2TGPZ

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
molecule tags Complex (proteinase/inhibitor)
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgpZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgpZ02
2A31A 1QL9A 5GDSH 1YC0A 1DWDH 5EG4A 1PPGE 1IQJA 1MTNC 2R0LA 2LPRA 1ID5H 2BZ6H 1TMUH 1LVMA 1HAVB 3LKWA 2BY7X 4UFEH 3U1JB 1GHWH 2ODYB 3SNBA 1C1NA 1C9PA 5LPFA 1K1MA 3QDZB 3SUFA 3D23A 1CT0E 1BTZA 1GDUA 1NRNH 4KP0A 2F9BH 1BJUA 1HYLA 3BTME 5DGJA 3SU5A 2CF8H 2FOGA 5JPMH 1Z71A 1TPSA 1WU1A 3S7KB 1K9OE 4QT8C 1K1IA 1P05A 2F91A 1UTNA 2FYRA 1UTKA 3VB6A 1B0FA 4D76A 1WQSA 5IYTA 1V2WT 5EU8A 2XRCA 3SW2B 1V3XA 4NZQA 1WTHD 2G51A 2JH5D 2ZHFH 1BBRH 1LHDH 4AGJA 5EOKA 3I78A 3ESTA 3IG6B 1HIAA 1ETTH 1FONA 1VCPA 2WPLS 1ABIH 1AD8H 1CBWC 5T6DA 1AHTH 1MBMA 2FOBA 1LPGB 4JMYA 4OS7A 1QQUA 1SBWA 4X8SH 4B75A 3HK3B 5A8YA 1ZRKA 1HAYB 1SHYA 4BTUB 2ASUB 3QUMP 3UR9A 4AOQA 1K1NA 2STAE 4GAWA 3T26A 2C93B 4A6LA 1MTSA 1O3NA 4X8TH 3U9AH 4CREA 2PSXA 2ZCLP 4AB8A 1KXBA 1ELGA 2IN2A 1F2SE 1ELFA 2W26A 3ITIA 3BG4C 5EGMA 2OINA 3P8FA 2EI7A 3MU4A 3Q00A 1AB9B 2V0BA 3S7HB 5E0JA 1RIWB 4WMFA 5E0HA 3LGUA 5ESTE 4B71A 4X6MA 5B6OA 1LVOA 5C1YA 1UJ1A 4KELA 5FXLA 1S6FA 1V2LT 4B2CA 2NU2E 2F9UA 2ZDKA 3TGKE 3ZZ3A 3CS7A 1SQTA 2BXUH 1QJ7B 1D4PB 1GI9B 5FX5A 1ZZZA 1G2LA 1LQDB 2GCTB 3OX7U 5C5NA 3H7OA 5AFZH 1RJXB 1LCYA 2BDBA 3LGIA 3V12A 2A7JA 4ISHH 1HDTH 3SHCH 1O2ZA 3SV8A 1XKAC 1HGTH 1HRTH 4OGXA 1DX5M 3LH3A 1W12U 1LHGH 1DXWA 1NC6A 2BY8X 2VWLA 3RC6A 4HGCA 1W0ZU 4CRCA 4K8BA 3TIUA 4B2AA 3SO3A 1MTVA 1V2OT 3MH5A 1RXPA 1SLXB 1H9LB 1XUKA 1AE8H 2BY6X 4FUFA 1V2MT 4SGBE 5DP7A 1A3BH 1UCYK 1YPHC 2WPKS 2VVVA 4FUBA 1W3CA 4J2YB 3RLYH 2B0FA 3BTWE 3RUOA 4BXWA 1OX1A 1J14A 3U8OH 3Q77A 1KXFA 4IN1A 4XBCA 2VH6A 5CHAC 3UQOA 1O39A 4D7FA 2Y7XA 2B5TB 2IJOB 1O36A 1LTOA 1EP5A 2GD4B 3TITA 2D1JA 3S9CA 1TNHA 2VGCB 1QR3E 3LC3A 3RXGA 1UK4A 3RM2H 2TGTA 4DJZB 1TRNA 3ATIA 3SU6A 4UEHH 4H6TA 2G5VA 3B9FH 4MTBA 1P11E 1EP6A 1O37A 3AAUA 1ARBA 4ASHA 3S9BA 3PMHB 4YT7H 2ZI2H 2OUAA 2ZECA 5EXLA 2BX3A 1P9UA 2UUKB 3M35A 4XBBA 1G2MA 1O2MA 1C1OA 2ZCKP 3VFEA 2PW8H 3P95A 4FUGA 2R3YA 3BTHE 3VB4A 2HRVA 1BTWA 5BRRE 4GHQA 2M5TA 1DWBH 1MKWK 3TPIZ 5DP4A 4VGCB 3S9AA 1TONA 4MPXA 3TK5A 1YBWA 1TQ7B 1TABE 4FUEA 1FNIA 2P3UB 4ZHMU 1GBEA 3QLPH 4Z0KA 1KXCA 5A09A 1DSTA 3QN7A 1BZXE 3GY4A 3M36A 5F8TA 1SPJA 2V35A 3VPKA 4WVPE 1VJ9U 4YM9A 2QA9E 4FU7A 3ZZDA 5EXMA 2BTCE 3LGTA 1BTXA 1YPGH 4RSPA 4CRGA 1ELAA 3TNSA 1GMHF 2FI3E 2B9LA 3RMMH 4THNH 3NKKA 1UO6A 4NZLA 2FTMA 1AE5A 3PTNA 1GVZA 2BLWA 4K69A 1EOJA 3OU0A 1ETRH 3R3GB 4I31A 1QA0A 3P8OA 1UTLM 1O3FA 2I6QA 1GHBG 1DWEH 1BMLA 4YESB 1GHAF 1T32A 3QGJA 1TYNA 1J9CH 1DPOA 2ZU2A 2WYGA 2OXSA 4IBLH 1LDTT 5AHGH 3F9FA 3RXDA 1FLEE 4NSYA 1ZMLA 1JMOH 1GJCB 7LPRA 1ZTKA 3MO9A 1OS8A 1EX3A 2Z9IA 3B23B 1W11U 2AH4X 5T3HA 3K6ZA 1AB9C 2FZZA 1KLIH 1RIWC 5JB8S 3DT0H 1WV7H 4NA8A 3URDA 4X1NU 3UFAA 3ZV9A 1MKXK 2HALA 5FPSA 3PMBB 1HNEE 5LGOA 2OCVB 4BOHA 3SNDA 1A0JA 3VGCC 5PTPA 3U98H 1K1JA 1NESE 4F49A 2UWPA 1F7ZA 3WY8A 1GJBB 4IMZA 3LPRA 4NWKA 4XSKU 2ZCHP 1INCA 1WSSH 1OWHA 2FLBH 3RU4T 1FAXA 2TGAA 2GCTC 3MU5A 2ALVA 4IMQA 4MQAA 3RXIA 1QJ6B 1ARCA 1ZPBA 3Q3YA 1A5GH 1ZMJA 4AFZA 3RXFA 3M61U 4GCHF 4FUDA 4RKOB 1FIZA 1H4WA 1AKSA 1IAUA 1KIGH 3CP7A 3LT3A 1WUNH 1CHOG 2GV6A 4IN2A 1UTJA 1J17T 1GVKB 4ZHLU 1MBQA 2BD4A 4HTCH 1GBKA 1C2FA 3RXRA 4GHTA 2PWXA 3SJ8A 2VVUA 2H9HA 2XBYA 2CGAA 4Y0ZE 4ESTE 2YNAA 2NU1E 3Q3XA 3TLOA 1K1PA 1AWFH 1DY9A 2AGEX 2FEQH 2QF3A 4A5TS 1B7XB 2ZEBA 4CH2B 1P2OA 3FAOA 1XM1A 3KNXA 2V3OH 3T29A 2HNTC 1KXEA 3ZZ6A 1NY22 1GDQA 1SLWB 4JYVH 1SGPE 4JCNA 2ZG0H 4X2YA 4MPWA 1NRPH 4LZ1H 1GJ7B 3GY7A 1TBZH 1C2GA 2A32A 1ANCA 1XUIA 1DDJA 1O3BA 3U8TH 4FUHA 3PLKA 5HYOA 1XXDA 5TJXA 1H9HE 1Z8IB 5F8ZA 1P9SA 1HV7A 2BLOA 5E8EH 1ANDA 1YM0A 5E2OA 3H7TA 2A4OA 5GXPA 1TNLA 4U32A 2Q1JA 1SI5H 4MG3A 3MMGA 1P03A 4B76A 1ESBA 3GCHC 1M9UA 3A8DA 1NRQH 3EA7A 3B8JA 1MAXA 3TJUA 4YOIA 4ZKNU 1O5GH 2SGEE 1TNIA 3RXTA 5CE1A 4WMDA 2F9VA 1GBBA 3RC4A 2XBVA 2H5DA 3TJNA 3A89A 1JOUB 4X8VH 3VB3A 1C5RA 1O2UA 2HPPH 2VWOA 1EAUA 1SVPA 2QYIA 1G9IE 4R8TB 4DG4A 1K1LA 1XUHA 1ZTJA 4H4FA 3GCTG 4DT7B 5JDUB 2ULLA 3QK1A 4YTAA 4K60A 1IQNA 3GYMA 1L1JA 3LC5A 1UK3A 2FWWA 4X1QU 4DURA 3W95A 1GBHA 1DICA 1O2IA 3E0PB 3E1XB 1S0RA 1C4U2 5EQRA 1L4ZA 1E0FD 1EZUC 2K1QA 3RXCA 1JRTA 5DP6A 1FN6A 1HAHH 1GBTA 4KTSA 2FOEA 1PYTD 1Y3VA 3RMNH 1ELCA 4UFDH 4A7IB 1P2MA 1UK2A 3UOPA 1P3CA 3SU0A 5JBAS 1EJAA 1CGJE 2Z9KA 4ABFA 2B7DH 1TOCB 3FP6E 2OP9A 4LXBH 3V7TA 2EI8A 3RXJA 5F6MA 1ANBA 3UUZA 1GJDB 1W0YH 3KQBA 2BDCA 3VB5A 1LMWB 1C1TA 2J92A 3PO1B 1YPHE 1QRWA 2BD5A 1PPEE 3RLWH 2QXGA 2QY0B 1AVWA 1RRKA 6ESTA 2GZ7A 1C5VA 1U6QA 3QTOH 1FY8E 5FX6A 4I7YH 3FZDA 6CHAC 3NPSA 1Z6EA 2PGBB 1XUGA 3K2UA 5JBCS 2XCNA 5GCHG 1BHXF 2A4RA 3D49H 1ESTA 3ELAH 1SGRE 3SORA 1C2IA 2FDAA 3UWIA 3URCA 3ZVGA 2Z9LA 4WH6A 3STJA 1A1RA 1CT4E 1THSH 4U30A 5I25A 3M7UA 1W14U 2J2UA 1BUIA 2OC7A 3EDXB 1P10A 4HZHA 2G4TA 3V0XA 2FI5E 4I32A 2ZFQH 3FP8E 4NIXA 1FMGA 3UNQA 1ZPCA 1SOZA 2HLCA 1OWIA 4TY7A 1F92A 1LO6A 3O8CA 4R0IA 3MNSA 2AGGX 5DG6A 1OP0A 3M5NA 2W5EA 4DCDA 2FX6A 1GL1A 4ZXXH 1UTPA 4BANB 8GCHG 1OWDA 2A4GA 4CHAC 3AW0A 1IQHA 1O2XA 3A86A 4DY7B 1UVUH 3RXKA 5JB9S 3GCOA 1OSSA 2ZFRH 1O2GH 2TIOA 4Q7ZA 2UWLA 1EXFA 2ZQ1A 2H6MA 1MD8A 4TY6A 2ZDLA 4BTIB 2ZWLH 4I8KA 1O2WA 4HI3A 2CHAB 5AVDA 3P70B 2ZHDA 2ZTXA 4JZEH 1FI8A 2KAIB 4AYVB 1BMNH 2GTBA 2OBOA 2BDIA 3A80A 4D7GA 2ZPQA 1CQQA 2WV4A 2H5CA 1SGYE 2TRMA 3GY6A 3A7WA 3AAVA 4J1YA 5EPNA 4H42U 3OY5U 1AFQB 4GLYA 5C2ZA 2FODA 3GICB 5FCRA 4NG9H 1O2JA 2EEKA 4M7GA 3ZYEA 3NZIA 1FPHH 4NSVA 1H1BA 4YOGA 3CS0A 3G01A 2FESH 1AN1E 1GI4A 1TA6A 2R9PA 1C2MA 2OQUA 1N1LA 1C1WH 2XBWA 1T7CA 2WPHS 1TGTA 1ELEE 1K1OA 3ZVBA 3SZNA 5L2ZH 1GHBF 2NU3E 4ZMAH 2VIVA 3SOSA 3TK6A 3V3MA 3SV9A 3E6PH 4XOJA 1DLKB 1H8IH 3D62A 3M37A 1DWCH 1MCVA 3GOVB 1NM6A 5A8ZA 1QRZA 1NRRH 2GT7A 3SQEE 4BAMB 4WY3A 1F0TA 1KDQA 1GHXH 3K9XB 3L3TA 4WWYA 4ABJA 2A45B 1OP2A 1GWAA 5GJ4B 1BMAA 4OS5A 4FXGH 4AYYB 2ZNKH 4HFPB 5C67A 1MQ6A 3BTQE 1C1QA 1EB2A 1G37A 1O3PB 1TRMA 1TGCA 1P2QA 1MH0A 2VB0A 4I8GA 3RXLA 3MU0A 1GL0E 1HAGE 3SU3A 2F9PA 3RM0H 1GMCF 2FIRH 1TPAE 1UCYH 4IW4E 7KMEH 1CGIE 1LPKB 3LGYA 5DP5A 5ABWA 3OYPA 1P8VC 1XXFA 1TX7A 1LHEH 2OBQA 2FO9A 1GJ4H 1VJAU 1YCPK 2SGFE 2ILNA 1F5KU 1VGCC 3VXEH 1VCQA 1SR5C 3QZQA 1O2NA 1PPHE 1AMHA 1E38B 4B74A 1CHOF 4DIIH 5LPEA 2XCFA 4KGAA 4NFFA 3BV9B 1TX6A 3E8LA 4CRBA 3C27B 3HGPA 1Z8GA 4MNYA 3PO1C 2Y82A 4B73A 2J9NA 2LNCA 3M3TA 1YF4A 1O3DA 2C90B 2ZO3H 3ZVCA 2QGRA 3RXEA 4IC6A 2VH0A 4IC5A 4NIVA 4Q2KA 2BMGB 4Y76A 2ZGBH 3RXPA 2WPJS 2R2WU 3SV7A 1GJ8B 1A0LA 2BHGA 3SU2A 4Y71A 5A0AE 4JK5A 1WQVH 1FY3A 1GJ5H 1Q31A 1O3EA 4RKJB 5E0GA 3BTTE 4PROA 3ZZ8A 3IITA 2VIWA 3SNEA 5T6GA 3F1SB 4WF8A 1Y59T 4X6PA 3A85A 1DVAH 2ZU5A 1O35A 1D3TB 3KHVA 1ZJDA 1D3DB 2QXHA 1UHBB 1O2HA 1BIOA 1O3HA 3GY8A 3BEIB 1PQ7A 1BBRK 2QV1A 2JETB 2O9QA 3KIDU 1K21H 2P94A 4OS2A 3SGQE 3RMLH 2ALPA 2PUQH 4Z6AH 1P06A 5F03A 2F3CE 1C2DA 1A3EH 1ELDE 4MNWA 2ZFFH 4WH8A 1T8OA 6GCHG 1Z7KA 5LPRA 2A5AA 2UUFB 4DIHH 1HB0B 1EAXA 1W2KH 1O30A 1KTTB 1A5HA 1T4VH 3UPEA 1HXEH 2RA0A 4ISIH 1GBMA 2R2MB 2Z7FE 3PTBA 1GI1A 4X8UH 1V2VT 1PQ5A 2ZHEH 3A7YA 3ATLA 2P3TB 3M3VA 4X1PU 1UCYE 2Y5FA 5E2PA 3MU8A 2D2DA 4O3UA 4NA7A 2W7SA 1Z1JA 3SI4H 1O3AA 3U8RH 1V2NT 4BAOB 4YO9A 1TLDA 1HAIH 2HWLB 3SU4A 3GCTF 4CH8B 1LHFH 1AFQC 2BDYA 2Z6BD 2Y6TA 1TGSZ 3UIRA 2PHBA 3PV4A 1SGTA 4GVUA 2WINI 2J95A 2RA3A 3BTDE 1W8BH 1MKXH 1EJNA 1CA0B 1GMDG 2GZ8A 3M3SA 1LPZB 1YPEH 5TCAA 3MWIU 2P95A 7GCHG 4AZ2B 4B1TA 1XKBC 1O2QA 3A83A 1YLDA 2GVFA 3RXSA 2PKSB 2XC0A 1V2PT 2P3FH 1C5TA 3TVJB 3GY2A 3SV2H 1G3DA 2UUYA 1Z8JB 4X6NA 3M5LA 1EZXC 3ZV8A 3SUGA 1C5ZB 1AO5A 2FS8A 1GI6A 3O8RA 1AU8A 3GDUA 1VITF 5AF9H 5DO4H 4ZH8A 4DW2U 3DD2H 2J38A 1DLEA 1DXPA 1FZZA 2SNVA 1HUTH 1JRSA 1GBDA 2Z3EA 3PWCA 3RMOH 1L4DA 2ZGHA 1MU8B 2OC8A 2WYJA 3MNCA 3A84A 5C3NA 4GSOA 2NU4E 4WXVA 1C1SA 1EPTB 2ZA5A 1HXFH 1O5BB 1XX9A 3ATKA 1O2SA 1O38A 4OS6A 2VU8E 1BMMH 1RTLA 2XYAA 1QTFA 5GCHF 1SSXA 1GHZA 4MNXA 2OLGA 5F8XA 2P16A 2CV3A 2ZDAH 4OS4A 1O5AB 1VITH 1QJ1B 4CRFA 1IQGA 2ZFPH 1HAOH 4X1RU 1WYKA 1KYNA 2WUBA 1SGEE 3TJOA 1JIMA 5C1UA 1PFXC 5DP9A 3SI3H 3VEQB 1Z8RA 3GDVA 4UDWH 1H9IE 3MU1A 1YPJH 1ZHPA 5FPTA 1QBVH 4X1SU 1E35B 1EQ9A 2Y81A 3TU7H 1J15A 2J34A 1MTUA 1PPBH 2ZGJA 3U1IB 1C4V2 2J4IA 1D6RA 3SJKA 2BVSH 3BSQA 1P0SH 1O3MA 2I6SA 1SQAA 1O2YA 1UVPA 2VJ1A 1TBRH 4NA9H 3IWMA 1EZQA 3K6YA 1FY5A 1SB1H 3UOUA 3H5CB 1ETSH 1AI8H 2CF9H 3UQVA 1VCWA 4ABBA 1C5NH 1PQ8A 9LPRA 1GI3A 3LH1A 2VINA 1AUTC 3HATH 1HAXB 1WOFA 2FOFA 1BITA 5HM9A 4WMEA 1S83A 2A0QB 4YOJA 1BRCE 4ZAEA 5EW2H 3A82A 4INHA 1EZSC 3P17H 1GCTB 2JETC 4K5ZA 2O8WA 2Q6DA 3GCNA 1KXDA 2QXIA 2ZC9H 1N8OB 3O8BA 1HAVA 1TA2A 3QTVH 4KTUA 1XVMA 1VZQH 1SMFE 3T27A 4U2WA 2ZIQH 2DE9A 3UREA 2CMYA 1AZZA 2ZU4A 3L33A 2FOAA 3MH4A 1O0DH 1OWKA 3K65B 1QNJA 1GBLA 3F6UH 2R0KA 1SGFG 2PV9B 1GGDB 1A2CH 2H2ZA 3EAJA 1ZYOA 2VGCC 1GI8B 2GZ9A 1O3CA 1Q2WA 1ZJKA 4UE7H 4Y8YA 4GPGA 2FI4E 2Z3CA 1AY6H 1Y8TA 5DP3A 3ZZ9A 1CGHA 1C5QA 3LGWA 4ZKOU 1ELVA 4ZKRU 5A8XA 1V2KT 4U01A 1JBUH 5SGAE 3MO3A 2C8YB 5C5OA 2ZHWH 3BTFE 1RTFB 1TRYA 1GBCA 1HCGA 1Y3XA 1KLTA 3ENSB 4X6OA 1YKTA 3F68H 4Y79A 3PMJA 1QL7A 1CA0C 2A1DB 4ABHA 1MQ5A 1OP8A 4AX9H 5HMAA 2PGQB 3ZYDA 1QL8A 1BDAA 2R3UA 1C5OH 3VB7A 1PJPA 1TNJA 3P92A 1C5SA 4VGCC 3SN8A 2ANYA 2PKSC 4ABEA 1FQ3A 1S84A 1V2JT 1ZRBA 1MMJN 1GHVH 1NU9A 4ZROA 1P57B 5FBIA 2RDLA 1G3EA 2RCEA 3KCGH 3T28A 3NWUA 1GI2A 2ANWA 4FUJA 1TE0A 1C2LA 2BYAX 1BB0B 3JZ1B 3RXUA 1J16A 2BVXH 3MH6A 3SQHE 1LVYA 1TBQH 4XE4A 1NO9H 3A81A 4BTTB 3DA9B 1SL3A 1VR1H 1DUEA 1YLCA 3LJJA 2G55A 1AVGH 4Y6DA 2FLRH 1EPTC 1X7AC 2ZGXH 2GCHG 2Y5GA 1XUFA 3LJOA 4INLA 3SBKA 2ZPRA 5A0BA 1DITH 4Y8ZA 1CBWB 4A1XA 3M5MA 2BQ7B 1FN8A 4SGAE 3RDZA 5L30H 1FUJA 3MO6A 2YOLA 1C4Y2 3GYLB 1EJMA 1NFYA 4BAKB 1IHSH 4NCYA 1O5DH 1KSNA 4MVNA 1QIXB 1ELTA 4K1SA 2YNBA 3HKIB 2FYQA 2JH6D 3A7XA 1NN6A 1C5XB 2G81E 1UMAH 1DM4B 3PB1E 4I8LA 2BLVA 5GWZA 1QGFA 2ZTYA 4E7RG 4RN6A 1PYTC 2V6NA 1OPHB 1QFKH 1ZSKA 1BTPA 5CMXH 3T2NA 2PUXB 1RS0A 1EATA 1ZOMA 3BF6H 3MI4A 1C5WB 3EA8A 2FS9A 3MFJA 4MPUA 1NFWA 1BJVA 1O5FH 1DE7H 4INKA 1XMNB 6GCHF 1IQEA 2FX4A 1O5EH 1F0RA 1O2RA 5I46H 1P3EA 2FM2A 5BPEA 2QAAA 1EKBB 4FVBA 1FJSA 3SUEA 1O3JA 1OWEA 3OTJE 3PM3A 1P02A 1ELBA 4MLFB 4CR5A 1YGCH 1CU1A 1A5IA 2Y80A 2GKVE 5T6FA 1F0SA 1GCTC 1NFXA 1G32B 3A88A 1L1GA 1N8OC 1O2OA 3SJ9A 3T25A 4ZHAA 2G00A 4MNVA 1HBTH 3HK6B 2HNTF 2OC1A 2J94A 1O3LA 1RD3B 1G3CA 2BVRH 4TYDA 3UWJH 3LOXA 4ABDA 1YP9A 4ISLA 2ZDNA 2BD3A 1GMDF 1ZSLA 1L1NA 2AMPA 2C8WB 1AUJA 1A4WH 4MPVA 3BEFB 4XDEA 3SNCA 1F5RA 1V2TT 2BD8A 3M5OA 1GGDC 3KQEA 1WBGB 2ANMH 1IOEA 1P12E 1HJ8A 2PR3A 2SGDE 2A4QA 5J4QA 2STBE 3MTYA 3A7ZA 2ZDMA 4FU8A 4BXSA 5K0HA 3RXAA 1PPZA 3RP2A 1C9TA 4OGYA 1TQ0B 1IQLA 1J8AA 1C1PA 2BX4A 1DS2E 1TGBA 4FU9A 4Y11E 2C8XB 4Q80A 4E06H 1W13U 2XC4A 1AKSB 2FXRA 2QCYA 1GBAA 1S85A 5DP8A 2BY9X 4XBDA 1DSUA 2OQ5A 2Q6FA 2EA3A 1GCDA 2JH0D 3P6ZB 2ZP0H 1D3QB 2FOCA 1H8DH 4ISOA 2BDHA 3QO6A 2PSYA 1KXAA 1TPPA 1C2EA 3SU1A 1YYY1 1TAWA 1F5LA 3KQCA 4YT6H 5DKMA 1N6XA 1TMBH 1ZGVA 1ZGIA 2QIQA 2WUCA 5LH8A 2TGDA 2AERH 1DY8A 1AZ8A 3E3TA 1FV9A 3MNBA 3W94A 2XTTB 3ZZ7A 2ZZUH 2Z9JA 3M7QA 1L0ZA 1PQAA 1C2KA 3UNRA 2F9NA 1NROH 4A92A 1W7GH 1SHHB 2VIDA 2THFB 4IGDA 1OKXA 5FHTA 1S82A 1C1VH 4ABAA 2ODPA 3ZZ4A 4O9VA 4ISNA 3BIUH 3KEEA 1WCZA 5JBTA 2G4UA 3LONA 1D6WA 5IDKA 3MHWU 2GGVB 3TGIE 1O3KA 2O8UA 1O31A 1BQYA 1BT7A 2A7HA 4AG2A 3EYDA 1SGCA 1T31A 4JZ1A 1DOJA 1SGFA 1THRH 4XFQA 1C2HA 2XW9A 2ZKSA 1O32A 1ZMNA 1BTUA 1QRXA 3FFGA 4AGKA 3E90B 3V13A 5H4IB 3RXMA 2OC0A 2G52A 1HFDA 3STIA 2HVXA 1CE5A 1TWXB 4CBNA 1SFQB 3TH3H 2JKHA 2HNTE 1T4UH 1OXGA 1DFPA 4WJG2 1KTSB 2Q6GA 2G8TA 5EQSA 1LKBA 1Y3WA 5ESBA 1GHYH 1AVXA 2WPMS 2SNWA 1NFUA 1BRUP 1Y3YA 4CBOA 2HGTH 3VGCB 2GMTB 2O8LA 3LDXH 5FBEA 1ANEA 1MKWH 1O2LA 5K7RA 1GDNA 1P2KA 1LHCH 3GY3A 1EB1H 4DGJA 2XNIA 4JYUH 1BRAA 1ZHRA 1C5YB 1S6HA 2Z9GA 5EXNA 1ZR0A 1Q3XA 2ZGCA 1GI7B 1GG6B 3UNSA 2AGIX 1ACBE 1C5PA 5EPYA 3ATMA 5EW1H 1BTHH 1BHXB 4K3JA 4X2WA 2ZFTA 4LOYH 2O8MA 1OYQA 2W3KA 2C4FH 2TGPZ 5HXFA 1A0HB 1DUAA 3ZVFA 1BRBE 1HLTH 4Y8XA 1S0QA 4BAHB 1KLJH 1BBRE 2OTVA 5FAHA 2XWAA 2BQ6B 3RU4E 1O3IA 2ESTE 3A8BA 1UVSH 2CJIA 3LU9B 4DVAU 4K1EA 1JWTA 2CHAC 2ZU1A 2G5NA 3BTEE 2W3IA 5JYIA 4ZXYH 3PMAB 1C1RA 2ZFSA 1JIRA 1AFEH 3QX5H 1HJAB 2XBXA 2SGQE 4AFQA 3NXPA 4BNRA 1LKAA 3ZZCA 1EAWA 3ZZBA 4K2YA 4Q7XA 4YZUA 1FPCH 3EA9A 2P93A 3QWCH 2V3HH 2H9EH 3A8AA 1BOQA 1MUEB 3S69A 1NS3A 2PKAB 3EE0B 4O3TA 3SJIA 1FDPA 2GCHF 2BY5X 3PYHA 5DPAA 2IPHA 1QBNA 3PLBA 2H1UA 1SFIA 2AIPA 4GUXA 5L6NH 2QN5T 3GCHB 2F9OA 3FZZA 4YLUA 1AIXH 4KTCA 3BIVH 3SJOA 2QXJA 1O3GA 2ZPSA 1QY6A 3D65E 3L6PA 4E7NA 5HGGA 1A46H 4JZFH 3A87A 3RXHA 2FMJA 1CHGA 2ZF0H 4LZ4B 3F9EA 1V2UT 1SGIB 2FP7B 1ABJH 1HAZB 3T5FH 2PLXA 4UONA 3MOCA 2RG3A 2VWNA 1MAYA 3A7TA 1A61H 1QBOA 1GI5A 3EQ0H 1ZSJA 5GIBA 1GJAB 1S5SA 2ANKH 4X2VA 3RXOA 3O8DA 5DK1A 2VIPA 2SFAA 1FAKH 1YCPM 3R0FA 2BLQA 2ZQ2A 2XXLA 4Y10E 3SV6A 1SG8B 3MNXA 3CENA 1IHTH 1XVOA 2OD3B 1TMTH 5HM2A 4WXIA 1TIOA 2H9TH 2VWMA 4NIYA 4NFEA 5C1XA 1BA8B 1E37B 4O97A 2QF0A 1RTKA 1O2KA 1TX8A 2QC2A 1CO7E 2D26C 1C5UA 3GISB 1K28D 2BOKA 4E05H 6LPRA 1TNKA 4DOQA 2BXTH 2BOHB 2C3SA 3KQDA 3ZVEA 1ZLRA 3MH7A 4Y7BA 5FCKA 4ZUHA 1D9IA 3MYWA 8GCHF 4O03A 1HIAB 3C1KA 1KDQB 3BG8A 5A0CA 2BDAA 2NU0E 1NU7B 3LGVA 1BTYA 2GMTC 1EASA 4FUIA 2Y7ZA 3ZVDA 2CXVA 2IOTA 2EC9H 2KAIA 1FXYA 2GDEH 1GMCG 3E16B 3QGNB 1HAPH 1MZDA 1SLUB 2BM2A 1C5MD 4NWLA 6CHAB 1Y5AT 1EOLA 3GY5A 1UVOA 1JXPA 3TH4H 3NK8A 4A1VA 3SGAE 1GBFA 1GG6C 4CRDA 4UFGH 1P09A 1MU6B 2VIOA 1V2QT 2A7CA 3A8CA 3TNTA 1UTOA 8ESTE 1CT2E 3FP7E 4AN7A 2XWBI 3Q3KA 1ZTLA 3OY6U 1EUFA 1PPFE 2AIQA 2PTNA 3E0NB 1ZHMA 2P8OB 3PROA 1T8LA 3DHKH 1GJ6A 1V2ST 4AG1A 1S81A 1SGNE 2GV7A 1IQMA 2A2QH 1P2IA 2BD7A 3BN9A 3SUDA 4F4OC 5C20A 1FY1A 1QHRB 1T8MA 1AGJA 4CHAB 1T8NA 3E91A 1L2EA 4I8JA 4TPIZ 3FVFB 3M7TA 2PFEA 1GI0A 4OS1A 4B2BA 3PLPA 3I29A 1NRSH 1KY9A 1HJAC 1E36B 2DE8A 3KN2A 4MDSA 1TNGA 3JZ2B 3S0NA 1AQ7A 2C8ZB 1A7SA 2GT8A 3SNAA 2WV5A 1Y5UT 1IQFA 1QCPA 3GDSA 4NGAH 2VVCA 3PWBA 1Y3UA 2UUJB 2W7UA 1QB1A 1P2NA 1G30B 3RU4D 2BZAA 4Y0YE 1QQ4A 1Y5BT 1O2VA 3I77A 1WTGH 2GX4A 2EI6A 1TALA 1MTNB 3KF2A 1LQEA 3TJVA 2FOHA 2AFQB 4JYTA 5EODA 3NUMA 4ABGA 4ZKSU 3AW1A 3P8GA 2TPIZ 3NCLA 3RC5A 1GPZA 3AASA 3N7OA 2A5IA 1QURH 2SGAA 4Y7AA 2FPZA 4FVDA 1IQKA 1Z6JH 3F9HA 3RXQA 4JK6A 2TBSA 3AVZA 3HGNA 3SGBE 3OSYA 3BEUA 2AS9A 3DUXH 1C1UH 1SGDE 1C5LH 3HKJB 1DANH 1BCUH 5L2YH 1G3BA 4CR9A 2BD2A 4D9RA 5J4SA 3QZRA 1OWJA 2FTLE 4FUCA 3ZVAA 4AORA 1ORFA 1TOMH 4JZDH 4UFFH 3TH2H 1UVTH 1RGQA 1NPMA 1O34A 2Y5HA 3BTGE 4X0WU 3UTUH 4ABIA 1P01A 5AFYH 3TGJE 1YPLH 1DT2A 1SQOA 3KL6A 1N6YA 1NTPA 1QB9A 4Q7YA 2CN0H 1O3OA 2D8WA 2BQWB 1MCTA 3EGKH 2NWNA 5ETXA 9ESTA 4BAQB 1UHBA 2ZTZA 2BB4A 3F9GA 3A7VA 3KGPA 3BG4B 1LVBA 1O2PA 1QB6A 1P2JA 1MZAA 1E34B 1YPMH 1V2RT 1NZQH 4CRAA 2P59A 2BD9A 4AFSA 1K22H 1VGCB 1O33A 1VITG 2PTCE 1TFXA 1P04A 1SOTA 3ZZAA 2SGPE 1F0UA 1XUJA 3ODFA 1UTMA 2ZU3A 5GPIB 1GMHG 1MTWA 3ZZ5A 2GDDA 1W7XH 2HPQH 3ATWA 1NT1A 3P8NA 4LK4A 4K8YA 4AB9A 1FIWA 4D9QA 2UWOA 2ZDVH 1SC8U 1W10U 7ESTE 4H6SB 1GBIA 1QA7A 3UR6A 1GHAG 2WPIS 3TK9A 2Z94A 3U69H 1O5CB 3BTKE 3FANA 4I33A 3SHAH 4D8NA 2HOBA 1TGNA 4KKDA 1B0EA 3UY9A 2ODQA 4K1TA 4TPYA 1HPGA 2AYWA 1V6DA 5DJ7A 2AMQA 1FY4A 4IS5A 1CVWH 1OYTH 1UTQA 5JBBS 1ESAA 1RFNA 2O8TA 2PKAA 1CSOE 1MD7A 4TWWA 8KME2 1GVLA 2P8OC 2XC5A 1C2JA 1SGQE 4YLQH 3VXFH 3RXBA 1AWHB 4TWYA 1PPCE 1THPB 7GCHF 4UD9H 1CA8B 4I8HA 2A2XH 1TPOA 2B8OH 3DFJA 1GJ9B 1TB6H 2BDGA 5EQQA 1D3PB 3ODDA 1GBJA 5G4BA 1G36A 5CHAB 2A5KA 1OOKB 1HJ9A 1SLVB 3Q76A 4A1TA 1EAIA 4GCHG 5FPYA 4JZIA 2VNTA 4NIWA 5TCCA 1YCPH 2VIQA 1YPKH 4X2XA 2AMDA 2DUCA 5A2MH 3DFLA 1K2I1 3RXVA 1B5GH 1O2TA 2GP9B 2ZHQH 2Z3DA 2FOMB 4AFUA 3LIWA 1Z1IA 1ZPZA 1EPTA 1WAYB 2AEIH 2F83A 1C1MA 1IQIA 8LPRA 3T62A 3HPTB
chains in the Genus database with same CATH superfamily
2A31A 1QL9A 5GDSH 1YC0A 1DWDH 5EG4A 1PPGE 1IQJA 1MTNC 2R0LA 2LPRA 1W0JD 1ID5H 2BZ6H 1TMUH 1LVMA 1HAVB 3LKWA 2BY7X 4UFEH 3U1JB 1GHWH 2ODYB 3SNBA 1C1NA 1C9PA 5LPFA 1K1MA 3QDZB 3SUFA 3D23A 1CT0E 1BTZA 1GDUA 1NRNH 4KP0A 2F9BH 1BJUA 1HYLA 3BTME 5DGJA 3SU5A 2CF8H 2FOGA 5JPMH 1Z71A 1TPSA 1WU1A 3S7KB 1K9OE 4QT8C 1K1IA 1P05A 2F91A 1UTNA 2FYRA 1UTKA 3VB6A 1B0FA 4D76A 1WQSA 5IYTA 1V2WT 5EU8A 2K0QA 2XRCA 3SW2B 1V3XA 4NZQA 1WTHD 2G51A 2JH5D 2ZHFH 1BBRH 1LHDH 4AGJA 5EOKA 1H8HD 3I78A 3ESTA 3IG6B 1HIAA 1ETTH 1FONA 1VCPA 2WPLS 1ABIH 1AD8H 2PP6A 1CBWC 5T6DA 5C94A 1AHTH 1MBMA 2FOBA 1LPGB 4JMYA 4OS7A 1QQUA 1SBWA 4X8SH 4B75A 3HK3B 5A8YA 1ZRKA 1HAYB 1SHYA 4BTUB 2ASUB 3QUMP 3UAIC 3UR9A 4AOQA 1K1NA 2STAE 4GAWA 3T26A 2C93B 4A6LA 2QF4A 1MTSA 1O3NA 4X8TH 2YMSD 3U9AH 4CREA 2PSXA 2ZCLP 4AB8A 1KXBA 1ELGA 2IN2A 1F2SE 1ELFA 2W26A 3ITIA 3OEHD 3BG4C 5EGMA 2OINA 5EJZA 3P8FA 2EI7A 3MU4A 3Q00A 2HLDD 1AB9B 2V0BA 3S7HB 3OE7D 1RIWB 5E0JA 5KECA 4WMFA 5E0HA 3LGUA 5ESTE 4B71A 4X6MA 5B6OA 3OFND 1LVOA 2IJD1 5C1YA 1UJ1A 4KELA 5FXLA 1S6FA 1V2LT 4B2CA 2NU2E 2F9UA 2ZDKA 3TGKE 3ZZ3A 4RT0A 3CS7A 1SQTA 2BXUH 1QJ7B 1D4PB 1GI9B 5FX5A 1ZZZA 2F43B 1G2LA 1LQDB 2GCTB 3KQ5A 3OX7U 5C5NA 3H7OA 5AFZH 1RJXB 1LCYA 2BDBA 3LGIA 3V12A 2A7JA 4ISHH 1HDTH 3SHCH 1O2ZA 3SV8A 1XKAC 1HGTH 1SQRA 1HRTH 4OGXA 1DX5M 3LH3A 1W12U 1LHGH 1DXWA 1NC6A 2BY8X 2VWLA 3RC6A 4HGCA 1W0ZU 3VG8A 3WWBA 4CRCA 2J98B 4K8BA 3TIUA 4B2AA 3SO3A 1MTVA 1V2OT 3MH5A 1RXPA 1SLXB 4ASUD 1H9LB 1XUKA 1AE8H 2BY6X 5HKKD 4FUFA 2V3MA 1V2MT 4SGBE 5DP7A 1A3BH 1UCYK 1YPHC 2WPKS 2VVVA 4FUBA 4FETA 1W3CA 4J2YB 3RLYH 2B0FA 3BTWE 3RUOA 4BXWA 1OX1A 1J14A 2LELA 3Q77A 1KXFA 4IN1A 4XBCA 3U8OH 2VH6A 5CHAC 3UQOA 1O39A 4D7FA 2Y7XA 1UW7A 2B5TB 2IJOB 1O36A 1LTOA 1EP5A 2GD4B 3TITA 2D1JA 3S9CA 1TNHA 2VGCB 1QR3E 3LC3A 3RXGA 1UK4A 3RM2H 2TGTA 4DJZB 1TRNA 3ATIA 3SU6A 4UEHH 4H6TA 2G5VA 3B9FH 4MTBA 1KMHB 1P11E 1EP6A 1O37A 3AAUA 1ARBA 4ASHA 3S9BA 3PMHB 4YT7H 2ZI2H 2OUAA 2ZECA 5EXLA 2BX3A 1P9UA 2UUKB 2VBCA 3M35A 4Z1MD 4XBBA 1G2MA 1O2MA 1C1OA 2ZCKP 3VFEA 2PW8H 3P95A 4FUGA 2R3YA 3BTHE 3VB4A 2HRVA 1BTWA 5BRRE 4GHQA 2M5TA 1DWBH 1MKWK 3TPIZ 5DP4A 4VGCB 3S9AA 1TONA 4MPXA 4RT1A 3TK5A 1YBWA 1TQ7B 1TABE 4FUEA 4TT3D 1FNIA 2P3UB 4ZHMU 4XRNA 1GBEA 3QLPH 4Z0KA 1KXCA 5A09A 1DSTA 3QN7A 1BZXE 3GY4A 3M36A 5F8TA 2KFWA 1SPJA 2V35A 3VPKA 4WVPE 1VJ9U 4YM9A 2QA9E 4FU7A 3ZZDA 5EXMA 2BTCE 3LGTA 1BTXA 1YPGH 4RSPA 4CRGA 1ELAA 3TNSA 1GMHF 2FI3E 2B9LA 3RMMH 4THNH 3NKKA 1UO6A 4NZLA 2FTMA 1AE5A 3PTNA 1GVZA 2BLWA 4K69A 1EOJA 3OU0A 1ETRH 5FL7D 3R3GB 4I31A 1QA0A 3P8OA 1UTLM 1O3FA 2I6QA 1GHBG 1DWEH 1BMLA 4YESB 1GHAF 1T32A 3QGJA 1TYNA 1J9CH 1DPOA 2ZU2A 2WYGA 2OXSA 4IBLH 1LDTT 5AHGH 3F9FA 3RXDA 1FLEE 4NSYA 1ZMLA 1JMOH 1GJCB 7LPRA 1ZTKA 3MO9A 1OS8A 4YXWD 1EX3A 2Z9IA 3B23B 1W11U 2AH4X 5T3HA 3K6ZA 1AB9C 2FZZA 1KLIH 1RIWC 5JB8S 3DT0H 1WV7H 4NA8A 3URDA 4X1NU 3UFAA 3ZV9A 1MKXK 4F48B 2HALA 5FPSA 3PMBB 1HNEE 5LGOA 2OCVB 1MABB 4BOHA 3SNDA 1A0JA 3VGCC 5PTPA 3U98H 1K1JA 1NESE 4F49A 2IPQX 2UWPA 1F7ZA 3WY8A 1GJBB 4IMZA 3LPRA 4NWKA 4XSKU 2ZCHP 1INCA 1WSSH 1OWHA 2FLBH 3RU4T 1FAXA 2TGAA 3F2HA 2GCTC 3MU5A 2ALVA 4IMQA 4MQAA 3RXIA 1QJ6B 1ARCA 1ZPBA 3Q3YA 1A5GH 1ZMJA 4AFZA 3RXFA 3M61U 4GCHF 4FUDA 4RKOB 1FIZA 1H4WA 1AKSA 1IAUA 1KIGH 2EQNA 3KYGA 3CP7A 3WW7A 3LT3A 1WUNH 3KYFA 1CHOG 2GV6A 4IN2A 1UTJA 1J17T 1GVKB 4ZHLU 1MBQA 2BD4A 4HTCH 1GBKA 1C2FA 3RXRA 4GHTA 2PWXA 3SJ8A 2VVUA 2H9HA 2XBYA 2CGAA 4Y0ZE 1WXRA 3H09A 4ESTE 2YNAA 2L6OA 2GJGA 2NU1E 3Q3XA 3TLOA 1K1PA 1AWFH 1DY9A 2AGEX 2FEQH 2QF3A 4A5TS 1B7XB 2ZEBA 4CH2B 1P2OA 3FAOA 1XM1A 3KNXA 2V3OH 3T29A 2HNTC 1KXEA 3ZZ6A 1NY22 1GDQA 1SLWB 4JYVH 1SGPE 4JCNA 2ZG0H 4X2YA 4MPWA 4F55A 1NRPH 4LZ1H 1GJ7B 3GY7A 1TBZH 1C2GA 2A32A 1ANCA 1XUIA 4RI0A 1DDJA 1O3BA 2L74A 3U8TH 4FUHA 3PLKA 5HYOA 1XXDA 5TJXA 1H9HE 1Z8IB 5F8ZA 1P9SA 1HV7A 2BLOA 5E8EH 1YM0A 1ANDA 5E2OA 3H7TA 2A4OA 4XD7D 5GXPA 1TNLA 4U32A 2Q1JA 1SI5H 4MG3A 3MMGA 1P03A 4B76A 1ESBA 3GCHC 1M9UA 3A8DA 1NRQH 3EA7A 3B8JA 1MAXA 3TJUA 4YOIA 4ZKNU 1O5GH 2SGEE 1TNIA 3RXTA 5CE1A 4WMDA 2F9VA 1GBBA 3RC4A 2XBVA 2H5DA 3TJNA 3A89A 1JOUB 4X8VH 3VB3A 1C5RA 1O2UA 2HPPH 2VWOA 1EAUA 1SVPA 2QYIA 1G9IE 4R8TB 4DG4A 1K1LA 1XUHA 1ZTJA 4H4FA 3GCTG 4DT7B 5JDUB 2ULLA 3QK1A 4YTAA 4K60A 1IQNA 3GYMA 1L1JA 3LC5A 1UK3A 2FWWA 4X1QU 2WPDD 4DURA 3W95A 1E1RD 1GBHA 1DICA 1O2IA 3E0PB 3E1XB 1S0RA 3FN8A 1C4U2 5EQRA 1L4ZA 1E0FD 1EZUC 2K1QA 3RXCA 1JRTA 5DP6A 1FN6A 1HAHH 1GBTA 4KTSA 2FOEA 1PYTD 1Y3VA 3RMNH 1ELCA 4UFDH 4A7IB 1P2MA 1UK2A 3UOPA 1P3CA 3SU0A 5JBAS 1EJAA 1CGJE 2Z9KA 4ABFA 2B7DH 1TOCB 3FP6E 2OP9A 4LXBH 3V7TA 2EI8A 3RXJA 5F6MA 1ANBA 3UUZA 1GJDB 1W0YH 3KQBA 2BDCA 3VB5A 1LMWB 1C1TA 2J92A 2YMSB 1YPHE 3PO1B 1QRWA 2BD5A 2KR7A 1PPEE 3RLWH 2QXGA 2QY0B 1WDIA 1AVWA 1RRKA 6ESTA 2GZ7A 1C5VA 1U6QA 3QTOH 1FY8E 5FX6A 4I7YH 3FZDA 6CHAC 3NPSA 1Z6EA 2PGBB 1XUGA 3K2UA 5JBCS 2XCNA 5GCHG 1BHXF 2A4RA 3D49H 1ESTA 3ELAH 1SGRE 3SORA 1C2IA 2FDAA 3CNRA 3UWIA 3URCA 3ZVGA 2Z9LA 4WH6A 3STJA 1A1RA 1CT4E 2F4LA 1THSH 4U30A 5I25A 3M7UA 1W14U 2J2UA 1BUIA 1K0HA 2OC7A 3EDXB 1P10A 4HZHA 2G4TA 3V0XA 2FI5E 4I32A 2ZFQH 3FP8E 4NIXA 1FMGA 3UNQA 1ZPCA 3FO8D 1SOZA 2HLCA 1OWIA 4TY7A 1F92A 1LO6A 3O8CA 4R0IA 3MNSA 2WV9A 3N7EA 2AGGX 5DG6A 1OP0A 3M5NA 2W5EA 4DCDA 2FX6A 1GL1A 4ZXXH 1UTPA 4BANB 8GCHG 1OWDA 2A4GA 4CHAC 3AW0A 1IQHA 1O2XA 3A86A 4DY7B 1UVUH 3RXKA 5JB9S 3GCOA 1OSSA 2ZFRH 1O2GH 2TIOA 4Q7ZA 2UWLA 1EXFA 2ZQ1A 2H6MA 1MD8A 4TY6A 2ZDLA 4BTIB 2ZWLH 4I8KA 1O2WA 4HI3A 2CHAB 5AVDA 3P70B 2ZHDA 2ZTXA 4JZEH 1FI8A 2KAIB 4AYVB 1BMNH 2GTBA 2OBOA 3WWFA 2BDIA 3A80A 4D7GA 2ZPQA 1CQQA 2WV4A 2H5CA 1SGYE 2TRMA 3GY6A 3A7WA 3AAVA 4J1YA 5EPNA 4H42U 4B6EA 3OY5U 1AFQB 4GLYA 5C2ZA 2FODA 3GICB 5FCRA 4NG9H 1NBME 1O2JA 2EEKA 4M7GA 3ZYEA 3NZIA 1FPHH 4NSVA 5CDFE 1H1BA 4YOGA 3CS0A 3G01A 2FESH 1AN1E 1GI4A 1TA6A 2R9PA 1C2MA 2OQUA 1N1LA 1C1WH 2XBWA 1T7CA 2WPHS 1TGTA 1ELEE 1K1OA 3ZVBA 3SZNA 5L2ZH 1GHBF 2NU3E 3F0PA 4ZMAH 2VIVA 3SOSA 3TK6A 3V3MA 3SV9A 3E6PH 4XOJA 1DLKB 1H8IH 3D62A 3M37A 1DWCH 1MCVA 3F2FA 3GOVB 3W1EA 1NM6A 5A8ZA 1QRZA 1NRRH 1YWUA 2GT7A 3SQEE 4BAMB 4WY3A 1F0TA 1KDQA 1GHXH 3K9XB 3L3TA 4WWYA 4ABJA 2A45B 1OP2A 1GWAA 5GJ4B 1BMAA 4OS5A 4FXGH 4AYYB 2ZNKH 4HFPB 5C67A 1MQ6A 3BTQE 1C1QA 1EB2A 1G37A 1O3PB 1TRMA 1TGCA 1P2QA 1MH0A 2VB0A 4I8GA 3RXLA 3MU0A 1GL0E 1HAGE 3SU3A 2F9PA 3RM0H 1GMCF 2FIRH 1TPAE 1UCYH 4IW4E 7KMEH 1CGIE 1LPKB 1QZ8A 3LGYA 5DP5A 5ABWA 3OYPA 1P8VC 2QF5A 2JDID 3NRLA 1XXFA 1TX7A 4Q63A 1LHEH 2OBQA 2FO9A 1GJ4H 3F0OA 1VJAU 1YCPK 2SGFE 2ILNA 1F5KU 1VGCC 3VXEH 1VCQA 1SR5C 3QZQA 1O2NA 1PPHE 1AMHA 1E38B 4B74A 1CHOF 4DIIH 5LPEA 2XCFA 4KGAA 4NFFA 3BV9B 1TX6A 3E8LA 4CRBA 3C27B 3HGPA 1Z8GA 4MNYA 3PO1C 2Y82A 4B73A 2J9NA 2LNCA 3M3TA 1YF4A 1O3DA 2C90B 2ZO3H 3ZVCA 2QGRA 3RXEA 4IC6A 2VH0A 4IC5A 4NIVA 4Q2KA 2BMGB 4Y76A 2ZGBH 3RXPA 2WPJS 2R2WU 4M9FA 3SV7A 1GJ8B 1A0LA 2BHGA 3SU2A 4Y71A 5A0AE 4JK5A 1WQVH 1FY3A 1GJ5H 1Q31A 1O3EA 4RKJB 5E0GA 3BTTE 4PROA 3ZZ8A 3IITA 2VIWA 5B6LA 3SNEA 5T6GA 3F1SB 4WF8A 1Y59T 4X6PA 3A85A 2KCPA 1DVAH 2ZU5A 1O35A 1D3TB 3KHVA 1ZJDA 1D3DB 2QXHA 1UHBB 1O2HA 1BIOA 1O3HA 3GY8A 3BEIB 5DN6D 1PQ7A 1BBRK 2QV1A 2JETB 2O9QA 3KIDU 1K21H 2P94A 4OS2A 3SGQE 3RMLH 5KGOA 2ALPA 2PUQH 4Z6AH 1P06A 1FX0B 5F03A 2F3CE 1C2DA 1A3EH 1ELDE 4MNWA 2ZFFH 4WH8A 1T8OA 6GCHG 1Z7KA 2LP6A 5LPRA 2A5AA 2UUFB 2KCOA 4DIHH 1HB0B 1EAXA 1W2KH 1O30A 1KTTB 1A5HA 1T4VH 3UPEA 1HXEH 2RA0A 4ISIH 1GBMA 2R2MB 2Z7FE 3PTBA 1GI1A 4X8UH 1V2VT 1PQ5A 2ZHEH 3A7YA 3ATLA 2P3TB 3M3VA 4X1PU 1UCYE 2Y5FA 5E2PA 3MU8A 2D2DA 4O3UA 4NA7A 2W7SA 1Z1JA 3SI4H 1O3AA 3U8RH 1V2NT 4BAOB 4YO9A 1TLDA 1HAIH 2HWLB 2WHXA 3GCTF 3SU4A 4CH8B 1LHFH 1AFQC 2BDYA 2Z6BD 2Y6TA 1TGSZ 3UIRA 2PHBA 3PV4A 4P00A 1SGTA 4GVUA 2WINI 2J95A 2RA3A 3BTDE 1W8BH 1MKXH 1EJNA 1CA0B 1GMDG 2GZ8A 3M3SA 1LPZB 1YPEH 5TCAA 3MWIU 2P95A 7GCHG 4AZ2B 4B1TA 1XKBC 1O2QA 3A83A 1YLDA 2GVFA 3RXSA 2PKSB 2XC0A 1V2PT 2P3FH 1C5TA 3TVJB 3GY2A 3SV2H 1G3DA 2UUYA 1Z8JB 3FOAA 4X6NA 3M5LA 1EZXC 3ZV8A 3SUGA 1C5ZB 1AO5A 2FS8A 1GI6A 3O8RA 1AU8A 3GDUA 1VITF 5AF9H 1E79D 5DO4H 4ZH8A 4DW2U 3DD2H 2J38A 1DLEA 1E1QD 1DXPA 1FZZA 2SNVA 1HUTH 1JRSA 1GBDA 1NBMD 2Z3EA 3PWCA 3RMOH 1L4DA 2ZGHA 1MU8B 2OC8A 2WYJA 3MNCA 3A84A 5C3NA 4GSOA 2NU4E 4WXVA 1C1SA 1EPTB 2ZA5A 1HXFH 1O5BB 1XX9A 3ATKA 1O2SA 1O38A 4OS6A 2VU8E 1BMMH 3DSPA 1RTLA 2XYAA 1QTFA 5GCHF 4P02A 1SSXA 1GHZA 4MNXA 2OLGA 5F8XA 2P16A 2CV3A 2ZDAH 4OS4A 1O5AB 1VITH 1QJ1B 2WSSD 1IQGA 2ZFPH 4CRFA 1HAOH 4X1RU 1WYKA 1KYNA 2WUBA 1SGEE 3TJOA 1JIMA 5C1UA 1PFXC 5DP9A 3SI3H 2QE7D 3VEQB 1Z8RA 3GDVA 4UDWH 1H9IE 3MU1A 1YPJH 1ZHPA 5FPTA 1QBVH 4X1SU 1E35B 1EQ9A 2Y81A 3TU7H 1J15A 2J34A 1MTUA 1PPBH 2ZGJA 3U1IB 1C4V2 2J4IA 1D6RA 3SJKA 2BVSH 3BSQA 1P0SH 1O3MA 2I6SA 1SQAA 1O2YA 1UVPA 2VJ1A 1TBRH 4NA9H 3IWMA 1EZQA 3K6YA 1FY5A 1SB1H 2AHME 5DSFA 3UOUA 3H5CB 1ETSH 1AI8H 2CF9H 3UQVA 1VCWA 4ABBA 1C5NH 1PQ8A 9LPRA 1GI3A 3LH1A 2VINA 1AUTC 3HATH 1HAXB 1WOFA 2FOFA 1BITA 2KCAA 5HM9A 4WMEA 1S83A 2A0QB 4YOJA 1BRCE 4ZAEA 5EW2H 3A82A 4INHA 1EZSC 3P17H 1GCTB 2JETC 4K5ZA 2O8WA 2Q6DA 3GCNA 1KXDA 2QXIA 2ZC9H 1N8OB 3O8BA 1HAVA 1TA2A 3QTVH 4KTUA 1XVMA 1VZQH 1SMFE 3T27A 4U2WA 2ZIQH 3U28C 2DE9A 3UREA 2CMYA 1AZZA 2ZU4A 3L33A 2FOAA 3MH4A 1O0DH 1OWKA 3K65B 1QNJA 1GBLA 3F6UH 2R0KA 1SGFG 3OAAD 2PV9B 1GGDB 1A2CH 2H2ZA 3EAJA 1ZYOA 2VGCC 1GI8B 2GZ9A 1O3CA 1Q2WA 1ZJKA 4UE7H 4Y8YA 4GPGA 2FI4E 2Z3CA 1AY6H 1Y8TA 5DP3A 3ZZ9A 1CGHA 1C5QA 3LGWA 4ZKOU 1ELVA 4ZKRU 5A8XA 1V2KT 4U01A 1JBUH 5SGAE 1OHHD 3MO3A 2C8YB 5C5OA 2ZHWH 3BTFE 1RTFB 5HIYA 1TRYA 1GBCA 1HCGA 1Y3XA 1KLTA 3ENSB 4X6OA 1YKTA 3F68H 4Y79A 3PMJA 1QL7A 1CA0C 2A1DB 4ABHA 1MQ5A 1OP8A 4AX9H 5C17A 5HMAA 2PGQB 3ZYDA 1QL8A 1BDAA 2R3UA 1C5OH 3VB7A 1PJPA 1TNJA 3P92A 1C5SA 4VGCC 3SN8A 2ANYA 2PKSC 4ABEA 1FQ3A 1S84A 1V2JT 1ZRBA 2CK3D 1MMJN 1GHVH 5KEDA 1NU9A 4ZROA 1P57B 5FBIA 2RDLA 1G3EA 2RCEA 3KCGH 3T28A 3NWUA 1GI2A 2ANWA 4FUJA 1TE0A 4B6FA 1C2LA 2BYAX 1BB0B 3JZ1B 3RXUA 1J16A 3FKSD 2BVXH 3MH6A 3SQHE 1LVYA 1TBQH 4XE4A 1NO9H 3A81A 4BTTB 3DA9B 1SL3A 1VR1H 1DUEA 1YLCA 3LJJA 2W6JD 2G55A 5T1VA 5C0UA 1AVGH 4Y6DA 2FLRH 1EPTC 1X7AC 2ZGXH 2GCHG 2Y5GA 1XUFA 3LJOA 4INLA 3SBKA 2ZPRA 5A0BA 1DITH 4Y8ZA 1CBWB 4A1XA 3M5MA 2BQ7B 1FN8A 4SGAE 3RDZA 5L30H 1FUJA 3MO6A 2YOLA 1C4Y2 3GYLB 1EJMA 1NFYA 4BAKB 5GNDA 1IHSH 4NCYA 1O5DH 1KSNA 4MVNA 1QIXB 1ELTA 4K1SA 2YNBA 3HKIB 2FYQA 2J98A 2JH6D 3A7XA 1NN6A 1C5XB 2G81E 1UMAH 1DM4B 3PB1E 4I8LA 2BLVA 5GWZA 1QGFA 2ZTYA 4E7RG 4RN6A 1PYTC 2V6NA 1OPHB 1QFKH 1ZSKA 1BTPA 5CMXH 3T2NA 2PUXB 1RS0A 1EATA 1ZOMA 3BF6H 3MI4A 1C5WB 3EA8A 2FS9A 3MFJA 2J5UA 4MPUA 1NFWA 1BJVA 1O5FH 1DE7H 4INKA 1XMNB 3OTPA 6GCHF 1IQEA 2FX4A 1O5EH 1F0RA 1O2RA 5I46H 1P3EA 2FM2A 5BPEA 2QAAA 1EKBB 4FVBA 1FJSA 3SUEA 1O3JA 1OWEA 3OTJE 3PM3A 2XNDD 3AK5A 1P02A 1ELBA 4MLFB 4CR5A 1YGCH 1CU1A 2V7QD 1S6LA 1A5IA 2Y80A 2GKVE 5T6FA 1F0SA 1GCTC 1NFXA 1G32B 3A88A 1L1GA 1N8OC 1O2OA 3SJ9A 3T25A 4ZHAA 2G00A 4MNVA 1HBTH 3DSOA 3HK6B 2HNTF 2OC1A 2J94A 1O3LA 1RD3B 1G3CA 2BVRH 4TYDA 3UWJH 3LOXA 4ABDA 1YP9A 4ISLA 3PV2A 2ZDNA 2BD3A 1GMDF 1ZSLA 1L1NA 2AMPA 2C8WB 3F3BA 1AUJA 1A4WH 4MPVA 3BEFB 4XDEA 3SNCA 1F5RA 1V2TT 2BD8A 3M5OA 1GGDC 3KQEA 1WBGB 4OM9A 2ANMH 1IOEA 1P12E 1HJ8A 2PR3A 2SGDE 2A4QA 5J4QA 2STBE 3MTYA 3A7ZA 2K8IA 2ZDMA 4FU8A 4BXSA 4TSFD 3RXAA 5K0HA 1PPZA 3RP2A 1C9TA 4OGYA 1TQ0B 1IQLA 1J8AA 1C1PA 2BX4A 1DS2E 1TGBA 4FU9A 4Y11E 2C8XB 4Q80A 4E06H 1W13U 2XC4A 1AKSB 2FXRA 2QCYA 1GBAA 1S85A 5DP8A 2BY9X 4XBDA 1DSUA 2OQ5A 2Q6FA 2EA3A 1GCDA 2JH0D 3P6ZB 2ZP0H 1D3QB 2FOCA 1H8DH 4ISOA 2BDHA 3QO6A 2PSYA 1KXAA 1TPPA 1C2EA 3SU1A 1YYY1 1TAWA 1F5LA 3KQCA 4YT6H 5DKMA 1N6XA 1TMBH 1ZGVA 1ZGIA 2QIQA 2WUCA 5LH8A 2TGDA 2AERH 1DY8A 1AZ8A 3E3TA 1FV9A 3MNBA 3W94A 2XTTB 3ZZ7A 2ZZUH 2Z9JA 3GS9A 3M7QA 1L0ZA 1PQAA 1C2KA 3UNRA 2F9NA 1NROH 2OK5A 4A92A 1W7GH 1SHHB 2VIDA 2THFB 4IGDA 1OKXA 5FHTA 1S82A 1C1VH 4ABAA 2ODPA 3ZZ4A 4O9VA 4ISNA 3BIUH 3KEEA 1WCZA 5JBTA 2G4UA 3LONA 1D6WA 5IDKA 3MHWU 2GGVB 3TGIE 1O3KA 2O8UA 1O31A 1BQYA 1BT7A 2A7HA 4AG2A 3EYDA 1SGCA 1T31A 4JZ1A 1DOJA 1SGFA 1THRH 4XFQA 1C2HA 2XW9A 2ZKSA 1O32A 1ZMNA 3F2GA 1BTUA 1QRXA 3FFGA 4AGKA 2YMSC 3E90B 3V13A 5H4IB 3RXMA 2OC0A 2G52A 1HFDA 3STIA 2HVXA 1CE5A 1TWXB 4CBNA 1SFQB 3TH3H 2JKHA 2HNTE 1T4UH 1OXGA 1DFPA 4WJG2 1KTSB 2Q6GA 2G8TA 5EQSA 1LKBA 1Y3WA 5ESBA 1GHYH 1AVXA 2WPMS 2SNWA 1NFUA 1BRUP 1Y3YA 4CBOA 3PV5A 2HGTH 3VGCB 2GMTB 2O8LA 3LDXH 5FBEA 1ANEA 1MKWH 1O2LA 5K7RA 1GDNA 1P2KA 4AC9A 1LHCH 3GY3A 1EB1H 4DGJA 2XNIA 4JYUH 1BRAA 2KCYA 1ZHRA 1C5YB 1S6HA 2Z9GA 5EXNA 1ZR0A 1Q3XA 2ZGCA 1GI7B 1GG6B 2KZ4A 3UNSA 2AGIX 1ACBE 1C5PA 5EPYA 3ATMA 5EW1H 1BTHH 1BHXB 4K3JA 4X2WA 5EJ1A 2ZFTA 4LOYH 2O8MA 1OYQA 2W3KA 2C4FH 2TGPZ 5HXFA 1A0HB 1DUAA 3ZVFA 1BRBE 1HLTH 4Y8XA 1S0QA 4BAHB 1KLJH 1BBRE 2OTVA 5FAHA 2XWAA 2BQ6B 3RU4E 1O3IA 2ESTE 3A8BA 1UVSH 2CJIA 3LU9B 4DVAU 4K1EA 3UB0A 1JWTA 2CHAC 2ZU1A 4HG6A 2G5NA 2KX4A 3BTEE 2W3IA 5JYIA 4ZXYH 3PMAB 1C1RA 1BMFD 2ZFSA 1JIRA 1AFEH 3QX5H 1HJAB 2XBXA 1SKYE 2SGQE 4AFQA 3NXPA 4BNRA 1LKAA 3ZZCA 1EAWA 3ZZBA 4K2YA 4Q7XA 4YZUA 1FPCH 3EA9A 2P93A 3QWCH 2V3HH 2H9EH 4ACAA 3A8AA 1BOQA 1MUEB 3S69A 1NS3A 2PKAB 3EE0B 4O3TA 3SJIA 1FDPA 2GCHF 3SZEA 2BY5X 3PYHA 5DPAA 2IPHA 1QBNA 3PLBA 2H1UA 1SFIA 2AIPA 4GUXA 5L6NH 2XOKD 2QN5T 3GCHB 2F9OA 2WZQA 3FZZA 1AIXH 4KTCA 4YLUA 3BIVH 3SJOA 2QXJA 1O3GA 2ZPSA 1QY6A 3D65E 3L6PA 4E7NA 5HGGA 3N99A 1A46H 4JZFH 3A87A 3RXHA 2FMJA 1CHGA 2ZF0H 3ZIAD 4LZ4B 3F9EA 1V2UT 1SGIB 2FP7B 1ABJH 2W6ID 1HAZB 3T5FH 2PLXA 4UONA 3MOCA 3PRDA 2RG3A 2VWNA 1MAYA 3A7TA 1A61H 1QBOA 1GI5A 3EQ0H 1ZSJA 3MQKC 5GIBA 1GJAB 1S5SA 2ANKH 4X2VA 3RXOA 3O8DA 5DK1A 2VIPA 2SFAA 1FAKH 1YCPM 3R0FA 1W0KD 3DSGA 2BLQA 2ZQ2A 2XXLA 4Y10E 3SV6A 2JJ2D 1SG8B 3MNXA 3CENA 1IHTH 1XVOA 2OD3B 1TMTH 5HM2A 4WXIA 1TIOA 2H9TH 2VWMA 3SYJA 4NIYA 4NFEA 5C1XA 1BA8B 1E37B 4O97A 2QF0A 1RTKA 1O2KA 1TX8A 2QC2A 1CO7E 2D26C 4Q4LA 1C5UA 3GISB 1K28D 2BOKA 4E05H 6LPRA 1TNKA 4DOQA 2BXTH 2BOHB 2C3SA 3KQDA 3ZVEA 1ZLRA 3MH7A 4Y7BA 5FCKA 4ZUHA 1D9IA 3MYWA 8GCHF 4O03A 1HIAB 3C1KA 1KDQB 3BG8A 5A0CA 2BDAA 2NU0E 1NU7B 3LGVA 1BTYA 2GMTC 1EASA 4FUIA 2Y7ZA 3ZVDA 2CXVA 2IOTA 3N7DA 2EC9H 2KAIA 1FXYA 2GDEH 1GMCG 3E16B 3QGNB 1HAPH 1MZDA 1SLUB 2BM2A 1C5MD 4NWLA 6CHAB 1Y5AT 1EOLA 3GY5A 1UVOA 1JXPA 3TH4H 3NK8A 4A1VA 3SGAE 1GBFA 1GG6C 2J97A 4CRDA 4UFGH 1P09A 1MU6B 2VIOA 1V2QT 2A7CA 3A8CA 3TNTA 1UTOA 8ESTE 1CT2E 3FP7E 4AN7A 2XWBI 3Q3KA 1ZTLA 3OY6U 1EUFA 1PPFE 2AIQA 2PTNA 3E0NB 1ZHMA 2P8OB 3PROA 3PRBA 1T8LA 3DHKH 1GJ6A 1V2ST 4AG1A 1S81A 1SGNE 2GV7A 1IQMA 2A2QH 1P2IA 2BD7A 3BN9A 3SUDA 4F4OC 5C20A 1FY1A 1QHRB 1T8MA 2JIZD 1AGJA 4CHAB 1T8NA 3E91A 1L2EA 4I8JA 4TPIZ 3FVFB 3M7TA 2PFEA 2EY4C 1GI0A 4OS1A 4B2BA 3PLPA 3I29A 1NRSH 1KY9A 1HJAC 1E36B 2DE8A 3KN2A 4MDSA 1TNGA 3JZ2B 3S0NA 1AQ7A 2C8ZB 1A7SA 2GT8A 3SNAA 4DT4A 2WV5A 1Y5UT 1IQFA 1QCPA 3GDSA 4NGAH 2VVCA 3PWBA 1Y3UA 2UUJB 2W7UA 2M2AA 1QB1A 1P2NA 1G30B 3RU4D 2BZAA 4Y0YE 1QQ4A 1Y5BT 1O2VA 3I77A 1WTGH 2GX4A 2EI6A 1TALA 1MTNB 3KF2A 1LQEA 3TJVA 2FOHA 2AFQB 4JYTA 5EODA 3NUMA 4ABGA 4ZKSU 3AW1A 3P8GA 5IK2D 2TPIZ 3NCLA 3RC5A 1GPZA 3AASA 3N7OA 2A5IA 1QURH 2SGAA 4Y7AA 2RDEA 2FPZA 4FVDA 1IQKA 1Z6JH 3F9HA 3OEED 5EJLA 3RXQA 4JK6A 2TBSA 3AVZA 3HGNA 3SGBE 3OSYA 3BEUA 2AS9A 3DUXH 2JJ1D 1C1UH 1SGDE 1C5LH 3HKJB 1DANH 1BCUH 5L2YH 1G3BA 5EIYA 4CR9A 2BD2A 4D9RA 5J4SA 3QZRA 1OWJA 2FTLE 4FUCA 3ZVAA 4AORA 1ORFA 1TOMH 4JZDH 4UFFH 3TH2H 1UVTH 3DCLA 1RGQA 1NPMA 1O34A 2Y5HA 3BTGE 2KM0A 4I86A 4X0WU 3UTUH 4ABIA 1P01A 5AFYH 3TGJE 1YPLH 1DT2A 1SQOA 3KL6A 1N6YA 1NTPA 1QB9A 4Q7YA 2CN0H 5F53A 1O3OA 2D8WA 2BQWB 1MCTA 3EGKH 2NWNA 2RFKC 5ETXA 9ESTA 4BAQB 1UHBA 2ZTZA 2BB4A 1COWD 3F9GA 3A7VA 3KGPA 3BG4B 1LVBA 1O2PA 1QB6A 1P2JA 1MZAA 1E34B 1YPMH 1V2RT 1NZQH 4CRAA 2P59A 2BD9A 4AFSA 1K22H 1VGCB 1O33A 1VITG 2PTCE 1TFXA 1P04A 1SOTA 3ZZAA 2SGPE 1F0UA 1XUJA 3ODFA 1UTMA 2ZU3A 5GPIB 1GMHG 1MTWA 3ZZ5A 2GDDA 4FOUC 1W7XH 2HPQH 3ATWA 4ZCNA 1NT1A 3P8NA 4LK4A 4K8YA 4AB9A 1FIWA 4D9QA 2UWOA 2ZDVH 1SC8U 1W10U 4ACBA 4H6SB 1GBIA 1QA7A 3UR6A 7ESTE 1GHAG 2WPIS 3TK9A 2Z94A 3U69H 1YY3A 1O5CB 3BTKE 3FANA 4I33A 3SHAH 4D8NA 2HOBA 1TGNA 4KKDA 1B0EA 3UY9A 2ODQA 4K1TA 4TPYA 1HPGA 2AYWA 1V6DA 5DJ7A 2AMQA 1FY4A 4IS5A 1CVWH 1OYTH 1UTQA 5JBBS 1ESAA 1RFNA 2O8TA 2PKAA 1CSOE 1VKYA 1MD7A 4TWWA 8KME2 1GVLA 2P8OC 2XC5A 5C0TA 1C2JA 1SGQE 4YLQH 3VXFH 3RXBA 1AWHB 4TWYA 1PPCE 1THPB 7GCHF 4UD9H 1CA8B 4I8HA 2A2XH 1TPOA 2HVYB 2B8OH 1YLNA 3DFJA 1GJ9B 1TB6H 5CHBA 2BDGA 5EQQA 1D3PB 3ODDA 1GBJA 1H8ED 5G4BA 1EFRD 1G36A 5CHAB 2A5KA 1OOKB 1HJ9A 5HIZA 1SLVB 3Q76A 4A1TA 1EAIA 4GCHG 5FPYA 4JZIA 2VNTA 4NIWA 5TCCA 1YCPH 2VIQA 1YPKH 3EE7A 4X2XA 2AMDA 2DUCA 5A2MH 3DFLA 1K2I1 3RXVA 1B5GH 1O2TA 2GP9B 2ZHQH 2Z3DA 2FOMB 4AFUA 3LIWA 1Z1IA 1ZPZA 1EPTA 1WAYB 2AEIH 2F83A 1C1MA 1IQIA 8LPRA 3T62A 3HPTB
chains in the Genus database with same CATH topology
2A31A 1QL9A 5GDSH 1YC0A 1DWDH 5EG4A 1PPGE 1IQJA 1MTNC 2R0LA 2LPRA 1ID5H 2BZ6H 1TMUH 1LVMA 1HAVB 3LKWA 2BY7X 4UFEH 3U1JB 1GHWH 2ODYB 3SNBA 1C1NA 1C9PA 5LPFA 1K1MA 3QDZB 3SUFA 3D23A 1CT0E 1BTZA 1GDUA 1NRNH 4KP0A 2F9BH 1BJUA 1HYLA 3BTME 5DGJA 3SU5A 2CF8H 2FOGA 5JPMH 1Z71A 1TPSA 1WU1A 3S7KB 1K9OE 4QT8C 1K1IA 1P05A 2F91A 1UTNA 2FYRA 1UTKA 3VB6A 1B0FA 4D76A 1WQSA 5IYTA 1V2WT 5EU8A 2XRCA 3SW2B 1V3XA 4NZQA 1WTHD 2G51A 2JH5D 2ZHFH 1BBRH 1LHDH 4AGJA 5EOKA 3I78A 3ESTA 3IG6B 1HIAA 1ETTH 1FONA 1VCPA 2WPLS 1ABIH 1AD8H 1CBWC 5T6DA 1AHTH 1MBMA 2FOBA 1LPGB 4JMYA 4OS7A 1QQUA 1SBWA 4X8SH 4B75A 3HK3B 5A8YA 1ZRKA 1HAYB 1SHYA 4BTUB 2ASUB 3QUMP 3UR9A 4AOQA 1K1NA 2STAE 4GAWA 3T26A 2C93B 4A6LA 1MTSA 1O3NA 4X8TH 3U9AH 4CREA 2PSXA 2ZCLP 4AB8A 1KXBA 1ELGA 2IN2A 1F2SE 1ELFA 2W26A 3ITIA 3BG4C 5EGMA 2OINA 3P8FA 2EI7A 3MU4A 3Q00A 1AB9B 2V0BA 3S7HB 5E0JA 1RIWB 4WMFA 5E0HA 3LGUA 5ESTE 4B71A 4X6MA 5B6OA 1LVOA 5C1YA 1UJ1A 4KELA 5FXLA 1S6FA 1V2LT 4B2CA 2NU2E 2F9UA 2ZDKA 3TGKE 3ZZ3A 3CS7A 1SQTA 2BXUH 1QJ7B 1D4PB 1GI9B 5FX5A 1ZZZA 1G2LA 1LQDB 2GCTB 3OX7U 5C5NA 3H7OA 5AFZH 1RJXB 1LCYA 2BDBA 3LGIA 3V12A 2A7JA 4ISHH 1HDTH 3SHCH 1O2ZA 3SV8A 1XKAC 1HGTH 1HRTH 4OGXA 1DX5M 3LH3A 1W12U 1LHGH 1DXWA 1NC6A 2BY8X 2VWLA 3RC6A 4HGCA 1W0ZU 4CRCA 4K8BA 3TIUA 4B2AA 3SO3A 1MTVA 1V2OT 3MH5A 1RXPA 1SLXB 1H9LB 1XUKA 1AE8H 2BY6X 4FUFA 1V2MT 4SGBE 5DP7A 1A3BH 1UCYK 1YPHC 2WPKS 2VVVA 4FUBA 1W3CA 4J2YB 3RLYH 2B0FA 3BTWE 3RUOA 4BXWA 1OX1A 1J14A 3U8OH 3Q77A 1KXFA 4IN1A 4XBCA 2VH6A 5CHAC 3UQOA 1O39A 4D7FA 2Y7XA 2B5TB 2IJOB 1O36A 1LTOA 1EP5A 2GD4B 3TITA 2D1JA 3S9CA 1TNHA 2VGCB 1QR3E 3LC3A 3RXGA 1UK4A 3RM2H 2TGTA 4DJZB 1TRNA 3ATIA 3SU6A 4UEHH 4H6TA 2G5VA 3B9FH 4MTBA 1P11E 1EP6A 1O37A 3AAUA 1ARBA 4ASHA 3S9BA 3PMHB 4YT7H 2ZI2H 2OUAA 2ZECA 5EXLA 2BX3A 1P9UA 2UUKB 3M35A 4XBBA 1G2MA 1O2MA 1C1OA 2ZCKP 3VFEA 2PW8H 3P95A 4FUGA 2R3YA 3BTHE 3VB4A 2HRVA 1BTWA 5BRRE 4GHQA 2M5TA 1DWBH 1MKWK 3TPIZ 5DP4A 4VGCB 3S9AA 1TONA 4MPXA 3TK5A 1YBWA 1TQ7B 1TABE 4FUEA 1FNIA 2P3UB 4ZHMU 1GBEA 3QLPH 4Z0KA 1KXCA 5A09A 1DSTA 3QN7A 1BZXE 3GY4A 3M36A 5F8TA 1SPJA 2V35A 3VPKA 4WVPE 1VJ9U 4YM9A 2QA9E 4FU7A 3ZZDA 5EXMA 2BTCE 3LGTA 1BTXA 1YPGH 4RSPA 4CRGA 1ELAA 3TNSA 1GMHF 2FI3E 2B9LA 3RMMH 4THNH 3NKKA 1UO6A 4NZLA 2FTMA 1AE5A 3PTNA 1GVZA 2BLWA 4K69A 1EOJA 3OU0A 1ETRH 3R3GB 4I31A 1QA0A 3P8OA 1UTLM 1O3FA 2I6QA 1GHBG 1DWEH 1BMLA 4YESB 1GHAF 1T32A 3QGJA 1TYNA 1J9CH 1DPOA 2ZU2A 2WYGA 2OXSA 4IBLH 1LDTT 5AHGH 3F9FA 3RXDA 1FLEE 4NSYA 1ZMLA 1JMOH 1GJCB 7LPRA 1ZTKA 3MO9A 1OS8A 1EX3A 2Z9IA 3B23B 1W11U 2AH4X 5T3HA 3K6ZA 1AB9C 2FZZA 1KLIH 1RIWC 5JB8S 3DT0H 1WV7H 4NA8A 3URDA 4X1NU 3UFAA 3ZV9A 1MKXK 2HALA 5FPSA 3PMBB 1HNEE 5LGOA 2OCVB 4BOHA 3SNDA 1A0JA 3VGCC 5PTPA 3U98H 1K1JA 1NESE 4F49A 2UWPA 1F7ZA 3WY8A 1GJBB 4IMZA 3LPRA 4NWKA 4XSKU 2ZCHP 1INCA 1WSSH 1OWHA 2FLBH 3RU4T 1FAXA 2TGAA 2GCTC 3MU5A 2ALVA 4IMQA 4MQAA 3RXIA 1QJ6B 1ARCA 1ZPBA 3Q3YA 1A5GH 1ZMJA 4AFZA 3RXFA 3M61U 4GCHF 4FUDA 4RKOB 1FIZA 1H4WA 1AKSA 1IAUA 1KIGH 3CP7A 3LT3A 1WUNH 1CHOG 2GV6A 4IN2A 1UTJA 1J17T 1GVKB 4ZHLU 1MBQA 2BD4A 4HTCH 1GBKA 1C2FA 3RXRA 4GHTA 2PWXA 3SJ8A 2VVUA 2H9HA 2XBYA 2CGAA 4Y0ZE 4ESTE 2YNAA 2NU1E 3Q3XA 3TLOA 1K1PA 1AWFH 1DY9A 2AGEX 2FEQH 2QF3A 4A5TS 1B7XB 2ZEBA 4CH2B 1P2OA 3FAOA 1XM1A 3KNXA 2V3OH 3T29A 2HNTC 1KXEA 3ZZ6A 1NY22 1GDQA 1SLWB 4JYVH 1SGPE 4JCNA 2ZG0H 4X2YA 4MPWA 1NRPH 4LZ1H 1GJ7B 3GY7A 1TBZH 1C2GA 2A32A 1ANCA 1XUIA 1DDJA 1O3BA 3U8TH 4FUHA 3PLKA 5HYOA 1XXDA 5TJXA 1H9HE 1Z8IB 5F8ZA 1P9SA 1HV7A 2BLOA 5E8EH 1ANDA 1YM0A 5E2OA 3H7TA 2A4OA 5GXPA 1TNLA 4U32A 2Q1JA 1SI5H 4MG3A 3MMGA 1P03A 4B76A 1ESBA 3GCHC 1M9UA 3A8DA 1NRQH 3EA7A 3B8JA 1MAXA 3TJUA 4YOIA 4ZKNU 1O5GH 2SGEE 1TNIA 3RXTA 5CE1A 4WMDA 2F9VA 1GBBA 3RC4A 2XBVA 2H5DA 3TJNA 3A89A 1JOUB 4X8VH 3VB3A 1C5RA 1O2UA 2HPPH 2VWOA 1EAUA 1SVPA 2QYIA 1G9IE 4R8TB 4DG4A 1K1LA 1XUHA 1ZTJA 4H4FA 3GCTG 4DT7B 5JDUB 2ULLA 3QK1A 4YTAA 4K60A 1IQNA 3GYMA 1L1JA 3LC5A 1UK3A 2FWWA 4X1QU 4DURA 3W95A 1GBHA 1DICA 1O2IA 3E0PB 3E1XB 1S0RA 1C4U2 5EQRA 1L4ZA 1E0FD 1EZUC 2K1QA 3RXCA 1JRTA 5DP6A 1FN6A 1HAHH 1GBTA 4KTSA 2FOEA 1PYTD 1Y3VA 3RMNH 1ELCA 4UFDH 4A7IB 1P2MA 1UK2A 3UOPA 1P3CA 3SU0A 5JBAS 1EJAA 1CGJE 2Z9KA 4ABFA 2B7DH 1TOCB 3FP6E 2OP9A 4LXBH 3V7TA 2EI8A 3RXJA 5F6MA 1ANBA 3UUZA 1GJDB 1W0YH 3KQBA 2BDCA 3VB5A 1LMWB 1C1TA 2J92A 3PO1B 1YPHE 1QRWA 2BD5A 1PPEE 3RLWH 2QXGA 2QY0B 1AVWA 1RRKA 6ESTA 2GZ7A 1C5VA 1U6QA 3QTOH 1FY8E 5FX6A 4I7YH 3FZDA 6CHAC 3NPSA 1Z6EA 2PGBB 1XUGA 3K2UA 5JBCS 2XCNA 5GCHG 1BHXF 2A4RA 3D49H 1ESTA 3ELAH 1SGRE 3SORA 1C2IA 2FDAA 3UWIA 3URCA 3ZVGA 2Z9LA 4WH6A 3STJA 1A1RA 1CT4E 1THSH 4U30A 5I25A 3M7UA 1W14U 2J2UA 1BUIA 2OC7A 3EDXB 1P10A 4HZHA 2G4TA 3V0XA 2FI5E 4I32A 2ZFQH 3FP8E 4NIXA 1FMGA 3UNQA 1ZPCA 1SOZA 2HLCA 1OWIA 4TY7A 1F92A 1LO6A 3O8CA 4R0IA 3MNSA 2AGGX 5DG6A 1OP0A 3M5NA 2W5EA 4DCDA 2FX6A 1GL1A 4ZXXH 1UTPA 4BANB 8GCHG 1OWDA 2A4GA 4CHAC 3AW0A 1IQHA 1O2XA 3A86A 4DY7B 1UVUH 3RXKA 5JB9S 3GCOA 1OSSA 2ZFRH 1O2GH 2TIOA 4Q7ZA 2UWLA 1EXFA 2ZQ1A 2H6MA 1MD8A 4TY6A 2ZDLA 4BTIB 2ZWLH 4I8KA 1O2WA 4HI3A 2CHAB 5AVDA 3P70B 2ZHDA 2ZTXA 4JZEH 1FI8A 2KAIB 4AYVB 1BMNH 2GTBA 2OBOA 2BDIA 3A80A 4D7GA 2ZPQA 1CQQA 2WV4A 2H5CA 1SGYE 2TRMA 3GY6A 3A7WA 3AAVA 4J1YA 5EPNA 4H42U 3OY5U 1AFQB 4GLYA 5C2ZA 2FODA 3GICB 5FCRA 4NG9H 1O2JA 2EEKA 4M7GA 3ZYEA 3NZIA 1FPHH 4NSVA 1H1BA 4YOGA 3CS0A 3G01A 2FESH 1AN1E 1GI4A 1TA6A 2R9PA 1C2MA 2OQUA 1N1LA 1C1WH 2XBWA 1T7CA 2WPHS 1TGTA 1ELEE 1K1OA 3ZVBA 3SZNA 5L2ZH 1GHBF 2NU3E 4ZMAH 2VIVA 3SOSA 3TK6A 3V3MA 3SV9A 3E6PH 4XOJA 1DLKB 1H8IH 3D62A 3M37A 1DWCH 1MCVA 3GOVB 1NM6A 5A8ZA 1QRZA 1NRRH 2GT7A 3SQEE 4BAMB 4WY3A 1F0TA 1KDQA 1GHXH 3K9XB 3L3TA 4WWYA 4ABJA 2A45B 1OP2A 1GWAA 5GJ4B 1BMAA 4OS5A 4FXGH 4AYYB 2ZNKH 4HFPB 5C67A 1MQ6A 3BTQE 1C1QA 1EB2A 1G37A 1O3PB 1TRMA 1TGCA 1P2QA 1MH0A 2VB0A 4I8GA 3RXLA 3MU0A 1GL0E 1HAGE 3SU3A 2F9PA 3RM0H 1GMCF 2FIRH 1TPAE 1UCYH 4IW4E 7KMEH 1CGIE 1LPKB 3LGYA 5DP5A 5ABWA 3OYPA 1P8VC 1XXFA 1TX7A 1LHEH 2OBQA 2FO9A 1GJ4H 1VJAU 1YCPK 2SGFE 2ILNA 1F5KU 1VGCC 3VXEH 1VCQA 1SR5C 3QZQA 1O2NA 1PPHE 1AMHA 1E38B 4B74A 1CHOF 4DIIH 5LPEA 2XCFA 4KGAA 4NFFA 3BV9B 1TX6A 3E8LA 4CRBA 3C27B 3HGPA 1Z8GA 4MNYA 3PO1C 2Y82A 4B73A 2J9NA 2LNCA 3M3TA 1YF4A 1O3DA 2C90B 2ZO3H 3ZVCA 2QGRA 3RXEA 4IC6A 2VH0A 4IC5A 4NIVA 4Q2KA 2BMGB 4Y76A 2ZGBH 3RXPA 2WPJS 2R2WU 3SV7A 1GJ8B 1A0LA 2BHGA 3SU2A 4Y71A 5A0AE 4JK5A 1WQVH 1FY3A 1GJ5H 1Q31A 1O3EA 4RKJB 5E0GA 3BTTE 4PROA 3ZZ8A 3IITA 2VIWA 3SNEA 5T6GA 3F1SB 4WF8A 1Y59T 4X6PA 3A85A 1DVAH 2ZU5A 1O35A 1D3TB 3KHVA 1ZJDA 1D3DB 2QXHA 1UHBB 1O2HA 1BIOA 1O3HA 3GY8A 3BEIB 1PQ7A 1BBRK 2QV1A 2JETB 2O9QA 3KIDU 1K21H 2P94A 4OS2A 3SGQE 3RMLH 2ALPA 2PUQH 4Z6AH 1P06A 5F03A 2F3CE 1C2DA 1A3EH 1ELDE 4MNWA 2ZFFH 4WH8A 1T8OA 6GCHG 1Z7KA 5LPRA 2A5AA 2UUFB 4DIHH 1HB0B 1EAXA 1W2KH 1O30A 1KTTB 1A5HA 1T4VH 3UPEA 1HXEH 2RA0A 4ISIH 1GBMA 2R2MB 2Z7FE 3PTBA 1GI1A 4X8UH 1V2VT 1PQ5A 2ZHEH 3A7YA 3ATLA 2P3TB 3M3VA 4X1PU 1UCYE 2Y5FA 5E2PA 3MU8A 2D2DA 4O3UA 4NA7A 2W7SA 1Z1JA 3SI4H 1O3AA 3U8RH 1V2NT 4BAOB 4YO9A 1TLDA 1HAIH 2HWLB 3SU4A 3GCTF 4CH8B 1LHFH 1AFQC 2BDYA 2Z6BD 2Y6TA 1TGSZ 3UIRA 2PHBA 3PV4A 1SGTA 4GVUA 2WINI 2J95A 2RA3A 3BTDE 1W8BH 1MKXH 1EJNA 1CA0B 1GMDG 2GZ8A 3M3SA 1LPZB 1YPEH 5TCAA 3MWIU 2P95A 7GCHG 4AZ2B 4B1TA 1XKBC 1O2QA 3A83A 1YLDA 2GVFA 3RXSA 2PKSB 2XC0A 1V2PT 2P3FH 1C5TA 3TVJB 3GY2A 3SV2H 1G3DA 2UUYA 1Z8JB 4X6NA 3M5LA 1EZXC 3ZV8A 3SUGA 1C5ZB 1AO5A 2FS8A 1GI6A 3O8RA 1AU8A 3GDUA 1VITF 5AF9H 5DO4H 4ZH8A 4DW2U 3DD2H 2J38A 1DLEA 1DXPA 1FZZA 2SNVA 1HUTH 1JRSA 1GBDA 2Z3EA 3PWCA 3RMOH 1L4DA 2ZGHA 1MU8B 2OC8A 2WYJA 3MNCA 3A84A 5C3NA 4GSOA 2NU4E 4WXVA 1C1SA 1EPTB 2ZA5A 1HXFH 1O5BB 1XX9A 3ATKA 1O2SA 1O38A 4OS6A 2VU8E 1BMMH 1RTLA 2XYAA 1QTFA 5GCHF 1SSXA 1GHZA 4MNXA 2OLGA 5F8XA 2P16A 2CV3A 2ZDAH 4OS4A 1O5AB 1VITH 1QJ1B 4CRFA 1IQGA 2ZFPH 1HAOH 4X1RU 1WYKA 1KYNA 2WUBA 1SGEE 3TJOA 1JIMA 5C1UA 1PFXC 5DP9A 3SI3H 3VEQB 1Z8RA 3GDVA 4UDWH 1H9IE 3MU1A