4XDEA

Coagulation factor xii protease domain crystal structure
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
241
Chain Sequence
b'VALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVSLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVSHHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coagulation factor XII
publication title Coagulation factor XII protease domain crystal structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 56
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.38: Coagulation factor XIIa.
pdb deposition date 2014-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xdeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4xdeA01
1TQ0B 5C20A 1O2NA 3TNTA 3RC4A 7KMEH 2ZGCA 1DFPA 2GCTB 2DE9A 3ZZ3A 1ZR0A 2ALPA 4IN1A 4KP0A 4UDWH 1VR1H 1GVLA 3SGAE 1C1RA 1SHYA 2IN2A 4CHAB 4HGCA 2C8ZB 2WV4A 1BITA 1T8OA 2V0BA 1UTMA 1C2IA 3T26A 1O37A 1ESBA 1UO6A 1WQVH 3O8CA 3LJOA 3MOCA 3H5CB 1YLCA 4X8VH 1J15A 3E91A 3ZZ6A 4WH8A 1B0EA 1BTUA 1ZMNA 2QXIA 1IQNA 1LVMA 1L1NA 5L6NH 3LGUA 4Y8ZA 1S84A 1YF4A 4B71A 4X2WA 3SU3A 4Y8XA 4MPXA 1GMDF 4HFPB 4AORA 2EC9H 1HAOH 1A5HA 1TNIA 2NU4E 3RC6A 2ZPRA 3SI4H 3UQOA 1G3BA 2TGTA 1MTNB 2WV5A 1V2TT 4IC5A 1GHVH 1SQAA 3LONA 2A7JA 2ZZUH 4FUIA 1GI5A 1BB0B 4TY7A 2Z94A 1JOUB 1QJ1B 2XBYA 2CHAC 1NRPH 2F9OA 1SGDE 1J17T 1QRXA 1P04A 7GCHF 2R2WU 2GX4A 1W7XH 4YZUA 1EB2A 1EOJA 2ILNA 1YCPH 3UNRA 1C1OA 2ZDLA 3A7VA 3A82A 2A2XH 2FTMA 2W3IA 2VIPA 4HI3A 1QTFA 2F9PA 5AFYH 5HGGA 2JH6D 4A1XA 5JB9S 1NU7B 3KGPA 2LPRA 1AU8A 4Y8YA 1BCUH 2WPLS 2AGIX 2VVCA 4X2VA 1C1QA 1WU1A 2VVUA 2PSYA 4DGJA 1MCTA 1QJ6B 5GDSH 4ZXXH 3CS7A 3ZVDA 1AN1E 3EA7A 3SOSA 3ZZ7A 2BZ6H 3AVZA 3RXRA 4NFFA 1O5CB 1GDNA 2FLRH 2BD9A 1S6FA 1BRBE 2F83A 3UR6A 3S9CA 1O2RA 1IHSH 1MZDA 1WAYB 1O2YA 5BPEA 4A1TA 4JZFH 1OSSA 1XUKA 1DICA 5DP4A 5HYOA 2VVVA 2ZGJA 1O2HA 3D49H 1AMHA 3QZRA 5CMXH 1D3DB 2BD2A 1LHEH 1GGDB 1UTKA 2OINA 4ZHAA 1YPMH 3BTWE 1ORFA 1O3KA 1P10A 1SOZA 4MLFB 2W7SA 2ZA5A 3SW2B 4GCHG 1P2IA 2QCYA 3SQEE 2AGGX 2CGAA 1VCWA 4RKOB 3BV9B 5DP9A 2G55A 3SHAH 8GCHG 2GCTC 5EODA 1G32B 1J8AA 4IMZA 4CHAC 1HAPH 3N7OA 4BTIB 4X2YA 1O33A 1PPFE 4ZXYH 1KLTA 1V2VT 1C1WH 1Z71A 4I33A 2RDLA 2SGEE 4TPIZ 2I6QA 1T7CA 1TNKA 2XRCA 1OXGA 1GDUA 2AS9A 1GJ6A 1F0TA 1FUJA 1GI0A 1BIOA 1GBKA 1GJBB 1HCGA 5T3HA 2BVXH 3WY8A 1UVUH 2CF9H 3EDXB 1BTWA 2VH0A 3RXQA 5EXMA 1E38B 3NPSA 3F9EA 1QB6A 1G3DA 3ODDA 1EAWA 3URCA 3SJKA 1A5IA 1BJVA 1XXFA 3OU0A 5FBIA 3ZVBA 1YPHC 1MCVA 3F1SB 1QFKH 1CT4E 1EPTB 3KL6A 5AHGH 1GI7B 5G4BA 3LPRA 1MTNC 2P95A 1XUHA 1P12E 1FV9A 4FUDA 3PYHA 3TU7H 1C1SA 4BTTB 5PTPA 3BG8A 1GL0E 2P3TB 1EATA 4RSPA 4ABJA 1P2KA 1HAHH 1Y3WA 5A0BA 3MU8A 4AGJA 1HPGA 3SQHE 1YCPM 3LIWA 3SU5A 1YYY1 3KCGH 1NFWA 1FIWA 1ZYOA 4X1QU 1BQYA 1LTOA 1QB9A 1BTPA 2HLCA 1EJAA 1GI4A 2W3KA 5GPIB 4D7FA 2EI8A 1K21H 1NROH 3FP7E 2OCVB 4ISIH 1AO5A 3SU1A 4Q7YA 3MH6A 1CQQA 4WWYA 1OPHB 1T8MA 2WPIS 4INKA 4E06H 1O2LA 2Q6FA 2EI7A 1O2XA 2AYWA 2FI5E 4B75A 1QR3E 2FI4E 4YO9A 1C9TA 1O3MA 1QQ4A 3QZQA 4X1RU 1MD7A 1NC6A 4X8TH 4FUGA 2VIVA 1W14U 4D9RA 5L30H 1GJDB 3KF2A 1TB6H 2FODA 3PWCA 1BTXA 1O2TA 1VITG 1GBBA 3S69A 5CHAC 1C5PA 2H9HA 2JETB 2OD3B 1W2KH 1GBJA 1ELDE 1C4Y2 2Q1JA 3HKJB 4YESB 1WV7H 4RKJB 1EAUA 2H5CA 1PJPA 2O8MA 1GDQA 4AFZA 1D6WA 1O2SA 1GGDC 2OC1A 3PMAB 1J16A 4E7NA 3A85A 2ZHFH 2ZFSA 2B5TB 1BHXF 3IITA 4XBDA 4IMQA 1LQDB 4YTAA 5ESBA 1BTHH 4DIIH 4AFUA 1PQ8A 4GSOA 5GCHG 2JKHA 5E8EH 2C8YB 3Q00A 4X6MA 1C5WB 1TGNA 3LKWA 4OS2A 1IQFA 2SNVA 5LGOA 1AKSA 1GBAA 1EP6A 3QO6A 3VFEA 4NIVA 4DCDA 3ZV9A 1KYNA 1TBZH 1MUEB 4ZKNU 2J34A 3U9AH 3MH5A 5DGJA 3BEUA 1O3JA 3U1IB 2BDHA 1JWTA 4J2YB 3OY5U 1TA2A 2XNIA 3M7TA 3SN8A 3K65B 3SU0A 1ESAA 2ZCHP 1QA7A 4K1SA 1TNJA 1A46H 3MO3A 2OQ5A 3ZVEA 3P8NA 4ZKRU 1AZ8A 1EPTC 1TFXA 1ZSJA 3BTQE 1ZHPA 3DT0H 2UWLA 5DP3A 4TPYA 1GBHA 2HOBA 3UY9A 1J9CH 3T27A 2PUXB 4JZIA 3LDXH 3HGPA 3SO3A 1YPJH 2BOHB 2PUQH 1GI6A 2JH0D 1HJ9A 1DLKB 1FI8A 1C5LH 4UFDH 1OWKA 1GBTA 5F8TA 3L33A 3RXTA 4B2CA 1TMTH 3ENSB 3RUOA 2Z9GA 3RXOA 3CP7A 1S6HA 1P01A 1TX6A 2TRMA 5DPAA 1NRNH 1EJMA 1TLDA 1MBMA 1TBQH 4WH6A 1NESE 2ZHEH 2Z6BD 2BY7X 1P03A 1MTVA 3TLOA 4FU7A 2XW9A 1ETSH 4UFEH 5B6OA 1VZQH 1TPPA 3BG4B 1WQSA 1AB9B 3QK1A 5HM2A 1HIAA 1CO7E 2A2QH 4PROA 3TH3H 1Z8IB 3EE0B 5TJXA 1GI9B 1S0QA 1ARCA 1PPCE 3VB5A 1O38A 2H9EH 4Y10E 1MTSA 5EPYA 2GCHF 4TWWA 2HNTE 1QBOA 1A3EH 2JETC 2XBWA 2PGQB 2KAIB 1UVOA 2ODQA 1MAYA 1UK4A 3L6PA 5IDKA 3C1KA 3TK5A 3BSQA 1GMCF 1FQ3A 2O8TA 4KTUA 3T2NA 3HGNA 2PFEA 4AB8A 4O3TA 3ZZ4A 3UOPA 1TMBH 1ZHRA 4AGKA 3UTUH 2XWAA 1JXPA 1FN6A 2FOMB 5F03A 1OP8A 2ZDMA 5JBBS 1ELCA 1ID5H 2V6NA 4INLA 1PQ5A 1XXDA 1IQJA 2OBOA 3AAUA 1ABIH 3GYLB 2A7CA 1RRKA 1YM0A 2ZO3H 1ABJH 1AZZA 4K60A 4DY7B 3ATWA 1ZMLA 2VIDA 1H9IE 1SGCA 3RXSA 1K22H 1SLXB 1HAIH 1V3XA 2UWOA 1ZZZA 2FOEA 4RN6A 1F5RA 3A84A 2Z9IA 3B23B 3A8AA 1OP2A 2PSXA 3K6ZA 8KME2 3S7HB 2OTVA 2Z9KA 3UR9A 1ANBA 3JZ2B 1ZRBA 2BLVA 2C93B 1GHAG 3PV4A 1G2MA 3UOUA 1RTLA 1T32A 1P57B 5EXLA 1V2ST 3V12A 1C1NA 1E36B 1EAIA 5TCCA 1G37A 3M5MA 2YNAA 3D62A 4X0WU 1D3TB 1GHYH 3GY3A 1O2JA 1P2MA 3A88A 3Q3YA 4ZAEA 1FMGA 4A6LA 3DFLA 1DY8A 5GWZA 1BMNH 2QC2A 2C90B 1YKTA 1NN6A 5HMAA 1CE5A 1O3HA 1D6RA 3FP6E 1HXFH 1O3NA 4MNWA 1HAVA 4B74A 4MNVA 3AAVA 1QIXB 2R0KA 3MFJA 4DIHH 1PPZA 2BDGA 1A1RA 3D65E 4MG3A 3A8BA 1FIZA 1HJAB 1GBLA 1ZRKA 4GVUA 2BTCE 1PYTD 3BTME 3U8OH 1E34B 4GAWA 4BTUB 2BYAX 2ZHDA 1BDAA 3RMNH 1TRYA 4YOGA 3MU0A 4FVDA 2SNWA 4UD9H 3GCTG 2F9VA 1AQ7A 5GIBA 5A2MH 3VB3A 3L3TA 2HPQH 5T6GA 3BG4C 1AB9C 1YP9A 1JIMA 5TCAA 1K1IA 2BLOA 3P17H 4Q80A 1ELVA 1GJ5H 1N6XA 1O3FA 1V2LT 4JZEH 2VWMA 1YLDA 4I7YH 1SMFE 2WPKS 2BOKA 1FPCH 1K1NA 3M37A 1V2OT 4U30A 1BHXB 5EG4A 1BBRH 3M61U 4AOQA 1TAWA 1THRH 2OUAA 1OP0A 2QXJA 1O2OA 8GCHF 1DUEA 1ELTA 2XCNA 1GJ9B 5DP8A 1GBDA 4K3JA 1EX3A 5FPYA 4I8JA 2GZ9A 1OWJA 2NU0E 3C27B 1K1LA 3V7TA 1C9PA 2SGFE 1CU1A 2R9PA 1PPBH 1SFQB 4CR9A 2BDBA 1ELFA 4X6OA 3ZV8A 1GHXH 4WVPE 1NU9A 1EJNA 2OC8A 2XC5A 1FY3A 5JBTA 3VGCB 2ANYA 2ANKH 2JH5D 2R3YA 3PMHB 2ZQ2A 4OS5A 1UHBA 4YT6H 3TVJB 1GJ7B 4NZQA 3PMBB 1V6DA 2D2DA 4NWKA 3DFJA 4IW4E 3GY6A 1AWFH 1RTKA 1GHWH 3UNQA 4B73A 1BJUA 1BTYA 4ESTE 1WYKA 2A5AA 3RU4E 2VWLA 3M5OA 2DE8A 2ZG0H 1S5SA 1DITH 3SU6A 2FLBH 5JPMH 2FMJA 2P3FH 1VJ9U 4OGYA 2XXLA 1UTJA 1C5TA 4FUFA 3PLBA 1LHGH 1CA0B 1OWIA 1P2OA 2ZHWH 1C2LA 1PQAA 1UTLM 1C5OH 5HXFA 2GKVE 1V2RT 1YPHE 1XX9A 1A3BH 2K1QA 2J95A 3P6ZB 1P0SH 2HPPH 1IQIA 3UWIA 4KTCA 3PMJA 3MNXA 1V2WT 2Z3DA 4ABIA 4BXWA 3ZVFA 4JZ1A 3TPIZ 1OYTH 4Z6AH 2PLXA 5C2ZA 4B2AA 3GY2A 5AVDA 1EB1H 4FU8A 2D1JA 3D23A 4YOJA 5J4SA 1C1VH 1HGTH 3AW0A 2G5NA 3E3TA 1LHCH 4K1EA 1CBWB 3RXGA 1HJAC 4I31A 3Q77A 1NS3A 1KXAA 1TQ7B 5LH8A 1Z1IA 3T25A 1O2MA 3ELAH 4KKDA 3S7KB 1DS2E 3ZVGA 3PLKA 1CT0E 1TX7A 4I8HA 4BAMB 1FONA 2GZ7A 4OS7A 3U8TH 2G5VA 4LK4A 4GHQA 3RM0H 4NFEA 1QBNA 1XUFA 2FYRA 1O3OA 4Z0KA 4B2BA 1F5LA 4U01A 3OYPA 1C5XB 4CRGA 1KXEA 1TGBA 4XBCA 1KY9A 2BDIA 1O3DA 3M36A 3I78A 1Y3VA 2ZFRH 5CHAB 2ZPSA 1YPEH 3SI3H 2BQ7B 1LVYA 3A7WA 1MAXA 4Y7AA 1CSOE 3RXPA 2G00A 3GISB 5GCHF 1P2JA 3HPTB 2Z9LA 1HAGE 2R2MB 4CREA 1GG6C 4X2XA 1LKBA 2AH4X 3KEEA 3SJIA 6GCHG 1EUFA 3SNDA 2ZECA 1CHGA 4TY6A 2G4TA 1KXDA 4A92A 2TGAA 2GVFA 3SNBA 3SGBE 3RXIA 1O3AA 1ZTLA 3VGCC 3T29A 2HWLB 1X7AC 3P8OA 3TK6A 1BTZA 2ODPA 3QGNB 1P09A 1E35B 2HALA 1G9IE 3SV6A 1N8OB 2QA9E 1MKXK 2VINA 4Y11E 1SOTA 3RXUA 5SGAE 1AE8H 3P92A 2WUBA 3PO1B 1P9UA 4WY3A 1VCQA 1LVBA 1BZXE 1O3BA 4JZDH 5JYIA 2IPHA 4UFGH 2ASUB 3MI4A 1C1TA 4I32A 1ACBE 4U2WA 2TIOA 1K1PA 3BN9A 3UPEA 2BD4A 3MNBA 2ZDKA 2FOAA 2WUCA 4NIXA 3BTTE 1CA0C 1ANEA 3BIUH 4NGAH 4LZ1H 2QAAA 3E1XB 3RMMH 3SUFA 2Z9JA 2A45B 2P16A 1P9SA 3LGTA 1H4WA 3UWJH 1NM6A 4ABDA 1FY5A 4WF8A 4A1VA 5A0CA 3SJ9A 2P94A 1C2DA 1MTWA 3QLPH 3MO6A 3U8RH 1L1GA 5EQRA 1Z1JA 3KQEA 1KLJH 1A61H 1BMLA 3U98H 3RXFA 4FUJA 3BEFB 1C2GA 4BAOB 1QB1A 4Q2KA 6ESTA 1CHOF 1L4ZA 2A1DB 4R0IA 1CBWC 3URDA 3VXEH 2TPIZ 4IGDA 2VGCB 1E37B 2CJIA 1BOQA 3UUZA 2EEKA 3M3SA 1SFIA 3PM3A 1HV7A 1JRTA 2PKSB 1O2PA 1NRSH 1QHRB 1C4V2 1FY4A 2IJOB 5CE1A 3MHWU 1DXPA 1HBTH 1O5AB 3H7OA 4O03A 3R0FA 3ZZCA 1W13U 2XC0A 5EU8A 2PR3A 3VB4A 4ZHLU 2F3CE 1F0SA 2Y7XA 4O9VA 1TABE 1SL3A 2F9BH 1XMNB 3OX7U 1TBRH 4MNXA 3QDZB 4MTBA 2ZGHA 1GCTB 2XYAA 3BEIB 1EOLA 1TX8A 1F7ZA 3ESTA 3AW1A 3MNSA 2ANMH 2ZDAH 1J14A 2PKAA 4WJG2 4A7IB 1GI8B 4KGAA 5FBEA 1UK2A 1SGNE 1Y5BT 1V2NT 1Z8RA 2AFQB 3SJ8A 4CBNA 2EA3A 2FXRA 4K1TA 2FOCA 1XUGA 3FZZA 1YC0A 2A32A 3GDUA 1B5GH 3G01A 3VXFH 3GDVA 4B1TA 4MVNA 1RS0A 1ZMJA 3K2UA 1K1MA 1CT2E 1O39A 1D3PB 1S82A 5A8ZA 4YLUA 3A8DA 1ZHMA 5EGMA 5FHTA 3TNSA 2ULLA 5DK1A 1DE7H 2ZU4A 3MO9A 2ZDVH 2ZPQA 1AUTC 1PYTC 1ZPBA 3LGVA 5DKMA 3STJA 1HJ8A 1KIGH 1H9HE 4XSKU 2VH6A 2UUJB 1TALA 4A5TS 2O9QA 2D26C 1N8OC 3E90B 3SV9A 4K69A 4ISNA 1V2UT 3EQ0H 3PO1C 3K9XB 1IAUA 4TYDA 2RCEA 4X8SH 4CRCA 3KHVA 2FOHA 1LHFH 1SGIB 3TK9A 1TNHA 4JYTA 4BAQB 1INCA 4BOHA 1Y3UA 4D8NA 1KXFA 4OS6A 1XVMA 1FXYA 1G2LA 2WPMS 1WCZA 4F49A 3A7ZA 4AB9A 1HAXB 3GCHC 3CS0A 2NU1E 1DUAA 2VNTA 1C5MD 1S0RA 4OGXA 3IG6B 3SGQE 1O34A 2BY9X 2ZFTA 4NWLA 1OYQA 2R0LA 4WXIA 1LPGB 5DO4H 5LPFA 1O3LA 3TJVA 1F0UA 2BX4A 1O2KA 1GPZA 1LQEA 1TPOA 3MU4A 1EZXC 3SJOA 2A31A 3RXJA 1FAXA 1NTPA 5LPEA 4B76A 2FS8A 1JMOH 4NSYA 3VPKA 5DP6A 1Z6EA 1SGTA 2XBXA 3VB7A 1SBWA 2M5TA 1AD8H 2ZU3A 3ZZ5A 1OS8A 5J4QA 2OQUA 4K8BA 1DWBH 2OBQA 3RDZA 2G51A 2ZWLH 2VGCC 1C2KA 2A4OA 3NKKA 4F4OC 2B9LA 1NT1A 2PKSC 3I77A 1T31A 1O3EA 2Q6GA 1THSH 2BY8X 1QURH 3BTHE 1C1UH 5K7RA 2BLWA 3LC5A 2PTCE 1NRQH 1Y59T 2R3UA 1DWCH 4YOIA 1IHTH 1P3EA 3SZNA 4ABBA 5EQSA 4XOJA 1K2I1 1OWHA 3W95A 4AG2A 5FPTA 1GCTC 1A0JA 1KXBA 4ABEA 3H7TA 1P3CA 3LOXA 4NIYA 1T4VH 1S85A 4AX9H 1O5FH 4CBOA 3FVFB 3RU4D 3MU1A 2ZHQH 2Y6TA 3ZZ9A 1KDQA 4THNH 2RA3A 1PPEE 1EZQA 1LKAA 3PTNA 4ZH8A 1A5GH 1TWXB 1HIAB 1L2EA 4I8LA 3PTBA 3SU2A 4DVAU 1UCYE 1ARBA 4AG1A 1UJ1A 1SSXA 4MPWA 2QY0B 2ZTXA 1VGCB 2FP7B 2Y7ZA 1YPGH 4JK6A 1T8LA 3TIUA 3DHKH 1C5YB 5C67A 1JBUH 1DXWA 1SQTA 1O5DH 1HFDA 2F9NA 4JYVH 3QTOH 1MU6B 2P93A 2F9UA 2WYGA 4GUXA 1SGRE 2ZKSA 3ATLA 4FUCA 3TJNA 4CRFA 1QBVH 1QL9A 1BBRE 1CGIE 5EW1H 4OS1A 3LGIA 3RLYH 1C1MA 1ELAA 3RM2H 1TOCB 4HZHA 2BDCA 2SGDE 1VITH 2BHGA 1SR5C 2PV9B 1AI8H 3KQDA 1O36A 3SORA 4Y79A 2AERH 1GBFA 3MMGA 3LT3A 2GT8A 3P70B 5L2YH 3QN7A 4ASHA 4OS4A 2D8WA 1UTPA 1ZLRA 3SV8A 2GDDA 1GI2A 4NA9H 1H8IH 3U69H 1PPHE 1GHBG 1GHZA 3RC5A 3RXKA 2TBSA 1YGCH 3LGWA 3A80A 3NZIA 1EXFA 3OTJE 1FNIA 4M7GA 1AVGH 1XKAC 4J1YA 2A4QA 2ZI2H 2ZGBH 3A81A 2FX6A 1O35A 2P59A 2FS9A 2BXTH 2FM2A 3QGJA 2ZEBA 1GBMA 1C5SA 3M7UA 1BMMH 1ETTH 1P2NA 4X1PU 4NCYA 3V3MA 4BXSA 1DWDH 3M3VA 2NWNA 1NFXA 1QL7A 2BMGB 3QX5H 2STBE 1QY6A 3S0NA 3QWCH 4H4FA 2P8OB 1UMAH 2CMYA 1FAKH 5ESTE 1DM4B 3A83A 3KIDU 5E2PA 2ZU5A 5DP7A 3OY6U 1Z6JH 1HAVB 1BRAA 1W0ZU 1C1PA 3GCOA 3RXHA 2UUKB 3TGJE 1TIOA 3GY8A 2Z3EA 5EPNA 2UUYA 1SHHB 3LJJA 1H8DH 3BTKE 1EKBB 4GCHF 3Q3KA 3ZVAA 5AF9H 1YPLH 2GTBA 1O31A 2CXVA 6GCHF 3OSYA 4Q7XA 1TE0A 3T28A 1WBGB 5F6MA 2RA0A 1L1JA 3T5FH 1ANDA 1KTSB 1O30A 1GG6B 1KLIH 1IQLA 3SV7A 3ZVCA 3HATH 2OC7A 2NU3E 4ZHMU 1A0LA 4ZKSU 4MNYA 2BZAA 1EP5A 3U1JB 4K5ZA 2WYJA 3ATMA 1VGCC 2AMPA 2G52A 1H9LB 2AIPA 5FCKA 1DSUA 1G30B 2QV1A 8ESTE 3M3TA 1ESTA 2CN0H 2IOTA 1ZPZA 5DG6A 3QUMP 2V3OH 3NCLA 3ZZBA 1NPMA 3TITA 2A5KA 1ZGVA 1CGHA 3NWUA 3QTVH 3SNEA 3E16B 5F8XA 3SUDA 3EYDA 1IQEA 3A86A 1SI5H 1GMCG 2FI3E 4NA7A 9ESTA 1BA8B 5E2OA 1ELGA 1O3PB 1TMUH 2BVSH 2XCFA 4NA8A 2SFAA 1P8VC 2I6SA 4X6NA 1QJ7B 2OLGA 1T8NA 4AZ2B 4MPVA 3VEQB 1RJXB 1A4WH 5I46H 1C2FA 1V2PT 1YBWA 1C5ZB 2TGDA 3PROA 1LPZB 1O32A 1GVZA 1AY6H 3Q76A 2DUCA 1W3CA 1W12U 1UHBB 1SVPA 1KSNA 2THFB 6CHAB 2AGEX 3BTGE 2B0FA 1O5GH 3RLWH 2BX3A 5H4IB 1NO9H 3SNAA 4MPUA 2GGVB 2BDAA 2Y81A 2VWOA 1E0FD 2ZQ1A 2GV7A 4UFFH 4HTCH 1HDTH 1N6YA 3TGKE 1SGYE 4AFQA 5JB8S 2ALVA 1AGJA 1CVWH 3ODFA 2ZU1A 3NUMA 5A8YA 3ZZ8A 1C5UA 1NRRH 3RXAA 4CRAA 4X8UH 1WUNH 1GI1A 3R3GB 2FESH 1RD3B 4JMYA 3K6YA 1WSSH 3CENA 3GOVB 1Q31A 2PTNA 2BY5X 2P8OC 1VITF 1GJ8B 4ABGA 3E0NB 1GMHG 4D9QA 4DG4A 1AWHB 1S81A 1TNLA 2FOGA 1Q2WA 4NG9H 1AFEH 3W94A 3M5LA 1SPJA 2A4RA 3M5NA 1NZQH 2BQWB 4Y0YE 1ZPCA 1G3EA 1ZTJA 2PW8H 2W5EA 2ZP0H 1MU8B 2PWXA 3MH4A 1C5QA 1QQUA 2BD7A 2G81E 3BTDE 1DSTA 3EA8A 1MBQA 1LHDH 4JCNA 2TGPZ 3UIRA 1GWAA 1UTOA 1UVPA 2Y80A 4Y71A 2QYIA 2J92A 1AE5A 3UFAA 4ISOA 4ISHH 3GICB 1P2QA 1SGEE 2H2ZA 2ZTZA 1HAZB 3LH3A 2O8WA 5A0AE 4ABFA 1SLWB 4GHTA 4Y76A 3GDSA 3KNXA 3MYWA 2SGAA 2A7HA 1BT7A 4LZ4B 3RXEA 5EQQA 1ZOMA 4VGCB 4DOQA 4ZKOU 1CA8B 3O8RA 2STAE 2B7DH 1O2VA 3FFGA 1XUIA 1XUJA 4X6PA 2HNTF 1O2GH 3RP2A 3F68H 1UTNA 2NU2E 2B8OH 1GJAB 3FANA 1ETRH 1IQHA 1B0FA 2YNBA 4I8KA 3RXDA 2AMQA 3SUGA 3AASA 2XBVA 2FZZA 2H9TH 1DY9A 3GY4A 1EPTA 6LPRA 1TGCA 2FEQH 1AFQB 1JIRA 1P11E 3BIVH 3GCNA 1V2MT 4CH8B 2VIWA 3GCHB 3A8CA 1GJCB 1THPB 4X1SU 3A89A 2ODYB 3ZYEA 5FX5A 1SQOA 2VU8E 1SLUB 1O2WA 4AN7A 2SGPE 2QXGA 3B9FH 4Y6DA 2OC0A 1UVTH 4FXGH 1TPAE 1HYLA 2WINI 6CHAC 1EASA 2QXHA 7LPRA 1ELEE 2ZNKH 1O5EH 2QN5T 2AIQA 3S9BA 1MH0A 2QIQA 1NFYA 2ZU2A 1Z8GA 1C2EA 1IOEA 4ZMAH 1V2KT 4BANB 1SC8U 1TGSZ 1HRTH 2ZTYA 2FO9A 1NFUA 1UVSH 2QGRA 2O8LA 3TJOA 2RG3A 1TPSA 3T62A 1GMDG 1DX5M 4INHA 4ABHA 1SGPE 4WMEA 4UE7H 2QF3A 1C5VA 2G4UA 3A7TA 3P95A 3S9AA 1QA0A 3RXCA 5C3NA 5C1YA 1OKXA 1DT2A 3TH2H 1VCPA 4K2YA 4O97A 5T6DA 2H5DA 1EZUC 3P8FA 5GXPA 1TGTA 5E0GA 3UNSA 1W0YH 2XC4A 3RXBA 4Y7BA 2V35A 2ZF0H 5EW2H 3BF6H 4BAKB 1Q3XA 1AVWA 2ESTE 1K28D 2PHBA 1SLVB 3HK3B 3LC3A 7GCHG 4TWYA 4ABAA 1ELBA 3V13A 1SG8B 1ZSKA 1MKWK 1L0ZA 2A5IA 1MTUA 1IQGA 3TGIE 1GL1A 2BQ6B 1DPOA 8LPRA 1EQ9A 2Z3CA 2GP9B 1Y3XA 1GI3A 3JZ1B 2GT7A 1WTHD 4FUBA 1OWEA 4E7RG 1MD8A 4FUEA 2SGQE 1AUJA 2BXUH 1TRMA 5JBAS 1D3QB 4CRBA 1O2QA 4D7GA 2OXSA 1TNGA 4DJZB 1SB1H 2J4IA 4IN2A 5I25A 2A0QB 2WPHS 3ATKA 4VGCC 3E8LA 4H6SB 1A0HB 3EA9A 4LOYH 5GJ4B 2PKAB 1EAXA 1OWDA 5T6FA 5A09A 2BD3A 2GV6A 4DW2U 1GHAF 1RIWB 4XDEA 5F8ZA 3A7YA 1GVKB 4CRDA 1GBEA 3LH1A 3LGYA 3TH4H 4IC6A 4CH2B 1F5KU 1AVXA 1KXCA 3PWBA 5E0HA 5K0HA 4FVBA 1C5NH 5A8XA 4NIWA 5C1XA 1HUTH 1GHBF 1O2UA 1XVOA 2ZFPH 1QCPA 1K1OA 1AFQC 1O3IA 2VJ1A 4Y0ZE 3RMLH 1HNEE 5HM9A 1MQ5A 1N1LA 1PPGE 4SGAE 3ITIA 2GMTB 2J9NA 1WOFA 2OP9A 3SNCA 5IYTA 1DVAH 1AKSB 1TYNA 1MKXH 1IQMA 2Y5HA 1D9IA 2C3SA 2ZC9H 3UREA 3NXPA 2BD5A 5EXNA 2VIOA 1OX1A 3UQVA 3HK6B 7ESTE 1G3CA 2CV3A 1RGQA 4AYVB 1B7XB 1HXEH 1DLEA 1Z8JB 5DJ7A 1K1JA 5C5OA 2W26A 3E6PH 2G8TA 3GCTF 1W7GH 1H1BA 1ZSLA 1UCYK 2VB0A 1O3CA 1ZGIA 4H6TA 2UWPA 2Q6DA 3NK8A 4KTSA 4NSVA 3RXLA 1FY1A 3I29A 5AFZH 3DUXH 1RXPA 2FIRH 1DWEH 1UTQA 1Y5UT 2C8WB 1HAYB 1D4PB 3F9FA 1FZZA 2J38A 4XE4A 2P3UB 2GDEH 4XBBA 3RU4T 2A4GA 2PGBB 3MNCA 1O2ZA 1P06A 1BRUP 1O2IA 5ABWA 4YT7H 2FX4A 3BTEE 1S83A 2J94A 2BDYA 2KAIA 4KELA 1FDPA 1BBRK 4MQAA 4JK5A 3V0XA 2H6MA 3DA9B 2XTTB 1MQ6A 2O8UA 1CHOG 1FLEE 1MZAA 1RTFB 4WMFA 2BLQA 1PFXC 1F0RA 4H42U 5FCRA 1W11U 4GLYA 3VB6A 5BRRE 2EI6A 1ANCA 4UONA 1GBIA 3SHCH 4XFQA 2AMDA 4IBLH 3MH7A 2ZFFH 1F2SE 1EZSC 2FOFA 3F6UH 1O5BB 1QRWA 4QT8C 1PQ7A 1QRZA 4MDSA 4YM9A 2HRVA 2VWNA 1DANH 3SV2H 2H1UA 1FN8A 4IS5A 1TRNA 3A87A 1FY8E 1DOJA 1U6QA 1C2HA 4ZUHA 1MKWH 1BMAA 4WXVA 1LCYA 1G36A 1WTGH 2FOBA 4O3UA 4Q7ZA 1M9UA 2BVRH 3GYMA 5FX6A 5LPRA 1UK3A 3IWMA 3TJUA 1RIWC 2FWWA 2V3HH 1KDQB 5DP5A 2QF0A 1TONA 2C4FH 3M7QA 2C8XB 1K9OE 1V2JT 1XKBC 2WPJS 1MMJN 4FUHA 1DDJA 2ZGXH 2ZCLP 3ZZDA 4YLQH 4I8GA 5FAHA 1QNJA 1LDTT 1HLTH 1C2JA 4GPGA 2ZFQH 5FXLA 4AYYB 2Y5FA 3PLPA 1IQKA 1O0DH 3O8DA 1O3GA 1TA6A 3B8JA 1ZJKA 2FPZA 2GMTC 4BAHB 3RXVA 4CR5A 4K8YA 5C5NA 1V2QT 4U32A 2XWBI 3GY5A 1P02A 1VJAU 1C2MA 1LPKB 2VIQA 1FJSA 2ZCKP 2BY6X 1F92A 1JRSA 2HVXA 1C4U2 4X1NU 4ZROA 1Y3YA 2Y82A 1AIXH 1SGQE 1GJ4H 1LVOA 1YCPK 2UUFB 2FTLE 1KTTB 3MWIU 4FU9A 3SUEA 3ZZAA 5ETXA 3P8GA 2GZ8A 4BNRA 3EGKH 3KQCA 1CGJE 5EOKA 1TOMH 1W10U 3HKIB 4UEHH 4AFSA 2BB4A 1SGFG 1Y8TA 1GMHF 3ATIA 3GY7A 5FPSA 3ZYDA 9LPRA 1NY22 2CHAB 3EAJA 3MTYA 2BD8A 2W7UA 3SBKA 5L2ZH 1T4UH 1ZTKA 3FAOA 1GCDA 2BM2A 4SGBE 4D76A 1RFNA 2Y5GA 3BTFE 1BRCE 1A2CH 2GD4B 1C5RA 4DURA 2HGTH 1ZJDA 1QGFA 2FYQA 3F9GA 3M35A 2ANWA 1HB0B 1YPKH 4WMDA 5C1UA 3FP8E 4ISLA 3O8BA 2LNCA 1UCYH 2F91A 2ZDNA 3RXMA 2CF8H 4JYUH 1XM1A 3LU9B 3FZDA 2FDAA 4R8TB 3KQBA 5JDUB 1P05A 1AHTH 1FPHH 4DT7B 4NZLA 4LXBH 1L4DA 3DD2H 3PB1E 2ZIQH 2AEIH 3F9HA 1W8BH 2HNTC 2YOLA 1QL8A 3A7XA 3RMOH 3KN2A 1A7SA 5E0JA 3SU4A 4E05H 2J2UA 1GBCA 3MU5A 1Y5AT 1Z7KA 5JBCS 1OOKB 1SGFA 1BUIA 2GCHG 2Z7FE 3STIA 3Q3XA 1LMWB 1LO6A 3E0PB
chains in the Genus database with same CATH superfamily
1TQ0B 5C20A 1O2NA 3TNTA 3RC4A 7KMEH 5DSFA 2ZGCA 2LELA 1DFPA 2GCTB 2DE9A 3ZZ3A 1ZR0A 2ALPA 4IN1A 4KP0A 4UDWH 1VR1H 1GVLA 3SGAE 1C1RA 1SHYA 2IN2A 4CHAB 4HGCA 2C8ZB 2WV4A 1BITA 1T8OA 2V0BA 1UTMA 1C2IA 1K0HA 3T26A 1O37A 1ESBA 1UO6A 1WQVH 3O8CA 3LJOA 3MOCA 3PRDA 3H5CB 1YLCA 4X8VH 1J15A 3E91A 3ZZ6A 4WH8A 1B0EA 1BTUA 1ZMNA 2QXIA 1IQNA 1LVMA 1L1NA 5L6NH 3LGUA 4Y8ZA 1S84A 1YF4A 4B71A 4X2WA 3SU3A 4Y8XA 4MPXA 1GMDF 4HFPB 4AORA 2EC9H 1HAOH 1A5HA 1TNIA 2NU4E 3RC6A 2ZPRA 3SI4H 3UQOA 1G3BA 3F2GA 2TGTA 1MTNB 2WV5A 1V2TT 4IC5A 1GHVH 1SQAA 3LONA 3SYJA 5HKKD 2A7JA 2ZZUH 4FUIA 1GI5A 1BB0B 4TY7A 2Z94A 1JOUB 1QJ1B 2XBYA 2CHAC 1NRPH 2F9OA 1SGDE 1J17T 3N7DA 1QRXA 1P04A 7GCHF 2R2WU 2GX4A 1W7XH 4YZUA 1EB2A 1EOJA 2ILNA 1YCPH 3UNRA 1C1OA 2ZDLA 1H8HD 3A7VA 3A82A 2A2XH 2FTMA 2W3IA 2VIPA 4HI3A 1QTFA 2F9PA 5AFYH 5HGGA 2JH6D 4A1XA 5JB9S 1NU7B 4TT3D 3KGPA 2LPRA 1AU8A 4Y8YA 1BCUH 2WPLS 2AGIX 2VVCA 4X2VA 1C1QA 1WU1A 2VVUA 2PSYA 4DGJA 2AHME 1MCTA 1QJ6B 5GDSH 4ZXXH 3CS7A 3ZVDA 1AN1E 3EA7A 3SOSA 3ZZ7A 2BZ6H 3AVZA 3RXRA 4NFFA 1O5CB 1GDNA 2FLRH 2BD9A 1S6FA 1BRBE 2F83A 3UR6A 3S9CA 4FOUC 1O2RA 1IHSH 1MZDA 5HIZA 1WAYB 1O2YA 5BPEA 4A1TA 4JZFH 1OSSA 1XUKA 1DICA 5DP4A 5HYOA 2VVVA 2ZGJA 2WSSD 1O2HA 3D49H 1AMHA 3QZRA 5CMXH 1D3DB 2BD2A 1LHEH 1GGDB 1UTKA 2OINA 4ZHAA 1YPMH 3BTWE 1ORFA 1O3KA 1P10A 1SOZA 4MLFB 2W7SA 2ZA5A 3SW2B 4GCHG 1P2IA 2QCYA 4RT1A 3NRLA 2AGGX 2CGAA 1VCWA 4RKOB 3SQEE 4ZCNA 3BV9B 5DP9A 2G55A 3SHAH 8GCHG 2GCTC 5EODA 1G32B 1J8AA 4IMZA 4CHAC 1HAPH 3N7OA 4BTIB 4X2YA 1O33A 1PPFE 4ZXYH 1KLTA 1V2VT 1C1WH 1Z71A 4I33A 2RDLA 2SGEE 5C17A 4TPIZ 2I6QA 1T7CA 1TNKA 2XRCA 1OXGA 1GDUA 2J98A 2AS9A 3F2HA 1GJ6A 1F0TA 1FUJA 1GI0A 1BIOA 1GBKA 1GJBB 1HCGA 5T3HA 2BVXH 3WY8A 3FOAA 1UVUH 2CF9H 3EDXB 1BTWA 2VH0A 3RXQA 5EXMA 1E38B 3NPSA 3F9EA 1QB6A 1G3DA 2GJGA 3ODDA 1EAWA 3URCA 3SJKA 1A5IA 1BJVA 1XXFA 3OU0A 5FBIA 3ZVBA 1YPHC 1MCVA 3F1SB 1QFKH 1CT4E 1EPTB 3KL6A 5AHGH 1GI7B 5G4BA 3LPRA 1MTNC 2P95A 1XUHA 1P12E 1FV9A 4FUDA 3PYHA 3TU7H 1C1SA 4BTTB 5PTPA 3BG8A 1GL0E 5KEDA 2P3TB 1EATA 4RSPA 4ABJA 1P2KA 1HAHH 1Y3WA 5A0BA 3MU8A 4AGJA 1HPGA 2RFKC 2RDEA 3SQHE 1YCPM 5KECA 3LIWA 3SU5A 1YYY1 3KCGH 1NFWA 1FIWA 1ZYOA 4X1QU 1BQYA 1LTOA 1QB9A 1BTPA 2HLCA 1EJAA 1GI4A 2W3KA 5GPIB 4D7FA 2EI8A 1K21H 1NROH 3FP7E 2OCVB 4Q63A 4ISIH 1AO5A 3SU1A 4Q7YA 3MH6A 1CQQA 4WWYA 1OPHB 1T8MA 2WPIS 4INKA 4E06H 5DN6D 3F0OA 1O2LA 2Q6FA 2EI7A 1O2XA 2AYWA 2FI5E 4B75A 1QR3E 2FI4E 4YO9A 1C9TA 1O3MA 1QQ4A 3QZQA 4X1RU 1MD7A 4HG6A 1NC6A 4X8TH 4FUGA 2VIVA 1W14U 4D9RA 5L30H 1GJDB 3KF2A 1TB6H 2FODA 3PWCA 1BTXA 1O2TA 1VITG 1GBBA 3S69A 5CHAC 1C5PA 2H9HA 2JETB 2OD3B 1W2KH 1GBJA 1ELDE 1C4Y2 2Q1JA 3HKJB 4YESB 1WV7H 3CNRA 4RKJB 1EAUA 2H5CA 1PJPA 1E1RD 2O8MA 1GDQA 3GS9A 3SZEA 4AFZA 1D6WA 1O2SA 1GGDC 2OC1A 3PMAB 1J16A 4E7NA 3N7EA 3A85A 2ZHFH 2ZFSA 2B5TB 1BHXF 1E79D 3IITA 3UAIC 4XBDA 4IMQA 1LQDB 4YTAA 5ESBA 2KCPA 1BTHH 4DIIH 4AFUA 1PQ8A 4GSOA 5GCHG 2JKHA 5E8EH 2C8YB 3Q00A 4X6MA 2JJ2D 1C5WB 1TGNA 3LKWA 4OS2A 2WHXA 1IQFA 2SNVA 5LGOA 1AKSA 1GBAA 1EP6A 3QO6A 3VFEA 4NIVA 4DCDA 3ZV9A 1KYNA 1TBZH 1MUEB 4ZKNU 2J34A 3U9AH 3MH5A 5DGJA 3BEUA 1O3JA 2QF4A 2BDHA 3U1IB 1JWTA 4J2YB 3OY5U 1TA2A 2XNIA 1W0JD 3M7TA 3SN8A 3K65B 3SU0A 1ESAA 2K8IA 2ZCHP 1QA7A 4K1SA 1TNJA 1A46H 3MO3A 2OQ5A 3ZVEA 3P8NA 4ZKRU 1AZ8A 1EPTC 1TFXA 1ZSJA 3BTQE 1ZHPA 3DT0H 2UWLA 5DP3A 4TPYA 1GBHA 2HOBA 3UY9A 1J9CH 3T27A 2PUXB 4JZIA 3LDXH 3HGPA 3SO3A 1YPJH 2BOHB 2PUQH 1GI6A 2JH0D 1HJ9A 1DLKB 1FI8A 1C5LH 4UFDH 1OWKA 1GBTA 5F8TA 3L33A 3RXTA 4B2CA 5EJ1A 1TMTH 3ENSB 3N99A 3RUOA 2Z9GA 3RXOA 3CP7A 1S6HA 1P01A 1TX6A 2TRMA 5DPAA 1NRNH 1EJMA 1TLDA 1MBMA 1TBQH 4WH6A 1NESE 2ZHEH 2Z6BD 2BY7X 1P03A 1MTVA 3TLOA 4FU7A 2XW9A 1ETSH 4UFEH 5B6OA 1VZQH 1TPPA 1H8ED 3BG4B 1WQSA 1AB9B 3QK1A 5HM2A 1HIAA 1CO7E 2A2QH 4PROA 3TH3H 1Z8IB 3EE0B 5TJXA 1GI9B 1S0QA 3OTPA 1ARCA 1PPCE 3VB5A 1O38A 2H9EH 4Y10E 1MTSA 5EPYA 2GCHF 4TWWA 2HNTE 1QBOA 1A3EH 2JETC 2XBWA 2PGQB 2KAIB 1UVOA 2ODQA 1MAYA 1UK4A 3L6PA 5IDKA 3C1KA 3TK5A 5C0TA 3BSQA 1GMCF 1FQ3A 2O8TA 4KTUA 3T2NA 3HGNA 2PFEA 4AB8A 4O3TA 3ZZ4A 3UOPA 1TMBH 1ZHRA 2KCYA 4AGKA 3UTUH 2XWAA 1JXPA 1FN6A 2FOMB 5F03A 1OP8A 2ZDMA 5JBBS 1ELCA 1ID5H 2V6NA 4INLA 1PQ5A 2OK5A 1XXDA 1IQJA 2OBOA 3AAUA 1ABIH 3GYLB 2A7CA 3WWFA 1RRKA 1YM0A 2ZO3H 1ABJH 1AZZA 4K60A 4DY7B 3ATWA 1ZMLA 2VIDA 1H9IE 1SGCA 3RXSA 1K22H 1SLXB 1HAIH 1V3XA 2UWOA 1ZZZA 2FOEA 4RN6A 1F5RA 3A84A 2Z9IA 3B23B 3A8AA 1OP2A 2PSXA 3K6ZA 8KME2 3S7HB 2OTVA 2Z9KA 2KZ4A 3UR9A 1ANBA 3JZ2B 1ZRBA 2BLVA 2C93B 1GHAG 3PV4A 1G2MA 3UOUA 1RTLA 1T32A 1P57B 5EXLA 1V2ST 3V12A 1C1NA 1E36B 1EAIA 5TCCA 1G37A 3M5MA 2YNAA 3D62A 4X0WU 1D3TB 1GHYH 3GY3A 1O2JA 1P2MA 3A88A 3Q3YA 3H09A 1FMGA 4ZAEA 3DFLA 4A6LA 1DY8A 5GWZA 1BMNH 2QC2A 2C90B 1YKTA 1NN6A 5HMAA 1CE5A 1O3HA 1D6RA 4YXWD 3FP6E 1HXFH 1O3NA 4MNWA 1HAVA 4B74A 4MNVA 1WDIA 3AAVA 1QIXB 2R0KA 3MFJA 4DIHH 1PPZA 2BDGA 1A1RA 3D65E 4MG3A 3A8BA 1FIZA 1HJAB 1GBLA 1ZRKA 4GVUA 2BTCE 1PYTD 3BTME 3U8OH 1E34B 4GAWA 4BTUB 2BYAX 2ZHDA 1BDAA 3RMNH 1TRYA 4YOGA 3MU0A 4FVDA 2SNWA 4UD9H 3GCTG 2F9VA 2PP6A 1AQ7A 5GIBA 5A2MH 3VB3A 3L3TA 2HPQH 5T6GA 3BG4C 1AB9C 1YP9A 1JIMA 5TCAA 1K1IA 2BLOA 2F43B 5T1VA 3P17H 4Q80A 1ELVA 1GJ5H 1N6XA 1O3FA 1V2LT 4JZEH 5EJLA 1OHHD 2VWMA 1YLDA 4I7YH 1SMFE 2WPKS 2BOKA 1FPCH 1K1NA 3M37A 1V2OT 3FKSD 4U30A 1BHXB 5EG4A 1BBRH 3M61U 4AOQA 1TAWA 1THRH 5EJZA 2OUAA 2QE7D 1OP0A 2QXJA 1O2OA 8GCHF 1DUEA 1SQRA 1ELTA 2XCNA 1GJ9B 5DP8A 1GBDA 4K3JA 1EX3A 5FPYA 4I8JA 2GZ9A 1OWJA 2NU0E 3C27B 1K1LA 3V7TA 1C9PA 2SGFE 1CU1A 2R9PA 1PPBH 1SFQB 4CR9A 2BDBA 1ELFA 4X6OA 3ZV8A 1GHXH 4WVPE 1NU9A 1EJNA 4Z1MD 2OC8A 2XC5A 1FY3A 5JBTA 3VGCB 2ANYA 2ANKH 2JH5D 2R3YA 3PMHB 2ZQ2A 4OS5A 1UHBA 4YT6H 3TVJB 1GJ7B 4NZQA 3PMBB 1V6DA 2D2DA 4NWKA 5GNDA 3DFJA 4IW4E 3GY6A 1AWFH 1RTKA 1GHWH 3UNQA 4B73A 1BJUA 2XOKD 1BTYA 4ESTE 1WYKA 2A5AA 2QF5A 3RU4E 2VWLA 3M5OA 2DE8A 2ZG0H 1S5SA 1DITH 3SU6A 2FLBH 5JPMH 2FMJA 2P3FH 1VJ9U 4OGYA 5B6LA 2XXLA 1UTJA 1C5TA 4FUFA 3MQKC 3PLBA 1LHGH 1CA0B 1OWIA 1P2OA 2ZHWH 1C2LA 1PQAA 1UTLM 1C5OH 5HXFA 2GKVE 1V2RT 1YPHE 1XX9A 1A3BH 2K1QA 2J95A 3P6ZB 1P0SH 2HPPH 1IQIA 3UWIA 4KTCA 3PMJA 3MNXA 1V2WT 2Z3DA 4ABIA 4BXWA 1E1QD 3ZVFA 4JZ1A 3TPIZ 1OYTH 4Z6AH 2PLXA 5C2ZA 4B2AA 3GY2A 5AVDA 1EB1H 2CK3D 4FU8A 2D1JA 3D23A 4YOJA 2IJD1 1C1VH 5J4SA 1HGTH 3AW0A 2G5NA 3E3TA 1LHCH 3OAAD 4K1EA 1CBWB 3RXGA 1HJAC 4I31A 3Q77A 1NS3A 1KXAA 1TQ7B 5LH8A 1Z1IA 3T25A 1O2MA 3ELAH 4KKDA 3S7KB 1DS2E 3ZVGA 3PLKA 1CT0E 1TX7A 4I8HA 4BAMB 3F2FA 1FONA 2GZ7A 4OS7A 3U8TH 2G5VA 4LK4A 4GHQA 3RM0H 4NFEA 1QBNA 1XUFA 2FYRA 1O3OA 4Z0KA 4B2BA 1F5LA 4U01A 3OYPA 1YY3A 1C5XB 4CRGA 1KXEA 1TGBA 4XBCA 1KY9A 2BDIA 1O3DA 3M36A 1YLNA 3I78A 1Y3VA 2ZFRH 5CHAB 2ZPSA 1YPEH 3SI3H 2BQ7B 2V7QD 1LVYA 3A7WA 1MAXA 4Y7AA 1CSOE 3RXPA 2G00A 3GISB 5GCHF 1P2JA 3HPTB 2Z9LA 1HAGE 2R2MB 4CREA 1GG6C 4X2XA 1LKBA 2AH4X 3KEEA 3SJIA 6GCHG 1EUFA 3SNDA 2ZECA 1CHGA 4TY6A 2G4TA 1KXDA 4A92A 2TGAA 2GVFA 3SNBA 3PV2A 3SGBE 3RXIA 1O3AA 1ZTLA 3VGCC 3T29A 2HWLB 1X7AC 3P8OA 3TK6A 1BTZA 2ODPA 3QGNB 1P09A 1E35B 2HALA 1G9IE 3SV6A 1N8OB 2QA9E 1MKXK 2VINA 4Y11E 1SOTA 3RXUA 5SGAE 1AE8H 3P92A 2WUBA 3PO1B 1P9UA 4WY3A 1VCQA 1LVBA 1BZXE 1O3BA 4JZDH 5JYIA 2IPHA 4UFGH 2ASUB 3MI4A 1C1TA 4I32A 1ACBE 4U2WA 2TIOA 1K1PA 2JIZD 3BN9A 3UPEA 2BD4A 3MNBA 2ZDKA 2FOAA 1WXRA 2WUCA 4NIXA 3BTTE 1CA0C 1ANEA 3BIUH 4NGAH 4LZ1H 2QAAA 3E1XB 3RMMH 3SUFA 2Z9JA 2A45B 2P16A 1P9SA 3LGTA 1H4WA 3UWJH 1NM6A 4ABDA 1FY5A 4WF8A 4A1VA 5A0CA 3SJ9A 2P94A 1C2DA 1MTWA 3QLPH 3MO6A 3U8RH 1L1GA 2J98B 5EQRA 1Z1JA 3KQEA 1KLJH 1A61H 5KGOA 1BMLA 3U98H 3RXFA 4FUJA 3BEFB 1C2GA 4BAOB 1QB1A 4Q2KA 6ESTA 1CHOF 1L4ZA 2A1DB 4R0IA 1CBWC 3URDA 3VXEH 2TPIZ 4IGDA 2VGCB 1E37B 2CJIA 1BOQA 3UUZA 2EEKA 3M3SA 1SFIA 3PM3A 1HV7A 1JRTA 2PKSB 1O2PA 1NRSH 1QHRB 1C4V2 1FY4A 2IJOB 5CE1A 3MHWU 1DXPA 1HBTH 1O5AB 3H7OA 4O03A 3R0FA 3ZZCA 1W13U 2XC0A 5EU8A 2PR3A 3VB4A 4ZHLU 2F3CE 1COWD 1F0SA 2Y7XA 4O9VA 2VBCA 1TABE 1SL3A 2F9BH 1MABB 1XMNB 3OX7U 1QZ8A 1TBRH 2JDID 4MNXA 3QDZB 4MTBA 2ZGHA 1GCTB 3ZIAD 2XYAA 3BEIB 1EOLA 1TX8A 1F7ZA 3ESTA 3AW1A 3MNSA 4M9FA 2ANMH 2ZDAH 1J14A 2PKAA 4WJG2 4A7IB 1GI8B 4KGAA 5FBEA 1UK2A 1SGNE 1Y5BT 1V2NT 1Z8RA 2AFQB 3SJ8A 4CBNA 2EA3A 2FXRA 4K1TA 2FOCA 1XUGA 3FZZA 1YC0A 3PV5A 2A32A 4ACBA 3GDUA 1B5GH 3G01A 3VXFH 3GDVA 4B1TA 4MVNA 1RS0A 1ZMJA 3K2UA 3KYFA 1K1MA 1CT2E 1O39A 1D3PB 1S82A 5A8ZA 4YLUA 3A8DA 1ZHMA 5EGMA 5FHTA 3TNSA 2ULLA 5DK1A 1DE7H 2ZU4A 3MO9A 2ZDVH 2ZPQA 1AUTC 1PYTC 1W0KD 1ZPBA 3LGVA 5DKMA 3STJA 1HJ8A 1KIGH 1H9HE 4XSKU 2VH6A 4Q4LA 2UUJB 1TALA 4A5TS 2O9QA 2D26C 1N8OC 3E90B 3FN8A 3SV9A 4K69A 4ISNA 1V2UT 3EQ0H 3PO1C 3K9XB 1IAUA 4TYDA 2RCEA 1NBMD 4X8SH 4CRCA 3KHVA 2FOHA 1LHFH 1SGIB 3TK9A 1TNHA 4JYTA 4BAQB 1INCA 4BOHA 1Y3UA 4D8NA 1KXFA 4OS6A 1XVMA 1FXYA 1G2LA 2WPMS 1WCZA 4F49A 3A7ZA 4AB9A 3UB0A 1HAXB 3GCHC 3CS0A 2NU1E 1DUAA 2VNTA 1C5MD 1S0RA 4OGXA 3IG6B 3SGQE 1O34A 2BY9X 2ZFTA 4NWLA 1OYQA 2R0LA 4WXIA 1LPGB 5DO4H 5LPFA 1O3LA 3TJVA 1F0UA 2BX4A 1O2KA 1GPZA 2JJ1D 1LQEA 1TPOA 3MU4A 1EZXC 3SJOA 2A31A 3RXJA 1FAXA 1NTPA 5LPEA 4B76A 2FS8A 1JMOH 4NSYA 3VPKA 5DP6A 1Z6EA 1S6LA 1SGTA 2XBXA 3VB7A 1SBWA 2M5TA 1AD8H 2ZU3A 3ZZ5A 1OS8A 5J4QA 2OQUA 4K8BA 1DWBH 2OBQA 3RDZA 2G51A 2ZWLH 2VGCC 1C2KA 2A4OA 3NKKA 4F4OC 2B9LA 1NT1A 2PKSC 3I77A 1T31A 2J97A 1O3EA 2Q6GA 1THSH 2BY8X 1QURH 3BTHE 1C1UH 3DCLA 1KMHB 5K7RA 2BLWA 2HLDD 3LC5A 2PTCE 1NRQH 1Y59T 2R3UA 1DWCH 4YOIA 1IHTH 1P3EA 3SZNA 2W6ID 4ABBA 5EQSA 4XOJA 1K2I1 1OWHA 3W95A 2LP6A 5FPTA 4AG2A 1GCTC 1A0JA 1KXBA 4ABEA 3H7TA 1P3CA 3LOXA 4NIYA 1T4VH 1S85A 4AX9H 1O5FH 4CBOA 3FVFB 3RU4D 3MU1A 2ZHQH 2Y6TA 3ZZ9A 1KDQA 4THNH 2RA3A 1PPEE 2KFWA 1EZQA 1LKAA 2IPQX 3PTNA 4ZH8A 1A5GH 1TWXB 1HIAB 1L2EA 4I8LA 3PTBA 3SU2A 4DVAU 1UCYE 1ARBA 4AG1A 5EIYA 1UJ1A 1SSXA 4MPWA 2QY0B 2ZTXA 3F0PA 1VGCB 2W6JD 2FP7B 2Y7ZA 1YPGH 4JK6A 3WW7A 1T8LA 3TIUA 3DHKH 1C5YB 5C67A 1JBUH 1UW7A 4RT0A 1DXWA 1SQTA 1O5DH 1HFDA 2F9NA 4JYVH 3QTOH 1MU6B 2P93A 3W1EA 2F9UA 2WYGA 4GUXA 1SGRE 3F3BA 5C94A 2M2AA 2ZKSA 3ATLA 4FUCA 3TJNA 4CRFA 1QBVH 1QL9A 1BBRE 1CGIE 5EW1H 4OS1A 3LGIA 3RLYH 1C1MA 1ELAA 3RM2H 1TOCB 4HZHA 2BDCA 2SGDE 1VITH 2BHGA 1SR5C 2PV9B 1AI8H 3KQDA 1O36A 3SORA 4Y79A 2AERH 1GBFA 3MMGA 3LT3A 2GT8A 3P70B 5L2YH 3QN7A 4ASHA 4OS4A 2D8WA 1UTPA 1ZLRA 3SV8A 2GDDA 1GI2A 4NA9H 1H8IH 3U69H 1PPHE 1GHBG 1GHZA 3RC5A 3RXKA 2TBSA 5F53A 1YGCH 3LGWA 3A80A 3NZIA 1EXFA 3OTJE 1FNIA 4M7GA 1AVGH 1XKAC 4J1YA 5FL7D 2A4QA 2ZI2H 2ZGBH 3A81A 2FX6A 1O35A 2P59A 2FS9A 2BXTH 2FM2A 3QGJA 2ZEBA 1GBMA 1C5SA 3M7UA 1BMMH 1ETTH 1P2NA 4X1PU 3OE7D 4NCYA 3V3MA 4BXSA 1DWDH 3M3VA 2NWNA 1NFXA 1QL7A 2BMGB 3QX5H 2STBE 1QY6A 3S0NA 3QWCH 4H4FA 2P8OB 1UMAH 2CMYA 1FAKH 3U28C 3WWBA 5ESTE 1DM4B 3A83A 3KIDU 5E2PA 2ZU5A 5DP7A 3OY6U 1Z6JH 1HAVB 1BRAA 1W0ZU 1C1PA 3GCOA 3RXHA 2UUKB 3TGJE 1TIOA 3GY8A 2Z3EA 5EPNA 2UUYA 1SHHB 4P02A 3LJJA 1H8DH 3BTKE 1EKBB 4GCHF 3Q3KA 3ZVAA 5AF9H 1YPLH 2GTBA 1O31A 2CXVA 6GCHF 3OSYA 4Q7XA 1TE0A 3T28A 1WBGB 5F6MA 2RA0A 1L1JA 3T5FH 1ANDA 1KTSB 1O30A 1GG6B 3KQ5A 1KLIH 1IQLA 3SV7A 3ZVCA 3HATH 2OC7A 2NU3E 4ZHMU 1A0LA 4ZKSU 4MNYA 2BZAA 1EP5A 3U1JB 4K5ZA 2WYJA 3ATMA 1VGCC 2AMPA 2G52A 1H9LB 2AIPA 5FCKA 1DSUA 1G30B 2F4LA 2QV1A 2WZQA 8ESTE 3M3TA 1ESTA 2CN0H 2IOTA 1ZPZA 5DG6A 3QUMP 2V3OH 3NCLA 3ZZBA 1NPMA 5C0UA 3TITA 3EE7A 2A5KA 1ZGVA 1CGHA 3NWUA 3QTVH 3SNEA 3E16B 5F8XA 3SUDA 3EYDA 1IQEA 3A86A 1SI5H 1GMCG 2FI3E 4NA7A 9ESTA 1BA8B 5E2OA 1ELGA 1O3PB 1TMUH 2BVSH 2XCFA 4NA8A 2SFAA 2KR7A 1P8VC 2I6SA 4X6NA 1QJ7B 2OLGA 1T8NA 4AZ2B 4MPVA 3VEQB 2L74A 1RJXB 1A4WH 5I46H 1C2FA 1V2PT 1YBWA 1C5ZB 2TGDA 3PROA 3AK5A 1LPZB 1O32A 1GVZA 1AY6H 3Q76A 2DUCA 1W3CA 1W12U 5CDFE 1UHBB 1SVPA 1KSNA 2THFB 6CHAB 2AGEX 3BTGE 2B0FA 1O5GH 3RLWH 2BX3A 5H4IB 1NO9H 3SNAA 4MPUA 2GGVB 2BDAA 2Y81A 2VWOA 1E0FD 2ZQ1A 2GV7A 4UFFH 4HTCH 1HDTH 1N6YA 3TGKE 1SGYE 4AFQA 5JB8S 2ALVA 1AGJA 1CVWH 3ODFA 2ZU1A 3NUMA 5A8YA 3ZZ8A 1C5UA 1NRRH 3RXAA 4CRAA 4X8UH 1WUNH 1GI1A 3R3GB 2FESH 1RD3B 4JMYA 3K6YA 1WSSH 3CENA 3GOVB 1Q31A 2PTNA 2BY5X 2P8OC 1VITF 1GJ8B 4ABGA 3E0NB 1GMHG 4D9QA 4DG4A 1AWHB 1S81A 1TNLA 2FOGA 1Q2WA 4FETA 4NG9H 1AFEH 3W94A 3M5LA 1SPJA 2A4RA 3M5NA 1NZQH 2BQWB 4Y0YE 1ZPCA 1G3EA 1ZTJA 4B6FA 2PW8H 2W5EA 2ZP0H 1MU8B 2PWXA 3MH4A 1C5QA 1QQUA 2BD7A 2G81E 3BTDE 1DSTA 3EA8A 1MBQA 1LHDH 4JCNA 2TGPZ 2WPDD 3UIRA 1GWAA 2YMSD 1UTOA 1UVPA 2Y80A 4Y71A 2QYIA 2J92A 1AE5A 3UFAA 4ISOA 4ISHH 3GICB 1P2QA 5HIYA 1SGEE 2H2ZA 2ZTZA 1HAZB 3LH3A 2O8WA 5A0AE 4ABFA 1SLWB 4GHTA 4Y76A 3GDSA 3KNXA 3MYWA 2SGAA 2KCOA 2A7HA 1BT7A 4LZ4B 3RXEA 5EQQA 1ZOMA 4VGCB 4DOQA 4ZKOU 1CA8B 3O8RA 2STAE 2B7DH 1O2VA 3FFGA 1XUIA 1XUJA 4X6PA 2HNTF 1O2GH 3RP2A 3F68H 1UTNA 2NU2E 2B8OH 1GJAB 3FANA 4DT4A 1ETRH 1IQHA 1B0FA 2YNBA 4I8KA 3RXDA 2AMQA 3SUGA 3AASA 2XBVA 2FZZA 2H9TH 1DY9A 3GY4A 1EPTA 6LPRA 1TGCA 2FEQH 1AFQB 1JIRA 3OEED 1P11E 3BIVH 3GCNA 1V2MT 4CH8B 2KX4A 2VIWA 3GCHB 3A8CA 1GJCB 1THPB 4X1SU 3A89A 2ODYB 3ZYEA 5FX5A 1SQOA 2VU8E 1SLUB 1O2WA 4AN7A 2SGPE 1BMFD 2QXGA 3B9FH 2OC0A 4Y6DA 1UVTH 4FXGH 1TPAE 1HYLA 2WINI 6CHAC 1EASA 2QXHA 4XRNA 7LPRA 1ELEE 2ZNKH 1O5EH 2QN5T 2AIQA 3S9BA 1MH0A 2QIQA 1NFYA 2ZU2A 1Z8GA 1C2EA 1IOEA 4ZMAH 1V2KT 4BANB 1SC8U 1TGSZ 1HRTH 2ZTYA 2FO9A 1NFUA 1UVSH 2EY4C 2O8LA 2QGRA 3TJOA 2RG3A 1TPSA 3T62A 1GMDG 1DX5M 3FO8D 4INHA 4ABHA 1SGPE 4WMEA 4UE7H 2XNDD 3DSGA 2QF3A 1C5VA 2G4UA 3A7TA 3P95A 3S9AA 1QA0A 3RXCA 5C3NA 5C1YA 1OKXA 1DT2A 3TH2H 1VCPA 4K2YA 4O97A 5T6DA 2H5DA 1EZUC 3P8FA 5GXPA 1TGTA 5E0GA 3UNSA 1W0YH 2XC4A 3RXBA 4Y7BA 2V35A 2ZF0H 5EW2H 3BF6H 4BAKB 1Q3XA 1AVWA 2ESTE 1K28D 2PHBA 1SLVB 3HK3B 3LC3A 7GCHG 4TWYA 4ABAA 1ELBA 3V13A 1SG8B 1ZSKA 1MKWK 1L0ZA 2A5IA 1MTUA 1IQGA 3TGIE 1GL1A 2K0QA 2BQ6B 1DPOA 8LPRA 5CHBA 1EQ9A 2Z3CA 2GP9B 1Y3XA 1GI3A 3JZ1B 2GT7A 1WTHD 4FUBA 1OWEA 4E7RG 1MD8A 4FUEA 2SGQE 1AUJA 2BXUH 1TRMA 5JBAS 1D3QB 4CRBA 1O2QA 4D7GA 2OXSA 1TNGA 4DJZB 1SB1H 2J4IA 4IN2A 5I25A 3KYGA 2A0QB 2WPHS 3ATKA 4VGCC 3E8LA 3DSPA 1A0HB 3EA9A 4H6SB 4LOYH 5GJ4B 2PKAB 1EAXA 1OWDA 5T6FA 5A09A 2BD3A 2GV6A 4DW2U 1GHAF 1RIWB 4XDEA 5F8ZA 3A7YA 1GVKB 4ASUD 4CRDA 1GBEA 3LH1A 3LGYA 3TH4H 4IC6A 4CH2B 1F5KU 2J5UA 1AVXA 1KXCA 3PWBA 5E0HA 5K0HA 4FVBA 1C5NH 5A8XA 4NIWA 5C1XA 1HUTH 1GHBF 1O2UA 1XVOA 2ZFPH 3VG8A 1QCPA 1K1OA 1AFQC 1O3IA 2VJ1A 4Y0ZE 3RMLH 1HNEE 5HM9A 2EQNA 1MQ5A 1N1LA 1PPGE 4SGAE 3ITIA 2GMTB 2J9NA 1WOFA 2OP9A 3SNCA 5IYTA 1FX0B 1DVAH 1AKSB 1TYNA 1MKXH 1IQMA 2Y5HA 1D9IA 2C3SA 2ZC9H 3UREA 3NXPA 2BD5A 5EXNA 2VIOA 2YMSB 1OX1A 3UQVA 3HK6B 7ESTE 1G3CA 2CV3A 4B6EA 1VKYA 1RGQA 4AYVB 1B7XB 1HXEH 1DLEA 1Z8JB 5DJ7A 1K1JA 5C5OA 2W26A 3E6PH 2G8TA 3GCTF 1W7GH 1H1BA 1ZSLA 1UCYK 2VB0A 1O3CA 3DSOA 1ZGIA 4H6TA 2UWPA 2Q6DA 3NK8A 4KTSA 4NSVA 3RXLA 1FY1A 3I29A 5AFZH 3DUXH 1RXPA 2FIRH 1DWEH 1UTQA 1Y5UT 2C8WB 1HAYB 1D4PB 3F9FA 1FZZA 2J38A 4XE4A 2P3UB 2GDEH 4XBBA 3RU4T 2A4GA 4AC9A 2PGBB 3MNCA 1O2ZA 1P06A 1BRUP 1O2IA 4F48B 5ABWA 4YT7H 2FX4A 3BTEE 1S83A 2J94A 2BDYA 2KAIA 4KELA 1FDPA 1BBRK 4MQAA 4JK5A 3V0XA 4F55A 2H6MA 3DA9B 2XTTB 1MQ6A 4XD7D 1CHOG 1FLEE 1MZAA 1RTFB 2O8UA 4WMFA 2BLQA 1PFXC 2V3MA 1F0RA 4H42U 5FCRA 1W11U 4GLYA 3VB6A 5BRRE 2EI6A 1ANCA 4UONA 1GBIA 3SHCH 4XFQA 2AMDA 4IBLH 3MH7A 2ZFFH 1F2SE 1EZSC 2FOFA 3F6UH 1O5BB 1QRWA 4QT8C 1PQ7A 1QRZA 4MDSA 4YM9A 4OM9A 3OFND 2HRVA 2VWNA 1DANH 3SV2H 2H1UA 1FN8A 4IS5A 3OEHD 1TRNA 3A87A 1FY8E 1DOJA 1U6QA 1C2HA 4ZUHA 1MKWH 1BMAA 4WXVA 1LCYA 1G36A 1WTGH 2FOBA 4O3UA 4Q7ZA 1M9UA 2BVRH 3GYMA 5FX6A 5LPRA 1UK3A 3IWMA 3TJUA 1RIWC 2FWWA 2V3HH 1KDQB 5DP5A 1YWUA 2QF0A 1TONA 2C4FH 3M7QA 2C8XB 1K9OE 1V2JT 1XKBC 2WPJS 1MMJN 4FUHA 4I86A 1DDJA 2ZGXH 2ZCLP 3ZZDA 4YLQH 4I8GA 5FAHA 1QNJA 1LDTT 1HLTH 1C2JA 4GPGA 2ZFQH 5FXLA 4AYYB 2Y5FA 3PLPA 1IQKA 1O0DH 3O8DA 1O3GA 1TA6A 2WV9A 3B8JA 1ZJKA 2KM0A 4P00A 2FPZA 2GMTC 4BAHB 3RXVA 4CR5A 4K8YA 5C5NA 1V2QT 4U32A 2XWBI 3GY5A 1P02A 1VJAU 1C2MA 1LPKB 2VIQA 1FJSA 2ZCKP 2BY6X 1F92A 2KCAA 1JRSA 2HVXA 2YMSC 1C4U2 4X1NU 4ZROA 1Y3YA 2Y82A 4RI0A 1AIXH 1SGQE 1GJ4H 1LVOA 1YCPK 2UUFB 2FTLE 1KTTB 3MWIU 4FU9A 3SUEA 3ZZAA 5ETXA 3P8GA 2GZ8A 4BNRA 3EGKH 3KQCA 1CGJE 5EOKA 1TOMH 1W10U 3HKIB 4UEHH 4AFSA 2BB4A 1SGFG 1Y8TA 1GMHF 3ATIA 3GY7A 5FPSA 3ZYDA 9LPRA 1NY22 2CHAB 3EAJA 3MTYA 2BD8A 2W7UA 3SBKA 5IK2D 1T4UH 5L2ZH 1ZTKA 3FAOA 1GCDA 2BM2A 2HVYB 4SGBE 4D76A 1RFNA 2Y5GA 3BTFE 1NBME 1BRCE 1A2CH 2GD4B 1C5RA 4DURA 2HGTH 1ZJDA 1QGFA 2FYQA 3F9GA 3M35A 2ANWA 4ACAA 1HB0B 1YPKH 4WMDA 5C1UA 3FP8E 4ISLA 3O8BA 2LNCA 1UCYH 2F91A 2ZDNA 3RXMA 2CF8H 4JYUH 1XM1A 3LU9B 3FZDA 2FDAA 4R8TB 3KQBA 5JDUB 2L6OA 1EFRD 1P05A 1AHTH 1FPHH 1SKYE 4DT7B 4TSFD 4NZLA 4LXBH 1L4DA 3DD2H 3PB1E 2ZIQH 2AEIH 3F9HA 1W8BH 2HNTC 2YOLA 1QL8A 3A7XA 3RMOH 3KN2A 3PRBA 1A7SA 5E0JA 3SU4A 4E05H 2J2UA 1GBCA 3MU5A 1Y5AT 1Z7KA 5JBCS 1OOKB 1SGFA 1BUIA 2GCHG 2Z7FE 3STIA 3Q3XA 1LMWB 1LO6A 3E0PB
chains in the Genus database with same CATH topology
1TQ0B 5C20A 1O2NA 3TNTA 3RC4A 7KMEH 2ZGCA 1DFPA 2GCTB 2DE9A 3ZZ3A 1ZR0A 2ALPA 4IN1A 4KP0A 4UDWH 1VR1H 1GVLA 3SGAE 1C1RA 1SHYA 2IN2A 4CHAB 4HGCA 2C8ZB 2WV4A 1BITA 1T8OA 2V0BA 1UTMA 1C2IA 3T26A 1O37A 1ESBA 1UO6A 1WQVH 3O8CA 3LJOA 3MOCA 3H5CB 1YLCA 4X8VH 1J15A 3E91A 3ZZ6A 4WH8A 1B0EA 1BTUA 1ZMNA 2QXIA 1IQNA 1LVMA 1L1NA 5L6NH 3LGUA 4Y8ZA 1S84A 1YF4A 4B71A 4X2WA 3SU3A 4Y8XA 4MPXA 1GMDF 4HFPB 4AORA 2EC9H 1HAOH 1A5HA 1TNIA 2NU4E 3RC6A 2ZPRA 3SI4H 3UQOA 1G3BA 2TGTA 1MTNB 2WV5A 1V2TT 4IC5A 1GHVH 1SQAA 3LONA 2A7JA 2ZZUH 4FUIA 1GI5A 1BB0B 4TY7A 2Z94A 1JOUB 1QJ1B 2XBYA 2CHAC 1NRPH 2F9OA 1SGDE 1J17T 1QRXA 1P04A 7GCHF 2R2WU 2GX4A 1W7XH 4YZUA 1EB2A 1EOJA 2ILNA 1YCPH 3UNRA 1C1OA 2ZDLA 3A7VA 3A82A 2A2XH 2FTMA 2W3IA 2VIPA 4HI3A 1QTFA 2F9PA 5AFYH 5HGGA 2JH6D 4A1XA 5JB9S 1NU7B 3KGPA 2LPRA 1AU8A 4Y8YA 1BCUH 2WPLS 2AGIX 2VVCA 4X2VA 1C1QA 1WU1A 2VVUA 2PSYA 4DGJA 1MCTA 1QJ6B 5GDSH 4ZXXH 3CS7A 3ZVDA 1AN1E 3EA7A 3SOSA 3ZZ7A 2BZ6H 3AVZA 3RXRA 4NFFA 1O5CB 1GDNA 2FLRH 2BD9A 1S6FA 1BRBE 2F83A 3UR6A 3S9CA 1O2RA 1IHSH 1MZDA 1WAYB 1O2YA 5BPEA 4A1TA 4JZFH 1OSSA 1XUKA 1DICA 5DP4A 5HYOA 2VVVA 2ZGJA 1O2HA 3D49H 1AMHA 3QZRA 5CMXH 1D3DB 2BD2A 1LHEH 1GGDB 1UTKA 2OINA 4ZHAA 1YPMH 3BTWE 1ORFA 1O3KA 1P10A 1SOZA 4MLFB 2W7SA 2ZA5A 3SW2B 4GCHG 1P2IA 2QCYA 3SQEE 2AGGX 2CGAA 1VCWA 4RKOB 3BV9B 5DP9A 2G55A 3SHAH 8GCHG 2GCTC 5EODA 1G32B 1J8AA 4IMZA 4CHAC 1HAPH 3N7OA 4BTIB 4X2YA 1O33A 1PPFE 4ZXYH 1KLTA 1V2VT 1C1WH 1Z71A 4I33A 2RDLA 2SGEE 4TPIZ 2I6QA 1T7CA 1TNKA 2XRCA 1OXGA 1GDUA 2AS9A 1GJ6A 1F0TA 1FUJA 1GI0A 1BIOA 1GBKA 1GJBB 1HCGA 5T3HA 2BVXH 3WY8A 1UVUH 2CF9H 3EDXB 1BTWA 2VH0A 3RXQA 5EXMA 1E38B 3NPSA 3F9EA 1QB6A 1G3DA 3ODDA 1EAWA 3URCA 3SJKA 1A5IA 1BJVA 1XXFA 3OU0A 5FBIA 3ZVBA 1YPHC 1MCVA 3F1SB 1QFKH 1CT4E 1EPTB 3KL6A 5AHGH 1GI7B 5G4BA 3LPRA 1MTNC 2P95A 1XUHA 1P12E 1FV9A 4FUDA 3PYHA 3TU7H 1C1SA 4BTTB 5PTPA 3BG8A 1GL0E 2P3TB 1EATA 4RSPA 4ABJA 1P2KA 1HAHH 1Y3WA 5A0BA 3MU8A 4AGJA 1HPGA 3SQHE 1YCPM 3LIWA 3SU5A 1YYY1 3KCGH 1NFWA 1FIWA 1ZYOA 4X1QU 1BQYA 1LTOA 1QB9A 1BTPA 2HLCA 1EJAA 1GI4A 2W3KA 5GPIB 4D7FA 2EI8A 1K21H 1NROH 3FP7E 2OCVB 4ISIH 1AO5A 3SU1A 4Q7YA 3MH6A 1CQQA 4WWYA 1OPHB 1T8MA 2WPIS 4INKA 4E06H 1O2LA 2Q6FA 2EI7A 1O2XA 2AYWA 2FI5E 4B75A 1QR3E 2FI4E 4YO9A 1C9TA 1O3MA 1QQ4A 3QZQA 4X1RU 1MD7A 1NC6A 4X8TH 4FUGA 2VIVA 1W14U 4D9RA 5L30H 1GJDB 3KF2A 1TB6H 2FODA 3PWCA 1BTXA 1O2TA 1VITG 1GBBA 3S69A 5CHAC 1C5PA 2H9HA 2JETB 2OD3B 1W2KH 1GBJA 1ELDE 1C4Y2 2Q1JA 3HKJB 4YESB 1WV7H 4RKJB 1EAUA 2H5CA 1PJPA 2O8MA 1GDQA 4AFZA 1D6WA 1O2SA 1GGDC 2OC1A 3PMAB 1J16A 4E7NA 3A85A 2ZHFH 2ZFSA 2B5TB 1BHXF 3IITA 4XBDA 4IMQA 1LQDB 4YTAA 5ESBA 1BTHH 4DIIH 4AFUA 1PQ8A 4GSOA 5GCHG 2JKHA 5E8EH 2C8YB 3Q00A 4X6MA 1C5WB 1TGNA 3LKWA 4OS2A 1IQFA 2SNVA 5LGOA 1AKSA 1GBAA 1EP6A 3QO6A 3VFEA 4NIVA 4DCDA 3ZV9A 1KYNA 1TBZH 1MUEB 4ZKNU 2J34A 3U9AH 3MH5A 5DGJA 3BEUA 1O3JA 3U1IB 2BDHA 1JWTA 4J2YB 3OY5U 1TA2A 2XNIA 3M7TA 3SN8A 3K65B 3SU0A 1ESAA 2ZCHP 1QA7A 4K1SA 1TNJA 1A46H 3MO3A 2OQ5A 3ZVEA 3P8NA 4ZKRU 1AZ8A 1EPTC 1TFXA 1ZSJA 3BTQE 1ZHPA 3DT0H 2UWLA 5DP3A 4TPYA 1GBHA 2HOBA 3UY9A 1J9CH 3T27A 2PUXB 4JZIA 3LDXH 3HGPA 3SO3A 1YPJH 2BOHB 2PUQH 1GI6A 2JH0D 1HJ9A 1DLKB 1FI8A 1C5LH 4UFDH 1OWKA 1GBTA 5F8TA 3L33A 3RXTA 4B2CA 1TMTH 3ENSB 3RUOA 2Z9GA 3RXOA 3CP7A 1S6HA 1P01A 1TX6A 2TRMA 5DPAA 1NRNH 1EJMA 1TLDA 1MBMA 1TBQH 4WH6A 1NESE 2ZHEH 2Z6BD 2BY7X 1P03A 1MTVA 3TLOA 4FU7A 2XW9A 1ETSH 4UFEH 5B6OA 1VZQH 1TPPA 3BG4B 1WQSA 1AB9B 3QK1A 5HM2A 1HIAA 1CO7E 2A2QH 4PROA 3TH3H 1Z8IB 3EE0B 5TJXA 1GI9B 1S0QA 1ARCA 1PPCE 3VB5A 1O38A 2H9EH 4Y10E 1MTSA 5EPYA 2GCHF 4TWWA 2HNTE 1QBOA 1A3EH 2JETC 2XBWA 2PGQB 2KAIB 1UVOA 2ODQA 1MAYA 1UK4A 3L6PA 5IDKA 3C1KA 3TK5A 3BSQA 1GMCF 1FQ3A 2O8TA 4KTUA 3T2NA 3HGNA 2PFEA 4AB8A 4O3TA 3ZZ4A 3UOPA 1TMBH 1ZHRA 4AGKA 3UTUH 2XWAA 1JXPA 1FN6A 2FOMB 5F03A 1OP8A 2ZDMA 5JBBS 1ELCA 1ID5H 2V6NA 4INLA 1PQ5A 1XXDA 1IQJA 2OBOA 3AAUA 1ABIH 3GYLB 2A7CA 1RRKA 1YM0A 2ZO3H 1ABJH 1AZZA 4K60A 4DY7B 3ATWA 1ZMLA 2VIDA 1H9IE 1SGCA 3RXSA 1K22H 1SLXB 1HAIH 1V3XA 2UWOA 1ZZZA 2FOEA 4RN6A 1F5RA 3A84A 2Z9IA 3B23B 3A8AA 1OP2A 2PSXA 3K6ZA 8KME2 3S7HB 2OTVA 2Z9KA 3UR9A 1ANBA 3JZ2B 1ZRBA 2BLVA 2C93B 1GHAG 3PV4A 1G2MA 3UOUA 1RTLA 1T32A 1P57B 5EXLA 1V2ST 3V12A 1C1NA 1E36B 1EAIA 5TCCA 1G37A 3M5MA 2YNAA 3D62A 4X0WU 1D3TB 1GHYH 3GY3A 1O2JA 1P2MA 3A88A 3Q3YA 4ZAEA 1FMGA 4A6LA 3DFLA 1DY8A 5GWZA 1BMNH 2QC2A 2C90B 1YKTA 1NN6A 5HMAA 1CE5A 1O3HA 1D6RA 3FP6E 1HXFH 1O3NA 4MNWA 1HAVA 4B74A 4MNVA 3AAVA 1QIXB 2R0KA 3MFJA 4DIHH 1PPZA 2BDGA 1A1RA 3D65E 4MG3A 3A8BA 1FIZA 1HJAB 1GBLA 1ZRKA 4GVUA 2BTCE 1PYTD 3BTME 3U8OH 1E34B 4GAWA 4BTUB 2BYAX 2ZHDA 1BDAA 3RMNH 1TRYA 4YOGA 3MU0A 4FVDA 2SNWA 4UD9H 3GCTG 2F9VA 1AQ7A 5GIBA 5A2MH 3VB3A 3L3TA 2HPQH 5T6GA 3BG4C 1AB9C 1YP9A 1JIMA 5TCAA 1K1IA 2BLOA 3P17H 4Q80A 1ELVA 1GJ5H 1N6XA 1O3FA 1V2LT 4JZEH 2VWMA 1YLDA 4I7YH 1SMFE 2WPKS 2BOKA 1FPCH 1K1NA 3M37A 1V2OT 4U30A 1BHXB 5EG4A 1BBRH 3M61U 4AOQA 1TAWA 1THRH 2OUAA 1OP0A 2QXJA 1O2OA 8GCHF 1DUEA 1ELTA 2XCNA 1GJ9B 5DP8A 1GBDA 4K3JA 1EX3A 5FPYA 4I8JA 2GZ9A 1OWJA 2NU0E 3C27B 1K1LA 3V7TA 1C9PA 2SGFE 1CU1A 2R9PA 1PPBH 1SFQB 4CR9A 2BDBA 1ELFA 4X6OA 3ZV8A 1GHXH 4WVPE 1NU9A 1EJNA 2OC8A 2XC5A 1FY3A 5JBTA 3VGCB 2ANYA 2ANKH 2JH5D 2R3YA 3PMHB 2ZQ2A 4OS5A 1UHBA 4YT6H 3TVJB 1GJ7B 4NZQA 3PMBB 1V6DA 2D2DA 4NWKA 3DFJA 4IW4E 3GY6A 1AWFH 1RTKA 1GHWH 3UNQA 4B73A 1BJUA 1BTYA 4ESTE 1WYKA 2A5AA 3RU4E 2VWLA 3M5OA 2DE8A 2ZG0H 1S5SA 1DITH 3SU6A 2FLBH 5JPMH 2FMJA 2P3FH 1VJ9U 4OGYA 2XXLA 1UTJA 1C5TA 4FUFA 3PLBA 1LHGH 1CA0B 1OWIA 1P2OA 2ZHWH 1C2LA 1PQAA 1UTLM 1C5OH 5HXFA 2GKVE 1V2RT 1YPHE 1XX9A 1A3BH 2K1QA 2J95A 3P6ZB 1P0SH 2HPPH 1IQIA 3UWIA 4KTCA 3PMJA 3MNXA 1V2WT 2Z3DA 4ABIA 4BXWA 3ZVFA 4JZ1A 3TPIZ 1OYTH 4Z6AH 2PLXA 5C2ZA 4B2AA 3GY2A 5AVDA 1EB1H 4FU8A 2D1JA 3D23A 4YOJA 5J4SA 1C1VH 1HGTH 3AW0A 2G5NA 3E3TA 1LHCH 4K1EA 1CBWB 3RXGA 1HJAC 4I31A 3Q77A 1NS3A 1KXAA 1TQ7B 5LH8A 1Z1IA 3T25A 1O2MA 3ELAH 4KKDA 3S7KB 1DS2E 3ZVGA 3PLKA 1CT0E 1TX7A 4I8HA 4BAMB 1FONA 2GZ7A 4OS7A 3U8TH 2G5VA 4LK4A 4GHQA 3RM0H 4NFEA 1QBNA 1XUFA 2FYRA 1O3OA 4Z0KA 4B2BA 1F5LA 4U01A 3OYPA 1C5XB 4CRGA 1KXEA 1TGBA 4XBCA 1KY9A 2BDIA 1O3DA 3M36A 3I78A 1Y3VA 2ZFRH 5CHAB 2ZPSA 1YPEH 3SI3H 2BQ7B 1LVYA 3A7WA 1MAXA 4Y7AA 1CSOE 3RXPA 2G00A 3GISB 5GCHF 1P2JA 3HPTB 2Z9LA 1HAGE 2R2MB 4CREA 1GG6C 4X2XA 1LKBA 2AH4X 3KEEA 3SJIA 6GCHG 1EUFA 3SNDA 2ZECA 1CHGA 4TY6A 2G4TA 1KXDA 4A92A 2TGAA 2GVFA 3SNBA 3SGBE 3RXIA 1O3AA 1ZTLA 3VGCC 3T29A 2HWLB 1X7AC 3P8OA 3TK6A 1BTZA 2ODPA 3QGNB 1P09A 1E35B 2HALA 1G9IE 3SV6A 1N8OB 2QA9E 1MKXK 2VINA 4Y11E 1SOTA 3RXUA 5SGAE 1AE8H 3P92A 2WUBA 3PO1B 1P9UA 4WY3A 1VCQA 1LVBA 1BZXE 1O3BA 4JZDH 5JYIA 2IPHA 4UFGH 2ASUB 3MI4A 1C1TA 4I32A 1ACBE 4U2WA 2TIOA 1K1PA 3BN9A 3UPEA 2BD4A 3MNBA 2ZDKA 2FOAA 2WUCA 4NIXA 3BTTE 1CA0C 1ANEA 3BIUH 4NGAH 4LZ1H 2QAAA 3E1XB 3RMMH 3SUFA 2Z9JA 2A45B 2P16A 1P9SA 3LGTA 1H4WA 3UWJH 1NM6A 4ABDA 1FY5A 4WF8A 4A1VA 5A0CA 3SJ9A 2P94A 1C2DA 1MTWA 3QLPH 3MO6A 3U8RH 1L1GA 5EQRA 1Z1JA 3KQEA 1KLJH 1A61H 1BMLA 3U98H 3RXFA 4FUJA 3BEFB 1C2GA 4BAOB 1QB1A 4Q2KA 6ESTA 1CHOF 1L4ZA 2A1DB 4R0IA 1CBWC 3URDA 3VXEH 2TPIZ 4IGDA 2VGCB 1E37B 2CJIA 1BOQA 3UUZA 2EEKA 3M3SA 1SFIA 3PM3A 1HV7A 1JRTA 2PKSB 1O2PA 1NRSH 1QHRB 1C4V2 1FY4A 2IJOB 5CE1A 3MHWU 1DXPA 1HBTH 1O5AB 3H7OA 4O03A 3R0FA 3ZZCA 1W13U 2XC0A 5EU8A 2PR3A 3VB4A 4ZHLU 2F3CE 1F0SA 2Y7XA 4O9VA 1TABE 1SL3A 2F9BH 1XMNB 3OX7U 1TBRH 4MNXA 3QDZB 4MTBA 2ZGHA 1GCTB 2XYAA 3BEIB 1EOLA 1TX8A 1F7ZA 3ESTA 3AW1A 3MNSA 2ANMH 2ZDAH 1J14A 2PKAA 4WJG2 4A7IB 1GI8B 4KGAA 5FBEA 1UK2A 1SGNE 1Y5BT 1V2NT 1Z8RA 2AFQB 3SJ8A 4CBNA 2EA3A 2FXRA 4K1TA 2FOCA 1XUGA 3FZZA 1YC0A 2A32A 3GDUA 1B5GH 3G01A 3VXFH 3GDVA 4B1TA 4MVNA 1RS0A 1ZMJA 3K2UA 1K1MA 1CT2E 1O39A 1D3PB 1S82A 5A8ZA 4YLUA 3A8DA 1ZHMA 5EGMA 5FHTA 3TNSA 2ULLA 5DK1A 1DE7H 2ZU4A 3MO9A 2ZDVH 2ZPQA 1AUTC 1PYTC 1ZPBA 3LGVA 5DKMA 3STJA 1HJ8A 1KIGH 1H9HE 4XSKU 2VH6A 2UUJB 1TALA 4A5TS 2O9QA 2D26C 1N8OC 3E90B 3SV9A 4K69A 4ISNA 1V2UT 3EQ0H 3PO1C 3K9XB 1IAUA 4TYDA 2RCEA