4XDEA

Coagulation factor xii protease domain crystal structure
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
241
Chain Sequence
VALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVSLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVSHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Coagulation factor XII
publication title Coagulation factor XII protease domain crystal structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.38: Coagulation factor XIIa.
pdb deposition date 2014-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xdeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xdeA01
1O3LA 3B9FH 5T6FA 1V2LT 4DJZB 5GXPA 1HRTH 3T29A 1ZHMA 2QXGA 1SGEE 2VGCC 2W5EA 2AGEX 1V3XA 1A1RA 1UVTH 1O38A 1P12E 2O8MA 2V35A 3C27B 3M3TA 1PQ5A 3D23A 1GBDA 2P8OC 3HATH 3SGAE 1KLIH 3STJA 2BX4A 2PKAB 3BG4B 1QQ4A 1Y3YA 4GUXA 1TNKA 2A4RA 3UNSA 1J16A 4MNXA 2ZFQH 1RXPA 4WMDA 4DIIH 1BB0B 1TNGA 5K7RA 1O2VA 1FIWA 1QY6A 4X2VA 4Y8YA 2B8OH 4X8VH 1YPJH 1FUJA 3A88A 5F03A 2J2UA 2BVRH 4THNH 2AS9A 1KDQA 4BANB 3JZ2B 1FY1A 2OQ5A 4XDEA 3SV6A 4Y7AA 4NCYA 2OQUA 1ELDE 4ZKRU 2P8OB 2UWOA 4U30A 4TPIZ 4D9QA 1BRBE 2VWOA 4JZDH 1UHBB 1K1MA 2PTCE 2JETC 1V2RT 1UJ1A 4DG4A 1HDTH 1P2MA 1ACBE 1UTMA 3PB1E 5G4BA 4BAQB 3MU1A 3IG6B 1C5NH 1EJMA 4FUGA 1GCTB 1BQYA 4WXIA 1O3CA 1GI1A 1PPFE 2FEQH 3OSYA 3RXUA 1D4PB 1T8LA 1QBNA 1TRYA 4DVAU 1Z1JA 1TWXB 1OP8A 4ABJA 1NY22 2YOLA 2BLVA 3DD2H 3BTDE 1BHXB 1GBMA 1SG8B 2OCVB 3BEFB 5AFZH 1TA6A 2D26C 1BRAA 5A8XA 1UCYK 8GCHG 4XE4A 3SU6A 3LGVA 5F8XA 2ZQ2A 1OP0A 3I77A 3S9BA 2TRMA 1QJ6B 1RD3B 2Q1JA 3P92A 3MU8A 2H9EH 1RFNA 5T6GA 2ZDAH 3L6PA 3A8BA 1T4VH 3LU9B 1O2NA 1V2UT 5A8YA 3H7TA 1T7CA 4IGDA 3A82A 2GT8A 3MU0A 5FX5A 3ATKA 1K1LA 2G5VA 2AMQA 1K1PA 1NRRH 1AE8H 1LHFH 2WPIS 4UEHH 1O2UA 3AW0A 2K1QA 2PSXA 4UD9H 4AYVB 1ELCA 1CSOE 3GDVA 4U01A 1MTNB 7KMEH 2VVVA 1PPHE 2WPHS 1HLTH 3A7WA 3ZV9A 2XWBI 4YOGA 1N8OC 2AYWA 3MH7A 4XBBA 4IC5A 1S81A 3A81A 4O03A 1GBJA 3BTFE 1QURH 1E37B 2A4GA 3UWIA 1UVUH 3GICB 4TY6A 1SGCA 1VITH 1P2NA 1C1UH 1SGRE 3MO9A 7GCHG 4NA9H 5JBAS 1C5YB 3GCHB 3B23B 4VGCC 2BQWB 1YPKH 1LVYA 1W8BH 2WV5A 1W10U 4Y76A 3TJOA 1BTXA 1ETRH 1AD8H 3GOVB 2ANYA 1UMAH 1Y5AT 3LJJA 1L4DA 3UOPA 2ZPSA 1GBEA 2Y81A 1AFEH 2BD3A 1OPHB 4B73A 2J9NA 1P09A 2RG3A 3M5OA 1O2RA 2CF9H 2ALVA 1CE5A 5BRRE 2PKAA 1C1QA 1BA8B 5F8ZA 4F49A 4K3JA 5DP7A 4JCNA 4BXSA 1C5SA 1WSSH 2A7JA 1ELBA 3AAVA 1GI0A 2SGAA 4CRGA 1PJPA 2FLBH 3TK6A 3TITA 1EXFA 4NG9H 4Y6DA 3S9CA 1MKWH 4NIVA 4WVPE 1W3CA 4OGYA 2AERH 1ZGVA 5DP5A 3RXLA 2J94A 1SSXA 3FZDA 1XX9A 2NWNA 1Z6JH 2THFB 2GZ8A 3LT3A 5JB8S 4HTCH 3BEIB 3TNTA 2OXSA 4JZEH 1TBQH 3ZZ9A 3MMGA 1HIAB 1SGFA 2Y80A 1KIGH 2F9BH 5DP8A 1GDNA 2P3FH 3MWIU 1YLDA 1UHBA 3BN9A 1A5GH 1C5ZB 1Z8JB 6LPRA 2C93B 2ZGHA 4K1TA 4AGKA 3M3VA 2V6NA 1C5RA 3P17H 3FP6E 1QHRB 1C1NA 1FXYA 4K60A 4H42U 2ZG0H 1MCTA 1U6QA 5HYOA 3RU4T 4JK6A 1XUKA 1FJSA 1QGFA 1HCGA 1ELFA 1G3EA 1O3NA 4AFUA 2B9LA 2ZHDA 3SJIA 2FODA 1QCPA 1OWDA 3EA9A 3VPKA 2I6QA 1NRQH 2FOFA 2Y82A 3BTHE 2GX4A 2OC8A 2W3KA 4Q80A 3A7ZA 1F7ZA 1S6HA 3M7TA 5JB9S 1TGTA 3FAOA 3SGQE 1LQDB 3ESTA 1O5CB 3M35A 3ZYEA 4GSOA 3S0NA 1G30B 1CA0C 1YYY1 3RXHA 2QV1A 2Z3CA 1EATA 2GP9B 4H6TA 4YT6H 3URDA 1T8NA 3OY5U 1KXAA 1GBCA 4IS5A 1AZ8A 1HBTH 1O32A 4CR9A 3GCOA 1IQNA 1YCPK 3ZVEA 4E06H 2G5NA 3UWJH 1SGDE 3UY9A 1XKAC 1C5LH 1WYKA 1UCYE 1T31A 1TGBA 1GI7B 1NFUA 3TK5A 1VJAU 2XCNA 3PO1B 3A85A 1A3EH 4X1RU 4NA8A 1JMOH 1BMAA 3SUEA 2HWLB 1AVXA 4UFGH 5FAHA 1GHWH 4NZQA 2FO9A 1AFQC 1W13U 1GBLA 4CHAC 3T5FH 1GJ5H 2UUFB 2Y5GA 1AMHA 1DXPA 2G8TA 1AHTH 2ZECA 4YOIA 4MNVA 2BTCE 1DLKB 1V2KT 1Z8IB 4ISLA 1IQFA 1EOJA 3ZVAA 5HGGA 4Y11E 3ZZ5A 1O3MA 8GCHF 1F0RA 1C1VH 1K9OE 3ITIA 2GGVB 3E16B 1K1OA 3P6ZB 1O5BB 1ZRKA 3A7YA 2R2MB 1XMNB 5LPFA 2BDAA 1GGDB 1E36B 2FOMB 1DFPA 2OTVA 2G4TA 2H9HA 2ZQ1A 2TGTA 1DE7H 1FY4A 3P70B 4INKA 4ZXXH 1SGTA 2ZA5A 1GG6C 4CHAB 2ZHFH 3FVFB 2HPQH 2QCYA 4SGAE 1AB9B 1MZAA 3VGCB 2ZDMA 2BY6X 1UTPA 1XUGA 1NZQH 2A5IA 1OS8A 2J4IA 3WY8A 1SLUB 2ZFTA 2TGAA 4CBOA 4AFZA 2B7DH 3LH1A 1QA7A 3KQEA 3LGWA 2F9UA 2Z9IA 2A7CA 1O2YA 1V2WT 1GPZA 4CRCA 1CQQA 2DE8A 1ZMJA 1O2XA 4A1TA 1JRTA 1W0YH 1TPPA 1W2KH 2BB4A 2ZGJA 1HIAA 3O8BA 3SN8A 4KP0A 3S7KB 3FP8E 2AIPA 1EAIA 4AB9A 4Y79A 4Q7YA 4R0IA 4H6SB 1WU1A 3UPEA 5A0AE 4D7GA 1FZZA 2C4FH 2ILNA 7GCHF 2CHAC 2CMYA 2QY0B 2ZIQH 5DGJA 1GJ7B 5GCHG 3SBKA 4JZ1A 2G4UA 2Z3EA 2BY7X 1O2WA 3DUXH 2A4QA 3E90B 3KQBA 1BTUA 1HAZB 1CHGA 1TBZH 3PMAB 4IN2A 1CVWH 1BRUP 1TMUH 2ZPRA 3QUMP 3U9AH 1EQ9A 4X8TH 4Y8ZA 3BSQA 4X2XA 1DVAH 2GCHG 4BNRA 5IYTA 1QR3E 1H8DH 3KQDA 3QTVH 4WF8A 4WJG2 1LVMA 3MNXA 1UK3A 5ESBA 3U8OH 4D8NA 1GMDG 4CRFA 1LHGH 3ZVDA 2VIDA 2CHAB 4DCDA 1O2TA 2GZ7A 5A0BA 1IHSH 4ABGA 1H9HE 1ZJDA 1AGJA 2BVSH 3LGTA 4AORA 1DS2E 5EG4A 1FY3A 3KNXA 1DLEA 1B0FA 2FP7B 4Y71A 3SGBE 3VB7A 4K1SA 4IN1A 3NWUA 2OC7A 4ISIH 4JMYA 1O3EA 3OTJE 1K1JA 1WCZA 9ESTA 1L4ZA 1Z7KA 2ANKH 1NRSH 5J4QA 2JH6D 4CRBA 5IDKA 3Q77A 2W7SA 2GT7A 3MI4A 1EPTC 2ZU5A 1PFXC 2EI8A 3NXPA 4AFSA 1P57B 1S6FA 3DFJA 5A0CA 2P93A 1NRPH 2QGRA 5CE1A 1QNJA 2IPHA 1P9SA 3EAJA 4E05H 3QWCH 4KKDA 2YNAA 3SU3A 2PLXA 2QF3A 4I32A 5FBEA 1O3FA 4IBLH 2XBXA 1CGJE 1VCWA 3RXIA 5A8ZA 4K5ZA 1EZQA 1GJ6A 2F91A 3H5CB 1GI9B 1ZRBA 1PPZA 1P3CA 3BTWE 1O0DH 4YLUA 2VVUA 1HJAC 2GV7A 4O97A 4INLA 2AEIH 1KTTB 2OP9A 4Y7BA 1LMWB 2HNTC 4LZ4B 3MHWU 2ZFPH 5TCCA 3SJOA 4Q7XA 3U69H 1AVGH 5FBIA 1EX3A 1TABE 1TNHA 2A32A 1P04A 1UK4A 1FIZA 1O37A 2CJIA 3GDSA 4IW4E 2BY8X 4K2YA 2G52A 1UTQA 1SLWB 1BMLA 2O9QA 3MO6A 5LPEA 3E6PH 4OS6A 2BLWA 2PWXA 3RP2A 4X6PA 3O8RA 1XXFA 3RXAA 1PQAA 1A2CH 2PHBA 1P03A 3TGKE 4TWYA 1O5AB 3AASA 1XVMA 1NRNH 3AW1A 1VJ9U 1XM1A 3A8CA 3RM2H 1EUFA 3A89A 1G3CA 3RM0H 2QXJA 1GJAB 1TFXA 3TGJE 4YZUA 2VWLA 1IQEA 2A2QH 5EXLA 9LPRA 3RXMA 1SB1H 3EE0B 2YNBA 1IHTH 1JIRA 4X1PU 6ESTA 1VCQA 1GHAG 1GMHF 2XBWA 2XWAA 1P11E 3A7TA 4MVNA 3OU0A 2WPMS 4ZXYH 2CV3A 1ELEE 4MG3A 4WY3A 1SBWA 1NROH 1C5TA 1O5DH 1P2JA 3SNAA 1YP9A 1G3DA 1RTFB 4RKJB 5SGAE 1EAXA 1KXFA 4BAHB 2ZU4A 1BITA 1FNIA 3SJKA 2TPIZ 2F9VA 2W7UA 2A2XH 1G37A 1HXEH 2C8ZB 4ISOA 4BAMB 1DX5M 1ELVA 2HPPH 3LJOA 1D6RA 5E2PA 4HFPB 2ZFRH 1Y5UT 1Y3XA 1JBUH 2SGPE 4LOYH 5EXMA 1G36A 5JBTA 2VGCB 4ZHAA 4B1TA 2GMTC 1P2QA 2VIWA 2NU0E 1O2JA 2J92A 3UTUH 4A1VA 2FX6A 3KIDU 1DSTA 1O3JA 1XUJA 1T32A 3A83A 3ENSB 3RXCA 1ZLRA 3EGKH 1TGNA 4B2CA 4WXVA 1MTSA 1EAWA 1HJ8A 1ZYOA 3P8FA 2Y7ZA 1J9CH 2FTLE 4MDSA 1O2GH 4OS1A 1EKBB 2BZ6H 3NZIA 1SQTA 1Y59T 4FVBA 3SZNA 1WTGH 4NZLA 3AAUA 1ZHPA 1O2MA 3ATMA 1DWBH 3PTNA 2PR3A 2VWNA 3OY6U 2J34A 1LO6A 1YPHE 2Q6FA 1K2I1 2WPJS 2Q6DA 2VIVA 3Q3XA 1QBVH 1RTKA 4B71A 1FPHH 2IN2A 2Z6BD 5HXFA 5GCHF 1SHYA 4MPVA 2ZU3A 2VIPA 3ZZBA 2JH0D 1ETTH 1CBWC 2JETB 3CS0A 3U1JB 5GIBA 1ZSJA 2XCFA 2WYGA 4ABBA 1IQJA 4MTBA 1LHEH 1VCPA 2ZPQA 1C1MA 1HAVB 2XC0A 2GCHF 1K1IA 3MYWA 2A31A 3SNDA 1Y5BT 1SVPA 1PYTC 2W26A 3W94A 4IMZA 1GMDF 3RMLH 4BAKB 3QZQA 1IOEA 1L1NA 2BDYA 1BTYA 3PM3A 1TX7A 3RXFA 3SNBA 4B74A 3KCGH 3RXTA 1UVOA 1YGCH 1SGFG 2GD4B 1SHHB 1CBWB 1MZDA 4JYTA 2IJOB 1LHCH 1TYNA 1ARBA 4YTAA 4A1XA 2PGQB 3IWMA 3MH6A 5PTPA 3RXJA 1HNEE 1M9UA 4I8LA 5TCAA 3RXDA 4XBDA 1BJVA 4WH6A 4AYYB 1Y3WA 3EYDA 2ZGCA 5CHAC 2BY5X 5EU8A 1O3OA 8ESTE 1WV7H 1C2IA 4D76A 1LVBA 1AU8A 2F9PA 1MAXA 1TE0A 1SQOA 1GHBF 1DANH 2R0KA 5C1UA 1DWDH 2ALPA 3K9XB 2FLRH 1BOQA 5DO4H 5GPIB 3P8NA 2XRCA 1E34B 5DP9A 4WMEA 1MAYA 3CENA 1HAXB 1NT1A 4J2YB 2VB0A 3SHCH 1BBRK 1EJAA 1LHDH 1Q2WA 2V0BA 1ZTJA 4DIHH 3T28A 1HAIH 4YLQH 2FM2A 5ESTE 1XUIA 3GYMA 2VWMA 1MKXH 4NIYA 1GI6A 1C5XB 1ESBA 1N8OB 3LC5A 1E35B 4GAWA 1MQ5A 4Y10E 4CREA 3O8CA 4NSYA 2ZCKP 3K6ZA 4YM9A 2ZI2H 1ABIH 4ISNA 2C3SA 1FI8A 1NO9H 4FXGH 3SUDA 3FANA 1C1SA 3MNBA 4VGCB 4MNYA 3PWBA 1YPGH 2PFEA 4CH2B 3MNCA 3GY5A 3V0XA 1OX1A 3SJ9A 2R9PA 1O3KA 1QBOA 2VNTA 4JZIA 3I29A 4WH8A 4HI3A 3PMJA 2XTTB 3T62A 1S84A 1A0HB 4K8YA 1QB6A 3MH5A 2XW9A 3SU0A 3T25A 1LPKB 3CS7A 1THSH 6GCHG 4OS2A 1HB0B 2PSYA 4NIXA 4K1EA 1GI2A 3RLYH 3LC3A 1Y3UA 4IC6A 4I8KA 3RXOA 1O2LA 1AZZA 2G55A 1A46H 1C5VA 1QJ7B 3F9GA 5C20A 2J38A 1ZSLA 1AN1E 1D3PB 2A1DB 3M5LA 2O8LA 2ZGXH 1ID5H 4FUBA 1WTHD 3L3TA 2G51A 1P10A 2GKVE 3JZ1B 2B0FA 1SFIA 4ZKSU 1GHAF 1GHXH 3ATLA 1J17T 2VIQA 4XOJA 1GMCG 2C90B 5EPNA 2AH4X 3M7QA 1CT2E 2ESTE 2HOBA 1EB1H 1OWKA 1Q31A 3RXVA 5DPAA 5ABWA 1N6YA 1JWTA 3S7HB 1QTFA 1P2IA 1HAVA 5L6NH 3EA8A 2HLCA 2ZDVH 4CH8B 6CHAC 2NU2E 1MBMA 3MU4A 2XYAA 3TH2H 3VB5A 4CRDA 4DURA 3E91A 3LDXH 2Q6GA 1L0ZA 1HAOH 1C5UA 2ZCHP 5EPYA 2Z3DA 1F5RA 2SNVA 4X2WA 2FWWA 5DK1A 2SGEE 1C9PA 1SGNE 4SGBE 3GY7A 1BTZA 2HRVA 5E0JA 2QYIA 1O3AA 1MUEB 1EASA 3UUZA 3MU5A 3SU5A 3TPIZ 5EW2H 2BZAA 3TH3H 3NPSA 4GPGA 3LH3A 1DUAA 2ODPA 2ODQA 3VB3A 1QL9A 1W14U 4IMQA 4CBNA 7LPRA 1QA0A 1UTKA 3SOSA 1CA0B 1O2HA 3SW2B 1DOJA 3MO3A 1AUJA 5DP4A 2ZNKH 3D49H 1WQSA 4PROA 1TMTH 1VR1H 2ZF0H 1CT0E 1YPEH 1PPBH 3P95A 4BOHA 1GMHG 1ELGA 1V2JT 1TIOA 3F9HA 2AGIX 2M5TA 2FI4E 1JOUB 2UWLA 2UUJB 5A2MH 1OWHA 3QLPH 2BDGA 3RXBA 2FESH 4ISHH 1AO5A 2FOEA 2BQ7B 4Q7ZA 2ANMH 4ZH8A 1C2GA 2AMDA 3D62A 3GY8A 4TYDA 1K1NA 1MMJN 2ASUB 1DSUA 4XSKU 2Z94A 1AFQB 3DHKH 4YO9A 1HXFH 3MOCA 2SNWA 4JZFH 3SUFA 1IQHA 1TGCA 1K21H 1DICA 3KN2A 1WQVH 1T8OA 3RXRA 4Y0ZE 1C2MA 1ESTA 1G3BA 1GBFA 2BD5A 3TGIE 3KEEA 4X6NA 2UUYA 3BTGE 2Z9LA 4NA7A 1K28D 1DT2A 4RN6A 2A4OA 1BBRE 3E8LA 3RLWH 2ZTXA 1ZZZA 1IQKA 1C1RA 1DM4B 1ZPBA 2FI3E 4NFEA 4XFQA 5L2YH 1GHVH 1QRWA 1NM6A 1TPOA 2BOKA 2OLGA 2SGFE 5FPSA 3TJVA 1P01A 1GG6B 1UCYH 3HKIB 1SI5H 2GCTC 3A7XA 3MH4A 1GJ8B 2ZZUH 3EDXB 5HM9A 1L1JA 3SQEE 2EA3A 1O2SA 3ZZAA 3STIA 2BVXH 1BHXF 3PYHA 1Z8GA 2BY9X 2ZWLH 1TQ7B 1B5GH 2FX4A 3U8RH 1AI8H 2AGGX 2Z9KA 1C2KA 4TWWA 4ZUHA 1W12U 1GVLA 1TGSZ 1MCVA 2FZZA 3ZV8A 1Z6EA 3KL6A 1BUIA 1TNLA 2BDHA 4NIWA 1OWEA 1V2NT 1OYTH 1UTJA 4NWKA 2H9TH 2V3HH 1P2KA 3QDZB 2VH6A 1JXPA 1HYLA 1NS3A 1T8MA 1O31A 1EB2A 1O2QA 2P59A 2G00A 1C5OH 1O3IA 1MH0A 1QIXB 2CGAA 3V12A 1OSSA 5E8EH 3GY6A 3M37A 4OS5A 1GBIA 1ZMLA 4X1NU 1VZQH 2F3CE 1W7GH 1EP5A 1ORFA 1A5IA 2BM2A 2A0QB 1DWCH 1C4V2 2QXIA 1V2PT 1UK2A 4FUHA 1FONA 1C2HA 1S85A 3SV2H 2F83A 3RMOH 4A6LA 3QTOH 2BXTH 2FOBA 2EI7A 3T26A 2QA9E 1KSNA 3A80A 3ZZ7A 4ABFA 3EQ0H 1C5QA 1CT4E 1O3DA 3ODDA 1NESE 3HK3B 4D7FA 6GCHF 3DA9B 1FN6A 1CHOG 1ZSKA 2ZGBH 1DDJA 1QQUA 1MU8B 1O30A 3FFGA 3ATIA 4K8BA 1RRKA 1C5PA 1GHBG 3SI4H 4UFDH 3SV7A 1QRXA 4MPUA 2XBVA 2GVFA 2WV4A 3A87A 3SV9A 2ODYB 1ANCA 2LPRA 3M36A 1YKTA 1N6XA 1KY9A 4FUEA 2TIOA 4B2BA 3U8TH 1MKWK 3N7OA 1ELAA 4X0WU 2ZFFH 5ETXA 2P95A 2UWPA 4O3UA 1GMCF 2D2DA 5E2OA 2P3UB 3RU4D 1O35A 3FZZA 1QL8A 1XVOA 2Z9JA 1EPTB 3F9EA 4TPYA 2WPKS 3BTKE 2Z7FE 2HGTH 5FHTA 2FOCA 2BD7A 3PROA 4KTSA 1GL1A 2SGDE 3L33A 4CRAA 3LKWA 3ZZ8A 2A45B 5FX6A 1GWAA 1A3BH 2O8UA 1ANBA 1H8IH 3K6YA 2H1UA 1UTLM 4GVUA 1BMNH 4YESB 2AFQB 1YM0A 3UREA 1TPAE 2R3UA 3QN7A 5FPYA 2HVXA 1RIWC 1O5GH 4RKOB 3QGNB 1FV9A 1O36A 1QFKH 1TNIA 1ZOMA 2RA3A 2LNCA 2WUBA 2BDCA 2PTNA 4NGAH 4DY7B 4Z6AH 2OC0A 3SO3A 1HJAB 2GDEH 1PYTD 3F1SB 1SFQB 5LH8A 2PKSC 3MTYA 4KELA 1P9UA 1GJDB 2PUQH 1FY8E 4F4OC 2H5DA 5AHGH 1ANDA 1QRZA 1A0LA 3V13A 3BG8A 1P8VC 1O2OA 3PLPA 1LPZB 3SNEA 2SGQE 1TRMA 3BIVH 1V2VT 1HUTH 4DW2U 3BG4C 2BMGB 5GJ4B 5E0GA 5FCKA 2BDBA 1TNJA 2STAE 2BOHB 3HGPA 3GY2A 1UVPA 1D3TB 1C2FA 1BIOA 4X2YA 2O8TA 1Y3VA 1D3QB 2BQ6B 3A86A 3UR6A 3UR9A 1V2TT 1TBRH 4ABDA 3VEQB 1VGCC 2IOTA 2PKSB 1SL3A 1DY8A 1YCPH 4R8TB 4I31A 4AGJA 1W11U 1V2OT 2CF8H 3F9FA 3IITA 1NFXA 1C1WH 1IQLA 1BZXE 3K65B 4Y0YE 1ZJKA 2BHGA 4K69A 1BTPA 2KAIB 3TK9A 4LK4A 2ZHEH 3ZYDA 4CR5A 1CGHA 1VITG 1P2OA 1GCTC 1VGCB 1V2MT 5F8TA 1QB1A 2BLQA 1SGPE 5AF9H 5FXLA 2QC2A 1LKBA 3S69A 4UDWH 1GCDA 4I8JA 1L2EA 4AX9H 1ZPZA 3LONA 5JBBS 2G81E 2GMTB 1O3GA 2ZO3H 1SGQE 2ZFSA 4BTTB 2FPZA 4AOQA 1TB6H 3M61U 4GHQA 3SU2A 3UOUA 2JH5D 1A61H 2BX3A 1TPSA 3KHVA 3S9AA 1G32B 1GVZA 3RMNH 1D6WA 4MNWA 2Y6TA 2FIRH 3PLKA 1C4U2 2WUCA 1GBTA 1HV7A 1GDQA 4TY7A 2EI6A 2HNTE 1IAUA 1UVSH 3ZVCA 1F2SE 1SQAA 2C8XB 2ZEBA 1O3BA 1EPTA 3LOXA 4INHA 3SUGA 1TX6A 4ABEA 2ZDLA 2B5TB 3ZVGA 4FU8A 1F5KU 1C1OA 1IQIA 3RDZA 3KF2A 3SORA 2F9OA 8KME2 1PQ7A 3SU1A 1FDPA 1MU6B 1MTNC 5CMXH 4BTIB 3BF6H 1AVWA 2STBE 1C2LA 2R0LA 3TIUA 3VB6A 4FUJA 3SNCA 2DE9A 1MD7A 2D1JA 2TBSA 2ZU1A 1GJ4H 1OYQA 1DPOA 5DP6A 2QIQA 1NU7B 1Z71A 1GL0E 1CHOF 2J95A 3DFLA 2BD9A 2H5CA 4ZHMU 1TQ0B 1AKSB 5E0HA 5DJ7A 2GTBA 3GCHC 4HZHA 1AWFH 3PTBA 2ZHWH 4FU7A 2EC9H 5C1YA 4U32A 2R2WU 3M3SA 4ESTE 2XXLA 1G9IE 2D8WA 3RC5A 1TAWA 1NN6A 1RJXB 3HKJB 2VINA 1BCUH 4DT7B 1C5MD 1O39A 4BTUB 2TGDA 1ESAA 5CHAB 4MPXA 2PW8H 3A84A 1A5HA 3R0FA 3RC6A 3RXKA 1CO7E 3QGJA 3HGNA 3O8DA 3UFAA 1GJCB 2FOAA 4B76A 5C2ZA 1EZUC 2A5AA 3VXFH 5LPRA 8LPRA 1DUEA 3RMMH 1C2JA 1UTOA 3PLBA 3BEUA 1PPEE 1GVKB 4OS4A 5TJXA 3V7TA 2QF0A 1RTLA 1W0ZU 3HPTB 2Z9GA 1T4UH 2EEKA 3RU4E 4J1YA 3TJUA 4FUIA 3SHAH 3M5NA 1CA8B 3BTTE 4UFEH 1ETSH 5F6MA 1TA2A 4AG1A 5EOKA 2BD2A 1O2KA 2KAIA 4A7IB 1HFDA 1XXDA 3SV8A 1NU9A 1THPB 2DUCA 1DITH 1BDAA 4ZMAH 5JBCS 3GDUA 1V6DA 2VVCA 1A4WH 1THRH 5I25A 1P05A 5C1XA 2ZKSA 1MTVA 3ELAH 1SGYE 1LCYA 3RXQA 1Z8RA 2OD3B 3VXEH 3TLOA 4I33A 2OBOA 4UONA 1N1LA 2P3TB 1O2ZA 2FMJA 2R3YA 5EQSA 5C5NA 3AVZA 4AFQA 5EW1H 4YT7H 2OUAA 2FOGA 4GCHG 3RUOA 1OXGA 3KGPA 1JIMA 1F5LA 4KTUA 1O3HA 4WWYA 2PUXB 1MQ6A 3GCTG 4Z0KA 4ABHA 1BJUA 3PWCA 2C8YB 1D3DB 1YPLH 5EQRA 1TRNA 4WMFA 3FP7E 3F6UH 3GYLB 3NUMA 3OX7U 1NPMA 1EZXC 1NFWA 2ZTZA 1ANEA 4Q2KA 2XC4A 1K22H 2XC5A 4FU9A 2FOHA 3VFEA 4DGJA 2ZTYA 3NKKA 1F92A 1MTWA 4ZKNU 1NFYA 1XKBC 3ZZDA 5C67A 1DXWA 4YOJA 1TOMH 1SLXB 3U98H 1IQMA 1AY6H 1D9IA 3A8DA 5HMAA 2NU3E 1O34A 3OYPA 4ABIA 1PPCE 2AIQA 2FS9A 3ZVFA 2O8WA 1O5EH 3PO1C 2ZDKA 1O3PB 1L1GA 2P94A 1DY9A 1F0TA 4NWLA 1VITF 2GV6A 5T3HA 2BXUH 3LGYA 1XUHA 1QJ1B 1WUNH 3V3MA 3U1IB 1ZTLA 4AZ2B 4E7NA 1GDUA 1UO6A 6CHAB 1E0FD 1J15A 1YPMH 2HNTF 4MLFB 1H1BA 1EJNA 3ZZCA 5EGMA 4ZHLU 3QZRA 1AKSA 3RXGA 4UFFH 1CU1A 3SJ8A 1S83A 3M7UA 1OP2A 1SPJA 2ULLA 1ZR0A 4X8SH 3QK1A 3LPRA 3URCA 3A8AA 3E0PB 2WINI 1AQ7A 1ARCA 1S0QA 3PMHB 5GDSH 3ZZ4A 4LZ1H 3RXSA 1OKXA 4A5TS 2BDIA 1C4Y2 2AMPA 3EA7A 4MPWA 1O2IA 1KXCA 3ODFA 1LTOA 1GGDC 5T6DA 2P16A 2ZHQH 1OWJA 3P8GA 5A09A 1WOFA 1ZPCA 1AE5A 4D9RA 3BTEE 3UNRA 3TJNA 1HAPH 3T27A 1YLCA 3Q3YA 1BRCE 1H9LB 1NC6A 1WAYB 1AB9C 3VGCC 5K0HA 4GLYA 2H2ZA 1P3EA 4AN7A 2FYRA 3E1XB 4LXBH 1EOLA 3RXEA 2TGPZ 1MD8A 3RC4A 3SI3H 5FPTA 4QT8C 3A7VA 1S82A 3TVJB 1INCA 1FN8A 3KQCA 4FUCA 1O2PA 1JRSA 1C5WB 3D65E 3QO6A 5C5OA 3T2NA 3BIUH 4HGCA 1PQ8A 3VB4A 1KXEA 1GJ9B 2QXHA 1SGIB 1P06A 1ZMNA 1P02A 2NU4E 2CN0H 3ATWA 1DWEH 1B7XB 4X6OA 1OWIA 2VH0A 1KYNA 2H6MA 2JKHA 4E7RG 2ZC9H 1GBAA 4OGXA 5H4IB 3GY4A 4ZKOU 4I7YH 1ZGIA 1OOKB 3UNQA 1KXDA 5B6OA 4BXWA 1C1TA 3GY3A 1W7XH 4B75A 1O5FH 5EQQA 2XBYA 3P8OA 1YC0A 2HALA 5EXNA 1F0UA 2I6SA 4I8HA 4ASHA 3MFJA 1AWHB 1LPGB 2ZCLP 1LDTT 2ZP0H 4DOQA 4I8GA 1SOTA 1BT7A 1V2QT 1GI5A 1TLDA 2FXRA 4FUFA 4UE7H 3B8JA 1WBGB 1YCPM 1CGIE 1RGQA 2GCTB 1Q3XA 1KLTA 1H9IE 1AUTC 1MBQA 2F9NA 2XNIA 4ABAA 1HJ9A 4AG2A 2GDDA 1HPGA 4ZROA 1LVOA 3NCLA 2UUKB 3UQOA 2BD4A 4OS7A 4X6MA 1GBHA 4JK5A 4Y8XA 2BD8A 1LKAA 3E0NB 3ZVBA 1O33A 1TOCB 4ZAEA 4NSVA 1A7SA 1V2ST 1P0SH 1XUFA 1A0JA 3G01A 3ZZ3A 5JDUB 2FDAA 1FY5A 3R3GB 2VIOA 2C8WB 5DG6A 4O9VA 2FYQA 1FMGA 1KTSB 2FI5E 1KDQB 1ZTKA 1B0EA 1TONA 5J4SA 3LGIA 2SFAA 1QL7A 1S5SA 2VU8E 3TNSA 3SU4A 1KLJH 2Y5HA 1GI3A 4AB8A 1BBRH 2PGBB 3LIWA 1MKXK 2WPLS 2OC1A 2QAAA 2RCEA 4X1QU 1FPCH 5L2ZH 5AVDA 1LQEA 2ANWA 2W3IA 4GHTA 1FQ3A 1GHZA 1YF4A 4FUDA 3Q3KA 2RA0A 2V3OH 3DT0H 2CXVA 4B2AA 2ZU2A 5JYIA 1EZSC 2ZDNA 1S0RA 4GCHF 4A92A 2A7HA 1TMBH 5BPEA 3W95A 2FTMA 5DP3A 3Q00A 4M7GA 3I78A 3F68H 1HAGE 3GCTF 1BTHH 1Y8TA 3E3TA 4JYVH 1C2DA 5JPMH 1YBWA 4FVDA 1AIXH 3HK6B 1SC8U 2BLOA 3QX5H 4X1SU 2Y5FA 2PV9B 3UQVA 5HM2A 1G2LA 1J8AA 1UTNA 1FAXA 3SQHE 5FCRA 2OINA 3Q76A 1GI4A 2Y7XA 3RXPA 1YPHC 3K2UA 1SOZA 2VJ1A 5DKMA 4KGAA 1GBBA 1C2EA 1ABJH 1BMMH 1HAHH 4O3TA 3BV9B 1C9TA 1E38B 1TALA 2BYAX 2RDLA 5GWZA 2NU1E 4JYUH 3NK8A 3PV4A 1G2MA 1BTWA 1F0SA 1QB9A 4RSPA 1HAYB 1EP6A 2WYJA 5EODA 1RS0A 2A5KA 2QN5T 1TX8A 3TH4H 1X7AC 2GZ9A 3M5MA 1GI8B 3C1KA 5AFYH 4KTCA 1HGTH 4X8UH 1Z1IA 1GBKA 1C1PA 7ESTE 3MNSA 4BAOB 1ZHRA 1GJBB 3BTQE 5L30H 1FAKH 1KXBA 1RIWB 4MQAA 1H4WA 3PMBB 5C3NA 2OBQA 1IQGA 4NFFA 3GCNA 5I46H 1GHYH 3LGUA 1J14A 1FLEE 1EAUA 1MTUA 3TU7H 3ZZ6A 1SMFE 1SLVB 5LGOA 1SR5C 1NTPA 3GISB 3H7OA 1PPGE 3UIRA 3CP7A 4H4FA 3BTME 2FS8A 4U2WA 1ELTA 4XBCA
chains in the Genus database with same CATH superfamily
1O3LA 3B9FH 5T6FA 1V2LT 4DJZB 5GXPA 1HRTH 3T29A 1ZHMA 2QXGA 1SGEE 2VGCC 2W5EA 1WDIA 2AGEX 1V3XA 4OM9A 1A1RA 1UVTH 1O38A 1P12E 2O8MA 2V35A 3C27B 3M3TA 1PQ5A 3D23A 1GBDA 2P8OC 3HATH 3SGAE 1KLIH 3STJA 2BX4A 2PKAB 3BG4B 1QQ4A 1Y3YA 4GUXA 1TNKA 2A4RA 3UNSA 1J16A 4MNXA 2ZFQH 1RXPA 4WMDA 4DIIH 1BB0B 1TNGA 5K7RA 1O2VA 1FIWA 1QY6A 4X2VA 2CK3D 4Y8YA 2M2AA 4P00A 2B8OH 2KR7A 4X8VH 1YPJH 1FUJA 3A88A 5F03A 2J2UA 2BVRH 4THNH 2AS9A 1KDQA 4BANB 3JZ2B 1FY1A 2OQ5A 4XDEA 3SV6A 4Y7AA 4NCYA 2OQUA 1ELDE 4ZKRU 2P8OB 2UWOA 4U30A 4TPIZ 4D9QA 1BRBE 2VWOA 4JZDH 1UHBB 1K1MA 2PTCE 2JETC 1V2RT 1UJ1A 4DG4A 1HDTH 1P2MA 1ACBE 1UTMA 2OK5A 3PB1E 1KMHB 5G4BA 4BAQB 3MU1A 3IG6B 1C5NH 1EJMA 4FUGA 1GCTB 1BQYA 4WXIA 1O3CA 1GI1A 1PPFE 2FEQH 3OSYA 3RXUA 1D4PB 1T8LA 1QBNA 1TRYA 4DVAU 1Z1JA 1TWXB 1OP8A 4ABJA 1NY22 2YOLA 2BLVA 3DD2H 3BTDE 1BHXB 1GBMA 1SG8B 2OCVB 5C94A 3BEFB 5AFZH 1TA6A 2D26C 1BRAA 5A8XA 1UCYK 8GCHG 4XE4A 3OE7D 3SU6A 3LGVA 5F8XA 2ZQ2A 1OP0A 3UAIC 3I77A 3S9BA 2TRMA 1QJ6B 1RD3B 2Q1JA 3P92A 3MU8A 2H9EH 1RFNA 5T6GA 2ZDAH 3L6PA 3A8BA 1T4VH 3LU9B 1O2NA 1V2UT 5A8YA 2IPQX 3H7TA 1T7CA 4IGDA 3A82A 2GT8A 3MU0A 5FX5A 3ATKA 3AK5A 3ZIAD 1K1LA 2G5VA 2AMQA 1K1PA 1NRRH 2V3MA 1AE8H 1LHFH 2WPIS 4UEHH 1O2UA 3AW0A 2K1QA 2PSXA 4UD9H 4AYVB 1ELCA 1CSOE 3GDVA 4U01A 1MTNB 7KMEH 2VVVA 1PPHE 1NBMD 2WPHS 3F0OA 1HLTH 3A7WA 3ZV9A 2XWBI 2WHXA 4YOGA 1N8OC 2AYWA 3MH7A 4XBBA 4IC5A 1S81A 3A81A 4O03A 1GBJA 3BTFE 1QURH 1E37B 2A4GA 3UWIA 1UVUH 3GICB 4TY6A 3N99A 1SGCA 1VITH 1P2NA 1C1UH 1SGRE 3MO9A 7GCHG 4NA9H 5JBAS 1C5YB 3GCHB 3B23B 4VGCC 2BQWB 1YPKH 1LVYA 1W8BH 2WV5A 1W10U 4Y76A 3TJOA 1BTXA 3KQ5A 1ETRH 1AD8H 3GOVB 2ANYA 1UMAH 1Y5AT 3LJJA 1L4DA 3UOPA 2ZPSA 1GBEA 2Y81A 1AFEH 2BD3A 1OPHB 4B73A 2J9NA 1P09A 2RG3A 3M5OA 1O2RA 2CF9H 2ALVA 1YWUA 1CE5A 5BRRE 2PKAA 1C1QA 2J5UA 1BA8B 5F8ZA 4F49A 4K3JA 5DP7A 4JCNA 4BXSA 1C5SA 1WSSH 2A7JA 1ELBA 3AAVA 1GI0A 2QF5A 2SGAA 4CRGA 1PJPA 2FLBH 3TK6A 3TITA 1EXFA 4NG9H 4Y6DA 3S9CA 1MKWH 4NIVA 4WVPE 1W3CA 4OGYA 2AERH 1ZGVA 5DP5A 3RXLA 2J94A 3F2HA 1SSXA 3FZDA 1XX9A 2NWNA 1Z6JH 2THFB 2GZ8A 3LT3A 5JB8S 4HTCH 3BEIB 3TNTA 2OXSA 4JZEH 1TBQH 3DSOA 3ZZ9A 2F43B 3MMGA 1HIAB 1SGFA 2Y80A 1KIGH 2F9BH 5DP8A 1GDNA 2P3FH 3MWIU 3H09A 1EFRD 1YLDA 1UHBA 3BN9A 1A5GH 1C5ZB 1Z8JB 6LPRA 2C93B 2ZGHA 4K1TA 4Q63A 4AGKA 3M3VA 2V6NA 1C5RA 3P17H 3FP6E 1QHRB 1C1NA 1FXYA 1BMFD 4K60A 4H42U 2ZG0H 1MCTA 1U6QA 5HYOA 3RU4T 4JK6A 1XUKA 1FJSA 1QGFA 1HCGA 1ELFA 1G3EA 1O3NA 4AFUA 2B9LA 2ZHDA 3SJIA 2FODA 1QCPA 3PV2A 1OWDA 3EA9A 3VPKA 2HLDD 2I6QA 1NRQH 2FOFA 3OFND 2Y82A 3BTHE 5EJLA 2GX4A 2OC8A 2W3KA 4Q80A 3A7ZA 1F7ZA 2KCOA 1S6HA 3M7TA 5JB9S 1TGTA 3FAOA 3SGQE 1K0HA 1LQDB 3ESTA 1O5CB 3M35A 3ZYEA 4GSOA 3S0NA 1G30B 1CA0C 1YYY1 3RXHA 2QV1A 2Z3CA 1EATA 2GP9B 4H6TA 4YT6H 3URDA 1T8NA 3OY5U 1KXAA 1GBCA 4IS5A 1AZ8A 1HBTH 1O32A 2KM0A 4CR9A 5EJ1A 3GCOA 1IQNA 1YCPK 3ZVEA 4E06H 2G5NA 3UWJH 1SGDE 3UY9A 1XKAC 1C5LH 1WYKA 1UCYE 1T31A 1TGBA 1GI7B 1NFUA 3TK5A 1VJAU 2XCNA 3N7DA 3A85A 3PO1B 1A3EH 3OAAD 4X1RU 4NA8A 1JMOH 1BMAA 3SUEA 1E1QD 2HWLB 1AVXA 4UFGH 5FAHA 1GHWH 4NZQA 2FO9A 1AFQC 1W13U 1H8ED 1GBLA 4CHAC 3T5FH 1GJ5H 2UUFB 2Y5GA 1AMHA 1DXPA 2G8TA 1AHTH 2ZECA 4YOIA 4MNVA 2BTCE 1DLKB 1V2KT 1Z8IB 4ISLA 1IQFA 1EOJA 3ZVAA 5HGGA 4Y11E 3ZZ5A 1O3MA 8GCHF 1F0RA 1C1VH 1K9OE 3ITIA 2GGVB 3E16B 2L6OA 1K1OA 3P6ZB 5HIZA 1O5BB 1ZRKA 3A7YA 2R2MB 1XMNB 5LPFA 3OTPA 2BDAA 1GGDB 1E36B 2FOMB 1DFPA 2OTVA 2G4TA 2H9HA 2ZQ1A 2TGTA 1DE7H 1FY4A 3P70B 4INKA 4ZXXH 1SGTA 2ZA5A 1GG6C 4CHAB 2ZHFH 3FVFB 2HPQH 2QCYA 4M9FA 4SGAE 1AB9B 1MZAA 3VGCB 2ZDMA 2BY6X 1UTPA 1XUGA 1NZQH 2A5IA 1OS8A 2J4IA 3WY8A 1SLUB 2ZFTA 2TGAA 4CBOA 4AFZA 2B7DH 5KGOA 3LH1A 1QA7A 3KQEA 3LGWA 2F9UA 2Z9IA 2A7CA 1O2YA 1V2WT 3F2FA 1GPZA 4CRCA 1CQQA 2DE8A 1ZMJA 1O2XA 4A1TA 4B6FA 1JRTA 1W0YH 5LGOA 1TPPA 1W2KH 2BB4A 2ZGJA 1HIAA 3O8BA 3SN8A 4KP0A 3S7KB 3FP8E 2AIPA 1EAIA 4AB9A 4Y79A 4Q7YA 4R0IA 4H6SB 1WU1A 3UPEA 5A0AE 4D7GA 1FZZA 2C4FH 2ILNA 7GCHF 2CHAC 2CMYA 1NBME 2QY0B 2ZIQH 5DGJA 3SYJA 1GJ7B 5GCHG 3SBKA 4JZ1A 2G4UA 2Z3EA 2BY7X 1O2WA 3DUXH 2A4QA 3E90B 3KQBA 1BTUA 1HAZB 1CHGA 1TBZH 3PMAB 4IN2A 1CVWH 1BRUP 1TMUH 2ZPRA 3QUMP 3U9AH 1EQ9A 4X8TH 4Y8ZA 3BSQA 4X2XA 1DVAH 2GCHG 4BNRA 5IYTA 1QR3E 1H8DH 2YMSC 3KQDA 3QTVH 4WF8A 4WJG2 1LVMA 3MNXA 1UK3A 3DCLA 5ESBA 3U8OH 4D8NA 1GMDG 4CRFA 1LHGH 3ZVDA 2RFKC 4B6EA 2VIDA 2CHAB 4DCDA 1O2TA 2GZ7A 5A0BA 1IHSH 4ABGA 1H9HE 1ZJDA 1AGJA 2BVSH 3LGTA 4AORA 1DS2E 5EG4A 1FY3A 3KNXA 1DLEA 1B0FA 2FP7B 4Y71A 3SGBE 3VB7A 4K1SA 4IN1A 3NWUA 2OC7A 4ISIH 4JMYA 1O3EA 3OTJE 1K1JA 1WCZA 9ESTA 1L4ZA 1Z7KA 2ANKH 1NRSH 5J4QA 2JH6D 4CRBA 5IDKA 3Q77A 2W7SA 2GT7A 3MI4A 1EPTC 2ZU5A 1PFXC 2EI8A 2WPDD 3NXPA 4AFSA 1P57B 1S6FA 3DFJA 5A0CA 2P93A 1NRPH 2QGRA 1E1RD 5CE1A 1QNJA 4XRNA 2IPHA 3F3BA 1P9SA 3EAJA 4E05H 3QWCH 4KKDA 2YNAA 3SU3A 2PLXA 2QF3A 5F53A 4I32A 5FBEA 1O3FA 4IBLH 2XBXA 1CGJE 1VCWA 3RXIA 5A8ZA 4K5ZA 1EZQA 1GJ6A 2F91A 3H5CB 1GI9B 1ZRBA 1PPZA 1P3CA 3BTWE 1O0DH 4YLUA 2VVUA 1HJAC 2GV7A 4O97A 4INLA 2AEIH 1KTTB 2OP9A 3NRLA 4Y7BA 1LMWB 2HNTC 4LZ4B 3MHWU 2ZFPH 2RDEA 5TCCA 3SJOA 4Q7XA 3U69H 1AVGH 5FBIA 1EX3A 1TABE 2QF4A 1TNHA 2A32A 5GNDA 1P04A 1UK4A 1FIZA 1O37A 2CJIA 3GDSA 4IW4E 2BY8X 4K2YA 2G52A 1UTQA 1SLWB 1BMLA 2O9QA 3MO6A 5LPEA 3E6PH 4OS6A 2BLWA 2PWXA 3RP2A 4X6PA 3O8RA 1XXFA 3RXAA 1PQAA 1A2CH 2PHBA 1P03A 3TGKE 4TWYA 1O5AB 3AASA 1XVMA 1NRNH 3AW1A 1VJ9U 1XM1A 3A8CA 3RM2H 1EUFA 3A89A 1G3CA 3RM0H 2QXJA 1GJAB 1TFXA 3TGJE 4YZUA 2VWLA 1IQEA 2A2QH 5EXLA 9LPRA 3RXMA 1SB1H 3EE0B 2YNBA 1IHTH 1JIRA 4X1PU 5HIYA 6ESTA 1VCQA 1GHAG 1GMHF 2XBWA 2XWAA 1P11E 3A7TA 4MVNA 2KCPA 3OU0A 2WPMS 4ZXYH 2CV3A 1ELEE 4MG3A 4WY3A 1SBWA 1NROH 1C5TA 1O5DH 1P2JA 3SNAA 1YP9A 1G3DA 1RTFB 4RKJB 5SGAE 1EAXA 1KXFA 4BAHB 2ZU4A 1BITA 1FNIA 3SJKA 2TPIZ 2F9VA 2W7UA 2A2XH 1G37A 1HXEH 2C8ZB 4ISOA 4BAMB 1DX5M 1ELVA 2HPPH 3LJOA 1D6RA 5E2PA 4HFPB 2ZFRH 1Y5UT 1Y3XA 1JBUH 2SGPE 4LOYH 5EXMA 1G36A 5JBTA 2VGCB 4ZHAA 5DSFA 2GMTC 4B1TA 1P2QA 2VIWA 2NU0E 1O2JA 2J92A 3UTUH 4A1VA 2FX6A 3KIDU 1DSTA 1O3JA 1XUJA 1T32A 2W6JD 3A83A 3ENSB 3RXCA 1ZLRA 3EGKH 1TGNA 4B2CA 4WXVA 1MTSA 1EAWA 1HJ8A 1ZYOA 3P8FA 3OEHD 1COWD 2Y7ZA 1J9CH 2FTLE 4MDSA 1O2GH 4OS1A 1EKBB 2BZ6H 3NZIA 1SQTA 1Y59T 4FVBA 3SZNA 1WTGH 4NZLA 2PP6A 3AAUA 1ZHPA 1O2MA 3ATMA 1DWBH 3PTNA 2PR3A 2VWNA 3OY6U 2J34A 1LO6A 1YPHE 2Q6FA 1K2I1 2WPJS 2Q6DA 2VIVA 3Q3XA 1QBVH 1RTKA 4B71A 1FPHH 2IN2A 2Z6BD 5HXFA 5GCHF 1SHYA 4MPVA 4RI0A 2ZU3A 2VIPA 3ZZBA 2JH0D 1ETTH 1CBWC 5C0TA 5IK2D 2JETB 3CS0A 3U1JB 5GIBA 1ZSJA 2XCFA 2WYGA 4ABBA 1IQJA 4MTBA 1LHEH 1VCPA 2ZPQA 2EY4C 1C1MA 1HAVB 2XC0A 2GCHF 1K1IA 3MYWA 2A31A 3SNDA 1Y5BT 1SVPA 1PYTC 2W26A 3W94A 4IMZA 1GMDF 3RMLH 4BAKB 3QZQA 1IOEA 1L1NA 2BDYA 1BTYA 1SKYE 3PM3A 1TX7A 3RXFA 3SNBA 4B74A 3KCGH 3RXTA 1UVOA 1YGCH 1SGFG 2GD4B 1SHHB 1CBWB 1MZDA 4JYTA 2IJOB 1LHCH 1TYNA 1ARBA 4YTAA 4A1XA 2PGQB 3IWMA 3MH6A 5PTPA 3RXJA 1HNEE 1M9UA 4I8LA 5TCAA 3RXDA 4XBDA 1BJVA 4WH6A 4AYYB 1Y3WA 3EYDA 2ZGCA 5CHAC 2BY5X 5EU8A 1O3OA 8ESTE 1WV7H 1C2IA 4D76A 1LVBA 4TSFD 1AU8A 2F9PA 1MAXA 1TE0A 1SQOA 1GHBF 1DANH 2R0KA 5C1UA 1DWDH 2ALPA 3K9XB 2FLRH 1BOQA 5DO4H 5GPIB 3P8NA 2XRCA 1E34B 5DP9A 4WMEA 1MAYA 3CENA 1HAXB 1NT1A 4J2YB 2VB0A 3SHCH 1BBRK 1EJAA 1LHDH 1Q2WA 2V0BA 1ZTJA 4DIHH 3T28A 1HAIH 4YLQH 2FM2A 5ESTE 1XUIA 3GYMA 2VWMA 1MKXH 4NIYA 1GI6A 1C5XB 1ESBA 1N8OB 3LC5A 1E35B 4GAWA 1MQ5A 4Y10E 4CREA 3O8CA 4NSYA 2ZCKP 2W6ID 3K6ZA 2ZI2H 4YM9A 1ABIH 4ISNA 2C3SA 1FI8A 1NO9H 4FXGH 3SUDA 3FANA 1C1SA 2XOKD 3MNBA 4VGCB 4MNYA 3PWBA 1YPGH 2PFEA 4CH2B 3MNCA 3GY5A 3V0XA 1OX1A 3SJ9A 2R9PA 1O3KA 1QBOA 2VNTA 4JZIA 2F4LA 3I29A 2J97A 4WH8A 4HI3A 3PMJA 2XTTB 4YXWD 3T62A 1S84A 1YLNA 1A0HB 4K8YA 1QB6A 3MH5A 2XW9A 3SU0A 2WV9A 3T25A 1LPKB 3CS7A 1THSH 6GCHG 4OS2A 1HB0B 2PSYA 4NIXA 4K1EA 1GI2A 3RLYH 3LC3A 1Y3UA 4IC6A 4I8KA 3RXOA 1O2LA 1AZZA 2G55A 1A46H 1C5VA 1QJ7B 3F9GA 5C20A 2J38A 1ZSLA 1AN1E 1D3PB 2A1DB 3M5LA 2O8LA 2ZGXH 1ID5H 4FUBA 1WTHD 3L3TA 2G51A 3FN8A 1P10A 2GKVE 3JZ1B 2B0FA 1SFIA 4ZKSU 1GHAF 1GHXH 3ATLA 1J17T 2VIQA 4AC9A 4XOJA 1GMCG 2C90B 5EIYA 5EPNA 2AH4X 3M7QA 1CT2E 2ESTE 2HOBA 1EB1H 1OWKA 1Q31A 3RXVA 5DPAA 5ABWA 1N6YA 1JWTA 3S7HB 1QTFA 1P2IA 1HAVA 5L6NH 3EA8A 2HLCA 2ZDVH 4CH8B 6CHAC 2NU2E 1MBMA 3MU4A 2XYAA 3TH2H 3VB5A 4CRDA 4DURA 3E91A 3LDXH 2Q6GA 1L0ZA 1HAOH 1C5UA 2ZCHP 5EPYA 2JJ2D 2Z3DA 1F5RA 2SNVA 4X2WA 2FWWA 5DK1A 2SGEE 1C9PA 1SGNE 4SGBE 3GY7A 1BTZA 2HRVA 5E0JA 2QYIA 1O3AA 1MUEB 1EASA 3UUZA 3MU5A 3SU5A 3TPIZ 5EW2H 2BZAA 2GJGA 2YMSD 3TH3H 3NPSA 4GPGA 3LH3A 1DUAA 2ODPA 2ODQA 3VB3A 1QL9A 1W14U 4IMQA 4CBNA 7LPRA 1QA0A 1UTKA 3SOSA 1CA0B 1O2HA 3SW2B 1DOJA 3MO3A 1AUJA 5DP4A 2ZNKH 3D49H 1WQSA 4PROA 2JIZD 1TMTH 1VR1H 2ZF0H 1CT0E 1YPEH 1PPBH 3P95A 4BOHA 1GMHG 1ELGA 1V2JT 1TIOA 3F9HA 2AGIX 2M5TA 2FI4E 1JOUB 2UWLA 2UUJB 5A2MH 1OWHA 3QLPH 2BDGA 3RXBA 2FESH 4ISHH 1AO5A 3GS9A 2FOEA 2BQ7B 4Q7ZA 2ANMH 4ZH8A 1C2GA 2AMDA 3D62A 3GY8A 4TYDA 1K1NA 1MMJN 2ASUB 3DSPA 1DSUA 4XSKU 2Z94A 1AFQB 3DHKH 4YO9A 1HXFH 3MOCA 3KYFA 2SNWA 4JZFH 3SUFA 1IQHA 1TGCA 1K21H 1DICA 3KN2A 1WQVH 1T8OA 3RXRA 5C17A 4Y0ZE 1C2MA 1ESTA 1G3BA 1GBFA 2BD5A 3TGIE 3KEEA 4X6NA 2UUYA 3BTGE 2Z9LA 4NA7A 1K28D 1DT2A 4RN6A 2A4OA 3SZEA 2JDID 1BBRE 3E8LA 3RLWH 2ZTXA 1ZZZA 2KZ4A 1IQKA 1C1RA 1DM4B 1ZPBA 2FI3E 4NFEA 4XFQA 5L2YH 3FKSD 1GHVH 1QRWA 1NM6A 1TPOA 2BOKA 2OLGA 2SGFE 5FPSA 3TJVA 1P01A 1GG6B 1UCYH 3HKIB 1SI5H 2GCTC 3A7XA 3MH4A 1GJ8B 2ZZUH 3EDXB 5HM9A 1L1JA 3SQEE 2EA3A 1O2SA 3ZZAA 3STIA 2BVXH 1BHXF 3PYHA 1Z8GA 2BY9X 2ZWLH 1TQ7B 1B5GH 2FX4A 3U8RH 1AI8H 2AGGX 2Z9KA 1C2KA 4TWWA 4ZUHA 1W12U 1GVLA 1TGSZ 1MCVA 2FZZA 4ZCNA 3ZV8A 1Z6EA 3KL6A 1BUIA 1TNLA 2BDHA 4NIWA 1OWEA 1V2NT 1OYTH 1UTJA 4NWKA 2H9TH 2V3HH 1P2KA 3QDZB 2VH6A 2AHME 1JXPA 1HYLA 1NS3A 1T8MA 1O31A 1EB2A 1O2QA 2P59A 2G00A 1C5OH 1O3IA 1MH0A 1QIXB 2CGAA 3V12A 1OSSA 5E8EH 3GY6A 3M37A 4OS5A 1GBIA 1ZMLA 4X1NU 1VZQH 2F3CE 1W7GH 1EP5A 1ORFA 1A5IA 2BM2A 2A0QB 1DWCH 1C4V2 2QXIA 1V2PT 1UK2A 4FUHA 1FONA 1C2HA 1S85A 3PRBA 3SV2H 2F83A 3RMOH 4A6LA 5DN6D 3QTOH 2BXTH 2FOBA 2EI7A 3T26A 2QA9E 1KSNA 3A80A 3ZZ7A 4ABFA 3EQ0H 1C5QA 1CT4E 1O3DA 2YMSB 3ODDA 1VKYA 1NESE 3HK3B 3WW7A 4D7FA 6GCHF 3DA9B 1FN6A 1CHOG 1ZSKA 2ZGBH 1DDJA 1QQUA 1MU8B 1O30A 3FFGA 3ATIA 4K8BA 1RRKA 1C5PA 1GHBG 3SI4H 4UFDH 3SV7A 1QRXA 4MPUA 2XBVA 2GVFA 2WV4A 3A87A 3SV9A 2LELA 2ODYB 1ANCA 2KCAA 2LPRA 3M36A 1YKTA 1N6XA 1KY9A 4FUEA 2TIOA 4B2BA 3U8TH 1MKWK 3N7OA 1ELAA 4X0WU 2ZFFH 5ETXA 2P95A 2UWPA 4O3UA 1GMCF 2D2DA 5E2OA 2P3UB 3RU4D 1O35A 3N7EA 3FZZA 1QL8A 1XVOA 2Z9JA 1EPTB 3F9EA 4TPYA 2WPKS 3BTKE 2Z7FE 2HGTH 5FHTA 2FOCA 2BD7A 3PROA 4KTSA 1GL1A 2SGDE 3L33A 4CRAA 3LKWA 3ZZ8A 2A45B 3PV5A 5FX6A 1GWAA 1A3BH 2O8UA 1ANBA 1H8IH 3K6YA 2H1UA 1UTLM 4GVUA 1BMNH 4YESB 2AFQB 1YM0A 3UREA 1TPAE 2R3UA 3QN7A 5FPYA 2HVXA 1RIWC 1O5GH 4RKOB 3QGNB 1FV9A 1O36A 1QFKH 1TNIA 5CHBA 2EQNA 1ZOMA 2WSSD 2RA3A 2LNCA 2WUBA 2BDCA 2PTNA 4DT4A 4NGAH 4DY7B 4Z6AH 2OC0A 3SO3A 1HJAB 2GDEH 1PYTD 3F1SB 1SFQB 5LH8A 2PKSC 3MTYA 4KELA 1P9UA 1GJDB 2PUQH 1FY8E 4F4OC 2H5DA 3F2GA 5AHGH 1ANDA 1QRZA 1A0LA 3V13A 3BG8A 1P8VC 1O2OA 3PLPA 1LPZB 3SNEA 2SGQE 1TRMA 3BIVH 1V2VT 1HUTH 4DW2U 3BG4C 2BMGB 5GJ4B 5E0GA 5FCKA 2BDBA 1TNJA 2STAE 2BOHB 3HGPA 3GY2A 1UVPA 1D3TB 1C2FA 1BIOA 4X2YA 2O8TA 1Y3VA 1D3QB 2BQ6B 3A86A 3UR6A 3UR9A 1V2TT 1TBRH 4ABDA 3VEQB 1VGCC 2J98B 2IOTA 2PKSB 1SL3A 5KEDA 1DY8A 1YCPH 4R8TB 4I31A 4AGJA 1W11U 1V2OT 2CF8H 3F9FA 3IITA 1NFXA 1C1WH 1IQLA 1BZXE 3K65B 4Y0YE 2QE7D 1ZJKA 2BHGA 4K69A 1BTPA 2KAIB 3TK9A 4LK4A 2ZHEH 3ZYDA 4CR5A 1CGHA 1VITG 1P2OA 1GCTC 1VGCB 1V2MT 5F8TA 1QB1A 2BLQA 1SGPE 5AF9H 5FXLA 2QC2A 1LKBA 3S69A 4UDWH 1GCDA 4I8JA 1L2EA 4AX9H 1ZPZA 4Z1MD 3LONA 5JBBS 2G81E 2GMTB 3FO8D 1O3GA 2ZO3H 3EE7A 1SGQE 2ZFSA 4BTTB 2FPZA 4AOQA 1TB6H 3M61U 4GHQA 3SU2A 3UOUA 2JH5D 1A61H 2BX3A 1TPSA 3KHVA 3S9AA 1G32B 1GVZA 3RMNH 1D6WA 4MNWA 2Y6TA 3VG8A 2K0QA 2FIRH 3W1EA 3PLKA 1C4U2 2WUCA 1GBTA 1HV7A 1GDQA 4TY7A 2EI6A 2HNTE 1IAUA 1UVSH 3ZVCA 1F2SE 1SQAA 2C8XB 2ZEBA 1O3BA 1EPTA 3LOXA 4INHA 3SUGA 1TX6A 4ABEA 2ZDLA 2B5TB 3ZVGA 4FU8A 1F5KU 2XNDD 1C1OA 1IQIA 3RDZA 3KF2A 3SORA 2F9OA 8KME2 1PQ7A 3SU1A 1FDPA 1MU6B 1MTNC 5CMXH 2IJD1 2WZQA 4BTIB 3BF6H 2HVYB 3U28C 1AVWA 2STBE 1C2LA 2R0LA 3TIUA 3VB6A 4FUJA 3SNCA 2DE9A 1MD7A 2D1JA 2TBSA 2ZU1A 1GJ4H 1OYQA 1DPOA 5C0UA 5DP6A 2QIQA 1NU7B 1Z71A 1GL0E 1CHOF 2J95A 3DFLA 2BD9A 2H5CA 4ZHMU 1TQ0B 1AKSB 5E0HA 5DJ7A 2GTBA 3GCHC 4HZHA 1AWFH 3PTBA 2ZHWH 4FU7A 2EC9H 5C1YA 4U32A 2R2WU 3M3SA 4ESTE 2XXLA 1G9IE 2D8WA 3RC5A 1TAWA 1NN6A 1RJXB 3HKJB 2VINA 1BCUH 4DT7B 1C5MD 1O39A 4BTUB 2TGDA 1ESAA 5CHAB 4MPXA 3F0PA 2PW8H 3A84A 1A5HA 3R0FA 4FETA 3RC6A 3RXKA 1CO7E 3QGJA 3HGNA 3O8DA 3UFAA 1GJCB 2FOAA 2KFWA 4B76A 5C2ZA 1EZUC 2A5AA 3VXFH 5LPRA 8LPRA 1DUEA 3RMMH 1C2JA 1UTOA 3PLBA 2J98A 3BEUA 1PPEE 1GVKB 1UW7A 4OS4A 5TJXA 3V7TA 2QF0A 1RTLA 1W0ZU 3HPTB 2Z9GA 1T4UH 2EEKA 3RU4E 4J1YA 3TJUA 4FUIA 3SHAH 3M5NA 2VBCA 1CA8B 3BTTE 4UFEH 1ETSH 5F6MA 1TA2A 4ASUD 4AG1A 5EJZA 5B6LA 5EOKA 2BD2A 1O2KA 2KAIA 4A7IB 1HFDA 1XXDA 4Q4LA 3SV8A 1NU9A 1THPB 2DUCA 1DITH 1BDAA 4ZMAH 5JBCS 1MABB 3GDUA 1V6DA 2VVCA 1A4WH 1THRH 5I25A 1P05A 5C1XA 2ZKSA 1MTVA 3ELAH 1SGYE 1LCYA 3RXQA 1Z8RA 3KYGA 2OD3B 3VXEH 3TLOA 4I33A 4RT1A 2OBOA 4UONA 1N1LA 2P3TB 1O2ZA 2FMJA 2R3YA 5EQSA 5C5NA 3AVZA 4AFQA 5EW1H 4YT7H 2OUAA 2FOGA 4GCHG 2K8IA 3RUOA 1OXGA 3KGPA 1JIMA 1F5LA 4KTUA 1O3HA 4WWYA 2PUXB 1MQ6A 3GCTG 4Z0KA 4ABHA 1BJUA 3PWCA 2C8YB 1D3DB 1YPLH 5EQRA 1TRNA 4WMFA 3FP7E 3F6UH 4FOUC 3GYLB 3NUMA 3OX7U 1NPMA 1EZXC 1NFWA 2ZTZA 1ANEA 4Q2KA 2XC4A 1K22H 2XC5A 4FU9A 2FOHA 3VFEA 4DGJA 2ZTYA 3NKKA 1F92A 1MTWA 4ZKNU 1NFYA 1XKBC 1W0KD 3ZZDA 5C67A 1DXWA 4YOJA 1TOMH 1SLXB 3U98H 1IQMA 1AY6H 1D9IA 3A8DA 5HMAA 2NU3E 5HKKD 1O34A 3OYPA 4ABIA 1PPCE 2AIQA 2FS9A 3ZVFA 2O8WA 1O5EH 3PO1C 2ZDKA 1O3PB 1L1GA 2P94A 1DY9A 1F0TA 4NWLA 1VITF 2GV6A 5T3HA 2BXUH 3LGYA 1XUHA 1QJ1B 1WUNH 3PRDA 3V3MA 3U1IB 1ZTLA 4AZ2B 4E7NA 1GDUA 1UO6A 6CHAB 1E0FD 1J15A 1YPMH 2HNTF 3CNRA 4MLFB 1H1BA 1EJNA 3MQKC 3ZZCA 5EGMA 4ZHLU 1E79D 3QZRA 1AKSA 3RXGA 4UFFH 1CU1A 3SJ8A 1S83A 3M7UA 1OP2A 1SPJA 2ULLA 1ZR0A 4X8SH 3QK1A 3LPRA 3URCA 3A8AA 3E0PB 2WINI 1AQ7A 1ARCA 1S0QA 3PMHB 5GDSH 3ZZ4A 4LZ1H 3RXSA 1OKXA 4A5TS 2BDIA 1C4Y2 2AMPA 3EA7A 4MPWA 1O2IA 1KXCA 1QZ8A 3ODFA 1LTOA 1GGDC 1S6LA 5CDFE 5T6DA 2P16A 2ZHQH 1OWJA 3P8GA 5A09A 1WOFA 1ZPCA 1AE5A 4D9RA 3BTEE 3UNRA 3TJNA 1HAPH 3T27A 1YLCA 3Q3YA 1BRCE 1H9LB 1NC6A 1WAYB 1AB9C 3VGCC 5K0HA 2L74A 4GLYA 2H2ZA 1P3EA 4AN7A 2FYRA 3E1XB 4LXBH 1EOLA 2KX4A 3RXEA 2TGPZ 1MD8A 3RC4A 3SI3H 5FPTA 4QT8C 3A7VA 1S82A 3TVJB 1INCA 1FN8A 3KQCA 4FUCA 1O2PA 1JRSA 1C5WB 3D65E 3QO6A 5C5OA 3T2NA 3BIUH 4HGCA 1PQ8A 3VB4A 1KXEA 1GJ9B 2QXHA 1SGIB 1P06A 1ZMNA 1P02A 2NU4E 1H8HD 2CN0H 2V7QD 3ATWA 1DWEH 1B7XB 4X6OA 1OWIA 2VH0A 4F55A 1KYNA 2H6MA 2JKHA 4E7RG 2ZC9H 1OHHD 1GBAA 4OGXA 5H4IB 3GY4A 4ZKOU 4I7YH 1ZGIA 1OOKB 3UNQA 1KXDA 5B6OA 4RT0A 4BXWA 1C1TA 4P02A 3GY3A 4F48B 1W7XH 1YY3A 4B75A 1O5FH 5EQQA 1W0JD 2XBYA 3P8OA 1YC0A 2HALA 5EXNA 1F0UA 2I6SA 4I8HA 4ASHA 3MFJA 1AWHB 4I86A 1LPGB 2ZCLP 1LDTT 2ZP0H 4DOQA 4I8GA 1SOTA 1BT7A 1V2QT 1GI5A 1TLDA 2FXRA 4FUFA 4UE7H 3B8JA 1WBGB 1YCPM 1CGIE 1RGQA 2GCTB 1Q3XA 1KLTA 1H9IE 1AUTC 1MBQA 2F9NA 2XNIA 2KCYA 4ABAA 1HJ9A 4AG2A 2GDDA 1HPGA 4ZROA 1LVOA 3NCLA 2UUKB 3UQOA 2BD4A 4OS7A 4X6MA 4HG6A 1GBHA 4JK5A 4Y8XA 2BD8A 1LKAA 3E0NB 3ZVBA 1O33A 1TOCB 4ZAEA 4NSVA 1A7SA 1V2ST 1P0SH 1XUFA 1A0JA 3G01A 3UB0A 3ZZ3A 5JDUB 2FDAA 1FY5A 3R3GB 2VIOA 2C8WB 5DG6A 4O9VA 2FYQA 1FMGA 1KTSB 2FI5E 1KDQB 2JJ1D 1ZTKA 1B0EA 1TONA 5J4SA 3LGIA 2SFAA 1QL7A 1S5SA 2VU8E 3TNSA 3SU4A 1KLJH 2Y5HA 1GI3A 4AB8A 1BBRH 2PGBB 3LIWA 1MKXK 2WPLS 2OC1A 2QAAA 2RCEA 4X1QU 1FPCH 5L2ZH 5AVDA 1LQEA 2ANWA 2W3IA 4GHTA 1FQ3A 1GHZA 1YF4A 4FUDA 3Q3KA 2RA0A 2V3OH 3DT0H 2CXVA 4B2AA 2ZU2A 5JYIA 1EZSC 2ZDNA 1S0RA 4GCHF 4A92A 2A7HA 1TMBH 5BPEA 3W95A 2FTMA 2LP6A 5DP3A 3Q00A 4M7GA 3I78A 3F68H 1HAGE 3GCTF 1BTHH 1Y8TA 3E3TA 4JYVH 1C2DA 5JPMH 1YBWA 4FVDA 5T1VA 1AIXH 3HK6B 3FOAA 1SC8U 2BLOA 3QX5H 4X1SU 2Y5FA 5KECA 1SQRA 2PV9B 3UQVA 5HM2A 3WWBA 4ACBA 1G2LA 1J8AA 1UTNA 1FAXA 3SQHE 5FCRA 2OINA 3Q76A 1GI4A 2Y7XA 3RXPA 1YPHC 3K2UA 1SOZA 2VJ1A 5DKMA 4KGAA 1GBBA 1C2EA 1ABJH 1BMMH 1HAHH 4O3TA 3BV9B 1C9TA 1E38B 1TALA 2BYAX 2RDLA 5GWZA 4XD7D 2NU1E 4JYUH 3NK8A 3PV4A 1G2MA 1BTWA 1F0SA 1QB9A 4RSPA 1HAYB 1EP6A 1FX0B 2WYJA 5EODA 1RS0A 2A5KA 2QN5T 1TX8A 3TH4H 1X7AC 2GZ9A 3M5MA 1GI8B 3C1KA 4ACAA 5AFYH 4KTCA 1HGTH 4X8UH 1Z1IA 3WWFA 1GBKA 1C1PA 7ESTE 3MNSA 4BAOB 1ZHRA 1GJBB 3BTQE 5L30H 1FAKH 5FL7D 1KXBA 1RIWB 4MQAA 1H4WA 3PMBB 5C3NA 2OBQA 4TT3D 1IQGA 4NFFA 3GCNA 5I46H 1GHYH 3LGUA 1J14A 1WXRA 1FLEE 1EAUA 1MTUA 3DSGA 3TU7H 1SMFE 1SLVB 3ZZ6A 1SR5C 1NTPA 3GISB 3H7OA 1PPGE 3OEED 3UIRA 3CP7A 4H4FA 3BTME 2FS8A 4U2WA 1ELTA 4XBCA
chains in the Genus database with same CATH topology
1O3LA 3B9FH 5T6FA 1V2LT 4DJZB 5GXPA 1HRTH 3T29A 1ZHMA 2QXGA 1SGEE 2VGCC 2W5EA 2AGEX 1V3XA 1A1RA 1UVTH 1O38A 1P12E 2O8MA 2V35A 3C27B 3M3TA 1PQ5A 3D23A 1GBDA 2P8OC 3HATH 3SGAE 1KLIH 3STJA 2BX4A 2PKAB 3BG4B 1QQ4A 1Y3YA 4GUXA 1TNKA 2A4RA 3UNSA 1J16A 4MNXA 2ZFQH 1RXPA 4WMDA 4DIIH 1BB0B 1TNGA 5K7RA 1O2VA 1FIWA 1QY6A 4X2VA 4Y8YA 2B8OH 4X8VH 1YPJH 1FUJA 3A88A 5F03A 2J2UA 2BVRH 4THNH 2AS9A 1KDQA 4BANB 3JZ2B 1FY1A 2OQ5A 4XDEA 3SV6A 4Y7AA 4NCYA 2OQUA 1ELDE 4ZKRU 2P8OB 2UWOA 4U30A 4TPIZ 4D9QA 1BRBE 2VWOA 4JZDH 1UHBB 1K1MA 2PTCE 2JETC 1V2RT 1UJ1A 4DG4A 1HDTH 1P2MA 1ACBE 1UTMA 3PB1E 5G4BA 4BAQB 3MU1A 3IG6B 1C5NH 1EJMA 4FUGA 1GCTB 1BQYA 4WXIA 1O3CA 1GI1A 1PPFE 2FEQH 3OSYA 3RXUA 1D4PB 1T8LA 1QBNA 1TRYA 4DVAU 1Z1JA 1TWXB 1OP8A 4ABJA 1NY22 2YOLA 2BLVA 3DD2H 3BTDE 1BHXB 1GBMA 1SG8B 2OCVB 3BEFB 5AFZH 1TA6A 2D26C 1BRAA 5A8XA 1UCYK 8GCHG 4XE4A 3SU6A 3LGVA 5F8XA 2ZQ2A 1OP0A 3I77A 3S9BA 2TRMA 1QJ6B 1RD3B 2Q1JA 3P92A 3MU8A 2H9EH 1RFNA 5T6GA 2ZDAH 3L6PA 3A8BA 1T4VH 3LU9B 1O2NA 1V2UT 5A8YA 3H7TA 1T7CA 4IGDA 3A82A 2GT8A 3MU0A 5FX5A 3ATKA 1K1LA 2G5VA 2AMQA 1K1PA 1NRRH 1AE8H 1LHFH 2WPIS 4UEHH 1O2UA 3AW0A 2K1QA 2PSXA 4UD9H 4AYVB 1ELCA 1CSOE 3GDVA 4U01A 1MTNB 7KMEH 2VVVA 1PPHE 2WPHS 1HLTH 3A7WA 3ZV9A 2XWBI 4YOGA 1N8OC 2AYWA 3MH7A 4XBBA 4IC5A 1S81A 3A81A 4O03A 1GBJA 3BTFE 1QURH 1E37B 2A4GA 3UWIA 1UVUH 3GICB 4TY6A 1SGCA 1VITH 1P2NA 1C1UH 1SGRE 3MO9A 7GCHG 4NA9H 5JBAS 1C5YB 3GCHB 3B23B 4VGCC 2BQWB 1YPKH 1LVYA 1W8BH 2WV5A 1W10U 4Y76A 3TJOA 1BTXA 1ETRH 1AD8H 3GOVB 2ANYA 1UMAH 1Y5AT 3LJJA 1L4DA 3UOPA 2ZPSA 1GBEA 2Y81A 1AFEH 2BD3A 1OPHB 4B73A 2J9NA 1P09A 2RG3A 3M5OA 1O2RA 2CF9H 2ALVA 1CE5A 5BRRE 2PKAA 1C1QA 1BA8B 5F8ZA 4F49A 4K3JA 5DP7A 4JCNA 4BXSA 1C5SA 1WSSH 2A7JA 1ELBA 3AAVA 1GI0A 2SGAA 4CRGA 1PJPA 2FLBH 3TK6A 3TITA 1EXFA 4NG9H 4Y6DA 3S9CA 1MKWH 4NIVA 4WVPE 1W3CA 4OGYA 2AERH 1ZGVA 5DP5A 3RXLA 2J94A 1SSXA 3FZDA 1XX9A 2NWNA 1Z6JH 2THFB 2GZ8A 3LT3A 5JB8S 4HTCH 3BEIB 3TNTA 2OXSA 4JZEH 1TBQH 3ZZ9A 3MMGA 1HIAB 1SGFA 2Y80A 1KIGH 2F9BH 5DP8A 1GDNA 2P3FH 3MWIU 1YLDA 1UHBA 3BN9A 1A5GH 1C5ZB 1Z8JB 6LPRA 2C93B 2ZGHA 4K1TA 4AGKA 3M3VA 2V6NA 1C5RA 3P17H 3FP6E 1QHRB 1C1NA 1FXYA 4K60A 4H42U 2ZG0H 1MCTA 1U6QA 5HYOA 3RU4T 4JK6A 1XUKA 1FJSA 1QGFA 1HCGA 1ELFA 1G3EA 1O3NA 4AFUA 2B9LA 2ZHDA 3SJIA 2FODA 1QCPA 1OWDA 3EA9A 3VPKA 2I6QA 1NRQH 2FOFA 2Y82A 3BTHE 2GX4A 2OC8A 2W3KA 4Q80A 3A7ZA 1F7ZA 1S6HA 3M7TA 5JB9S 1TGTA 3FAOA 3SGQE 1LQDB 3ESTA 1O5CB 3M35A 3ZYEA 4GSOA 3S0NA 1G30B 1CA0C 1YYY1 3RXHA 2QV1A 2Z3CA 1EATA 2GP9B 4H6TA 4YT6H 3URDA 1T8NA 3OY5U 1KXAA 1GBCA 4IS5A 1AZ8A 1HBTH 1O32A 4CR9A 3GCOA 1IQNA 1YCPK 3ZVEA 4E06H 2G5NA 3UWJH 1SGDE 3UY9A 1XKAC 1C5LH 1WYKA 1UCYE 1T31A 1TGBA 1GI7B 1NFUA 3TK5A 1VJAU 2XCNA 3PO1B 3A85A 1A3EH 4X1RU 4NA8A 1JMOH 1BMAA 3SUEA 2HWLB 1AVXA 4UFGH 5FAHA 1GHWH 4NZQA 2FO9A 1AFQC 1W13U 1GBLA 4CHAC 3T5FH 1GJ5H 2UUFB 2Y5GA 1AMHA 1DXPA 2G8TA 1AHTH 2ZECA 4YOIA 4MNVA 2BTCE 1DLKB 1V2KT 1Z8IB 4ISLA 1IQFA 1EOJA 3ZVAA 5HGGA 4Y11E 3ZZ5A 1O3MA 8GCHF 1F0RA 1C1VH 1K9OE 3ITIA 2GGVB 3E16B 1K1OA 3P6ZB 1O5BB 1ZRKA 3A7YA 2R2MB 1XMNB 5LPFA 2BDAA 1GGDB 1E36B 2FOMB 1DFPA 2OTVA 2G4TA 2H9HA 2ZQ1A 2TGTA 1DE7H 1FY4A 3P70B 4INKA 4ZXXH 1SGTA 2ZA5A 1GG6C 4CHAB 2ZHFH 3FVFB 2HPQH 2QCYA 4SGAE 1AB9B 1MZAA 3VGCB 2ZDMA 2BY6X 1UTPA 1XUGA 1NZQH 2A5IA 1OS8A 2J4IA 3WY8A 1SLUB 2ZFTA 2TGAA 4CBOA 4AFZA 2B7DH 3LH1A 1QA7A 3KQEA 3LGWA 2F9UA 2Z9IA 2A7CA 1O2YA 1V2WT 1GPZA 4CRCA 1CQQA 2DE8A 1ZMJA 1O2XA 4A1TA 1JRTA 1W0YH 1TPPA 1W2KH 2BB4A 2ZGJA 1HIAA 3O8BA 3SN8A 4KP0A 3S7KB 3FP8E 2AIPA 1EAIA 4AB9A 4Y79A 4Q7YA 4R0IA 4H6SB 1WU1A 3UPEA 5A0AE 4D7GA 1FZZA 2C4FH 2ILNA 7GCHF 2CHAC 2CMYA 2QY0B 2ZIQH 5DGJA 1GJ7B 5GCHG 3SBKA 4JZ1A 2G4UA 2Z3EA 2BY7X 1O2WA 3DUXH 2A4QA 3E90B 3KQBA 1BTUA 1HAZB 1CHGA 1TBZH 3PMAB 4IN2A 1CVWH 1BRUP 1TMUH 2ZPRA 3QUMP 3U9AH 1EQ9A 4X8TH 4Y8ZA 3BSQA 4X2XA 1DVAH 2GCHG 4BNRA 5IYTA 1QR3E 1H8DH 3KQDA 3QTVH 4WF8A 4WJG2 1LVMA 3MNXA 1UK3A 5ESBA 3U8OH 4D8NA 1GMDG 4CRFA 1LHGH 3ZVDA 2VIDA 2CHAB 4DCDA 1O2TA 2GZ7A 5A0BA 1IHSH 4ABGA 1H9HE 1ZJDA 1AGJA 2BVSH 3LGTA 4AORA 1DS2E 5EG4A 1FY3A 3KNXA 1DLEA 1B0FA 2FP7B 4Y71A 3SGBE 3VB7A 4K1SA 4IN1A 3NWUA 2OC7A 4ISIH 4JMYA 1O3EA 3OTJE 1K1JA 1WCZA 9ESTA 1L4ZA 1Z7KA 2ANKH 1NRSH 5J4QA 2JH6D 4CRBA 5IDKA 3Q77A 2W7SA 2GT7A 3MI4A 1EPTC 2ZU5A 1PFXC 2EI8A 3NXPA 4AFSA 1P57B 1S6FA 3DFJA 5A0CA 2P93A 1NRPH 2QGRA 5CE1A 1QNJA 2IPHA 1P9SA 3EAJA 4E05H 3QWCH 4KKDA 2YNAA 3SU3A 2PLXA 2QF3A 4I32A 5FBEA 1O3FA 4IBLH 2XBXA 1CGJE 1VCWA 3RXIA 5A8ZA 4K5ZA 1EZQA 1GJ6A 2F91A 3H5CB 1GI9B 1ZRBA 1PPZA 1P3CA 3BTWE 1O0DH 4YLUA 2VVUA 1HJAC 2GV7A 4O97A 4INLA 2AEIH 1KTTB 2OP9A 4Y7BA 1LMWB 2HNTC 4LZ4B 3MHWU 2ZFPH 5TCCA 3SJOA 4Q7XA 3U69H 1AVGH 5FBIA 1EX3A 1TABE 1TNHA 2A32A 1P04A 1UK4A 1FIZA 1O37A 2CJIA 3GDSA 4IW4E 2BY8X 4K2YA 2G52A 1UTQA 1SLWB 1BMLA 2O9QA 3MO6A 5LPEA 3E6PH 4OS6A 2BLWA 2PWXA 3RP2A 4X6PA 3O8RA 1XXFA 3RXAA 1PQAA 1A2CH 2PHBA 1P03A 3TGKE 4TWYA 1O5AB 3AASA 1XVMA 1NRNH 3AW1A 1VJ9U 1XM1A 3A8CA 3RM2H 1EUFA 3A89A 1G3CA 3RM0H 2QXJA 1GJAB 1TFXA 3TGJE 4YZUA 2VWLA 1IQEA 2A2QH 5EXLA 9LPRA 3RXMA 1SB1H 3EE0B 2YNBA 1IHTH 1JIRA 4X1PU 6ESTA 1VCQA 1GHAG 1GMHF 2XBWA 2XWAA 1P11E 3A7TA 4MVNA 3OU0A 2WPMS 4ZXYH 2CV3A 1ELEE 4MG3A 4WY3A 1SBWA 1NROH 1C5TA 1O5DH 1P2JA 3SNAA 1YP9A 1G3DA 1RTFB 4RKJB 5SGAE 1EAXA 1KXFA 4BAHB 2ZU4A 1BITA 1FNIA 3SJKA 2TPIZ 2F9VA 2W7UA 2A2XH 1G37A 1HXEH 2C8ZB 4ISOA 4BAMB 1DX5M 1ELVA 2HPPH 3LJOA 1D6RA 5E2PA 4HFPB 2ZFRH 1Y5UT 1Y3XA 1JBUH 2SGPE 4LOYH 5EXMA 1G36A 5JBTA 2VGCB 4ZHAA 4B1TA 2GMTC 1P2QA 2VIWA 2NU0E 1O2JA 2J92A 3UTUH 4A1VA 2FX6A 3KIDU 1DSTA 1O3JA 1XUJA 1T32A 3A83A 3ENSB 3RXCA 1ZLRA 3EGKH 1TGNA 4B2CA 4WXVA 1MTSA 1EAWA 1HJ8A 1ZYOA 3P8FA 2Y7ZA 1J9CH 2FTLE 4MDSA 1O2GH 4OS1A 1EKBB 2BZ6H 3NZIA 1SQTA 1Y59T 4FVBA 3SZNA 1WTGH 4NZLA 3AAUA 1ZHPA 1O2MA 3ATMA 1DWBH 3PTNA 2PR3A 2VWNA 3OY6U 2J34A 1LO6A 1YPHE 2Q6FA 1K2I1 2WPJS 2Q6DA 2VIVA 3Q3XA 1QBVH 1RTKA 4B71A 1FPHH 2IN2A 2Z6BD 5HXFA 5GCHF 1SHYA 4MPVA 2ZU3A 2VIPA 3ZZBA 2JH0D 1ETTH 1CBWC 2JETB 3CS0A 3U1JB 5GIBA 1ZSJA 2XCFA 2WYGA 4ABBA 1IQJA 4MTBA 1LHEH 1VCPA 2ZPQA 1C1MA 1HAVB 2XC0A 2GCHF 1K1IA 3MYWA 2A31A 3SNDA 1Y5BT 1SVPA 1PYTC 2W26A 3W94A 4IMZA 1GMDF 3RMLH 4BAKB 3QZQA 1IOEA 1L1NA 2BDYA 1BTYA 3PM3A 1TX7A 3RXFA 3SNBA 4B74A 3KCGH 3RXTA 1UVOA 1YGCH 1SGFG 2GD4B 1SHHB 1CBWB 1MZDA 4JYTA 2IJOB 1LHCH 1TYNA 1ARBA 4YTAA 4A1XA 2PGQB 3IWMA 3MH6A 5PTPA 3RXJA 1HNEE 1M9UA 4I8LA 5TCAA 3RXDA 4XBDA 1BJVA 4WH6A 4AYYB 1Y3WA 3EYDA 2ZGCA 5CHAC 2BY5X 5EU8A 1O3OA 8ESTE 1WV7H 1C2IA 4D76A 1LVBA 1AU8A 2F9PA 1MAXA 1TE0A 1SQOA 1GHBF 1DANH 2R0KA 5C1UA 1DWDH 2ALPA 3K9XB 2FLRH 1BOQA 5DO4H 5GPIB 3P8NA 2XRCA 1E34B 5DP9A 4WMEA 1MAYA 3CENA 1HAXB 1NT1A 4J2YB 2VB0A 3SHCH 1BBRK 1EJAA 1LHDH 1Q2WA 2V0BA 1ZTJA 4DIHH 3T28A 1HAIH 4YLQH 2FM2A 5ESTE 1XUIA 3GYMA 2VWMA 1MKXH 4NIYA 1GI6A 1C5XB 1ESBA 1N8OB 3LC5A 1E35B 4GAWA 1MQ5A 4Y10E 4CREA 3O8CA 4NSYA 2ZCKP 3K6ZA 4YM9A 2ZI2H 1ABIH 4ISNA 2C3SA 1FI8A 1NO9H 4FXGH 3SUDA 3FANA 1C1SA 3MNBA 4VGCB 4MNYA 3PWBA 1YPGH 2PFEA 4CH2B 3MNCA 3GY5A 3V0XA 1OX1A 3SJ9A 2R9PA 1O3KA 1QBOA 2VNTA 4JZIA 3I29A 4WH8A 4HI3A 3PMJA 2XTTB 3T62A 1S84A 1A0HB 4K8YA 1QB6A 3MH5A 2XW9A 3SU0A 3T25A 1LPKB 3CS7A 1THSH 6GCHG 4OS2A 1HB0B 2PSYA 4NIXA 4K1EA 1GI2A 3RLYH 3LC3A 1Y3UA 4IC6A 4I8KA 3RXOA 1O2LA 1AZZA 2G55A 1A46H 1C5VA 1QJ7B 3F9GA 5C20A 2J38A 1ZSLA 1AN1E 1D3PB 2A1DB 3M5LA 2O8LA 2ZGXH 1ID5H 4FUBA 1WTHD 3L3TA 2G51A 1P10A 2GKVE 3JZ1B 2B0FA 1SFIA 4ZKSU 1GHAF 1GHXH 3ATLA 1J17T 2VIQA 4XOJA 1GMCG 2C90B 5EPNA 2AH4X 3M7QA 1CT2E 2ESTE 2HOBA 1EB1H 1OWKA 1Q31A 3RXVA 5DPAA 5ABWA 1N6YA 1JWTA 3S7HB 1QTFA 1P2IA 1HAVA 5L6NH 3EA8A 2HLCA 2ZDVH 4CH8B 6CHAC 2NU2E 1MBMA 3MU4A 2XYAA 3TH2H 3VB5A 4CRDA 4DURA 3E91A 3LDXH 2Q6GA 1L0ZA 1HAOH 1C5UA 2ZCHP 5EPYA 2Z3DA 1F5RA 2SNVA 4X2WA 2FWWA 5DK1A 2SGEE 1C9PA 1SGNE 4SGBE 3GY7A 1BTZA 2HRVA 5E0JA 2QYIA 1O3AA 1MUEB 1EASA 3UUZA 3MU5A 3SU5A 3TPIZ 5EW2H 2BZAA 3TH3H 3NPSA 4GPGA 3LH3A 1DUAA 2ODPA 2ODQA 3VB3A 1QL9A 1W14U 4IMQA 4CBNA 7LPRA 1QA0A 1UTKA 3SOSA 1CA0B 1O2HA 3SW2B 1DOJA