2TGPZ

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
molecule tags Complex (proteinase/inhibitor)
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgpZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgpZ02
1OS8A 4D7GA 1QQ4A 1ELFA 1O3KA 5DP4A 1WCZA 1GDUA 1OYTH 2CV3A 3Q3KA 2XCFA 3S9BA 4CHAB 2P8OC 1C2EA 3SUEA 1QJ7B 3IITA 2VIQA 1TNKA 4O03A 3K9XB 4UD9H 4Y7AA 2P95A 1MUEB 5TCCA 5L2YH 1ETRH 1MTWA 1CU1A 1GI6A 2VVCA 1O3BA 1AZZA 3GISB 1Y5AT 1DWDH 1P9UA 3VB3A 3RU4E 4AGKA 1V2ST 1D4PB 1S0QA 2ZHFH 1TNGA 1HUTH 4BAKB 3A80A 3BV9B 2BD3A 1QB9A 1TBZH 4YLQH 1GJDB 3PMHB 3RU4T 2UWOA 3MYWA 3TJUA 1YF4A 2ZECA 1Y3XA 2BDCA 4MNWA 1MD8A 1IQJA 1V2KT 1G3DA 1ZSJA 1NROH 4ABJA 1FLEE 3BN9A 3RXRA 1O3DA 4NSVA 1YPKH 3VGCB 3FANA 4NSYA 1ELDE 4WXIA 4MNYA 1C4Y2 4E05H 1OPHB 1YCPK 3FFGA 3GOVB 2V3HH 3SN8A 4NG9H 1KTSB 2A5AA 3LC3A 2XYAA 1GI7B 2NU4E 1AD8H 1C5WB 2ALPA 1EAIA 1ZLRA 2AEIH 3MNSA 4UFEH 4ABGA 5LPEA 3ZZCA 4JZFH 2Z3DA 1LKBA 2FEQH 1RFNA 1VCQA 2ZDVH 4NIYA 1C5OH 2ZFTA 3JZ1B 3ATKA 1O34A 5HMAA 5A8XA 1EAWA 3GCHB 4OGXA 5T6FA 1C5LH 1SFIA 1CHOG 4IN2A 2AIQA 1GJ5H 2Y7XA 1A0HB 1AN1E 2RCEA 4DCDA 2A4RA 3RXTA 1KSNA 3VEQB 1UTJA 3P8OA 2B8OH 3RXOA 1HAGE 3TNSA 5C5OA 1D3QB 2AS9A 2FXRA 2QA9E 5E0HA 3ATMA 1MQ5A 5FPYA 1MKWH 3TJNA 1O32A 4R8TB 1YLDA 2EA3A 3UY9A 2PKSC 4IS5A 1XX9A 1SGTA 1DOJA 1F5LA 2C93B 1FZZA 1AWFH 1Z8GA 4A92A 2ESTE 3VB6A 6LPRA 4DURA 1EB2A 2OBQA 1W0YH 3U8TH 1QNJA 2J34A 3EA9A 1CQQA 1UTNA 3AW1A 1SR5C 1H9IE 2R2WU 1C5MD 5F8XA 2VWOA 2YNBA 4H42U 1HBTH 4SGBE 4INKA 2GVFA 1C1TA 3E0NB 4DVAU 1E35B 1QRZA 1HAPH 2HLCA 3SUGA 3BTKE 3Q3XA 1FPCH 2LPRA 1NT1A 3BTTE 1TFXA 1CO7E 1FMGA 3JZ2B 1G2LA 3SNCA 1F0SA 1SG8B 1GVKB 2OP9A 3TNTA 5L30H 1EKBB 3MFJA 1SGQE 3RXKA 1XXDA 3DUXH 1CSOE 1W2KH 2ZFSA 5GXPA 2DE8A 2WV5A 3OY5U 1BMMH 2Z3CA 1O2QA 4Y8ZA 3PV4A 4RKJB 1H4WA 2OD3B 3TK5A 2A45B 1XM1A 4WVPE 2F9PA 2FS8A 1C5SA 4WH8A 2HRVA 1T4VH 1G3CA 4ISOA 5AF9H 3KL6A 3LC5A 2BDHA 1AVWA 1TBRH 2C3SA 3PWBA 2B9LA 2FP7B 2ZDMA 1TMUH 1P12E 4FUFA 3S9AA 2BMGB 3BG4B 4MPVA 6GCHF 2VH6A 1F2SE 1UK4A 2GV6A 2FOCA 1MH0A 4ABEA 1GDNA 1OWJA 3ZZAA 2GTBA 2VGCB 1LQEA 1DXPA 2A4OA 3MU1A 1O2MA 2QY0B 1MTNC 1OYQA 3A88A 5JYIA 3P95A 2P8OB 2TGDA 1VJ9U 1O3EA 3M3TA 2OQUA 4QT8C 5DPAA 1A1RA 2FDAA 3ESTA 1UJ1A 3S9CA 3RMMH 1L1NA 1P2IA 1L4DA 2Y5FA 2ANKH 2BD8A 2FLBH 1GBJA 3BTQE 4Y11E 3RP2A 1ZSKA 1YPEH 5LPRA 4AFZA 3CP7A 1GMCF 5L2ZH 3QZRA 2J9NA 2PTNA 1O2GH 4ZHMU 1MD7A 1A5HA 1BB0B 4X2VA 4I33A 2WPIS 1TX6A 5HYOA 3SORA 4J2YB 1AZ8A 5C1XA 1NRSH 4OS2A 1H9HE 4X6MA 1OKXA 2A2XH 5AFZH 4GLYA 1OSSA 2QGRA 5DP8A 2BD5A 2BQWB 2QYIA 2OBOA 1TPSA 1MMJN 2ZDNA 4WH6A 1GBDA 1U6QA 1E38B 1MTVA 3CENA 3AVZA 1UTKA 3LDXH 4AB8A 4AFQA 4KP0A 4FU8A 2J2UA 1MQ6A 1CGIE 1QURH 3HKJB 2NU3E 1HIAB 1GBTA 1MKWK 1UK2A 4X6NA 4ZHAA 1TRMA 1V2QT 4JZIA 1P10A 2H9EH 4Y8YA 2JKHA 2GZ8A 1S0RA 1C1VH 1P2JA 5E8EH 1C1MA 1PQ5A 1UVPA 4Y71A 1O5AB 3QDZB 1BRAA 1Y5BT 3E3TA 4KELA 2FZZA 3NK8A 3KN2A 2TIOA 1C1QA 3SO3A 4A1VA 2Z9JA 4ZUHA 1SLXB 4FVBA 1P2MA 1NTPA 5TJXA 1GI5A 3M3VA 3F1SB 5ESTE 1AFQC 1O2LA 3QLPH 1ZPCA 3GDSA 1KDQB 1KXEA 4AG1A 5JDUB 1YPMH 1ETTH 1K2I1 9LPRA 3U1IB 1GJAB 5LH8A 1BMAA 3NCLA 3LGWA 4H6TA 2BD9A 3UWIA 2PV9B 3ZZ5A 3DFLA 1SGDE 2R3UA 2D1JA 3GY8A 4Z6AH 2XW9A 7KMEH 1GMDF 1NC6A 2QC2A 3FP7E 3LIWA 5PTPA 3AAVA 4Y7BA 1GBBA 4DGJA 1ZR0A 3M35A 1EAXA 3M7TA 2A7JA 1AVXA 1LPKB 2Y81A 1QJ1B 3M36A 1ZTLA 3M37A 1IQMA 1B7XB 1OX1A 2KAIA 1UVOA 2JETC 4K2YA 4AGJA 1YCPM 2VVVA 3A81A 1G37A 2BHGA 3BTFE 3A85A 3EDXB 3RXIA 2A1DB 4AOQA 4FUGA 2D26C 4WMFA 1O2HA 4DOQA 1SLUB 1G36A 4Q2KA 4IMQA 1G9IE 1TRYA 3HK6B 2FLRH 1P2OA 1CBWB 3H7TA 4CRAA 1VCPA 2P59A 2W3IA 5F8ZA 2EI7A 2TBSA 1DE7H 2FODA 3LJOA 3LU9B 1P2KA 3S69A 3NWUA 1GJBB 2QXGA 5A8ZA 3GCTF 2CN0H 4KGAA 1OWKA 1QRXA 1O2UA 3TPIZ 1K1IA 2WPMS 4YOJA 1ESTA 4NA9H 3RXHA 5ETXA 2OUAA 3ZZDA 1V3XA 2BD4A 3QO6A 5FCKA 5LPFA 2STAE 3QWCH 1WBGB 2PKAA 5E2OA 1ELBA 4MG3A 5JBAS 2FTMA 2O9QA 3KNXA 4BNRA 2R0KA 4AORA 4X8UH 3S0NA 1QB6A 2PGBB 1GHAG 3KCGH 1PYTD 3UPEA 1NFYA 1KY9A 3ZZ8A 1HJ9A 1D9IA 3E1XB 4U2WA 3DD2H 1NFWA 1C2IA 5FXLA 3TH2H 4K3JA 3ZYDA 4OS7A 2QF3A 1O33A 2W7UA 2AH4X 2FPZA 5E0JA 1O3NA 2RA0A 1Z71A 5AVDA 1A3BH 1TPAE 1QJ6B 4MPWA 3SI4H 1O5EH 3GYMA 1T8LA 3LH3A 3ODDA 4AZ2B 1ID5H 2ZFRH 1BCUH 1ANBA 4YOIA 3RXLA 5T3HA 1ETSH 3RLWH 2ZU4A 4Z0KA 4SGAE 1O2JA 5CE1A 4LZ4B 2GCHF 1HAOH 2C4FH 3D65E 1GHBF 1O3MA 1HNEE 1EZSC 1A0LA 1TIOA 2VWLA 2B7DH 1LPZB 1TPPA 1GHXH 5FPTA 3T5FH 1GMHF 2ZPSA 1S6FA 5EOKA 2XTTB 2EC9H 1FAXA 2BY9X 1BRBE 1C9PA 1WOFA 4LZ1H 1KLJH 3P17H 5A0CA 1IHSH 2RA3A 4B2CA 3SGQE 1L1JA 1O2TA 1GBFA 1TNJA 1GHYH 1LPGB 1J16A 1TB6H 1P09A 5EXNA 1YGCH 4H6SB 1MAXA 2ZHWH 3M5OA 2XRCA 1VR1H 2P3UB 3A8CA 1O2YA 4AYYB 1LVOA 3SUDA 3I77A 4BAOB 1QIXB 1GG6B 1TGTA 1SQTA 2AMDA 1AFQB 3UTUH 1C2MA 2XBVA 3SV6A 1C5NH 5T6DA 2BLWA 4UONA 3ZV8A 1HAXB 1MKXK 2RDLA 3FZZA 5LGOA 1UCYK 3SNEA 2SNWA 5B6OA 3SHCH 1LDTT 3E6PH 1ACBE 2V0BA 3BIVH 7GCHF 3U9AH 2Z94A 4ZROA 2ODPA 1E0FD 2ZEBA 1QFKH 1Y5UT 3ZZ9A 3T27A 4JYTA 3D62A 2XNIA 1TWXB 1N1LA 2GGVB 2JETB 5JBTA 2O8WA 3ZZ4A 1T8OA 3MO6A 3KQCA 4NWLA 3HGPA 3MH6A 1AUTC 4H4FA 3E8LA 2BD7A 3UNSA 1TNLA 1FY1A 5GCHG 3EYDA 1RXPA 3QX5H 1O2VA 1ZGIA 4CRDA 2Q6DA 4X2WA 3ZVAA 4MNVA 2AERH 1IQLA 2NU0E 1CT4E 4RSPA 1BDAA 4MQAA 2R0LA 2GCTC 1PPHE 1DICA 1GL0E 1SGCA 4B2BA 2C8YB 1Z6JH 1QCPA 2BVSH 2OCVB 2ZCLP 2ZGHA 3SJKA 5EW2H 3SU0A 3MH4A 2RG3A 1W13U 3BTEE 4DIHH 2ZP0H 3B23B 3FP6E 1DWCH 2VGCC 1MBQA 1TQ7B 4NA8A 2FM2A 1TGBA 1A5IA 2ZGCA 2F9UA 3TGKE 1WSSH 2WPKS 1EJNA 4XBDA 2G5VA 2XC4A 1CHGA 3PMBB 1ESBA 3O8BA 3RXGA 1G3BA 1O3GA 3PWCA 3B8JA 1TNIA 3KF2A 3ATLA 1EJAA 3BEIB 2PGQB 1P02A 1SMFE 1LO6A 3D23A 4JZDH 4X0WU 1WAYB 4I31A 2OTVA 2BX3A 3P6ZB 3SGAE 2Q6FA 2VIVA 2HOBA 1HXEH 2M5TA 3EAJA 2GD4B 1O38A 4WY3A 3V0XA 2VJ1A 3BSQA 3ZV9A 1E37B 2Y5HA 4R0IA 4RN6A 3V3MA 1LHEH 1UHBA 3A86A 2G8TA 1KTTB 4CREA 1AUJA 1QR3E 2VWNA 4X1SU 3F9HA 3SJIA 1GBHA 1S81A 2ZA5A 1ZMJA 1OWHA 5C20A 1WTHD 4AN7A 2SNVA 3OSYA 3P92A 3SHAH 1T31A 4X6PA 2ZQ1A 1VITF 3ZVBA 5EXLA 2EI6A 4B76A 1TOCB 1NU7B 1V2TT 3RLYH 1V2MT 1W7GH 4CRGA 1PQAA 3RXJA 1V2VT 4MTBA 4DJZB 1F0UA 1GVLA 4IC5A 1THSH 4AFUA 1YPGH 1SOZA 2ILNA 4TWYA 2HPPH 1GJ7B 3LH1A 4WMEA 1NO9H 1OP2A 1ZOMA 4FUHA 3RU4D 2I6SA 1Q3XA 1AKSB 6CHAB 1OWEA 2WYJA 5FHTA 1HGTH 1KYNA 2F9OA 3SU5A 1H8DH 1O3JA 1NU9A 3LGUA 2UUYA 1FI8A 3V7TA 5IYTA 1EJMA 1FN6A 2ZU1A 4JK6A 4MVNA 5BPEA 8GCHF 2ODYB 1WQSA 3BTME 2BY8X 2ZKSA 1O3FA 2ZFPH 4K8BA 2Z7FE 2A2QH 4K1TA 3SU3A 1GI8B 4I7YH 4ASHA 1O3LA 4IBLH 5FBIA 1S6HA 3F9GA 1GJ4H 1OOKB 3RXQA 1SGEE 5FX6A 2GT7A 2H2ZA 2QAAA 4MPXA 1T7CA 4ABFA 5FAHA 4ZXYH 1DLEA 5G4BA 3WY8A 5L6NH 3ZYEA 4BTIB 2C8WB 1SGYE 3UFAA 1C5PA 3ATIA 1GGDB 1TONA 4WF8A 2XWBI 1ZRKA 2BOHB 4KKDA 2BLOA 3RXCA 3QGNB 2F83A 1WV7H 5AHGH 1RTKA 1LMWB 1TQ0B 3A8BA 3GDVA 1C4V2 2FESH 1O31A 3UREA 1EPTC 3VFEA 1IHTH 2Y6TA 2TRMA 4FXGH 1SGFA 2HNTC 2FS9A 1ANCA 4AYVB 1K9OE 1SLVB 1MBMA 3MMGA 3LGTA 1CBWC 4LXBH 3U8OH 4WXVA 3BTWE 2GCTB 3ATWA 3SU2A 3GY2A 1GBEA 1BJUA 4GHQA 1ZPZA 2FOGA 3RXAA 1FV9A 1CGJE 3IWMA 4GCHF 1NFUA 3OX7U 4FUEA 2BVXH 3LOXA 1ZZZA 1O2IA 3SNAA 1NRPH 1V2NT 1JXPA 1CT2E 2NU2E 2CHAC 1BQYA 4U01A 2BX4A 2J94A 1A2CH 3M61U 1QY6A 3VXFH 3I78A 2ANWA 4X1RU 3LKWA 4Y79A 5A0AE 1GJCB 1P06A 2PKAB 1SVPA 4D76A 4A1XA 3S7KB 5IDKA 1BHXB 1JOUB 4BTTB 1L4ZA 1K1JA 2P3FH 3RM0H 1LHCH 4J1YA 2CF9H 1AB9C 4TPIZ 2XC0A 1TGCA 2FOHA 2VINA 2G4UA 3MU5A 3ZVCA 1VZQH 5C1YA 2W7SA 5DP9A 3GY7A 1JIMA 1O5BB 1NM6A 2JH5D 1IQKA 3FVFB 1BJVA 3SU6A 5GWZA 3QN7A 2NU1E 1GJ8B 3GDUA 1WUNH 1TBQH 1C1RA 5K7RA 1KIGH 1GBMA 2BDYA 3VPKA 1SHYA 3RXUA 1K1NA 2CXVA 2BVRH 2VH0A 4YM9A 5K0HA 4OS4A 1ZRBA 1IOEA 5DKMA 1HXFH 1FDPA 4XE4A 1NZQH 5HGGA 1D3DB 5I46H 3M7UA 1QA7A 1XXFA 5DJ7A 1HB0B 3VXEH 1EOLA 4MNXA 1C1NA 4FUJA 1BUIA 4IMZA 2ZWLH 2GMTB 3A7TA 5JB8S 3UNQA 4BAQB 4CRBA 5DGJA 2G81E 2ZHQH 2Y80A 1BBRH 1WQVH 1L1GA 1DWEH 1YPLH 2SGQE 1TA6A 1P11E 1P2NA 1XKAC 1UCYE 1S82A 3SW2B 5ESBA 4TY7A 2BZ6H 1C2FA 1PPFE 3E0PB 2GZ9A 1C5VA 3EGKH 1QHRB 1Z8IB 1S5SA 4BANB 1O2NA 1GG6C 5FPSA 2YNAA 3U69H 1UTOA 4ISNA 1A0JA 4NWKA 3AW0A 1ZYOA 2BLQA 2J95A 2DE9A 1C5XB 1ZTJA 1HAVA 4UDWH 1PYTC 3UR6A 1GBLA 2Y7ZA 5EU8A 1DANH 1SQOA 1NRQH 1C1OA 3T26A 1MU8B 2A32A 4AX9H 2A4GA 4NGAH 5H4IB 1C4U2 3UR9A 4Q80A 4B73A 1EUFA 5HXFA 1ZGVA 1MCTA 1AU8A 1BITA 2BDAA 2VIOA 2B0FA 2VIPA 1ZSLA 4HTCH 3VB7A 3SI3H 1LVBA 1O5FH 2HVXA 7LPRA 3KQDA 1SGIB 4AFSA 1O5DH 3P8NA 4NZLA 3AAUA 3HATH 2FYRA 3MI4A 3DFJA 3GCOA 2WPJS 2GT8A 1EPTB 1C9TA 2ZQ2A 4K69A 1NY22 1FIZA 4Y6DA 1OP0A 3PTBA 1CVWH 3P70B 5DG6A 2XWAA 1QTFA 2ZDAH 2WYGA 4X2YA 4DIIH 1GDQA 1A5GH 1O0DH 4O9VA 1AE5A 1YBWA 1C5TA 1YPHE 3SBKA 4YESB 1KXAA 5GIBA 1UMAH 1A46H 5DO4H 1HJAC 1DM4B 1SGFG 2F9BH 3TK9A 1FY4A 3ELAH 3TH3H 2H1UA 3RC6A 2GP9B 5DP6A 1RIWB 1P0SH 3O8CA 2TPIZ 2THFB 4RKOB 3MU8A 4JCNA 3SU4A 3A82A 1EB1H 4GVUA 2CHAB 4OS1A 4YT6H 3RXPA 1ABJH 4O3TA 1V2JT 1T32A 1W10U 1O36A 3GCNA 3BTDE 4WWYA 1ELCA 4NCYA 1WU1A 1HV7A 2XCNA 4YLUA 2ZIQH 2ZG0H 1IQGA 7ESTE 2ASUB 3TGIE 1O3IA 4E7RG 1ZTKA 5SGAE 4MDSA 2ANMH 1AB9B 3QGJA 2ZO3H 1Q2WA 1UTPA 1XKBC 3P8GA 2ZTZA 1GJ9B 6GCHG 4MLFB 1LQDB 2HPQH 1C5RA 5C1UA 1Z1JA 2Q6GA 2ZC9H 3MOCA 2XBXA 1DT2A 2R2MB 4ZXXH 4FUDA 2VIWA 2ZCHP 3RXSA 1VCWA 3V13A 3K6ZA 4X1NU 3HPTB 4JMYA 3RXBA 3ENSB 1FONA 3K2UA 4X2XA 2UWLA 2YOLA 4K60A 4X6OA 2H6MA 2PUXB 2JH6D 5JPMH 1BBRK 1H9LB 4IN1A 2AGIX 2UWPA 1NFXA 1T8NA 1QL8A 2W3KA 1X7AC 1O5CB 4I8HA 3PLPA 1C5YB 2B5TB 4F4OC 1GMCG 2FOAA 1F5KU 2J92A 8LPRA 3F68H 1BRCE 1O3CA 4B71A 3A7WA 4JZ1A 1Y59T 3EA7A 3MWIU 1UTQA 5T6GA 2NWNA 2FYQA 3SV9A 1V2OT 1DSTA 1CA8B 1THRH 2O8UA 3T28A 1PPBH 1DSUA 1HRTH 1CHOF 1IQIA 8KME2 2SGDE 2H5DA 1J9CH 4Q7ZA 1DPOA 2OC1A 3MNXA 4KTUA 2GZ7A 1AQ7A 1S83A 1UO6A 4I8LA 1HIAA 2QF0A 1S85A 5CMXH 4ZMAH 1HYLA 4A7IB 1TX7A 4NIXA 2Z9GA 1P9SA 2WUCA 5E2PA 4D8NA 1PQ7A 1BMLA 1XUKA 6CHAC 3MH7A 5JBCS 2ZTYA 3C1KA 2SFAA 4YOGA 2A5KA 1A3EH 1W8BH 3SJ8A 1GI9B 1PPEE 3SV7A 1SQAA 1YCPH 1W7XH 1AY6H 3G01A 4K8YA 3KGPA 1GJ6A 2ZTXA 1GHZA 2BDBA 3SNBA 3UOUA 3H5CB 5C5NA 2A31A 1B0FA 4Y76A 4X1PU 3K6YA 1QRWA 3MTYA 2P93A 1KDQA 1HAZB 1GL1A 2FOMB 1CT0E 2JH0D 1TOMH 1YLCA 4D9RA 1ZHRA 4CR9A 3RC5A 2AMPA 2HGTH 5EPNA 1O3AA 2Z9LA 1BTYA 5A09A 2BQ6B 4X8TH 5HM9A 1ZHMA 1P04A 2A5IA 3R3GB 2ZNKH 3KHVA 1T8MA 3RUOA 2PUQH 2FOFA 4ESTE 2UUJB 3GYLB 4LOYH 1GGDC 3QUMP 1TMBH 1CA0C 1XVMA 3E90B 1Y3UA 3T29A 9ESTA 1SL3A 1GBIA 2HNTF 3MNCA 5E0GA 1FY3A 5TCAA 3LONA 4AG2A 1J8AA 1UTMA 1IQEA 2OQ5A 1K1PA 4Y8XA 3T2NA 1LHDH 3RDZA 1HJAB 2ZU5A 1O3PB 1V2WT 4FU9A 8ESTE 5CHAC 3BIUH 2A0QB 1XUHA 2EEKA 2PSYA 2ZF0H 4UEHH 3RXVA 1GBCA 3BTHE 4UFFH 3I29A 2CJIA 2HALA 4FVDA 1GPZA 3MH5A 3PM3A 5DK1A 4A1TA 3U1JB 1EATA 1O3OA 1JBUH 2PWXA 2FI5E 3DA9B 1IQNA 1MZAA 1BTWA 1RGQA 2BOKA 3TJVA 4ISHH 1PPCE 3W94A 1FQ3A 4O3UA 1BOQA 1V2PT 1RTLA 1FAKH 1KXCA 4Q7XA 1P05A 1PJPA 1HCGA 1LVMA 4BOHA 2ZZUH 2SGAA 3GCTG 1VJAU 3Q00A 1Z8RA 3NKKA 4ZKRU 1QL9A 1TYNA 2ZGXH 3GY3A 1SLWB 1Z8JB 1ARCA 4INHA 1D3TB 1DFPA 2A7CA 3SGBE 4AB9A 2STBE 1ELEE 1ESAA 4DY7B 1KXDA 1QQUA 1DS2E 1NPMA 2XBYA 2R3YA 1O39A 2ALVA 3L33A 2QXIA 1MAYA 3E91A 3PYHA 2C90B 4CH2B 4K5ZA 3NPSA 4OS5A 6ESTA 1B5GH 2W26A 3F6UH 3GY6A 1LCYA 1KXBA 1GCTC 1GI4A 2BZAA 1XUJA 1C5UA 1O2SA 1C1UH 2SGEE 5F03A 2BY7X 5EPYA 2O8TA 1O2KA 2GMTC 1Z1IA 1VGCB 1GHVH 2ZHEH 2ANYA 3A8DA 2PHBA 1GBAA 2OC7A 1NRRH 2ZPQA 3UIRA 3TIUA 2GCHG 1P57B 1SC8U 3A7ZA 3A7YA 5BRRE 1GHBG 1EOJA 2VB0A 1BMNH 4BXSA 5EQQA 4UE7H 1NRNH 1HFDA 3RXDA 3TJOA 3ZVGA 1GMHG 1BT7A 3BG8A 1SI5H 2C8XB 4ZKSU 1BTZA 4UFGH 4ZHLU 1F0RA 2XXLA 3S7HB 2F91A 2OLGA 1DVAH 2TGPZ 2GDEH 1F5RA 2BDGA 2VWMA 4ZKNU 2ZGBH 3E16B 4HGCA 1O2ZA 3KIDU 3ZVFA 1SHHB 2VNTA 1AMHA 1FIWA 3T25A 3L3TA 4IW4E 4K1SA 1HAYB 1QBOA 3DHKH 3FP8E 1HAVB 1S84A 3BTGE 3ZVDA 2FO9A 1P3EA 1QA0A 5FCRA 2F9VA 3LGYA 2QXHA 2ZU2A 3URDA 4ABHA 1SGPE 4XFQA 1TMTH 2H9TH 2QXJA 2AIPA 1BZXE 1O2OA 3CS7A 3IG6B 1Y3YA 3ITIA 1MZDA 3Q76A 3SNDA 2UUFB 1EZQA 5C67A 1CA0B 2KAIB 2Z9KA 3QK1A 2BYAX 1C5QA 7GCHG 1IAUA 4NIWA 1DY8A 4O97A 1DUAA 1PFXC 4CRFA 3HKIB 1P01A 1IQFA 4WJG2 5CHAB 3LJJA 4YTAA 2FOEA 4JZEH 1YP9A 2C8ZB 2SGFE 5GJ4B 4Y0YE 1O30A 2ZHDA 4UFDH 3ZZBA 2QN5T 1GI2A 3M5LA 1G32B 3GY4A 3UWJH 3P8FA 1YC0A 2LNCA 2G00A 1RIWC 2Z9IA 3SJ9A 4ISLA 1ELTA 5GPIB 1ZJKA 2SGPE 5EGMA 1BTPA 1F0TA 1O2WA 3PMJA 3M5NA 1GHAF 1MU6B 1AGJA 4HI3A 2ULLA 1WTGH 5EW1H 4ABBA 1HJ8A 1IQHA 2WPHS 4CR5A 2HNTE 1C2GA 1DY9A 5ABWA 4DG4A 1MCVA 4JK5A 2BTCE 1MTUA 2TGTA 3B9FH 2ZFFH 1K1OA 2PFEA 3MHWU 4XBCA 4NIVA 1D6WA 4CH8B 3L6PA 2WINI 1C5ZB 3TLOA 1BBRE 3K65B 3UQVA 2ZI2H 5C3NA 3QZQA 1JMOH 2QCYA 1TAWA 3MO3A 2VVUA 3RM2H 1C2LA 1FNIA 1V2UT 1W3CA 1GI3A 1AHTH 3Q77A 1W0ZU 4I8JA 3SV2H 4GHTA 1YKTA 3KQEA 1FN8A 1E36B 1C2JA 3PO1C 2FMJA 4XDEA 1YPJH 1EZXC 4XOJA 3PB1E 1TA2A 2ZU3A 2FX6A 3MO9A 3A7XA 1AFEH 3PROA 4BAMB 2FOBA 1QBNA 3O8RA 4X1QU 1GCTB 3UNRA 1AVGH 3U98H 1F92A 5FX5A 4K1EA 1K1LA 3SUFA 3U8RH 1AWHB 2UUKB 2F3CE 2G5NA 2J38A 3UUZA 3LPRA 3PTNA 3QTVH 3BF6H 3BEFB 4FU7A 3OY6U 3T62A 3UOPA 1L0ZA 2GX4A 3NUMA 4BTUB 4B1TA 3F9FA 1MTSA 2O8MA 1H1BA 2AFQB 1G2MA 3MU0A 4YZUA 1BA8B 4ABDA 3MU4A 1ELVA 3TGJE 2F9NA 4Y10E 4NZQA 2R9PA 1C1SA 1RS0A 5EODA 3TVJB 1BTXA 1KLIH 2Y82A 1M9UA 3HGNA 4X8VH 2V6NA 5C2ZA 1ANEA 4HZHA 1VITG 1Z6EA 2G55A 2ZDLA 2G51A 1SB1H 4YO9A 3STIA 1UK3A 2Z3EA 1SOTA 2BY6X 1BTHH 3PLBA 1GCDA 2P94A 1AKSA 1HAHH 1DLKB 1RRKA 2GV7A 1W11U 1HAIH 1N8OC 3SJOA 2V3OH 2DUCA 2FTLE 2O8LA 2Y5GA 3EQ0H 1C2KA 1P8VC 1G30B 5F8TA 1TGSZ 3H7OA 4IGDA 1EQ9A 1DX5M 4JYVH 3EE0B 1GVZA 2PKSB 3RXMA 1TNHA 2AGGX 1QGFA 3RMLH 5J4QA 3VB4A 3N7OA 1AE8H 4DW2U 8GCHG 3TU7H 1XUFA 2FWWA 1AI8H 5HM2A 1Q31A 1T4UH 4D7FA 1EP5A 1P3CA 3M5MA 1SPJA 3RC4A 4OS6A 1Y8TA 4X8SH 4LK4A 2J4IA 1JIRA 2OXSA 1TLDA 5GDSH 1O2XA 1DDJA 5GCHF 4NFEA 1YPHC 3SU1A 5A0BA 1TX8A 1K22H 1O2PA 1G3EA 3BEUA 4B74A 1ANDA 1AO5A 5EXMA 1MKXH 2P3TB 1UVSH 4VGCC 1UCYH 1SSXA 4A6LA 2G52A 2BXUH 3RXFA 5A2MH 1J15A 1Z7KA 3TITA 1QL7A 1FUJA 1JRSA 2H9HA 2BB4A 4ZAEA 1UTLM 1TGNA 1BTUA 2WUBA 1A61H 2FI3E 1OP8A 1EASA 4XBBA 2BM2A 2Z6BD 1K1MA 1H8IH 1UVTH 1VITH 2BQ7B 1LHGH 1DWBH 2TGAA 5DP5A 1W12U 2VU8E 4Q7YA 1BIOA 1K28D 2VIDA 1BHXF 4ZH8A 1EAUA 4KTSA 1N6YA 4ZKOU 1NS3A 3A7VA 3Q3YA 4U32A 2H5CA 4DT7B 5A8YA 2IOTA 2OC8A 2PSXA 4XSKU 1MTNB 3FAOA 5J4SA 4A5TS 2QIQA 2D8WA 4GCHG 4MPUA 3CS0A 1ELAA 4IC6A 3MNBA 1RTFB 1TRNA 3RMNH 3DT0H 1THPB 2P16A 1J17T 2GKVE 1K21H 4ISIH 4OGYA 1FY8E 1N6XA 4CHAC 1TE0A 2I6QA 1ZMNA 3PO1B 3NXPA 1TALA 1SGNE 3AASA 2XC5A 1ORFA 1XMNB 2W5EA 2PTCE 3ODFA 4TYDA 1LHFH 4TPYA 1BRUP 1YM0A 2WPLS 1C2DA 1J14A 1KLTA 1UHBB 2GDDA 3O8DA 1LVYA 2BXTH 1GWAA 3SQEE 2OINA 1INCA 3GICB 4M7GA 2BD2A 2ZCKP 4NA7A 3LGVA 2ZDKA 3ZZ6A 1TABE 3STJA 1Y3WA 3SZNA 5FBEA 2A4QA 2A7HA 3M3SA 1FJSA 1ZJDA 4TWWA 3LT3A 3VGCC 1DITH 2ZGJA 1E34B 1SBWA 5I25A 5AFYH 4E7NA 1VGCC 1JRTA 4JYUH 1HDTH 2V35A 1GI1A 1UVUH 1OWIA 3R0FA 3URCA 1LKAA 1V2LT 2HWLB 1C1PA 1XVOA 4GSOA 2AYWA 1XUIA 3QTOH 3RMOH 2EI8A 5JBBS 1CGHA 4I32A 1CE5A 2BDIA 1OWDA 5JB9S 1F7ZA 2FI4E 3OTJE 4YT7H 2FIRH 1EZUC 3PLKA 1DUEA 1GHWH 1N8OB 4HFPB 1P03A 1WYKA 1QB1A 2Q1JA 1RD3B 1W14U 3GCHC 1ZMLA 3W95A 1O2RA 1OXGA 1FPHH 2CGAA 4B75A 3KEEA 4GPGA 4GAWA 3ZZ3A 4FUIA 4D9QA 2CMYA 1HPGA 2AMQA 4FUCA 1O3HA 3NZIA 1O5GH 1C2HA 1FXYA 2ZFQH 2QV1A 1ABIH 5DP7A 3SQHE 4ABIA 3SV8A 3TH4H 1D3PB 4I8GA 1XUGA 4I8KA 4Y0ZE 5F6MA 1LTOA 1O37A 4F49A 1PQ8A 3F9EA 2ZPRA 3D49H 1ZPBA 1L2EA 2WV4A 3A8AA 1NESE 2ODQA 4TY6A 5EG4A 2XBWA 1A7SA 4THNH 1GMDG 1DXWA 1P2QA 3EA8A 2OC0A 1ARBA 4VGCB 2G4TA 1TPOA 1EXFA 2PR3A 1PPGE 1A4WH 3TK6A 3A89A 1KXFA 4CBNA 3V12A 3RXEA 1EPTA 4E06H 4BXWA 3OU0A 1GI0A 4KTCA 4GUXA 4NFFA 1SFQB 3ZVEA 2FX4A 4INLA 1GBKA 3GY5A 3VB5A 1QBVH 2IN2A 3SOSA 2BLVA 4U30A 1JWTA 3A87A 2BY5X 3HK3B 1D6RA 1SGRE 1YYY1 1V6DA 3KQBA 3UQOA 2D2DA 3FZDA 4BAHB 5EQSA 2AGEX 1Y3VA 5DP3A 1FY5A 1C1WH 3PMAB 1AIXH 3LGIA 1ZHPA 3M7QA 3OYPA 1HLTH 2K1QA 2CF8H 3A83A 4WMDA 1EX3A 1EP6A 2IPHA 3A84A 1B0EA 5EQRA 1V2RT 1PPZA 4PROA 3C27B 2PW8H 1O35A 3BG4C 4CRCA 3ZZ7A 2IJOB 4B2AA 2PLXA 4CBOA 1NN6A 4ABAA 1ELGA 4FUBA 1RJXB
chains in the Genus database with same CATH superfamily
1OS8A 4D7GA 1QQ4A 1ELFA 1O3KA 5DP4A 1WCZA 3DSOA 1GDUA 1OYTH 2CV3A 3Q3KA 2XCFA 3S9BA 4CHAB 2P8OC 1C2EA 3SUEA 1QJ7B 3IITA 2YMSD 2VIQA 1TNKA 4O03A 3K9XB 4UD9H 4Y7AA 2P95A 1MUEB 5TCCA 5L2YH 1ETRH 1MTWA 1CU1A 1GI6A 2VVCA 1O3BA 1AZZA 3GISB 1Y5AT 1DWDH 1YY3A 1P9UA 3VB3A 3RU4E 4AGKA 1V2ST 1D4PB 1S0QA 3KQ5A 2ZHFH 1TNGA 1HUTH 4BAKB 3A80A 3BV9B 2BD3A 1QB9A 1TBZH 4YLQH 1GJDB 3PMHB 3RU4T 2UWOA 3MYWA 3TJUA 1YF4A 2ZECA 1Y3XA 2BDCA 4MNWA 1MD8A 1IQJA 1V2KT 1G3DA 1ZSJA 1NROH 4ABJA 1FLEE 3BN9A 3RXRA 1O3DA 4NSVA 1YPKH 3VGCB 3FANA 3EE7A 4NSYA 1ELDE 4WXIA 4MNYA 1C4Y2 4E05H 1OPHB 1YCPK 3FFGA 3GOVB 2V3HH 3SN8A 4NG9H 1KTSB 2A5AA 3LC3A 2XYAA 1GI7B 2NU4E 1AD8H 1C5WB 2ALPA 1EAIA 1ZLRA 2AEIH 3MNSA 4UFEH 4ABGA 5LPEA 3ZZCA 4JZFH 2Z3DA 1LKBA 2FEQH 1RFNA 1VCQA 2ZDVH 4NIYA 1C5OH 2ZFTA 3JZ1B 3ATKA 1O34A 5HMAA 5A8XA 1EAWA 3GCHB 4OGXA 5T6FA 1C5LH 1SFIA 1CHOG 4IN2A 2AIQA 1GJ5H 2Y7XA 1A0HB 1AN1E 2RCEA 4DCDA 2A4RA 3RXTA 1KSNA 3VEQB 1UTJA 3P8OA 2B8OH 3RXOA 1HAGE 3TNSA 5C5OA 1D3QB 2AS9A 2FXRA 2QA9E 5E0HA 3ATMA 5CDFE 2KZ4A 1MQ5A 5FPYA 1MKWH 3TJNA 1O32A 4R8TB 1YLDA 2EA3A 3UY9A 2PKSC 4IS5A 1XX9A 1SGTA 1DOJA 1F5LA 2C93B 1FZZA 1AWFH 1Z8GA 4A92A 2ESTE 3VB6A 6LPRA 4DURA 1EB2A 2OBQA 1W0YH 3U8TH 1QNJA 2J34A 3EA9A 1CQQA 1UTNA 3AW1A 1SR5C 5HIZA 1H9IE 2IJD1 2R2WU 1C5MD 5F8XA 2VWOA 2YNBA 4H42U 1HBTH 4SGBE 4INKA 2GVFA 1C1TA 3E0NB 4DVAU 1E35B 1QRZA 1QZ8A 2HLCA 1HAPH 3SUGA 3BTKE 3Q3XA 1FPCH 2LPRA 4FOUC 1NT1A 3BTTE 1TFXA 1CO7E 1FMGA 3JZ2B 1G2LA 3SNCA 1F0SA 1SG8B 1GVKB 2OP9A 3TNTA 5L30H 1EKBB 3MFJA 1SGQE 3RXKA 1XXDA 3DUXH 1CSOE 1W2KH 2ZFSA 5GXPA 2DE8A 2WV5A 3OY5U 1BMMH 2Z3CA 1O2QA 4Y8ZA 3PV4A 4RKJB 1H4WA 2OD3B 3TK5A 2A45B 1XM1A 4WVPE 2F9PA 5T1VA 2FS8A 1C5SA 4WH8A 2HRVA 1T4VH 1G3CA 4ISOA 5AF9H 3KL6A 3LC5A 2BDHA 1AVWA 1TBRH 2C3SA 3PWBA 2B9LA 2L74A 2FP7B 2ZDMA 1TMUH 1P12E 4FUFA 3S9AA 2BMGB 3BG4B 4MPVA 5KGOA 6GCHF 2VH6A 1F2SE 1UK4A 2GV6A 2FOCA 1MH0A 4ABEA 1GDNA 1OWJA 3ZZAA 2GTBA 2VGCB 1LQEA 1DXPA 2A4OA 3MU1A 3CNRA 1O2MA 2QY0B 1MTNC 1OYQA 3A88A 5JYIA 3P95A 2P8OB 2TGDA 1VJ9U 1O3EA 3M3TA 2OQUA 4QT8C 5DPAA 1A1RA 2FDAA 3ESTA 1UJ1A 3S9CA 3RMMH 1L1NA 1P2IA 1L4DA 2Y5FA 2ANKH 2BD8A 2FLBH 1GBJA 3BTQE 4Y11E 3RP2A 1ZSKA 1YPEH 5LPRA 4AFZA 3CP7A 1GMCF 5L2ZH 3QZRA 2J9NA 2PTNA 5KECA 1O2GH 4ZHMU 1MD7A 1A5HA 1BB0B 4X2VA 4I33A 2WPIS 1TX6A 5HYOA 3SORA 4J2YB 1AZ8A 5C1XA 1NRSH 4OS2A 1H9HE 4X6MA 1OKXA 2A2XH 5AFZH 4GLYA 1OSSA 2QGRA 5DP8A 1NBME 2BD5A 2BQWB 2QYIA 2OBOA 1TPSA 3F2FA 1MMJN 1MABB 2ZDNA 4WH6A 1GBDA 1U6QA 1E38B 1MTVA 3CENA 3AVZA 1UTKA 3LDXH 4AB8A 4AFQA 4F48B 4KP0A 4FU8A 2J2UA 1MQ6A 1CGIE 1QURH 3HKJB 2NU3E 1HIAB 2OK5A 1GBTA 1MKWK 1UK2A 4M9FA 4X6NA 4ZHAA 1TRMA 1V2QT 4JZIA 1P10A 2H9EH 4Y8YA 2JKHA 2GZ8A 3PV2A 1S0RA 1C1VH 1P2JA 5E8EH 1C1MA 1PQ5A 1UVPA 4Y71A 1O5AB 3QDZB 1BRAA 1Y5BT 3E3TA 4KELA 2FZZA 3NK8A 3KN2A 2TIOA 1C1QA 3SO3A 4A1VA 2Z9JA 4ZUHA 1SLXB 4FVBA 1P2MA 1NTPA 5TJXA 1GI5A 3M3VA 3F1SB 5ESTE 1AFQC 1O2LA 3QLPH 1ZPCA 3GDSA 1KDQB 1KXEA 4AG1A 5JDUB 1YPMH 1ETTH 1K2I1 9LPRA 3U1IB 1GJAB 5LH8A 1BMAA 3NCLA 3LGWA 4H6TA 2BD9A 3UWIA 2PV9B 1VKYA 3ZZ5A 3UAIC 3DFLA 1SGDE 2R3UA 2D1JA 3GY8A 4Z6AH 2XW9A 7KMEH 1GMDF 1NC6A 2QC2A 3FP7E 3LIWA 5PTPA 3AAVA 4Y7BA 1GBBA 4DGJA 1ZR0A 3M35A 1EAXA 3M7TA 2A7JA 1AVXA 1LPKB 2Y81A 1QJ1B 3M36A 1ZTLA 3M37A 1IQMA 1B7XB 1OX1A 2KAIA 1UVOA 2JETC 4K2YA 4AGJA 1YCPM 2VVVA 3A81A 1G37A 2BHGA 2QE7D 3BTFE 3A85A 4F55A 3EDXB 3RXIA 2A1DB 4AOQA 4FUGA 2D26C 4WMFA 1O2HA 4DOQA 1SLUB 1G36A 5KEDA 4Q2KA 4IMQA 1G9IE 1TRYA 3HK6B 2FLRH 1P2OA 1CBWB 3H7TA 4CRAA 1VCPA 5F53A 2P59A 2W3IA 5F8ZA 2EI7A 2TBSA 1DE7H 2FODA 3LJOA 3LU9B 1P2KA 3S69A 3NWUA 1GJBB 2QXGA 5A8ZA 3GCTF 2CN0H 4KGAA 1OWKA 1QRXA 1O2UA 3TPIZ 1K1IA 2WPMS 4YOJA 1ESTA 4NA9H 3RXHA 5ETXA 2OUAA 3ZZDA 1V3XA 2BD4A 3QO6A 5FCKA 5LPFA 2STAE 3QWCH 1WBGB 2PKAA 5E2OA 1ELBA 4MG3A 5JBAS 2FTMA 2O9QA 3KNXA 4BNRA 2R0KA 4AORA 4X8UH 3S0NA 1QB6A 2PGBB 1GHAG 3KCGH 1PYTD 3UPEA 1NFYA 1KY9A 3ZZ8A 1HJ9A 3OE7D 1D9IA 3E1XB 2JDID 4U2WA 3DD2H 1NFWA 1C2IA 5FXLA 3TH2H 4K3JA 3ZYDA 4OS7A 2QF3A 1O33A 2W7UA 3F0PA 2AH4X 2FPZA 5E0JA 1O3NA 2RA0A 1Z71A 5AVDA 1A3BH 1TPAE 1QJ6B 4MPWA 3SI4H 1O5EH 3GYMA 1T8LA 3LH3A 3ODDA 4AZ2B 1ID5H 3WWFA 2ZFRH 1BCUH 1ANBA 4YOIA 3RXLA 5T3HA 1ETSH 3RLWH 2ZU4A 4Z0KA 4SGAE 1O2JA 5CE1A 4LZ4B 2GCHF 1HAOH 2C4FH 3D65E 1GHBF 1O3MA 1HNEE 5EJZA 1EZSC 1A0LA 1TIOA 2VWLA 2B7DH 1LPZB 1TPPA 1GHXH 5FPTA 3T5FH 1GMHF 2ZPSA 1S6FA 2IPQX 5EOKA 2XTTB 2EC9H 1FAXA 1YWUA 2BY9X 1BRBE 1C9PA 1WOFA 4LZ1H 1KLJH 3P17H 5A0CA 1IHSH 2RA3A 4B2CA 3SGQE 2QF4A 1L1JA 1O2TA 1GBFA 1TNJA 1GHYH 1LPGB 1J16A 1TB6H 1P09A 3DSPA 4TT3D 5EXNA 1YGCH 4H6SB 1MAXA 2ZHWH 3M5OA 2XRCA 1VR1H 2P3UB 2GJGA 3A8CA 1O2YA 4AYYB 4YXWD 1LVOA 3SUDA 3I77A 4BAOB 1QIXB 1GG6B 1TGTA 3F0OA 1SQTA 2AMDA 1AFQB 3UTUH 1C2MA 2XBVA 3SV6A 1C5NH 5T6DA 2BLWA 4UONA 3ZV8A 4OM9A 1HAXB 1MKXK 2RDLA 3FZZA 5LGOA 1UCYK 3SNEA 2YMSC 2SNWA 5B6OA 3SHCH 1LDTT 3E6PH 1ACBE 2V0BA 3BIVH 7GCHF 3U9AH 2Z94A 2J97A 4ZROA 2ODPA 1E0FD 2ZEBA 1QFKH 1Y5UT 3ZZ9A 3T27A 4JYTA 3D62A 2XNIA 1TWXB 1N1LA 2GGVB 2JETB 5JBTA 2O8WA 3ZZ4A 4RI0A 1T8OA 3MO6A 3KQCA 4NWLA 3HGPA 3MH6A 1AUTC 4H4FA 3E8LA 2BD7A 2K0QA 2L6OA 3UNSA 1TNLA 1FY1A 5GCHG 3EYDA 1RXPA 3QX5H 1O2VA 1ZGIA 4CRDA 2Q6DA 4X2WA 3ZVAA 4MNVA 2AERH 1IQLA 2NU0E 1CT4E 4RSPA 1BDAA 4MQAA 2R0LA 2GCTC 1PPHE 1DICA 1GL0E 1SGCA 4B2BA 2C8YB 1Z6JH 1QCPA 2BVSH 2OCVB 2ZCLP 2ZGHA 3SJKA 5EW2H 3SU0A 3MH4A 2RG3A 1W13U 3BTEE 4DIHH 2ZP0H 3W1EA 3B23B 3FP6E 1DWCH 2VGCC 1MBQA 1TQ7B 4NA8A 2FM2A 2WSSD 1TGBA 1A5IA 2ZGCA 2F9UA 3TGKE 3F3BA 1WSSH 2WPKS 1EJNA 4XBDA 2G5VA 2XC4A 1CHGA 3PMBB 3FOAA 1ESBA 3O8BA 3RXGA 1G3BA 3N7DA 1O3GA 2XOKD 3PWCA 3B8JA 1FX0B 1TNIA 3KF2A 3ATLA 1EJAA 3BEIB 2PGQB 3FO8D 1P02A 1SMFE 1LO6A 3D23A 4JZDH 4X0WU 1WAYB 4I31A 2OTVA 2BX3A 3P6ZB 3SGAE 2Q6FA 2VIVA 2HOBA 1HXEH 2M5TA 3EAJA 2GD4B 1O38A 4WY3A 3V0XA 2VJ1A 3BSQA 3ZV9A 5C94A 1E37B 2Y5HA 4R0IA 2RDEA 4RN6A 3V3MA 1LHEH 1UHBA 3A86A 2G8TA 1KTTB 1YLNA 4CREA 1AUJA 1QR3E 2VWNA 4X1SU 3F9HA 3SJIA 1GBHA 1S81A 2ZA5A 1ZMJA 1OWHA 5C20A 1WTHD 4AN7A 2SNVA 3OSYA 3P92A 3SHAH 1T31A 4X6PA 2ZQ1A 1VITF 3ZVBA 5EXLA 2EI6A 1WXRA 4B76A 1TOCB 1NU7B 1V2TT 3RLYH 1V2MT 1K0HA 1W7GH 4CRGA 1PQAA 3RXJA 1V2VT 4MTBA 4DJZB 5C17A 1F0UA 2HLDD 1GVLA 4IC5A 1THSH 4AFUA 1YPGH 1SOZA 2ILNA 4TWYA 2HPPH 1GJ7B 3LH1A 4WMEA 1NO9H 1OP2A 1ZOMA 4FUHA 3RU4D 2I6SA 1Q3XA 1AKSB 6CHAB 1OWEA 2WYJA 5FHTA 1HGTH 1KYNA 2F9OA 3SU5A 1H8DH 1O3JA 1NU9A 3LGUA 2UUYA 3ZIAD 1FI8A 3V7TA 5IYTA 1EJMA 1FN6A 2ZU1A 4JK6A 4MVNA 5BPEA 8GCHF 2ODYB 1WQSA 3BTME 2BY8X 2ZKSA 1O3FA 2ZFPH 3KYGA 5EJLA 4K8BA 2YMSB 2Z7FE 2A2QH 4K1TA 3SU3A 1GI8B 4I7YH 4ASHA 1O3LA 4IBLH 5FBIA 1S6HA 3F9GA 1GJ4H 1OOKB 3RXQA 1SGEE 5FX6A 2GT7A 3N99A 2H2ZA 2QAAA 4MPXA 4Z1MD 1T7CA 4ABFA 5FAHA 3PRDA 4ZXYH 1DLEA 5G4BA 3WY8A 2F4LA 3ZYEA 4BTIB 2C8WB 1SGYE 3UFAA 5L6NH 1C5PA 3ATIA 1GGDB 1TONA 4WF8A 2XWBI 1ZRKA 2BOHB 4KKDA 2BLOA 3RXCA 3QGNB 2F83A 1WV7H 5AHGH 1RTKA 1LMWB 1TQ0B 3A8BA 3GDVA 4ZCNA 1C4V2 2FESH 1O31A 3UREA 1EPTC 3VFEA 1IHTH 2Y6TA 2TRMA 4FXGH 1SGFA 2HNTC 2FS9A 1ANCA 4AYVB 1K9OE 1SLVB 1MBMA 3MMGA 3LGTA 1CBWC 4LXBH 3U8OH 4WXVA 3BTWE 2GCTB 3OFND 3ATWA 3SU2A 3GY2A 1GBEA 1BJUA 4GHQA 1ZPZA 2FOGA 3RXAA 1FV9A 1CGJE 3IWMA 4GCHF 4Q63A 1NFUA 3OX7U 4FUEA 2BVXH 3LOXA 1ZZZA 1O2IA 3SNAA 1NRPH 1V2NT 1JXPA 1CT2E 2NU2E 2CHAC 1BQYA 4U01A 2BX4A 2J94A 1A2CH 3M61U 1QY6A 3VXFH 3I78A 2ANWA 4X1RU 3LKWA 4Y79A 5A0AE 1GJCB 1P06A 2PKAB 1SVPA 4D76A 4A1XA 3S7KB 5IDKA 1BHXB 1JOUB 4BTTB 1L4ZA 1K1JA 2P3FH 3RM0H 1LHCH 4J1YA 2CF9H 1AB9C 4TPIZ 2XC0A 1TGCA 2FOHA 2VINA 2G4UA 3DSGA 3MU5A 3ZVCA 1VZQH 5C1YA 2W7SA 5DP9A 3GY7A 1JIMA 1O5BB 1NM6A 2JH5D 1IQKA 3FVFB 1BJVA 3SU6A 5GWZA 3QN7A 2NU1E 1GJ8B 3GDUA 1WUNH 1TBQH 1C1RA 5K7RA 4XRNA 1KIGH 1GBMA 2BDYA 3VPKA 1SHYA 2KCOA 3RXUA 1K1NA 2CXVA 2BVRH 2VH0A 4YM9A 5K0HA 4OS4A 1ZRBA 4DT4A 1IOEA 5DKMA 1HXFH 1FDPA 5DSFA 4XE4A 4RT1A 1NZQH 2VBCA 5HGGA 1D3DB 5I46H 3M7UA 1QA7A 1XXFA 5DJ7A 1HB0B 3VXEH 1EOLA 4MNXA 1C1NA 4FUJA 1BUIA 4IMZA 2ZWLH 2GMTB 3A7TA 2KM0A 5JB8S 3UNQA 4BAQB 4CRBA 5DGJA 2G81E 2ZHQH 2Y80A 1BBRH 1WQVH 1L1GA 1DWEH 1YPLH 2SGQE 1TA6A 1P11E 1P2NA 1XKAC 1UCYE 1S82A 3SW2B 5ESBA 4TY7A 2BZ6H 1C2FA 1PPFE 3E0PB 2GZ9A 1C5VA 3EGKH 1QHRB 1Z8IB 3GS9A 2JJ1D 1S5SA 4BANB 1O2NA 1GG6C 5FPSA 2YNAA 3U69H 1UTOA 4ISNA 1A0JA 4NWKA 3AW0A 1ZYOA 2BLQA 2J95A 2DE9A 1C5XB 1ZTJA 1HAVA 4UDWH 1PYTC 3OTPA 3UR6A 1GBLA 2Y7ZA 5EU8A 1DANH 1SQOA 1NRQH 1C1OA 1NBMD 3T26A 1MU8B 2A32A 1W0JD 4AX9H 2A4GA 4NGAH 5H4IB 1C4U2 2KCPA 3UR9A 4Q80A 4B73A 1EUFA 5HXFA 1ZGVA 1MCTA 1AU8A 1BITA 2BDAA 2VIOA 2B0FA 2VIPA 1ZSLA 4HTCH 5HKKD 3VB7A 3SI3H 1LVBA 1O5FH 2HVXA 7LPRA 3KQDA 1SGIB 4AFSA 1O5DH 3P8NA 4NZLA 3AAUA 3HATH 2FYRA 3MI4A 3DFJA 3GCOA 2WPJS 2GT8A 4AC9A 1EPTB 1C9TA 2WZQA 1E1QD 2ZQ2A 4K69A 1NY22 1FIZA 4Y6DA 1OP0A 3PTBA 1CVWH 3P70B 5DG6A 2XWAA 1QTFA 2ZDAH 2WYGA 4X2YA 4DIIH 5C0TA 1GDQA 1A5GH 1O0DH 4O9VA 1AE5A 1YBWA 1C5TA 1YPHE 3SBKA 4YESB 1KXAA 5GIBA 1UMAH 1A46H 5DO4H 1HJAC 1DM4B 1SGFG 2F9BH 3TK9A 1FY4A 4ACBA 3ELAH 3TH3H 2H1UA 3RC6A 2GP9B 5DP6A 1RIWB 1P0SH 3O8CA 2TPIZ 2THFB 4RKOB 3MU8A 4JCNA 3SU4A 3A82A 1EB1H 4GVUA 2CHAB 4OS1A 4YT6H 3RXPA 1ABJH 4O3TA 1V2JT 3NRLA 1T32A 1W10U 1O36A 3GCNA 3BTDE 4WWYA 1ELCA 4NCYA 1WU1A 1HV7A 2XCNA 4YLUA 2ZIQH 2ZG0H 1IQGA 7ESTE 2ASUB 3TGIE 1O3IA 3U28C 4E7RG 1ZTKA 5SGAE 4MDSA 2ANMH 1AB9B 3QGJA 2ZO3H 1Q2WA 1UTPA 1XKBC 2KR7A 3P8GA 2ZTZA 1GJ9B 6GCHG 4MLFB 1LQDB 2HPQH 1C5RA 5C1UA 1Z1JA 2Q6GA 2ZC9H 2W6ID 3MOCA 2XBXA 1DT2A 2R2MB 4ZXXH 4FUDA 2VIWA 2ZCHP 1E79D 3RXSA 1VCWA 3V13A 3K6ZA 4X1NU 3HPTB 4JMYA 3RXBA 3ENSB 1FONA 3K2UA 4X2XA 2UWLA 2YOLA 4K60A 4X6OA 2H6MA 2PUXB 2JH6D 5JPMH 1BBRK 1H9LB 4IN1A 2AGIX 2UWPA 1NFXA 1T8NA 1QL8A 2W3KA 1X7AC 1O5CB 4I8HA 3PLPA 1C5YB 2B5TB 4F4OC 1GMCG 2FOAA 1F5KU 2J92A 8LPRA 3F68H 5B6LA 1BRCE 1O3CA 4B71A 3A7WA 4JZ1A 1Y59T 3EA7A 3MWIU 1UTQA 5T6GA 2NWNA 2FYQA 3SV9A 1V2OT 1DSTA 1CA8B 1THRH 2O8UA 3T28A 1PPBH 1DSUA 1HRTH 1CHOF 1IQIA 8KME2 2SGDE 2H5DA 1J9CH 4Q7ZA 1DPOA 2OC1A 3MNXA 4KTUA 2GZ7A 1AQ7A 1S83A 1UO6A 4I8LA 1HIAA 5DN6D 2QF0A 1S85A 5CMXH 4ZMAH 1HYLA 4A7IB 1TX7A 4NIXA 2Z9GA 1P9SA 2WUCA 5E2PA 4D8NA 1PQ7A 1BMLA 1XUKA 6CHAC 3MH7A 2RFKC 5JBCS 2ZTYA 3C1KA 2SFAA 4YOGA 2A5KA 1A3EH 1W8BH 3SJ8A 1GI9B 1PPEE 3SV7A 1SQAA 1YCPH 1W7XH 1AY6H 3G01A 2JJ2D 4K8YA 3KGPA 1GJ6A 2ZTXA 1GHZA 2BDBA 3SNBA 3UOUA 3H5CB 5C5NA 2A31A 1B0FA 4Y76A 4X1PU 3K6YA 1QRWA 3MTYA 2P93A 1KDQA 1HAZB 1GL1A 2FOMB 1CT0E 2JH0D 1TOMH 1YLCA 4D9RA 1ZHRA 4CR9A 4P00A 3RC5A 2AMPA 2HGTH 2W6JD 1O3AA 5EPNA 2Z9LA 1BTYA 5A09A 2BQ6B 4X8TH 5HM9A 1ZHMA 1P04A 2A5IA 3R3GB 2ZNKH 1SKYE 1T8MA 3KHVA 3RUOA 2PUQH 2FOFA 4ESTE 2UUJB 3GYLB 4LOYH 1S6LA 1GGDC 4TSFD 3QUMP 1TMBH 1CA0C 1XVMA 3FN8A 3E90B 1Y3UA 3T29A 9ESTA 1SL3A 4XD7D 1GBIA 2HNTF 3MNCA 5E0GA 2F43B 1FY3A 5TCAA 3LONA 4AG2A 1J8AA 1UTMA 1IQEA 2OQ5A 1K1PA 4Y8XA 4RT0A 3T2NA 1LHDH 3RDZA 1HJAB 2ZU5A 1O3PB 1V2WT 4FU9A 2XNDD 8ESTE 5CHAC 3BIUH 2A0QB 1XUHA 2EEKA 2PSYA 2ZF0H 4UEHH 3RXVA 1GBCA 3BTHE 4UFFH 3I29A 2CJIA 2HALA 4FVDA 1GPZA 3MH5A 3PM3A 5DK1A 4A1TA 3U1JB 1EATA 1O3OA 1JBUH 2PWXA 2FI5E 3DA9B 1IQNA 1MZAA 1BTWA 1RGQA 2BOKA 3TJVA 4ISHH 1PPCE 3W94A 1FQ3A 3N7EA 4O3UA 1BOQA 1V2PT 1RTLA 1FAKH 1KXCA 4Q7XA 1P05A 1PJPA 1HCGA 1LVMA 4BOHA 2ZZUH 2SGAA 2CK3D 2J5UA 3GCTG 1VJAU 3Q00A 1Z8RA 3NKKA 4ZKRU 1QL9A 1TYNA 2ZGXH 1OHHD 3GY3A 1SLWB 1Z8JB 1ARCA 4INHA 1D3TB 1DFPA 3WW7A 2A7CA 3SGBE 2J98A 4AB9A 2STBE 1ELEE 1ESAA 4DY7B 1KXDA 1QQUA 1DS2E 1NPMA 2XBYA 3KYFA 2R3YA 1O39A 2ALVA 3L33A 2QXIA 1MAYA 3E91A 3PYHA 2C90B 4CH2B 4K5ZA 3NPSA 3WWBA 4OS5A 6ESTA 1B5GH 2W26A 3F6UH 3GY6A 1LCYA 2AHME 1KXBA 1GCTC 1GI4A 2BZAA 1XUJA 1C5UA 1O2SA 3AK5A 1C1UH 2SGEE 5F03A 2BY7X 5EPYA 2O8TA 1O2KA 2GMTC 1Z1IA 1VGCB 1GHVH 1SQRA 2ZHEH 2ANYA 3A8DA 2PHBA 1GBAA 2OC7A 1NRRH 2ZPQA 3UIRA 3TIUA 2GCHG 1P57B 1SC8U 3A7ZA 3A7YA 5BRRE 1GHBG 1EOJA 2VB0A 1BMNH 4BXSA 4FETA 5EQQA 4UE7H 1NRNH 1HFDA 3RXDA 3TJOA 3ZVGA 1GMHG 1BT7A 3BG8A 1SI5H 2C8XB 4ZKSU 1BTZA 4UFGH 4ZHLU 1F0RA 2XXLA 3S7HB 2F91A 2OLGA 1DVAH 2TGPZ 2GDEH 1F5RA 2BDGA 5C0UA 2VWMA 4ZKNU 2ZGBH 3E16B 4HGCA 1O2ZA 3KIDU 3ZVFA 1SHHB 2VNTA 1AMHA 1FIWA 2EQNA 3T25A 3L3TA 4IW4E 4K1SA 1HAYB 1QBOA 3DHKH 3FP8E 1HAVB 1S84A 3BTGE 5EJ1A 3ZVDA 2V3MA 2FO9A 1P3EA 1QA0A 2EY4C 5FCRA 2F9VA 3LGYA 2QXHA 2ZU2A 3URDA 4ABHA 1SGPE 4XFQA 1TMTH 2H9TH 2QXJA 2AIPA 1BZXE 1O2OA 3CS7A 3IG6B 3OAAD 2LP6A 1Y3YA 3ITIA 1MZDA 3Q76A 3SNDA 2UUFB 1EZQA 1H8ED 5C67A 1CA0B 2KAIB 2Z9KA 3QK1A 1BMFD 2BYAX 1C5QA 7GCHG 1IAUA 4NIWA 1DY8A 4O97A 1DUAA 1PFXC 4CRFA 3HKIB 1P01A 1IQFA 4WJG2 5CHAB 3LJJA 4YTAA 2FOEA 4JZEH 1YP9A 2C8ZB 2SGFE 5GJ4B 4Y0YE 1O30A 2ZHDA 4UFDH 3ZZBA 2QN5T 1GI2A 3M5LA 1G32B 3GY4A 3UWJH 3P8FA 1YC0A 2LNCA 2G00A 1RIWC 2Z9IA 3SJ9A 4ISLA 1ELTA 5GPIB 1ZJKA 2SGPE 5EGMA 1BTPA 1F0TA 1O2WA 3PMJA 3M5NA 1GHAF 1MU6B 1AGJA 4HI3A 2ULLA 1WTGH 5EW1H 4ABBA 1HJ8A 1IQHA 2WPHS 4CR5A 2HNTE 1C2GA 1DY9A 5ABWA 4DG4A 1MCVA 4JK5A 2BTCE 1MTUA 2TGTA 3B9FH 2JIZD 1K1OA 2ZFFH 2PFEA 3MHWU 4XBCA 4NIVA 1D6WA 4CH8B 3L6PA 2WINI 1C5ZB 3TLOA 1BBRE 3K65B 3UQVA 1KMHB 2WHXA 2ZI2H 5C3NA 3QZQA 1JMOH 2QCYA 1TAWA 3MO3A 2VVUA 3RM2H 1C2LA 1FNIA 1V2UT 1W3CA 1GI3A 1AHTH 3Q77A 1W0ZU 4I8JA 3SV2H 4GHTA 1YKTA 3KQEA 1FN8A 3F2GA 1E36B 1C2JA 3PO1C 2FMJA 4XDEA 1YPJH 1EZXC 4XOJA 3PB1E 1TA2A 2ZU3A 2FX6A 3MO9A 3A7XA 1AFEH 3PROA 4BAMB 3SYJA 2FOBA 1QBNA 3O8RA 4X1QU 1GCTB 3UNRA 1AVGH 3U98H 1F92A 5FX5A 4K1EA 1K1LA 3SUFA 3U8RH 1AWHB 2UUKB 2F3CE 3SZEA 2G5NA 2J38A 3UUZA 3LPRA 3PTNA 3QTVH 3BF6H 3BEFB 4FU7A 3OY6U 3T62A 3UOPA 1L0ZA 2LELA 2GX4A 3NUMA 4BTUB 4B1TA 3F9FA 1MTSA 2O8MA 1H1BA 2AFQB 1G2MA 3MU0A 4YZUA 1BA8B 4ABDA 3MU4A 1ELVA 3TGJE 2F9NA 4Y10E 4NZQA 2R9PA 1C1SA 1RS0A 5EODA 3TVJB 1BTXA 1KLIH 2Y82A 4HG6A 1M9UA 3HGNA 4X8VH 2V6NA 5C2ZA 1ANEA 4HZHA 1VITG 4ACAA 1Z6EA 2G55A 2ZDLA 2G51A 1SB1H 4YO9A 3STIA 1UK3A 2Z3EA 1SOTA 2BY6X 1BTHH 1UW7A 3PLBA 1GCDA 2P94A 1AKSA 1HAHH 1DLKB 1RRKA 2GV7A 1W11U 1HAIH 1N8OC 3SJOA 4P02A 2V3OH 4B6EA 2DUCA 2FTLE 2O8LA 2Y5GA 3EQ0H 1C2KA 1P8VC 1G30B 5F8TA 1TGSZ 3H7OA 4IGDA 1EQ9A 1DX5M 4JYVH 3EE0B 1GVZA 2PKSB 3RXMA 1TNHA 2AGGX 1QGFA 3RMLH 1EFRD 5J4QA 3VB4A 3N7OA 1AE8H 4DW2U 8GCHG 3TU7H 1XUFA 2FWWA 1AI8H 5HM2A 1Q31A 1T4UH 4D7FA 1EP5A 1P3CA 3M5MA 1SPJA 3RC4A 4OS6A 1Y8TA 3PV5A 4X8SH 4LK4A 2J4IA 1JIRA 2OXSA 1TLDA 5GDSH 1O2XA 1DDJA 5GCHF 4NFEA 1YPHC 3SU1A 5A0BA 1TX8A 1W0KD 1K22H 1O2PA 1G3EA 3BEUA 4B74A 1ANDA 1AO5A 5EXMA 1MKXH 2P3TB 1UVSH 4VGCC 1UCYH 1SSXA 4A6LA 2G52A 2BXUH 3RXFA 5A2MH 1J15A 1Z7KA 3TITA 1QL7A 1FUJA 1JRSA 3DCLA 2H9HA 2BB4A 4ZAEA 1UTLM 1TGNA 3FKSD 1BTUA 2WUBA 1A61H 2FI3E 2WPDD 1OP8A 1EASA 4XBBA 2BM2A 2Z6BD 1K1MA 1H8IH 1UVTH 1VITH 2BQ7B 1LHGH 2KX4A 1DWBH 2TGAA 5DP5A 1W12U 2WV9A 2VU8E 4Q7YA 1BIOA 1K28D 2VIDA 1BHXF 4ZH8A 2KCYA 1EAUA 4KTSA 1N6YA 5FL7D 1NS3A 3A7VA 4ZKOU 3Q3YA 4U32A 2H5CA 4DT7B 5A8YA 2IOTA 2OC8A 2PSXA 4XSKU 1MTNB 3FAOA 5J4SA 4A5TS 2QIQA 1COWD 2D8WA 3PRBA 3CS0A 4GCHG 4MPUA 1ELAA 4IC6A 3MNBA 1RTFB 4B6FA 1TRNA 3RMNH 3DT0H 1THPB 2P16A 5CHBA 3OEED 1J17T 2GKVE 1K21H 4ISIH 4OGYA 1FY8E 1N6XA 4CHAC 1TE0A 3VG8A 2I6QA 1ZMNA 3PO1B 3NXPA 1TALA 1SGNE 3AASA 2XC5A 1ORFA 1XMNB 2W5EA 2PTCE 2J98B 3ODFA 2HVYB 4TYDA 1LHFH 4TPYA 1BRUP 1YM0A 2WPLS 1C2DA 1J14A 1KLTA 1UHBB 2GDDA 3O8DA 1LVYA 2BXTH 1GWAA 3SQEE 2OINA 1INCA 3GICB 4M7GA 2BD2A 2QF5A 2ZCKP 4NA7A 3LGVA 2ZDKA 3ZZ6A 1TABE 4Q4LA 3STJA 1Y3WA 3SZNA 5FBEA 2A4QA 2A7HA 3M3SA 1FJSA 2PP6A 1ZJDA 4TWWA 3LT3A 3VGCC 1DITH 2ZGJA 1E34B 1SBWA 5I25A 5AFYH 4E7NA 1VGCC 1JRTA 4JYUH 1H8HD 1HDTH 2V35A 1GI1A 1UVUH 1OWIA 3R0FA 3URCA 1LKAA 1V2LT 2HWLB 1C1PA 1XVOA 4GSOA 2AYWA 1XUIA 3QTOH 3RMOH 2EI8A 5JBBS 1CGHA 4I32A 1CE5A 2BDIA 1OWDA 5JB9S 1F7ZA 2FI4E 3OTJE 4YT7H 2FIRH 1EZUC 3PLKA 1DUEA 1GHWH 1E1RD 1N8OB 4HFPB 1P03A 1WYKA 1QB1A 2Q1JA 1RD3B 1W14U 3GCHC 1ZMLA 3W95A 1O2RA 1OXGA 1FPHH 2CGAA 4B75A 1WDIA 3KEEA 4GPGA 4GAWA 3ZZ3A 4FUIA 4D9QA 2CMYA 1HPGA 3UB0A 2AMQA 3OEHD 4FUCA 4ASUD 2K8IA 1O3HA 3NZIA 1O5GH 1C2HA 5IK2D 1FXYA 2ZFQH 2QV1A 1ABIH 5DP7A 3SQHE 4ABIA 3SV8A 3TH4H 1D3PB 4I8GA 1XUGA 4I8KA 4Y0ZE 5F6MA 1LTOA 1O37A 4F49A 1PQ8A 3F9EA 2ZPRA 3D49H 1ZPBA 1L2EA 2WV4A 3A8AA 1NESE 2ODQA 4TY6A 5EG4A 2XBWA 1A7SA 4THNH 5EIYA 4I86A 1GMDG 1DXWA 1P2QA 3EA8A 2V7QD 3MQKC 2OC0A 1ARBA 4VGCB 2G4TA 1TPOA 1EXFA 2PR3A 1PPGE 1A4WH 3TK6A 3A89A 1KXFA 4CBNA 3V12A 3RXEA 1EPTA 5GNDA 4E06H 4BXWA 3OU0A 1GI0A 4KTCA 4GUXA 4NFFA 1SFQB 3ZVEA 2FX4A 4INLA 1GBKA 3GY5A 3VB5A 1QBVH 2IN2A 3SOSA 2BLVA 4U30A 1JWTA 3A87A 2BY5X 3HK3B 1D6RA 1SGRE 1YYY1 1V6DA 3KQBA 2KFWA 3UQOA 2D2DA 3FZDA 5HIYA 4BAHB 5EQSA 2AGEX 1Y3VA 2M2AA 5DP3A 1FY5A 1C1WH 2KCAA 3PMAB 1AIXH 3LGIA 1ZHPA 3M7QA 3OYPA 3F2HA 1HLTH 2K1QA 2CF8H 3A83A 4WMDA 1EX3A 1EP6A 2IPHA 3A84A 1B0EA 3H09A 5EQRA 1V2RT 1PPZA 4PROA 3C27B 2PW8H 1O35A 3BG4C 4CRCA 3ZZ7A 2IJOB 4B2AA 2PLXA 4CBOA 1NN6A 4ABAA 1ELGA 4FUBA 1RJXB
chains in the Genus database with same CATH topology
1OS8A 4D7GA 1QQ4A 1ELFA 1O3KA 5DP4A 1WCZA 1GDUA 1OYTH 2CV3A 3Q3KA 2XCFA 3S9BA 4CHAB 2P8OC 1C2EA 3SUEA 1QJ7B 3IITA 2VIQA 1TNKA 4O03A 3K9XB 4UD9H 4Y7AA 2P95A 1MUEB 5TCCA 5L2YH 1ETRH 1MTWA 1CU1A 1GI6A 2VVCA 1O3BA 1AZZA 3GISB 1Y5AT 1DWDH 1P9UA 3VB3A 3RU4E 4AGKA 1V2ST 1D4PB 1S0QA 2ZHFH 1TNGA 1HUTH 4BAKB 3A80A 3BV9B 2BD3A 1QB9A 1TBZH 4YLQH 1GJDB 3PMHB 3RU4T 2UWOA 3MYWA 3TJUA 1YF4A 2ZECA 1Y3XA 2BDCA 4MNWA 1MD8A 1IQJA 1V2KT 1G3DA 1ZSJA 1NROH 4ABJA 1FLEE 3BN9A 3RXRA 1O3DA 4NSVA 1YPKH 3VGCB 3FANA 4NSYA 1ELDE 4WXIA 4MNYA 1C4Y2 4E05H 1OPHB 1YCPK 3FFGA 3GOVB 2V3HH 3SN8A 4NG9H 1KTSB 2A5AA 3LC3A 2XYAA 1GI7B 2NU4E 1AD8H 1C5WB 2ALPA 1EAIA 1ZLRA 2AEIH 3MNSA 4UFEH 4ABGA 5LPEA 3ZZCA 4JZFH 2Z3DA 1LKBA 2FEQH 1RFNA 1VCQA 2ZDVH 4NIYA 1C5OH 2ZFTA 3JZ1B 3ATKA 1O34A 5HMAA 5A8XA 1EAWA 3GCHB 4OGXA 5T6FA 1C5LH 1SFIA 1CHOG 4IN2A 2AIQA 1GJ5H 2Y7XA 1A0HB 1AN1E 2RCEA 4DCDA 2A4RA 3RXTA 1KSNA 3VEQB 1UTJA 3P8OA 2B8OH 3RXOA 1HAGE 3TNSA 5C5OA 1D3QB 2AS9A 2FXRA 2QA9E 5E0HA 3ATMA 1MQ5A 5FPYA 1MKWH 3TJNA 1O32A 4R8TB 1YLDA 2EA3A 3UY9A 2PKSC 4IS5A 1XX9A 1SGTA 1DOJA 1F5LA 2C93B 1FZZA 1AWFH 1Z8GA 4A92A 2ESTE 3VB6A 6LPRA 4DURA 1EB2A 2OBQA 1W0YH 3U8TH 1QNJA 2J34A 3EA9A 1CQQA 1UTNA 3AW1A 1SR5C 1H9IE 2R2WU 1C5MD 5F8XA 2VWOA 2YNBA 4H42U 1HBTH 4SGBE 4INKA 2GVFA 1C1TA 3E0NB 4DVAU 1E35B 1QRZA 1HAPH 2HLCA 3SUGA 3BTKE 3Q3XA 1FPCH 2LPRA 1NT1A 3BTTE 1TFXA 1CO7E 1FMGA 3JZ2B 1G2LA 3SNCA 1F0SA 1SG8B 1GVKB 2OP9A 3TNTA 5L30H 1EKBB 3MFJA 1SGQE 3RXKA 1XXDA 3DUXH 1CSOE 1W2KH 2ZFSA 5GXPA 2DE8A 2WV5A 3OY5U 1BMMH 2Z3CA 1O2QA 4Y8ZA 3PV4A 4RKJB 1H4WA 2OD3B 3TK5A 2A45B 1XM1A 4WVPE 2F9PA 2FS8A 1C5SA 4WH8A 2HRVA 1T4VH 1G3CA 4ISOA 5AF9H 3KL6A 3LC5A 2BDHA 1AVWA 1TBRH 2C3SA 3PWBA 2B9LA 2FP7B 2ZDMA 1TMUH 1P12E 4FUFA 3S9AA 2BMGB 3BG4B 4MPVA 6GCHF 2VH6A 1F2SE 1UK4A 2GV6A 2FOCA 1MH0A 4ABEA 1GDNA 1OWJA 3ZZAA 2GTBA 2VGCB 1LQEA 1DXPA 2A4OA 3MU1A 1O2MA 2QY0B 1MTNC 1OYQA 3A88A 5JYIA 3P95A 2P8OB 2TGDA 1VJ9U 1O3EA 3M3TA 2OQUA 4QT8C 5DPAA 1A1RA 2FDAA 3ESTA 1UJ1A 3S9CA 3RMMH 1L1NA 1P2IA 1L4DA 2Y5FA 2ANKH 2BD8A 2FLBH 1GBJA 3BTQE 4Y11E 3RP2A 1ZSKA 1YPEH 5LPRA 4AFZA 3CP7A 1GMCF 5L2ZH 3QZRA 2J9NA 2PTNA 1O2GH 4ZHMU 1MD7A 1A5HA 1BB0B 4X2VA 4I33A 2WPIS 1TX6A 5HYOA 3SORA 4J2YB 1AZ8A 5C1XA 1NRSH 4OS2A 1H9HE 4X6MA 1OKXA 2A2XH 5AFZH 4GLYA 1OSSA 2QGRA 5DP8A 2BD5A 2BQWB 2QYIA 2OBOA 1TPSA 1MMJN 2ZDNA 4WH6A 1GBDA 1U6QA 1E38B 1MTVA 3CENA 3AVZA 1UTKA 3LDXH 4AB8A 4AFQA 4KP0A 4FU8A 2J2UA 1MQ6A 1CGIE 1QURH 3HKJB 2NU3E 1HIAB 1GBTA 1MKWK 1UK2A 4X6NA 4ZHAA 1TRMA 1V2QT 4JZIA 1P10A 2H9EH 4Y8YA 2JKHA 2GZ8A 1S0RA 1C1VH 1P2JA 5E8EH 1C1MA 1PQ5A 1UVPA 4Y71A 1O5AB 3QDZB 1BRAA 1Y5BT 3E3TA 4KELA 2FZZA 3NK8A 3KN2A 2TIOA 1C1QA 3SO3A 4A1VA 2Z9JA 4ZUHA 1SLXB 4FVBA 1P2MA 1NTPA 5TJXA 1GI5A 3M3VA 3F1SB 5ESTE 1AFQC 1O2LA 3QLPH 1ZPCA 3GDSA 1KDQB 1KXEA 4AG1A 5JDUB 1YPMH 1ETTH 1K2I1 9LPRA 3U1IB 1GJAB 5LH8A 1BMAA 3NCLA 3LGWA 4H6TA 2BD9A 3UWIA 2PV9B 3ZZ5A 3DFLA 1SGDE 2R3UA 2D1JA 3GY8A 4Z6AH 2XW9A 7KMEH 1GMDF 1NC6A 2QC2A 3FP7E 3LIWA 5PTPA 3AAVA 4Y7BA 1GBBA 4DGJA 1ZR0A 3M35A 1EAXA 3M7TA 2A7JA 1AVXA 1LPKB 2Y81A 1QJ1B 3M36A 1ZTLA 3M37A 1IQMA 1B7XB 1OX1A 2KAIA 1UVOA 2JETC 4K2YA 4AGJA 1YCPM 2VVVA 3A81A 1G37A 2BHGA 3BTFE 3A85A 3EDXB 3RXIA 2A1DB 4AOQA 4FUGA 2D26C 4WMFA 1O2HA 4DOQA 1SLUB 1G36A 4Q2KA 4IMQA 1G9IE 1TRYA 3HK6B 2FLRH 1P2OA 1CBWB 3H7TA 4CRAA 1VCPA 2P59A 2W3IA 5F8ZA 2EI7A 2TBSA 1DE7H 2FODA 3LJOA 3LU9B 1P2KA 3S69A 3NWUA 1GJBB 2QXGA 5A8ZA 3GCTF 2CN0H 4KGAA 1OWKA 1QRXA 1O2UA 3TPIZ 1K1IA 2WPMS 4YOJA 1ESTA 4NA9H 3RXHA 5ETXA 2OUAA 3ZZDA 1V3XA 2BD4A 3QO6A 5FCKA 5LPFA 2STAE 3QWCH 1WBGB 2PKAA 5E2OA 1ELBA 4MG3A 5JBAS 2FTMA 2O9QA 3KNXA 4BNRA 2R0KA 4AORA 4X8UH 3S0NA 1QB6A 2PGBB 1GHAG 3KCGH 1PYTD 3UPEA 1NFYA 1KY9A 3ZZ8A 1HJ9A 1D9IA 3E1XB 4U2WA 3DD2H 1NFWA 1C2IA 5FXLA 3TH2H 4K3JA 3ZYDA 4OS7A 2QF3A 1O33A 2W7UA 2AH4X 2FPZA 5E0JA 1O3NA 2RA0A 1Z71A 5AVDA 1A3BH 1TPAE 1QJ6B 4MPWA 3SI4H 1O5EH 3GYMA 1T8LA 3LH3A 3ODDA 4AZ2B 1ID5H 2ZFRH 1BCUH 1ANBA 4YOIA 3RXLA 5T3HA 1ETSH 3RLWH 2ZU4A 4Z0KA 4SGAE 1O2JA 5CE1A 4LZ4B 2GCHF 1HAOH 2C4FH 3D65E 1GHBF 1O3MA 1HNEE 1EZSC 1A0LA 1TIOA 2VWLA 2B7DH 1LPZB 1TPPA 1GHXH 5FPTA 3T5FH 1GMHF 2ZPSA 1S6FA 5EOKA 2XTTB 2EC9H 1FAXA 2BY9X 1BRBE 1C9PA 1WOFA 4LZ1H 1KLJH 3P17H 5A0CA 1IHSH 2RA3A 4B2CA 3SGQE 1L1JA 1O2TA 1GBFA 1TNJA 1GHYH 1LPGB 1J16A 1TB6H 1P09A 5EXNA 1YGCH 4H6SB 1MAXA 2ZHWH 3M5OA 2XRCA 1VR1H 2P3UB 3A8CA 1O2YA 4AYYB 1LVOA 3SUDA 3I77A 4BAOB 1QIXB 1GG6B 1TGTA 1SQTA 2AMDA 1AFQB 3UTUH 1C2MA 2XBVA 3SV6A 1C5NH 5T6DA 2BLWA 4UONA 3ZV8A 1HAXB 1MKXK 2RDLA 3FZZA 5LGOA 1UCYK 3SNEA 2SNWA 5B6OA 3SHCH 1LDTT 3E6PH 1ACBE 2V0BA 3BIVH 7GCHF 3U9AH 2Z94A 4ZROA 2ODPA 1E0FD 2ZEBA 1QFKH 1Y5UT 3ZZ9A 3T27A 4JYTA 3D62A 2XNIA 1TWXB 1N1LA 2GGVB 2JETB 5JBTA 2O8WA 3ZZ4A 1T8OA 3MO6A 3KQCA 4NWLA 3HGPA 3MH6A 1AUTC 4H4FA 3E8LA 2BD7A 3UNSA 1TNLA 1FY1A 5GCHG 3EYDA 1RXPA 3QX5H 1O2VA 1ZGIA 4CRDA 2Q6DA 4X2WA 3ZVAA 4MNVA 2AERH 1IQLA 2NU0E 1CT4E 4RSPA 1BDAA 4MQAA 2R0LA 2GCTC 1PPHE 1DICA 1GL0E 1SGCA 4B2BA 2C8YB 1Z6JH 1QCPA 2BVSH 2OCVB 2ZCLP 2ZGHA 3SJKA 5EW2H 3SU0A 3MH4A 2RG3A 1W13U 3BTEE 4DIHH 2ZP0H 3B23B 3FP6E 1DWCH 2VGCC 1MBQA 1TQ7B 4NA8A 2FM2A 1TGBA 1A5IA 2ZGCA 2F9UA 3TGKE 1WSSH 2WPKS 1EJNA 4XBDA 2G5VA 2XC4A 1CHGA 3PMBB 1ESBA 3O8BA 3RXGA 1G3BA 1O3GA 3PWCA 3B8JA 1TNIA 3KF2A 3ATLA 1EJAA 3BEIB 2PGQB 1P02A 1SMFE 1LO6A 3D23A 4JZDH 4X0WU 1WAYB 4I31A 2OTVA 2BX3A 3P6ZB 3SGAE 2Q6FA 2VIVA 2HOBA 1HXEH 2M5TA 3EAJA 2GD4B 1O38A 4WY3A 3V0XA 2VJ1A 3BSQA 3ZV9A 1E37B 2Y5HA 4R0IA 4RN6A 3V3MA 1LHEH 1UHBA 3A86A 2G8TA 1KTTB 4CREA 1AUJA 1QR3E 2VWNA 4X1SU 3F9HA 3SJIA 1GBHA 1S81A 2ZA5A 1ZMJA 1OWHA 5C20A 1WTHD 4AN7A 2SNVA 3OSYA 3P92A 3SHAH 1T31A 4X6PA 2ZQ1A 1VITF 3ZVBA 5EXLA 2EI6A 4B76A 1TOCB 1NU7B 1V2TT 3RLYH 1V2MT 1W7GH 4CRGA 1PQAA 3RXJA 1V2VT 4MTBA 4DJZB 1F0UA 1GVLA 4IC5A 1THSH 4AFUA 1YPGH 1SOZA 2ILNA 4TWYA 2HPPH 1GJ7B 3LH1A 4WMEA 1NO9H 1OP2A 1ZOMA 4FUHA 3RU4D 2I6SA 1Q3XA 1AKSB 6CHAB 1OWEA 2WYJA 5FHTA 1HGTH 1KYNA 2F9OA 3SU5A 1H8DH 1O3JA 1NU9A 3LGUA 2UUYA 1FI8A 3V7TA 5IYTA 1EJMA 1FN6A 2ZU1A 4JK6A 4MVNA 5BPEA 8GCHF 2ODYB 1WQSA 3BTME 2BY8X 2ZKSA 1O3FA 2ZFPH 4K8BA 2Z7FE 2A2QH 4K1TA 3SU3A 1GI8B 4I7YH 4ASHA 1O3LA 4IBLH 5FBIA 1S6HA 3F9GA 1GJ4H 1OOKB 3RXQA 1SGEE 5FX6A 2GT7A 2H2ZA 2QAAA 4MPXA 1T7CA 4ABFA 5FAHA 4ZXYH 1DLEA 5G4BA 3WY8A 5L6NH 3ZYEA 4BTIB 2C8WB 1SGYE 3UFAA 1C5PA 3ATIA 1GGDB 1TONA 4WF8A 2XWBI 1ZRKA 2BOHB 4KKDA 2BLOA 3RXCA 3QGNB 2F83A 1WV7H 5AHGH 1RTKA 1LMWB 1TQ0B 3A8BA 3GDVA 1C4V2 2FESH 1O31A 3UREA 1EPTC 3VFEA 1IHTH 2Y6TA 2TRMA 4FXGH 1SGFA 2HNTC 2FS9A 1ANCA 4AYVB 1K9OE 1SLVB 1MBMA 3MMGA 3LGTA 1CBWC 4LXBH 3U8OH 4WXVA 3BTWE 2GCTB 3ATWA 3SU2A 3GY2A 1GBEA 1BJUA 4GHQA 1ZPZA 2FOGA 3RXAA 1FV9A 1CGJE 3IWMA 4GCHF 1NFUA 3OX7U 4FUEA 2BVXH 3LOXA 1ZZZA 1O2IA 3SNAA 1NRPH 1V2NT 1JXPA 1CT2E 2NU2E 2CHAC 1BQYA 4U01A 2BX4A 2J94A 1A2CH 3M61U 1QY6A 3VXFH 3I78A 2ANWA 4X1RU 3LKWA 4Y79A 5A0AE 1GJCB 1P06A 2PKAB 1SVPA 4D76A 4A1XA 3S7KB 5IDKA 1BHXB 1JOUB 4BTTB 1L4ZA 1K1JA 2P3FH 3RM0H 1LHCH 4J1YA 2CF9H 1AB9C 4TPIZ 2XC0A 1TGCA 2FOHA 2VINA 2G4UA 3MU5A 3ZVCA 1VZQH 5C1YA 2W7SA 5DP9A 3GY7A 1JIMA 1O5BB 1NM6A 2JH5D 1IQKA 3FVFB 1BJVA 3SU6A 5GWZA 3QN7A 2NU1E 1GJ8B 3GDUA 1WUNH 1TBQH 1C1RA 5K7RA 1KIGH 1GBMA 2BDYA 3VPKA 1SHYA 3RXUA 1K1NA 2CXVA 2BVRH 2VH0A 4YM9A 5K0HA 4OS4A 1ZRBA 1IOEA 5DKMA 1HXFH 1FDPA 4XE4A 1NZQH 5HGGA 1D3DB 5I46H 3M7UA 1QA7A 1XXFA 5DJ7A 1HB0B 3VXEH 1EOLA 4MNXA 1C1NA 4FUJA 1BUIA 4IMZA 2ZWLH 2GMTB 3A7TA 5JB8S 3UNQA 4BAQB 4CRBA 5DGJA 2G81E 2ZHQH 2Y80A 1BBRH 1WQVH 1L1GA 1DWEH 1YPLH 2SGQE 1TA6A 1P11E 1P2NA 1XKAC 1UCYE 1S82A 3SW2B 5ESBA 4TY7A 2BZ6H 1C2FA 1PPFE 3E0PB 2GZ9A 1C5VA 3EGKH 1QHRB 1Z8IB 1S5SA 4BANB 1O2NA 1GG6C 5FPSA 2YNAA 3U69H 1UTOA 4ISNA 1A0JA 4NWKA 3AW0A 1ZYOA 2BLQA 2J95A 2DE9A 1C5XB 1ZTJA 1HAVA 4UDWH 1PYTC 3UR6A 1GBLA 2Y7ZA 5EU8A 1DANH 1SQOA 1NRQH 1C1OA 3T26A 1MU8B 2A32A 4AX9H 2A4GA 4NGAH 5H4IB 1C4U2 3UR9A 4Q80A 4B73A 1EUFA 5HXFA 1ZGVA 1MCTA 1AU8A