4XDEA

Coagulation factor xii protease domain crystal structure
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
241
Chain Sequence
b'VALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVSLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVSHHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coagulation factor XII
molecule tags Blood clotting
source organism Homo sapiens
publication title Coagulation factor XII protease domain crystal structure.
pubmed doi rcsb
total genus 56
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.38: Coagulation factor XIIa.
pdb deposition date 2014-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xdeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xdeA01
3Q3KA 1CE5A 4Y71A 3LGVA 3RXBA 1O2TA 3S9AA 2XXLA 2VWMA 3K2UA 1S0RA 1NRPH 2HOBA 2WPIS 4YT7H 3GCHB 3TITA 3I77A 3ZV8A 1Z6EA 1TX7A 1P02A 3PMBB 4ABIA 1C2EA 4HGCA 1O31A 3PV4A 1GDUA 3OX7U 2NU1E 6LPRA 1BJVA 4D7FA 1EPTA 2A45B 4ASHA 3DD2H 4TYDA 5EG4A 1GVZA 3PROA 1P2MA 2BDBA 4Y76A 3SU6A 4GCHF 1Y3YA 1Y8TA 2WUBA 3RM2H 3SHCH 1UCYH 4DG4A 2P93A 4AFZA 1C9PA 2TGDA 1P01A 1MTSA 5H4IB 1IQJA 1ZMNA 1KXAA 2FODA 2QY0B 4YZUA 3NUMA 3ZVCA 5DKMA 1P05A 3RP2A 3L3TA 2CN0H 3LC5A 1HJAC 4HI3A 1OSSA 3LGUA 4IW4E 5F8TA 1GCDA 4DW2U 2P94A 2ODYB 5HM2A 3MYWA 2FESH 5A2MH 2BQ7B 4AB8A 2CHAC 3TVJB 4FVBA 1C2GA 4X1RU 4Q7XA 1TNJA 2ZFTA 1EZUC 2XTTB 5T6GA 2PTNA 1LVMA 3LPRA 3D65E 1C1RA 2ANWA 1Y59T 1P2NA 1N8OC 4XBBA 2UUFB 1TNGA 2AYWA 3T26A 1SB1H 4WMFA 3OU0A 2G00A 4IBLH 1GJ7B 2DUCA 1ZGIA 4WY3A 1ZJDA 1UVSH 2HALA 4A7IB 3U8TH 2G8TA 4AG2A 1O2XA 1AN1E 1SVPA 1EP6A 1XUJA 2G5NA 4H6SB 3RXIA 5DPAA 3GDUA 1MZAA 4B76A 1MZDA 1QL9A 2FWWA 1C2FA 1EJNA 9ESTA 1P2KA 3AASA 1HNEE 4YLQH 1V2LT 2FDAA 5GIBA 1AZ8A 1KLIH 1Q2WA 2FOHA 1SMFE 1GGDB 4JYUH 2OQ5A 4ABBA 2A5KA 2ZDNA 1PPHE 4O3UA 1OWKA 1UK3A 5F6MA 1IQIA 1PPBH 1OWHA 4H6TA 3RC6A 4JZIA 2J2UA 2YOLA 1L2EA 1O38A 1V2ST 2R0KA 1GJ8B 4E06H 3M5NA 2AMPA 1RTFB 2XBXA 5HXFA 4IC5A 5LGOA 2ZDLA 3A85A 3E1XB 1UTLM 1O2PA 5AFZH 3KN2A 3SUDA 2G52A 3SNBA 1ELVA 1CU1A 1ELFA 5T6FA 2O9QA 4WVPE 1V2PT 3RXRA 1AZZA 3SGAE 4QT8C 1QURH 2ZFQH 4Z6AH 4UEHH 1ZPCA 1FLEE 3KQCA 4ISIH 2EC9H 1WOFA 3A7YA 3BN9A 2V35A 1O3IA 1MCTA 1Y3UA 4UFFH 3RXJA 1C2IA 3C27B 5A0CA 2BX3A 1AD8H 1SLXB 2OC0A 3GYLB 5C1XA 3V13A 1ZYOA 4BAHB 2PV9B 5TCCA 3M36A 3RXOA 1UO6A 1P0SH 1KXBA 4O97A 2BY7X 4AYVB 2WUCA 4NSVA 4F4OC 1WTGH 2VNTA 4YLUA 5DGJA 3TNSA 1PFXC 2QIQA 4CRGA 1TBRH 3SJOA 3R3GB 1E0FD 5I46H 2AS9A 2A2XH 4NWLA 2Y7XA 1ANBA 3BTEE 5L2YH 1BDAA 5ETXA 3T62A 2QCYA 2D26C 1RJXB 3T29A 2AMDA 1NFYA 4Y7AA 1D4PB 3T5FH 1FN6A 1EOJA 2B5TB 3MOCA 3PWCA 1CGJE 3PWBA 4MPUA 4SGBE 2R2MB 3KQDA 1S82A 2OC8A 2ZU5A 3STJA 3LIWA 4K1TA 2H5DA 4UFEH 5EGMA 4XDEA 1K1OA 4ZKRU 2O8UA 1Y5AT 1O2IA 1HGTH 1H4WA 3SV7A 2OINA 3BTKE 1NO9H 1FQ3A 1ZTLA 4BAKB 1HDTH 1O3DA 1SLVB 4XBCA 2R3YA 2AIQA 3BTQE 2EEKA 4MQAA 1ESAA 2QN5T 4JZEH 1SR5C 1O2YA 3MU5A 3VB7A 2Z9GA 1BTYA 1C5OH 1H8IH 4Y8ZA 2CHAB 3KQEA 1EP5A 1SGNE 3KNXA 2Z7FE 1SBWA 1DUAA 1JIRA 1NRSH 1C5SA 1HJ8A 1SGDE 1YPHC 2BY5X 2BZAA 1U6QA 5JB9S 4CR9A 4INKA 3S7HB 3VXFH 1GI3A 3U8OH 2B8OH 3ZVEA 3S0NA 2ALPA 1SSXA 1HAVB 4WWYA 1XXFA 4ABFA 2CGAA 1SQAA 4OGYA 4OGXA 1FIWA 4DJZB 1VGCC 2GMTB 1GI2A 1DX5M 2C8ZB 3SGBE 4B2BA 1W0ZU 5JDUB 4VGCB 1C5QA 2VH6A 1YLDA 1C1SA 1L4DA 1MH0A 2BD7A 1O3AA 8ESTE 3QUMP 1GGDC 3HK6B 1QL8A 3LGIA 1SGPE 3E90B 1P12E 2FOFA 1K1IA 1SLWB 1DY9A 2QYIA 1HXEH 1FY3A 1FIZA 4Y0YE 1GHAG 2BVXH 2H9TH 1GHYH 1RIWB 4K1SA 1O2GH 2Z6BD 1IQGA 1D3TB 2F83A 3TLOA 2YNBA 3SJ9A 7ESTE 1TGNA 3A86A 1MBQA 2QC2A 1HYLA 3C1KA 2A7HA 3EGKH 1LVYA 5FCKA 3TU7H 3LJOA 1ELGA 2BDIA 3SV9A 4U32A 2A7CA 1O5FH 3QO6A 2BVRH 1FNIA 1XUKA 5E2OA 1T4UH 5CHAB 3R0FA 1GHXH 1LTOA 1GBCA 3P8NA 3UUZA 3G01A 1HCGA 3M5LA 3KGPA 1L1JA 1OXGA 5FPTA 1C5PA 4FUHA 4Q7YA 5JBTA 1ZRBA 2SGEE 1SG8B 2ZU2A 1QB6A 1HAHH 5AF9H 2BTCE 1AB9B 2FYRA 1ETRH 1QJ7B 2PFEA 3QK1A 4JYTA 2GGVB 2EI6A 1YPMH 1IQHA 3SU1A 4GLYA 2UUJB 1G3EA 2ZHFH 1MTNC 2Z94A 3GYMA 1TONA 1FY4A 1C4V2 5EPNA 4X2VA 3PYHA 2C8WB 1TAWA 1HFDA 1BRBE 1IQLA 4NZQA 1MAYA 1BOQA 1YPHE 3SJIA 3Q77A 1QY6A 2PGBB 3BSQA 3RXTA 2EI7A 1DSUA 3MNXA 2GV6A 1GHZA 3SU3A 1CSOE 2STBE 3QDZB 1UK2A 2J34A 2Q6FA 1A46H 1DICA 2P3FH 1C1TA 3U9AH 2AGIX 2XBWA 2Y5HA 3RC5A 2VVUA 1QQUA 2FOEA 1VJAU 3ZZCA 1K1MA 5GCHG 1ZGVA 1ZR0A 3SUFA 3UR9A 2Q1JA 2RDLA 3U98H 1GJ6A 5C67A 3TH2H 1TLDA 1E34B 4I8KA 2CV3A 1C5TA 4R8TB 5GWZA 5C1UA 1JRTA 2OBOA 2VVCA 3TJVA 2XC4A 1G32B 2ZP0H 1ANCA 4I31A 4CR5A 3W94A 2BD2A 2VIDA 3MFJA 1OX1A 1CQQA 1P2OA 2AERH 2FLRH 1TGCA 4BAOB 1P2IA 2BHGA 4FU7A 4FU9A 1AWHB 1ETTH 1ZSKA 3QLPH 1ZHPA 2C4FH 1JRSA 2PKSC 1C1UH 1MAXA 1NY22 4JZFH 1A5GH 2GCTC 1BTWA 3LC3A 4K1EA 4CRBA 1AWFH 1KDQB 3TK9A 4DOQA 4TPIZ 4MG3A 1HIAB 1GJBB 3A8CA 3K65B 5BRRE 5L2ZH 3U69H 1BITA 2XW9A 3BG4C 3UFAA 4JZ1A 1TMBH 2Y6TA 3BF6H 3A7TA 5FAHA 2ZHEH 1O3EA 2ZA5A 2ESTE 2BXUH 3B8JA 4I32A 2J95A 1UJ1A 3TH3H 2WPKS 3LOXA 3Q76A 1UTKA 1TPAE 1BTPA 1DM4B 1O2NA 1THSH 2GZ9A 1A5IA 1K2I1 3JZ1B 3E3TA 1FXYA 2Y81A 2O8MA 1C5RA 4A92A 1ANEA 3ZYEA 1NRNH 3MNCA 1LPGB 1ELBA 3E91A 1C1MA 5F03A 5AHGH 6GCHF 4AFSA 1ABIH 1BMLA 6CHAC 2ZECA 1TPOA 1TMUH 3UNQA 4K8YA 1AKSA 3VB4A 5C3NA 3FAOA 1ZHMA 3RXKA 4CHAC 2B7DH 2O8WA 3OYPA 1MQ6A 1BMMH 2FLBH 2FOBA 1YKTA 4Q7ZA 3CP7A 4INHA 4FUDA 4SGAE 3E0PB 1ACBE 1C1NA 1C2JA 2ZU4A 2ULLA 2CF9H 1DPOA 4MPWA 3SQEE 1W7XH 4I7YH 1TBQH 4NIVA 4H42U 1T31A 3GY6A 2WV5A 3VFEA 1AGJA 2Y5GA 3EYDA 1CT2E 2A2QH 1DXPA 3GISB 2GDDA 3GY5A 2BYAX 2R2WU 1OYQA 1A3EH 5T3HA 1MD8A 1ZZZA 2FOMB 3DA9B 1L1GA 1RD3B 3EAJA 5EW1H 1AMHA 4RN6A 1YPLH 2XWBI 1QJ6B 4I8HA 1GJCB 1MQ5A 2A32A 1W13U 5DK1A 3MU4A 1TWXB 5ESBA 1GL1A 1P03A 2BM2A 1JBUH 3HK3B 1IOEA 2GZ8A 2OLGA 1O2UA 1W14U 1ZPZA 1RS0A 1PPFE 1FUJA 1W7GH 2I6SA 3GCTG 3SUEA 1GI7B 3P17H 2ZU1A 3M3TA 3GY3A 2HNTC 2QXHA 3S7KB 1T8OA 4A6LA 3P70B 1PYTD 1UCYK 1VCPA 3TH4H 4K5ZA 3O8RA 1L0ZA 4YM9A 3DFLA 4ZXYH 1GMCF 3UQVA 5L30H 2CMYA 3RU4T 2OC1A 5FX5A 1ELTA 1TX6A 1H9LB 1TGSZ 2ODPA 4U2WA 1S6FA 1NFUA 3CENA 2FTLE 2VWLA 3TK5A 4RKOB 3HGNA 3NXPA 3AW0A 1TQ0B 1V3XA 3MO9A 4KTUA 3SO3A 4AX9H 1LKAA 3V7TA 2F9BH 5JBCS 1V2QT 3AAVA 1HUTH 3HGPA 1OPHB 2GX4A 3GCOA 1XKAC 3BV9B 2W7UA 5E8EH 2QV1A 4KTSA 4NA9H 2Q6DA 4D7GA 2FYQA 3SBKA 4IGDA 5DP5A 5DP4A 2OBQA 3A8DA 1O33A 2Z3DA 1QR3E 5FCRA 1JIMA 4ZH8A 1MTVA 4NSYA 5GJ4B 4E7NA 1T32A 1W3CA 3SNDA 2ANMH 1ZJKA 3S9CA 1GI4A 1AFQB 4BAMB 3ZVGA 1V2KT 1G9IE 4X2WA 1DS2E 2G55A 1CVWH 1MCVA 1BUIA 5DP3A 1C5XB 1B5GH 4B75A 2FXRA 2UWOA 2ZDAH 3EA7A 1EKBB 3LH1A 1XUIA 1K9OE 2PKSB 4FUCA 3ZZ6A 1EPTB 2ZQ2A 3FZDA 2ZGHA 6ESTA 2PKAB 7GCHG 2TPIZ 1QBNA 2WINI 4K69A 1ZLRA 1SQTA 4B2CA 2ZQ1A 1Z71A 2PHBA 2GTBA 1OS8A 1AY6H 4O9VA 5F8XA 1UVTH 2OP9A 2Z9LA 1O37A 5SGAE 2STAE 3FP6E 2ASUB 1UHBA 3KF2A 4YOGA 2ZFSA 1G36A 2AH4X 4CRDA 1V2UT 1TIOA 1QB1A 4DIIH 1ARBA 5EW2H 3ZVDA 3MO3A 1P10A 5A8ZA 1GL0E 1W8BH 1DWCH 1WYKA 2BD4A 1D3QB 5GXPA 1KTSB 1O3GA 2FX4A 1C2KA 2LNCA 3AW1A 3QTOH 1QBVH 1V2JT 1GJ5H 3A82A 2A1DB 2CJIA 4ZHAA 4NZLA 2SGFE 2QGRA 1FMGA 2A4GA 2FOGA 4B71A 4LOYH 4CHAB 1DXWA 4KP0A 1GBHA 2HPQH 1OWJA 3PO1B 4Y6DA 1UTMA 3M5OA 2FI3E 4X8TH 1J16A 1EAWA 2Z9IA 1IHTH 1TRYA 1C4U2 1FV9A 2C8XB 2P3UB 3S9BA 1DY8A 1EB2A 1YLCA 4XBDA 1HBTH 5EXMA 2ZTZA 1NRQH 1SGYE 1P57B 2BB4A 2FX6A 3VEQB 3F1SB 3DFJA 3WY8A 1O3LA 5E0JA 4AFQA 1C5LH 1SGTA 5DP7A 1G3DA 2WPLS 3ZZ5A 2Y5FA 2QF3A 3MU8A 4AORA 3MMGA 4MLFB 3P8GA 2PGQB 3UTUH 3TGKE 5ESTE 3EA9A 1ID5H 1P8VC 2ZCKP 3MHWU 3O8DA 1H9IE 1TABE 4CH8B 3UNSA 3GY2A 1QA0A 3OTJE 2VU8E 1HXFH 1P9SA 2BY6X 3URCA 3ATWA 2O8TA 2XBYA 2XNIA 1V6DA 2ZHWH 1NZQH 2OTVA 2TIOA 1SGEE 2D2DA 3RM0H 1CA0C 3UPEA 4WF8A 1J15A 4AFUA 1AUTC 1EX3A 3GCNA 3BTFE 3A7XA 3ZZ4A 4CBNA 2JETC 1GVKB 2QXIA 4NFEA 2CF8H 4BTTB 2ZNKH 2OXSA 1GJAB 2A5AA 1NFWA 8KME2 3FP7E 1A5HA 2FOAA 1LHGH 2FS9A 2O8LA 3SU4A 3F9FA 3ZZDA 4BNRA 3RXLA 2THFB 2GCHF 1GBFA 3VXEH 1PQAA 1KDQA 1SQOA 5E2PA 4MNXA 1Z7KA 1TFXA 1GHAF 3UWIA 2C90B 1BTXA 2QA9E 4Y0ZE 3ATLA 3A8AA 1QHRB 3QWCH 5J4QA 4GCHG 3TGIE 1KLJH 4JK6A 2A4OA 4JZDH 3MU1A 1P2JA 2GP9B 1TYNA 5JB8S 1TPSA 5DO4H 3PLPA 4X8UH 3SI4H 1MU6B 4ISLA 3MWIU 3D62A 1C5NH 5TCAA 1DFPA 1XKBC 1YBWA 1UK4A 1BRAA 2ALVA 3SOSA 1QBOA 1TRMA 4THNH 1A1RA 1GI1A 1FPHH 3ZZAA 3KL6A 2ZIQH 3M7QA 1KYNA 2VVVA 2ZHQH 2QF0A 4J1YA 2NU0E 1F0SA 2XYAA 3O8CA 3NK8A 1T8LA 2XC5A 1CBWB 4JK5A 2BD8A 5JBBS 4WH6A 1DOJA 3ATIA 1C2LA 2G51A 2VIPA 4KTCA 1ELDE 1ESBA 4Y11E 4BXWA 3NZIA 1FDPA 4FU8A 1SPJA 5A09A 2P8OB 1P9UA 1GVLA 1NN6A 3MNSA 1P2QA 1CT0E 1HJ9A 3ESTA 1GBTA 1F5RA 1LVBA 1KXCA 3SU5A 1SGFG 2QXJA 3V0XA 2IPHA 3BIUH 1P3CA 1UTPA 4GPGA 1QQ4A 1RXPA 3GY7A 1DWEH 2BDGA 5CMXH 2AGGX 4H4FA 2QAAA 1O2JA 3PO1C 4Y8YA 1XVOA 2ZG0H 3MNBA 1DLKB 3F68H 1H9HE 1RTLA 2R3UA 5HM9A 3RXGA 1A3BH 1EQ9A 3UIRA 1XMNB 1W11U 3IWMA 1BB0B 1O3PB 4BANB 2OCVB 1GG6C 2V3OH 1ZHRA 2ZU3A 1K1PA 2SGAA 4ZKSU 2FI4E 1RFNA 3BEFB 2C3SA 1GJ9B 5J4SA 4X1PU 3H5CB 3IG6B 1H1BA 1F7ZA 3M7UA 1YM0A 4IN2A 1ZTKA 5FXLA 1F5KU 1BCUH 3K6YA 3RXUA 4YOJA 3UQOA 4NWKA 5I25A 1Z8JB 2BQWB 4CRAA 1EJMA 4DVAU 4MVNA 2ILNA 1WV7H 1D9IA 2A5IA 1AU8A 1GHBF 1MKXK 3SNAA 3VGCC 2F9UA 1C1WH 3STIA 3SN8A 4FUJA 1W0YH 1J8AA 4YO9A 3I29A 5FPSA 5A0BA 1V2VT 1V2NT 3SV6A 2SFAA 2Y7ZA 4X6OA 1YPKH 2OUAA 4NA7A 1F5LA 1C5ZB 3F9EA 4WXIA 3RXSA 5A8YA 1OOKB 1FY8E 1GPZA 3BTWE 3BEUA 4ABJA 2BX4A 1SHYA 5ABWA 8LPRA 1UTJA 5L6NH 1ELAA 1BTUA 1UCYE 1TB6H 1VJ9U 3BG8A 2JETB 1DE7H 1LHCH 5EXNA 3LKWA 2JH6D 5G4BA 4ABAA 4AGKA 2BD9A 2BD5A 1C1PA 1W10U 3TJUA 1AVWA 3GOVB 1OWDA 1BHXF 1MTUA 2RA3A 1O39A 1S5SA 2GCHG 9LPRA 1NROH 4WMEA 3A7ZA 1C1OA 3EDXB 4KELA 3BTGE 1NS3A 2F9OA 4MNVA 4CRCA 1IQNA 1TE0A 2ZFRH 2ZTYA 3V12A 4NIWA 1FAKH 4I8JA 3FVFB 1DITH 1EB1H 1IQFA 2KAIB 4MNYA 5A0AE 1BMNH 2ZDVH 1C5YB 2ZO3H 1QB9A 3GY4A 1UVUH 4F49A 2SNWA 4BAQB 2BLQA 1MKWH 5AVDA 4ABHA 2XRCA 3SHAH 1GWAA 1GMDF 5GDSH 2BVSH 1VCQA 2G81E 2DE9A 4K8BA 1EAIA 4X2YA 3RLYH 1BRUP 1LCYA 3LDXH 1ELCA 3ZZ9A 1J14A 5DP6A 8GCHF 4D9QA 3OY5U 2RA0A 2FIRH 2P59A 1HJAB 1YPGH 3MI4A 3RUOA 1LHDH 4CH2B 1O2MA 2ZPRA 1ZMJA 1AE8H 4E05H 1K1LA 2FI5E 3LONA 5LH8A 1O2ZA 3F9GA 2ZHDA 3PTNA 4OS4A 1QNJA 1EZSC 4Y8XA 2ZPQA 4A1TA 1AVXA 3T2NA 1S85A 2BLVA 3K9XB 2OC7A 2P95A 1CGHA 2Y82A 2SGDE 2SGPE 1SI5H 3AAUA 3RXDA 3BTTE 3PLBA 3VB6A 3SUGA 4UDWH 5HGGA 1O2QA 4Q80A 1TOMH 1EATA 5LPRA 1AO5A 5FX6A 1HAIH 2GDEH 4UONA 1D3DB 3VPKA 1GI0A 1OWEA 1DDJA 3F6UH 4WJG2 1MBMA 1CHOF 3RMNH 3AVZA 1O2LA 1AB9C 1LPKB 1TX8A 2FO9A 2VWOA 2VIOA 1C5WB 2PR3A 2VINA 3QGNB 3RXVA 4YT6H 4X2XA 2IN2A 3SNCA 1YF4A 1AQ7A 4UE7H 5IYTA 2WPJS 1AVGH 2BY9X 1DANH 5F8ZA 1S6HA 3FANA 3KHVA 4B73A 1M9UA 1GMHF 1O5DH 1V2MT 2F9VA 2G4UA 1GDQA 2GCTB 2J92A 1GBMA 4VGCC 3TJOA 3QN7A 2J4IA 1IQEA 4LZ1H 1GHWH 3SJ8A 3UOUA 3OSYA 4O03A 1W12U 2GT8A 1YCPK 3E8LA 1X7AC 2AMQA 4FVDA 3HKJB 3BG4B 1T4VH 5C20A 5C5OA 1TNLA 4GAWA 1O3OA 4U01A 2FPZA 2ANKH 1DSTA 1YYY1 1G2LA 1HAOH 1Z1IA 4JMYA 4YESB 1THPB 1O3CA 2GT7A 1QFKH 4DIHH 4ISOA 4YOIA 1DUEA 3S69A 1DVAH 1C9TA 5HMAA 4OS6A 4NGAH 3E6PH 1TNIA 4X8VH 2C93B 1OYTH 4FUFA 2BLWA 3PMAB 1G37A 3LU9B 3GDVA 6CHAB 5AFYH 4AGJA 1WUNH 1EZXC 4OS7A 5JYIA 1QA7A 2XCFA 2Y80A 1XX9A 1E38B 3A8BA 1O3KA 3I78A 3P92A 1VITG 4NIYA 2BXTH 2ZKSA 3NKKA 5CHAC 1PPCE 1EUFA 2OQUA 4U30A 4FXGH 1NESE 1GBAA 1GI5A 3UR6A 1DLEA 3KCGH 4ZXXH 3LJJA 4WMDA 1Y5BT 2F9NA 1UVPA 3KQBA 1GBKA 4HTCH 3PM3A 3Q00A 3U1JB 3SU0A 3A7WA 1GBJA 1F0RA 1QGFA 1Y3XA 1WAYB 2PUXB 1VR1H 1F2SE 1BTZA 1N1LA 1WTHD 2ZWLH 5EU8A 1QCPA 3SU2A 1WQVH 4K3JA 1MUEB 1TPPA 3LGTA 3RC4A 3ZZ8A 2XCNA 1AFEH 4X1QU 4NG9H 1HAYB 3E16B 4AN7A 3QTVH 1BBRH 3NCLA 3RMMH 4IC6A 3ZV9A 1KY9A 2RG3A 4GHTA 2F91A 2FP7B 3TIUA 4A1XA 1VITH 4Y10E 1K22H 2ZGCA 3U8RH 1SGFA 2BMGB 3BTHE 4I8LA 3SV8A 4IN1A 1ZOMA 3RXEA 2HWLB 1Z8RA 5A8XA 1TQ7B 4IMQA 1N8OB 2TGPZ 1PPGE 1XXDA 2VIWA 3P8OA 1AKSB 2W7SA 1BT7A 1NC6A 1BRCE 2XWAA 1AIXH 2FM2A 1O3HA 2PUQH 1F0UA 1FJSA 3B23B 2GZ7A 4UFDH 3EQ0H 3MTYA 3HKIB 1K21H 4DY7B 2H5CA 4OS2A 1EASA 4M7GA 2B0FA 1FY1A 1S83A 2YNAA 3A88A 2SGQE 2LPRA 1C2HA 3ZVFA 1MU8B 1LHFH 1PQ8A 5JPMH 2F9PA 3P8FA 1RGQA 3B9FH 3DT0H 1EZQA 2Z3EA 4ZHLU 3M3SA 1O30A 1ZMLA 1QRWA 4INLA 4NA8A 1TALA 1LQDB 5C1YA 1A0LA 4CRFA 1KXDA 5EQSA 4GSOA 4MPXA 4A1VA 4ABDA 3ENSB 1T8MA 3KIDU 1G3CA 1Z8GA 1S84A 2FOCA 4JCNA 1EJAA 2WYJA 3EE0B 2BZ6H 4ISNA 1Q31A 4FUBA 1JXPA 4J2YB 7KMEH 2IJOB 5DP9A 2VIQA 2OD3B 1MKWK 1O2RA 3ZVBA 4Z0KA 1O5AB 3N7OA 2SNVA 5LPFA 4AB9A 1K1NA 1ARCA 2B9LA 4X1NU 2IOTA 2G4TA 2ZFFH 1RTKA 4YTAA 4BOHA 3KEEA 3UREA 2P3TB 5FPYA 1GI9B 2J38A 3ODFA 1P06A 1KIGH 4I8GA 1A61H 2AGEX 3BIVH 2ZGJA 2R9PA 3RXMA 3ZVAA 1P04A 3QGJA 2PKAA 1GCTB 1SOTA 4X6NA 2Z9KA 2EA3A 1HAVA 1N6YA 4MPVA 4XFQA 2WV4A 7GCHF 3BTDE 3FP8E 3RMLH 1HB0B 3GCHC 2FS8A 2HLCA 4LK4A 3ZZ3A 1SFIA 3QX5H 2BDCA 1Y3VA 3RXAA 3M3VA 4WXVA 1P11E 1FAXA 1ZSLA 4TY7A 1O5EH 1GBIA 3U1IB 2V3HH 4ZMAH 3Q3YA 3TPIZ 1VITF 1LO6A 2D1JA 4X6PA 4RSPA 1D6RA 1JWTA 2BQ6B 1WCZA 3UY9A 5T6DA 1MTNB 2KAIA 1F0TA 3RLWH 3A87A 1GJDB 3RMOH 3UWJH 2W5EA 2W26A 4TY6A 4DURA 3O8BA 3SI3H 1SFQB 1AHTH 1VZQH 2VGCC 2P16A 1BBRK 1L1NA 1QJ1B 2BDHA 1Z1JA 5GPIB 3GY8A 3CS0A 1FZZA 5DJ7A 1B0FA 4TWYA 2GVFA 5E0HA 1O3FA 2HVXA 1HIAA 2UUKB 2PWXA 1PQ5A 3MH4A 1OP8A 1QL7A 1O3JA 3P95A 3RXQA 1E35B 1O2OA 2HGTH 5EXLA 1YPJH 1JOUB 1Z6JH 5FBEA 1T8NA 1O2KA 1RIWC 1GBLA 2TGAA 3A84A 1YCPM 2FEQH 4ZUHA 3RDZA 2PSYA 3SORA 7LPRA 4X6MA 1HLTH 1ETSH 1UMAH 1QIXB 2G5VA 3A81A 1UVOA 4K60A 4B74A 2ZCLP 4D9RA 1TBZH 1A0HB 2TRMA 2ZF0H 1NT1A 1SHHB 5E0GA 3ELAH 1D3PB 1KXFA 1SC8U 1ESTA 3T27A 1YPEH 2AIPA 4I33A 2J9NA 4NCYA 5DP8A 1ZRKA 5HYOA 1PJPA 1SL3A 1CHOG 1K1JA 4XSKU 2FTMA 4X0WU 4AYYB 2GMTC 4A5TS 1B0EA 1HRTH 1OP2A 1GDNA 1VGCB 4MNWA 4WH8A 1NPMA 4X1SU 1LHEH 3F9HA 4FUIA 1LQEA 1C2DA 1V2TT 3SZNA 4PROA 1OKXA 1GI8B 2ZEBA 1Z8IB 3E0NB 3W95A 4ESTE 2ZI2H 1HAXB 1V2WT 1NU7B 2AEIH 2H2ZA 3TGJE 1O0DH 2W3IA 3JZ2B 1C5UA 3MH6A 1J17T 3QZRA 4BTIB 4ZKNU 1LMWB 1WQSA 1KXEA 2VJ1A 5PTPA 1G30B 1KLTA 2GV7A 5CE1A 2GKVE 3RU4D 1BHXB 2V0BA 1BJUA 1O2SA 1BZXE 4TPYA 1AE5A 2WYGA 1CT4E 2XBVA 1K28D 3D23A 3PLKA 1QTFA 1QRXA 3M7TA 1TRNA 2GD4B 2Z3CA 1O3MA 4Q2KA 4O3TA 1HV7A 4FUGA 1C4Y2 1A0JA 2BDAA 3T28A 3VB3A 2XC0A 4D76A 1PYTC 1S81A 2RCEA 1GBEA 2P8OC 3OY6U 5EQQA 3A7VA 3VB5A 4LZ4B 1QRZA 4NIXA 1E36B 4UD9H 4ZAEA 1SLUB 1J9CH 1IAUA 3LH3A 1TNKA 5JBAS 1XUGA 4E7RG 2PSXA 1WSSH 5B6OA 2JH5D 3SQHE 1ANDA 4KGAA 1TMTH 1FY5A 4XE4A 3NPSA 1JMOH 1FPCH 2A0QB 1GMHG 1W2KH 4X8SH 2ANYA 3NWUA 1SGIB 3MU0A 1MTWA 3LT3A 3ODDA 3ATKA 2FMJA 1YCPH 1HPGA 2HRVA 1TGTA 2ODQA 1PQ7A 1L4ZA 4MDSA 2K1QA 4B2AA 1GG6B 2JKHA 2F3CE 1CGIE 1GHVH 3A80A 1Q3XA 2PLXA 2BOKA 3P6ZB 2FZZA 2D8WA 2A4RA 3Q3XA 4TWWA 1YC0A 3QZQA 1P3EA 2Z9JA 1KTTB 3TJNA 2NWNA 3BTME 3LGYA 5GCHF 1KSNA 3MH5A 2H9EH 2ZFPH 1V2RT 2HPPH 3H7OA 4HFPB 2NU2E 5C2ZA 2Q6GA 1MD7A 1A4WH 3M37A 1WBGB 3VGCB 1PPZA 1XUHA 1IQKA 1BBRE 1OWIA 4Y7BA 3ZZBA 1RRKA 4DT7B 1O5BB 3D49H 3TNTA 1XUFA 1EXFA 1GHBG 2BD3A 4ABEA 3HPTB 2VIVA 1GMCG 5FHTA 1UTNA 1IQMA 1O2WA 5IDKA 1EAUA 3SV2H 1V2OT 2NU3E 1BIOA 2BOHB 8GCHG 2AFQB 5EQRA 2A7JA 1TA2A 4GVUA 1Y3WA 1CA8B 1YGCH 1HAGE 3GCTF 4ZKOU 3M35A 1N6XA 2TGTA 4NFFA 1AI8H 1D6WA 3M61U 1GI6A 3RXFA 2H9HA 1T7CA 4AZ2B 3SNEA 1EOLA 1LVOA 3ATMA 1LKBA 2ZGBH 1O3NA 2ZZUH 4ZHMU 1O5GH 1LPZB 4BTUB 2WPHS 5BPEA 3TK6A 1GJ4H 4DCDA 1CA0B 4FUEA 3PMJA 1UTOA 5DG6A 1C2MA 3A83A 1TNHA 1ZPBA 4R0IA 3V3MA 1MMJN 4GUXA 3L6PA 1UHBB 3EA8A 1O2VA 1UTQA 3M5MA 4JYVH 1MKXH 4HZHA 2DE8A 2ZGXH 1TGBA 2HNTF 1NU9A 2V6NA 3A89A 1O35A 3RXHA 5EODA 1CBWC 4ABGA 4ZROA 2HNTE 1G2MA 1LDTT 5K7RA 1O2HA 3GICB 4AG1A 1ABJH 1INCA 1PPEE 1GMDG 2ZPSA 1GBBA 1F92A 1GCTC 2W3KA 3CS7A 1E37B 1C5MD 1BTHH 2C8YB 1BMAA 4BXSA 1EAXA 3T25A 1DT2A 2QXGA 1FN8A 1OP0A 2ZDMA 3RXPA 3SJKA 4D8NA 3URDA 3RXCA 1SGQE 3GDSA 1O3BA 1C1VH 4AOQA 2BY8X 1H8DH 2A4QA 5FBIA 1CO7E 3SGQE 1NRRH 2ZCHP 1O32A 1NFXA 1G3BA 3FZZA 2NU4E 2R0LA 4DGJA 1WU1A 1AFQC 2UUYA 5EOKA 3HATH 5EPYA 1NM6A 2A31A 3PB1E 1AUJA 1ELEE 2H6MA 1HAZB 1O5CB 1SGRE 2EI8A 2JH0D 2TBSA 4UFGH 1O36A 2VGCB 1DWDH 6GCHG 2H1UA 4CBOA 1IHSH 3DHKH 1XVMA 1EPTC 1ZSJA 1B7XB 2M5TA 3ZYDA 2PW8H 1XM1A 2ZC9H 1GBDA 2VWNA 3UOPA 3UNRA 3L33A 2PTCE 3BEIB 1C1QA 4IMZA 1BA8B 1YP9A 2BLOA 2ZDKA 2CXVA 1TOCB 2UWLA 4CREA 1ZTJA 3LGWA 4Y79A 4OS5A 4LXBH 2VB0A 2BDYA 4ISHH 3ZZ7A 2J94A 1S0QA 1CHGA 2I6QA 1HAPH 1THRH 1SGCA 3ITIA 2ZTXA 4XOJA 4B1TA 1VCWA 2VH0A 1SOZA 4OS1A 1TA6A 4MTBA 4KKDA 1FONA 4RKJB 1C5VA 3H7TA 3PMHB 1A2CH 1FI8A 1P09A 4IS5A 3MH7A 1NTPA 3DUXH 1Y5UT 1DWBH 2UWPA 3PTBA 3SW2B 5K0HA 1ORFA 3MO6A 1BQYA 5C5NA 1A7SA 4K2YA 4GHQA 5TJXA 3FFGA 1O34A 3K6ZA 3RU4E 3IITA 5LPEA 2WPMS
chains in the Genus database with same CATH superfamily
3Q3KA 1CE5A 4Y71A 3LGVA 3RXBA 1O2TA 3S9AA 2XXLA 2VWMA 3K2UA 1S0RA 1NRPH 2HOBA 2WPIS 4YT7H 3GCHB 3TITA 3I77A 3ZV8A 1Z6EA 1TX7A 1P02A 3PMBB 4ABIA 1C2EA 4HGCA 1O31A 3PV4A 1GDUA 3OX7U 2NU1E 6LPRA 1BJVA 4D7FA 1EPTA 2A45B 4ASHA 3DD2H 4TYDA 5EG4A 1GVZA 3PROA 1P2MA 2BDBA 4Y76A 3SU6A 4GCHF 1Y3YA 1Y8TA 2WUBA 3RM2H 3SHCH 1UCYH 4DG4A 2P93A 4AFZA 1C9PA 2TGDA 1P01A 4B6FA 1MTSA 5H4IB 1IQJA 1ZMNA 1KXAA 2FODA 2QY0B 4YZUA 3NUMA 3ZVCA 5DKMA 1P05A 3RP2A 3L3TA 2CN0H 3LC5A 1HJAC 4HI3A 1OSSA 3LGUA 4IW4E 5F8TA 1GCDA 4DW2U 2P94A 2ODYB 5HM2A 3MYWA 2FESH 5A2MH 2BQ7B 3F2HA 4AB8A 2CHAC 2PP6A 4FETA 4FVBA 3TVJB 1C2GA 4X1RU 4Q7XA 1TNJA 2ZFTA 1EZUC 2XTTB 5T6GA 2PTNA 1LVMA 3LPRA 3D65E 4DT4A 1C1RA 2ANWA 1Y59T 1P2NA 1N8OC 4XBBA 2UUFB 1TNGA 2AYWA 3T26A 2EY4C 1SB1H 4WMFA 3OU0A 2G00A 4IBLH 1GJ7B 2DUCA 1ZGIA 4WY3A 1ZJDA 1UVSH 2HALA 4A7IB 3U8TH 2G8TA 4AG2A 1O2XA 1AN1E 1SVPA 1EP6A 1XUJA 2G5NA 4H6SB 3RXIA 5DPAA 3GDUA 4YXWD 1MZAA 4B76A 1MZDA 1QL9A 2FWWA 1C2FA 1EJNA 9ESTA 1P2KA 3AASA 1HNEE 4YLQH 1V2LT 2FDAA 5GIBA 1AZ8A 1KLIH 1Q2WA 2FOHA 1SMFE 1GGDB 4JYUH 3U28C 2OQ5A 4ABBA 2KCAA 2A5KA 2ZDNA 1PPHE 4O3UA 1OWKA 1UK3A 5F6MA 1IQIA 1PPBH 1OWHA 4H6TA 3RC6A 4JZIA 2J2UA 2YOLA 1L2EA 1O38A 1V2ST 2R0KA 1GJ8B 4E06H 3M5NA 2AMPA 2JIZD 1RTFB 2XBXA 5HXFA 4IC5A 5LGOA 1YY3A 2ZDLA 3A85A 3E1XB 1UTLM 1O2PA 5AFZH 3KN2A 2L74A 3SUDA 2G52A 3SNBA 1ELVA 1CU1A 3EE7A 1ELFA 5T6FA 2O9QA 4WVPE 1V2PT 3RXRA 1AZZA 3SGAE 4QT8C 1QURH 5CHBA 2ZFQH 4Z6AH 4UEHH 1ZPCA 1FLEE 3KQCA 4ISIH 2EC9H 1WOFA 3A7YA 3BN9A 2V35A 1O3IA 1MCTA 1Y3UA 4UFFH 3RXJA 1C2IA 3C27B 5A0CA 2BX3A 2J98B 1AD8H 1SLXB 2OC0A 3GYLB 5C1XA 3V13A 1ZYOA 4BAHB 3H09A 2PV9B 5TCCA 3M36A 3RXOA 1UO6A 1YWUA 1P0SH 1KXBA 4O97A 2BY7X 4AYVB 2WUCA 4NSVA 4F4OC 5FL7D 1WTGH 2VNTA 4YLUA 5DGJA 3TNSA 1PFXC 2QIQA 4CRGA 1TBRH 3SJOA 2JDID 3R3GB 1E0FD 5I46H 2AS9A 2A2XH 4NWLA 2Y7XA 1ANBA 3BTEE 5L2YH 1BDAA 5ETXA 3T62A 2QCYA 2D26C 1RJXB 3T29A 2AMDA 1NFYA 4Y7AA 1D4PB 3FOAA 3T5FH 1FN6A 1EOJA 2B5TB 3MOCA 3PWCA 1CGJE 3PWBA 4MPUA 4SGBE 2R2MB 3KQDA 1S82A 2OC8A 2ZU5A 3STJA 3LIWA 4K1TA 2H5DA 4UFEH 5EGMA 4XDEA 1K1OA 4ZKRU 2O8UA 1Y5AT 1O2IA 1HGTH 1H4WA 3SV7A 2OINA 3BTKE 1NO9H 1FQ3A 1ZTLA 4BAKB 1HDTH 1O3DA 1SLVB 4XBCA 5DN6D 2R3YA 2AIQA 3BTQE 2EEKA 4MQAA 1ESAA 2QN5T 3N99A 4JZEH 1SR5C 2OK5A 2WV9A 1O2YA 3MU5A 3VB7A 2Z9GA 1BTYA 1C5OH 1H8IH 4Y8ZA 2CHAB 3KQEA 1EP5A 1SGNE 3KNXA 2Z7FE 1SBWA 1DUAA 1JIRA 1NRSH 1C5SA 1HJ8A 1SGDE 1YPHC 2BY5X 2BZAA 1U6QA 5JB9S 4CR9A 4INKA 2F4LA 3S7HB 3VXFH 1GI3A 3U8OH 2B8OH 3ZVEA 3S0NA 2ALPA 1SSXA 1HAVB 4WWYA 3VG8A 1XXFA 4ABFA 2CGAA 1SQAA 4OGYA 4OGXA 1FIWA 4DJZB 5T1VA 1VGCC 2GMTB 1GI2A 1DX5M 2C8ZB 3SGBE 4B2BA 1W0ZU 5JDUB 2XOKD 1C5QA 4VGCB 2VH6A 1YLDA 1C1SA 1L4DA 1MH0A 2BD7A 1O3AA 8ESTE 3QUMP 1GGDC 2XNDD 3HK6B 1QL8A 3LGIA 1SGPE 3E90B 4OM9A 1P12E 2FOFA 1K1IA 1SLWB 1DY9A 2QYIA 3ZIAD 1HXEH 1FY3A 1FIZA 4Y0YE 1GHAG 2BVXH 2H9TH 1E1RD 1GHYH 1RIWB 4K1SA 1O2GH 2Z6BD 1IQGA 1D3TB 2F83A 3TLOA 2YNBA 3SJ9A 7ESTE 1TGNA 3A86A 1MBQA 2QC2A 1HYLA 3C1KA 2A7HA 3EGKH 1LVYA 5FCKA 1KMHB 3TU7H 3LJOA 1ELGA 2BDIA 3SV9A 4U32A 2A7CA 1O5FH 3QO6A 2BVRH 1FNIA 1XUKA 5E2OA 1T4UH 5HIYA 5CHAB 3R0FA 1GHXH 1LTOA 1GBCA 3P8NA 1WDIA 3UUZA 3G01A 1HCGA 3M5LA 3KGPA 1L1JA 1OXGA 5EJ1A 5FPTA 1C5PA 4FUHA 4Q7YA 5JBTA 1ZRBA 2SGEE 1SG8B 2ZU2A 1QB6A 1HAHH 5AF9H 2BTCE 1AB9B 2FYRA 1ETRH 1QJ7B 2PFEA 3FN8A 3QK1A 2RDEA 4JYTA 2GGVB 2EI6A 1YPMH 1IQHA 3SU1A 4GLYA 2UUJB 1G3EA 2ZHFH 1MTNC 2Z94A 3GYMA 1TONA 1FY4A 3WWBA 1C4V2 5EPNA 4X2VA 3PYHA 1S6LA 2C8WB 1TAWA 1HFDA 1BRBE 1IQLA 4NZQA 1MAYA 1BOQA 1YPHE 5KGOA 3SJIA 3Q77A 1QY6A 2PGBB 3BSQA 3RXTA 2EI7A 1DSUA 3MNXA 2GV6A 1GHZA 3SU3A 1CSOE 2STBE 3QDZB 1UK2A 2J34A 2Q6FA 1A46H 1DICA 2P3FH 1C1TA 3U9AH 2AGIX 2XBWA 2Y5HA 3RC5A 2VVUA 1QQUA 2FOEA 1VJAU 3ZZCA 1K1MA 5GCHG 1ZGVA 1K0HA 1ZR0A 3SUFA 3UR9A 2Q1JA 2RDLA 3U98H 1GJ6A 5C67A 3TH2H 1TLDA 1E34B 4I8KA 2CV3A 1C5TA 4R8TB 5GWZA 5C1UA 1JRTA 2OBOA 2VVCA 3TJVA 2XC4A 1G32B 2ZP0H 1ANCA 4I31A 4CR5A 3W94A 2BD2A 2VIDA 3MFJA 1OX1A 1CQQA 1P2OA 2AERH 2FLRH 1WXRA 3KYFA 1TGCA 4BAOB 3F2GA 1P2IA 2BHGA 4FU7A 4FU9A 1AWHB 1ETTH 1ZSKA 3QLPH 1ZHPA 2C4FH 1JRSA 2PKSC 1C1UH 1MAXA 1NY22 4JZFH 1A5GH 2GCTC 1BTWA 3LC3A 4K1EA 4CRBA 1AWFH 1KDQB 3TK9A 4DOQA 4TPIZ 4MG3A 1HIAB 1GJBB 3A8CA 3K65B 5BRRE 5L2ZH 3U69H 1BITA 2XW9A 3BG4C 3UFAA 4JZ1A 1TMBH 2Y6TA 5HKKD 3BF6H 3A7TA 5FAHA 2ZHEH 1O3EA 2ZA5A 2ESTE 2BXUH 3B8JA 4I32A 2J95A 2JJ1D 1UJ1A 3TH3H 2WPKS 3LOXA 3Q76A 1UTKA 1TPAE 1BTPA 1DM4B 1O2NA 1THSH 2GZ9A 1A5IA 2QF4A 1K2I1 3JZ1B 3E3TA 1FXYA 2Y81A 2O8MA 1C5RA 4A92A 1ANEA 3ZYEA 1OHHD 1NRNH 3MNCA 1LPGB 1ELBA 3E91A 1C1MA 5F03A 5AHGH 6GCHF 4AFSA 1ABIH 1BMLA 6CHAC 2ZECA 1TPOA 1TMUH 3UNQA 4K8YA 1AKSA 3VB4A 5C3NA 3FAOA 1ZHMA 3RXKA 4CHAC 2B7DH 2O8WA 3OYPA 1MQ6A 1BMMH 2FLBH 2FOBA 1YKTA 2HVYB 3NRLA 4Q7ZA 3CP7A 4INHA 4FUDA 4SGAE 3E0PB 1ACBE 1C1NA 1C2JA 2ZU4A 2ULLA 2CF9H 1DPOA 4MPWA 3SQEE 1W7XH 4I7YH 1TBQH 4NIVA 4H42U 3SYJA 1T31A 3GY6A 2WV5A 3VFEA 1AGJA 2Y5GA 4ZCNA 3EYDA 1CT2E 2A2QH 1DXPA 3GISB 2GDDA 3GY5A 2BYAX 2R2WU 1OYQA 1A3EH 5T3HA 1MD8A 3PV5A 1ZZZA 2FOMB 3DA9B 1L1GA 5F53A 1RD3B 3EAJA 5EW1H 1AMHA 2KFWA 4RN6A 1YPLH 2XWBI 1QJ6B 4I8HA 1GJCB 1MQ5A 2A32A 1W13U 5DK1A 3MU4A 1TWXB 5ESBA 1GL1A 1P03A 2BM2A 1JBUH 3HK3B 1IOEA 2GZ8A 2OLGA 1O2UA 1W14U 1ZPZA 1RS0A 1PPFE 1FUJA 1W7GH 2KR7A 2I6SA 3GCTG 3SUEA 1GI7B 3P17H 2ZU1A 3M3TA 2W6ID 3GY3A 2HNTC 2QXHA 3S7KB 1T8OA 4A6LA 3P70B 1PYTD 1UCYK 1VCPA 3TH4H 4K5ZA 3O8RA 1L0ZA 4YM9A 3DFLA 4ZXYH 1GMCF 3UQVA 5L30H 2CMYA 3RU4T 2OC1A 5FX5A 1ELTA 1TX6A 1H9LB 4Q4LA 1TGSZ 2ODPA 4U2WA 1S6FA 1NFUA 3CENA 2FTLE 2VWLA 3TK5A 4RKOB 3HGNA 3NXPA 3AW0A 1TQ0B 1V3XA 3MO9A 4KTUA 3SO3A 4AX9H 1LKAA 3V7TA 2F9BH 5JBCS 1V2QT 3AAVA 1HUTH 3HGPA 1OPHB 2GX4A 3GCOA 1XKAC 3BV9B 2W7UA 5E8EH 2HLDD 2QV1A 4KTSA 4NA9H 2Q6DA 4D7GA 2FYQA 3SBKA 4IGDA 5DP5A 5DP4A 2OBQA 3A8DA 1O33A 2Z3DA 1QR3E 5FCRA 1JIMA 4ZH8A 1MTVA 4NSYA 5GJ4B 4E7NA 1T32A 1W3CA 3SNDA 2W6JD 4XRNA 2ANMH 1ZJKA 3S9CA 1GI4A 1AFQB 4BAMB 3ZVGA 1V2KT 1G9IE 4X2WA 1DS2E 2G55A 1CVWH 1MCVA 1BUIA 5DP3A 1C5XB 1B5GH 4B75A 2FXRA 4F55A 2UWOA 2ZDAH 3EA7A 1EKBB 3LH1A 2K8IA 1XUIA 1K9OE 2PKSB 4FUCA 3ZZ6A 1EPTB 2ZQ2A 3FZDA 2ZGHA 6ESTA 2PKAB 7GCHG 2TPIZ 1QBNA 2WINI 4K69A 5C17A 1ZLRA 1SQTA 4B2CA 2ZQ1A 1Z71A 2PHBA 2GTBA 4ACBA 1OS8A 1AY6H 4O9VA 5F8XA 1UVTH 2OP9A 2Z9LA 1O37A 5SGAE 2STAE 3FP6E 2ASUB 1UHBA 3KF2A 4YOGA 2ZFSA 1G36A 2AH4X 4CRDA 1V2UT 1TIOA 1QB1A 4DIIH 1ARBA 5EW2H 3ZVDA 2WSSD 3MO3A 1P10A 5A8ZA 1GL0E 1W8BH 1DWCH 1WYKA 2BD4A 1D3QB 5GXPA 1KTSB 1O3GA 2FX4A 1C2KA 2LNCA 3AW1A 3QTOH 1QBVH 1V2JT 1GJ5H 3A82A 3KYGA 2A1DB 2CJIA 4ZHAA 4NZLA 2SGFE 2QGRA 1FMGA 1BMFD 2A4GA 2FOGA 4B71A 4LOYH 4CHAB 1DXWA 4KP0A 1GBHA 2HPQH 1OWJA 3PO1B 4Y6DA 1UTMA 3M5OA 2FI3E 4X8TH 1J16A 1EAWA 2Z9IA 1IHTH 1TRYA 1C4U2 1FV9A 2C8XB 2P3UB 3S9BA 1DY8A 1EB2A 1YLCA 4XBDA 1HBTH 2WPDD 5EXMA 2L6OA 2ZTZA 1NRQH 1SGYE 1P57B 1SKYE 2BB4A 2FX6A 3VEQB 3F1SB 3DFJA 3WY8A 1O3LA 5E0JA 4AFQA 1C5LH 1SGTA 5DP7A 1G3DA 2WPLS 3ZZ5A 2Y5FA 2QF3A 3MU8A 4AORA 3MMGA 4MLFB 2IJD1 3P8GA 2PGQB 3UTUH 3TGKE 5ESTE 3EA9A 1ID5H 1P8VC 4ASUD 2ZCKP 3MHWU 2LP6A 3O8DA 1H9IE 1TABE 2LELA 4CH8B 3UNSA 3GY2A 1QA0A 3OTJE 1HXFH 2VU8E 1P9SA 2BY6X 3URCA 5EJZA 3UAIC 3ATWA 2O8TA 2XBYA 2XNIA 1V6DA 2ZHWH 1NZQH 2OTVA 2TIOA 1SGEE 2D2DA 3RM0H 1CA0C 3UPEA 4WF8A 1J15A 4AC9A 4AFUA 1AUTC 1EX3A 3GCNA 3BTFE 3F2FA 3A7XA 3ZZ4A 4CBNA 2JETC 1GVKB 2JJ2D 2QXIA 4NFEA 2CF8H 4BTTB 2ZNKH 2OXSA 1GJAB 2A5AA 1NFWA 8KME2 3FP7E 1A5HA 2FOAA 1LHGH 2FS9A 2O8LA 3SU4A 3F9FA 3ZZDA 4BNRA 3RXLA 2THFB 2GCHF 1GBFA 3VXEH 1PQAA 1NBME 1KDQA 1SQOA 5E2PA 4MNXA 1Z7KA 1TFXA 1GHAF 3UWIA 2C90B 1BTXA 2QA9E 4Y0ZE 3ATLA 3A8AA 1QHRB 3QWCH 5J4QA 4GCHG 3TGIE 3DCLA 1KLJH 4JK6A 2A4OA 4JZDH 3MU1A 1P2JA 2GP9B 4Q63A 1TYNA 5JB8S 1TPSA 5DO4H 3PLPA 4X8UH 2EQNA 3SI4H 4P02A 1MU6B 4ISLA 3MWIU 3D62A 4Z1MD 1C5NH 5TCAA 1DFPA 1XKBC 1YBWA 1UK4A 1BRAA 2ALVA 3SOSA 1QBOA 1TRMA 4THNH 1A1RA 1GI1A 1FPHH 3ZZAA 3KL6A 2ZIQH 3M7QA 1KYNA 2VVVA 2ZHQH 2QF0A 4J1YA 2NU0E 1F0SA 2XYAA 3O8CA 3NK8A 1T8LA 2XC5A 1CBWB 4JK5A 2BD8A 5JBBS 4WH6A 1DOJA 3ATIA 1C2LA 2G51A 2VIPA 5C0UA 4KTCA 1ELDE 1ESBA 4Y11E 4BXWA 3NZIA 1FDPA 4FU8A 1SPJA 5A09A 2P8OB 1P9UA 1GVLA 1NN6A 3MNSA 1P2QA 1CT0E 1HJ9A 3ESTA 1GBTA 1F5RA 1LVBA 1KXCA 2J98A 1SGFG 3SU5A 2QXJA 2KM0A 3V0XA 4FOUC 2IPHA 3MQKC 3BIUH 1P3CA 1UTPA 4GPGA 1QQ4A 1RXPA 3GY7A 1DWEH 2BDGA 5CMXH 2AGGX 4H4FA 2QAAA 1O2JA 3PO1C 4Y8YA 1XVOA 2K0QA 2ZG0H 3MNBA 1DLKB 3F68H 1H9HE 1RTLA 2R3UA 3WW7A 5HM9A 3RXGA 1A3BH 1EQ9A 3UIRA 1XMNB 1H8ED 1W11U 3IWMA 1BB0B 1O3PB 4BANB 2OCVB 1GG6C 2V3OH 1ZHRA 2ZU3A 1K1PA 2QF5A 2SGAA 4ZKSU 2FI4E 1RFNA 3BEFB 2C3SA 1GJ9B 5J4SA 4X1PU 3H5CB 3IG6B 1H1BA 1F7ZA 3M7UA 1YM0A 4IN2A 1ZTKA 5FXLA 1F5KU 1BCUH 3K6YA 3RXUA 4YOJA 4RI0A 3UQOA 4NWKA 5I25A 1Z8JB 2BQWB 4CRAA 1EJMA 4DVAU 4MVNA 2ILNA 3OEHD 1WV7H 1D9IA 2A5IA 3DSOA 1AU8A 1GHBF 1MKXK 3SNAA 3VGCC 2F9UA 1C1WH 3STIA 3SN8A 4FUJA 1W0YH 1J8AA 4YO9A 3I29A 5FPSA 5A0BA 1V2VT 1V2NT 3SV6A 2SFAA 2Y7ZA 4X6OA 1YPKH 2OUAA 3KQ5A 4NA7A 1F5LA 1C5ZB 3F9EA 4WXIA 3RXSA 5A8YA 1OOKB 1FY8E 1GPZA 3BTWE 5EIYA 3BEUA 4ABJA 2BX4A 1SHYA 5ABWA 8LPRA 1UTJA 5IK2D 5L6NH 1ELAA 1BTUA 1UCYE 2YMSC 1TB6H 1VJ9U 3BG8A 2JETB 1DE7H 1LHCH 5EXNA 3LKWA 2JH6D 5G4BA 4ABAA 4AGKA 2BD9A 2BD5A 2KCOA 1C1PA 1W10U 3TJUA 1AVWA 3GOVB 1E1QD 1OWDA 1BHXF 1MTUA 2RA3A 1O39A 1S5SA 2GCHG 9LPRA 1NROH 4WMEA 3A7ZA 1C1OA 3EDXB 4KELA 3BTGE 1NS3A 2F9OA 4MNVA 4CRCA 1IQNA 1TE0A 3OFND 2ZFRH 2ZTYA 3V12A 4NIWA 1FAKH 4I8JA 3FVFB 1DITH 1EB1H 3PRBA 1IQFA 2KAIB 4MNYA 5A0AE 1BMNH 2ZDVH 1C5YB 2ZO3H 1QB9A 4F48B 3GY4A 1UVUH 4F49A 2SNWA 4BAQB 2BLQA 1MKWH 5AVDA 4ABHA 3OE7D 2KCYA 2XRCA 3SHAH 1GWAA 1GMDF 5GDSH 2BVSH 1VCQA 2G81E 2DE9A 4K8BA 1EAIA 4X2YA 3RLYH 1BRUP 1LCYA 3LDXH 1ELCA 3ZZ9A 1J14A 5DP6A 8GCHF 4D9QA 3OY5U 2RA0A 2FIRH 2P59A 1HJAB 1YPGH 3MI4A 3RUOA 1LHDH 4CH2B 1O2MA 2ZPRA 1ZMJA 1AE8H 4E05H 1K1LA 2FI5E 3LONA 5LH8A 1O2ZA 5HYOA 3F9GA 2ZHDA 3PTNA 4OS4A 1QNJA 4RT1A 1EZSC 4Y8XA 2ZPQA 4A1TA 1AVXA 3T2NA 1S85A 2BLVA 3K9XB 2OC7A 2P95A 1CGHA 2Y82A 2SGDE 2SGPE 1SI5H 3AAUA 3RXDA 3BTTE 3PLBA 3VB6A 3SUGA 4UDWH 5HGGA 1O2QA 4Q80A 1TOMH 3SZEA 1EATA 5LPRA 1AO5A 5FX6A 1HAIH 2GDEH 4UONA 1D3DB 3VPKA 1GI0A 1OWEA 1DDJA 3F6UH 4WJG2 3FO8D 1MBMA 1CHOF 3RMNH 3AVZA 1O2LA 1AB9C 1LPKB 1TX8A 2FO9A 2VIOA 2VWOA 1C5WB 2PR3A 2VINA 3QGNB 3RXVA 4YT6H 4X2XA 2IN2A 3SNCA 1YF4A 1AQ7A 4UE7H 5IYTA 5C94A 2WPJS 1AVGH 2BY9X 1DANH 5F8ZA 1S6HA 3FANA 3KHVA 4B73A 1M9UA 1GMHF 1O5DH 1V2MT 2F9VA 2G4UA 1GDQA 2GCTB 2J92A 1GBMA 4VGCC 3TJOA 3QN7A 2J4IA 1IQEA 4LZ1H 1GHWH 3SJ8A 3UOUA 3OSYA 4O03A 1W12U 2GT8A 1YCPK 3E8LA 1X7AC 2AMQA 4FVDA 3HKJB 3BG4B 1T4VH 5C20A 5C5OA 1TNLA 4GAWA 1O3OA 4U01A 2FPZA 2ANKH 1DSTA 1YYY1 1G2LA 1HAOH 1Z1IA 4JMYA 4YESB 1THPB 1O3CA 2GT7A 1QFKH 4DIHH 4ISOA 4YOIA 1DUEA 3S69A 1DVAH 1C9TA 5HMAA 4OS6A 4NGAH 3E6PH 5GNDA 1TNIA 4X8VH 2C93B 1OYTH 4FUFA 2BLWA 3PMAB 1G37A 2V3MA 1YLNA 3LU9B 1VKYA 1FX0B 3GDVA 5AFYH 6CHAB 4AGJA 1WUNH 1EZXC 4OS7A 5JYIA 1QA7A 2XCFA 2Y80A 1XX9A 1E38B 3A8BA 1O3KA 3I78A 3P92A 1VITG 3UB0A 4NIYA 2BXTH 2ZKSA 3NKKA 5CHAC 2V7QD 1PPCE 1EUFA 2OQUA 4U30A 4FXGH 1NESE 1GBAA 1GI5A 3UR6A 1DLEA 3KCGH 4ZXXH 3LJJA 4WMDA 1Y5BT 2F9NA 1UVPA 3KQBA 1GBKA 4HTCH 3PM3A 3Q00A 3U1JB 3SU0A 3A7WA 1GBJA 1F0RA 1QGFA 1Y3XA 1WAYB 2PUXB 3N7DA 1VR1H 1F2SE 1BTZA 1N1LA 1WTHD 2ZWLH 5EU8A 1QCPA 3SU2A 4RT0A 1WQVH 4K3JA 1MUEB 1TPPA 3LGTA 3RC4A 3ZZ8A 2XCNA 1AFEH 4X1QU 4NG9H 1HAYB 3E16B 4AN7A 3QTVH 4XD7D 1BBRH 3NCLA 3F0PA 3RMMH 4IC6A 3ZV9A 1KY9A 2RG3A 4GHTA 2F91A 2FP7B 3TIUA 4A1XA 1VITH 4Y10E 1K22H 2ZGCA 3U8RH 1SGFA 2BMGB 3BTHE 2QE7D 1W0JD 4I8LA 3SV8A 4IN1A 1ZOMA 3RXEA 2HWLB 1Z8RA 5A8XA 1TQ7B 4IMQA 1N8OB 2TGPZ 1PPGE 1XXDA 2VIWA 3P8OA 1AKSB 2W7SA 1BT7A 1NC6A 1BRCE 2XWAA 1AIXH 2FM2A 1O3HA 2PUQH 1F0UA 1FJSA 3B23B 2GZ7A 4UFDH 3F0OA 3EQ0H 3MTYA 3HKIB 1K21H 2KZ4A 4DY7B 2H5CA 4OS2A 1EASA 4M7GA 2B0FA 1FY1A 1S83A 2YNAA 3A88A 2SGQE 2LPRA 1C2HA 3ZVFA 1MU8B 1LHFH 1PQ8A 5JPMH 2F9PA 3P8FA 1RGQA 3B9FH 3DT0H 1EZQA 2Z3EA 2CK3D 4ZHLU 3M3SA 1O30A 1ZMLA 1QRWA 4INLA 4NA8A 1TALA 1LQDB 5C1YA 1A0LA 4CRFA 1KXDA 3W1EA 5EQSA 4GSOA 4MPXA 4A1VA 2WHXA 3DSGA 3ENSB 1T8MA 4ABDA 3KIDU 1G3CA 1Z8GA 1S84A 2FOCA 4JCNA 1EJAA 5CDFE 5KEDA 2WYJA 3EE0B 2BZ6H 4ISNA 1Q31A 4FUBA 1JXPA 4J2YB 7KMEH 2IJOB 5DP9A 2VIQA 2OD3B 1MKWK 3F3BA 1O2RA 3ZVBA 4Z0KA 1O5AB 3N7OA 2SNVA 5LPFA 4AB9A 1K1NA 1ARCA 2B9LA 4X1NU 2IOTA 2G4TA 2ZFFH 5C0TA 1RTKA 3OAAD 4YTAA 4BOHA 3KEEA 3UREA 2P3TB 5FPYA 1GI9B 2J38A 2J5UA 4HG6A 3ODFA 4I86A 1P06A 1KIGH 4I8GA 1A61H 2AGEX 3BIVH 2ZGJA 2R9PA 3RXMA 3ZVAA 1P04A 3QGJA 2PKAA 1GCTB 1SOTA 4X6NA 2Z9KA 2EA3A 1HAVA 1N6YA 4MPVA 4XFQA 2WV4A 7GCHF 3BTDE 3FP8E 3RMLH 1HB0B 3GCHC 2FS8A 2HLCA 4LK4A 3ZZ3A 1SFIA 3QX5H 2BDCA 1Y3VA 3RXAA 3M3VA 4WXVA 1P11E 1FAXA 1ZSLA 4TY7A 1O5EH 1GBIA 3U1IB 2V3HH 4ZMAH 3Q3YA 3TPIZ 1VITF 1LO6A 2D1JA 4X6PA 1COWD 4RSPA 1D6RA 1JWTA 2BQ6B 1WCZA 3UY9A 5T6DA 1MTNB 2KAIA 1F0TA 3RLWH 3A87A 1GJDB 3RMOH 3UWJH 2W5EA 2W26A 4TY6A 4DURA 3O8BA 3SI3H 1SFQB 1AHTH 1VZQH 2KCPA 2VGCC 2P16A 1SQRA 1BBRK 1L1NA 1QJ1B 2BDHA 1Z1JA 5GPIB 3GY8A 3CS0A 1FZZA 5DJ7A 1B0FA 4TWYA 2GVFA 5E0HA 3OTPA 1O3FA 2HVXA 1HIAA 2UUKB 2PWXA 1PQ5A 3MH4A 1OP8A 1QL7A 1O3JA 3P95A 3RXQA 1E35B 1O2OA 2HGTH 1E79D 5EXLA 1YPJH 1JOUB 1Z6JH 5FBEA 1T8NA 1O2KA 1RIWC 1GBLA 2TGAA 3A84A 1YCPM 2FEQH 4ZUHA 3RDZA 2PSYA 3SORA 7LPRA 4X6MA 1HLTH 1ETSH 1UMAH 1QIXB 2G5VA 3A81A 1UVOA 4K60A 4B74A 2ZCLP 4D9RA 1TBZH 1A0HB 2TRMA 2ZF0H 4P00A 1NT1A 1SHHB 4ACAA 5E0GA 3ELAH 1D3PB 1KXFA 1SC8U 1ESTA 3T27A 1YPEH 2AIPA 4I33A 2J9NA 2M2AA 4NCYA 1ZRKA 5DP8A 1PJPA 1SL3A 1CHOG 1K1JA 2KX4A 4XSKU 2FTMA 4X0WU 4AYYB 2GMTC 4A5TS 1B0EA 1HRTH 2YMSB 1OP2A 1GDNA 1VGCB 4MNWA 4WH8A 1NPMA 4X1SU 1LHEH 3F9HA 1UW7A 4FUIA 1LQEA 1C2DA 1V2TT 3SZNA 4PROA 1OKXA 1GI8B 2ZEBA 1Z8IB 3E0NB 3PV2A 3W95A 4ESTE 2ZI2H 1HAXB 1V2WT 1NU7B 2AEIH 2H2ZA 3TGJE 1O0DH 2IPQX 2W3IA 3JZ2B 1C5UA 3MH6A 1J17T 3QZRA 4BTIB 4ZKNU 1LMWB 1WQSA 1KXEA 2VJ1A 5PTPA 1G30B 1KLTA 2GV7A 3N7EA 5CE1A 2GKVE 3RU4D 1BHXB 2V0BA 1BJUA 1O2SA 1BZXE 4TPYA 1AE5A 2WYGA 4M9FA 1CT4E 2XBVA 1K28D 3D23A 3PLKA 1QTFA 1QRXA 3M7TA 1TRNA 2GD4B 2Z3CA 1O3MA 4Q2KA 4O3TA 1HV7A 4FUGA 1C4Y2 1A0JA 2BDAA 3T28A 3VB3A 2XC0A 4D76A 1PYTC 1S81A 2RCEA 1GBEA 2P8OC 3OY6U 5EQQA 3A7VA 3VB5A 4LZ4B 1QRZA 4NIXA 1E36B 4UD9H 4ZAEA 1SLUB 1J9CH 1IAUA 3LH3A 1TNKA 5JBAS 1XUGA 4E7RG 2PSXA 1WSSH 5B6OA 2JH5D 3CNRA 3SQHE 1ANDA 4KGAA 1TMTH 1FY5A 4TSFD 4XE4A 3NPSA 1JMOH 2GJGA 1FPCH 2A0QB 1MABB 1GMHG 1W2KH 4X8SH 2ANYA 3NWUA 1SGIB 3MU0A 1MTWA 3LT3A 3ODDA 3ATKA 2FMJA 1YCPH 1HPGA 2HRVA 1TGTA 2ODQA 1PQ7A 1L4ZA 4MDSA 2K1QA 4B2AA 1GG6B 2JKHA 2F3CE 1CGIE 1GHVH 3PRDA 3A80A 1Q3XA 2PLXA 2BOKA 3P6ZB 2FZZA 2D8WA 2A4RA 3Q3XA 4TWWA 1YC0A 2F43B 3QZQA 1P3EA 2Z9JA 1KTTB 3TJNA 2NWNA 3BTME 3LGYA 5GCHF 1KSNA 3MH5A 2H9EH 2ZFPH 1V2RT 1W0KD 2HPPH 3H7OA 4HFPB 2NU2E 3WWFA 5C2ZA 2Q6GA 1MD7A 1A4WH 3M37A 1WBGB 3VGCB 1PPZA 1XUHA 1IQKA 1BBRE 1OWIA 4Y7BA 3AK5A 3ZZBA 1RRKA 4DT7B 1O5BB 3D49H 3TNTA 1XUFA 1EXFA 1GHBG 2BD3A 2RFKC 4ABEA 3HPTB 2VIVA 1GMCG 5FHTA 1UTNA 1IQMA 1O2WA 5IDKA 1EAUA 3SV2H 1V2OT 2NU3E 1BIOA 5HIZA 2BOHB 8GCHG 2AFQB 5EQRA 2A7JA 3FKSD 1TA2A 4GVUA 1Y3WA 1CA8B 1YGCH 1HAGE 4B6EA 3GCTF 4ZKOU 3M35A 1N6XA 2TGTA 4NFFA 1AI8H 1D6WA 3M61U 1GI6A 3RXFA 2H9HA 1T7CA 4AZ2B 3SNEA 1EOLA 1LVOA 3ATMA 1LKBA 2ZGBH 1O3NA 2ZZUH 4ZHMU 5DSFA 1O5GH 1LPZB 4BTUB 2WPHS 5BPEA 2J97A 3TK6A 1GJ4H 4DCDA 1CA0B 4FUEA 1QZ8A 3PMJA 1UTOA 5DG6A 1C2MA 2VBCA 3A83A 1TNHA 1ZPBA 4R0IA 3V3MA 1MMJN 4GUXA 3L6PA 1UHBB 3EA8A 1O2VA 1UTQA 3DSPA 3M5MA 4JYVH 1MKXH 4HZHA 2DE8A 2ZGXH 1TGBA 1EFRD 1NU9A 2HNTF 2V6NA 3A89A 1O35A 3RXHA 5EODA 1CBWC 4ABGA 4ZROA 2HNTE 1G2MA 1LDTT 5K7RA 1O2HA 3GICB 4AG1A 1ABJH 1INCA 2WZQA 2AHME 1PPEE 1GMDG 2ZPSA 1GBBA 1F92A 1GCTC 2W3KA 5KECA 3CS7A 1E37B 1C5MD 1BTHH 2C8YB 1BMAA 4BXSA 1EAXA 3T25A 1DT2A 2QXGA 1FN8A 1OP0A 2ZDMA 3RXPA 3SJKA 4D8NA 3URDA 3RXCA 1SGQE 3GDSA 1O3BA 1C1VH 4AOQA 2BY8X 1H8DH 2A4QA 5FBIA 1CO7E 5EJLA 3SGQE 1NRRH 2ZCHP 1O32A 1NFXA 1G3BA 3FZZA 2NU4E 2R0LA 4DGJA 1WU1A 1AFQC 2UUYA 5EOKA 3HATH 5EPYA 1NM6A 2A31A 3PB1E 1AUJA 1ELEE 2H6MA 1HAZB 1O5CB 2TBSA 1SGRE 2EI8A 2JH0D 4UFGH 1O36A 2VGCB 1DWDH 6GCHG 2H1UA 4CBOA 1IHSH 2YMSD 3DHKH 1XVMA 1EPTC 1ZSJA 1B7XB 2M5TA 3ZYDA 2PW8H 1XM1A 2ZC9H 1GBDA 2VWNA 3UOPA 3UNRA 3L33A 2PTCE 3BEIB 1C1QA 4TT3D 4IMZA 1BA8B 1YP9A 2BLOA 2ZDKA 2CXVA 1TOCB 2UWLA 4CREA 1ZTJA 3LGWA 4Y79A 4OS5A 4LXBH 2VB0A 2BDYA 4ISHH 3ZZ7A 2J94A 1S0QA 1CHGA 2I6QA 1HAPH 1THRH 1SGCA 3ITIA 2ZTXA 4XOJA 4B1TA 1VCWA 2VH0A 1SOZA 4OS1A 1TA6A 4MTBA 4KKDA 1FONA 3OEED 4RKJB 1C5VA 3H7TA 3PMHB 1A2CH 3GS9A 1FI8A 5B6LA 1P09A 4IS5A 3MH7A 1NTPA 1H8HD 3DUXH 1Y5UT 1DWBH 2UWPA 3PTBA 1NBMD 3SW2B 5K0HA 1ORFA 3MO6A 1BQYA 5C5NA 1A7SA 4K2YA 4GHQA 5TJXA 3FFGA 1O34A 3K6ZA 3RU4E 3IITA 5LPEA 2WPMS
chains in the Genus database with same CATH topology
3Q3KA 1CE5A 4Y71A 3LGVA 3RXBA 1O2TA 3S9AA 2XXLA 2VWMA 3K2UA 1S0RA 1NRPH 2HOBA 2WPIS 4YT7H 3GCHB 3TITA 3I77A 3ZV8A 1Z6EA 1TX7A 1P02A 3PMBB 4ABIA 1C2EA 4HGCA 1O31A 3PV4A 1GDUA 3OX7U 2NU1E 6LPRA 1BJVA 4D7FA 1EPTA 2A45B 4ASHA 3DD2H 4TYDA 5EG4A 1GVZA 3PROA 1P2MA 2BDBA 4Y76A 3SU6A 4GCHF 1Y3YA 1Y8TA 2WUBA 3RM2H 3SHCH 1UCYH 4DG4A 2P93A 4AFZA 1C9PA 2TGDA 1P01A 1MTSA 5H4IB 1IQJA 1ZMNA 1KXAA 2FODA 2QY0B 4YZUA 3NUMA 3ZVCA 5DKMA 1P05A 3RP2A 3L3TA 2CN0H 3LC5A 1HJAC 4HI3A 1OSSA 3LGUA 4IW4E 5F8TA 1GCDA 4DW2U 2P94A 2ODYB 5HM2A 3MYWA 2FESH 5A2MH 2BQ7B 4AB8A 2CHAC 3TVJB 4FVBA 1C2GA 4X1RU 4Q7XA 1TNJA 2ZFTA 1EZUC 2XTTB 5T6GA 2PTNA 1LVMA 3LPRA 3D65E 1C1RA 2ANWA 1Y59T 1P2NA 1N8OC 4XBBA 2UUFB 1TNGA 2AYWA 3T26A 1SB1H 4WMFA 3OU0A 2G00A 4IBLH 1GJ7B 2DUCA 1ZGIA 4WY3A 1ZJDA 1UVSH 2HALA 4A7IB 3U8TH 2G8TA 4AG2A 1O2XA 1AN1E 1SVPA 1EP6A 1XUJA 2G5NA 4H6SB 3RXIA 5DPAA 3GDUA 1MZAA 4B76A 1MZDA 1QL9A 2FWWA 1C2FA 1EJNA 9ESTA 1P2KA 3AASA 1HNEE 4YLQH 1V2LT 2FDAA 5GIBA 1AZ8A 1KLIH 1Q2WA 2FOHA 1SMFE 1GGDB 4JYUH 2OQ5A 4ABBA 2A5KA 2ZDNA 1PPHE 4O3UA 1OWKA 1UK3A 5F6MA 1IQIA 1PPBH 1OWHA 4H6TA 3RC6A 4JZIA 2J2UA 2YOLA 1L2EA 1O38A 1V2ST 2R0KA 1GJ8B 4E06H 3M5NA 2AMPA 1RTFB 2XBXA 5HXFA 4IC5A 5LGOA 2ZDLA 3A85A 3E1XB 1UTLM 1O2PA 5AFZH 3KN2A 3SUDA 2G52A 3SNBA 1ELVA 1CU1A 1ELFA 5T6FA 2O9QA 4WVPE 1V2PT 3RXRA 1AZZA 3SGAE 4QT8C 1QURH 2ZFQH 4Z6AH 4UEHH 1ZPCA 1FLEE 3KQCA 4ISIH 2EC9H 1WOFA 3A7YA 3BN9A 2V35A 1O3IA 1MCTA 1Y3UA 4UFFH 3RXJA 1C2IA 3C27B 5A0CA 2BX3A 1AD8H 1SLXB 2OC0A 3GYLB 5C1XA 3V13A 1ZYOA 4BAHB 2PV9B 5TCCA 3M36A 3RXOA 1UO6A 1P0SH 1KXBA 4O97A 2BY7X 4AYVB 2WUCA 4NSVA 4F4OC 1WTGH 2VNTA 4YLUA 5DGJA 3TNSA 1PFXC 2QIQA 4CRGA 1TBRH 3SJOA 3R3GB 1E0FD 5I46H 2AS9A 2A2XH 4NWLA 2Y7XA 1ANBA 3BTEE 5L2YH 1BDAA 5ETXA 3T62A 2QCYA 2D26C 1RJXB 3T29A 2AMDA 1NFYA 4Y7AA 1D4PB 3T5FH 1FN6A 1EOJA 2B5TB 3MOCA 3PWCA 1CGJE 3PWBA 4MPUA 4SGBE 2R2MB 3KQDA 1S82A 2OC8A 2ZU5A 3STJA 3LIWA 4K1TA 2H5DA 4UFEH 5EGMA 4XDEA 1K1OA 4ZKRU 2O8UA 1Y5AT 1O2IA 1HGTH 1H4WA 3SV7A 2OINA 3BTKE 1NO9H 1FQ3A 1ZTLA 4BAKB 1HDTH 1O3DA 1SLVB 4XBCA 2R3YA 2AIQA 3BTQE 2EEKA 4MQAA 1ESAA 2QN5T 4JZEH 1SR5C 1O2YA 3MU5A 3VB7A 2Z9GA 1BTYA 1C5OH 1H8IH 4Y8ZA 2CHAB 3KQEA 1EP5A 1SGNE 3KNXA 2Z7FE 1SBWA 1DUAA 1JIRA 1NRSH 1C5SA 1HJ8A 1SGDE 1YPHC 2BY5X 2BZAA 1U6QA 5JB9S 4CR9A 4INKA 3S7HB 3VXFH 1GI3A 3U8OH 2B8OH 3ZVEA 3S0NA 2ALPA 1SSXA 1HAVB 4WWYA 1XXFA 4ABFA 2CGAA 1SQAA 4OGYA 4OGXA 1FIWA 4DJZB 1VGCC 2GMTB 1GI2A 1DX5M 2C8ZB 3SGBE 4B2BA 1W0ZU 5JDUB 4VGCB 1C5QA 2VH6A 1YLDA 1C1SA 1L4DA 1MH0A 2BD7A 1O3AA 8ESTE 3QUMP 1GGDC 3HK6B 1QL8A 3LGIA 1SGPE 3E90B 1P12E 2FOFA 1K1IA 1SLWB 1DY9A 2QYIA 1HXEH 1FY3A 1FIZA 4Y0YE 1GHAG 2BVXH 2H9TH 1GHYH 1RIWB 4K1SA 1O2GH 2Z6BD 1IQGA 1D3TB 2F83A 3TLOA 2YNBA 3SJ9A 7ESTE 1TGNA 3A86A 1MBQA 2QC2A 1HYLA 3C1KA 2A7HA 3EGKH 1LVYA 5FCKA 3TU7H 3LJOA 1ELGA 2BDIA 3SV9A 4U32A 2A7CA 1O5FH 3QO6A 2BVRH 1FNIA 1XUKA 5E2OA 1T4UH 5CHAB 3R0FA 1GHXH 1LTOA 1GBCA 3P8NA 3UUZA 3G01A 1HCGA 3M5LA 3KGPA 1L1JA 1OXGA 5FPTA 1C5PA 4FUHA 4Q7YA 5JBTA 1ZRBA 2SGEE 1SG8B 2ZU2A 1QB6A 1HAHH 5AF9H 2BTCE 1AB9B 2FYRA 1ETRH 1QJ7B 2PFEA 3QK1A 4JYTA 2GGVB 2EI6A 1YPMH 1IQHA 3SU1A 4GLYA 2UUJB 1G3EA 2ZHFH 1MTNC 2Z94A 3GYMA 1TONA 1FY4A 1C4V2 5EPNA 4X2VA 3PYHA 2C8WB 1TAWA 1HFDA 1BRBE 1IQLA 4NZQA 1MAYA 1BOQA 1YPHE 3SJIA 3Q77A 1QY6A 2PGBB 3BSQA 3RXTA 2EI7A 1DSUA 3MNXA 2GV6A 1GHZA 3SU3A 1CSOE 2STBE 3QDZB 1UK2A 2J34A 2Q6FA 1A46H 1DICA 2P3FH 1C1TA 3U9AH 2AGIX 2XBWA 2Y5HA 3RC5A 2VVUA 1QQUA 2FOEA 1VJAU 3ZZCA 1K1MA 5GCHG 1ZGVA 1ZR0A 3SUFA 3UR9A 2Q1JA 2RDLA 3U98H 1GJ6A 5C67A 3TH2H 1TLDA 1E34B 4I8KA 2CV3A 1C5TA 4R8TB 5GWZA 5C1UA 1JRTA 2OBOA 2VVCA 3TJVA 2XC4A 1G32B 2ZP0H 1ANCA 4I31A 4CR5A 3W94A 2BD2A 2VIDA 3MFJA 1OX1A 1CQQA 1P2OA 2AERH 2FLRH 1TGCA 4BAOB 1P2IA 2BHGA 4FU7A 4FU9A 1AWHB 1ETTH 1ZSKA 3QLPH 1ZHPA 2C4FH 1JRSA 2PKSC 1C1UH 1MAXA 1NY22 4JZFH 1A5GH 2GCTC 1BTWA 3LC3A 4K1EA 4CRBA 1AWFH 1KDQB 3TK9A 4DOQA 4TPIZ 4MG3A 1HIAB 1GJBB 3A8CA 3K65B 5BRRE 5L2ZH 3U69H 1BITA 2XW9A 3BG4C 3UFAA 4JZ1A 1TMBH 2Y6TA 3BF6H 3A7TA 5FAHA 2ZHEH 1O3EA 2ZA5A 2ESTE 2BXUH 3B8JA 4I32A 2J95A 1UJ1A 3TH3H 2WPKS 3LOXA 3Q76A 1UTKA 1TPAE 1BTPA 1DM4B 1O2NA 1THSH 2GZ9A 1A5IA 1K2I1 3JZ1B 3E3TA 1FXYA 2Y81A 2O8MA 1C5RA 4A92A 1ANEA 3ZYEA 1NRNH 3MNCA 1LPGB 1ELBA 3E91A 1C1MA 5F03A 5AHGH 6GCHF 4AFSA 1ABIH 1BMLA 6CHAC 2ZECA 1TPOA 1TMUH 3UNQA 4K8YA 1AKSA 3VB4A 5C3NA 3FAOA 1ZHMA 3RXKA 4CHAC 2B7DH 2O8WA 3OYPA 1MQ6A 1BMMH 2FLBH 2FOBA 1YKTA 4Q7ZA 3CP7A 4INHA 4FUDA 4SGAE 3E0PB 1ACBE 1C1NA 1C2JA 2ZU4A 2ULLA 2CF9H 1DPOA 4MPWA 3SQEE 1W7XH 4I7YH 1TBQH 4NIVA 4H42U 1T31A 3GY6A 2WV5A 3VFEA 1AGJA 2Y5GA 3EYDA 1CT2E 2A2QH 1DXPA 3GISB 2GDDA 3GY5A 2BYAX 2R2WU 1OYQA 1A3EH 5T3HA 1MD8A 1ZZZA 2FOMB 3DA9B 1L1GA 1RD3B 3EAJA 5EW1H 1AMHA 4RN6A 1YPLH 2XWBI 1QJ6B 4I8HA 1GJCB 1MQ5A 2A32A 1W13U 5DK1A 3MU4A 1TWXB 5ESBA 1GL1A 1P03A 2BM2A 1JBUH 3HK3B 1IOEA 2GZ8A 2OLGA 1O2UA 1W14U 1ZPZA 1RS0A 1PPFE 1FUJA 1W7GH 2I6SA 3GCTG 3SUEA 1GI7B 3P17H 2ZU1A 3M3TA 3GY3A 2HNTC 2QXHA 3S7KB 1T8OA 4A6LA 3P70B 1PYTD 1UCYK 1VCPA 3TH4H 4K5ZA 3O8RA 1L0ZA 4YM9A 3DFLA 4ZXYH 1GMCF 3UQVA 5L30H 2CMYA 3RU4T 2OC1A 5FX5A 1ELTA 1TX6A 1H9LB 1TGSZ 2ODPA 4U2WA 1S6FA 1NFUA 3CENA 2FTLE 2VWLA 3TK5A 4RKOB 3HGNA 3NXPA 3AW0A 1TQ0B 1V3XA 3MO9A 4KTUA 3SO3A 4AX9H 1LKAA 3V7TA 2F9BH 5JBCS 1V2QT 3AAVA 1HUTH 3HGPA 1OPHB 2GX4A 3GCOA 1XKAC 3BV9B 2W7UA 5E8EH 2QV1A 4KTSA 4NA9H 2Q6DA 4D7GA 2FYQA 3SBKA 4IGDA 5DP5A 5DP4A 2OBQA 3A8DA 1O33A 2Z3DA 1QR3E 5FCRA 1JIMA 4ZH8A 1MTVA 4NSYA 5GJ4B 4E7NA 1T32A 1W3CA 3SNDA 2ANMH 1ZJKA 3S9CA 1GI4A 1AFQB 4BAMB 3ZVGA 1V2KT 1G9IE 4X2WA 1DS2E 2G55A 1CVWH 1MCVA 1BUIA 5DP3A 1C5XB 1B5GH 4B75A 2FXRA 2UWOA 2ZDAH 3EA7A 1EKBB 3LH1A 1XUIA 1K9OE 2PKSB 4FUCA 3ZZ6A 1EPTB 2ZQ2A 3FZDA 2ZGHA 6ESTA 2PKAB 7GCHG 2TPIZ 1QBNA 2WINI 4K69A 1ZLRA 1SQTA 4B2CA 2ZQ1A 1Z71A 2PHBA 2GTBA 1OS8A 1AY6H 4O9VA 5F8XA 1UVTH 2OP9A 2Z9LA 1O37A 5SGAE 2STAE 3FP6E 2ASUB 1UHBA 3KF2A 4YOGA 2ZFSA 1G36A 2AH4X 4CRDA 1V2UT 1TIOA 1QB1A 4DIIH 1ARBA 5EW2H 3ZVDA 3MO3A 1P10A 5A8ZA 1GL0E 1W8BH 1DWCH 1WYKA 2BD4A 1D3QB 5GXPA 1KTSB 1O3GA 2FX4A 1C2KA 2LNCA 3AW1A 3QTOH 1QBVH 1V2JT 1GJ5H 3A82A 2A1DB 2CJIA 4ZHAA 4NZLA 2SGFE 2QGRA 1FMGA 2A4GA 2FOGA 4B71A 4LOYH 4CHAB 1DXWA 4KP0A 1GBHA 2HPQH 1OWJA 3PO1B 4Y6DA 1UTMA 3M5OA 2FI3E 4X8TH 1J16A 1EAWA 2Z9IA 1IHTH 1TRYA 1C4U2 1FV9A 2C8XB 2P3UB 3S9BA 1DY8A 1EB2A 1YLCA 4XBDA 1HBTH 5EXMA 2ZTZA 1NRQH 1SGYE 1P57B 2BB4A 2FX6A 3VEQB 3F1SB 3DFJA 3WY8A 1O3LA 5E0JA 4AFQA 1C5LH 1SGTA 5DP7A 1G3DA 2WPLS 3ZZ5A 2Y5FA 2QF3A 3MU8A 4AORA 3MMGA 4MLFB 3P8GA 2PGQB 3UTUH 3TGKE 5ESTE 3EA9A 1ID5H 1P8VC 2ZCKP 3MHWU 3O8DA 1H9IE 1TABE 4CH8B 3UNSA 3GY2A 1QA0A 3OTJE 2VU8E 1HXFH 1P9SA 2BY6X 3URCA 3ATWA 2O8TA 2XBYA 2XNIA 1V6DA 2ZHWH 1NZQH 2OTVA 2TIOA 1SGEE 2D2DA 3RM0H 1CA0C 3UPEA 4WF8A 1J15A 4AFUA 1AUTC 1EX3A 3GCNA 3BTFE 3A7XA 3ZZ4A 4CBNA 2JETC 1GVKB 2QXIA 4NFEA 2CF8H 4BTTB 2ZNKH 2OXSA 1GJAB 2A5AA 1NFWA 8KME2 3FP7E 1A5HA 2FOAA 1LHGH 2FS9A 2O8LA 3SU4A 3F9FA 3ZZDA 4BNRA 3RXLA 2THFB 2GCHF 1GBFA 3VXEH 1PQAA 1KDQA 1SQOA 5E2PA 4MNXA 1Z7KA 1TFXA 1GHAF 3UWIA 2C90B 1BTXA 2QA9E 4Y0ZE 3ATLA 3A8AA 1QHRB 3QWCH 5J4QA 4GCHG 3TGIE 1KLJH 4JK6A 2A4OA 4JZDH 3MU1A 1P2JA 2GP9B 1TYNA 5JB8S 1TPSA 5DO4H 3PLPA 4X8UH 3SI4H 1MU6B 4ISLA 3MWIU 3D62A 1C5NH 5TCAA 1DFPA 1XKBC 1YBWA 1UK4A 1BRAA 2ALVA 3SOSA 1QBOA 1TRMA 4THNH 1A1RA 1GI1A 1FPHH 3ZZAA 3KL6A 2ZIQH 3M7QA 1KYNA 2VVVA 2ZHQH 2QF0A 4J1YA 2NU0E 1F0SA 2XYAA 3O8CA 3NK8A 1T8LA 2XC5A 1CBWB 4JK5A 2BD8A 5JBBS 4WH6A 1DOJA 3ATIA 1C2LA 2G51A 2VIPA 4KTCA 1ELDE 1ESBA 4Y11E 4BXWA 3NZIA 1FDPA 4FU8A 1SPJA 5A09A 2P8OB 1P9UA 1GVLA 1NN6A 3MNSA 1P2QA 1CT0E 1HJ9A 3ESTA 1GBTA 1F5RA 1LVBA 1KXCA 3SU5A 1SGFG 2QXJA 3V0XA 2IPHA 3BIUH 1P3CA 1UTPA 4GPGA 1QQ4A 1RXPA 3GY7A 1DWEH 2BDGA 5CMXH 2AGGX 4H4FA 2QAAA 1O2JA 3PO1C 4Y8YA 1XVOA 2ZG0H 3MNBA 1DLKB 3F68H 1H9HE 1RTLA 2R3UA 5HM9A 3RXGA 1A3BH 1EQ9A 3UIRA 1XMNB 1W11U 3IWMA 1BB0B 1O3PB 4BANB 2OCVB 1GG6C 2V3OH 1ZHRA 2ZU3A 1K1PA 2SGAA 4ZKSU 2FI4E 1RFNA 3BEFB 2C3SA 1GJ9B 5J4SA 4X1PU 3H5CB 3IG6B