2TGPZ

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (proteinase/inhibitor)
molecule keywords TRYPSINOGEN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgpZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgpZ02
3EA7A 1Z8RA 2NU2E 2DUCA 2OP9A 4MTBA 3LGIA 2EEKA 5GDSH 2Z6BD 1IOEA 5T6GA 1QR3E 2SGPE 2OC0A 3O8RA 1XKBC 1P2NA 3LT3A 4OS5A 1EAWA 3MI4A 1ETTH 3SUEA 2FS8A 3ATIA 4BAQB 1O2QA 2BZ6H 4HTCH 3ODDA 3A85A 1J17T 5FX6A 1HJAB 1P2KA 3A7TA 3E91A 1C1PA 4X0WU 3LGWA 1CBWC 5T6FA 3VB3A 1O2VA 2ZGCA 3KF2A 2AFQB 3ZZ8A 5A8XA 3KCGH 1ZLRA 1FIZA 3ZZ9A 1A3BH 3NCLA 3TH2H 4I33A 4RN6A 1KIGH 4ZXYH 2BDYA 1CSOE 2ANYA 3U9AH 2FO9A 1ZGVA 1ELAA 5B6OA 1H4WA 1HAYB 1KSNA 4KTCA 1PQ8A 3MU4A 4YOJA 3GCTF 2ZGXH 1JIMA 2H9EH 1WTGH 1A0JA 5FPSA 5F8ZA 1C1RA 2WPLS 1O3FA 1B5GH 2ZPSA 3VPKA 4O03A 3ATKA 1BTXA 3RXFA 1KLIH 3MOCA 4TWWA 2R3UA 5PTPA 1P8VC 1PQ7A 3RC6A 2F9OA 3NPSA 3UWIA 2C4FH 3URDA 2F91A 3A81A 1HIAA 1GDUA 1ACBE 1L1JA 2OBQA 3A8DA 2TPIZ 1W12U 1GBIA 1E36B 1N6YA 1A2CH 4I8KA 2TRMA 2ANKH 1WAYB 1ZSJA 2W3KA 1C2KA 1GI0A 3TJOA 1TAWA 2F9UA 4Y76A 3PLKA 3LGTA 4IMQA 1A0HB 2Y5GA 1GCTB 5JBTA 1V2WT 1O3JA 1PQ5A 1OKXA 4GHQA 1NFWA 1Z6JH 3SU2A 1O3MA 1P9SA 3UOPA 2C8ZB 4OS1A 1HNEE 1L4DA 1ZHMA 1HRTH 4Y79A 2FIRH 1G3DA 4CR9A 4X2XA 1ZSLA 3A84A 3ESTA 3ELAH 3M35A 1GJ5H 1C5ZB 5I46H 1K28D 4H42U 2BDAA 1V2VT 3CS0A 1LTOA 4B76A 3PV4A 3SNDA 2FOFA 2FI3E 1LMWB 1JMOH 3OU0A 4CR5A 3FANA 1KXCA 1F0SA 3JZ1B 1IHTH 1ZJKA 3MO6A 3DD2H 3P8GA 2XWAA 2XW9A 1KXFA 1WQSA 4ZMAH 1HAPH 1N8OB 2STBE 3D62A 3UUZA 1VITF 1QB1A 2UUKB 2Z7FE 5CE1A 6CHAB 5GCHF 2HLCA 3RU4T 2VJ1A 3FP7E 1AMHA 4KELA 4X8VH 1GGDC 2Z9LA 1LPKB 2Y81A 1EJAA 1SGFA 1EATA 2ILNA 2W5EA 4E06H 1GI4A 1DWBH 1RRKA 3MH7A 4GVUA 4NIVA 4O97A 3SHAH 4AYVB 1A1RA 1T8MA 1LQDB 4K1SA 2QN5T 5AHGH 1EB1H 1ANDA 2PKSB 2R0KA 1E34B 5K0HA 1QB9A 1BTZA 2A1DB 3MO9A 1HCGA 1V2OT 3T25A 3GCTG 1IQJA 3T29A 2RA0A 4Y0ZE 3MMGA 3S69A 2FTMA 5CHAC 3ODFA 1Y5UT 1K1NA 1A7SA 5L30H 2BQ6B 1O5BB 5GWZA 1UTOA 1SI5H 3SU4A 3PWCA 3SU5A 1C1QA 4K8BA 1C2EA 2C8XB 4JZEH 1T8LA 3ZZCA 2Z9JA 3EDXB 3NK8A 1WUNH 1C9PA 2XYAA 4ABJA 3OYPA 1UHBA 3GICB 3NUMA 2ZC9H 1KXEA 3TK5A 2F9VA 1CBWB 1ZMJA 4Q7ZA 4ISIH 1JRSA 2FLBH 3RXRA 1AB9C 1C5WB 1AE8H 3GY6A 2ZDLA 3ZZ7A 4DJZB 5DP3A 5C5OA 5K7RA 1GMHF 1NROH 1QGFA 2QF3A 2TGAA 4UFEH 2VNTA 5IYTA 1LHGH 4INLA 5LH8A 1VITH 1OP0A 2BXUH 3CENA 4ZKSU 3GYMA 1G3BA 2ODPA 1O3PB 1SGCA 4YO9A 1FIWA 3V0XA 3RXGA 1KTSB 1V2ST 1DOJA 2OC8A 2Y7ZA 1TGSZ 3HK3B 1GHXH 1IQIA 2FEQH 2VINA 1ZMNA 1LKBA 1O3NA 3SN8A 1EP6A 3SJKA 3F9FA 1WSSH 1NU9A 2XC4A 1NRPH 5FAHA 1UTKA 1G36A 1F0TA 1KDQB 2FOCA 4OGYA 3KIDU 1GI8B 3A86A 2EI6A 2Q6DA 1CT4E 2A32A 3S9BA 1JWTA 1P2IA 2Z3EA 3RXQA 4JK6A 1YPMH 3SUFA 3BTHE 3E1XB 3M7UA 4MPUA 2O8MA 1DLKB 1YPHE 2A4OA 3GY8A 1Z6EA 1CA0C 1GDNA 3IG6B 3KEEA 3MU8A 1ARCA 1W8BH 3QTVH 1P11E 3ZVCA 3EA8A 1XXFA 2Y5FA 3B9FH 3E0NB 3VEQB 1EQ9A 2Y6TA 4Y6DA 5GXPA 1C1UH 1OWEA 1TX8A 4ZH8A 3M5LA 2BLOA 2F9BH 2XCNA 1ANBA 1LO6A 1C1NA 1P01A 4YT6H 4THNH 3QN7A 2P95A 4CRGA 2P94A 1G2MA 3SNEA 3BTKE 1H8DH 3GISB 1SGTA 2BY8X 2FYRA 1V2NT 2AS9A 3GOVB 1C2JA 4ZHAA 3TJNA 1SQTA 4FUEA 1SVPA 3O8BA 1O39A 2A0QB 2AIQA 1FY4A 2ESTE 1TBZH 3E8LA 2B7DH 3WY8A 2EI8A 2VB0A 3KL6A 1HXEH 1TMUH 3RLWH 1BTWA 2ZFRH 1LQEA 1XUIA 2PGBB 1YLDA 2ZQ1A 1GGDB 1FY8E 4YM9A 1TRMA 1NRNH 2THFB 3MNCA 4WF8A 2YNBA 4WXVA 3ITIA 1FY3A 1E38B 4K8YA 1GMHG 3UPEA 1UMAH 1TRNA 2IPHA 4ZKRU 3VFEA 1DM4B 1TGTA 3DT0H 2PWXA 2J38A 1OWIA 2AGIX 4M7GA 1TALA 1UTLM 2ODQA 2AGEX 3QX5H 4UFDH 2V3OH 4FUFA 4CRCA 5IDKA 2SFAA 3P92A 4Y7BA 2AGGX 3UQOA 1BTYA 1MTWA 1RFNA 1FMGA 1K9OE 2ZFQH 2QC2A 2QF0A 1JOUB 2J34A 2G8TA 5CHAB 4UONA 1GI1A 1C5XB 4XBCA 2QV1A 1PPBH 1O2LA 2F3CE 2ZDKA 1YPKH 2BLQA 3BEFB 5L2YH 3UQVA 4D8NA 2OTVA 4O3TA 4CRAA 3O8CA 3FVFB 3TK9A 1TGNA 1OP2A 3GCNA 1HAZB 3SBKA 1AIXH 1BMMH 1MTUA 1C5SA 4A92A 2G00A 3MHWU 1EAUA 1ZMLA 1ESBA 1AUJA 3QLPH 1HLTH 2ZP0H 5JBCS 1C1TA 2ZU1A 1QBVH 1FZZA 1NFYA 1J8AA 1SGEE 2CF9H 2QGRA 2VWLA 2BZAA 1C4V2 1S82A 4B2AA 3RXPA 1F5RA 2FS9A 4AZ2B 2QXHA 3PYHA 2OLGA 5DGJA 1MZDA 5ESTE 1O34A 1G32B 2GP9B 1CT0E 4HI3A 2ZTXA 1A5GH 5HM2A 4NSYA 1SGNE 1WTHD 2FTLE 5A8ZA 3ZYDA 1ZR0A 3ATLA 1BMAA 3ZVGA 1HIAB 4NIWA 3MH5A 1OWDA 4FU9A 1CGJE 1H1BA 2BXTH 4Y8YA 1U6QA 1YCPH 2FLRH 2ZFTA 1AN1E 1GHWH 4JZFH 3RDZA 2WPMS 4O3UA 3RXTA 2WYJA 4NZQA 3RXVA 3NZIA 1H9IE 1AY6H 3BG4C 3FFGA 5FCRA 3EYDA 5GJ4B 3N7OA 3V13A 4WXIA 2BD9A 2QAAA 1HAOH 1L4ZA 1SPJA 3BIVH 3E6PH 1IAUA 1CA0B 1F5LA 1XUGA 4RKOB 4DVAU 5JBAS 3A83A 2VIVA 4IBLH 3QZRA 1E0FD 1P0SH 3L3TA 1C5QA 3S9CA 1HJ9A 3ZVDA 2ZG0H 4NIXA 4AGJA 1O5EH 4MNXA 1BBRE 1THSH 3P70B 1S6FA 4I8HA 2W26A 3LGUA 5DG6A 4WJG2 1V2JT 3ZVEA 1LHFH 1QB6A 1XMNB 4JZ1A 4K60A 1W3CA 1MBQA 4NSVA 1QNJA 1P2QA 2R9PA 2ZGHA 2D8WA 4WWYA 1GJDB 2A31A 1MAYA 1HYLA 1C2DA 1O5CB 1P3CA 3RXDA 1AVGH 1DANH 3U1JB 3RMMH 2A2QH 4LXBH 1YP9A 3MH6A 1GPZA 2A7JA 1ZTJA 2XTTB 4BNRA 1AFEH 1SGYE 2R2MB 1AWHB 1OXGA 3BG8A 2O8LA 3K9XB 5FX5A 1NO9H 1QRWA 1OSSA 1MTSA 2ZHEH 1EZSC 1ELGA 1O2KA 2HWLB 1PYTC 2VVVA 3UNQA 4I8GA 1TX7A 3PMBB 2XC0A 3M37A 1DXWA 1YPGH 1C2FA 6GCHF 2FOMB 4H4FA 4YT7H 3I78A 2Z3CA 1SGIB 1GJ4H 1TA6A 2VWOA 3M3VA 1SHYA 2QY0B 3GY3A 1MQ6A 4GPGA 5A2MH 1WCZA 5T6DA 1QURH 3UWJH 1UK2A 1ELCA 3P95A 7GCHF 1MTVA 1THPB 5J4QA 4CREA 1FY5A 2ZCHP 4B75A 1C4U2 1FAKH 3A88A 4MG3A 1AVXA 1O36A 1SQAA 1T7CA 4Y8XA 3QWCH 2WPHS 1UTQA 3A7WA 1FJSA 5C5NA 1BRAA 1UHBB 2Y80A 5JB8S 9LPRA 2Y7XA 3MYWA 3MNBA 4NGAH 1FXYA 2V0BA 9ESTA 2BD2A 3TIUA 1HGTH 1C5UA 3RC4A 2C93B 1VCPA 8GCHF 2XBYA 2VVCA 1W7XH 3ZVBA 2W7UA 4AFZA 4U32A 2GCHF 3BEUA 1UTMA 2QYIA 1S5SA 1AGJA 1OP8A 1YF4A 4FUDA 1O31A 2XRCA 2PHBA 1P9UA 4NFFA 2ANWA 1KYNA 5JBBS 1K1MA 3Q00A 2IOTA 2H9TH 1JRTA 4OS6A 3ZZAA 1DT2A 3U69H 1SG8B 1DICA 1SR5C 4U2WA 1GJ7B 1EUFA 1P12E 2J94A 3NXPA 3RXLA 4Z0KA 1C5TA 3MH4A 1BCUH 1UCYE 1RD3B 5FHTA 2BX3A 1NTPA 2SGQE 4BAOB 1FONA 1WU1A 3DA9B 1WOFA 1J15A 4TWYA 3STJA 3TITA 1WBGB 1Y3YA 3MNXA 2FOHA 1IQLA 3TGJE 5L2ZH 2BDHA 1F5KU 4J1YA 1O2ZA 1PJPA 2QIQA 3OTJE 3RUOA 1CGIE 1HUTH 1MMJN 1Z71A 3BG4B 4WMDA 3SV6A 2BOKA 3SNAA 4NFEA 1UVSH 3SQEE 2CN0H 1QFKH 2K1QA 3KQEA 2QCYA 3GDSA 2FDAA 4SGAE 3URCA 4TY7A 1V6DA 1EJNA 2P8OC 4AG1A 1CO7E 1CQQA 1NM6A 6GCHG 3BSQA 1ANCA 2GVFA 4KTUA 3QTOH 2VH6A 2A5IA 2GTBA 3UY9A 1HAVA 1DPOA 2STAE 2YOLA 1CT2E 1QQUA 3S9AA 4ISLA 2GKVE 4DIIH 1SLXB 1QA0A 1GVKB 3Q3YA 1TNKA 5DO4H 1MKWH 2BB4A 1IQHA 3SV9A 2PFEA 7ESTE 2VWNA 2ZGBH 3TJUA 3P8NA 4KP0A 2AEIH 5DP4A 3RMLH 4E7RG 3S7HB 4TPIZ 1AU8A 1IQEA 4GHTA 1DS2E 1V2PT 1ZHRA 3Q3XA 2BX4A 2R3YA 1G37A 3TU7H 3BV9B 2HGTH 2KAIA 4AORA 2Q1JA 2CGAA 2HNTF 3QK1A 3SJOA 1GMDF 4GSOA 1D4PB 3W95A 1GHBF 1V2LT 3M5MA 1HAGE 2FI5E 1EASA 2FX4A 5SGAE 4NA9H 2ZFPH 4Y71A 1HAIH 1TQ7B 2GCHG 4CBNA 2CV3A 2GCTC 1BJUA 3RC5A 5E2PA 2UWOA 1S84A 3PWBA 1GMCF 2CXVA 1SFIA 1TGCA 3LIWA 1AD8H 1YLCA 4NA8A 1EJMA 3P8FA 4X2WA 4J2YB 1HPGA 5E2OA 2ZHDA 2VH0A 1MAXA 1RTLA 3KNXA 5EW2H 5EPYA 1KXBA 4H6TA 1D6RA 1V2TT 4FVDA 1C4Y2 4AFUA 2BY5X 4Y10E 3SGBE 3VXEH 3SHCH 1A3EH 5ABWA 3I29A 5C3NA 2ZWLH 1NT1A 3KQCA 3IITA 1QRZA 2SGEE 4F4OC 2XXLA 2PLXA 1N6XA 1C5MD 3RMOH 4ABDA 1C1OA 2JH6D 2GMTC 2ZU4A 3H5CB 5DP5A 1GBAA 1MKXH 4MPVA 4SGBE 1PPHE 2XCFA 3KHVA 2BTCE 2P16A 3TH4H 3UIRA 5E0HA 5EXNA 1Q31A 1W14U 4AX9H 1UVTH 1EPTA 2FMJA 2WUBA 4AYYB 2V35A 2IJOB 3TH3H 3ZZBA 1BTHH 1BIOA 1AKSB 4ISNA 4X1QU 5GIBA 3LGYA 2GGVB 3BEIB 1OS8A 3SV2H 5HXFA 2O8WA 3U8RH 1O3LA 1X7AC 1DVAH 4E05H 1C5PA 1Q2WA 1YPJH 3LGVA 5AFYH 1AZZA 1J14A 2I6QA 5FPYA 4YLUA 2FOGA 5FBEA 3ZV9A 1EXFA 1G30B 2Q6FA 4HGCA 2P3UB 1W13U 1LDTT 1ZGIA 2ZNKH 5F03A 1MU6B 3LH3A 1O2WA 1Y8TA 1INCA 1YGCH 4X1PU 2BD8A 1TOMH 2PUQH 1O3EA 4X6OA 3LOXA 3HGNA 1GHBG 2D2DA 3FP6E 4CRDA 4ZXXH 2AH4X 2GV7A 1S0RA 1GBKA 1A5IA 1LHEH 2OD3B 1OX1A 1VITG 1O3IA 4FUHA 3A80A 1F92A 5GCHG 3M3SA 1UK4A 2BVSH 1SGQE 4QT8C 2BD7A 1O2PA 1LVBA 4X6MA 1D6WA 3R0FA 4KGAA 2P8OB 3P8OA 1O3BA 1O32A 1TNHA 1ZPCA 3PM3A 2Z3DA 2ZTYA 5A0BA 5HMAA 1RJXB 1GBCA 2BLVA 3GY4A 5BPEA 1B0FA 2W7SA 4K1TA 4AB8A 1QJ6B 4XSKU 3S7KB 5EXLA 4YOIA 2I6SA 2P93A 2ZDMA 1PPFE 3STIA 1AI8H 2GD4B 3K6ZA 2ZFSA 1LPZB 3U98H 1GHAF 4IN2A 4LZ1H 3VGCC 3KQDA 3EE0B 1K1OA 2ZA5A 1ELDE 5DKMA 4FUBA 1TBRH 1RTFB 1NU7B 1BTUA 2YNAA 4FVBA 5I25A 2EI7A 4D76A 2EC9H 4BAMB 3MO3A 4A6LA 4IS5A 2NU0E 4CHAC 4XBDA 2XWBI 4D9QA 5F8XA 4ESTE 1LVOA 2P3TB 3UTUH 3RXOA 1S85A 4JCNA 1FV9A 1S6HA 1O2HA 2F83A 3P6ZB 1NFUA 1ZJDA 3QZQA 1C1VH 2GCTB 1V2QT 5JDUB 1AHTH 1EKBB 1C1MA 1K1IA 3SNCA 1ESTA 1LKAA 2RA3A 2O8TA 2OC1A 2G55A 3PB1E 1YPHC 3PO1C 3LC3A 3IWMA 2HNTE 3TNTA 1HDTH 4DIHH 1ZTKA 1BTPA 1XM1A 1CGHA 1ELBA 3HKIB 1NY22 1O0DH 2JH5D 1TMTH 2ZU5A 1FUJA 5E8EH 3SQHE 1B0EA 2G5VA 1F7ZA 1AUTC 3LPRA 4VGCC 3KQBA 1RIWC 2ALVA 3A8CA 3F1SB 3T62A 1NC6A 2Z94A 4A7IB 4IGDA 1EPTC 1QL9A 3PTNA 2HPPH 2BDBA 1E37B 3PROA 4D7FA 3ZZDA 3UOUA 5C1UA 5HM9A 3Q77A 1O3KA 2FESH 1TNGA 1Z8JB 1GJ6A 2VIQA 4OS2A 4X1SU 1GI5A 4A1XA 3R3GB 1AB9B 5E0JA 1O3CA 4A1TA 1BB0B 2ZU2A 4MNWA 4ISHH 1K1PA 1TNJA 4NCYA 2B9LA 4IC6A 1SQOA 3AASA 1F0UA 2Z9GA 2UUFB 1B7XB 3FZZA 5A09A 2PGQB 4I32A 1EX3A 1YKTA 1O2NA 4ISOA 3RXCA 1C5NH 2BDIA 4KKDA 4RKJB 1HJAC 2LPRA 1TPPA 5FXLA 2ZDAH 1MD8A 2GZ8A 4Q80A 3M36A 4GLYA 2XBWA 1THRH 5G4BA 1RGQA 1WQVH 3HPTB 1O5GH 1GBTA 2ZGJA 3SORA 2G4UA 1ELTA 2ZQ2A 2AIPA 1BQYA 1YPLH 2GDEH 2RCEA 4CH8B 3A8AA 1GJ9B 3SU6A 4INHA 4NA7A 5L6NH 1P57B 1BHXB 3SOSA 1Z1JA 3AVZA 3E3TA 1FNIA 4YZUA 1HAHH 2VIPA 2V6NA 1CHGA 1P09A 2PSYA 1O3DA 1PQAA 4JK5A 2BDGA 2A4QA 3GCOA 1HAVB 1UVUH 3E0PB 2AMDA 1TPOA 2JETC 1SMFE 2QXIA 1YYY1 4D7GA 1TOCB 3GCHC 1GL0E 1GBFA 5CMXH 4OS7A 2AMPA 1P03A 1MCVA 3RXEA 1ZTLA 4X2YA 4X8UH 1O3HA 1Y5AT 2BY6X 3RXSA 3VB4A 3AAVA 3UREA 1VCWA 1GBBA 2ZDVH 1A4WH 1FQ3A 3BTGE 3VGCB 2FPZA 1S81A 2OXSA 4WY3A 4HFPB 1GJCB 1C2HA 3HKJB 4IN1A 3SUDA 3UNRA 4OS4A 5LPFA 1P2MA 1TPSA 2Z9IA 1IQFA 1ESAA 2SNWA 1BBRK 1MCTA 4XFQA 3UFAA 5DP9A 2OCVB 1W2KH 1PPEE 1DSUA 1GCDA 5AVDA 3MWIU 2PUXB 2B8OH 1GDQA 3S0NA 2B5TB 1DSTA 1VJAU 1AO5A 5DPAA 4NIYA 3DFLA 3M7TA 3H7TA 1O30A 1K21H 1T4UH 4INKA 3D65E 3SJIA 1CHOF 1OYTH 1MBMA 3L33A 1FLEE 1HAXB 4Q2KA 1ABJH 1BT7A 1OWHA 1GBEA 3PO1B 1MH0A 3LJJA 3RLYH 1BJVA 5TJXA 1BUIA 2XBVA 1W7GH 1P2OA 1EZXC 3QO6A 4CRBA 3MU0A 1CA8B 1O3AA 1BRBE 2BHGA 4MLFB 4TYDA 3PLBA 2WPKS 6ESTA 1QY6A 2DE9A 1NESE 2HPQH 4AFQA 1GI3A 3RU4D 1YC0A 5JYIA 4VGCB 2VIWA 1T4VH 5FPTA 5C1YA 1O38A 1RIWB 5BRRE 2CJIA 4XDEA 2AMQA 3GDVA 1BHXF 2SGDE 3T28A 1XUKA 1QJ1B 2J95A 3A7ZA 1S0QA 4LZ4B 2BVRH 1GWAA 1RS0A 1KXAA 2O9QA 2ZPQA 4Q7XA 1SOZA 2ANMH 3RM2H 4ABBA 3FAOA 3BTWE 2GZ9A 5JB9S 1SOTA 1V2KT 4MDSA 2D1JA 2TIOA 1V2RT 3QGNB 2JKHA 5C67A 1Z1IA 2ZZUH 4NG9H 4IC5A 3PMHB 1ANEA 1XXDA 1P05A 3ZVAA 3ZYEA 3ATMA 3HK6B 1C5VA 3U8OH 1D9IA 2P3FH 1NFXA 4LOYH 1G3EA 1YCPK 3DUXH 3UR6A 2JH0D 1DLEA 5C20A 2C8YB 5TCCA 2PV9B 2AERH 4X1RU 4NWKA 3PTBA 5EODA 1V3XA 4XOJA 3EAJA 1O2MA 5EG4A 1FN8A 2SNVA 1GI2A 1FPHH 2FZZA 1DUAA 1GL1A 3ATWA 2PW8H 2H2ZA 2PKAA 2VGCC 5F8TA 3C27B 5FCKA 1ZRKA 3DHKH 5A8YA 1HB0B 4K69A 2VWMA 4BTTB 1LPGB 4AOQA 2C8WB 6LPRA 4MQAA 1P3EA 1EP5A 2A2XH 1V2UT 1ZYOA 1UVPA 3NKKA 1D3PB 3U8TH 2IN2A 3LU9B 4JZIA 2QXGA 1DY8A 4H6SB 4Y0YE 1UCYK 4YOGA 2TBSA 2H9HA 8KME2 1BMLA 3A89A 2FWWA 1ORFA 1P2JA 1P04A 2EA3A 2A5AA 4BOHA 1TIOA 2NU4E 1TONA 2JETB 4U30A 4ZUHA 3MFJA 4X2VA 1CHOG 1FAXA 3TK6A 1O2JA 1IQKA 3BTEE 3GCHB 1Q3XA 4K5ZA 1PFXC 3BTTE 3SI4H 5JPMH 1JXPA 3F9GA 1G2LA 2WV5A 1T8OA 1XUFA 3ZZ6A 1LHDH 3M3TA 1P10A 2OINA 4ASHA 3T26A 1QTFA 1O2IA 3VB6A 1JBUH 1BITA 2TGTA 5EPNA 3BN9A 3OX7U 1TNIA 1MU8B 1H9LB 3SU3A 5EU8A 7GCHG 4X6PA 1TB6H 2J9NA 3DFJA 1F2SE 1TRYA 1BMNH 3BF6H 2ZIQH 2ZO3H 3JZ2B 4FUIA 1GBDA 3VXFH 2BY9X 3GDUA 1O5FH 3SJ9A 4BXWA 3PMAB 2BD5A 3SW2B 1L1NA 4B2CA 1ZPZA 2ZCKP 4ABGA 4DCDA 4FU8A 5C1XA 2ZI2H 1Y3UA 3RU4E 1EZUC 1H9HE 2G52A 3OSYA 2GV6A 2RG3A 2H5DA 2WPIS 3UNSA 1H8IH 1J16A 7KMEH 3D23A 8GCHG 4GCHF 3MU5A 4Y7AA 1CVWH 2Y82A 1UJ1A 5EOKA 1GHVH 1SL3A 2ZHQH 1GBLA 3ZV8A 4BTUB 1GI7B 1A5HA 1L1GA 5DK1A 1PPZA 1TE0A 2OQUA 3SV7A 8LPRA 2F9NA 1QL7A 1G9IE 5DP6A 1TX6A 4AG2A 1VR1H 1C5YB 3MTYA 3AAUA 1QBOA 1ETSH 2Y5HA 2A7CA 1P02A 2QXJA 1VJ9U 2A45B 1SGDE 4I31A 4AN7A 4MNYA 2ALPA 4GAWA 4BAKB 2FOEA 1SBWA 4DY7B 1IQGA 1EOLA 5A0CA 4UD9H 5GPIB 1RXPA 3TGIE 1SGFG 2H1UA 2ZKSA 1QA7A 5LGOA 5EQQA 1TGBA 2ZECA 1WYKA 1V2MT 2R2WU 1DUEA 1KY9A 1ZZZA 1C2LA 3OY6U 1DY9A 1OPHB 1SLVB 5EQRA 2QA9E 2Z9KA 3F9EA 4ZAEA 3W94A 4D9RA 5FBIA 3SI3H 5A0AE 1SB1H 1QIXB 4ABAA 1OWKA 1DX5M 1HV7A 2AYWA 1IQMA 2ZU3A 1F0RA 2FOBA 1ZHPA 3SNBA 3VB5A 1VGCC 2GT7A 4ABFA 2A7HA 2M5TA 1ARBA 1K1JA 4UFFH 1XUJA 1D3DB 1W10U 3OY5U 1Y3XA 4B74A 1AE5A 1NRQH 1Y5BT 1YCPM 2G81E 2FI4E 4CRFA 5EW1H 1DDJA 1DWEH 3RXUA 2FM2A 3GY2A 1LVYA 4CBOA 4ABIA 1O2RA 1SLUB 1OYQA 1SGPE 2VIOA 3RXBA 1SHHB 2VGCB 1C1WH 1TQ0B 2PTNA 3RXIA 2GDDA 3ZZ3A 2OQ5A 1Z8IB 2V3HH 4FUCA 4AB9A 3A7VA 2Q6GA 1FPCH 4FU7A 1GVZA 1LHCH 4I8LA 3QGJA 3LH1A 1UK3A 4YTAA 1S83A 1DFPA 2BQWB 4PROA 2BLWA 1GMDG 3H7OA 1ABIH 1Y59T 2ZDNA 1XVMA 1K22H 1XVOA 4GCHG 2UUYA 3SZNA 3ZVFA 1MKWK 2ASUB 1BRUP 2ZEBA 3LC5A 4TPYA 3RXHA 2WPJS 3M5NA 1UTNA 1BZXE 1J9CH 3Q76A 1CU1A 1TABE 2FXRA 3M5OA 4NWLA 5EQSA 1AZ8A 1GMCG 2CHAC 1AFQC 1GI9B 1C9TA 3SJ8A 1QQ4A 1NS3A 1XKAC 2DE8A 5H4IB 1O2OA 4JMYA 1DWDH 3QUMP 4K3JA 3TVJB 4E7NA 4X8SH 1C5OH 1MTNC 2VU8E 3LKWA 4HZHA 1O3GA 1IHSH 4UE7H 2UWLA 1EZQA 4K2YA 5DP8A 1O37A 1O33A 2A4GA 2FP7B 3P17H 3D49H 1YM0A 1QHRB 2A4RA 1HBTH 2BQ7B 2G5NA 2BD4A 5F6MA 5LPRA 3U1IB 1T8NA 2XNIA 2FYQA 4DT7B 1K1LA 1W0ZU 3QDZB 1AVWA 1ETRH 4DURA 2R0LA 4X1NU 1Y3VA 2ZTZA 1ELEE 1GHYH 1UTPA 2WUCA 4WH8A 1GG6C 1SLWB 1NRSH 5E0GA 1Y3WA 3MU1A 4YESB 1NRRH 2TGPZ 2WYGA 1QBNA 3ENSB 3LONA 1EOJA 2ZCLP 3GYLB 1A61H 4ZROA 1OWJA 1C5LH 1Z7KA 5AF9H 3SUGA 4BAHB 5AFZH 2XC5A 1ZSKA 4FUJA 3LJOA 2PSXA 2HVXA 1PYTD 3BTME 1EB2A 5DP7A 4BANB 3PMJA 1TMBH 2GZ7A 4MPXA 1NN6A 2BVXH 2FOAA 1MKXK 1O2TA 4B73A 1VCQA 4RSPA 3CS7A 1C2IA 3NWUA 2FX6A 3KN2A 2G4TA 1HJ8A 1C5RA 1O5AB 1YPEH 2BD3A 3Q3KA 4FUGA 4MNVA 3F68H 4CH2B 5C2ZA 1KTTB 4X8TH 3A87A 2NU3E 3PLPA 3V12A 1ID5H 5TCAA 2A5KA 1EAXA 3BTDE 1BBRH 1D3QB 3CP7A 4UDWH 2BMGB 4ABHA 4BTIB 3GY5A 1UVOA 2GMTB 3ZZ5A 2CMYA 1O2UA 1TA2A 2SGAA 3K2UA 1QJ7B 4GUXA 5T3HA 1N1LA 3HGPA 1GJAB 3SV8A 2J2UA 1GBMA 1GBHA 2WV4A 3BIUH 3RM0H 2UWPA 1XUHA 1IQNA 1ZOMA 2W3IA 2G51A 3T5FH 3ZZ4A 2GX4A 1GI6A 1NZQH 1UO6A 3RXMA 1VGCB 1OOKB 1MQ5A 1BA8B 1SGRE 3C1KA 5J4SA 1GJ8B 3RXJA 2BY7X 4XE4A 1JIRA 2PKAB 3SGQE 2P59A 1EAIA 3F9HA 5DJ7A 4B1TA 1DE7H 1O2XA 4B71A 1TBQH 2HNTC 4JZDH 4ABEA 1GHAG 1LVMA 1W11U 2C3SA 4IMZA 2UUJB 1C2MA 3M7QA 1DXPA 1FDPA 3FZDA 1O3OA 1TFXA 1WV7H 2H6MA 8ESTE 3VB7A 2XBXA 4FXGH 4ZHMU 5EGMA 1ELFA 3MNSA 5EXMA 2CF8H 2OUAA 4O9VA 3SU0A 4Z6AH 1SFQB 5LPEA 1AKSA 3B8JA 1A46H 2BM2A 3TPIZ 2GT8A 1K2I1 3T2NA 1BDAA 4A5TS 1D3TB 2C90B 4WMEA 4NZLA 3AW0A 3AW1A 2O8UA 1XX9A 4IW4E 3GY7A 4KTSA 1O2SA 1RTKA 4WVPE 3V3MA 1TYNA 1HFDA 1O5DH 1HXFH 3EQ0H 2CHAB 1AFQB 1FN6A 1TWXB 4OGXA 1CE5A 3SU1A 1TLDA 2NU1E 1NPMA 3TJVA 3A8BA 4ZHLU 2J92A 1MTNB 3G01A 1FI8A 2H5CA 3I77A 4K1EA 4Q7YA 1QL8A 1TNLA 1PPGE 1A0LA 1W0YH 1ZRBA 1TPAE 2VIDA 4MPWA 1ZPBA 3T27A 1O35A 1T32A 3TNSA 1KDQA 2KAIB 4X6NA 1O2GH 4JYTA 2HRVA 4DOQA 4ZKOU 1DITH 2BOHB 1LCYA 2OC7A 3RMNH 1MUEB 2HALA 1PPCE 1L2EA 3SGAE 2BDCA 1MD7A 1GBJA 4ZKNU 1C1SA 4I8JA 3V7TA 2ULLA 4B2BA 5ETXA 1Z8GA 1SSXA 4CHAB 1GCTC 3E16B 4F49A 1GG6B 1UCYH 3BTFE 1AWFH 2LNCA 3K6YA 3BTQE 3RXAA 1KXDA 1O2YA 3RXKA 3LDXH 3TLOA 4AFSA 1P06A 2ZPRA 2ZF0H 1T31A 3UR9A 3E90B 1G3CA 3A7XA 2ZHFH 3RP2A 1KLJH 3KGPA 1BOQA 4WMFA 1E35B 3M61U 4UFGH 2WINI 3SO3A 1QCPA 4UEHH 1AQ7A 4R8TB 4YLQH 4Y11E 1GJBB 2OBOA 1MZAA 4TY6A 1BRCE 1KLTA 1UTJA 5HGGA 4DG4A 1N8OC 6CHAC 4MVNA 2PTCE 2FODA 3EA9A 1ELVA 2TGDA 3A7YA 3A82A 1FY1A 1L0ZA 2ZFFH 4A1VA 1SC8U 5HYOA 1VZQH 2B0FA 2J4IA 2ZHWH 2VVUA 2BYAX 4DGJA 2ODYB 3F6UH 3L6PA 4AGKA 2RDLA 4XBBA 2D26C 3EGKH 1GVLA 1M9UA 5ESBA 3B23B 4DW2U 4R0IA 1GHZA 2F9PA 4LK4A 1EPTB 2PR3A 3FP8E 3K65B 7LPRA 4Y8ZA 1YBWA 4JYVH 3O8DA 2PKSC 4U01A 1DWCH 2SGFE 1QRXA 1C2GA 2NWNA 3HATH 4JYUH 3TGKE 4I7YH 4BXSA 2HOBA 4WH6A
chains in the Genus database with same CATH superfamily
3EA7A 1Z8RA 2NU2E 2DUCA 3FOAA 2OP9A 4MTBA 3LGIA 2EEKA 5GDSH 2Z6BD 1IOEA 5T6GA 1QR3E 2SGPE 2OC0A 3O8RA 1XKBC 1P2NA 3LT3A 4OS5A 1EAWA 3MI4A 2YMSD 1ETTH 2EQNA 3SUEA 2FS8A 3ATIA 4BAQB 1O2QA 2BZ6H 4HTCH 3ODDA 3A85A 1J17T 4TT3D 5FX6A 1HJAB 1P2KA 3A7TA 3E91A 5FL7D 2GJGA 1C1PA 4X0WU 3LGWA 1CBWC 5T6FA 3VB3A 1O2VA 2ZGCA 3KF2A 2AFQB 3ZZ8A 5A8XA 2KCPA 3KCGH 1ZLRA 1FIZA 3ZZ9A 1A3BH 3NCLA 3TH2H 4I33A 4RN6A 1KIGH 4ZXYH 2BDYA 1CSOE 2ANYA 3U9AH 2FO9A 1ZGVA 1ELAA 5B6OA 2KR7A 1H4WA 1HAYB 1KSNA 4KTCA 1PQ8A 3MU4A 2WV9A 4YOJA 3GCTF 2ZGXH 1JIMA 2H9EH 1WTGH 1A0JA 5FPSA 5F8ZA 1C1RA 2WPLS 1O3FA 1B5GH 2ZPSA 3VPKA 4O03A 3ATKA 1BTXA 3RXFA 1KLIH 3MOCA 4TWWA 2R3UA 5PTPA 1P8VC 1PQ7A 3RC6A 2F9OA 3NPSA 3UWIA 3OTPA 2C4FH 3URDA 2F91A 3A81A 1HIAA 1GDUA 1ACBE 1L1JA 2OBQA 3VG8A 3A8DA 2TPIZ 1W12U 1GBIA 1W0JD 2IJD1 1E36B 1N6YA 1A2CH 4I8KA 2TRMA 2ANKH 1WAYB 1ZSJA 2W3KA 1C2KA 1GI0A 3TJOA 1TAWA 2F9UA 4Y76A 3PLKA 3LGTA 4IMQA 1A0HB 2Y5GA 1GCTB 5JBTA 3N7DA 1V2WT 5CHBA 1O3JA 1PQ5A 1OKXA 4GHQA 1NFWA 1Z6JH 3SU2A 1O3MA 1P9SA 3UOPA 2C8ZB 4OS1A 1HNEE 1L4DA 1ZHMA 1HRTH 4Y79A 2FIRH 1G3DA 4CR9A 4X2XA 1ZSLA 3A84A 3ESTA 3ELAH 3M35A 1GJ5H 1C5ZB 5I46H 1K28D 4H42U 2BDAA 1V2VT 2K8IA 3CS0A 1LTOA 4B76A 3PV4A 3SNDA 2FOFA 2FI3E 1LMWB 1JMOH 3OU0A 4CR5A 3FANA 1KXCA 1F0SA 3JZ1B 1IHTH 1ZJKA 3MO6A 3DD2H 3P8GA 2XWAA 2XW9A 1KXFA 1WQSA 4ZMAH 1HAPH 1N8OB 2STBE 3D62A 3UUZA 1VITF 1QB1A 2UUKB 2Z7FE 5CE1A 6CHAB 5GCHF 2HLCA 3RU4T 2VJ1A 3FP7E 1AMHA 4KELA 4X8VH 1GGDC 2Z9LA 1LPKB 2IPQX 2Y81A 1EJAA 1SGFA 1EATA 2ILNA 2W5EA 4E06H 1GI4A 1DWBH 1RRKA 3MH7A 3F0OA 4GVUA 4NIVA 4O97A 3SHAH 4AYVB 1A1RA 1T8MA 2VBCA 1LQDB 4K1SA 2QN5T 5AHGH 1EB1H 1ANDA 2PKSB 2R0KA 1E34B 5K0HA 1QB9A 1BTZA 2A1DB 3MO9A 1HCGA 1V2OT 3T25A 3GCTG 1IQJA 3T29A 2RA0A 4Y0ZE 3MMGA 3S69A 2FTMA 5CHAC 3ODFA 1Y5UT 1K1NA 1A7SA 5L30H 2BQ6B 1O5BB 2J97A 5GWZA 1UTOA 1SI5H 1WXRA 3SU4A 3PWCA 3SU5A 1C1QA 3PRDA 4K8BA 1C2EA 2C8XB 4JZEH 1T8LA 3ZZCA 2Z9JA 3EDXB 3NK8A 1WUNH 1C9PA 2XYAA 4ABJA 3OYPA 1UHBA 3GICB 3NUMA 2ZC9H 1KXEA 3TK5A 2F9VA 1CBWB 2L6OA 2JJ1D 1ZMJA 4Q7ZA 4ISIH 1JRSA 2FLBH 3RXRA 1AB9C 1C5WB 1AE8H 3GY6A 2ZDLA 3ZZ7A 4DJZB 5DP3A 5C5OA 5K7RA 1GMHF 1NROH 1QGFA 2QF3A 2TGAA 4UFEH 2VNTA 5IYTA 1LHGH 1COWD 4INLA 5LH8A 1VITH 1OP0A 2BXUH 3CENA 3DSGA 4ZKSU 3GYMA 1G3BA 2ODPA 1O3PB 1SGCA 4YO9A 1FIWA 2OK5A 3V0XA 3RXGA 1KTSB 1V2ST 1DOJA 2OC8A 3EE7A 2Y7ZA 1TGSZ 3HK3B 1GHXH 1IQIA 2FEQH 2VINA 1ZMNA 1LKBA 1O3NA 3SN8A 1EP6A 3SJKA 3F9FA 1WSSH 1NU9A 2XC4A 1NRPH 5FAHA 1UTKA 1G36A 1F0TA 1KDQB 2FOCA 2JDID 4OGYA 3KIDU 1GI8B 4YXWD 3MQKC 3A86A 2EI6A 2Q6DA 1CT4E 2A32A 3S9BA 1JWTA 1P2IA 2Z3EA 3RXQA 4JK6A 1YPMH 3SUFA 3BTHE 3E1XB 3M7UA 4MPUA 2O8MA 1DLKB 1YPHE 2A4OA 5KEDA 3GY8A 1Z6EA 1CA0C 1GDNA 3IG6B 3KEEA 3MU8A 1ARCA 1W8BH 3QTVH 1P11E 3ZVCA 3EA8A 1XXFA 2Y5FA 3B9FH 3E0NB 3VEQB 1EQ9A 2Y6TA 4Y6DA 5GXPA 1C1UH 1OWEA 1TX8A 4ZH8A 3M5LA 2BLOA 2F9BH 2XCNA 1ANBA 1LO6A 1C1NA 1P01A 4YT6H 4THNH 3QN7A 2P95A 4CRGA 2P94A 1G2MA 3SNEA 3BTKE 1H8DH 4XD7D 3GISB 5EIYA 1SGTA 3PV2A 2BY8X 2FYRA 1V2NT 2AS9A 3GOVB 1C2JA 4ZHAA 1YWUA 3TJNA 1SQTA 4FUEA 1SVPA 3O8BA 1O39A 2A0QB 2AIQA 1FY4A 2ESTE 1TBZH 2KFWA 3E8LA 2B7DH 3WY8A 2EI8A 2VB0A 1YY3A 3KL6A 1HXEH 1TMUH 3RLWH 1BTWA 2ZFRH 1LQEA 1XUIA 2PGBB 1YLDA 2ZQ1A 1GGDB 1FY8E 4YM9A 1TRMA 1NRNH 2THFB 3MNCA 4WF8A 2YNBA 4WXVA 3ITIA 1FY3A 1E38B 4K8YA 1GMHG 3UPEA 1UMAH 1TRNA 2IPHA 4ZKRU 3VFEA 1DM4B 4P02A 2KCYA 1TGTA 3DT0H 2PWXA 2J38A 1OWIA 2AGIX 4M7GA 1TALA 1UTLM 2ODQA 2AGEX 3QX5H 4UFDH 2V3OH 4FUFA 4CRCA 5IDKA 2SFAA 3P92A 4Y7BA 2AGGX 3UQOA 1BTYA 1MTWA 1RFNA 1FMGA 1K9OE 2ZFQH 2QC2A 2QF0A 1JOUB 2J34A 2G8TA 5CHAB 4UONA 1GI1A 1C5XB 3OEED 4XBCA 2QV1A 1PPBH 1O2LA 2F3CE 2ZDKA 1YPKH 2BLQA 3BEFB 5L2YH 3UQVA 4D8NA 2OTVA 4O3TA 4CRAA 3O8CA 3FVFB 3TK9A 1TGNA 1OP2A 3GCNA 1HAZB 3SBKA 1AIXH 1BMMH 3UB0A 1MTUA 1C5SA 4Z1MD 4A92A 2G00A 3MHWU 1EAUA 1ZMLA 1ESBA 1AUJA 4ASUD 3QLPH 1HLTH 2ZP0H 5JBCS 1C1TA 2ZU1A 1QBVH 1FZZA 1NFYA 1J8AA 1SGEE 2CF9H 2QGRA 4RT1A 2VWLA 2BZAA 1C4V2 1S82A 4B2AA 3RXPA 1F5RA 2FS9A 4AZ2B 2QXHA 3PRBA 3PYHA 2OLGA 5DGJA 1MZDA 5ESTE 1O34A 1G32B 2GP9B 1CT0E 4HI3A 2ZTXA 1A5GH 5HM2A 4NSYA 1SGNE 1WTHD 2FTLE 5A8ZA 3ZYDA 1ZR0A 3ATLA 1BMAA 3ZVGA 1HIAB 4NIWA 3MH5A 1OWDA 4FU9A 1CGJE 1H1BA 2BXTH 4Y8YA 1U6QA 1YCPH 2FLRH 2ZFTA 1AN1E 1GHWH 4JZFH 3RDZA 2WPMS 4O3UA 3RXTA 2WYJA 4NZQA 3RXVA 3NZIA 1EFRD 1AY6H 1H9IE 3BG4C 3FFGA 3WWBA 2WPDD 5FCRA 3EYDA 5GJ4B 3N7OA 3V13A 3CNRA 4WXIA 2BD9A 2QAAA 1E1RD 1HAOH 1L4ZA 1SPJA 3BIVH 4ACBA 3E6PH 1IAUA 1CA0B 5EJ1A 1F5LA 1XUGA 4RKOB 4DVAU 5JBAS 3A83A 2VIVA 3F3BA 4IBLH 3QZRA 1E0FD 1P0SH 3L3TA 1C5QA 3S9CA 1HJ9A 3ZVDA 2ZG0H 5IK2D 2JIZD 4NIXA 4AGJA 1O5EH 4MNXA 1BBRE 1THSH 3P70B 1S6FA 4I8HA 2W26A 3LGUA 5DG6A 4WJG2 1V2JT 3ZVEA 1LHFH 1QB6A 4RT0A 1XMNB 4JZ1A 4K60A 1W3CA 5C0UA 1MBQA 4NSVA 1QNJA 1P2QA 2R9PA 2ZGHA 2D8WA 4WWYA 1GJDB 2A31A 1MAYA 2JJ2D 1HYLA 1C2DA 1O5CB 1P3CA 3RXDA 1AVGH 1DANH 3U1JB 3RMMH 2A2QH 4LXBH 1YP9A 3MH6A 1GPZA 2A7JA 1ZTJA 2XTTB 4BNRA 1AFEH 3AK5A 1SQRA 1SGYE 2R2MB 1AWHB 1OXGA 3BG8A 2O8LA 3K9XB 5FX5A 1NO9H 1QRWA 1OSSA 1MTSA 2ZHEH 1EZSC 1ELGA 1O2KA 2HWLB 1PYTC 2VVVA 3UNQA 4I8GA 1TX7A 3PMBB 2XC0A 3M37A 1DXWA 1YPGH 1C2FA 4FETA 6GCHF 2FOMB 2W6JD 4H4FA 4YT7H 3I78A 2Z3CA 1SGIB 1GJ4H 1TA6A 2VWOA 3M3VA 1SHYA 2QY0B 3GY3A 1MQ6A 4GPGA 5A2MH 1WCZA 5T6DA 4I86A 1QURH 3UWJH 1UK2A 1ELCA 3P95A 7GCHF 1MTVA 1THPB 5J4QA 4CREA 1FY5A 2ZCHP 4B75A 1C4U2 1FAKH 3A88A 4MG3A 1AVXA 1O36A 1SQAA 1T7CA 4Y8XA 3QWCH 2WPHS 1UTQA 3A7WA 1FJSA 2RDEA 5C5NA 1BRAA 1UHBB 2Y80A 3F2HA 5JB8S 9LPRA 2Y7XA 3MYWA 3MNBA 4NGAH 1FXYA 2V0BA 9ESTA 2BD2A 3TIUA 1HGTH 1C5UA 3KYFA 3RC4A 2C93B 1VCPA 8GCHF 2XBYA 2VVCA 3U28C 1W7XH 3ZVBA 2W7UA 5KGOA 4AFZA 4U32A 2GCHF 3BEUA 1UTMA 2QYIA 1S5SA 1AGJA 1OP8A 1YF4A 4FUDA 1O31A 2XRCA 2PHBA 1P9UA 4NFFA 2ANWA 1KYNA 5JBBS 1K1MA 3Q00A 2IOTA 2H9TH 1JRTA 4OS6A 3ZZAA 1DT2A 3U69H 1SG8B 1DICA 1SR5C 4AC9A 4U2WA 1GJ7B 1EUFA 1P12E 2J94A 3NXPA 2HVYB 3RXLA 4Z0KA 1C5TA 3MH4A 1BCUH 1UCYE 1RD3B 5FHTA 2BX3A 1NTPA 2SGQE 4BAOB 1FONA 1WU1A 3DA9B 1WOFA 1J15A 4TWYA 3STJA 3TITA 1WBGB 1Y3YA 3N99A 3MNXA 2FOHA 1IQLA 3TGJE 5L2ZH 2BDHA 1F5KU 4J1YA 1O2ZA 1PJPA 2QIQA 3OTJE 3RUOA 1CGIE 1HUTH 1MMJN 1Z71A 3BG4B 3KYGA 4WMDA 3SV6A 2BOKA 3SNAA 4NFEA 1UVSH 3SQEE 2CN0H 1QFKH 2K1QA 3KQEA 2QCYA 3GDSA 2FDAA 4SGAE 3URCA 4TY7A 1V6DA 1EJNA 2P8OC 4AG1A 1CO7E 1CQQA 1NM6A 4ZCNA 6GCHG 3BSQA 1ANCA 2GVFA 4KTUA 3QTOH 2VH6A 2A5IA 2GTBA 3UY9A 1HAVA 1NBME 1DPOA 2STAE 2YOLA 1CT2E 2WHXA 1QQUA 3S9AA 5C0TA 4ISLA 2GKVE 4DIIH 1SLXB 1QA0A 1GVKB 3Q3YA 1TNKA 5DO4H 1MKWH 2BB4A 1IQHA 3SV9A 2PFEA 7ESTE 2VWNA 2ZGBH 3TJUA 3P8NA 4KP0A 2AEIH 5DP4A 3RMLH 4E7RG 3S7HB 4TPIZ 1AU8A 1IQEA 4GHTA 1DS2E 2CK3D 1V2PT 1ZHRA 3Q3XA 2BX4A 2R3YA 1G37A 3TU7H 3BV9B 2HGTH 2KAIA 4AORA 2Q1JA 2CGAA 2HNTF 3QK1A 3SJOA 1GMDF 4TSFD 4GSOA 1D4PB 3W95A 1GHBF 1V2LT 3M5MA 1HAGE 2FI5E 1EASA 2FX4A 5SGAE 4NA9H 2ZFPH 4Y71A 1HAIH 1TQ7B 2GCHG 4CBNA 2CV3A 2GCTC 1BJUA 3RC5A 5E2PA 2UWOA 1S84A 2K0QA 3PWBA 1GMCF 2CXVA 1SFIA 1TGCA 3LIWA 1AD8H 1YLCA 4NA8A 1EJMA 3P8FA 4X2WA 4J2YB 1HPGA 5E2OA 2ZHDA 2VH0A 1MAXA 1RTLA 3KNXA 5EW2H 5EPYA 1KXBA 1K0HA 4H6TA 1QZ8A 1D6RA 1V2TT 4FVDA 1C4Y2 4AFUA 2BY5X 4Y10E 3SGBE 3VXEH 2AHME 1A3EH 3SHCH 3I29A 5ABWA 2ZWLH 5C3NA 1NT1A 3KQCA 3IITA 1QRZA 2SGEE 4F4OC 2XXLA 2PLXA 1N6XA 3SZEA 1C5MD 2LP6A 3RMOH 4ABDA 1C1OA 2JH6D 3F0PA 2GMTC 2ZU4A 3H5CB 5DP5A 1GBAA 1MKXH 4MPVA 4SGBE 1PPHE 2XCFA 3KHVA 2BTCE 2P16A 3TH4H 3UIRA 5E0HA 5EXNA 1Q31A 1W14U 4AX9H 1UVTH 1EPTA 2FMJA 2WUBA 4AYYB 2V35A 2IJOB 3TH3H 3ZZBA 1BTHH 1BIOA 1AKSB 4ISNA 4X1QU 5GIBA 2YMSC 3LGYA 2GGVB 3BEIB 1OS8A 2F4LA 3SV2H 5HXFA 2O8WA 3U8RH 1O3LA 1X7AC 1DVAH 4E05H 1C5PA 1Q2WA 1YPJH 3LGVA 5AFYH 1AZZA 1J14A 2WZQA 2I6QA 5FPYA 4YLUA 2FOGA 5FBEA 4F48B 3ZV9A 1EXFA 1G30B 2Q6FA 4HGCA 2P3UB 1W13U 1LDTT 2KZ4A 1ZGIA 2ZNKH 5F03A 1MU6B 3LH3A 4OM9A 1O2WA 1Y8TA 1INCA 1YGCH 4X1PU 2BD8A 1TOMH 2PUQH 1O3EA 4X6OA 3WWFA 3LOXA 3HGNA 1GHBG 2D2DA 3FP6E 4CRDA 4ZXXH 2AH4X 2GV7A 1S0RA 1GBKA 1A5IA 2F43B 1LHEH 2OD3B 1OX1A 1VITG 1O3IA 4FUHA 3A80A 1F92A 5GCHG 3M3SA 1UK4A 2BVSH 1SGQE 4RI0A 4QT8C 2BD7A 1O2PA 1LVBA 4X6MA 1D6WA 2J98B 3R0FA 4KGAA 2P8OB 3P8OA 1O3BA 1O32A 1TNHA 5C17A 1ZPCA 3PM3A 2Z3DA 2ZTYA 5A0BA 5HMAA 1RJXB 1GBCA 2BLVA 3GY4A 5BPEA 1B0FA 2W7SA 4K1TA 4AB8A 5KECA 1QJ6B 4XSKU 3S7KB 1WDIA 5EXLA 4YOIA 2I6SA 2P93A 2ZDMA 1PPFE 3STIA 1AI8H 2GD4B 3K6ZA 2ZFSA 1LPZB 3U98H 1GHAF 4IN2A 4LZ1H 3VGCC 3KQDA 3EE0B 1K1OA 2ZA5A 1ELDE 5DKMA 4FUBA 1TBRH 1RTFB 1NU7B 1BTUA 2YNAA 4FVBA 5I25A 2EI7A 5EJZA 4D76A 2EC9H 4BAMB 3MO3A 4A6LA 4IS5A 2NU0E 4CHAC 4XBDA 2XWBI 4D9QA 5F8XA 4ESTE 1LVOA 2P3TB 3UTUH 3RXOA 1S85A 4JCNA 1FV9A 1S6HA 1O2HA 2F83A 3P6ZB 1NFUA 1ZJDA 3QZQA 1C1VH 2GCTB 1V2QT 5JDUB 1AHTH 1EKBB 1C1MA 1K1IA 3SNCA 1ESTA 2QF5A 1LKAA 2RA3A 2O8TA 2OC1A 2G55A 3PB1E 1YPHC 3PO1C 3LC3A 3IWMA 2HNTE 3TNTA 1HDTH 4DIHH 1ZTKA 1BTPA 1XM1A 1CGHA 1ELBA 3HKIB 1NY22 3SYJA 1O0DH 2JH5D 1TMTH 2ZU5A 1FUJA 5E8EH 3SQHE 1B0EA 2G5VA 1F7ZA 3DSOA 1AUTC 3LPRA 4VGCC 3KQBA 1RIWC 2ALVA 3A8CA 3F1SB 3T62A 1NC6A 2Z94A 4A7IB 4IGDA 1EPTC 1QL9A 3PTNA 2HPPH 2BDBA 1E37B 3PROA 4D7FA 3ZZDA 2L74A 3UOUA 3WW7A 5C1UA 5HM9A 3Q77A 1O3KA 2FESH 1TNGA 1Z8JB 1GJ6A 2KCOA 2VIQA 4OS2A 4X1SU 1GI5A 4A1XA 3R3GB 1AB9B 5F53A 5E0JA 1O3CA 4A1TA 1BB0B 2ZU2A 4MNWA 4ISHH 1K1PA 1TNJA 2YMSB 4NCYA 3F2FA 2B9LA 4IC6A 1SQOA 3AASA 3OE7D 1F0UA 2Z9GA 2UUFB 1B7XB 3FZZA 5A09A 2PGQB 4I32A 1EX3A 1YKTA 1O2NA 4ISOA 3RXCA 1C5NH 2BDIA 4KKDA 4RKJB 1HJAC 2LPRA 1TPPA 5FXLA 2ZDAH 3NRLA 1MD8A 2GZ8A 4Q80A 3M36A 4GLYA 2XBWA 1THRH 5G4BA 1RGQA 3N7EA 2M2AA 1WQVH 3HPTB 1O5GH 1GBTA 1H8ED 2ZGJA 3SORA 2G4UA 1ELTA 2ZQ2A 2AIPA 1BQYA 1YPLH 2GDEH 2RCEA 4CH8B 4HG6A 3A8AA 1GJ9B 3SU6A 4INHA 4NA7A 5L6NH 1P57B 1BHXB 3SOSA 1Z1JA 3AVZA 3DSPA 3E3TA 1FNIA 4YZUA 1HAHH 2VIPA 2V6NA 1CHGA 1P09A 2PSYA 1O3DA 1PQAA 4JK5A 2HLDD 2BDGA 2A4QA 3GCOA 1HAVB 1UVUH 3E0PB 2AMDA 1TPOA 2JETC 1SMFE 2QXIA 1YYY1 4D7GA 1TOCB 3GCHC 1GL0E 4B6FA 1GBFA 5CMXH 4OS7A 2AMPA 1P03A 1MCVA 3RXEA 1ZTLA 4X2YA 4X8UH 1O3HA 1Y5AT 2BY6X 3RXSA 3VB4A 3AAVA 3UREA 1VCWA 1GBBA 2ZDVH 1A4WH 1FQ3A 3BTGE 1E79D 3VGCB 2FPZA 1S81A 2OXSA 4WY3A 4HFPB 1GJCB 1C2HA 3HKJB 4IN1A 3SUDA 3UNRA 4OS4A 5LPFA 1P2MA 1TPSA 2Z9IA 1IQFA 1ESAA 2SNWA 1BBRK 1MCTA 4XFQA 3UFAA 5DP9A 2OCVB 1W2KH 1PPEE 1DSUA 1GCDA 2RFKC 5AVDA 3MWIU 2PUXB 2B8OH 1GDQA 3S0NA 2B5TB 1DSTA 1VJAU 1AO5A 5DPAA 4NIYA 3DFLA 3M7TA 1NBMD 2WSSD 3H7TA 1O30A 1K21H 4P00A 1T4UH 4INKA 3D65E 3SJIA 1CHOF 1OYTH 1MBMA 3L33A 1FLEE 1HAXB 4Q2KA 1ABJH 1BT7A 1OWHA 1GBEA 3PO1B 1MH0A 3LJJA 3RLYH 1BJVA 5TJXA 1BUIA 2XBVA 1W7GH 1P2OA 1EZXC 3QO6A 4CRBA 3MU0A 1CA8B 1O3AA 1BRBE 2BHGA 4MLFB 4TYDA 3PLBA 2WPKS 6ESTA 1QY6A 2DE9A 1NESE 2HPQH 4AFQA 1GI3A 3RU4D 1YC0A 5JYIA 4VGCB 2VIWA 1T4VH 5FPTA 5C1YA 1O38A 1RIWB 5BRRE 2CJIA 4XDEA 2AMQA 3GDVA 1BHXF 2SGDE 1H8HD 3T28A 1XUKA 1QJ1B 2J95A 3A7ZA 1S0QA 4LZ4B 2BVRH 1GWAA 1RS0A 1KXAA 2O9QA 2ZPQA 4Q7XA 1SOZA 2ANMH 3RM2H 2LELA 4ABBA 3FAOA 3BTWE 2GZ9A 5JB9S 1SOTA 1V2KT 4MDSA 2D1JA 2TIOA 1V2RT 3QGNB 2JKHA 5C67A 1Z1IA 2ZZUH 4NG9H 4IC5A 3PMHB 1ANEA 1XXDA 1P05A 3ZVAA 3ZYEA 3ATMA 3HK6B 1C5VA 3U8OH 1D9IA 2P3FH 1NFXA 4LOYH 1G3EA 1YCPK 3DUXH 3UR6A 2JH0D 4Q4LA 1DLEA 5C20A 2C8YB 5TCCA 2PV9B 2AERH 3KQ5A 4X1RU 4NWKA 3PTBA 5EODA 1V3XA 4XOJA 3EAJA 1O2MA 5EG4A 1FN8A 2SNVA 1GI2A 1FPHH 2FZZA 1DUAA 1GL1A 3ATWA 2PW8H 2H2ZA 2PKAA 2VGCC 5F8TA 3C27B 5FCKA 1ZRKA 3DHKH 4Q63A 5A8YA 1HB0B 4K69A 2VWMA 4BTTB 1LPGB 5EJLA 4AOQA 2C8WB 6LPRA 4MQAA 1P3EA 1EP5A 2A2XH 1V2UT 1ZYOA 1UVPA 3NKKA 1D3PB 2J5UA 3U8TH 2IN2A 3LU9B 4JZIA 2QXGA 1DY8A 4H6SB 4Y0YE 1UCYK 4YOGA 2TBSA 2H9HA 8KME2 1BMLA 3A89A 2FWWA 1ORFA 1P2JA 1P04A 2EA3A 2A5AA 1W0KD 4BOHA 1TIOA 2NU4E 1TONA 2JETB 4U30A 4ZUHA 3MFJA 4X2VA 1CHOG 1FAXA 3TK6A 1O2JA 1IQKA 3BTEE 3GCHB 1Q3XA 4K5ZA 1PFXC 3BTTE 3SI4H 5JPMH 1JXPA 3F9GA 3UAIC 1G2LA 2WV5A 1T8OA 1XUFA 5T1VA 3ZZ6A 1LHDH 3M3TA 1P10A 2OINA 4ASHA 3T26A 1QTFA 1OHHD 1O2IA 3VB6A 1JBUH 5B6LA 1BITA 2TGTA 5EPNA 3BN9A 3OX7U 1TNIA 1MU8B 1H9LB 3SU3A 5EU8A 7GCHG 4X6PA 1TB6H 2J9NA 3DFJA 1F2SE 1TRYA 1BMNH 3BF6H 2ZIQH 2ZO3H 3JZ2B 4FUIA 1GBDA 3VXFH 2BY9X 3GDUA 1O5FH 3SJ9A 4BXWA 3PMAB 2BD5A 3SW2B 1L1NA 4B2CA 1ZPZA 2ZCKP 4ABGA 4DCDA 4FU8A 5C1XA 2ZI2H 1Y3UA 3RU4E 1EZUC 1H9HE 2G52A 3OSYA 2GV6A 1MABB 2RG3A 2H5DA 2WPIS 3UNSA 1H8IH 1J16A 7KMEH 3D23A 5DN6D 8GCHG 4GCHF 3MU5A 4Y7AA 2XNDD 1CVWH 2Y82A 1UJ1A 5EOKA 1GHVH 1SL3A 2ZHQH 1GBLA 3ZV8A 4BTUB 1GI7B 1A5HA 1L1GA 5DK1A 1PPZA 1TE0A 2OQUA 4XRNA 3SV7A 5DSFA 8LPRA 2F9NA 1QL7A 1G9IE 3FN8A 5DP6A 1TX6A 4AG2A 1VR1H 1C5YB 3MTYA 3AAUA 1QBOA 1ETSH 2Y5HA 2A7CA 4B6EA 1P02A 2QXJA 1VJ9U 5HIZA 2A45B 1SGDE 4I31A 4AN7A 4MNYA 2ALPA 4GAWA 4BAKB 2FOEA 1SBWA 1UW7A 4DY7B 1IQGA 1EOLA 5A0CA 4UD9H 5GPIB 1RXPA 3TGIE 1SGFG 2EY4C 2H1UA 2ZKSA 1QA7A 5LGOA 5EQQA 1TGBA 2ZECA 1WYKA 1V2MT 2R2WU 1DUEA 1KY9A 1ZZZA 1C2LA 3OY6U 1DY9A 1OPHB 1SLVB 5EQRA 2KX4A 2QA9E 2Z9KA 3F9EA 4ZAEA 3W94A 4D9RA 5FBIA 3SI3H 5A0AE 1SB1H 1QIXB 4ABAA 1OWKA 1DX5M 1HV7A 2AYWA 1IQMA 2ZU3A 1F0RA 2FOBA 1ZHPA 3SNBA 3VB5A 1VGCC 2GT7A 4ABFA 2A7HA 2M5TA 1ARBA 1K1JA 4UFFH 1XUJA 1D3DB 1W10U 3OY5U 1Y3XA 4B74A 1AE5A 1NRQH 1Y5BT 1YCPM 2G81E 2FI4E 4CRFA 5EW1H 1DDJA 2W6ID 1DWEH 3RXUA 2FM2A 3GY2A 1LVYA 4CBOA 4ABIA 1O2RA 5HKKD 1SLUB 1OYQA 1SGPE 2VIOA 3RXBA 1SHHB 2VGCB 1C1WH 1TQ0B 2PTNA 3RXIA 2GDDA 3ZZ3A 2OQ5A 1Z8IB 2V3HH 4FUCA 4AB9A 3A7VA 2Q6GA 1FPCH 4FU7A 1GVZA 1LHCH 4I8LA 3QGJA 3LH1A 1UK3A 4YTAA 1S83A 1DFPA 2BQWB 4PROA 2BLWA 1GMDG 3H7OA 1ABIH 1Y59T 2ZDNA 1XVMA 1K22H 1VKYA 1XVOA 4GCHG 2UUYA 3SZNA 3ZVFA 1MKWK 2ASUB 3ZIAD 2KM0A 1BRUP 2ZEBA 3LC5A 4TPYA 3RXHA 2WPJS 3M5NA 1UTNA 1BZXE 1J9CH 3Q76A 1CU1A 1TABE 2FXRA 3OAAD 3M5OA 4NWLA 5EQSA 1AZ8A 1GMCG 2CHAC 1AFQC 1GI9B 1C9TA 3SJ8A 1QQ4A 1NS3A 1XKAC 2DE8A 5H4IB 1O2OA 4JMYA 5GNDA 1DWDH 3QUMP 4K3JA 3TVJB 4E7NA 4X8SH 1C5OH 1MTNC 2VU8E 3LKWA 4HZHA 1O3GA 1IHSH 4UE7H 2UWLA 1EZQA 4K2YA 5DP8A 1O37A 1O33A 2A4GA 2FP7B 3P17H 3D49H 1YM0A 1QHRB 2A4RA 1HBTH 2BQ7B 2G5NA 2BD4A 5F6MA 5LPRA 3U1IB 1T8NA 2XNIA 2FYQA 4DT7B 2KCAA 1K1LA 1W0ZU 3QDZB 1AVWA 1ETRH 4DURA 2R0LA 1BMFD 4X1NU 1Y3VA 2ZTZA 1ELEE 1GHYH 1UTPA 2WUCA 4WH8A 5C94A 1GG6C 1SLWB 1NRSH 5E0GA 1Y3WA 3MU1A 4YESB 1NRRH 2TGPZ 2WYGA 1QBNA 2PP6A 3ENSB 3LONA 1EOJA 2ZCLP 3GYLB 1A61H 4ZROA 1OWJA 1C5LH 1Z7KA 5AF9H 3SUGA 4BAHB 5AFZH 2XC5A 1ZSKA 4FUJA 3LJOA 2PSXA 2HVXA 1PYTD 3BTME 1EB2A 5DP7A 4BANB 3PMJA 1TMBH 2GZ7A 4MPXA 1NN6A 2BVXH 2FOAA 1MKXK 1O2TA 4B73A 1VCQA 4RSPA 3CS7A 1C2IA 3NWUA 2FX6A 3KN2A 2G4TA 1HJ8A 1C5RA 1O5AB 1YPEH 2BD3A 3Q3KA 4FUGA 4MNVA 3F68H 4ACAA 4CH2B 5C2ZA 1KTTB 4X8TH 3A87A 2NU3E 3PLPA 2XOKD 1FX0B 3V12A 1ID5H 5TCAA 2QF4A 2A5KA 1EAXA 3BTDE 1BBRH 1D3QB 3CP7A 4UDWH 2BMGB 4ABHA 4BTIB 3GY5A 1UVOA 2GMTB 3ZZ5A 2CMYA 1O2UA 1TA2A 2SGAA 3K2UA 1QJ7B 3PV5A 4GUXA 3H09A 5T3HA 1N1LA 5HIYA 3HGPA 1GJAB 3SV8A 2V7QD 2J2UA 1GBMA 1GBHA 2WV4A 3BIUH 3RM0H 2UWPA 1XUHA 1IQNA 1ZOMA 2W3IA 2G51A 3T5FH 3ZZ4A 2GX4A 1GI6A 1NZQH 1UO6A 3RXMA 1VGCB 3OEHD 4FOUC 1OOKB 1MQ5A 4F55A 1BA8B 1S6LA 1SGRE 3C1KA 5J4SA 1GJ8B 3RXJA 2BY7X 4XE4A 1JIRA 2PKAB 3SGQE 2P59A 1EAIA 3F9HA 5DJ7A 4B1TA 1DE7H 1O2XA 4B71A 1TBQH 1E1QD 2HNTC 4JZDH 4ABEA 1GHAG 1LVMA 1W11U 2C3SA 4IMZA 2UUJB 1C2MA 3M7QA 1DXPA 1FDPA 1KMHB 3FZDA 1O3OA 1TFXA 1WV7H 2H6MA 8ESTE 3VB7A 2XBXA 4FXGH 4ZHMU 5EGMA 1ELFA 3MNSA 4M9FA 3GS9A 5EXMA 2CF8H 2OUAA 4O9VA 3SU0A 4Z6AH 1SFQB 5LPEA 2V3MA 1AKSA 3B8JA 1A46H 2BM2A 3TPIZ 2GT8A 1K2I1 4DT4A 3T2NA 1BDAA 4A5TS 1D3TB 2C90B 4WMEA 4NZLA 3AW0A 3AW1A 2O8UA 1XX9A 4IW4E 3GY7A 4KTSA 1O2SA 1RTKA 4WVPE 3V3MA 1TYNA 1HFDA 1O5DH 1HXFH 3EQ0H 2CHAB 1AFQB 1FN6A 3DCLA 1TWXB 4OGXA 1CE5A 3SU1A 1TLDA 2NU1E 1NPMA 3TJVA 3A8BA 4ZHLU 2J92A 1MTNB 3G01A 1FI8A 2H5CA 3I77A 4K1EA 4Q7YA 1QL8A 1TNLA 1PPGE 1A0LA 1W0YH 1ZRBA 1TPAE 2VIDA 4MPWA 1ZPBA 3T27A 1O35A 1SKYE 1T32A 3TNSA 1KDQA 2KAIB 4X6NA 1O2GH 4JYTA 2HRVA 4DOQA 5CDFE 4ZKOU 1DITH 2BOHB 1LCYA 2OC7A 3RMNH 1MUEB 2HALA 1PPCE 1L2EA 3W1EA 3SGAE 2BDCA 1MD7A 1GBJA 4ZKNU 1C1SA 2J98A 4I8JA 3V7TA 2ULLA 4B2BA 5ETXA 1Z8GA 1SSXA 4CHAB 1GCTC 3E16B 4F49A 1GG6B 1UCYH 3BTFE 1AWFH 2LNCA 3K6YA 3BTQE 3RXAA 1KXDA 1O2YA 3RXKA 3LDXH 3TLOA 3OFND 4AFSA 1P06A 2ZPRA 2ZF0H 1T31A 3UR9A 3E90B 1G3CA 3A7XA 2ZHFH 3RP2A 3FKSD 1KLJH 3KGPA 1BOQA 4WMFA 1E35B 3M61U 4UFGH 2WINI 3FO8D 3SO3A 1QCPA 4UEHH 1AQ7A 4R8TB 4YLQH 4Y11E 3F2GA 1GJBB 2OBOA 1MZAA 4TY6A 1BRCE 1KLTA 1YLNA 1UTJA 5HGGA 4DG4A 1N8OC 6CHAC 4MVNA 2PTCE 2FODA 3EA9A 1ELVA 2TGDA 3A7YA 3A82A 1FY1A 1L0ZA 2ZFFH 4A1VA 1SC8U 5HYOA 1VZQH 2B0FA 2J4IA 2ZHWH 2VVUA 2BYAX 4DGJA 2ODYB 3F6UH 3L6PA 4AGKA 2QE7D 2RDLA 4XBBA 2D26C 3EGKH 1GVLA 1M9UA 5ESBA 3B23B 4DW2U 4R0IA 1GHZA 2F9PA 4LK4A 1EPTB 2PR3A 3FP8E 3K65B 7LPRA 4Y8ZA 1YBWA 4JYVH 3O8DA 2PKSC 4U01A 1DWCH 2SGFE 1QRXA 1C2GA 2NWNA 3HATH 4JYUH 3TGKE 4I7YH 4BXSA 2HOBA 4WH6A
chains in the Genus database with same CATH topology
3EA7A 1Z8RA 2NU2E 2DUCA 2OP9A 4MTBA 3LGIA 2EEKA 5GDSH 2Z6BD 1IOEA 5T6GA 1QR3E 2SGPE 2OC0A 3O8RA 1XKBC 1P2NA 3LT3A 4OS5A 1EAWA 3MI4A 1ETTH 3SUEA 2FS8A 3ATIA 4BAQB 1O2QA 2BZ6H 4HTCH 3ODDA 3A85A 1J17T 5FX6A 1HJAB 1P2KA 3A7TA 3E91A 1C1PA 4X0WU 3LGWA 1CBWC 5T6FA 3VB3A 1O2VA 2ZGCA 3KF2A 2AFQB 3ZZ8A 5A8XA 3KCGH 1ZLRA 1FIZA 3ZZ9A 1A3BH 3NCLA 3TH2H 4I33A 4RN6A 1KIGH 4ZXYH 2BDYA 1CSOE 2ANYA 3U9AH 2FO9A 1ZGVA 1ELAA 5B6OA 1H4WA 1HAYB 1KSNA 4KTCA 1PQ8A 3MU4A 4YOJA 3GCTF 2ZGXH 1JIMA 2H9EH 1WTGH 1A0JA 5FPSA 5F8ZA 1C1RA 2WPLS 1O3FA 1B5GH 2ZPSA 3VPKA 4O03A 3ATKA 1BTXA 3RXFA 1KLIH 3MOCA 4TWWA 2R3UA 5PTPA 1P8VC 1PQ7A 3RC6A 2F9OA 3NPSA 3UWIA 2C4FH 3URDA 2F91A 3A81A 1HIAA 1GDUA 1ACBE 1L1JA 2OBQA 3A8DA 2TPIZ 1W12U 1GBIA 1E36B 1N6YA 1A2CH 4I8KA 2TRMA 2ANKH 1WAYB 1ZSJA 2W3KA 1C2KA 1GI0A 3TJOA 1TAWA 2F9UA 4Y76A 3PLKA 3LGTA 4IMQA 1A0HB 2Y5GA 1GCTB 5JBTA 1V2WT 1O3JA 1PQ5A 1OKXA 4GHQA 1NFWA 1Z6JH 3SU2A 1O3MA 1P9SA 3UOPA 2C8ZB 4OS1A 1HNEE 1L4DA 1ZHMA 1HRTH 4Y79A 2FIRH 1G3DA 4CR9A 4X2XA 1ZSLA 3A84A 3ESTA 3ELAH 3M35A 1GJ5H 1C5ZB 5I46H 1K28D 4H42U 2BDAA 1V2VT 3CS0A 1LTOA 4B76A 3PV4A 3SNDA 2FOFA 2FI3E 1LMWB 1JMOH 3OU0A 4CR5A 3FANA 1KXCA 1F0SA 3JZ1B 1IHTH 1ZJKA 3MO6A 3DD2H 3P8GA 2XWAA 2XW9A 1KXFA 1WQSA 4ZMAH 1HAPH 1N8OB 2STBE 3D62A 3UUZA 1VITF 1QB1A 2UUKB 2Z7FE 5CE1A 6CHAB 5GCHF 2HLCA 3RU4T 2VJ1A 3FP7E 1AMHA 4KELA 4X8VH 1GGDC 2Z9LA 1LPKB 2Y81A 1EJAA 1SGFA 1EATA 2ILNA 2W5EA 4E06H 1GI4A 1DWBH 1RRKA 3MH7A 4GVUA 4NIVA 4O97A 3SHAH 4AYVB 1A1RA 1T8MA 1LQDB 4K1SA 2QN5T 5AHGH 1EB1H 1ANDA 2PKSB 2R0KA 1E34B 5K0HA 1QB9A 1BTZA 2A1DB 3MO9A 1HCGA 1V2OT 3T25A 3GCTG 1IQJA 3T29A 2RA0A 4Y0ZE 3MMGA 3S69A 2FTMA 5CHAC 3ODFA 1Y5UT 1K1NA 1A7SA 5L30H 2BQ6B 1O5BB 5GWZA 1UTOA 1SI5H 3SU4A 3PWCA 3SU5A 1C1QA 4K8BA 1C2EA 2C8XB 4JZEH 1T8LA 3ZZCA 2Z9JA 3EDXB 3NK8A 1WUNH 1C9PA 2XYAA 4ABJA 3OYPA 1UHBA 3GICB 3NUMA 2ZC9H 1KXEA 3TK5A 2F9VA 1CBWB 1ZMJA 4Q7ZA 4ISIH 1JRSA 2FLBH 3RXRA 1AB9C 1C5WB 1AE8H 3GY6A 2ZDLA 3ZZ7A 4DJZB 5DP3A 5C5OA 5K7RA 1GMHF 1NROH 1QGFA 2QF3A 2TGAA 4UFEH 2VNTA 5IYTA 1LHGH 4INLA 5LH8A 1VITH 1OP0A 2BXUH 3CENA 4ZKSU 3GYMA 1G3BA 2ODPA 1O3PB 1SGCA 4YO9A 1FIWA 3V0XA 3RXGA 1KTSB 1V2ST 1DOJA 2OC8A 2Y7ZA 1TGSZ 3HK3B 1GHXH 1IQIA 2FEQH 2VINA 1ZMNA 1LKBA 1O3NA 3SN8A 1EP6A 3SJKA 3F9FA 1WSSH 1NU9A 2XC4A 1NRPH 5FAHA 1UTKA 1G36A 1F0TA 1KDQB 2FOCA 4OGYA 3KIDU 1GI8B 3A86A 2EI6A 2Q6DA 1CT4E 2A32A 3S9BA 1JWTA 1P2IA 2Z3EA 3RXQA 4JK6A 1YPMH 3SUFA 3BTHE 3E1XB 3M7UA 4MPUA 2O8MA 1DLKB 1YPHE 2A4OA 3GY8A 1Z6EA 1CA0C 1GDNA 3IG6B 3KEEA 3MU8A 1ARCA 1W8BH 3QTVH 1P11E 3ZVCA 3EA8A 1XXFA 2Y5FA 3B9FH 3E0NB 3VEQB 1EQ9A 2Y6TA 4Y6DA 5GXPA 1C1UH 1OWEA 1TX8A 4ZH8A 3M5LA 2BLOA 2F9BH 2XCNA 1ANBA 1LO6A 1C1NA 1P01A 4YT6H 4THNH 3QN7A 2P95A 4CRGA 2P94A 1G2MA 3SNEA 3BTKE 1H8DH 3GISB 1SGTA 2BY8X 2FYRA 1V2NT 2AS9A 3GOVB 1C2JA 4ZHAA 3TJNA 1SQTA 4FUEA 1SVPA 3O8BA 1O39A 2A0QB 2AIQA 1FY4A 2ESTE 1TBZH 3E8LA 2B7DH 3WY8A 2EI8A 2VB0A 3KL6A 1HXEH 1TMUH 3RLWH 1BTWA 2ZFRH 1LQEA 1XUIA 2PGBB 1YLDA 2ZQ1A 1GGDB 1FY8E 4YM9A 1TRMA 1NRNH 2THFB 3MNCA 4WF8A 2YNBA 4WXVA 3ITIA 1FY3A 1E38B 4K8YA 1GMHG 3UPEA 1UMAH 1TRNA 2IPHA 4ZKRU 3VFEA 1DM4B 1TGTA 3DT0H 2PWXA 2J38A 1OWIA 2AGIX 4M7GA 1TALA 1UTLM 2ODQA 2AGEX 3QX5H 4UFDH 2V3OH 4FUFA 4CRCA 5IDKA 2SFAA 3P92A 4Y7BA 2AGGX 3UQOA 1BTYA 1MTWA 1RFNA 1FMGA 1K9OE 2ZFQH 2QC2A 2QF0A 1JOUB 2J34A 2G8TA 5CHAB 4UONA 1GI1A 1C5XB 4XBCA 2QV1A 1PPBH 1O2LA 2F3CE 2ZDKA 1YPKH 2BLQA 3BEFB 5L2YH 3UQVA 4D8NA 2OTVA 4O3TA 4CRAA 3O8CA 3FVFB 3TK9A 1TGNA 1OP2A 3GCNA 1HAZB 3SBKA 1AIXH 1BMMH 1MTUA 1C5SA 4A92A 2G00A 3MHWU 1EAUA 1ZMLA 1ESBA 1AUJA 3QLPH 1HLTH 2ZP0H 5JBCS 1C1TA 2ZU1A 1QBVH 1FZZA 1NFYA 1J8AA 1SGEE 2CF9H 2QGRA 2VWLA 2BZAA 1C4V2 1S82A 4B2AA 3RXPA 1F5RA 2FS9A 4AZ2B 2QXHA 3PYHA 2OLGA 5DGJA 1MZDA 5ESTE 1O34A 1G32B 2GP9B 1CT0E 4HI3A 2ZTXA 1A5GH 5HM2A 4NSYA 1SGNE 1WTHD 2FTLE 5A8ZA 3ZYDA 1ZR0A 3ATLA 1BMAA 3ZVGA 1HIAB 4NIWA 3MH5A 1OWDA 4FU9A 1CGJE 1H1BA 2BXTH 4Y8YA 1U6QA 1YCPH 2FLRH 2ZFTA 1AN1E 1GHWH 4JZFH 3RDZA 2WPMS 4O3UA 3RXTA 2WYJA 4NZQA 3RXVA 3NZIA 1H9IE 1AY6H 3BG4C 3FFGA 5FCRA 3EYDA 5GJ4B 3N7OA 3V13A 4WXIA 2BD9A 2QAAA 1HAOH 1L4ZA 1SPJA 3BIVH 3E6PH 1IAUA 1CA0B 1F5LA 1XUGA 4RKOB 4DVAU 5JBAS 3A83A 2VIVA 4IBLH 3QZRA 1E0FD 1P0SH 3L3TA 1C5QA 3S9CA 1HJ9A 3ZVDA 2ZG0H 4NIXA 4AGJA 1O5EH 4MNXA 1BBRE 1THSH 3P70B 1S6FA 4I8HA 2W26A 3LGUA 5DG6A 4WJG2 1V2JT 3ZVEA 1LHFH 1QB6A 1XMNB 4JZ1A 4K60A 1W3CA 1MBQA 4NSVA 1QNJA 1P2QA 2R9PA 2ZGHA 2D8WA 4WWYA 1GJDB 2A31A 1MAYA 1HYLA 1C2DA 1O5CB 1P3CA 3RXDA 1AVGH 1DANH 3U1JB 3RMMH 2A2QH 4LXBH 1YP9A 3MH6A 1GPZA 2A7JA 1ZTJA 2XTTB 4BNRA 1AFEH 1SGYE 2R2MB 1AWHB 1OXGA 3BG8A 2O8LA 3K9XB 5FX5A 1NO9H 1QRWA 1OSSA 1MTSA 2ZHEH 1EZSC 1ELGA 1O2KA 2HWLB 1PYTC 2VVVA 3UNQA 4I8GA 1TX7A 3PMBB 2XC0A 3M37A 1DXWA 1YPGH 1C2FA 6GCHF 2FOMB 4H4FA 4YT7H 3I78A 2Z3CA 1SGIB 1GJ4H 1TA6A 2VWOA 3M3VA 1SHYA 2QY0B 3GY3A 1MQ6A 4GPGA 5A2MH 1WCZA 5T6DA 1QURH 3UWJH 1UK2A 1ELCA 3P95A 7GCHF 1MTVA 1THPB 5J4QA 4CREA 1FY5A 2ZCHP 4B75A 1C4U2 1FAKH 3A88A 4MG3A 1AVXA 1O36A 1SQAA 1T7CA 4Y8XA 3QWCH 2WPHS 1UTQA 3A7WA 1FJSA 5C5NA 1BRAA 1UHBB 2Y80A 5JB8S 9LPRA 2Y7XA 3MYWA 3MNBA 4NGAH 1FXYA 2V0BA 9ESTA 2BD2A 3TIUA 1HGTH 1C5UA 3RC4A 2C93B 1VCPA 8GCHF 2XBYA 2VVCA 1W7XH 3ZVBA 2W7UA 4AFZA 4U32A 2GCHF 3BEUA 1UTMA 2QYIA 1S5SA 1AGJA 1OP8A 1YF4A 4FUDA 1O31A 2XRCA 2PHBA 1P9UA 4NFFA 2ANWA 1KYNA 5JBBS 1K1MA 3Q00A 2IOTA 2H9TH 1JRTA 4OS6A 3ZZAA 1DT2A 3U69H 1SG8B 1DICA 1SR5C 4U2WA 1GJ7B 1EUFA 1P12E 2J94A 3NXPA 3RXLA 4Z0KA 1C5TA 3MH4A 1BCUH 1UCYE 1RD3B 5FHTA 2BX3A 1NTPA 2SGQE 4BAOB 1FONA 1WU1A 3DA9B 1WOFA 1J15A 4TWYA 3STJA 3TITA 1WBGB 1Y3YA 3MNXA 2FOHA 1IQLA 3TGJE 5L2ZH 2BDHA 1F5KU 4J1YA 1O2ZA 1PJPA 2QIQA 3OTJE 3RUOA 1CGIE 1HUTH 1MMJN 1Z71A 3BG4B 4WMDA 3SV6A 2BOKA 3SNAA 4NFEA 1UVSH 3SQEE 2CN0H 1QFKH 2K1QA 3KQEA 2QCYA 3GDSA 2FDAA 4SGAE 3URCA 4TY7A 1V6DA 1EJNA 2P8OC 4AG1A 1CO7E 1CQQA 1NM6A 6GCHG 3BSQA 1ANCA 2GVFA 4KTUA 3QTOH 2VH6A 2A5IA 2GTBA 3UY9A 1HAVA 1DPOA 2STAE 2YOLA 1CT2E 1QQUA 3S9AA 4ISLA 2GKVE 4DIIH 1SLXB 1QA0A 1GVKB 3Q3YA 1TNKA 5DO4H 1MKWH 2BB4A 1IQHA 3SV9A 2PFEA 7ESTE 2VWNA 2ZGBH 3TJUA 3P8NA 4KP0A 2AEIH 5DP4A 3RMLH 4E7RG 3S7HB 4TPIZ 1AU8A 1IQEA 4GHTA 1DS2E 1V2PT 1ZHRA 3Q3XA 2BX4A 2R3YA 1G37A 3TU7H 3BV9B 2HGTH 2KAIA 4AORA 2Q1JA 2CGAA 2HNTF 3QK1A 3SJOA 1GMDF 4GSOA 1D4PB 3W95A 1GHBF 1V2LT 3M5MA 1HAGE 2FI5E 1EASA 2FX4A 5SGAE 4NA9H 2ZFPH 4Y71A 1HAIH 1TQ7B 2GCHG 4CBNA 2CV3A 2GCTC 1BJUA 3RC5A 5E2PA 2UWOA 1S84A 3PWBA 1GMCF 2CXVA 1SFIA 1TGCA 3LIWA 1AD8H 1YLCA 4NA8A 1EJMA 3P8FA 4X2WA 4J2YB 1HPGA 5E2OA 2ZHDA 2VH0A 1MAXA 1RTLA 3KNXA 5EW2H 5EPYA 1KXBA 4H6TA 1D6RA 1V2TT 4FVDA 1C4Y2 4AFUA 2BY5X 4Y10E 3SGBE 3VXEH 3SHCH 1A3EH 5ABWA 3I29A 5C3NA 2ZWLH 1NT1A 3KQCA 3IITA 1QRZA 2SGEE 4F4OC 2XXLA 2PLXA 1N6XA 1C5MD 3RMOH 4ABDA 1C1OA 2JH6D 2GMTC 2ZU4A 3H5CB 5DP5A 1GBAA 1MKXH 4MPVA 4SGBE 1PPHE 2XCFA 3KHVA 2BTCE 2P16A 3TH4H 3UIRA 5E0HA 5EXNA 1Q31A 1W14U 4AX9H 1UVTH 1EPTA 2FMJA 2WUBA 4AYYB 2V35A 2IJOB 3TH3H 3ZZBA 1BTHH 1BIOA 1AKSB 4ISNA 4X1QU 5GIBA 3LGYA 2GGVB 3BEIB 1OS8A 3SV2H 5HXFA 2O8WA 3U8RH 1O3LA 1X7AC 1DVAH 4E05H 1C5PA 1Q2WA 1YPJH 3LGVA 5AFYH 1AZZA 1J14A 2I6QA 5FPYA 4YLUA 2FOGA 5FBEA 3ZV9A 1EXFA 1G30B 2Q6FA 4HGCA 2P3UB 1W13U 1LDTT 1ZGIA 2ZNKH 5F03A 1MU6B 3LH3A 1O2WA 1Y8TA 1INCA 1YGCH 4X1PU 2BD8A 1TOMH 2PUQH 1O3EA 4X6OA 3LOXA 3HGNA 1GHBG 2D2DA 3FP6E 4CRDA 4ZXXH 2AH4X 2GV7A 1S0RA 1GBKA 1A5IA 1LHEH 2OD3B 1OX1A 1VITG 1O3IA 4FUHA 3A80A 1F92A 5GCHG 3M3SA 1UK4A 2BVSH 1SGQE 4QT8C 2BD7A 1O2PA 1LVBA 4X6MA 1D6WA 3R0FA 4KGAA 2P8OB 3P8OA 1O3BA 1O32A 1TNHA 1ZPCA 3PM3A 2Z3DA 2ZTYA 5A0BA 5HMAA 1RJXB 1GBCA 2BLVA 3GY4A 5BPEA 1B0FA 2W7SA 4K1TA 4AB8A 1QJ6B 4XSKU 3S7KB 5EXLA 4YOIA 2I6SA 2P93A 2ZDMA 1PPFE 3STIA 1AI8H 2GD4B 3K6ZA 2ZFSA 1LPZB 3U98H 1GHAF 4IN2A 4LZ1H 3VGCC 3KQDA 3EE0B 1K1OA 2ZA5A 1ELDE 5DKMA 4FUBA 1TBRH 1RTFB 1NU7B 1BTUA 2YNAA 4FVBA 5I25A 2EI7A 4D76A 2EC9H 4BAMB 3MO3A 4A6LA 4IS5A 2NU0E 4CHAC 4XBDA 2XWBI 4D9QA 5F8XA