0HB 1AZ8A 3QGJA 1GJAB 1PPFE 1TNJA 2HALA 1V2ST 1F0RA 1LVBA 4K8YA 1GHYH 2AIPA 4X8TH 3PMJA 4K1SA 3FZZA 3T27A 2J2UA 1ETRH 2FP7B 5C67A 5EPYA 5F03A 4ABIA 1TGBA 4FUCA 3A7VA 4Y7BA 2H1UA 2JH5D 1QJ7B 1BTHH 3RXDA 1YC0A 1LPKB 3MO9A 2ZU5A 4X1QU 5FXLA 4K1EA 4M7GA 2G52A 1O2IA 1P2JA 1P12E 4OS2A 2EI7A 2F9BH 1Z8RA 2WPKS 4FUIA 4YLUA 1GL1A 1GMHG 1SPJA 2H9EH 1E37B 1IHTH 1VITG 2VB0A 1HAYB 2BOKA 4AORA 1NRRH 3A7WA 2VGCB 3SHAH 3ZYEA 3RU4D 2H5DA 1W14U 3U8RH 4B74A 1C9TA 3EQ0H 3NK8A 2ESTE 4X2XA 2W7SA 1SGQE 3V12A 3A8AA 1O5BB 3FVFB 1FPHH 3OY6U 5C1XA 4ZKNU 3LU9B 2AGEX 1UJ1A 4DT7B 2TRMA 2A2XH 1OP8A 1AB9C 3PM3A 2Y5FA 2ZFRH 2VIDA 3LH3A 3QX5H 1HAVB 5SGAE 3QTVH 1GI9B 3BV9B 1GI1A 4X2VA 3LOXA 4DIIH 1BB0B 1E36B 1FZZA 2HVXA 1W13U 1GJ8B 2VWLA 2QXHA 2SGDE 1OYTH 2K1QA 2XC0A 5HYOA 1HNEE 3URCA 1SMFE 2WV5A 2D26C 1GDNA 3MNBA 4XDEA 1O2PA 1YPGH 5HXFA 1PJPA 1J16A 4WXIA 4Q7YA 1DWEH 2BVSH 2BD5A 2BOHB 1P2IA 2HWLB 1C5RA 4GPGA 3LC3A 3SUGA 3UOUA 4YM9A 3MWIU 5JYIA 8GCHG 2RA0A 4ABGA 4ZH8A 1O3FA 5E2OA 2WUCA 3Q76A 3NZIA 3MH5A 1V2NT 1SI5H 3ZVAA 1FDPA 2BX3A 2OXSA 3UQOA 3QWCH 3ZZ7A 2AYWA 2XC4A 1A3BH 2WPJS 3BTHE 3PROA 1O3KA 4X2WA 1ZPCA 1EZSC 1GJ5H 1HCGA 1Z8JB 1CHOG 2ZHEH 3QZQA 4A1XA 4NSYA 5FX6A 1GHAG 3GDVA 1BTUA 1YPJH 2BDCA 4NIWA 1BCUH 1V2JT 3EE0B 5C3NA 1MKWK 1D3QB 3PYHA 3GCHC 2BQ7B 5E0JA 1RJXB 2Y82A 1JIRA 3IITA 2W26A 1CO7E 3D49H 1UCYE 3MYWA 3HATH 1BRAA 1A5IA 2CHAB 1IQGA 5TJXA 3TK5A 5IYTA 2ZDNA 2FOFA 2O8MA 2ZQ1A 3A82A 3SJ9A 2QF0A 3LGIA 2OCVB 3BTEE 2GMTC 2PV9B 2Q1JA 4GCHF 4VGCC 4ZUHA 1CT2E 4YT6H 6GCHG 2B7DH 1XUKA 2EI6A 4H6TA 1AWFH 2OC8A 1P0SH 1BTPA 5C20A 5A8YA 2WPHS 4Y79A 1M9UA 1GVLA 1OWDA 3KEEA 2QV1A 1GBCA 5FBIA 3TIUA 1O2VA 4MTBA 3SU0A 1HIAB 1F5LA 1ZHMA 4GVUA 1XXFA 1DX5M 4MG3A 4KGAA 1AE5A 3VXEH 1C5ZB 1C2HA 1AD8H 2BD9A 3D62A 2HOBA 5FPTA 1ESBA 3TITA 2J95A 1Z6EA 2VH6A 1C1VH 1A0JA 1GJ6A 4B73A 1QJ1B 5DO4H 1IQFA 4IS5A 2O9QA 1Z7KA 1OWKA 4D9RA 1NFXA 1O5EH 1C2FA 1HPGA 3KN2A 3RUOA 2A2QH 1K2I1 3RXGA 7ESTE 1C5VA 1HGTH 2XBYA 2J9NA 2EI8A 4UFFH 3D65E 2BM2A 1EP5A 2Z9KA 1IQNA 3UWJH 2F9VA 4JK5A 3TJUA 1D3TB 2BX4A 2ZHWH 2V3OH 3SU6A 2GT7A 3RP2A 1V2PT 2VU8E 1LHGH 1LKBA 3ZYDA 1QQ4A 1K22H 1PPBH 2BDBA 1PPCE 1GBTA 3P17H 1AWHB 2B8OH 2JETC 2XXLA 4WXVA 1O5GH 4CR5A 2J38A 2JKHA 5J4SA 2P94A 1DXPA 3V13A 3PLKA 1FXYA 1X7AC 1ANEA 5JPMH 3GDUA 1HBTH 2EEKA 2J34A 3RLWH 1QL9A 1DWDH 1L4DA 1HJAB 3RDZA 1S81A 3O8CA 4WH6A 3LONA 4WF8A 2Q6FA 1O36A 1EJMA 5G4BA 3PLPA 1C5WB 3DFJA 1C4V2 1BTZA 1E0FD 3HKJB 4WJG2 3RXOA 1EP6A 1DPOA 1AFEH 4WWYA 1S0QA 1H9HE 2ZC9H 1O2NA 1MTNB 1QL8A 4AFQA 1MTSA 1S84A 6CHAC 1P3EA 2ZCKP 1O3AA 1PYTD 1B0EA 4AB9A 1P57B 2C8YB 1O35A 4DG4A 1G32B 3ATKA 1O2JA 2A5AA 1WUNH 2Q6DA 1VITH 4ZKRU 3MNSA 2SGQE 4CBNA 2ZECA 1YCPH 1GMCG 1LTOA 1Y8TA 4DGJA 5DJ7A 4ZKOU 1GVKB 1QJ6B 3SUDA 1FIZA 3BIUH 4AFSA 2HLCA 3MH4A 2SGFE 2JH6D 3Q3KA 3GY4A 3GCTG 3T29A 1GI2A 1P3CA 4O3TA 5A0AE 1AY6H 1RGQA 1TPAE 3KHVA 1FY1A 2VWNA 3GCOA 3SNEA 4B76A 3TJOA 3DUXH 3RC6A 1W2KH 1TE0A 3BN9A 1A0LA 2Z9IA 1YYY1 3PTNA 1L2EA 3E90B 2R3UA 1LVYA 2ZWLH 3KL6A 5BRRE 4XOJA 1XKAC 3F6UH 4ISHH 3A85A 1Z8GA 2HRVA 3AAVA 5FCKA 1YBWA 3HGPA 3MU1A 3SGAE 4GHTA 3SV6A 5ESBA 4TPYA 3SV2H 3HK3B 1TONA 3STIA 1UVOA 1SQTA 3MO3A 4ABBA 5LH8A 1C2EA 4JYUH 4B2BA 1DANH 2P3UB 1KDQA 1DOJA 3P8OA 5FPSA 2JH0D 2P16A 2XTTB 3BIVH 1AVXA 5A0CA 3TU7H 2FOHA 1H8DH 2ZPSA 3VEQB 1F0SA 2AGIX 1YPHC 2HPPH 4INKA 1F7ZA 2ALPA 1XMNB 1CT0E 1MQ5A 2ASUB 1SHYA 1ZHRA 1P9UA 1DLEA 5FHTA 1XUJA 1GCDA 3O8RA 1O3LA 2BY7X 1YLCA 1MQ6A 2Q6GA 1ZTKA 4U30A 4O3UA 1UVTH 3GICB 4ZMAH 1GBBA 1ZSKA 3MU5A 5EODA 1ZZZA 1K1MA 1KXEA 3MO6A 4Z0KA 1GWAA 2CN0H 3AVZA 3ZZ6A 3UREA 2ZHFH 1FN8A 1O2SA 3DA9B 4I8KA 3RXUA 1HV7A 1RTKA 1BRUP 2ANYA 1LPZB 1G9IE 1D6WA 2ZG0H 1HXEH 1W8BH 3RU4T 4I31A 1TGCA 3ZVCA 2GV7A 4DURA 1HAGE 1QFKH 4A1TA 2IPHA 4Y8ZA 8KME2 1UCYH 3T2NA 2A5KA 4SGAE 4TY6A 4ZKSU 2BDYA 4D76A 1MAYA 3RXEA 3T25A 1SVPA 1T32A 2TBSA 4F49A 5F8TA 1SGCA 4NG9H 4O03A 1C5XB 1BMNH 4UFEH 2ZFQH 1V2LT 2WPIS 2PTCE 2QF3A 4BAKB 2FPZA 2PKAB 1DWCH 3PO1C 4UFDH 1O38A 4BTUB 1AUJA 2IJOB 2FODA 1GBDA 5A2MH 1FAKH 1QA0A 1OWEA 3R3GB 2WINI 1MU6B 3FP8E 3SV7A 2CF8H 2GCTC 2FEQH 2BDHA 4AOQA 4DJZB 3TJVA 1DY8A 4JZ1A 4NFFA 1EOJA 5JB8S 2SGAA 4LZ4B 1GBKA 3M3VA 1FV9A 1SGTA 2OTVA 4NIXA 2GX4A 2J4IA 1AI8H 1O3PB 1GPZA 1C5LH 5HM2A 1AB9B 2LPRA 3ZZ4A 2VIQA 1C1TA 4X0WU 4K5ZA 1J15A 2BZ6H 3PB1E 4LK4A 1GI5A 2SGPE 1O5FH 5DP7A 2ZI2H 2GCHF 5ETXA 2FYRA 4R8TB 2P8OC 2BYAX 2ANKH 2A31A 3TPIZ 3QLPH 2GZ8A 2Z3DA 1EOLA 1AUTC 1O3GA 2ZHQH 1SGRE 1NFYA 1FLEE 2XW9A 2RG3A 1TB6H 2VIPA 5T6DA 1ELEE 4OS4A 1AQ7A 1IHSH 4MNYA 3SUEA 4AFZA 1NT1A 1TABE 1QBOA 1NRPH 1AVWA 1IQEA 4KP0A 1YCPM 1YF4A 2ZTYA 3G01A 1EXFA 2CXVA 1WTHD 3LT3A 2UUYA 4JMYA 4NWKA 1GJ7B 1PQAA 1GJDB 4ZROA 2STAE 1P01A 1VCPA 3RXAA 1INCA 5I25A 4I7YH 4X1SU 5AF9H 5H4IB 1OXGA 1OWIA 1Q2WA 3S9CA 1IQMA 1BRBE 3HKIB 1YPLH 2B9LA 1MD8A 5E2PA 4IN2A 1YM0A 2BLQA 3OSYA 2ZDLA 4K60A 3ENSB 2F91A 1ELVA 1B7XB 3EYDA 3A8CA 4LXBH 1IAUA 4KELA 2XYAA 2AS9A 3LGTA 4MNVA 4D7FA 2G8TA 4RSPA 1TOMH 1BMLA 2PWXA 1DUEA 1E38B 1IQLA 1J14A 4X1RU 4AZ2B 1C1MA 1AHTH 1HYLA 3IG6B 1CA0C 4DCDA 1G30B 1VGCB 4E7RG 3L6PA 1QBVH 1GJ9B 3MOCA 5DP6A 2ZDKA 1TQ0B 1QIXB 1GG6C 1S6FA 2BLVA 1LQEA 2H9TH 3LH1A 1KLTA 1QURH 2UWLA 3BTKE 3ESTA 3RXSA 1DUAA 1T8NA 1WV7H 3ZZBA 2HNTF 4E06H 3E91A 3MI4A 4HTCH 1J9CH 3ZZDA 2V6NA 3DD2H 1L1GA 3UNSA 1LHFH 2GGVB 1BITA 4I8GA 1Z1IA 1W0ZU 3STJA 4JZFH 1AKSB 2NU3E 3SV9A 1GGDC 4MNXA 3GOVB 1DICA 3ZZ9A 1NRNH 3NKKA 1T31A 4IC5A 1ABIH 2FOEA 1O5AB 1SSXA 1O2YA 3GDSA 1O3BA 3A88A 1MCVA 2FMJA 1WCZA 4ISNA
chains in the Genus database with same CATH superfamily
1AKSA 2CK3D 1C2DA 3RM2H 1N8OB 2A4RA 5F8ZA 4ABFA 2ZFSA 1A3EH 1WXRA 1A61H 1SQOA 1TMUH 2OUAA 2AMQA 2F83A 2QY0B 2R2MB 1HAVA 7GCHG 1K1JA 1EZQA 1GI0A 1CHGA 1TGNA 4MNWA 1TLDA 2A4OA 1C1WH 3GCNA 4A92A 1EPTC 1GHBG 2FS9A 1ETSH 3SGQE 1DT2A 1GBEA 5GCHG 2R0KA 2L6OA 2RA3A 2Z6BD 1C5MD 3S9BA 3M7QA 4HG6A 4MQAA 3PMAB 4XBBA 4BXWA 1J17T 1FY3A 1EAUA 3KQEA 1KTSB 3A80A 1O3EA 1P09A 1GDUA 1D4PB 1O39A 1EB2A 1O3OA 2PGBB 4CHAB 2XBXA 2UUKB 1NTPA 3F2FA 1ELBA 3ZZ5A 1H9IE 3EA7A 1MAXA 1UK4A 2ZNKH 3U69H 1OWHA 4BOHA 1GBAA 1SC8U 2Y80A 2DE9A 1O5DH 1AIXH 3FAOA 3OY5U 1MKWH 5LPFA 4CR9A 2UWPA 3Q3YA 1TNKA 1A5HA 1MD7A 2PUQH 2ZDAH 3SGBE 3F68H 1Y3YA 4KTSA 2QCYA 1HRTH 4CRDA 3SBKA 1P11E 1GI7B 2FIRH 1TBQH 1Q31A 1C4U2 1CT4E 5C0TA 1ETTH 1AO5A 2JJ2D 2Y7XA 1C5YB 1E1QD 1ID5H 3SJOA 3MMGA 2WPLS 4B1TA 1PPGE 2GZ7A 4MPUA 4BNRA 3KNXA 4A5TS 5T3HA 1SOTA 3MHWU 1QGFA 2BTCE 3SOSA 2Z3CA 1L1NA 1P2OA 3VB3A 4B2AA 1ORFA 1OHHD 4DW2U 1S6HA 5HM9A 2ZPQA 1LKAA 2J98A 1FPCH 4AFUA 1ZSLA 4ISIH 1PQ8A 2ANWA 2ZDMA 4ABDA 4NFEA 5C1UA 4AB8A 2VNTA 2J94A 3L33A 3VGCC 3LDXH 1W0YH 3W1EA 2J92A 2C93B 1EZXC 5PTPA 1V2VT 1FJSA 1TOCB 1MTWA 2BD4A 2O8LA 5A8ZA 1NY22 2XRCA 3I77A 3U28C 3TH2H 2Z3EA 3SJ8A 1JRSA 1EX3A 2CMYA 2Y5HA 2QN5T 1XVMA 4YZUA 3K6ZA 4YLQH 2OLGA 1SGEE 3BTFE 3QUMP 1UHBB 2FLRH 3OTJE 4RN6A 1C4Y2 2LP6A 1W11U 1VZQH 1EAIA 7LPRA 1WQSA 3NWUA 5EXLA 1HIAA 1UHBA 1ZPZA 1OOKB 1YP9A 1SGYE 2GT8A 2W3IA 1ZMJA 2HVYB 2QE7D 1D3PB 1NC6A 4IN1A 2G51A 1S83A 1O30A 5BPEA 4H6SB 1C1QA 1GJ4H 5HIYA 2IOTA 1EZUC 1O2XA 3GY8A 4BAHB 1YPKH 1YLDA 3TH4H 1O2UA 5FL7D 3S7KB 2Y7ZA 3QZRA 3OU0A 1PPEE 3DSPA 1WTGH 3ZV8A 4BTIB 4I33A 1XUHA 2A4GA 4WMEA 3F9FA 2P95A 1GMHF 3SU2A 2TGAA 1MCTA 3PV4A 1NESE 1ZSJA 1JMOH 1AU8A 3MNCA 4FUJA 4IBLH 4FETA 1NFUA 1V3XA 4Z6AH 5ABWA 1T4VH 1IQKA 3MTYA 1DM4B 2KAIB 1PQ5A 2GVFA 4I8HA 2BY8X 3BG8A 3N99A 1BBRK 2ZKSA 1P02A 4GAWA 4HGCA 4MVNA 1TRNA 2A7CA 2XCFA 4JZDH 1ANBA 1S0RA 1C1OA 3QDZB 3M5MA 3RXQA 4GHQA 1CE5A 1ZJKA 1KSNA 3B9FH 4MDSA 1VJ9U 2ULLA 3TGIE 3LJJA 3NXPA 2H6MA 5B6LA 3EAJA 4AGJA 1W0KD 1P04A 3JZ2B 3HPTB 4AN7A 3U1JB 1K21H 1QL7A 4U32A 5GDSH 3A81A 2UWOA 1ZLRA 3RU4E 1HDTH 2ZP0H 1GI3A 1O2RA 1SGFA 1UTPA 3KQCA 1THRH 3P8GA 1HAIH 3U8TH 3BTGE 5E0HA 4K8BA 5DK1A 3ZZAA 3B8JA 2OQ5A 3A7ZA 4DY7B 5EU8A 5T1VA 1TX7A 2PLXA 1TNGA 4X1PU 2RDLA 3E8LA 2A7JA 2SGEE 2PTNA 2V0BA 4K3JA 3GY5A 4J1YA 1O0DH 3BG4B 4FUGA 5GWZA 2ZCLP 3HGNA 1G3DA 1ZRKA 1O37A 4CRCA 3VXFH 3A83A 1FY5A 5EW2H 3KQDA 3Q00A 1S82A 4HI3A 1QRWA 8GCHF 2ZHDA 4K69A 1KLIH 3BSQA 2AGGX 2LNCA 2O8UA 3QGNB 2CHAC 5B6OA 1P8VC 1TA6A 1TMTH 1UTOA 1DVAH 3D23A 4UFGH 4TYDA 2GJGA 3M7UA 6ESTA 4F4OC 2R3YA 2ZU3A 1BT7A 3FOAA 3BF6H 2OP9A 3FP6E 3M5OA 3QO6A 3FO8D 3O8BA 4HZHA 1T8LA 5C94A 3BEIB 2ZDVH 2C8ZB 1GMDG 1OYQA 4K2YA 1NO9H 1AMHA 5LPEA 1L4ZA 4Y11E 3ELAH 2DUCA 3CS0A 1OP2A 3OX7U 1LVOA 3K2UA 1XM1A 2GP9B 3PWBA 2FX6A 1JBUH 1SLXB 4YTAA 1A1RA 2KCOA 1KIGH 2OBQA 2ZEBA 2VINA 1MU8B 1DS2E 4ZHAA 2ZCHP 1A2CH 1ELFA 1ELCA 4ZHLU 1GBJA 1TRYA 2KM0A 5L30H 5C1YA 4IMZA 3TGJE 2FYQA 2D2DA 1LHDH 2PSYA 1THPB 2BQ6B 1W12U 1ZRBA 2F43B 2R2WU 3F9GA 4JZIA 5EXNA 3A86A 1PPZA 3PWCA 1KXCA 1TPOA 1NU7B 5C5NA 3EA8A 3ZZ8A 1IQIA 3RXTA 1XXDA 1QQUA 4X8VH 4ACBA 1O32A 1UTJA 2YNBA 6GCHF 3AK5A 5CHAC 1TPPA 2WYJA 1K1OA 1GJBB 2P8OB 2ZFPH 2ZTXA 4Y7AA 1GBIA 3LPRA 4WVPE 2FWWA 5KECA 2YMSD 1O3CA 2VJ1A 1LMWB 3UY9A 4ZHMU 1SB1H 1ZGVA 3F9EA 3UIRA 3RC4A 2ZIQH 5GIBA 2KCYA 1C5OH 2TPIZ 3GY2A 4FVBA 3E6PH 5FCRA 3ZVBA 1Q3XA 1OWJA 1V2RT 2TGTA 2ZPRA 2Z9JA 1O2GH 1D9IA 1KYNA 1CBWB 1UTLM 3I29A 1COWD 3RXFA 3N7OA 1HUTH 3P92A 5F53A 1O2ZA 2QAAA 3NUMA 1C5TA 3MU4A 4IC6A 1C5PA 4NZQA 1TA2A 2F3CE 2G81E 3RM0H 1LQDB 1F5KU 5L6NH 3OYPA 1P10A 1D3DB 4X1NU 3F0OA 3QTOH 3FANA 1FI8A 1O2MA 3ZVEA 2K0QA 1W3CA 1CU1A 4ISLA 1MH0A 5DN6D 4XFQA 4TY7A 3RMMH 3EGKH 5CHBA 3RXRA 1Y59T 1YGCH 4B75A 1EKBB 2FI5E 2VVUA 1Y5BT 1RD3B 2J5UA 4U2WA 3ATLA 3TVJB 5K0HA 1O31A 3RLYH 2DE8A 1XUGA 1CQQA 2QA9E 3SO3A 4UONA 2ZU4A 1GBLA 1IOEA 2AMDA 1DSTA 1P9SA 1K1IA 1TNHA 1MTNC 1UTQA 5C5OA 4CRGA 1P03A 4BXSA 1O2QA 1F0TA 2W5EA 1S5SA 5KEDA 4I8LA 1NPMA 5JB9S 3ZZCA 1HAZB 3TLOA 1F5RA 1QRZA 9LPRA 2F9PA 3TK6A 5DPAA 3F1SB 4E05H 1GG6B 1GJCB 3PRDA 4RKJB 3U9AH 4BAQB 4H4FA 2PKAA 1BMAA 5EOKA 5GPIB 2FOAA 1SL3A 1YKTA 1MZDA 2ODYB 1DSUA 2YMSB 1Y3VA 3UPEA 3S7HB 4WY3A 4CREA 2BY9X 2KFWA 2FOMB 3R0FA 1SLUB 1SBWA 2QXGA 1TRMA 5L2YH 2PUXB 2OQUA 1GGDB 1LHEH 5EQQA 1FN6A 1TGSZ 4IGDA 2ODPA 1WBGB 1O3NA 3U8OH 5JBTA 1SQAA 4JK6A 1QB6A 1ESAA 3VB4A 1KXFA 5AFYH 2O8WA 1NZQH 1SLVB 2UUJB 3WY8A 3E16B 4UE7H 4DVAU 5DG6A 1O2TA 5EXMA 3UTUH 3UAIC 3SUFA 8ESTE 3FZDA 4X8UH 4Q80A 1BBRE 1TNLA 2ZU1A 3E3TA 4UDWH 1FQ3A 3RXVA 1NRSH 2BD3A 1EB1H 4O9VA 1HFDA 1TMBH 5F8XA 4RT1A 2A32A 2ZTZA 3UWIA 1EPTB 1P2MA 1QCPA 2C3SA 1GMCF 3B23B 4Y76A 2EY4C 4NIYA 1YPMH 1BTYA 2BD2A 2FTMA 4OGXA 1V2QT 1WQVH 1BTXA 1Y5UT 3M5LA 1WSSH 1GI4A 1N6XA 3C1KA 2HPQH 1F92A 1G2MA 3GY3A 4NA8A 2KCAA 4HFPB 2FTLE 2FX4A 1ELAA 1GBHA 2Z94A 1QB9A 1MKXK 1MTVA 3GCTF 1PYTC 3SJIA 3AW1A 2FI4E 1AZZA 3BTDE 1JXPA 1QR3E 2I6SA 3OAAD 2STBE 3VFEA 3LGVA 3KCGH 4GCHG 3BEFB 1NFWA 2GD4B 1RRKA 2IN2A 2PKSC 1UK2A 1VCQA 4KTCA 3RXBA 1G2LA 1B0FA 4FVDA 5T6GA 2JIZD 2AIQA 1C5SA 4ASHA 1Y3WA 3SNAA 2WUBA 1GBMA 1XUIA 1O3DA 4D7GA 1O3IA 1QBNA 1KXDA 2ILNA 1KXAA 1MBMA 4AYVB 5DP5A 2XWBI 3SV8A 3CENA 5DP8A 1Y3UA 3V7TA 2P3FH 5AVDA 1SFIA 2FOBA 2QXJA 1PPHE 2FS8A 4GLYA 3GCHB 1EQ9A 1OX1A 3ATIA 1Z6JH 5DP3A 5FX5A 4LZ1H 1AE8H 1O2LA 1TPSA 5HMAA 1C2KA 4OS1A 1KXBA 2G4TA 5DP9A 2D1JA 1XVOA 1FAXA 4ZAEA 1NU9A 1RIWC 1QB1A 3P8FA 1ZYOA 4OS5A 2GMTB 1ZMLA 3VGCB 3RMNH 1V2UT 4VGCB 3UR9A 2GKVE 4DOQA 6LPRA 2BDGA 2UUFB 4CBOA 1J8AA 2IJD1 2VIVA 1C5QA 3FFGA 2C4FH 1AGJA 3ZVDA 1BOQA 4D9QA 1L0ZA 1ARBA 1QRXA 2H2ZA 3W94A 1O33A 2ZQ2A 1HXFH 5EG4A 4THNH 1N6YA 1PQ7A 5EQSA 3IWMA 2BMGB 3K9XB 3Q77A 2BY5X 1QA7A 3CP7A 3VB5A 3K6YA 1SGIB 3UR6A 2R0LA 1XUFA 3O8DA 4TWWA 1P06A 3JZ1B 3SU1A 1FY4A 1TNIA 1MABB 1OPHB 2CV3A 4X6NA 4B2CA 1UO6A 4CH2B 1DLKB 4NGAH 3S69A 2G55A 4TPIZ 2P93A 1CSOE 3M7TA 4FUBA 1O5CB 1UK3A 1EATA 3RMLH 2AH4X 1WYKA 4Q7XA 2HGTH 1EJAA 1G3EA 3UNRA 3MNXA 1K1LA 2GDEH 4TT3D 3OEHD 1T7CA 5EJZA 1VKYA 3RXIA 2OK5A 1MUEB 3PMBB 1XKBC 3DSOA 4MPVA 5C17A 5ESTE 5EIYA 4CRFA 2EC9H 3A84A 5DKMA 3ZVFA 3T28A 3BTQE 2QGRA 1A7SA 1B5GH 3SU5A 3LGYA 1G37A 4INHA 4ESTE 2KX4A 1GHZA 4Y0ZE 4CH8B 2OC1A 3MFJA 3KIDU 3E0PB 2M5TA 4PROA 2QXIA 2YOLA 4NCYA 3BTTE 2QC2A 2RCEA 3F9HA 3ZZ3A 5JBAS 1JOUB 1THSH 4INLA 4CRAA 1BMFD 2EQNA 4Q63A 1BIOA 1GCTC 4OS7A 3M5NA 4MPWA 2BD8A 2JETB 1NBMD 1K28D 2KZ4A 1ZR0A 1AFQC 3EA9A 1C1SA 3T62A 5DP4A 5C2ZA 1TYNA 1FY8E 2ZA5A 4U01A 2NU2E 4ABJA 1EAXA 1BZXE 2A4QA 5K7RA 5GJ4B 2SNVA 2KCPA 5FBEA 1V2WT 1N1LA 4FUDA 4D8NA 1SGPE 3CS7A 1BQYA 4AYYB 1HB0B 1OP0A 1DY9A 1S85A 2C90B 1TWXB 3M3SA 1SOZA 1F2SE 4OM9A 1MZAA 1TBRH 2XNIA 1P2QA 3E1XB 1OS8A 3ATWA 1O2OA 3P8NA 2ZO3H 3U98H 1YLNA 2CGAA 1DFPA 1GHVH 1TALA 2A0QB 4DIHH 1VGCC 2FO9A 1CGIE 3U1IB 6CHAB 2QYIA 2XCNA 3ODFA 3UOPA 1H4WA 4UEHH 1C1RA 1TAWA 2ZGBH 2PHBA 2VH0A 3ITIA 5EW1H 2GZ9A 3S9AA 1OSSA 1C5UA 3E0NB 3PLBA 1W10U 8LPRA 2VGCC 1BHXF 2Y5GA 2F9UA 3LGWA 3FP7E 2VWMA 3KYFA 2XOKD 3M36A 1C2JA 2B5TB 1HLTH 5JDUB 1C1PA 3BTME 1EASA 2P3TB 2ZF0H 1ELTA 1A5GH 3PMHB 4RKOB 2BLOA 2ANMH 1T8OA 2FESH 3A8DA 5CMXH 4J2YB 3SORA 5AHGH 3URDA 4SGBE 4FU8A 2A1DB 4I8JA 5GNDA 1KY9A 1Z71A 4TWYA 1GI6A 4JYTA 1N8OC 3GYMA 1G36A 1GI8B 1H1BA 3I78A 1SGNE 3QN7A 1QY6A 3SHCH 1HAHH 2YNAA 2BXUH 3MH7A 2G00A 4FU9A 4BAOB 2W7UA 3LKWA 1EJNA 4NZLA 5TCCA 1GDQA 1BBRH 2WV4A 3SNBA 3LGUA 4BANB 4YOJA 3BEUA 3MH6A 1RXPA 2W6JD 1VITF 3GS9A 2WV9A 3V3MA 3P6ZB 5A8XA 1GHWH 2BZAA 4NA7A 3AASA 3TNSA 1F0UA 1SG8B 2NWNA 3VPKA 2A5IA 2OBOA 1FMGA 4A7IB 5CHAB 4B71A 3DFLA 2ZGXH 2KAIA 4XBDA 1D6RA 1Z8IB 1BJUA 4H42U 1VR1H 2OD3B 1ARCA 4CHAC 4AG1A 3H5CB 2VVCA 1BTWA 2TGDA 2ZGCA 1E1RD 4FUHA 4B6FA 2WYGA 1V2KT 1DDJA 2Z7FE 1ANCA 2F9OA 3SI3H 3SQEE 1ZTJA 7GCHF 2BY6X 1O2HA 4E7NA 5GXPA 3OEED 4FUFA 3GISB 2VIOA 1BRCE 4KKDA 1K0HA 1SR5C 2G4UA 2THFB 1C1UH 3A7YA 3N7EA 1GHBF 5IDKA 1TX8A 1K1PA 2TIOA 3A8BA 5J4QA 5GCHF 3DT0H 2FDAA 1NROH 1GBFA 4JZEH 1QZ8A 3OTPA 5F6MA 1ELGA 2W3KA 4WMDA 1SGDE 4X6OA 2V3HH 3L3TA 4A1VA 4BAMB 4AG2A 4OS6A 2GV6A 3SW2B 4IMQA 2BHGA 2BD7A 3M37A 4X2YA 1UVSH 4FXGH 1CGHA 3RXHA 5E0GA 3K65B 3TH3H 4OGYA 2L74A 1E35B 5AFZH 1W7XH 2H5CA 3SN8A 3V0XA 4Q2KA 3A7TA 4ZXYH 2A45B 3LJOA 1UTKA 2GCHG 4X6MA 1C2LA 1IQJA 4X8SH 2BLWA 3QK1A 3PO1B 1CHOF 1HAPH 1K1NA 1LO6A 1FX0B 5HGGA 1Z1JA 3WWBA 3SNDA 3LC5A 3ODDA 1GHAF 1NM6A 2BQWB 4IW4E 4YOGA 5EPNA 5FPYA 1P05A 1ZJDA 1AVGH 3ZV9A 2QIQA 3UUZA 1L1JA 1UVUH 5CE1A 2GCTB 4RT0A 1O2WA 1ZPBA 1Y3XA 1ZGIA 3GY6A 1EAWA 1C2GA 3P70B 4A6LA 1TBZH 3RXLA 3NPSA 1VCWA 2XBVA 1U6QA 1YCPK 1TFXA 1FNIA 3M3TA 2C8WB 3ATMA 1NBME 3SQHE 1GVZA 3M61U 2FLBH 2VVVA 4NA9H 1CVWH 1WU1A 4NWLA 4YOIA 2D8WA 3SU3A 3KGPA 1GL0E 1WDIA 3TNTA 1ABJH 4AX9H 1HJ9A 4P00A 4ISOA 4XSKU 4YESB 1MBQA 3RXKA 2PGQB 1AN1E 5DGJA 1BUIA 1RTLA 3F2GA 2AERH 1H9LB 1QTFA 5I46H 2G5VA 2ZGHA 1ZHPA 5JBCS 3RMOH 1KDQB 2O8TA 2GTBA 4FU7A 3SZNA 1VJAU 4NIVA 5A09A 1ELDE 3AAUA 3UNQA 3PTBA 5FAHA 1P2NA 1G3BA 1RFNA 2ZFTA 3A87A 3UQVA 1BMMH 2CF9H 3SZEA 2F9NA 4XE4A 1YPHE 2Z9GA 1IQHA 4ABHA 1T4UH 1K9OE 2AFQB 3PRBA 4FUEA 2ODQA 1SGFG 1W7GH 1UTNA 4X6PA 1UTMA 2XBWA 1C1NA 1DE7H 3H7OA 4YT7H 3TGKE 2A7HA 2XC5A 3HK6B 2FI3E 4CRBA 2EA3A 2FXRA 1V2MT 4MPXA 1O34A 2HNTE 3H7TA 1NRQH 1A4WH 1V6DA 7KMEH 1HJAC 2ZFFH 3GY7A 1BHXB 1TIOA 2HNTC 3Q3XA 1V2OT 2PKSB 1WOFA 1C5NH 2GDDA 4XD7D 4I32A 1HAOH 4Y8YA 1ESTA 3A7XA 4Q7ZA 1JIMA 4YO9A 4UD9H 4Y6DA 1CA8B 2Y81A 5CDFE 3KF2A 1CGJE 4QT8C 2BDAA 1A46H 1RS0A 2FOCA 4TSFD 1GHXH 1TQ7B 1SLWB 3BG4C 4Y8XA 1O3MA 1JRTA 3UFAA 2PSXA 4AGKA 1C2MA 1O3HA 2FM2A 2WPMS 3RXCA 1S6LA 4BTTB 1LCYA 1CA0B 1YPEH 2W6ID 2VIWA 3RC5A 1FIWA 4Y71A 2OC7A 1QHRB 2PP6A 1C9PA 3ZIAD 1BJVA 1NN6A 3M35A 1T8MA 5EQRA 3MU0A 4ZXXH 3ZVGA 3SI4H 1RIWB 3KQBA 2PR3A 5T6FA 1MMJN 1ZOMA 3SJKA 3WWFA 1O2KA 2FZZA 1LVMA 2C8XB 3RXMA 9ESTA 1UCYK 1UVPA 2M2AA 1DWBH 1KTTB 2ZU2A 2Z9LA 2CJIA 1ANDA 5EGMA 5LGOA 2R9PA 1LPGB 1WAYB 2VWOA 3BTWE 2ALVA 3TJNA 5LPRA 1C2IA 3VB6A 2AHME 2AMPA 1EUFA 1LHCH 1XX9A 2G5NA 1ZMNA 1JWTA 3DHKH 3SU4A 3TK9A 4R0IA 4ABAA 1DITH 1G3CA 2BVRH 1TGTA 1H8IH 1UMAH 2AEIH 5JBBS 2XWAA 1QNJA 4LOYH 3C27B 1E34B 5L2ZH 2OC0A 3GYLB 3VB7A 2BXTH 4JCNA 1SFQB 4WMFA 1O3JA 3T26A 3LIWA 1BDAA 2OINA 2BDIA 3RXPA 3UB0A 1ACBE 1E79D 2FOGA 5TCAA 1HJ8A 1DXWA 3P95A 1MKXH 1NS3A 4Y0YE 2PFEA 1GMDF 4JYVH 1EPTA 1SHHB 1RTFB 3RXJA 2Y6TA 4ABEA 3MU8A 4Y10E 1V2TT 2H9HA 3T5FH 1ZTLA 2BVXH 1FUJA 1TX6A 3S0NA 5A0BA 2PW8H 2V35A 3AW0A 1PFXC 2B0FA 1OKXA 4GSOA 2NU4E 4NSVA 3KYGA 2SNWA 3NCLA 1FONA 3SNCA 5E8EH 2BB4A 2TGPZ 1BA8B 5KGOA 2NU1E 4O97A 4MLFB 4K1TA 1HAXB 2ZGJA 3EDXB 4GUXA 1CBWC 1Y5AT 1LDTT 3W95A 2NU0E 2P59A 1P2KA 1MTUA 4KTUA 1GCTB 1KLJH 4XBCA 1AFQB 2ZZUH 2I6QA 2SFAA 3A89A 4WH8A 1A0HB 1AZ8A 3QGJA 1GJAB 1PPFE 1TNJA 2HALA 2IPQX 1V2ST 1F0RA 1LVBA 4K8YA 1GHYH 2AIPA 4X8TH 3PMJA 4K1SA 3FZZA 3T27A 2J2UA 1ETRH 2FP7B 5C67A 5EPYA 5F03A 4ABIA 1TGBA 4FUCA 3A7VA 4Y7BA 2H1UA 2JH5D 1QJ7B 1BTHH 3RXDA 1YC0A 1LPKB 3MO9A 2ZU5A 4X1QU 5FXLA 4K1EA 4M7GA 2G52A 1O2IA 1P2JA 1P12E 2V7QD 2EI7A 4OS2A 2F9BH 1Z8RA 2WPKS 4FUIA 4YLUA 1GL1A 3NRLA 1GMHG 1SPJA 2H9EH 1E37B 1IHTH 1VITG 2VB0A 1HAYB 2BOKA 4AORA 2QF5A 1NRRH 3A7WA 2VGCB 3SHAH 3ZYEA 3RU4D 2H5DA 1W14U 3U8RH 4B74A 2YMSC 1C9TA 3EQ0H 3NK8A 2ESTE 4X2XA 2W7SA 1SGQE 3V12A 3A8AA 1O5BB 3FVFB 1FPHH 3OY6U 5C1XA 4ZKNU 3LU9B 2AGEX 1UJ1A 4DT7B 2TRMA 2A2XH 1OP8A 1AB9C 3OFND 3PM3A 2Y5FA 2ZFRH 2VIDA 3LH3A 3QX5H 1HAVB 5SGAE 3QTVH 1GI9B 3BV9B 1GI1A 4X2VA 3LOXA 4DIIH 1BB0B 1E36B 1FZZA 2HVXA 1W13U 1GJ8B 2VWLA 2QXHA 2SGDE 1OYTH 2K1QA 2XC0A 5HYOA 1HNEE 3URCA 1SMFE 2WV5A 2D26C 1GDNA 3MNBA 4XDEA 1O2PA 1YPGH 5HXFA 1PJPA 1J16A 4WXIA 4Q7YA 1DWEH 2BVSH 2BD5A 2BOHB 1P2IA 2HWLB 1C5RA 4GPGA 3LC3A 3SUGA 5IK2D 3UOUA 4YM9A 3MWIU 5JYIA 8GCHG 2RA0A 4ABGA 4ZH8A 4FOUC 1O3FA 5E2OA 3WW7A 2WUCA 3Q76A 3NZIA 3MH5A 1V2NT 1SI5H 3ZVAA 1FDPA 2BX3A 2OXSA 1EFRD 3UQOA 2RDEA 3QWCH 3ZZ7A 1H8HD 2AYWA 2XC4A 1A3BH 1YY3A 2WPJS 3BTHE 3PROA 1O3KA 4X2WA 1ZPCA 3OE7D 5HIZA 1EZSC 1GJ5H 1HCGA 1Z8JB 1CHOG 2ZHEH 2KR7A 3QZQA 4A1XA 4NSYA 5FX6A 1GHAG 3GDVA 4ZCNA 1BTUA 1YPJH 2BDCA 4NIWA 4DT4A 1BCUH 1V2JT 3EE0B 5C3NA 1MKWK 1D3QB 3F3BA 2JDID 3PYHA 4M9FA 3GCHC 2BQ7B 5E0JA 1RJXB 2Y82A 3DCLA 1JIRA 3IITA 2W26A 2J98B 3PV5A 2WSSD 2LELA 1CO7E 3D49H 1UCYE 3MYWA 3HATH 1BRAA 1A5IA 2CHAB 1IQGA 3FKSD 2F4LA 5TJXA 3TK5A 5IYTA 2ZDNA 2FOFA 2O8MA 2ZQ1A 3A82A 3SJ9A 2QF0A 3LGIA 2OCVB 3BTEE 2GMTC 2PV9B 2Q1JA 4GCHF 4VGCC 4ZUHA 1CT2E 4YT6H 4ASUD 5EJLA 6GCHG 2B7DH 5HKKD 1XUKA 2EI6A 4H6TA 1AWFH 2OC8A 1P0SH 1BTPA 5C20A 5A8YA 2WZQA 2WPHS 4Y79A 1M9UA 1GVLA 1OWDA 3KEEA 2QV1A 1GBCA 5FBIA 3TIUA 1O2VA 4MTBA 3SU0A 1HIAB 1F5LA 1ZHMA 4GVUA 1XXFA 1DX5M 4MG3A 4KGAA 1AE5A 3VXEH 1C5ZB 1C2HA 1AD8H 2BD9A 3D62A 2HOBA 5FPTA 1ESBA 4AC9A 3TITA 2J95A 1Z6EA 2VH6A 1C1VH 1A0JA 1GJ6A 4B73A 1QJ1B 5DO4H 1IQFA 4IS5A 2O9QA 1Z7KA 1OWKA 4D9RA 1NFXA 3F0PA 1O5EH 1C2FA 1HPGA 3KN2A 1W0JD 2A2QH 3RUOA 1K2I1 3RXGA 7ESTE 1C5VA 1HGTH 2XBYA 2J9NA 2EI8A 4UFFH 3D65E 2BM2A 1EP5A 2Z9KA 1IQNA 3FN8A 3UWJH 2F9VA 4JK5A 3TJUA 1D3TB 3VG8A 2V3MA 2BX4A 2ZHWH 2V3OH 3SU6A 2GT7A 2K8IA 4RI0A 3RP2A 1V2PT 2VU8E 1LHGH 1LKBA 3ZYDA 1QQ4A 1K22H 1PPBH 2BDBA 1PPCE 1GBTA 3P17H 1AWHB 2B8OH 2JETC 2XXLA 4WXVA 1O5GH 4B6EA 4CR5A 2J38A 2JKHA 5J4SA 2P94A 1DXPA 3V13A 3PLKA 1FXYA 1X7AC 1ANEA 5JPMH 3GDUA 1HBTH 2EEKA 2J34A 3RLWH 1QL9A 1DWDH 1L4DA 1HJAB 3RDZA 1UW7A 1S81A 3O8CA 4WH6A 3LONA 4WF8A 2Q6FA 1O36A 1EJMA 5G4BA 3PLPA 1C5WB 3DFJA 1C4V2 1BTZA 1E0FD 5EJ1A 3HKJB 4WJG2 3RXOA 2HLDD 1EP6A 1DPOA 1AFEH 4WWYA 1S0QA 1H9HE 1SKYE 2ZC9H 1O2NA 1MTNB 1QL8A 4AFQA 1MTSA 1S84A 6CHAC 1P3EA 2ZCKP 1O3AA 1PYTD 1B0EA 4AB9A 1P57B 2C8YB 1O35A 4DG4A 1G32B 3ATKA 3EE7A 1O2JA 2A5AA 1WUNH 2Q6DA 1VITH 4ZKRU 3MNSA 3MQKC 2SGQE 4CBNA 2ZECA 1YCPH 1GMCG 1LTOA 2QF4A 1Y8TA 4DGJA 5DJ7A 4ZKOU 1H8ED 1GVKB 1QJ6B 3SUDA 1FIZA 3BIUH 4AFSA 2HLCA 3MH4A 2SGFE 2JH6D 3Q3KA 3GY4A 3GCTG 3T29A 1GI2A 1P3CA 4O3TA 5A0AE 1AY6H 1RGQA 1TPAE 3KHVA 1FY1A 2VWNA 3GCOA 3SNEA 4B76A 3TJOA 2RFKC 3DUXH 3RC6A 1W2KH 1TE0A 3BN9A 1A0LA 2Z9IA 1YYY1 3PTNA 1L2EA 3E90B 2R3UA 1LVYA 2ZWLH 3KL6A 5BRRE 4XOJA 1XKAC 3F6UH 4ISHH 3A85A 1Z8GA 2HRVA 3AAVA 5FCKA 1YBWA 3HGPA 3MU1A 3SGAE 4GHTA 3SV6A 5ESBA 4P02A 4TPYA 3SV2H 3HK3B 1TONA 4Q4LA 3STIA 1UVOA 1SQTA 3MO3A 4ABBA 5LH8A 1C2EA 4JYUH 4B2BA 1DANH 2P3UB 1KDQA 1DOJA 3P8OA 4F48B 5FPSA 2JH0D 2P16A 2XTTB 3BIVH 1AVXA 5A0CA 3TU7H 2FOHA 1H8DH 2ZPSA 3VEQB 1F0SA 2AGIX 1YPHC 2HPPH 4INKA 1F7ZA 2ALPA 1XMNB 1CT0E 1MQ5A 2ASUB 1SHYA 3F2HA 1ZHRA 3PV2A 1P9UA 1DLEA 5FHTA 4Z1MD 1XUJA 1GCDA 3O8RA 1O3LA 2BY7X 1YLCA 1MQ6A 2Q6GA 1ZTKA 4U30A 4O3UA 1UVTH 3GICB 4ZMAH 1GBBA 1ZSKA 3MU5A 5EODA 1ZZZA 1K1MA 1KXEA 3MO6A 4Z0KA 1GWAA 2CN0H 3AVZA 3ZZ6A 3UREA 2ZHFH 1FN8A 1O2SA 3DA9B 4I8KA 3RXUA 1HV7A 1RTKA 1BRUP 2ANYA 1LPZB 1G9IE 1D6WA 2ZG0H 1HXEH 1W8BH 3RU4T 5DSFA 4I31A 1TGCA 3ZVCA 2GV7A 2VBCA 4DURA 1HAGE 1QFKH 4A1TA 2IPHA 4Y8ZA 8KME2 1UCYH 3T2NA 2A5KA 2WHXA 4SGAE 4TY6A 4ZKSU 2BDYA 4D76A 1MAYA 3RXEA 3T25A 1SVPA 1T32A 2TBSA 4F49A 5F8TA 1SGCA 4NG9H 4O03A 1C5XB 1BMNH 4UFEH 2XNDD 2ZFQH 1V2LT 2WPIS 2PTCE 2QF3A 4BAKB 2FPZA 2PKAB 1DWCH 3PO1C 4UFDH 1O38A 4BTUB 1AUJA 2IJOB 2FODA 1GBDA 5A2MH 1FAKH 1QA0A 1OWEA 3R3GB 2WINI 1MU6B 3FP8E 3SV7A 2CF8H 2GCTC 4I86A 2FEQH 2BDHA 4AOQA 4DJZB 3TJVA 1DY8A 4JZ1A 4NFFA 1EOJA 5JB8S 2SGAA 4LZ4B 1GBKA 4F55A 3M3VA 1FV9A 1SGTA 2OTVA 4NIXA 2GX4A 3CNRA 2J4IA 1AI8H 1O3PB 1GPZA 1C5LH 5HM2A 1AB9B 2LPRA 3ZZ4A 2VIQA 1C1TA 4X0WU 4K5ZA 1J15A 2BZ6H 3PB1E 4LK4A 1GI5A 2SGPE 1O5FH 5DP7A 2ZI2H 2GCHF 5ETXA 2FYRA 4R8TB 2P8OC 2BYAX 2ANKH 2A31A 3TPIZ 3QLPH 2GZ8A 2Z3DA 1EOLA 1AUTC 1O3GA 2ZHQH 1SGRE 1NFYA 1FLEE 2XW9A 2RG3A 1TB6H 2VIPA 5T6DA 1ELEE 4OS4A 1AQ7A 1IHSH 2WPDD 4MNYA 3SUEA 5C0UA 4AFZA 1NT1A 1TABE 1QBOA 4YXWD 1NRPH 1AVWA 1IQEA 4KP0A 1YCPM 1YF4A 2ZTYA 3G01A 1EXFA 1KMHB 2CXVA 1WTHD 3LT3A 2UUYA 4JMYA 4NWKA 1GJ7B 1SQRA 1PQAA 1GJDB 4ZROA 2STAE 1P01A 1VCPA 3RXAA 1INCA 5I25A 4I7YH 4X1SU 5AF9H 5H4IB 1OXGA 1OWIA 2JJ1D 1Q2WA 3S9CA 4XRNA 1IQMA 1BRBE 3H09A 3HKIB 4ACAA 1YPLH 2B9LA 1MD8A 5E2PA 4IN2A 1YM0A 2BLQA 3OSYA 2J97A 2ZDLA 4K60A 3ENSB 2F91A 1ELVA 1B7XB 3EYDA 3A8CA 3N7DA 4LXBH 1IAUA 4KELA 2XYAA 2AS9A 3LGTA 4MNVA 4D7FA 2G8TA 4RSPA 1TOMH 3DSGA 1BMLA 2PWXA 1DUEA 1E38B 1IQLA 1J14A 4X1RU 4AZ2B 1C1MA 1AHTH 1HYLA 3IG6B 1CA0C 4DCDA 1G30B 1VGCB 4E7RG 3L6PA 3KQ5A 1QBVH 1GJ9B 3MOCA 5DP6A 2ZDKA 1TQ0B 1QIXB 1GG6C 1S6FA 2BLVA 3SYJA 1LQEA 1YWUA 2H9TH 3LH1A 1KLTA 1QURH 2UWLA 3BTKE 3ESTA 3RXSA 1DUAA 1T8NA 1WV7H 3ZZBA 2HNTF 4E06H 3E91A 3MI4A 4HTCH 1J9CH 3ZZDA 2V6NA 3DD2H 1L1GA 3UNSA 1LHFH 2GGVB 1BITA 4I8GA 1Z1IA 1W0ZU 3STJA 4JZFH 1AKSB 2NU3E 3SV9A 1GGDC 4MNXA 3GOVB 1DICA 3ZZ9A 1NRNH 3NKKA 1T31A 4IC5A 1ABIH 2FOEA 1O5AB 1SSXA 1O2YA 3GDSA 1O3BA 3A88A 1MCVA 2FMJA 1WCZA 4ISNA
chains in the Genus database with same CATH topology
1AKSA 1C2DA 3RM2H 1N8OB 2A4RA 5F8ZA 4ABFA 2ZFSA 1A3EH 1A61H 1SQOA 1TMUH 2OUAA 2AMQA 2F83A 2QY0B 2R2MB 1HAVA 7GCHG 1K1JA 1EZQA 1GI0A 1CHGA 1TGNA 4MNWA 1TLDA 2A4OA 1C1WH 3GCNA 4A92A 1EPTC 1GHBG 2FS9A 1ETSH 3SGQE 1DT2A 1GBEA 5GCHG 2R0KA 2RA3A 2Z6BD 1C5MD 3S9BA 3M7QA 4MQAA 3PMAB 4XBBA 4BXWA 1J17T 1FY3A 1EAUA 3KQEA 1KTSB 3A80A 1O3EA 1P09A 1GDUA 1D4PB 1O39A 1EB2A 1O3OA 2PGBB 4CHAB 2XBXA 2UUKB 1NTPA 1ELBA 3ZZ5A 1H9IE 3EA7A 1MAXA 1UK4A 2ZNKH 3U69H 1OWHA 4BOHA 1GBAA 1SC8U 2Y80A 2DE9A 1O5DH 1AIXH 3FAOA 3OY5U 1MKWH 5LPFA 4CR9A 2UWPA 3Q3YA 1TNKA 1A5HA 1MD7A 2PUQH 2ZDAH 3SGBE 3F68H 1Y3YA 4KTSA 2QCYA 1HRTH 4CRDA 3SBKA 1P11E 1GI7B 2FIRH 1TBQH 1Q31A 1C4U2 1CT4E 1ETTH 1AO5A 2Y7XA 1C5YB 1ID5H 3SJOA 3MMGA 2WPLS 4B1TA 1PPGE 2GZ7A 4MPUA 4BNRA 3KNXA 4A5TS 5T3HA 1SOTA 3MHWU 1QGFA 2BTCE 3SOSA 2Z3CA 1L1NA 1P2OA 3VB3A 4B2AA 1ORFA 4DW2U 1S6HA 5HM9A 2ZPQA 1LKAA 1FPCH 4AFUA 1ZSLA 4ISIH 1PQ8A 2ANWA 2ZDMA 4ABDA 4NFEA 5C1UA 4AB8A 2VNTA 2J94A 3L33A 3VGCC 3LDXH 1W0YH 2J92A 2C93B 1EZXC 5PTPA 1V2VT 1FJSA 1TOCB 1MTWA 2BD4A 2O8LA 5A8ZA 1NY22 2XRCA 3I77A 3TH2H 2Z3EA 3SJ8A 1JRSA 1EX3A 2CMYA 2Y5HA 2QN5T 1XVMA 4YZUA 3K6ZA 4YLQH 2OLGA 1SGEE 3BTFE 3QUMP 1UHBB 2FLRH 3OTJE 4RN6A 1C4Y2 1W11U 1VZQH 1EAIA 7LPRA 1WQSA 3NWUA 5EXLA 1HIAA 1UHBA 1ZPZA 1OOKB 1YP9A 1SGYE 2GT8A 2W3IA 1ZMJA 1D3PB 1NC6A 4IN1A 2G51A 1S83A 1O30A 5BPEA 4H6SB 1C1QA 1GJ4H 2IOTA 1EZUC 1O2XA 3GY8A 4BAHB 1YPKH 1YLDA 3TH4H 1O2UA 3S7KB 2Y7ZA 3QZRA 3OU0A 1PPEE 1WTGH 3ZV8A 4BTIB 4I33A 1XUHA 2A4GA 4WMEA 3F9FA 2P95A 1GMHF 3SU2A 2TGAA 1MCTA 3PV4A 1NESE 1ZSJA 1JMOH 1AU8A 3MNCA 4FUJA 4IBLH 1NFUA 1V3XA 4Z6AH 5ABWA 1T4VH 1IQKA 3MTYA 1DM4B 2KAIB 1PQ5A 2GVFA 4I8HA 2BY8X 3BG8A 1BBRK 2ZKSA 1P02A 4GAWA 4HGCA 4MVNA 1TRNA 2A7CA 2XCFA 4JZDH 1ANBA 1S0RA 1C1OA 3QDZB 3M5MA 3RXQA 4GHQA 1CE5A 1ZJKA 1KSNA 3B9FH 4MDSA 1VJ9U 2ULLA 3TGIE 3LJJA 3NXPA 2H6MA 3EAJA 4AGJA 1P04A 3JZ2B 3HPTB 4AN7A 3U1JB 1K21H 1QL7A 4U32A 5GDSH 3A81A 2UWOA 1ZLRA 3RU4E 1HDTH 2ZP0H 1GI3A 1O2RA 1SGFA 1UTPA 3KQCA 1THRH 3P8GA 1HAIH 3U8TH 3BTGE 5E0HA 4K8BA 5DK1A 3ZZAA 3B8JA 2OQ5A 3A7ZA 4DY7B 5EU8A 1TX7A 2PLXA 1TNGA 4X1PU 2RDLA 3E8LA 2A7JA 2SGEE 2PTNA 2V0BA 4K3JA 3GY5A 4J1YA 1O0DH 3BG4B 4FUGA 5GWZA 2ZCLP 3HGNA 1G3DA 1ZRKA 1O37A 4CRCA 3VXFH 3A83A 1FY5A 5EW2H 3KQDA 3Q00A 1S82A 4HI3A 1QRWA 8GCHF 2ZHDA 4K69A 1KLIH 3BSQA 2AGGX 2LNCA 2O8UA 3QGNB 2CHAC 5B6OA 1P8VC 1TA6A 1TMTH 1UTOA 1DVAH 3D23A 4UFGH 4TYDA 3M7UA 6ESTA 4F4OC 2R3YA 2ZU3A 1BT7A 3BF6H 2OP9A 3FP6E 3M5OA 3QO6A 4HZHA 3O8BA 1T8LA 3BEIB 2ZDVH 2C8ZB 1GMDG 1OYQA 4K2YA 1NO9H 1AMHA 5LPEA 1L4ZA 4Y11E 3ELAH 2DUCA 3CS0A 1OP2A 3OX7U 1LVOA 3K2UA 1XM1A 2GP9B 3PWBA 2FX6A 1JBUH 1SLXB 4YTAA 1A1RA 2OBQA 1KIGH 2ZEBA 2VINA 1MU8B 1DS2E 4ZHAA 2ZCHP 1A2CH 1ELFA 1ELCA 4ZHLU 1GBJA 1TRYA 5L30H 5C1YA 4IMZA 3TGJE 2FYQA 2D2DA 1LHDH 2PSYA 1THPB 2BQ6B 1W12U 1ZRBA 2R2WU 3F9GA 4JZIA 5EXNA 3A86A 1PPZA 3PWCA 1KXCA 1TPOA 1NU7B 5C5NA 3EA8A 3ZZ8A 1IQIA 3RXTA 1XXDA 1QQUA 4X8VH 1O32A 1UTJA 2YNBA 6GCHF 5CHAC 1TPPA 2WYJA 1K1OA 1GJBB 2P8OB 2ZFPH 2ZTXA 4Y7AA 1GBIA 3LPRA 4WVPE 2FWWA 1O3CA 2VJ1A 1LMWB 3UY9A 4ZHMU 1SB1H 1ZGVA 3F9EA 3UIRA 3RC4A 2ZIQH 5GIBA 1C5OH 2TPIZ 3GY2A 4FVBA 3E6PH 5FCRA 3ZVBA 1Q3XA 1OWJA 1V2RT 2TGTA 2ZPRA 2Z9JA 1O2GH 1D9IA 1KYNA 1CBWB 1UTLM 3I29A 3RXFA 3N7OA 1HUTH 3P92A 1O2ZA 2QAAA 3NUMA 1C5TA 3MU4A 4IC6A 1C5PA 4NZQA 1TA2A 2F3CE 2G81E 3RM0H 1LQDB 1F5KU 5L6NH 3OYPA 1P10A 1D3DB 4X1NU 3QTOH 3FANA 1FI8A 1O2MA 3ZVEA 1W3CA 1CU1A 4ISLA 1MH0A 4XFQA 4TY7A 3RMMH 3EGKH 3RXRA 1Y59T 1YGCH 4B75A 1EKBB 2FI5E 2VVUA 1Y5BT 1RD3B 4U2WA 3TVJB 3ATLA 5K0HA 1O31A 3RLYH 2DE8A 1XUGA 1CQQA 2QA9E 3SO3A 4UONA 2ZU4A 1GBLA 1IOEA 2AMDA 1DSTA 1P9SA 1K1IA 1TNHA 1MTNC 1UTQA 5C5OA 4CRGA 1P03A 4BXSA 1O2QA 1F0TA 2W5EA 1S5SA 4I8LA 1NPMA 5JB9S 3ZZCA 1HAZB 3TLOA 1F5RA 1QRZA 9LPRA 2F9PA 3TK6A 5DPAA 3F1SB 4E05H 1GG6B 1GJCB 4RKJB 3U9AH 4BAQB 4H4FA 2PKAA 1BMAA 5EOKA 5GPIB 2FOAA 1SL3A 1YKTA 1MZDA 2ODYB 1DSUA 1Y3VA 3UPEA 3S7HB 4WY3A 4CREA 2BY9X 2FOMB 3R0FA 1SLUB 1SBWA 2QXGA 1TRMA 5L2YH 2PUXB 2OQUA 1GGDB 1LHEH 5EQQA 1FN6A 1TGSZ 4IGDA 2ODPA 1WBGB 1O3NA 3U8OH 5JBTA 1SQAA 4JK6A 1QB6A 1ESAA 3VB4A 1KXFA 5AFYH 2O8WA 1NZQH 1SLVB 2UUJB 3WY8A 3E16B 4UE7H 4DVAU 5DG6A 1O2TA 5EXMA 3UTUH 3SUFA 8ESTE 3FZDA 4X8UH 4Q80A 1BBRE 1TNLA 2ZU1A 3E3TA 4UDWH 1FQ3A 3RXVA 1NRSH 2BD3A 1EB1H 4O9VA 1HFDA 1TMBH 5F8XA 2A32A 2ZTZA 3UWIA 1EPTB 1P2MA 1QCPA 2C3SA 1GMCF 3B23B 4Y76A 4NIYA 1YPMH 1BTYA 2BD2A 2FTMA 4OGXA 1V2QT 1WQVH 1BTXA 1Y5UT 3M5LA 1WSSH 1GI4A 1N6XA 3C1KA 2HPQH 1F92A 1G2MA 3GY3A 4NA8A 4HFPB 2FTLE 2FX4A 1ELAA 1GBHA 2Z94A 1QB9A 1MKXK 1MTVA 3GCTF 1PYTC 3SJIA 3AW1A 2FI4E 1AZZA 3BTDE 1JXPA 1QR3E 2I6SA 3VFEA 2STBE 3LGVA 3KCGH 4GCHG 3BEFB 1NFWA 2GD4B 1RRKA 2IN2A 2PKSC 1UK2A 1VCQA 4KTCA 3RXBA 1G2LA 1B0FA 4FVDA 5T6GA 2AIQA 1C5SA 4ASHA 1Y3WA 3SNAA 2WUBA 1GBMA 1XUIA 1O3DA 4D7GA 1O3IA 1QBNA 1KXDA 2ILNA 1KXAA 1MBMA 4AYVB 5DP5A 2XWBI 3SV8A 3CENA 5DP8A 1Y3UA 3V7TA 2P3FH 5AVDA 1SFIA 2FOBA 2QXJA 1PPHE 2FS8A 4GLYA 3GCHB 1EQ9A 1OX1A 3ATIA 1Z6JH 5DP3A 5FX5A 4LZ1H 1AE8H 1O2LA 1TPSA 5HMAA 1C2KA 4OS1A 1KXBA 2G4TA 5DP9A 2D1JA 1XVOA 1FAXA 4ZAEA 1NU9A 1RIWC 1QB1A 3P8FA 1ZYOA 4OS5A 2GMTB 1ZMLA 3VGCB 3RMNH 1V2UT 4VGCB 3UR9A 2GKVE 4DOQA 6LPRA 2BDGA 2UUFB 4CBOA 1J8AA 2VIVA 1C5QA 3FFGA 2C4FH 1AGJA 3ZVDA 1BOQA 4D9QA 1L0ZA 1ARBA 1QRXA 2H2ZA 3W94A 1O33A 2ZQ2A 1HXFH 5EG4A 4THNH 1N6YA 1PQ7A 5EQSA 3IWMA 2BMGB 3K9XB 3Q77A 2BY5X 1QA7A 3CP7A 3VB5A 3K6YA 1SGIB 3UR6A 2R0LA 1XUFA 3O8DA 4TWWA 1P06A 3JZ1B 3SU1A 1FY4A 1TNIA 1OPHB 2CV3A 4X6NA 4B2CA 1UO6A 4CH2B 1DLKB 4NGAH 3S69A 2G55A 4TPIZ 2P93A 1CSOE 3M7TA 4FUBA 1O5CB 1UK3A 1EATA 3RMLH 2AH4X 1WYKA 4Q7XA 2HGTH 1EJAA 1G3EA 3UNRA 3MNXA 1K1LA 2GDEH 1T7CA 3RXIA 1MUEB 3PMBB 1XKBC 4MPVA 5ESTE 4CRFA 2EC9H 3A84A 5DKMA 3ZVFA 3T28A 3BTQE 2QGRA 1A7SA 1B5GH 3SU5A 3LGYA 1G37A 4INHA 4ESTE 1GHZA 4Y0ZE 4CH8B 2OC1A 3MFJA 3KIDU 3E0PB 2M5TA 4PROA 2QXIA 2YOLA 4NCYA 3BTTE 2QC2A 2RCEA 3F9HA 3ZZ3A 5JBAS 1JOUB 1THSH 4INLA 4CRAA 1BIOA 1GCTC 4OS7A 3M5NA 4MPWA 2BD8A 2JETB 1K28D 1ZR0A 1AFQC 3EA9A 1C1SA 3T62A 5DP4A 5C2ZA 1TYNA 1FY8E 2ZA5A 4U01A 2NU2E 4ABJA 1EAXA 1BZXE 2A4QA 5K7RA 5GJ4B 2SNVA 5FBEA 1V2WT 1N1LA 4FUDA 4D8NA 1SGPE 3CS7A 1BQYA 4AYYB 1HB0B 1OP0A 1DY9A 1S85A 2C90B 1TWXB 3M3SA 1SOZA 1F2SE 1MZAA 1TBRH 2XNIA 1P2QA 3E1XB 1OS8A 3ATWA 1O2OA 3P8NA 2ZO3H 3U98H 2CGAA 1DFPA 1GHVH 1TALA 2A0QB 4DIHH 1VGCC 2FO9A 1CGIE 3U1IB 6CHAB 2QYIA 2XCNA 3ODFA 3UOPA 1H4WA 4UEHH 1C1RA 1TAWA 2ZGBH 2PHBA 2VH0A 3ITIA 5EW1H 2GZ9A 3S9AA 1OSSA 1C5UA 3E0NB 3PLBA 1W10U 8LPRA 2VGCC 1BHXF 2Y5GA 2F9UA 3LGWA 3FP7E 2VWMA 3M36A 1C2JA 2B5TB 1HLTH 5JDUB 1C1PA 3BTME 1EASA 2P3TB 2ZF0H 1ELTA 1A5GH 3PMHB 4RKOB 2BLOA 2ANMH 1T8OA 2FESH 3A8DA 5CMXH 4J2YB 3SORA 5AHGH 3URDA 4SGBE 4FU8A 2A1DB 4I8JA 1KY9A 1Z71A 4TWYA 1GI6A 4JYTA 1N8OC 3GYMA 1G36A 1GI8B 1H1BA 3I78A 1SGNE 3QN7A 1QY6A 3SHCH 1HAHH 2YNAA 2BXUH 3MH7A 2G00A 4FU9A 4BAOB 2W7UA 3LKWA 1EJNA 4NZLA 5TCCA 1GDQA 1BBRH 2WV4A 3SNBA 3LGUA 4BANB 4YOJA 3BEUA 3MH6A 1RXPA 1VITF 3V3MA 3P6ZB 5A8XA 1GHWH 2BZAA 4NA7A 3AASA 3TNSA 1F0UA 1SG8B 2NWNA 3VPKA 2A5IA 2OBOA 1FMGA 4A7IB 5CHAB 4B71A 3DFLA 2ZGXH 2KAIA 4XBDA 1D6RA 1Z8IB 1BJUA 4H42U 1VR1H 2OD3B 1ARCA 4CHAC 4AG1A 3H5CB 2VVCA 1BTWA 2TGDA 2ZGCA 4FUHA 2WYGA 1V2KT 1DDJA 2Z7FE 1ANCA 2F9OA 3SI3H 3SQEE 1ZTJA 7GCHF 1O2HA 2BY6X 4E7NA 5GXPA 4FUFA 3GISB 2VIOA 1BRCE 4KKDA 1SR5C 2G4UA 2THFB 1C1UH 3A7YA 5IDKA 1GHBF 1TX8A 1K1PA 2TIOA 3A8BA 5J4QA 5GCHF 3DT0H 2FDAA 1NROH 1GBFA 4JZEH 5F6MA 1ELGA 2W3KA 4WMDA 1SGDE 4X6OA 2V3HH 3L3TA 4A1VA 4BAMB 4AG2A 4OS6A 2GV6A 3SW2B 4IMQA 2BHGA 2BD7A 3M37A 4X2YA 1UVSH 4FXGH 1CGHA 3RXHA 5E0GA 3K65B 3TH3H 4OGYA 1E35B 5AFZH 1W7XH 2H5CA 3SN8A 3V0XA 4Q2KA 3A7TA 4ZXYH 2A45B 3LJOA 1UTKA 2GCHG 4X6MA 1C2LA 1IQJA 4X8SH 2BLWA 3QK1A 3PO1B 1CHOF 1HAPH 1K1NA 1LO6A 5HGGA 1Z1JA 3SNDA 3LC5A 3ODDA 1GHAF 1NM6A 2BQWB 4IW4E 4YOGA 5EPNA 5FPYA 1P05A 1ZJDA 1AVGH 3ZV9A 2QIQA 3UUZA 1L1JA 1UVUH 5CE1A 2GCTB 1O2WA 1ZPBA 1Y3XA 1ZGIA