4XDEA

Coagulation factor xii protease domain crystal structure
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
241
Chain Sequence
VALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVSLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVSHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Coagulation factor XII protease domain crystal structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Coagulation factor XII
total genus 56
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.38: Coagulation factor XIIa.
pdb deposition date 2014-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xdeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xdeA01
2C90B 5T6DA 3ZVAA 2P95A 1TBRH 1EZQA 1GHVH 2PWXA 3FZDA 4K69A 4LZ1H 2GX4A 2IOTA 3PWBA 1DANH 3S69A 1O3GA 2OUAA 1KDQB 2FTMA 1DUEA 1O3AA 1FNIA 3PWCA 4CRBA 3MO6A 2JKHA 4ABJA 4MNYA 1C9TA 1V2TT 2FOAA 4CRAA 3MU4A 2Z9IA 4AYYB 4FUHA 1HJAC 3BTTE 2XBXA 2FXRA 4NZLA 2BOKA 3FANA 1M9UA 3T2NA 2GCHG 3SQEE 4NWLA 1C1PA 1EZUC 2SGQE 3DUXH 2R2MB 1FY4A 3UNSA 1O2XA 2BDGA 2Q6FA 3S9CA 1HIAA 1A3EH 2FI5E 2P8OC 3PMAB 1O2PA 4NIYA 2VWLA 1LVBA 1GJ7B 2FOGA 3E16B 1YGCH 1E38B 2BDIA 4BOHA 1P2NA 2R2WU 4IS5A 2K1QA 3QTVH 4B2BA 4ABAA 1K9OE 1E35B 1IHTH 1KXEA 1BTHH 5F8ZA 1GCTC 3RP2A 4K1SA 5JBTA 3RC6A 1DWBH 2SGDE 3GCTF 3RXJA 1ARCA 1O2NA 1S6FA 2ULLA 2P93A 3LIWA 2Y7ZA 5HYOA 1BRAA 1C2EA 1GJ8B 5CHAC 2ZCKP 3SNEA 1TOCB 2BY5X 1T8LA 2XBYA 1P3EA 4OS7A 5CE1A 1E37B 1EPTB 2C3SA 3FP7E 1D3TB 3QN7A 5DO4H 1CT0E 3RMMH 1UVUH 4JZ1A 1V2MT 3NWUA 5DP9A 2FMJA 3R0FA 1ZTJA 1Y3VA 3UNQA 2GDEH 2VWMA 1LPGB 3GY8A 3M35A 5FBEA 2B5TB 1J16A 5E8EH 4Y7BA 4ZKRU 1VITF 1MKXK 4DGJA 1ZRKA 1J14A 6CHAC 1O3KA 2WPMS 3A7ZA 1MQ6A 3D49H 2AGIX 3SI4H 2HGTH 2VIVA 2JH6D 1LMWB 4A1XA 3B23B 1ARBA 4ABDA 2F3CE 2H5CA 4R0IA 4INHA 1BTZA 1NRSH 1MCVA 2A1DB 2GV6A 1GBKA 1HV7A 3PB1E 3TK9A 2A5AA 3RXGA 1ZPBA 4B2CA 1EASA 2BTCE 4VGCC 3F6UH 1DOJA 1C1OA 1CA8B 2PR3A 1AUTC 1N6YA 4I33A 4RN6A 3H7TA 1SGPE 3LGUA 5G4BA 3RUOA 1O2JA 1RD3B 1UTNA 1TLDA 2ZFQH 3T27A 4JZFH 2A4OA 1LKAA 3ZZ4A 1F0UA 3U8OH 1Z1JA 4NG9H 1P2IA 2TRMA 1KXBA 2GCTB 1L4ZA 1JBUH 2QAAA 2C8WB 1D6RA 3MMGA 5AVDA 1TPAE 4CR9A 4ABEA 1BQYA 1A0LA 1OP0A 1V2PT 1VCWA 1BBRH 1GL1A 1OPHB 1G3DA 3U69H 1FV9A 1IQMA 1RFNA 1SHYA 1SLVB 5DG6A 4WJG2 1EB2A 1P01A 2HPPH 3SUDA 5FCKA 1GVZA 3KL6A 2FLRH 2UUJB 3A8BA 2QCYA 1C4Y2 2BQ6B 4Z6AH 1GBMA 1G9IE 5DP4A 1Z8GA 2ZIQH 5FX6A 5DP8A 4CH2B 4LZ4B 1SL3A 1C2DA 1Z6EA 2ODQA 5EOKA 3RXTA 5EXMA 1GI1A 2BD3A 1O2UA 2B8OH 2W3IA 5E2OA 3A81A 2CGAA 1O2QA 1MAYA 1LO6A 1XUIA 2BHGA 1PFXC 1L1NA 1LVYA 2BX4A 5EQSA 1C1TA 1VJAU 2F9BH 1MKWK 2BLQA 2FWWA 1FXYA 4NZQA 3NUMA 4XBBA 1GHAF 2Y5FA 5FCRA 1QFKH 1WTHD 1WSSH 5DGJA 4B73A 4YT7H 4Q7XA 3BG4C 1F0RA 1HAGE 4K2YA 1IQLA 2HNTE 1CHOF 3BIVH 4GLYA 4WH6A 2OC8A 2OP9A 2GDDA 2R3YA 1GBCA 4FUFA 1AN1E 2BYAX 1QB6A 4LXBH 3PLBA 2A2QH 4KTUA 4I8LA 5HMAA 1YPEH 2YNAA 3RMNH 1G37A 3BTEE 2GTBA 3SOSA 4FUEA 1P9UA 3STIA 4AFQA 1TBZH 4B71A 3PMJA 5LPRA 1F5RA 1IQIA 3KNXA 1HXFH 1QRZA 4NGAH 3VGCB 1O2YA 1UTPA 1ZMNA 3RXBA 1SQOA 3RXLA 1XKAC 1Y3UA 2BLVA 2EI7A 3MOCA 1QJ1B 1UK4A 1QA7A 1O3IA 1TNGA 3ATKA 3RM0H 3MFJA 3L33A 1SSXA 3P6ZB 3ZZAA 1ETRH 3GCNA 3QZRA 1C1NA 1ANBA 4H6SB 3ZZ3A 2NWNA 3E6PH 3A7VA 4WMFA 2AEIH 3EE0B 3QTOH 1FI8A 1GDQA 3F9GA 3E3TA 1NRNH 1W8BH 2UUYA 1O3FA 2VB0A 1GDNA 5GXPA 2FTLE 3PO1B 1DUAA 2VGCC 1ZRBA 3NCLA 1H1BA 4AOQA 3SJ9A 1FDPA 1O3BA 4R8TB 1C4U2 1CE5A 1GMDF 1O5BB 1P10A 4AYVB 3VEQB 1BJUA 5JBAS 4ZXYH 4FVDA 1VGCC 4DW2U 1HAVB 2ZDLA 1C5WB 5DJ7A 5C1UA 1AKSB 1ZR0A 1BA8B 2ZU5A 1K1PA 2FDAA 3Q00A 3LGYA 2ZHWH 3MHWU 4Y0YE 3U98H 4MPWA 1OYTH 1TALA 3P95A 3S9BA 3ODDA 1O3MA 2AMQA 2GT7A 1A3BH 3M7UA 2D2DA 1C5YB 4K5ZA 3SO3A 4FUBA 1C5LH 2Y81A 5H4IB 2QA9E 2VWNA 5AFYH 1HAYB 4IBLH 4MNVA 1E0FD 3A80A 4AFZA 3SUGA 3Q76A 5FXLA 1W0YH 1HCGA 3A86A 1ZHRA 5EGMA 1TONA 4LOYH 2Y6TA 1SQTA 1WYKA 1SC8U 3DD2H 2F9UA 2PKAB 1Z8RA 3SUEA 1PPHE 4WXIA 1GI0A 4KELA 4I32A 1NM6A 4Y7AA 1DM4B 2WPJS 1HRTH 2D1JA 2OC0A 1MUEB 4JYUH 5J4QA 1LHGH 1XVOA 4UEHH 1AVGH 2CHAC 1SGNE 3OYPA 1OKXA 1BT7A 5I46H 1EOLA 1UO6A 1KY9A 3KQCA 3PV4A 3SN8A 1EZXC 4MNWA 1YCPM 1UTOA 3SU0A 2P8OB 3ZZBA 4MPVA 1ANEA 2PUQH 4CRCA 3EAJA 1MZDA 5PTPA 1GBDA 1YM0A 4Y79A 2ZKSA 1C5RA 1UVPA 1NRRH 1AB9C 3HKIB 2FOEA 1CT4E 1P11E 1OP2A 2V6NA 3GCHB 3GCTG 3SUFA 2BD8A 4KKDA 4B74A 3ZVCA 2C93B 1TX8A 5F03A 1NRPH 1ESTA 1HPGA 2EC9H 2BM2A 5CHAB 1N8OB 3MI4A 1S6HA 1XXDA 4WXVA 3TIUA 3V7TA 3RXKA 4WWYA 2W7UA 4J1YA 3A7YA 4AFSA 1Y8TA 1TGNA 1UVSH 4X6OA 4IMQA 1GPZA 1LPKB 1A46H 1ABIH 4ZHMU 3MTYA 1ACBE 4F49A 4YOGA 2B7DH 2GZ8A 5IDKA 1O2ZA 1H9HE 4NIVA 4OS2A 4B1TA 1EPTA 1DPOA 1TRMA 3L6PA 1S81A 1O0DH 5EU8A 3CS0A 3CS7A 1SGRE 1V2NT 4X1SU 1IQGA 1MCTA 1DWEH 2PV9B 3TH4H 1O3CA 1O33A 1GBIA 3NK8A 5JBCS 1JRTA 5AHGH 3T62A 5L2ZH 4GVUA 1TQ0B 1VITH 1HLTH 2FYQA 1SVPA 2DE8A 3HK3B 2AERH 1Y59T 2D26C 4ZKNU 3VB4A 4E05H 1F5KU 1G2LA 5HGGA 2VIWA 2HRVA 4I8GA 4XSKU 1QR3E 3TJVA 4AG1A 1GI2A 1OWEA 2QC2A 3SV9A 9LPRA 1EOJA 2BQ7B 1OWIA 1AVXA 3OY5U 3ZZ8A 1QL9A 1DXPA 3A85A 1OXGA 3BIUH 1XXFA 1O3PB 1GVLA 2SGAA 2OCVB 4DT7B 2PKSC 3QO6A 1RGQA 3OTJE 3TLOA 1OSSA 2THFB 2B0FA 2G8TA 1KXAA 1YPHC 1RTKA 2JH5D 1T31A 2FP7B 2G5NA 5A0AE 4IC6A 3EGKH 1O38A 1GL0E 4GHTA 1F92A 2Z94A 1H9LB 1OWDA 1AI8H 1CHGA 1GJAB 2BOHB 3MH7A 2H6MA 4D7GA 1YBWA 4K8BA 4ZKSU 4DCDA 3LH1A 2CMYA 1ESAA 1J8AA 2O8LA 3SGAE 1UK3A 1DT2A 1TABE 1A0HB 3RM2H 3LGIA 2A2XH 1BCUH 1MKXH 2H2ZA 2V3OH 3ATLA 3TGKE 1RTLA 1QIXB 3SHCH 5CMXH 3PMHB 2J4IA 1FY1A 1Y3WA 1K1IA 1ANCA 1GMCG 1TX7A 1SI5H 3B8JA 2ALPA 1V2VT 1AD8H 3LC5A 3T26A 2GV7A 1KLTA 5LPFA 1QA0A 5LH8A 3KHVA 1A1RA 1PYTC 3VB5A 1BTUA 2BMGB 1SMFE 1O5GH 2ZDNA 4Y0ZE 2JH0D 2FIRH 2CF8H 2Z3EA 4AGJA 3EYDA 1VCQA 3UR6A 2YNBA 1C2JA 4D9RA 1RXPA 3U8TH 2XC0A 3F9HA 1FQ3A 1L1GA 4AB9A 2BD2A 1V6DA 3M5MA 1TYNA 1C1WH 1UVOA 3EA9A 1RIWC 1Z1IA 2FS8A 2BDBA 2NU0E 3MNXA 4ZH8A 4BAMB 3BN9A 1GG6B 3ODFA 3ZVFA 3JZ2B 1B0FA 2F91A 1C2FA 2WV4A 2XCFA 3UQVA 4I8HA 2A4GA 2EI6A 1TWXB 1INCA 1LVMA 2FI3E 1XVMA 4TYDA 4AGKA 1J9CH 1G2MA 1SLWB 3K2UA 3KIDU 3LJOA 3KCGH 3SU5A 1SGIB 1O2MA 1AU8A 4IGDA 2Z6BD 2SNVA 4Y76A 3A7TA 4NSYA 2ZPSA 2ZHQH 2KAIB 1O3HA 2ZECA 1VZQH 3P8FA 2OXSA 3ZYEA 2OLGA 1LDTT 1DY8A 1FUJA 3TITA 2O9QA 2AMDA 2W7SA 2QF0A 1RTFB 1BTPA 2ANWA 2Z9GA 4Y11E 4FU8A 3KF2A 4UFEH 2D8WA 2XC4A 3HGNA 1CT2E 4KGAA 2UWPA 3PMBB 1FAKH 4INKA 1MQ5A 1BMLA 2TBSA 3MWIU 3PO1C 2VGCB 2ZCLP 2AH4X 1P06A 2R9PA 5FPYA 4FU9A 1KLJH 3TK5A 1MU8B 2FODA 1TAWA 3Q3KA 3VXFH 3UWJH 1ETSH 4NIXA 3MU0A 2ASUB 2QV1A 4ABHA 1WAYB 3PTBA 1O2IA 1CU1A 1HXEH 1Y3XA 1V3XA 1O3OA 1ZHPA 2W3KA 5C1YA 1FY8E 1LQEA 4Y71A 2GKVE 4XE4A 1EAUA 4SGAE 1PPGE 1TMUH 1UK2A 4NCYA 3MO9A 1S0RA 4ISLA 1UTMA 1O3EA 2CF9H 1MTWA 2SNWA 4YO9A 1V2UT 1S5SA 1OOKB 1S0QA 2V3HH 1IOEA 3ZYDA 4DJZB 3RU4E 3BTQE 1P2OA 1ZMJA 3BV9B 1BHXB 2DE9A 3GY4A 5L6NH 1DDJA 3LT3A 4BAKB 1YPHE 2OC7A 4NIWA 1B7XB 1G32B 1EAWA 1XM1A 1SGQE 1FAXA 2F9PA 2ZFPH 1L4DA 4U2WA 1N1LA 3LC3A 2H9TH 2QN5T 5TCAA 2YOLA 2Q6DA 3D23A 1YPJH 3HKJB 1LKBA 1Y5BT 1GBEA 1FY5A 1GJ5H 1ZPCA 2BY9X 1X7AC 4X8TH 1ZPZA 2BVXH 2Y82A 2ZI2H 4B76A 3LONA 4I8JA 1OWKA 2Y7XA 3P70B 4X2VA 4ZUHA 4CH8B 1GCTB 3SI3H 1HUTH 4X8UH 4U30A 2VNTA 2WINI 2BDAA 2G4TA 2SGEE 3TGJE 4TPYA 1TMTH 3AVZA 1UTKA 2A45B 3UR9A 1V2RT 2PUXB 3ENSB 3VXEH 1F0SA 1BRUP 2ZG0H 1KLIH 1CBWC 2H1UA 4TWWA 1S83A 3GCHC 1ESBA 3RXUA 1C5MD 3DFLA 1UTQA 3SV2H 3ZZ9A 5A8XA 1YLDA 3D62A 3MNCA 1GHXH 1GI3A 2ZU2A 5FPTA 1IQFA 6GCHG 1HDTH 3E0NB 3TH2H 5L2YH 1ELGA 3HPTB 1TGBA 3SV6A 1MBQA 4OS1A 3TK6A 1EKBB 3WY8A 1V2OT 2O8MA 1HYLA 3GCOA 1A5IA 1Z71A 2PW8H 2BB4A 3M36A 1AZ8A 4FXGH 2VIOA 1SPJA 1NT1A 1OWJA 1PQ7A 3ZVBA 4DURA 2J94A 1BRBE 1JWTA 4BAHB 4Y10E 4MLFB 3VB6A 1NU9A 1SGFG 4YLQH 4DOQA 3GDUA 4BNRA 4NFFA 2I6SA 6CHAB 4BAOB 1BMNH 3UREA 1A2CH 2EI8A 1KYNA 3MH4A 2EEKA 2VWOA 1XUJA 3TJOA 1MH0A 3EA8A 2RA0A 3BG8A 3A7WA 1W7XH 1P57B 3PTNA 3M37A 2ZNKH 2AGGX 4OS6A 1ZJKA 1TA6A 1B0EA 1AIXH 1JRSA 4YT6H 1A61H 3K6ZA 4ISNA 2BD9A 1GVKB 2VU8E 3RU4T 5C3NA 1AUJA 1XUFA 3QX5H 1WQVH 2STAE 3IWMA 1EZSC 3ZZCA 4WMEA 4TPIZ 1K2I1 4A5TS 3K65B 1DITH 1K22H 2ANKH 4KTSA 1O2VA 3BTHE 4MDSA 4J2YB 1NFWA 3ELAH 2BX3A 1GCDA 1O2WA 2ANMH 4ZAEA 3RXMA 2SFAA 3RXVA 1W0ZU 3SV7A 5A0CA 3BTME 1JMOH 3EA7A 3SNBA 3SU2A 2ZQ2A 3RXEA 2ZU3A 1GBHA 1KXFA 3RC4A 5FX5A 1GDUA 3TU7H 2GGVB 5C2ZA 4FUIA 2BDCA 1KTTB 1XX9A 1BTXA 3T29A 1FZZA 4ZHAA 1GBAA 1SLXB 3TNTA 3MYWA 4OGXA 1OX1A 3S7KB 3ZV8A 2WYGA 3OX7U 5GPIB 2RG3A 4Z0KA 4XDEA 4X1QU 4Y6DA 4X2YA 1DVAH 1V2WT 4JZIA 1ELDE 1W3CA 1QRXA 3DHKH 1T8NA 1TFXA 2J92A 2IPHA 4BXSA 1ELCA 5JB9S 4IMZA 2ZGXH 1QQUA 2FOFA 1MBMA 1AKSA 4OS5A 3P8NA 1THSH 1NESE 1AE5A 2NU4E 2JETC 4CR5A 1ZTLA 1TNLA 2HPQH 1Z8IB 2LPRA 3QZQA 3SQHE 3BTFE 3UNRA 1QJ6B 1U6QA 3SGQE 2FOHA 2HNTC 1EAXA 1ANDA 4Y8YA 1WV7H 5F6MA 3U1IB 4O9VA 1EX3A 1P03A 3BG4B 1K1NA 1GGDC 3I78A 2ZTXA 1GHAG 1F2SE 1P12E 1TX6A 1G3CA 7GCHF 1IQKA 1O5FH 1B5GH 3URDA 3VB3A 1W7GH 4X6NA 5E0GA 3QK1A 1FIWA 1GJ4H 1C1QA 3GDSA 4X0WU 1FY3A 3PLPA 4XFQA 2TPIZ 4INLA 3V13A 2VH6A 1DFPA 2VVCA 1LHDH 1LVOA 2CXVA 2Y80A 2PFEA 1Q3XA 1RIWB 4WF8A 4IN2A 1BB0B 4LK4A 5C67A 1YC0A 2DUCA 1GI5A 3VB7A 2NU1E 4HFPB 3RXSA 3C1KA 1P2MA 1EJAA 1ZGIA 3TJNA 4YESB 1FIZA 1D6WA 5GCHF 4D9QA 3RXPA 1LHCH 5DP7A 3LGWA 2AGEX 2XYAA 5BRRE 3GY2A 2ZFFH 2TGAA 3D65E 1C2GA 1C5UA 1UJ1A 3E8LA 4YZUA 1DXWA 2FX6A 4AB8A 2VJ1A 3H7OA 2BD4A 1O39A 2ZHEH 4HI3A 4Q80A 1WBGB 3K6YA 3SU6A 2ZPRA 4Y8XA 4CRDA 3Q77A 3F9EA 1ZZZA 5F8TA 4E7RG 2ZDAH 4AFUA 2PTCE 2ANYA 2BVRH 4JCNA 5JDUB 2AIQA 1K28D 2QXIA 4H42U 2A0QB 2GD4B 2BY7X 5JB8S 1JIRA 1ZGVA 3N7OA 1V2QT 1C5NH 2W5EA 1BJVA 4X8SH 4U01A 4A6LA 1C1UH 1GI7B 1XUKA 1VGCB 3ATMA 1C5PA 5K0HA 1C5TA 4D8NA 3SU4A 1QURH 4WH8A 1DS2E 4GAWA 4UD9H 1F5LA 3PLKA 3SBKA 3UOPA 2OC1A 1NRQH 1JIMA 4X1RU 1SFIA 4Q7YA 1WUNH 2A32A 2WPLS 1WCZA 1G30B 4FUJA 2VVUA 3SZNA 1GHBG 3OY6U 4ABBA 1AMHA 1BTYA 1G3EA 3EQ0H 3BTKE 4QT8C 1YPMH 1C5QA 7GCHG 1Z8JB 2NU2E 3RDZA 3SW2B 3E90B 5EXNA 7ESTE 1W10U 3RLWH 1GBJA 3NXPA 1VITG 3MNBA 2BXTH 4YOIA 5AFZH 1TE0A 3NPSA 2HLCA 3AAVA 2HALA 1QQ4A 4FUCA 6LPRA 2Z7FE 2ZPQA 1GWAA 3E1XB 3RXDA 1GHWH 4DY7B 1C9PA 1EQ9A 5EG4A 1GBLA 1CA0C 1SLUB 3I77A 2C8XB 1GMCF 3RC5A 2WUBA 1IQEA 5TJXA 1SBWA 1MTNB 1BRCE 1NO9H 1O2GH 4IC5A 4RSPA 2PSXA 2UUFB 2EA3A 3SJIA 3ZZ5A 1GMDG 1ZJDA 2ZU4A 1V2KT 1Y5AT 3T25A 5BPEA 1O31A 1QHRB 1O3JA 3BSQA 5A09A 8LPRA 4HTCH 4CREA 5GJ4B 1HAIH 1O2SA 1QB1A 2AYWA 1SGFA 1D3PB 2C8YB 2H5DA 2GT8A 1FPHH 1DSUA 4B2AA 3F1SB 5GIBA 2G5VA 4YTAA 1N8OC 2FM2A 1CBWB 5LGOA 1D3QB 1HAOH 3FAOA 1YYY1 1AHTH 3SORA 3OU0A 2F9OA 4XBCA 3UTUH 4MNXA 4O3UA 3BEUA 1K1JA 1KTSB 4MVNA 2M5TA 2PKAA 4MQAA 2P59A 3KEEA 4TY6A 3ZVDA 4THNH 5DPAA 2W26A 3MU5A 4D76A 4Q2KA 1S82A 1HJAB 4UE7H 1TB6H 3ZZDA 3AASA 3SNCA 3KQDA 1P2KA 1C5SA 5A2MH 2V35A 2I6QA 3GY3A 1TNKA 2G81E 2OBQA 1UCYH 2VH0A 1W11U 3TNSA 1YCPK 4H4FA 1VR1H 3QGJA 5DKMA 1AO5A 3TH3H 1LHEH 1SGTA 3R3GB 1QBOA 2WPHS 4K60A 4DVAU 1Z6JH 5IYTA 1EB1H 2Q1JA 1WOFA 3GY7A 3AW0A 1RJXB 1O35A 4SGBE 2ZA5A 3LGVA 1DICA 2ZHFH 2J9NA 4UONA 2Z9KA 2XCNA 2ZGCA 2AMPA 3UUZA 5C20A 3U1JB 1BOQA 2PKSB 3A7XA 1SGEE 4ZMAH 8GCHG 1H4WA 3S9AA 2LNCA 2O8WA 2Z9LA 1TNIA 1FMGA 3BF6H 2HWLB 2TGPZ 5B6OA 5ETXA 1OWHA 1EPTC 5F8XA 3M3TA 3BEFB 4UFFH 4NA7A 1PPEE 5ESBA 1UHBA 3V0XA 2ODPA 5K7RA 4GCHF 1VJ9U 2ZGBH 4H6TA 2P3FH 1IAUA 3UPEA 1OP8A 1YF4A 3H5CB 5GWZA 1O5CB 1TNJA 4GCHG 5EXLA 3E91A 2QXJA 3FVFB 1YPKH 1KXDA 3M3VA 1S84A 3DT0H 2XBVA 3KQBA 1UCYE 3O8DA 3GICB 1L0ZA 1NFXA 1TQ7B 4ISIH 1TRNA 1L1JA 1FPCH 1PYTD 2AIPA 2BLOA 3UY9A 3UQOA 4X1PU 3RXRA 5GCHG 1FJSA 1C5ZB 1DWCH 4JMYA 1LPZB 4FUDA 4GHQA 1EATA 1FLEE 2JETB 3KQEA 3UIRA 3B9FH 3JZ1B 3SNDA 3P8OA 4HZHA 1E36B 2XW9A 1QNJA 1K21H 4K3JA 4BANB 3AW1A 1TNHA 4BTTB 2A31A 1QBNA 1FN6A 2ZDKA 1DY9A 2ZFRH 4X8VH 1WU1A 1ETTH 4UDWH 1FONA 4XOJA 1QTFA 2QYIA 3A8CA 4K1EA 1IQNA 1GGDB 3A8DA 3DA9B 3SJOA 1RRKA 1JOUB 4X2XA 1P02A 2BZAA 1GG6C 2VINA 4JK5A 2UWLA 3KN2A 3MU8A 1G36A 1HNEE 2IJOB 2AS9A 3BEIB 4GSOA 1Y3YA 5E2PA 4UFDH 1UTJA 1QJ7B 1ZMLA 5HM2A 3FP6E 5T6GA 4WMDA 1HAVA 5LPEA 1JXPA 1P9SA 3URCA 3A87A 2XWAA 2A4QA 1PPBH 1NU7B 5I25A 1C4V2 5C5OA 1ZHMA 2QY0B 3M7QA 3L3TA 2BZ6H 2J95A 3GDVA 1BZXE 3U9AH 1C1MA 1LTOA 1F7ZA 3RU4D 2WPKS 4ISOA 3TPIZ 1C2KA 1Z7KA 2FYRA 1AGJA 1C2LA 4I31A 3RXOA 1TOMH 3V12A 3W94A 1P2QA 4DIIH 4OGYA 1HJ9A 1GI8B 3M5LA 2XNIA 2G52A 3A84A 2FO9A 2O8TA 2H9EH 3MO3A 1HAXB 2WV5A 1AFQC 3U8RH 1O2KA 1GI6A 3Q3YA 1O5EH 2AFQB 4JK6A 2XC5A 5A0BA 1CSOE 1THRH 1HAPH 2HNTF 4CHAC 1A0JA 1GMHF 1TPOA 2R3UA 1THPB 1SB1H 3IG6B 3V3MA 3ATIA 1CGHA 3SV8A 1MD7A 2TIOA 3HATH 1FN8A 2A5KA 2FEQH 2OINA 1O2OA 5HXFA 2BDYA 5FPSA 1T4VH 1O36A 1T8OA 2FOCA 1YPGH 5JYIA 4JZDH 1TPPA 1C2MA 1O32A 4O97A 3UWIA 2GMTB 2F83A 3RMLH 1O2RA 4BAQB 1KIGH 3LJJA 5J4SA 5JPMH 1ABJH 1G3BA 4A7IB 1MD8A 3VGCC 1N6XA 4ZHLU 5T6FA 1SG8B 1AY6H 2VIQA 2PSYA 3O8RA 1H8DH 2XWBI 1P0SH 1SOZA 4ABFA 3SJKA 1GBTA 4IW4E 1W12U 1IQHA 1KDQA 2PGBB 2SGFE 5EPYA 1HAZB 1P2JA 2G4UA 4I8KA 1MZAA 4O3TA 3C27B 2Q6GA 4ABIA 3RXIA 3T28A 1PQ8A 2TGDA 5FBIA 2ALVA 4E06H 1LHFH 3M5OA 1BMMH 3RXCA 3BTGE 1O2HA 2TGTA 4KP0A 4X6MA 3ZVGA 3S7HB 4B75A 2F9VA 1GBFA 1ELBA 1KSNA 3M7TA 1WQSA 2XTTB 3LDXH 1CA0B 2XRCA 1XKBC 1SR5C 1YCPH 1C2IA 1SFQB 1MTNC 1CO7E 3A8AA 2QXHA 1UTLM 4KTCA 2FI4E 3K9XB 1O34A 1MAXA 1C1VH 4JYTA 1NPMA 3GYLB 5ABWA 1CGIE 1XUHA 1YLCA 4I7YH 2Z3DA 2ZEBA 3RXFA 5SGAE 1DWDH 3CENA 3FZZA 1BMAA 2Z9JA 3O8BA 2WYJA 2G51A 4X2WA 5T3HA 1HFDA 5FHTA 2CV3A 1ELEE 1PPCE 4ESTE 3SNAA 2ESTE 1O2TA 4Q7ZA 1K1LA 4MPUA 3NKKA 4DIHH 1EJMA 2ILNA 3I29A 1HGTH 2ZCHP 4ABGA 1V2ST 2XXLA 3TJUA 2FS9A 1YKTA 1AFEH 4MTBA 1BITA 1TGTA 3FFGA 2FOBA 4OS4A 3MH5A 1QBVH 2ZZUH 1EAIA 1O3DA 2UUKB 1EP6A 2R0LA 3CP7A 1GHYH 1H9IE 4BTUB 5L30H 2GCHF 4NFEA 5EODA 3P8GA 1A4WH 5EPNA 1BHXF 3QDZB 3SHAH 3S0NA 3SGBE 2BVSH 1V2JT 1PPFE 4IN1A 1D9IA 9ESTA 2CHAB 2P3TB 1OYQA 5HM9A 2ZWLH 1ELVA 2ZFTA 2BY6X 4FVBA 3LKWA 1Y5UT 1HBTH 2QF3A 5AF9H 1QCPA 2BQWB 3G01A 1ZSKA 1EUFA 1HAHH 1PQAA 2Z3CA 1O3NA 4X1NU 5EQQA 1QY6A 2ZDMA 1CHOG 2BLWA 5DP3A 3PYHA 2OBOA 2ZO3H 1AB9B 2BXUH 1GJ9B 4HGCA 1TRYA 4NA9H 1SGYE 2RCEA 3STJA 1BDAA 3DFJA 1O30A 2PTNA 1GJBB 2NU3E 1WTGH 2OQUA 4NA8A 1PJPA 4FU7A 2FX4A 7LPRA 1BUIA 4YLUA 4AN7A 1LCYA 1TMBH 3QLPH 2FESH 1NFUA 1H8IH 2RA3A 1UCYK 2H9HA 4WY3A 1P8VC 8KME2 3OSYA 5A8YA 3QWCH 1TIOA 3A88A 2HOBA 4Y8ZA 4ISHH 3A83A 2ZTYA 2ZU1A 1EP5A 4NSVA 1Q31A 2O8UA 1ID5H 4CBOA 5C5NA 5TCCA 3A82A 2J2UA 1Q2WA 4AG2A 2A7JA 1C1RA 1O3LA 1ZSJA 1AQ7A 2ODYB 1NTPA 4WVPE 4CRFA 4X6PA 2BY8X 1A7SA 3ESTA 3HGPA 3SU1A 4A1VA 4D7FA 4JZEH 1GJ6A 3GYMA 1UMAH 3F68H 3W95A 1O5DH 4GUXA 2BD5A 3VFEA 4UFGH 4VGCB 2PHBA 1T4UH 1TGSZ 1TGCA 1A5HA 4O03A 3EDXB 4GPGA 3UFAA 2Y5HA 2B9LA 2GP9B 1AWFH 1P3CA 1C2HA 1MTUA 1HJ8A 2GCTC 3SU3A 1TBQH 1NC6A 1BBRE 1ZSLA 1GI9B 1PQ5A 4ZKOU 2G55A 5A8ZA 1P04A 2QIQA 1GHBF 1SOTA 3KGPA 1GJCB 2J38A 5ESTE 1NFYA 3VPKA 1QL8A 1NROH 1BIOA 2FPZA 3ITIA 1NZQH 4ZXXH 2KAIA 1NN6A 3A89A 3LGTA 1ELFA 2CJIA 2P94A 3LH3A 3QUMP 4A92A 3TGIE 2RDLA 1T32A 5DP6A 2A5IA 1UHBB 5E0JA 6GCHF 4M7GA 5JBBS 1SHHB 1C1SA 3PM3A 3LOXA 1XMNB 1TA2A 2OTVA 1TPSA 1MTVA 3ZVEA 4K8YA 1QGFA 2ZGJA 5EW2H 1A5GH 1VCPA 1ZLRA 2V0BA 3P17H 4CBNA 1P09A 1CVWH 2Y5GA 3GY6A 4ASHA 1F0TA 4PROA 1K1MA 1RS0A 2STBE 3RXAA 1MTSA 4JYVH 2WPIS 2XBWA 4TY7A 1D4PB 3ZZ7A 1IQJA 2VVVA 3RLYH 4YM9A 6ESTA 1LQDB 1OS8A 1W14U 1DSTA 7KMEH 2A7HA 4BXWA 2GVFA 3ATWA 3O8CA 4E7NA 2HVXA 1ELAA 1AE8H 2OQ5A 3E0PB 3SJ8A 1CGJE 1P05A 1AFQB 1L2EA 1SGDE 3QGNB 2BD7A 3MNSA 3MU1A 1HIAB 1GMHG 2C8ZB 2IN2A 2VIPA 4CHAB 3BTDE 2FOMB 2ZF0H 1W13U 4YOJA 1ORFA 1ZTKA 2OD3B 1DLKB 4AX9H 2G00A 1GHZA 1QB9A 1QRWA 1UVTH 2GZ9A 3GISB 3Q3XA 4TWYA 5C1XA 4F4OC 4MG3A 2UWOA 3LU9B 3TVJB 1YPLH 1BBRK 3F9FA 2ZQ1A 4RKOB 3M3SA 3RMOH 1J15A 3UOUA 1V2LT 4XBDA 1DE7H 1IHSH 1O5AB 1T8MA 2ZDVH 3IITA 4A1TA 3RXQA 4NWKA 2GMTC 3NZIA 3FP8E 2ZGHA 3HK6B 3MH6A 1DLEA 1GJDB 3M5NA 1EJNA 1O2LA 2ZFSA 1QL7A 5GDSH 1NS3A 1T7CA 1S85A 1D3DB 1EXFA 1SQAA 1C5XB 1YP9A 2ZP0H 4DG4A 2FLBH 1C5OH 1W2KH 4FUGA 8ESTE 1K1OA 2SGPE 5DK1A 1J17T 1E34B 2A4RA 2ZHDA 3GY5A 1ZYOA 1KXCA 3P92A 1PPZA 2FZZA 3AAUA 4RKJB 1MKWH 2VIDA 1MMJN 1XUGA 5E0HA 2A7CA 2P3UB 4AORA 1AZZA 1CQQA 1SGCA 2PGQB 8GCHF 2QGRA 2F9NA 2WUCA 5EW1H 1AWHB 2J34A 1BTWA 1C5VA 1ZOMA 3RXHA 4ZROA 1DX5M 3T5FH 4U32A 1O37A 4BTIB 2ZC9H 1HB0B 2ZTZA 3ZV9A 5DP5A 4AZ2B 1NY22 3GOVB 3LPRA 4CRGA 2PLXA 2QXGA 2GZ7A 3M61U 1AVWA 1GI4A 4K1TA 4MPXA 3ZZ6A 2CN0H 2P16A 3PROA 2R0KA 1ELTA 2BDHA 2C4FH 5FAHA 5EQRA 3BTWE 1GBBA 1MU6B
chains in the Genus database with same CATH superfamily
1YY3A 2C90B 5T6DA 3ZVAA 2P95A 1TBRH 1EZQA 1GHVH 2PWXA 3FZDA 4K69A 4LZ1H 2GX4A 2IOTA 3PWBA 1DANH 3S69A 1O3GA 2OUAA 1KDQB 2FTMA 1DUEA 1O3AA 1FNIA 3PWCA 4CRBA 3MO6A 2JKHA 4ABJA 4MNYA 1C9TA 1V2TT 2FOAA 2XOKD 4CRAA 3MU4A 2Z9IA 4AYYB 4FUHA 1HJAC 3BTTE 2XBXA 2FXRA 4NZLA 2BOKA 3FANA 1M9UA 3T2NA 2GCHG 3SQEE 4NWLA 5CDFE 1C1PA 1EZUC 2SGQE 3DUXH 2R2MB 1FY4A 3UNSA 1O2XA 2BDGA 2Q6FA 3S9CA 1HIAA 2YMSB 1A3EH 2FI5E 2P8OC 5C0TA 3PMAB 1O2PA 4NIYA 2VWLA 1LVBA 1GJ7B 2FOGA 3E16B 1YGCH 1E38B 2L74A 2BDIA 2K8IA 4BOHA 1P2NA 2R2WU 4IS5A 2K1QA 3QTVH 4B2BA 4ABAA 1K9OE 1E35B 1IHTH 1KXEA 1BTHH 5F8ZA 1GCTC 3RP2A 4K1SA 5JBTA 3RC6A 1DWBH 2SGDE 3GCTF 3RXJA 1ARCA 1O2NA 1S6FA 2ULLA 2P93A 3LIWA 2Y7ZA 5HYOA 1BRAA 1C2EA 1GJ8B 5CHAC 2ZCKP 3SNEA 1TOCB 2BY5X 1T8LA 2XBYA 1P3EA 4OS7A 5CE1A 1E37B 1EPTB 2C3SA 3FP7E 1D3TB 3QN7A 3F0PA 5DO4H 1CT0E 3RMMH 1UVUH 4JZ1A 1V2MT 3NWUA 5DP9A 2FMJA 3R0FA 1ZTJA 1Y3VA 3UNQA 2GDEH 4F48B 2VWMA 1LPGB 3GY8A 3M35A 5FBEA 2B5TB 1J16A 5E8EH 4Y7BA 5T1VA 4ZKRU 1VITF 1MKXK 4DGJA 1ZRKA 1J14A 6CHAC 2VBCA 1O3KA 2WPMS 3A7ZA 1MQ6A 3D49H 2AGIX 3SI4H 2HGTH 2VIVA 2JH6D 5EIYA 1LMWB 4A1XA 3B23B 1ARBA 4ABDA 2F3CE 2H5CA 4R0IA 4ACAA 4INHA 1BTZA 1NRSH 1MCVA 2A1DB 2GV6A 1SQRA 2JDID 3NRLA 1GBKA 1HV7A 3PB1E 3TK9A 2A5AA 3RXGA 1ZPBA 4B2CA 1EASA 2BTCE 4VGCC 3F6UH 1DOJA 1C1OA 1CA8B 2PR3A 1AUTC 1N6YA 4I33A 4RN6A 3H7TA 1SGPE 3LGUA 5G4BA 3RUOA 1O2JA 1RD3B 1UTNA 1TLDA 2ZFQH 3T27A 4JZFH 2A4OA 1LKAA 3ZZ4A 1F0UA 3U8OH 1Z1JA 4NG9H 1P2IA 2TRMA 1KXBA 2GCTB 1L4ZA 1JBUH 3KYFA 2QAAA 2XNDD 2C8WB 1D6RA 3MMGA 5AVDA 1TPAE 4CR9A 4ABEA 1BQYA 1A0LA 1OP0A 1V2PT 1VCWA 1NBME 1BBRH 1GL1A 1OPHB 1G3DA 3U69H 1FV9A 1IQMA 1RFNA 1SHYA 1SLVB 5DG6A 4WJG2 1EB2A 1P01A 2HPPH 3SUDA 2LP6A 5FCKA 1GVZA 3KL6A 2FLRH 2UUJB 3A8BA 2QCYA 1C4Y2 2BQ6B 4Z6AH 2KM0A 1GBMA 1G9IE 4RI0A 3SYJA 5DP4A 1Z8GA 2ZIQH 5FX6A 5DP8A 4B6EA 4CH2B 4LZ4B 1SL3A 1C2DA 1Z6EA 2ODQA 5EOKA 3RXTA 5EXMA 1GI1A 2BD3A 4ACBA 1O2UA 2B8OH 2W3IA 5E2OA 3A81A 2CGAA 1O2QA 1MAYA 1VKYA 4B6FA 1LO6A 1XUIA 2BHGA 2J98B 1PFXC 1L1NA 1LVYA 2BX4A 5EQSA 5HIYA 5C94A 1C1TA 1VJAU 2F9BH 1MKWK 2BLQA 2FWWA 1FXYA 4NZQA 3NUMA 4XBBA 1GHAF 2Y5FA 5FCRA 1QFKH 1WTHD 1WSSH 3FKSD 5DGJA 4B73A 4YT7H 4Q7XA 3BG4C 1F0RA 1HAGE 4K2YA 1IQLA 2HNTE 4TSFD 1CHOF 3BIVH 4GLYA 4WH6A 2OC8A 2OP9A 2GDDA 2R3YA 1GBCA 4FUFA 1AN1E 2BYAX 3PV2A 1QB6A 4LXBH 1MABB 3PLBA 2A2QH 4KTUA 4I8LA 2V3MA 5HMAA 1YPEH 2YNAA 3RMNH 1G37A 3BTEE 2GTBA 3SOSA 4FUEA 1P9UA 3STIA 4AFQA 1TBZH 2YMSD 4B71A 3PMJA 5LPRA 1F5RA 1IQIA 3KNXA 1HXFH 1QRZA 4NGAH 3VGCB 2GJGA 1O2YA 2QE7D 1UTPA 1ZMNA 3RXBA 3F2GA 1SQOA 3RXLA 1XKAC 1Y3UA 2BLVA 2EI7A 3MOCA 1QJ1B 1UK4A 1QA7A 1O3IA 1TNGA 3ATKA 3RM0H 3MFJA 3L33A 1SSXA 3P6ZB 3ZZAA 1ETRH 3GCNA 3QZRA 1C1NA 1ANBA 4H6SB 3ZZ3A 2NWNA 3E6PH 3A7VA 4WMFA 2AEIH 3EE0B 3QTOH 1FI8A 2M2AA 1GDQA 3F9GA 3E3TA 1NRNH 1W8BH 2UUYA 1O3FA 2VB0A 1GDNA 5GXPA 2FTLE 3PO1B 1DUAA 2VGCC 1ZRBA 3NCLA 1H1BA 4AOQA 3SJ9A 1FDPA 1O3BA 4R8TB 1C4U2 1CE5A 1GMDF 1O5BB 1P10A 4AYVB 3VEQB 1BJUA 2WZQA 5JBAS 4ZXYH 4FVDA 1W0KD 1VGCC 4DW2U 1HAVB 2ZDLA 1C5WB 5DJ7A 2JJ2D 5C1UA 1AKSB 1ZR0A 2QF4A 1BA8B 2CK3D 2ZU5A 1K1PA 2FDAA 3Q00A 3LGYA 2ZHWH 3MHWU 4Y0YE 3U98H 4MPWA 1OYTH 1TALA 3P95A 3S9BA 1S6LA 3ODDA 1O3MA 2AMQA 2GT7A 1A3BH 3M7UA 2D2DA 1C5YB 4K5ZA 3SO3A 4FUBA 1C5LH 2Y81A 5H4IB 2QA9E 2VWNA 5AFYH 1HAYB 4IBLH 4MNVA 4TT3D 1E0FD 3A80A 4AFZA 3SUGA 3Q76A 5C17A 5FXLA 1W0YH 1HCGA 3A86A 1ZHRA 5EGMA 1TONA 4LOYH 2Y6TA 1SQTA 1WYKA 1SC8U 3DD2H 2F9UA 2PKAB 1Z8RA 3SUEA 1PPHE 4WXIA 1GI0A 4KELA 4I32A 1NM6A 4Y7AA 1DM4B 2WPJS 1HRTH 2D1JA 2OC0A 1MUEB 4JYUH 5J4QA 1LHGH 1XVOA 4UEHH 1AVGH 2CHAC 1SGNE 3OYPA 1OKXA 1BT7A 5I46H 1EOLA 1UO6A 1KY9A 3KQCA 3PV4A 3SN8A 1EZXC 4MNWA 1YCPM 1UTOA 3SU0A 2P8OB 3ZZBA 4MPVA 1ANEA 2PUQH 4CRCA 3EAJA 1MZDA 5PTPA 1GBDA 1YM0A 4Y79A 2ZKSA 1C5RA 1UVPA 1NRRH 1AB9C 3HKIB 2FOEA 1CT4E 1P11E 1OP2A 2V6NA 3GCHB 3GCTG 3SUFA 2BD8A 4KKDA 4B74A 3ZVCA 2C93B 1TX8A 5F03A 1NRPH 1ESTA 1HPGA 2EC9H 2BM2A 5CHAB 1N8OB 3MI4A 1S6HA 1XXDA 4WXVA 3TIUA 3V7TA 3RXKA 4DT4A 3OEED 4WWYA 2W7UA 4J1YA 3A7YA 4AFSA 1Y8TA 1TGNA 1UVSH 4X6OA 4IMQA 1GPZA 1LPKB 1A46H 1ABIH 4ZHMU 3MTYA 1ACBE 4F49A 4YOGA 2B7DH 2GZ8A 5IDKA 1O2ZA 1H9HE 4NIVA 4OS2A 4B1TA 1EPTA 1DPOA 1TRMA 3L6PA 1S81A 1O0DH 5EU8A 3CS0A 3CS7A 1SGRE 1V2NT 4X1SU 1IQGA 1MCTA 1DWEH 2PV9B 3TH4H 1O3CA 1O33A 1GBIA 2J5UA 3NK8A 5JBCS 1JRTA 5AHGH 3T62A 5L2ZH 4GVUA 1TQ0B 1VITH 3OFND 3WWFA 1HLTH 2FYQA 1SVPA 2DE8A 3HK3B 2AERH 1Y59T 2D26C 4ZKNU 3VB4A 4E05H 1F5KU 1G2LA 2HVYB 3EE7A 5HGGA 2VIWA 2HRVA 4I8GA 4XSKU 1QR3E 3TJVA 2KZ4A 4AG1A 1GI2A 1OWEA 2QC2A 3SV9A 9LPRA 1EOJA 2BQ7B 1OWIA 5EJLA 1AVXA 3OY5U 3ZZ8A 1QL9A 1DXPA 3A85A 1OXGA 3BIUH 1XXFA 1O3PB 1GVLA 2SGAA 3FO8D 2OCVB 4DT7B 2PKSC 3QO6A 1RGQA 3OTJE 2JJ1D 3TLOA 1OSSA 2THFB 2B0FA 2G8TA 1KXAA 5DN6D 1H8ED 1YPHC 1RTKA 2JH5D 1T31A 1WDIA 2FP7B 2G5NA 5A0AE 4IC6A 3EGKH 1O38A 1GL0E 4GHTA 1F92A 2Z94A 1H9LB 1OWDA 3UB0A 1AI8H 1CHGA 1GJAB 2BOHB 3MH7A 2H6MA 4D7GA 5GNDA 3PRBA 1YBWA 4K8BA 4ZKSU 4DCDA 3LH1A 2CMYA 1ESAA 1J8AA 2O8LA 3SGAE 1UK3A 1DT2A 1KMHB 1A0HB 1TABE 3RM2H 3LGIA 2A2XH 1BCUH 1MKXH 2H2ZA 2V3OH 3ATLA 3TGKE 1RTLA 3WW7A 1QIXB 3SHCH 5CMXH 3PMHB 2J4IA 1FY1A 1Y3WA 1K1IA 1ANCA 1GMCG 1TX7A 1SI5H 1E1RD 3B8JA 2ALPA 1V2VT 1AD8H 3LC5A 3T26A 2GV7A 1KLTA 5LPFA 1QA0A 5LH8A 3KHVA 1A1RA 1PYTC 3VB5A 1BTUA 2BMGB 1SMFE 1O5GH 2ZDNA 4Y0ZE 2JH0D 2WHXA 2FIRH 2CF8H 2Z3EA 4AGJA 3EYDA 1VCQA 3UR6A 2YNBA 1C2JA 4D9RA 1RXPA 3U8TH 2XC0A 3F9HA 1FQ3A 1L1GA 4AB9A 2BD2A 1V6DA 3M5MA 1TYNA 1C1WH 1UVOA 3EA9A 1RIWC 1Z1IA 2FS8A 2BDBA 2NU0E 3MNXA 4ZH8A 4BAMB 3BN9A 1GG6B 3ODFA 3ZVFA 3JZ2B 1SKYE 1B0FA 2F91A 1C2FA 2WV4A 2XCFA 4XRNA 3UQVA 4I8HA 1FX0B 2A4GA 2EI6A 3PRDA 1TWXB 1INCA 1LVMA 2FI3E 1XVMA 1BMFD 4TYDA 4AGKA 1J9CH 1G2MA 1SLWB 3K2UA 3KIDU 3LJOA 3KCGH 3SU5A 1SGIB 1O2MA 2EQNA 3H09A 1AU8A 4IGDA 2Z6BD 2SNVA 4Y76A 3A7TA 4NSYA 2ZPSA 2ZHQH 2KAIB 1O3HA 2ZECA 1VZQH 3P8FA 2OXSA 3ZYEA 2KX4A 2OLGA 1LDTT 1DY8A 1FUJA 3TITA 2O9QA 2AMDA 2W7SA 1EFRD 2QF0A 1RTFB 1BTPA 2ANWA 2Z9GA 4Y11E 4FU8A 3KF2A 4UFEH 2D8WA 2XC4A 3HGNA 1CT2E 4KGAA 2UWPA 3PMBB 1FAKH 4INKA 1MQ5A 1BMLA 2TBSA 3MWIU 3PO1C 2VGCB 2ZCLP 2AH4X 1P06A 2R9PA 5FPYA 4FU9A 1KLJH 3TK5A 4ZCNA 1MU8B 2FODA 1TAWA 3Q3KA 3VXFH 3UWJH 1QZ8A 1ETSH 4NIXA 3MU0A 2ASUB 2QV1A 4ABHA 1WAYB 3PTBA 5EJ1A 1O2IA 1CU1A 1HXEH 1Y3XA 1V3XA 1O3OA 1ZHPA 2W3KA 5C1YA 1FY8E 1LQEA 4Y71A 2GKVE 4XE4A 4I86A 1EAUA 4SGAE 1PPGE 1TMUH 1UK2A 3N7DA 4NCYA 3MO9A 1S0RA 4ISLA 1UTMA 1O3EA 2CF9H 1MTWA 2SNWA 4YO9A 1V2UT 1S5SA 1OOKB 1S0QA 2V3HH 1IOEA 3ZYDA 4DJZB 3RU4E 3BTQE 1P2OA 1ZMJA 3BV9B 1BHXB 2DE9A 3GY4A 5L6NH 1DDJA 3LT3A 4BAKB 5HKKD 1YPHE 2OC7A 4NIWA 1B7XB 1G32B 1EAWA 1XM1A 1SGQE 1FAXA 2F9PA 2ZFPH 1L4DA 4U2WA 1N1LA 3LC3A 2H9TH 2QN5T 2YMSC 5TCAA 2YOLA 2Q6DA 3D23A 1YPJH 3HKJB 1LKBA 1Y5BT 1GBEA 1FY5A 1GJ5H 1ZPCA 2BY9X 1X7AC 4X8TH 1ZPZA 2BVXH 2Y82A 2ZI2H 2V7QD 4B76A 3LONA 4I8JA 1OWKA 2Y7XA 3P70B 4X2VA 4ZUHA 4CH8B 1GCTB 3SI3H 1HUTH 4X8UH 4U30A 1UW7A 2VNTA 2WINI 2BDAA 2G4TA 3OEHD 2SGEE 3TGJE 4TPYA 1TMTH 3AVZA 1UTKA 2A45B 2EY4C 3UR9A 1V2RT 2PUXB 3ENSB 3VXEH 1F0SA 1BRUP 2ZG0H 1KLIH 1CBWC 2H1UA 4TWWA 1S83A 3GCHC 1ESBA 3RXUA 1C5MD 3DFLA 1UTQA 3SV2H 3ZZ9A 5A8XA 1YLDA 3D62A 3MNCA 1GHXH 1GI3A 2ZU2A 5FPTA 1IQFA 6GCHG 1HDTH 3E0NB 3TH2H 5L2YH 1ELGA 3HPTB 1TGBA 3SV6A 1MBQA 4OS1A 3TK6A 1EKBB 3WY8A 1V2OT 2O8MA 1HYLA 3GCOA 1A5IA 1Z71A 2PW8H 2BB4A 3M36A 1AZ8A 4FXGH 1SPJA 2VIOA 1NT1A 1OWJA 1PQ7A 3ZVBA 4DURA 2J94A 1BRBE 1JWTA 4BAHB 4Y10E 4MLFB 3VB6A 1NU9A 1SGFG 4YLQH 4DOQA 3GDUA 4BNRA 4NFFA 2I6SA 6CHAB 4BAOB 1BMNH 3DSOA 3UREA 1A2CH 2EI8A 1KYNA 3MH4A 2EEKA 2VWOA 1XUJA 3TJOA 1MH0A 3EA8A 2RA0A 3BG8A 3A7WA 1W7XH 1P57B 4P02A 3PTNA 3M37A 2ZNKH 2AGGX 4OS6A 1ZJKA 1TA6A 1B0EA 1AIXH 1JRSA 4YT6H 1A61H 3K6ZA 4ISNA 2BD9A 1GVKB 2VU8E 3RU4T 5C3NA 1AUJA 1XUFA 3QX5H 1WQVH 2STAE 3IWMA 1EZSC 3ZZCA 4WMEA 4TPIZ 1K2I1 4A5TS 3K65B 1DITH 1K22H 2ANKH 4KTSA 1O2VA 3BTHE 4MDSA 4J2YB 1NFWA 3ELAH 2BX3A 1GCDA 1O2WA 2ANMH 4ZAEA 3RXMA 2SFAA 3RXVA 3MQKC 1W0ZU 3SV7A 5A0CA 3BTME 1JMOH 3EA7A 3SNBA 3SU2A 2ZQ2A 3RXEA 2ZU3A 1GBHA 1KXFA 3RC4A 5FX5A 1GDUA 3TU7H 2GGVB 5C2ZA 4FUIA 2BDCA 1KTTB 1XX9A 1BTXA 4P00A 3T29A 1FZZA 4ZHAA 1GBAA 1SLXB 3TNTA 3MYWA 4OGXA 1OX1A 3S7KB 3ZV8A 2WYGA 3OX7U 5GPIB 2RG3A 4Z0KA 4Q4LA 4XDEA 4X1QU 4Y6DA 4X2YA 1DVAH 1V2WT 4JZIA 1ELDE 1W3CA 1QRXA 3DHKH 1T8NA 1TFXA 2J92A 2AHME 2IPHA 4BXSA 1ELCA 5JB9S 4IMZA 2ZGXH 1QQUA 2FOFA 1MBMA 1AKSA 4OS5A 3P8NA 1THSH 1NESE 1AE5A 2NU4E 2JETC 4CR5A 1ZTLA 1TNLA 2HPQH 1Z8IB 2LPRA 3QZQA 3SQHE 1YLNA 3BTFE 3FN8A 3UNRA 1QJ6B 1U6QA 3SGQE 2FOHA 2HNTC 1EAXA 1ANDA 4Y8YA 1WV7H 5F6MA 3U1IB 4O9VA 1EX3A 5HIZA 1P03A 3BG4B 2F43B 2LELA 1K1NA 1GGDC 3I78A 2ZTXA 1GHAG 1F2SE 1P12E 1TX6A 1G3CA 4YXWD 7GCHF 1IQKA 1O5FH 4HG6A 1B5GH 3URDA 3VB3A 1W7GH 4X6NA 3CNRA 3QK1A 1FIWA 1GJ4H 1C1QA 3GDSA 5E0GA 4X0WU 1FY3A 3PLPA 4XFQA 2TPIZ 4INLA 3V13A 2VH6A 1DFPA 2VVCA 1LHDH 1LVOA 2CXVA 2Y80A 2PFEA 1Q3XA 1RIWB 4WF8A 2W6ID 4IN2A 1BB0B 4LK4A 5C67A 1YC0A 2DUCA 1GI5A 3VB7A 2NU1E 2KCOA 4HFPB 3RXSA 3C1KA 1P2MA 1EJAA 1ZGIA 3TJNA 4YESB 1FIZA 5B6LA 1D6WA 5GCHF 4D9QA 3RXPA 1LHCH 5DP7A 3LGWA 2AGEX 2XYAA 5BRRE 3GY2A 2ZFFH 2TGAA 3D65E 1C2GA 1C5UA 1UJ1A 3E8LA 4YZUA 1DXWA 2FX6A 4AB8A 2VJ1A 3H7OA 2BD4A 1O39A 2ZHEH 4HI3A 4Q80A 1WBGB 3K6YA 3SU6A 3ZIAD 2ZPRA 4Y8XA 4CRDA 3Q77A 3F9EA 1ZZZA 5F8TA 4E7RG 2ZDAH 4AFUA 2PTCE 2ANYA 2BVRH 4JCNA 5JDUB 2AIQA 1K28D 2QXIA 4H42U 2A0QB 2GD4B 2BY7X 5JB8S 1JIRA 2WV9A 1ZGVA 3N7OA 1V2QT 1C5NH 2W5EA 1BJVA 4X8SH 4U01A 4A6LA 1C1UH 1GI7B 1XUKA 4FOUC 1VGCB 3ATMA 1C5PA 5K0HA 1C5TA 4D8NA 3OTPA 3SU4A 1QURH 4WH8A 1DS2E 4GAWA 4ASUD 4UD9H 1F5LA 1YWUA 3PLKA 3SBKA 3UOPA 2OC1A 1NRQH 1JIMA 4X1RU 1SFIA 4Q7YA 1WUNH 2A32A 2WPLS 1WCZA 1G30B 4FUJA 2VVUA 3SZNA 1GHBG 3OY6U 4ABBA 1AMHA 1BTYA 1G3EA 3EQ0H 3BTKE 4QT8C 1YPMH 1C5QA 7GCHG 1Z8JB 4AC9A 2NU2E 3RDZA 3SW2B 3E90B 5EXNA 7ESTE 1W10U 3RLWH 3F3BA 1GBJA 3NXPA 1VITG 3MNBA 3VG8A 2BXTH 4YOIA 5AFZH 1TE0A 3NPSA 2HLCA 3AAVA 2HALA 1QQ4A 4FUCA 6LPRA 2Z7FE 2ZPQA 1GWAA 3E1XB 3RXDA 2WSSD 1GHWH 4DY7B 1C9PA 1EQ9A 5EG4A 1GBLA 1CA0C 1SLUB 3I77A 2KCPA 2C8XB 1GMCF 3RC5A 2WUBA 1IQEA 5TJXA 1SBWA 1MTNB 1BRCE 1NO9H 1O2GH 4IC5A 4RSPA 2PSXA 2UUFB 2EA3A 3SJIA 3ZZ5A 1GMDG 1ZJDA 2ZU4A 1V2KT 1Y5AT 3T25A 5BPEA 1O31A 1QHRB 1O3JA 3BSQA 5A09A 8LPRA 4HTCH 4CREA 5GJ4B 1HAIH 3GS9A 1O2SA 1QB1A 2AYWA 1SGFA 1D3PB 2C8YB 2H5DA 2GT8A 1FPHH 1DSUA 4B2AA 3F1SB 5GIBA 2G5VA 4YTAA 1N8OC 2FM2A 1CBWB 5LGOA 2J98A 1D3QB 1HAOH 3FAOA 1YYY1 1AHTH 3SORA 3OU0A 2F9OA 4XBCA 3UTUH 4MNXA 4O3UA 3BEUA 1K1JA 1KTSB 4MVNA 2M5TA 2PKAA 4MQAA 2P59A 3KEEA 4TY6A 5F53A 3ZVDA 4THNH 5DPAA 2W26A 3MU5A 4D76A 4Q2KA 1S82A 1HJAB 4UE7H 1TB6H 3ZZDA 2RDEA 3AASA 3SNCA 3KQDA 1P2KA 1C5SA 5A2MH 2V35A 2I6QA 3GY3A 1TNKA 3F2FA 5KGOA 2G81E 2OBQA 1UCYH 2VH0A 1W11U 3TNSA 1YCPK 4H4FA 1VR1H 3QGJA 5DKMA 1AO5A 3TH3H 1LHEH 4OM9A 1SGTA 3R3GB 1QBOA 2WPHS 4K60A 4DVAU 1Z6JH 5IYTA 2Q1JA 1EB1H 1WOFA 3GY7A 3AW0A 1RJXB 1O35A 4SGBE 2ZA5A 3LGVA 1DICA 2ZHFH 2J9NA 4UONA 2Z9KA 2XCNA 2ZGCA 2AMPA 3UUZA 5C20A 3U1JB 1BOQA 2PKSB 3A7XA 1SGEE 4ZMAH 8GCHG 1H4WA 3S9AA 2LNCA 2O8WA 2Z9LA 1TNIA 1FMGA 3BF6H 2HWLB 2TGPZ 5B6OA 5ETXA 1OWHA 1EPTC 5F8XA 3M3TA 3BEFB 4UFFH 4NA7A 1PPEE 5ESBA 1UHBA 3V0XA 4RT0A 2ODPA 5K7RA 4GCHF 1VJ9U 2J97A 2ZGBH 4H6TA 2P3FH 1IAUA 3UPEA 4F55A 1OP8A 1YF4A 3H5CB 5GWZA 1O5CB 1TNJA 4GCHG 5EXLA 2OK5A 3E91A 2QXJA 3FVFB 1YPKH 1KXDA 3M3VA 5EJZA 1S84A 3DT0H 2XBVA 3KQBA 1UCYE 3O8DA 3GICB 1L0ZA 1NFXA 1TQ7B 4ISIH 1TRNA 1L1JA 1FPCH 1PYTD 2AIPA 2BLOA 3UY9A 3UQOA 4X1PU 3RXRA 5GCHG 1FJSA 1C5ZB 1DWCH 4JMYA 1LPZB 4FUDA 4GHQA 1EATA 1FLEE 2JETB 3KQEA 3UIRA 3B9FH 3JZ1B 3SNDA 3P8OA 4HZHA 1E36B 2XW9A 1QNJA 1K21H 4K3JA 4BANB 3AW1A 1TNHA 4BTTB 3UAIC 2A31A 1QBNA 1FN6A 2ZDKA 1DY9A 2ZFRH 4X8VH 1WU1A 1ETTH 4UDWH 1FONA 4XOJA 1QTFA 2QYIA 3A8CA 4K1EA 1IQNA 1GGDB 3A8DA 3DA9B 3SJOA 1RRKA 1JOUB 4X2XA 1P02A 2BZAA 1GG6C 2VINA 4JK5A 2UWLA 3KN2A 3MU8A 1G36A 1HNEE 2IJOB 5CHBA 2AS9A 3BEIB 4GSOA 1Y3YA 5E2PA 4UFDH 3KYGA 1UTJA 1QJ7B 1ZMLA 5HM2A 3FP6E 5T6GA 4WMDA 1HAVA 2L6OA 5LPEA 1JXPA 1P9SA 3URCA 3A87A 2XWAA 2A4QA 1PPBH 1NU7B 5I25A 1C4V2 5C5OA 1ZHMA 2QY0B 3M7QA 3L3TA 2BZ6H 2J95A 3GDVA 1BZXE 3U9AH 2QF5A 1C1MA 1LTOA 1F7ZA 3RU4D 2WPKS 4ISOA 3TPIZ 1COWD 1C2KA 1Z7KA 2FYRA 1AGJA 1C2LA 4I31A 3RXOA 1TOMH 3V12A 3W94A 1P2QA 4DIIH 4OGYA 1HJ9A 1GI8B 3M5LA 2XNIA 2G52A 3A84A 2FO9A 3AK5A 2O8TA 2H9EH 3MO3A 1HAXB 2WV5A 1AFQC 3U8RH 1O2KA 1GI6A 3Q3YA 1O5EH 2AFQB 4JK6A 2XC5A 5A0BA 1CSOE 1THRH 1HAPH 2HNTF 4CHAC 1A0JA 1GMHF 1TPOA 2R3UA 1THPB 1SB1H 3IG6B 3V3MA 3ATIA 1NBMD 1CGHA 3SV8A 1MD7A 2TIOA 3HATH 1FN8A 2A5KA 2FEQH 2OINA 1O2OA 5HXFA 2BDYA 5FPSA 1T4VH 1O36A 1T8OA 2FOCA 1YPGH 5JYIA 4JZDH 1TPPA 1C2MA 1O32A 4O97A 3UWIA 2GMTB 2F83A 3RMLH 1O2RA 4BAQB 1KIGH 3LJJA 5J4SA 5JPMH 1ABJH 1G3BA 4A7IB 3N7EA 1MD8A 3VGCC 1N6XA 4ZHLU 5T6FA 1SG8B 1AY6H 2VIQA 2PSYA 3O8RA 1H8DH 2XWBI 1P0SH 1SOZA 4ABFA 3SJKA 1GBTA 4IW4E 1W12U 1IQHA 1KDQA 2PGBB 2SGFE 5EPYA 1HAZB 1P2JA 2G4UA 4I8KA 1MZAA 4O3TA 3C27B 2Q6GA 4ABIA 3RXIA 3T28A 1PQ8A 2TGDA 5FBIA 2ALVA 4E06H 1LHFH 3M5OA 1BMMH 3RXCA 3BTGE 1O2HA 2TGTA 4KP0A 4X6MA 3ZVGA 3S7HB 4B75A 2F9VA 1GBFA 3OE7D 1ELBA 1KSNA 3M7TA 1WQSA 2XTTB 3LDXH 1CA0B 2XRCA 1XKBC 1OHHD 4Q63A 1K0HA 1SR5C 1YCPH 1C2IA 1SFQB 1MTNC 1CO7E 3A8AA 2QXHA 1UTLM 4KTCA 2FI4E 3K9XB 1O34A 3WWBA 1MAXA 1C1VH 4JYTA 1NPMA 3GYLB 5ABWA 1CGIE 1XUHA 1YLCA 4I7YH 2Z3DA 2ZEBA 3RXFA 5SGAE 1DWDH 3CENA 3FZZA 1BMAA 2Z9JA 3O8BA 2WYJA 2G51A 4X2WA 5T3HA 1HFDA 5FHTA 2CV3A 1ELEE 1PPCE 4ESTE 3SNAA 2ESTE 1O2TA 4Q7ZA 1K1LA 4MPUA 3NKKA 4DIHH 1EJMA 2ILNA 3I29A 1HGTH 2ZCHP 4ABGA 1V2ST 2XXLA 3TJUA 2IJD1 2FS9A 1YKTA 1AFEH 2KCAA 5KEDA 3F2HA 4MTBA 4FETA 1BITA 1TGTA 3FFGA 2FOBA 3N99A 4OS4A 3MH5A 1QBVH 2ZZUH 1EAIA 1O3DA 2UUKB 1EP6A 2R0LA 3CP7A 1GHYH 1H9IE 4BTUB 5L30H 2GCHF 4NFEA 5EODA 3P8GA 1A4WH 5EPNA 1BHXF 3QDZB 3SHAH 3S0NA 2K0QA 2BVSH 3SGBE 1V2JT 1PPFE 4IN1A 1D9IA 3DSGA 9ESTA 2CHAB 2P3TB 2JIZD 1OYQA 5HM9A 2ZWLH 1ELVA 1W0JD 2ZFTA 2BY6X 4FVBA 3LKWA 1Y5UT 1HBTH 2QF3A 5AF9H 1QCPA 2BQWB 3G01A 1ZSKA 1EUFA 1HAHH 1PQAA 2Z3CA 1O3NA 4X1NU 5EQQA 1QY6A 2ZDMA 1CHOG 2BLWA 5DP3A 3PYHA 2OBOA 2ZO3H 1AB9B 2BXUH 1GJ9B 4HGCA 1TRYA 4NA9H 2F4LA 1SGYE 2RCEA 3STJA 1BDAA 3DSPA 3DFJA 1O30A 2PTNA 1GJBB 2NU3E 1WTGH 2OQUA 4NA8A 1PJPA 4FU7A 2FX4A 7LPRA 1BUIA 4YLUA 4AN7A 3FOAA 1LCYA 1TMBH 3F0OA 3QLPH 2FESH 1NFUA 5IK2D 1H8IH 2RA3A 1UCYK 2H9HA 4WY3A 1P8VC 8KME2 3OSYA 5A8YA 3QWCH 1TIOA 3A88A 2HOBA 4Y8ZA 4ISHH 3KQ5A 3A83A 2ZTYA 2ZU1A 1EP5A 4NSVA 1Q31A 2O8UA 1ID5H 4CBOA 5C5NA 5TCCA 3A82A 2J2UA 1Q2WA 4AG2A 2A7JA 1C1RA 1O3LA 1ZSJA 1AQ7A 2ODYB 1NTPA 4WVPE 4CRFA 4X6PA 1WXRA 2W6JD 2BY8X 1A7SA 3ESTA 3HGPA 3SU1A 4A1VA 4D7FA 4JZEH 1GJ6A 3GYMA 1UMAH 3F68H 3W95A 1O5DH 4GUXA 2BD5A 3VFEA 4UFGH 4VGCB 2PHBA 5KECA 1T4UH 4Z1MD 1TGSZ 5DSFA 1TGCA 1A5HA 4O03A 3EDXB 4GPGA 3UFAA 2Y5HA 2B9LA 2GP9B 1AWFH 1P3CA 3W1EA 1C2HA 1MTUA 1HJ8A 2GCTC 3SU3A 1TBQH 1NC6A 1BBRE 1ZSLA 1GI9B 1PQ5A 4ZKOU 2KR7A 2KCYA 2G55A 5A8ZA 1P04A 2QIQA 1GHBF 2WPDD 1SOTA 3KGPA 1GJCB 2J38A 5ESTE 1NFYA 3VPKA 1QL8A 1NROH 1BIOA 2FPZA 3ITIA 1NZQH 4ZXXH 2KAIA 1NN6A 3A89A 3LGTA 1ELFA 2CJIA 2P94A 3LH3A 3QUMP 4A92A 3TGIE 2RDLA 1T32A 5DP6A 2A5IA 1UHBB 2IPQX 5E0JA 6GCHF 4M9FA 4M7GA 5JBBS 1SHHB 1C1SA 4XD7D 1E1QD 3PM3A 3LOXA 1XMNB 1TA2A 2OTVA 1TPSA 1MTVA 3ZVEA 4K8YA 1QGFA 2ZGJA 5EW2H 1A5GH 1VCPA 1ZLRA 2V0BA 3P17H 4CBNA 1P09A 1CVWH 2RFKC 2HLDD 2Y5GA 3GY6A 4ASHA 1F0TA 4PROA 1K1MA 1RS0A 2STBE 3RXAA 1MTSA 4JYVH 2WPIS 2XBWA 4TY7A 1D4PB 3ZZ7A 1IQJA 5C0UA 2VVVA 3RLYH 4YM9A 6ESTA 1LQDB 1OS8A 1H8HD 3OAAD 1W14U 1DSTA 5FL7D 7KMEH 2A7HA 4BXWA 2GVFA 3ATWA 3O8CA 4RT1A 4E7NA 2HVXA 1ELAA 1AE8H 2OQ5A 3E0PB 3SJ8A 1CGJE 1P05A 1AFQB 1L2EA 1SGDE 3QGNB 1E79D 2BD7A 3MNSA 3MU1A 1HIAB 1GMHG 2C8ZB 2IN2A 2VIPA 4CHAB 3BTDE 2FOMB 2ZF0H 1W13U 3DCLA 4YOJA 1ORFA 1ZTKA 2OD3B 1DLKB 4AX9H 2G00A 1GHZA 1QB9A 1QRWA 1UVTH 2GZ9A 3GISB 3Q3XA 4TWYA 5C1XA 4F4OC 4MG3A 2UWOA 3LU9B 3TVJB 1YPLH 1BBRK 3F9FA 2ZQ1A 4RKOB 3M3SA 3RMOH 1J15A 3UOUA 2PP6A 1V2LT 4XBDA 1DE7H 1IHSH 1O5AB 1T8MA 2ZDVH 3IITA 4A1TA 3RXQA 4NWKA 2GMTC 3NZIA 3FP8E 2ZGHA 3HK6B 3MH6A 1DLEA 1GJDB 3M5NA 2KFWA 1EJNA 1O2LA 2ZFSA 1QL7A 5GDSH 1NS3A 1T7CA 1S85A 1D3DB 1EXFA 1SQAA 1C5XB 1YP9A 2ZP0H 4DG4A 3SZEA 2FLBH 1C5OH 1W2KH 4FUGA 8ESTE 1K1OA 2SGPE 5DK1A 1J17T 1E34B 2A4RA 2ZHDA 3GY5A 1ZYOA 1KXCA 3P92A 1PPZA 2FZZA 3AAUA 4RKJB 1MKWH 2VIDA 1MMJN 1XUGA 5E0HA 2A7CA 2P3UB 4AORA 1AZZA 1CQQA 1SGCA 2PGQB 8GCHF 2QGRA 2F9NA 2WUCA 5EW1H 1AWHB 3U28C 2J34A 1BTWA 1C5VA 1ZOMA 3RXHA 4ZROA 1DX5M 3T5FH 4U32A 1O37A 4BTIB 2ZC9H 1HB0B 2ZTZA 3ZV9A 5DP5A 4AZ2B 1NY22 3GOVB 3LPRA 4CRGA 2PLXA 2QXGA 2GZ7A 3M61U 1AVWA 1GI4A 4K1TA 3PV5A 4MPXA 3ZZ6A 2CN0H 2P16A 3PROA 2R0KA 1ELTA 2BDHA 2C4FH 5FAHA 5EQRA 3BTWE 1GBBA 1MU6B
chains in the Genus database with same CATH topology
2C90B 5T6DA 3ZVAA 2P95A 1TBRH 1EZQA 1GHVH 2PWXA 3FZDA 4K69A 4LZ1H 2GX4A 2IOTA 3PWBA 1DANH 3S69A 1O3GA 2OUAA 1KDQB 2FTMA 1DUEA 1O3AA 1FNIA 3PWCA 4CRBA 3MO6A 2JKHA 4ABJA 4MNYA 1C9TA 1V2TT 2FOAA 4CRAA 3MU4A 2Z9IA 4AYYB 4FUHA 1HJAC 3BTTE 2XBXA 2FXRA 4NZLA 2BOKA 3FANA 1M9UA 3T2NA 2GCHG 3SQEE 4NWLA 1C1PA 1EZUC 2SGQE 3DUXH 2R2MB 1FY4A 3UNSA 1O2XA 2BDGA 2Q6FA 3S9CA 1HIAA 1A3EH 2FI5E 2P8OC 3PMAB 1O2PA 4NIYA 2VWLA 1LVBA 1GJ7B 2FOGA 3E16B 1YGCH 1E38B 2BDIA 4BOHA 1P2NA 2R2WU 4IS5A 2K1QA 3QTVH 4B2BA 4ABAA 1K9OE 1E35B 1IHTH 1KXEA 1BTHH 5F8ZA 1GCTC 3RP2A 4K1SA 5JBTA 3RC6A 1DWBH 2SGDE 3GCTF 3RXJA 1ARCA 1O2NA 1S6FA 2ULLA 2P93A 3LIWA 2Y7ZA 5HYOA 1BRAA 1C2EA 1GJ8B 5CHAC 2ZCKP 3SNEA 1TOCB 2BY5X 1T8LA 2XBYA 1P3EA 4OS7A 5CE1A 1E37B 1EPTB 2C3SA 3FP7E 1D3TB 3QN7A 5DO4H 1CT0E 3RMMH 1UVUH 4JZ1A 1V2MT 3NWUA 5DP9A 2FMJA 3R0FA 1ZTJA 1Y3VA 3UNQA 2GDEH 2VWMA 1LPGB 3GY8A 3M35A 5FBEA 2B5TB 1J16A 5E8EH 4Y7BA 4ZKRU 1VITF 1MKXK 4DGJA 1ZRKA 1J14A 6CHAC 1O3KA 2WPMS 3A7ZA 1MQ6A 3D49H 2AGIX 3SI4H 2HGTH 2VIVA 2JH6D 1LMWB 4A1XA 3B23B 1ARBA 4ABDA 2F3CE 2H5CA 4R0IA 4INHA 1BTZA 1NRSH 1MCVA 2A1DB 2GV6A 1GBKA 1HV7A 3PB1E 3TK9A 2A5AA 3RXGA 1ZPBA 4B2CA 1EASA 2BTCE 4VGCC 3F6UH 1DOJA 1C1OA 1CA8B 2PR3A 1AUTC 1N6YA 4I33A 4RN6A 3H7TA 1SGPE 3LGUA 5G4BA 3RUOA 1O2JA 1RD3B 1UTNA 1TLDA 2ZFQH 3T27A 4JZFH 2A4OA 1LKAA 3ZZ4A 1F0UA 3U8OH 1Z1JA 4NG9H 1P2IA 2TRMA 1KXBA 2GCTB 1L4ZA 1JBUH 2QAAA 2C8WB 1D6RA 3MMGA 5AVDA 1TPAE 4CR9A 4ABEA 1BQYA 1A0LA 1OP0A 1V2PT 1VCWA 1BBRH 1GL1A 1OPHB 1G3DA 3U69H 1FV9A 1IQMA 1RFNA 1SHYA 1SLVB 5DG6A 4WJG2 1EB2A 1P01A 2HPPH 3SUDA 5FCKA 1GVZA 3KL6A 2FLRH 2UUJB 3A8BA 2QCYA 1C4Y2 2BQ6B 4Z6AH 1GBMA 1G9IE 5DP4A 1Z8GA 2ZIQH 5FX6A 5DP8A 4CH2B 4LZ4B 1SL3A 1C2DA 1Z6EA 2ODQA 5EOKA 3RXTA 5EXMA 1GI1A 2BD3A 1O2UA 2B8OH 2W3IA 5E2OA 3A81A 2CGAA 1O2QA 1MAYA 1LO6A 1XUIA 2BHGA 1PFXC 1L1NA 1LVYA 2BX4A 5EQSA 1C1TA 1VJAU 2F9BH 1MKWK 2BLQA 2FWWA 1FXYA 4NZQA 3NUMA 4XBBA 1GHAF 2Y5FA 5FCRA 1QFKH 1WTHD 1WSSH 5DGJA 4B73A 4YT7H 4Q7XA 3BG4C 1F0RA 1HAGE 4K2YA 1IQLA 2HNTE 1CHOF 3BIVH 4GLYA 4WH6A 2OC8A 2OP9A 2GDDA 2R3YA 1GBCA 4FUFA 1AN1E 2BYAX 1QB6A 4LXBH 3PLBA 2A2QH 4KTUA 4I8LA 5HMAA 1YPEH 2YNAA 3RMNH 1G37A 3BTEE 2GTBA 3SOSA 4FUEA 1P9UA 3STIA 4AFQA 1TBZH 4B71A 3PMJA 5LPRA 1F5RA 1IQIA 3KNXA 1HXFH 1QRZA 4NGAH 3VGCB 1O2YA 1UTPA 1ZMNA 3RXBA 1SQOA 3RXLA 1XKAC 1Y3UA 2BLVA 2EI7A 3MOCA 1QJ1B 1UK4A 1QA7A 1O3IA 1TNGA 3ATKA 3RM0H 3MFJA 3L33A 1SSXA 3P6ZB 3ZZAA 1ETRH 3GCNA 3QZRA 1C1NA 1ANBA 4H6SB 3ZZ3A 2NWNA 3E6PH 3A7VA 4WMFA 2AEIH 3EE0B 3QTOH 1FI8A 1GDQA 3F9GA 3E3TA 1NRNH 1W8BH 2UUYA 1O3FA 2VB0A 1GDNA 5GXPA 2FTLE 3PO1B 1DUAA 2VGCC 1ZRBA 3NCLA 1H1BA 4AOQA 3SJ9A 1FDPA 1O3BA 4R8TB 1C4U2 1CE5A 1GMDF 1O5BB 1P10A 4AYVB 3VEQB 1BJUA 5JBAS 4ZXYH 4FVDA 1VGCC 4DW2U 1HAVB 2ZDLA 1C5WB 5DJ7A 5C1UA 1AKSB 1ZR0A 1BA8B 2ZU5A 1K1PA 2FDAA 3Q00A 3LGYA 2ZHWH 3MHWU 4Y0YE 3U98H 4MPWA 1OYTH 1TALA 3P95A 3S9BA 3ODDA 1O3MA 2AMQA 2GT7A 1A3BH 3M7UA 2D2DA 1C5YB 4K5ZA 3SO3A 4FUBA 1C5LH 2Y81A 5H4IB 2QA9E 2VWNA 5AFYH 1HAYB 4IBLH 4MNVA 1E0FD 3A80A 4AFZA 3SUGA 3Q76A 5FXLA 1W0YH 1HCGA 3A86A 1ZHRA 5EGMA 1TONA 4LOYH 2Y6TA 1SQTA 1WYKA 1SC8U 3DD2H 2F9UA 2PKAB 1Z8RA 3SUEA 1PPHE 4WXIA 1GI0A 4KELA 4I32A 1NM6A 4Y7AA 1DM4B 2WPJS 1HRTH 2D1JA 2OC0A 1MUEB 4JYUH 5J4QA 1LHGH 1XVOA 4UEHH 1AVGH 2CHAC 1SGNE 3OYPA 1OKXA 1BT7A 5I46H 1EOLA 1UO6A 1KY9A 3KQCA 3PV4A 3SN8A 1EZXC 4MNWA 1YCPM 1UTOA 3SU0A 2P8OB 3ZZBA 4MPVA 1ANEA 2PUQH 4CRCA 3EAJA 1MZDA 5PTPA 1GBDA 1YM0A 4Y79A 2ZKSA 1C5RA 1UVPA 1NRRH 1AB9C 3HKIB 2FOEA 1CT4E 1P11E 1OP2A 2V6NA 3GCHB 3GCTG 3SUFA 2BD8A 4KKDA 4B74A 3ZVCA 2C93B 1TX8A 5F03A 1NRPH 1ESTA 1HPGA 2EC9H 2BM2A 5CHAB 1N8OB 3MI4A 1S6HA 1XXDA 4WXVA 3TIUA 3V7TA 3RXKA 4WWYA 2W7UA 4J1YA 3A7YA 4AFSA 1Y8TA 1TGNA 1UVSH 4X6OA 4IMQA 1GPZA 1LPKB 1A46H 1ABIH 4ZHMU 3MTYA 1ACBE 4F49A 4YOGA 2B7DH 2GZ8A 5IDKA 1O2ZA 1H9HE 4NIVA 4OS2A 4B1TA 1EPTA 1DPOA 1TRMA 3L6PA 1S81A 1O0DH 5EU8A 3CS0A 3CS7A 1SGRE 1V2NT 4X1SU 1IQGA 1MCTA 1DWEH 2PV9B 3TH4H 1O3CA 1O33A 1GBIA 3NK8A 5JBCS 1JRTA 5AHGH 3T62A 5L2ZH 4GVUA 1TQ0B 1VITH 1HLTH 2FYQA 1SVPA 2DE8A 3HK3B 2AERH 1Y59T 2D26C 4ZKNU 3VB4A 4E05H 1F5KU 1G2LA 5HGGA 2VIWA 2HRVA 4I8GA 4XSKU 1QR3E 3TJVA 4AG1A 1GI2A 1OWEA 2QC2A 3SV9A 9LPRA 1EOJA 2BQ7B 1OWIA 1AVXA 3OY5U 3ZZ8A 1QL9A 1DXPA 3A85A 1OXGA 3BIUH 1XXFA 1O3PB 1GVLA 2SGAA 2OCVB 4DT7B 2PKSC 3QO6A 1RGQA 3OTJE 3TLOA 1OSSA 2THFB 2B0FA 2G8TA 1KXAA 1YPHC 1RTKA 2JH5D 1T31A 2FP7B 2G5NA 5A0AE 4IC6A 3EGKH 1O38A 1GL0E 4GHTA 1F92A 2Z94A 1H9LB 1OWDA 1AI8H 1CHGA 1GJAB 2BOHB 3MH7A 2H6MA 4D7GA 1YBWA 4K8BA 4ZKSU 4DCDA 3LH1A 2CMYA 1ESAA 1J8AA 2O8LA 3SGAE 1UK3A 1DT2A 1TABE 1A0HB 3RM2H 3LGIA 2A2XH 1BCUH 1MKXH 2H2ZA 2V3OH 3ATLA 3TGKE 1RTLA 1QIXB 3SHCH 5CMXH 3PMHB 2J4IA 1FY1A 1Y3WA 1K1IA 1ANCA 1GMCG 1TX7A 1SI5H 3B8JA 2ALPA 1V2VT 1AD8H 3LC5A 3T26A 2GV7A 1KLTA 5LPFA 1QA0A 5LH8A 3KHVA 1A1RA 1PYTC 3VB5A 1BTUA 2BMGB 1SMFE 1O5GH 2ZDNA 4Y0ZE 2JH0D 2FIRH 2CF8H 2Z3EA 4AGJA 3EYDA 1VCQA 3UR6A 2YNBA 1C2JA 4D9RA 1RXPA 3U8TH 2XC0A 3F9HA 1FQ3A 1L1GA 4AB9A 2BD2A 1V6DA 3M5MA 1TYNA 1C1WH 1UVOA 3EA9A 1RIWC 1Z1IA 2FS8A 2BDBA 2NU0E 3MNXA 4ZH8A 4BAMB 3BN9A 1GG6B 3ODFA 3ZVFA 3JZ2B 1B0FA 2F91A 1C2FA 2WV4A 2XCFA 3UQVA 4I8HA 2A4GA 2EI6A 1TWXB 1INCA 1LVMA 2FI3E 1XVMA 4TYDA 4AGKA 1J9CH 1G2MA 1SLWB 3K2UA 3KIDU 3LJOA 3KCGH 3SU5A 1SGIB 1O2MA 1AU8A 4IGDA 2Z6BD 2SNVA 4Y76A 3A7TA 4NSYA 2ZPSA 2ZHQH 2KAIB 1O3HA 2ZECA 1VZQH 3P8FA 2OXSA 3ZYEA 2OLGA 1LDTT 1DY8A 1FUJA 3TITA 2O9QA 2AMDA 2W7SA 2QF0A 1RTFB 1BTPA 2ANWA 2Z9GA 4Y11E 4FU8A 3KF2A 4UFEH 2D8WA 2XC4A 3HGNA 1CT2E 4KGAA 2UWPA 3PMBB 1FAKH 4INKA 1MQ5A 1BMLA 2TBSA 3MWIU 3PO1C 2VGCB 2ZCLP 2AH4X 1P06A 2R9PA 5FPYA 4FU9A 1KLJH 3TK5A 1MU8B 2FODA 1TAWA 3Q3KA 3VXFH 3UWJH 1ETSH 4NIXA 3MU0A 2ASUB 2QV1A 4ABHA 1WAYB 3PTBA 1O2IA 1CU1A 1HXEH 1Y3XA 1V3XA 1O3OA 1ZHPA 2W3KA 5C1YA 1FY8E 1LQEA 4Y71A 2GKVE 4XE4A 1EAUA 4SGAE 1PPGE 1TMUH 1UK2A 4NCYA 3MO9A 1S0RA 4ISLA 1UTMA 1O3EA 2CF9H 1MTWA 2SNWA 4YO9A 1V2UT 1S5SA 1OOKB 1S0QA 2V3HH 1IOEA 3ZYDA 4DJZB 3RU4E 3BTQE 1P2OA 1ZMJA 3BV9B 1BHXB 2DE9A 3GY4A 5L6NH 1DDJA 3LT3A 4BAKB 1YPHE 2OC7A 4NIWA 1B7XB 1G32B 1EAWA 1XM1A 1SGQE 1FAXA 2F9PA 2ZFPH 1L4DA 4U2WA 1N1LA 3LC3A 2H9TH 2QN5T 5TCAA 2YOLA 2Q6DA 3D23A 1YPJH 3HKJB 1LKBA 1Y5BT 1GBEA 1FY5A 1GJ5H 1ZPCA 2BY9X 1X7AC 4X8TH 1ZPZA 2BVXH 2Y82A 2ZI2H 4B76A 3LONA 4I8JA 1OWKA 2Y7XA 3P70B 4X2VA 4ZUHA 4CH8B 1GCTB 3SI3H 1HUTH 4X8UH 4U30A 2VNTA 2WINI 2BDAA 2G4TA 2SGEE 3TGJE 4TPYA 1TMTH 3AVZA 1UTKA 2A45B 3UR9A 1V2RT 2PUXB 3ENSB 3VXEH 1F0SA 1BRUP 2ZG0H 1KLIH 1CBWC 2H1UA 4TWWA 1S83A 3GCHC 1ESBA 3RXUA 1C5MD 3DFLA 1UTQA 3SV2H 3ZZ9A 5A8XA 1YLDA 3D62A 3MNCA 1GHXH 1GI3A 2ZU2A 5FPTA 1IQFA 6GCHG 1HDTH 3E0NB 3TH2H 5L2YH 1ELGA 3HPTB 1TGBA 3SV6A 1MBQA 4OS1A 3TK6A 1EKBB 3WY8A 1V2OT 2O8MA 1HYLA 3GCOA 1A5IA 1Z71A 2PW8H 2BB4A 3M36A 1AZ8A 4FXGH 2VIOA 1SPJA 1NT1A 1OWJA 1PQ7A 3ZVBA 4DURA 2J94A 1BRBE 1JWTA 4BAHB 4Y10E 4MLFB 3VB6A 1NU9A 1SGFG 4YLQH 4DOQA 3GDUA 4BNRA 4NFFA 2I6SA 6CHAB 4BAOB 1BMNH 3UREA 1A2CH 2EI8A 1KYNA 3MH4A 2EEKA 2VWOA 1XUJA 3TJOA 1MH0A 3EA8A 2RA0A 3BG8A 3A7WA 1W7XH 1P57B 3PTNA 3M37A 2ZNKH 2AGGX 4OS6A 1ZJKA 1TA6A 1B0EA 1AIXH 1JRSA 4YT6H 1A61H 3K6ZA 4ISNA 2BD9A 1GVKB 2VU8E 3RU4T 5C3NA 1AUJA 1XUFA 3QX5H 1WQVH 2STAE 3IWMA 1EZSC 3ZZCA 4WMEA 4TPIZ 1K2I1 4A5TS 3K65B 1DITH 1K22H 2ANKH 4KTSA 1O2VA 3BTHE 4MDSA 4J2YB 1NFWA 3ELAH 2BX3A 1GCDA 1O2WA 2ANMH 4ZAEA 3RXMA 2SFAA 3RXVA 1W0ZU 3SV7A 5A0CA 3BTME 1JMOH 3EA7A 3SNBA 3SU2A 2ZQ2A 3RXEA 2ZU3A 1GBHA 1KXFA 3RC4A 5FX5A 1GDUA 3TU7H 2GGVB 5C2ZA 4FUIA 2BDCA 1KTTB 1XX9A 1BTXA 3T29A 1FZZA 4ZHAA 1GBAA 1SLXB 3TNTA 3MYWA 4OGXA 1OX1A 3S7KB 3ZV8A 2WYGA 3OX7U 5GPIB 2RG3A 4Z0KA 4XDEA 4X1QU 4Y6DA 4X2YA 1DVAH 1V2WT 4JZIA 1ELDE 1W3CA 1QRXA 3DHKH 1T8NA 1TFXA 2J92A 2IPHA 4BXSA 1ELCA 5JB9S 4IMZA 2ZGXH 1QQUA 2FOFA 1MBMA 1AKSA 4OS5A 3P8NA 1THSH 1NESE 1AE5A 2NU4E 2JETC 4CR5A 1ZTLA 1TNLA 2HPQH 1Z8IB 2LPRA 3QZQA 3SQHE 3BTFE 3UNRA 1QJ6B 1U6QA 3SGQE 2FOHA 2HNTC 1EAXA 1ANDA 4Y8YA 1WV7H 5F6MA 3U1IB 4O9VA 1EX3A 1P03A 3BG4B 1K1NA 1GGDC 3I78A